2L5YA

Nmr structure of calcium-loaded stim2 ef-sam.
Total Genus 49
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
49
sequence length
150
structure length
150
Chain Sequence
GSHMASTEEDRFSLEALQTIHKQMDDDKDGGIEVEESDEFIREDMKYKDATNKHSHLHREDKHITIEDLWKRWKTSEVHNWTLEDTLQWLIEFVELPQYEKNFRDNNVKGTTLPRIAVHEPSFMISQLKISDRSHRQKLQLKALDVVLFG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Signaling protein
molecule keywords Stromal interaction molecule 2
publication title Auto-inhibitory role of the EF-SAM domain of STIM proteins in store-operated calcium entry.
pubmed doi rcsb
source organism Homo sapiens
total genus 49
structure length 150
sequence length 150
ec nomenclature
pdb deposition date 2010-11-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07647 SAM_2 SAM domain (Sterile alpha motif)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.50 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 Transcription Factor, Ets-1 2l5yA02
1.10.238.180 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 Recoverin; domain 1 2l5yA01
1X40A 3TADC 5J8YC 1V85A 1PK3A 3SENA 2DKXA 2QB0A 3TADA 5J8YA 2DKZA 2E8PA 1OXJA 3BS7A 4IS7A 2KG5A 4NL9C 1Z1VA 5KNIA 4NL9A 1DXSA 2EANA 2QARA 2F8KA 2QB0B 1KW4A 2LPEA 5JTIA 2KSOA 1F0MA 2K4PA 2E8MA 2QARB 1LKYA 2D8CA 1X9XA 2KSOB 2JV3A 2EAPA 1PK1A 5JRTA 1LKYB 2QKQA 2KIVA 2EAOA 1SXDA 3SEIA 1OW5A 1X66A 1RG6A 4PZOA 1SV4A 2DL0A 1PK1B 2Y9UA 2FE9A 5JU5A 2D3DA 2ESEA 1JI7A 1SV0C 1WWUA 2GLEA 3HILA 4NJ8A 5L1MA 1SV0A 1B0XA 4PZNA 2K60A 3BS5A 3K1RB 4RQMA 2B6GA 2KMDA 4MHVA 2EAMA 2Y9TA 1V38A 1SXEA 2ES6A 3BS5B 3KKAC 3TACB 2L5YA 2F44A 4RQNA 3KKAA 2QB1A 1COKA 2F3NA 3H8MA 3IDWA 1UCVA 1B4FA 2E8OA 1UQVA 2E8NA 1SGGA 5F3XB 2YTUA 2LMRA 1WWVA 2KE7A 3BQ7A
chains in the Genus database with same CATH superfamily
4NLKA 3TADC 5J8YC 4M6WB 3R72A 5H2FU 3OBVA 4EYIB 1JWDA 3WKCA 1UPHA 3DF0B 5IINA 1JF2A 1Z1VA 5DKWA 1DF0A 1F4OA 4NL9A 4Y2UA 5EE3A 4OJ6A 2KZ3A 1CFDA 5J0TA 2ZRSA 2KICA 3OP0A 2KJ9A 1DJIA 5F9NA 1XFUO 1ORGA 4MLWA 4ACOA 4RPYA 3I1YA 5KG7A 1NJZA 2FPLA 1DT7B 3TAPA 1F0MA 4P5OE 2YMLA 1IG5A 3H40A 3AM9A 4KLTA 3BUNB 3ISDA 5TISU 4AP9A 2A1JA 2VKQA 5ALJA 1PSRA 4GC6A 1RXWA 2DQNB 4KX5A 1LV5A 5CWRA 3OSNA 4J9NA 1RECA 3FE6A 5TNCA 3CNHA 1B7TZ 2JULA 5AKXA 4NDDA 1C7VA 2KKVA 2KI6D 4DCCA 4DL5A 5D4BA 4PGXA 1WRZA 3HKZC 1ZQGA 2NV3A 8ICRA 1SXDA 4MEXA 3FE8A 1SKRA 2HHXA 4K4HA 1YTZC 3O4XA 2MUTA 3TQ1A 5CHGA 4Q44A 1ZJNA 2DL0A 1KSMA 2AHOB 1NCZA 5K4LA 4GNKB 1M45A 4ED8A 2FE9A 5AK4A 4USLA 1IRJA 2BPFA 3C5FA 3SG5A 1MN8A 1FFUA 2BL0C 1L7NA 4CFRA 4J9RA 2NXQA 3L4LA 2YB4A 2XGPA 3TI0A 2ZJ8A 2K4EA 3OJSA 1NX3A 3EK8A 1PRWA 3CR5X 1JF0A 2PQLA 3CR4X 5L9XA 5KFVA 1CLBA 2KI6C 3RAQA 4PGQA 4JB3A 2AH5A 2XCPA 3KZIU 4CRXA 5J2BA 1M6YA 4DOBA 2ZIXB 2HETA 3KKAC 3JPPA 5KFOA 3M8SA 5HKYA 2SCPA 4NWIA 3FIAA 3AL0B 4DS5A 8ICVA 1SK6D 1KTQA 4QZBA 1NK8A 1ZQKA 2BBMA 5HR6A 1ZRMA 2RDIA 4DQQA 3IM1A 4FFDA 5AKIA 2Z7JA 2LMRA 5ALNA 4K4GA 9ICBA 2KE7A 3RB6A 3N7HA 3UXPA 3HPOA 4YGAA 5AK6A 2CPRA 4F72A 5IIIA 2M29A 2MRDA 5DDYA 4J9MA 2KV2A 4Q8EA 1TRFA 1IQ5A 1ZQ1C 4EZ6A 2CT9A 1KK8C 1OOFA 5KG5A 4P4MA 2LVJA 3UPQA 1WDCB 1S6CA 3TARA 7ICNA 3D78A 1DGUA 2W9BA 5D46A 4ELVA 4P4PA 5L1KA 1QQ7A 3IF7A 4F71A 1C7YA 2GGZA 1C3YA 5J2FA 1GM0A 2RQ5A 2E8MA 5AM3A 2ZNDA 1LA3A 4DSLA 4FO6A 1HEKA 2WF6A 2CN1A 4FQTA 2ZXIA 1DGVA 1XFRA 5E79U 1PZNA 2HQWA 4BY5A 1QLSA 2EAPA 1AHRA 5HP4A 2ODGA 1JUOA 4PCWA 1HT9A 1TK5A 1S1EA 3QEBZ 3NVWA 4MFFA 3EVRA 3OHAA 3SAHA 4C8LA 4Z6FA 3BQ1A 2P6RA 4RZRA 2AUCA 2KAVA 3SG2A 1TK0A 3L4PA 4XJKB 1ZQIA 3D2SA 5I2OA 1WCLA 1GGZA 2EQYA 4UPGA 2M8UA 3OJUA 4G9BA 2F2PA 3O78A 1CLLA 3H0RB 5DBBA 3WK7A 2J6TA 4U6PA 4PZNA 4M9HA 2ZG6A 2PMZC 1ZMZA 4CIDA 2LYBA 3TUYC 1T94A 2W9CA 1Z1BA 1XVJA 4DOCA 5KT3A 3S0FA 9ICPA 1COOA 3PLFB 4DS4A 1KL9A 1QXPA 3UMBA 4GIBA 2YB1A 2GV5A 1OQPA 5ALWA 3RJGA 3PSTA 1XYDA 1K90D 4TUPA 3Q8MA 4RQ4A 3C2LA 4NQGA 3BS5B 5KFPA 2LMUA 4YR2A 3A4UB 1UA0A 4R63A 2QB1A 2XC9A 2R8KA 5KFQA 1MSWD 3RRHA 1OOGA 4RQ3A 2KHQA 2G09A 1S76D 2I7AA 2K8AA 2ZIVA 2P35A 5EWFA 1B43A 1L7ZA 3RB0A 4TUSA 3PR5B 2YTUA 3F2DA 3T5JA 1SWVA 4JWNA 4IJ7A 3SIAA 9ICXA 3PV8A 2O60A 1WCNA 4UBBA 4IRKA 2DKZA 9ICTA 2M49B 2P70A 2W9CB 1RXVA 2PMYA 5KNIA 3BZKA 1DXSA 1ZQCA 2K2FA 5KAFU 1XSLA 2PFPA 4R66A 1NK5A 2LHLA 1MXLC 4EELA 5CSNA 2LPEA 5HLOA 3F53A 3H8WA 3TS5C 2F1IA 2ZXHA 4YD1A 1JFKA 2LYAA 1B47A 2Q0ZX 1NKEA 4FS1A 3SJSA 2FJYA 2JZIA 3WKAA 4I2FA 5GQQC 2W9AA 3T5LA 5DB7A 2JRZA 3F5EA 2BZFA 1CM1A 1SY9A 2F3YA 2MRLA 2AAOA 3T3FA 4JV2A 5AM5A 4PGYA 1ZD2P 4MEWA 5KFBA 3D75A 3MC1A 1XO0A 4M9GA 3S0BA 1PK1A 5DG7A 2AXTU 4GXIA 1IIPA 3DVJA 4C8OA 1ZQAA 2EAOA 3D2NA 4NM2A 8ICSA 4BUGA 3NHIA 1X66A 4PZOA 3TANA 8ICBA 3PO4A 3EG5B 3OX6A 5J29A 2O5GA 5HL1A 2ESEA 1JI7A 1SV0C 1BU3A 2CCMA 5KFWA 1QLNA 1HUOA 2OCEA 3NUQA 3QYPA 4O3NA 1GQMA 1FPWA 4P2HA 5CSIA 3NSLA 4BDPA 1FI6A 1ZQFA 3RR8A 4QWDA 2Y0SF 1NK6A 3ETRA 1X42A 2B6GA 4DF8A 3OSPA 2LC5A 3I76A 4DFPA 2KGBC 2Q4UA 2KMDA 2Q91A 2BL0B 1DELA 3MDCA 2EAMA 1U4BA 1Z2CB 1IWQA 1XWLA 2IMWP 1ZQWA 4PE4A 1S6IA 4C0LA 3F45A 3SS5A 1XFYO 3OB1B 4GBAA 1BPYA 3CZTX 1SL1A 1KQQA 4DLEA 4GXKA 4GXJA 2YY6A 1XFWO 2JWWA 3CWGA 1J7OA 2BPCA 1V1GA 4RQ1A 2RDJA 3OX5A 2HBKA 4YMMA 2H61A 4DFDA 3QU7A 2P66A 1HIWA 1DOQA 3N97B 2DF4B 4F8RA 4UB3A 1QSLA 4PH5A 4M04A 1KK7Y 1WLZA 2W7PA 2B21A 2QEOA 2H5XA 1BPXA 4DSKA 1HUZA 2M3WA 3C5GA 1X2IA 3GV5B 1PVQA 3BXKA 4WJ3B 4C7ZA 3EK4A 3L47A 4F4KA 2C2EA 7ICRA 4DS7A 1AK8A 4DLGA 1PULA 3PFVA 3UMGA 4I2EA 2RGIA 4DOAA 1KK8B 2ISDA 1T8EA 2LUXA 8ICQA 5FI7A 3M9OB 2KNEA 1PUZA 3PM2A 3MR6A 2W7OA 3QUBA 4EZ9A 2BAPA 2JMGA 1KKXA 4M2PA 1S5LU 7ICOA 4J03A 2C2RA 3PM8A 5CPVA 1UT8A 1DMOA 4ORAB 1OW5A 1VLBA 1NOMA 4MZJA 2F1JA 1RFJA 1LINA 1M31A 3ZDAA 3H7IA 3H8JA 4RQ7A 4OV2A 2HHUA 1K8UA 3NS1A 2WCMA 8ICYA 1UWOA 1N2DA 2YX8A 3S0DA 5KG4A 1SSEB 1ZQTA 4ECQA 3K1ZA 4NJ8A 3B6XA 4CPVA 3L4AA 1VDVA 4C0ZA 3K1EA 4QNLA 2F1HA 3LDAA 1CUKA 2GH1A 3KHGA 2NRZA 5G5GA 4F5NA 4MVFA 2EZZA 2ATLA 3ISBA 1WRKA 2A3VA 2KDHA 2EHBA 4KLIA 1ZQZA 1K5OA 2ZTEA 1C3ZA 1NKCA 1ZRNA 1IJ5A 3AKAA 3PVXA 3D0YB 4QZIA 4UAZA 3BOWA 2G2BA 4YI9A 1ZQRA 3SR6A 4NV0A 4F92B 4RQ6A 4DSFA 3O4YA 1SXEA 1OSAA 1JC2A 4FZMA 4J9OA 3FM9A 3TUYB 4QZFA 5HNKA 1Q8KA 2NRVA 2DOQA 3I28A 1NPQA 2F3NA 5KFTA 1CFCA 3UXNA 4F5RA 2VA8A 4F91B 1RYUA 3A8RA 4DO9A 4F4WA 3Q8LA 4YMOA 1SL2A 4JV1A 1KWOC 4YI8A 5AI9A 3QMEA 2A1AA 5BOMA 3M6ZA 3GV7B 1L7MA 4QWBA 3IRUA 1X6JA 5KFXA 1EG3A 1TAQA 2BCSA 4KLDA 1S0VA 1J55A 1P28A 2BNXA 4PHMA 1JSAA 5DLGA 5JUMA 1MQ1A 3WK9A 4DEZA 2ZTCA 2L2EA 1OZSA 4JMUA 4ECTA 4P0PB 4PE7A 2JGAA 1K9KA 7ICTA 9ICVA 2KLDA 1K9PA 2JXLA 5AEQA 2ZN8A 4EEKA 2ERBA 1CMGA 1ZOTB 3B7AA 4US8A 2QARB 2QEBA 2HOQA 2JTTA 3GK2A 3PW0A 1GJYA 4M9LA 4GGFC 1PVAA 4JUZA 4ZOHC 4JD9A 2IOFK 4NLNA 3VRPA 1QSYA 5J0RA 2LLUA 3TS5B 4FBUA 1BT6A 4TQSA 1WG8A 3EPGA 2FMPA 1ALVA 4OCIA 4PE0A 5JRTA 1EJ3A 5CSJA 1F55A 4KLJA 4BWMA 3MBYA 3EVUA 2KIVA 5AKHA 1B8CA 4DSEA 1B7TY 1W7IB 2N1RA 2HF5A 2KLEA 5AI5A 1RG6A 4F7FA 1SV4A 4NDCA 3ONNA 4HRHA 1UHJA 2FCDA 1FW4A 2C22A 3IG8A 1PVPA 5KFMA 3M8RA 3UNWA 3ZNIA 7ICKA 3TDUA 1SYMA 2W43A 3HJEA 1Q80A 5G08A 2FLNA 2JH1A 4KLHA 2LAPA 4NLBA 3TFSA 1X9WA 4EYHB 4LZDA 1RZTA 2DWQA 4ED6A 4KLLA 3BUMB 1YUSA 1NK7A 3H0MB 3LCPC 5GTHU 1YR5A 2OEHA 4NLZA 4CF5A 3L3FX 2FLPA 3PX6A 2TN4A 4OVNF 2L5YA 2HQ8A 1DJXA 4M6WA 2UVRA 1COKA 2PASA 4UW9A 1A29A 5KL8B 4DFMA 5AANA 1SGGA 3S6JA 3DF0A 3D73A 2K8BB 3BQ0A 2VA2A 2HI0A 5ALQA 2MLFC 4M9NA 2ZIWB 1A03A 4M2QA 5IBWA 2DKXA 4UAUA 9ICMA 3LK0A 4HRGA 4B6JA 1SCMB 3BS7A 3V7JA 2JEIA 1BOCA 2PKEA 4Z6DA 3PN7C 1N65A 5AI6A 1XO5A 1T7PA 2G06A 4ICAA 1OZOA 2KI4C 1AQ6A 2F8LA 3RTVA 3PW4A 2CRXA 1QVIZ 5J0PA 4DQIA 3KZXA 2CBLA 2K4IA 2F8KA 3B0XA 3F5AA 4BXOA 2KHNA 3WK8A 4PHEA 2Y5IA 2LVIA 5DQGA 3B87A 1IQ3A 4AQIA 4IR1A 5TZVA 2R8HA 2GTEA 5DBAA 8ICGA 1SL0A 4O5KA 4OJLA 3ZDDA 1JALA 4J9SA 2LV7A 2BCUA 3NXAA 4OO1J 5KFNA 4CDGA 3KFUF 2ISOA 2BE4A 5AIAA 4DL6A 1CNPA 2LNKA 4J9PA 1Y1XA 2VANA 2BQRA 2KYFA 2MAXA 1BVSA 1Z4HA 3PO5A 2NCOA 4N1FA 1JFJA 4KMOB 3PW2A 2JEJA 1HQVA 4DQPA 9ICUA 2WCBA 2RRDA 2QLTA 1B9AA 1B8RA 1S3PA 3LK9A 4UBCA 4KLFA 1NX2A 5KG0A 5J0QA 9ICFA 3C2MA 1LA0A 1TAUA 3GFKB 2COLB 5DGAA 3CS1A 3RJEA 4BXOB 4AYBC 3V72A 3PW5A 1FFVA 3HILA 1IV8A 5L1MA 1WLMA 2BQ3A 4RU9A 1D8YA 2E1FA 1H38A 2NO4A 3SQIA 3EKHA 1F71A 3K1RB 2ZIXA 3A0BU 3ZWHA 4UB4A 5AKKA 5F9LA 4RQ0A 1JXEA 2FI1A 3A0HU 5KFYA 2C2DA 3S0EA 2WCHA 3LVWA 4KLQA 2KBMA 4KITB 4IRCA 3M6KA 2JNFA 3PX0A 3QRXA 3WK5A 2YMMA 4YGDB 2AGPA 1N5XA 3AU6A 3HCMA 4ORBB 2MHHA 4B9LA 1D8BA 5J2HA 1NWDA 4P0QB 4R65A 8ICHA 4HYKA 1QWVA 2AU0A 3CDNA 2WF7A 1KQMC 4JWQA 3MR2A 3DEEA 5KFSA 5KFKA 3I5HC 4QZGA 5J2KA 4MSPA 2BQUA 1N48A 1RROA 4JPZB 1PK3A 7ICHA 3R1VA 5KG1A 4QZ8A 3RF9A 2WAQF 4JV0A 1L3VA 1CB1A 1ED1A 2HHQA 2KZMA 1KWOB 2JT3A 5KFUA 2JXJA 2Y1IA 2F2AB 2ZRTA 5HKWA 3K21A 2QB0B 4YP3A 2K7CA 1UP5A 1G8IA 1JXLA 8ICPA 5EOZA 4O5CA 4YBHB 4FBTA 2GWSA 3NGDA 4K4IA 4R1EA 4YFKA 4O3PA 3WXAA 3U26A 1KFXL 1EXRA 5J0YA 1CRXA 2BGWA 3KHRA 1S5GY 2LLTA 1F5SA 2EZYA 1A76A 2KJ8A 2I1QA 5DLFA 4ORCB 1Q46A 2KSOB 2L2CA 4UATA 4F93B 3CRXA 5KT6A 3D76A 3E58A 2DUYA 3PSFA 2Y0SC 2IHNA 1Y6WA 4XJKA 1L2OB 4WQ3A 1NJWA 2BDPA 1ZQLA 2ZTDA 2E5SA 2WORA 4B9SA 2A4JA 4IQTA 3THVA 5D69A 2MBXA 3FWBA 4ELTA 3RJIA 4F5PA 4I2HA 4B9UA 5ALDA 7ICEA 3IQOA 1BLQA 2PXIA 1DGSA 4D1EA 1A0PA 3OPXA 3SS4A 5FP0A 1DC1A 2W04A 4RPZA 4MF8A 3I5IC 2JT0A 1KSOA 2BDUA 3SG3A 3AEVA 3SYZA 4TURA 3BS5A 3BUWB 3AUOA 3IV6A 1S36A 3B9JA 3FYHA 3M7DA 2PFNA 3M0WA 3WKEA 1B8LA 3B0YA 4C8NA 5HMLA 3JPSA 4IRDA 2MA2A 4DIRA 2CNPA 2JPOA 3KTQA 4R8UB 4QJ5B 2Q4TA 4DL3A 3T79A 1D1OA 1ZQBA 4F3OA 2J6UA 2HHWA 1S77D 1YUUA 2CTNA 3FWCA 2LMVA 2L0PA 8ICTA 1P7DA 4HREE 2ASDA 2WF9A 3TACB 1QV0A 2F44A 2W03A 3VRNA 4ECVA 2Y1NA 4ZCVA 1UCVA 2JNXA 1TVAA 3MFIA 2WC8A 4J9KA 1XC9A 2QACA 2I18A 2M7LA 1XK4A 1AJ5A 4Y2PA 1QX5B 4PJ0U 2EH9A 4Y2JA 5AKLA 1AJ4A 3ED5A 3TADA 4FZNA 3M1YA 5AKZA 5J8YA 1OXJA 5KTQA 4DUQA 1CMFA 2KEYA 8ICMA 1PVBA 3ZDBA 2OHFA 1OUQA 4NLGA 4BJQA 1ZFSA 3WK6A 2R8JA 3WHTB 5EL2A 5AKYA 4RQ8A 2WB1C 3NTUA 5JTIA 5KT5A 1GO3F 3RR7A 1SB3C 5AI0A 1TK8A 1LS8A 1K2HA 4M2YA 2ZJAA 2WF5A 3VRRA 1RYSA 3CGAA 3J81j 3PN7B 5AXIA 5C5JA 1ZQUA 3RM1A 1WUDA 1Z3EB 2WTFA 1DJZA 2IS9A 2KI4B 1BPDA 5AERA 4N5XA 2D8CA 1X9XA 2WCFA 5ALVA 4O9MA 3VCBA 7ICJA 4O3MA 3OHMB 4GC7A 2SASA 3WHUB 5J2EA 1QX7A 1A4PA 3OGNA 1ZETA 4KLSA 5ALOA 3BUXB 1BPZA 4Y2YA 3GIMA 2F77X 3NVZA 1S5GZ 1LKYB 1TN4A 3DZTA 5ALMA 3MSEB 4PL2A 4CFQA 1KRPA 1KFDA 1ZQDA 3ZI4A 1SW8A 1SL7A 3CYMA 3HKZF 3QU5A 2L5XB 5L1IA 1U49A 1B1GA 4N1GA 4E0DA 2D3DA 4JWMA 4MFCA 4KLGA 2HHVA 1RJVA 4ECRA 1F44A 3KHEA 3EWAA 5IIKA 1LKJA 3DY9A 3D2QA 2GLEA 1KDHA 5HLVA 4MFAA 2ZUCA 9ICSA 3RJJA 1S6JA 1Y88A 1KLNA 1BR1B 3EW9A 4C8KA 2BCRA 4YGEB 3TZ1A 4PHAA 2MSNA 2M9GA 2KOTA 4EBCA 5KFCA 2WHEA 4XQ8A 4CGZA 1WY9A 4G3IA 2JHDA 1DJWA 2UVVA 3ZD8A 3RLZA 1C07A 1YZ7A 4OJ5A 1DTLA 1ZQOA 1K95A 1UA1A 1D9DA 4QZCA 5IIJA 8ICXA 4F2RA 4QWEA 3C29A 2K2AA 2JZBB 2HOFA 5C0YA 4P2YB 3KKAA 2W11A 2LHIA 2KNJA 4OJOA 1QSSA 4CE6A 2HDOA 2M97A 3EK7A 3MABA 1FF1A 1SKTA 1XA5A 1UQVA 2LYHA 1OMVA 1U5IB 2G07A 3GQCA 2KKPA 1VJ5A 5F3XB 8ICOA 1MR8A 3RB3A 5EWGA 5I94A 3C1YA 5ER4X 4QW9A 1X9MA 2Y1MA 4DWIA 4C4TA 1JRPA 2DGZA 7ICSA 4RT3A 1UHUA 2WC6A 2HHTA 5FYXA 2E8PA 2FPKA 4F4YA 8ICJA 9ICIA 1KQMB 3GDXA 1PVRA 2HCFA 3QUQA 5J2AA 2KTQA 2HBLA 1NJXA 3I5HB 3GK4X 3ORYA 1CDPA 1QASA 1EXNA 3IN5A 1UHIA 4RUCA 1M63B 3O6BA 5DICA 2AQ4A 2KSPA 1N5WA 3C1ZA 5CJ7A 2W3RA 1X02A 1NX0A 4C80A 1PSBA 3DVEA 4ICBA 4NM1A 2D6FC 3V7KA 1BGXT 2JOJA 1TFRA 2JRFA 3Q8QB 3FS7A 9ICCA 1BJFA 5KFAA 3MDAA 4UB2A 2KBIA 1KEJA 2JV3A 1EH2A 4INWA 4M0AA 3QEAZ 2W8LA 5ALKA 5KU1A 2V4QA 1MC8A 2ZJ5A 1W9ZA 4FQOA 1IGVA 3SIBA 4PHJA 4Y2QA 3UO9A 3JPRA 1K1SA 4U8DA 2H3FA 3SEIA 1KFXS 1OMRA 1S97A 1QX2A 3BDPA 3E3RA 3HX4A 4CCHA 3AAJA 3CP8A 3G6XA 3NSKA 2WCJA 3AQEA 1OE9B 5IILA 1CKKA 3G6VA 1QIWA 4EENA 4RQ2A 5DQHA 1QLKA 1TKDA 1ZQXA 3D0YA 1MHOA 1ZQSA 2K7BA 2BCXA 2F3ZA 5AFPA 3I5FC 7ICLA 4PHPA 1XSNA 5HKZA 5B66U 5ALZA 4ECWA 3DDHA 2J6SA 4C0KA 5G5HA 2ZIUA 3RB4A 3PW7A 2ZFDA 1NKBA 7ICVA 4GAOA 3RJFA 9ICKA 1J7RA 1J2NA 1URJA 9ICLA 4YR0A 2ASJA 4F5OA 4PHNA 4EX7A 5KG6A 3I5IB 4F4ZA 3PY8A 3PR4A 1LXFC 3H4SE 1DQEA 4CNQA 3GIJA 2F33A 1UHKA 5T14A 2LANA 1CDNA 3EPIA 3IDWA 3QX7A 3CW2C 3WK4A 4WQ2A 3UMCA 2E8OA 3HX0A 2HBMA 3O0FA 2LM1A 4PT1A 4RUAA 1TUZA 4FE3A 1V1FA 4JQ0D 5HYDA 4P0PA 2W54A 4I2DA 3SD7A 1U9LA 1B22A 4I29A 1OW4A 3F2CA 5KT7A 4QIWF 3LVVA 1S0OA 2C28A 2XICA 2ZIUB 1BPBA 1ZQVA 4NL9C 4PHDA 3LYSA 3N28A 4UQGA 3CLNA 1Y0VH 1KFSA 1G33A 1OOJA 3PMLA 3DXLA 2QARA 4RNNA 1CDMA 3N7PD 2ISPA 1KFUL 3JTDC 1L7PA 2WNDA 1MA7A 1RYRA 4B9NA 3I5GC 1QH9A 3NRWA 1QVIY 3KBBA 3PALA 4DRWA 3KHLA 3BQ2A 1MXEA 2OXOA 5ALEA 4OD0A 5J0UA 1NZBA 4BX9C 2OWOA 3O2PA 3AKBA 2LMTA 4ZH4A 3B88A 3R1PA 3V7LA 1YX8A 3VROA 2G9BA 3N4MB 2PRUA 1X6IA 2LLSA 1TCOB 3JVTC 5I8NA 1YVHA 3V6JA 1L3TA 2DBYA 1VRKA 2NRWA 2YQEA 4RNOA 5KFDA 1DJYA 2IHMA 1XU4A 2Y9UA 1JIHA 4B9TA 9ICOA 1UUSA 2JQ6A 3RZSA 2HSZA 1U45A 1SR6C 5K89A 4RPXA 4NLCA 2OYYA 2K8MB 2FPMA 1SV0A 4YR3A 2JR5A 1R6PA 5ALFA 1T4GA 1YZ6A 5KFZA 1UHHA 3QU9A 4EEYA 3KPXA 2KJ5A 4YCXA 1ZQHA 5IIMA 4DQRA 1TNWA 4IL6U 5DKNA 4CF4A 3EZ5A 5J2CA 1DK3A 4KMUA 1ZACA 5KFEA 4IQWA 4L9MA 4BY4A 5I2QA 3DD4A 3SG7A 1Y1AA 5BPJA 2R2IA 1L8OA 5DB8A 2IOFA 2JEGA 2ZIWA 2QPTA 2OM6A 3CTNA 2L51A 3WNXB 1B4FA 2P6BB 3GK1A 2E8NA 1Z19A 3CABA 2LE9B 1J1DA 2HOIA 5EE1A 5AM1A 2ASLA 4GFTA 3NVYA 3VGOA 1ZQEA 5JJGA 5DG9A 1A75B 3RRGA 3RH4A 1J7QA 4MEYA 2BCAA 1Z00B 3KOOA 5CB1A 2KFGA 1U48A 3PATA 2EANA 2BCQA 1ODBA 3BUOB 2G08A 4B9VA 2K7OA 1S26D 1KFTA 1OOIX 2WCKA 1SMGA 3K4GA 4ZCUA 2JH7A 2RP5A 3LWLA 1CTRA 1ZQMA 2YN4A 5J2DA 2KAXA 4O3OA 2K4PA 3Q8RB 1SZPA 2KK0A 3HT3A 4AQJA 4QJFB 1YRUB 5DBCA 1ZYQA 4GGNA 2FOTA 5EE0A 5FI2A 2KYCA 2KZZA 5KAIU 1V9PA 2VJ5A 5J3XA 7ICPA 1ALWA 2F8PA 2WCEA 4KN4A 4QZ9A 4YQWA 5CEHA 1L7OA 3F2BA 3FE9A 2W55A 1SL8A 5KG3A 1F8HA 1F70A 1DRGA 1XSPA 4P4OA 4NY8A 2KFNA 1XFXO 4TUQA 2JTZA 5AKEA 9ICRA 1SL9A 2L98A 4O3RA 3HWTA 8ICIA 1CM4A 3JPNA 2XY7A 3ICXA 5AM0A 1OMDA 4Q04A 1TOPA 3SG6A 3NSOA 4MBEA 3LL8B 3SG4A 1RM6C 2MA1A 3C21A 3PSPA 3RFAA 3RBDA 2OTGC 4KYNA 3V6KA 2WFAA 4DFJA 5AM4A 4RT2A 3H8SA 1MWNA 2LI6A 4MHVA 4QZAA 4P0QA 3C1VA 1B4CA 5AICA 4ECSA 3K75D 4IQUA 2LCPA 2LHTA 3AU2A 2HHSA 3I5FB 8ICKA 4NDBA 1MQ2A 4UASA 5IIOA 5ALHA 4B9MA 5D49A 1NUBA 4U7CA 4MN0A 1CDLA 5ALPA 4Z6CA 1SPYA 1LB2B 1KQVA 4KTQA 8ICWA 3PSRA 3MGIA 2KN7A 3OHBA 1SKSA 3E0FA 4ED3A 1K93D 2WF8A 2H3IA 1LVCD 1NK0A 3GILA 1NYAA 4I2IA 3BQ3A 5ALIA 2OH2A 2QB0A 2ZN9A 3AMZA 1NP8A 8ICEA 4IS7A 2P71A 2LVVA 2FMQA 1JUDA 1RWYA 1UURA 2EGDA 5L1LA 2KAYA 3RH5A 3AQFA 1D8LA 1NI3A 3H0LB 5CP2A 5DKQA 3PMNA 1S0NA 3LK1A 1TNQA 4LJXA 1JBAA 7ICIA 4QW8A 2KSOA 2HVIA 2CXYA 2HW3A 8ICLA 9ICAA 1DF0B 3SMVA 4DL7A 4Y2VA 5DG8A 3C28A 1H8BA 3E2EA 5J2IA 2VIXA 1W7JB 2A19A 2FMSA 2MAZA 2RHFA 5DDMA 4EBEA 1SWWA 2LUCA 4GGFA 4A4BA 3JTDB 1NJYA 4ECZA 2ZUDA 3I5GB 4ECYA 1KFUS 5KFIA 3SV3A 2A1JB 5AIBA 2UVUA 1Z4OA 3EVVA 1BODA 1SNLA 1SRAA 3IQQA 3KF9A 3HP6A 4OCZA 1J2MA 5D7FA 5ALGA 1HJPA 4Z6EA 4PL1A 1ZQJA 2V9WA 2KVCA 1AUIB 5AK3A 2KVSA 2NYVA 1XNSA 3BFAA 4MRXA 1AROP 5CRXA 3RAXA 4WRIA 3NGVA 1DVIA 4DL4A 9ICEA 3QUCA 1S9FA 3JVTB 1TNPA 3BZCA 2MUTB 4YRUA 3FC4A 4R8UA 4F4XA 4DSIA 4C4RA 3OB2B 2AMIA 1RQNA 1FEZA 4O5EA 1NSHA 3GU3A 5PALA 2XVTA 1NZPA 3RBEA 1N56A 3Q8PB 1C7WA 1BMOA 1NCXA 1SR6B 1S0MA 2LM4A 2V4RA 2Y1JA 4GUKA 1BR4B 2ALZA 5BPCA 3JPTA 4DQSA 2WCLA 1JMSA 3IHQB 3GIKA 4INXA 3UM9A 3UXOA 3NRZA 4RQNA 5HHIA 4GPLB 2IBKA 3H8MA 2NO5A 4ED2A 2FCEA 2E6WA 2NZ0A 5DQIA 1X9SA 1S8OA 5KT4A 7ICUA 3SAGA 4XRHA 2H61C 3D10A 3ZDEA 4KLUA 3PX4A 4FS2A 2I6XA 1SZHA 3CZ1A 4USAA 4I2BA 1O03A 5AKGA 4IC9A 2E1EA 3T5HA 3GZFA 2KG5A 3HRDD 2JEFA 3ISCA 2OS8C 4FTGA 2G5HB 2H3ZA 3H4DA 4GLXA 2NRXA 4BWJA 2MJWB 2E3TA 3IG5A 5A0LA 3FDSA 2PYQA 1J1EA 1JN3A 3QU4A 2R18A 4UAWA 4YXMA 1N60A 3QXGA 3Q8SB 4Y2TA 4BGDA 1TIZA 3MGVA 1F4QA 1LKYA 2W9BB 1YURA 2PI4A 5KTYA 3T5KA 3GOFA 4EBDA 2K8CB 3CR2A 3Q8IA 7ICQA 3GIIA 1S10A 2MU2A 1QS7A 2O6KA 4E68A 9ICNA 3LWMA 3TKAA 1A2XA 2Y4QA 1N62A 2LVKA 4I5NB 4UAVA 1A77A 1ZD3A 1TV9A 2NLNA 1AP4A 3MR5A 2NRTA 5JU5A 2G5IB 1EG4A 5BOLA 1QIVA 4I5JA 4JK1A 2VA3A 3MR3A 1Z4NA 2JU0A 1WWUA 3BJHA 5CR0A 3ZD9A 4AYBF 1TUJA 2K60A 2YMPA 3QZ7A 2GO7A 1ZQYA 3JPOA 2JZBA 3BQTA 1TCFA 5J0WA 3OTQA 1ZQNA 2LP3A 2K0JA 4QIWC 1YVLA 1PK0D 5D3OA 3TDZA 1EL4A 1GGWA 1MQ3A 2B0CA 4RNMA 1NNLA 3BFHA 1T3NA 1U5IA 2Y9TA 5KSZA 2OTGB 2K89A 2ES6A 1ZD5A 4M2OA 4YXJA 4I2CA 1QJTA 3UQ2A 4C7YA 2FJUB 3SZ2A 5L1JA 2DFLA 2W8KA 4UB8U 1KBUA 1SKWA 4UB5A 1SCVA 7ICFA 8ICZA 3M9NB 1CLMA 1YRTB 4YGCB 4ECXA 1ECWA 2P6UA 3DVKA 3BQ7A 1KN5A 1X40A 2F2OA 9ICJA 1CI4A 3BYAA 1OOHA 5J0SA 2XGQA 2XIDA 2PVBA 1WYGA 2ZIVB 3D6JA 4XYNA 4XUSA 1XFZO 1KSPA 3IP4B 1QCKA 4I27A 4EX6A 1CFPA 5KFGA 2I5HA 3L5KA 4IL1A 3DYEA 4QJ3B 4X5VA 4OKHA 1C20A 2M9NA 1E8AA 3D77A 1G4YR 1DJHA 1DEKA 3KO0A 3QE9Y 2M0NA 1K96A 1L5UA 5DGBA 1JX4A 1SBJA 3D74A 4AOMA 1IH0A 4PALA 2R8IA 1K9UA 2DPIA 2YGUA 3R1OA 4UB6U 3C23A 3DVMA 3QU2A 4TQRA 2EC6C 4KLOA 4IR9A 5AKJA 3TFRA 5AK5A 1QTMA 3WU2U 1IJ6A 1RTP1 3NSIA 5CSFA 3H4BA 4FZLA 4UB1A 2KPHA 1BF5A 3ICBA 3OGUA 2KD1A 4RQ5A 4OZDA 2DPJA 1QQ5A 1QV1A 3EKJA 2M7NA 1PK1B 2BPGA 2QDIA 2XY5A 4DFKA 5KT2A 4Y2XA 3TDIA 2ZKMX 4QZDA 4KLEA 4O3QA 2H3QA 1SCMC 2FLLA 4OR9B 4ELUA 2KOBA 2K4HA 4PHKA 4MZLA 2KQYA 2KHVA 4HAIA 2R8GA 2W9MA 3N7RC 2IA6A 3EYZA 1TWOA 5AI8A 1XFVO 2OPOA 3CZ2A 5AHXA 1T14A 2UVWA 3NVVA 2XY6A 2JT8A 4YD2A 4I5LB 3N7SC 3QNMA 4Q43A 3G6YA 5HMMA 2PFQA 4QZHA 8ICFA 3EUB2 4KX3A 9ICGA 1Y1UA 4I2JA 5B8IB 1N63A 1XO1A 3DV9A 1UHNA 1NK9A 1R2UA 2B1UA 4M9JA 3IVTA 4DCKA 2PMZF 2M1UA 2I2RE 3B86A 1WWVA 1DK2A 4ECUA 1IXRA 1V85A 9ICHA 5I2LA 3SENA 2XO7A 1J97A 1A6SA 2QEHA 4YGBB 1ZD4A 4ED7A 8ICCA 4M47A 2JPTA 2BHNA 4I2GA 1ZUZA 2PI5A 2BKEA 4OJPA 5GTIU 3FAHA 3V6HA 1XS9D 1K94A 3BFBA 4A4CA 2BCVA 2AGQA 1IKUA 5DB9A 4I2AA 5KFHA 5ALXA 3TAQA 2L4IA 2KFZA 4KLMA 2KIWA 4ED0A 3MGHA 4HSZA 4UARA 4LZGA 1BNPA 2WB1F 4J9QA 1QATA 3WKBA 1NK4A 4CLNA 2H3VA 2OS8B 4IQVA 3AAKA 1FI5A 1U47A 3LLEA 4Y2RA 4MZKA 2IOHA 2HVHA 1TAMA 3ETLA 2KP7A 1ZXIA 2F76X 2LBOA 1NIWA 2BE6A 5DKRA 4F5QA 3VC8A 3AN1A 2WOSA 3C2KA 1M46A 3SV4A 5B5EU 1QQ6A 1YX7A 1IG6A 1FBVA 4ETOA 2BKHB 3UQ0A 1ZQPA 2KFHA 4F0ZB 1K1QA 2FJ6A 4MRYA 4XA5A 4J9LA 4PPXA 3NHTA 4CF3A 1RPLA 3M9MB 4DL2A 2ZUBA 1RDFA 3ALRA 2AQ0A 1N0YA 1PALA 2EZXA 5KFFA 1L3SA 4QWCA 4US9A 1UT5A 2XI9A 4Q8FA 5J2GA 3GV8B 2AGOA 2NCPA 4QZEA 2PSRA 3ZDCA 2BR0A 3HW8A 9ICQA 2JXCA 7ICMA 3SAFA 1RQLA 1J7PA 3Q8KA 2KQ6A 1KCYA 4YVZA 1BNOA 2KGRA 1DJGA 5KFLA 1MF8B 1DGJA 2M0RA 2XCAA 2GGMA 2LM5A 4O0IA 1N61A 1A75A 2GOLA 1ZOLA 3BOWB 4NXZA 2LKYA 3RJKA 2BCBA 1RK9A 1L8LA 1NCYA 4JKTA 8ICNA 1Z00A 2JC2A 4F50A 2M1KB 1LVHA 9ICWA 4LVSA 2I94A 5ER5A 4DF4A 4KN7A 5ALLA 1WDCC 1KK7Z 1L2OC 2K7DA 1FO4A 3PZPA 5HHHA 2WAQC 4QWAA 1D9FA 2MLEC 5J2JA 2VRGA 3WKDA 3S0AA 2E30A 1CFFA 1NX1A 2V53A 4C4SA 4MF2A 5J0OA 5AI4A 4QJ4B 5EWEA 4I5KA 2I9GA 2G0AA 4A8EA 3KHHA 1KW4A 1YUTA 4UAYA 3CYZA 1L6NA 2HPSA 2RLTA 3NASA 1MUXA 1BG1A 1IM4A 3R9KA 2L50A 5ALTA 2EDUA 5F6TA 5JOLA 5FI6A 3QUTA 1V97A 5J0XA 1TTXA 4DSJA 1Q3UA 5AM2A 4R64A 5CA7A 3QZ8A 2PFOA 2KFFA 2YMQA 3S0GA 2WC5A 3VRQA 1WRLA 2ZNEA 5DB6A 5ALSA 2HMXA 1O08A 2K61A 1BPEA 2QKQA 4O3SA 3KD3A 3BJYA 1L3UA 1JROA 4TNCA 4YG2A 5KL1B 1QTXA 2EC6B 5KG2A 8ICUA 4YMNA 2QEVA 5ALRA 2H2KA 1H4BA 3SI8A 5HR7A 4Y2SA 5KFRA 2AJQA 1SIJA 1ZQQA 2VJ4A 2BKIB 3VB1A 2HBJA 2H8VA 2PALA 1B0XA 1FIQA 3CZ0A 2W3SA 3MFHA 3KEVA 1TNXA 1N2XA 2CXJA 1IIOA 2BBNA 3PJIA 2D8NA 4PDZA 4RQMA 4C8MA 2LP2A 3RJHA 1CEZA 1Q3VA 1AVSA 1ZJMA 1F54A 4Q45A 1YT3A 5KFJA 1V38A 4F2SA 4I28A 1M39A 5ALUA 8ICAA 3PNCA 5EE9A 3RH6A 1T3QA 3SS3A 2FDRA 1TE2A 4YN4A 1XK4C 4GFJA 3JPQA 4C0JA 4PE1A 4ED1A 3PSIA 2BECA 5ALYA 2L4HA 3V2LA 7ICGA
chains in the Genus database with same CATH topology
1X40A 3TADC 5J8YC 1V85A 1PK3A 3SENA 2DKXA 2QB0A 3TADA 5J8YA 2DKZA 2E8PA 1OXJA 2BNXA 3OBVA 3BS7A 4IS7A 2KG5A 4NL9C 1Z1VA 5KNIA 4NL9A 1DXSA 2EANA 2QARA 4I5KA 2F8KA 2QB0B 1KW4A 2LPEA 2KLDA 5JTIA 1DEKA 2KSOA 1F0MA 2K4PA 2YGUA 2E8MA 2QARB 1LKYA 2D8CA 1X9XA 5FI2A 5FI6A 5FI7A 2KSOB 4MEWA 2JV3A 2EAPA 3PM2A 2BAPA 1PK1A 5JRTA 1W9ZA 1LKYB 2QKQA 3UO9A 1Z4HA 2KIVA 2EAOA 4I5NB 1SXDA 3SEIA 1OW5A 2KLEA 1X66A 3O4XA 1RG6A 4PZOA 1SV4A 2DL0A 1PK1B 3EG5B 2Y9UA 2FE9A 5JU5A 2D3DA 5HL1A 2ESEA 1JI7A 4I5JA 1SV0C 1WWUA 3SS4A 2GLEA 3HILA 4NJ8A 5L1MA 1DC1A 1SV0A 3UNWA 1B0XA 4PZNA 3KEVA 2K60A 4KYNA 3BS5A 3K1RB 4RQMA 4GAOA 2B6GA 5D3OA 2KMDA 4MHVA 1DELA 2EAMA 1Z2CB 2Y9TA 1V38A 1SXEA 2ES6A 4I5LB 3BS5B 3KKAC 3SS5A 3TACB 2L5YA 2F44A 4RQNA 3KKAA 4GBAA 2QB1A 1COKA 2F3NA 3H8MA 3IDWA 3SS3A 1UCVA 1B4FA 2E8OA 1UQVA 2E8NA 4JKTA 1SGGA 5F3XB 5I94A 2YTUA 2LMRA 3IVTA 4IJ7A 1WWVA 2KE7A 3BQ7A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1X40 A;  3TAD C;  5J8Y C;  1V85 A;  1PK3 A;  3SEN A;  2DKX A;  2QB0 A;  3TAD A;  5J8Y A;  2DKZ A;  2E8P A;  1OXJ A;  3BS7 A;  4IS7 A;  2KG5 A;  4NL9 C;  1Z1V A;  5KNI A;  4NL9 A;  1DXS A;  2EAN A;  2QAR A;  2F8K A;  2QB0 B;  1KW4 A;  2LPE A;  5JTI A;  2KSO A;  1F0M A;  2K4P A;  2E8M A;  2QAR B;  1LKY A;  2D8C A;  1X9X A;  2KSO B;  2JV3 A;  2EAP A;  1PK1 A;  5JRT A;  1LKY B;  2QKQ A;  2KIV A;  2EAO A;  1SXD A;  3SEI A;  1OW5 A;  1X66 A;  1RG6 A;  4PZO A;  1SV4 A;  2DL0 A;  1PK1 B;  2Y9U A;  2FE9 A;  5JU5 A;  2D3D A;  2ESE A;  1JI7 A;  1SV0 C;  1WWU A;  2GLE A;  3HIL A;  4NJ8 A;  5L1M A;  1SV0 A;  1B0X A;  4PZN A;  2K60 A;  3BS5 A;  3K1R B;  4RQM A;  2B6G A;  2KMD A;  4MHV A;  2EAM A;  2Y9T A;  1V38 A;  1SXE A;  2ES6 A;  3BS5 B;  3KKA C;  3TAC B;  2L5Y A;  2F44 A;  4RQN A;  3KKA A;  2QB1 A;  1COK A;  2F3N A;  3H8M A;  3IDW A;  1UCV A;  1B4F A;  2E8O A;  1UQV A;  2E8N A;  1SGG A;  5F3X B;  2YTU A;  2LMR A;  1WWV A;  2KE7 A;  3BQ7 A; 
#chains in the Genus database with same CATH topology
 4NLK A;  3TAD C;  5J8Y C;  4M6W B;  3R72 A;  5H2F U;  3OBV A;  4EYI B;  1JWD A;  3WKC A;  1UPH A;  3DF0 B;  5IIN A;  1JF2 A;  1Z1V A;  5DKW A;  1DF0 A;  1F4O A;  4NL9 A;  4Y2U A;  5EE3 A;  4OJ6 A;  2KZ3 A;  1CFD A;  5J0T A;  2ZRS A;  2KIC A;  3OP0 A;  2KJ9 A;  1DJI A;  5F9N A;  1XFU O;  1ORG A;  4MLW A;  4ACO A;  4RPY A;  3I1Y A;  5KG7 A;  1NJZ A;  2FPL A;  1DT7 B;  3TAP A;  1F0M A;  4P5O E;  2YML A;  1IG5 A;  3H40 A;  3AM9 A;  4KLT A;  3BUN B;  3ISD A;  5TIS U;  4AP9 A;  2A1J A;  2VKQ A;  5ALJ A;  1PSR A;  4GC6 A;  1RXW A;  2DQN B;  4KX5 A;  1LV5 A;  5CWR A;  3OSN A;  4J9N A;  1REC A;  3FE6 A;  5TNC A;  3CNH A;  1B7T Z;  2JUL A;  5AKX A;  4NDD A;  1C7V A;  2KKV A;  2KI6 D;  4DCC A;  4DL5 A;  5D4B A;  4PGX A;  1WRZ A;  3HKZ C;  1ZQG A;  2NV3 A;  8ICR A;  1SXD A;  4MEX A;  3FE8 A;  1SKR A;  2HHX A;  4K4H A;  1YTZ C;  3O4X A;  2MUT A;  3TQ1 A;  5CHG A;  4Q44 A;  1ZJN A;  2DL0 A;  1KSM A;  2AHO B;  1NCZ A;  5K4L A;  4GNK B;  1M45 A;  4ED8 A;  2FE9 A;  5AK4 A;  4USL A;  1IRJ A;  2BPF A;  3C5F A;  3SG5 A;  1MN8 A;  1FFU A;  2BL0 C;  1L7N A;  4CFR A;  4J9R A;  2NXQ A;  3L4L A;  2YB4 A;  2XGP A;  3TI0 A;  2ZJ8 A;  2K4E A;  3OJS A;  1NX3 A;  3EK8 A;  1PRW A;  3CR5 X;  1JF0 A;  2PQL A;  3CR4 X;  5L9X A;  5KFV A;  1CLB A;  2KI6 C;  3RAQ A;  4PGQ A;  4JB3 A;  2AH5 A;  2XCP A;  3KZI U;  4CRX A;  5J2B A;  1M6Y A;  4DOB A;  2ZIX B;  2HET A;  3KKA C;  3JPP A;  5KFO A;  3M8S A;  5HKY A;  2SCP A;  4NWI A;  3FIA A;  3AL0 B;  4DS5 A;  8ICV A;  1SK6 D;  1KTQ A;  4QZB A;  1NK8 A;  1ZQK A;  2BBM A;  5HR6 A;  1ZRM A;  2RDI A;  4DQQ A;  3IM1 A;  4FFD A;  5AKI A;  2Z7J A;  2LMR A;  5ALN A;  4K4G A;  9ICB A;  2KE7 A;  3RB6 A;  3N7H A;  3UXP A;  3HPO A;  4YGA A;  5AK6 A;  2CPR A;  4F72 A;  5III A;  2M29 A;  2MRD A;  5DDY A;  4J9M A;  2KV2 A;  4Q8E A;  1TRF A;  1IQ5 A;  1ZQ1 C;  4EZ6 A;  2CT9 A;  1KK8 C;  1OOF A;  5KG5 A;  4P4M A;  2LVJ A;  3UPQ A;  1WDC B;  1S6C A;  3TAR A;  7ICN A;  3D78 A;  1DGU A;  2W9B A;  5D46 A;  4ELV A;  4P4P A;  5L1K A;  1QQ7 A;  3IF7 A;  4F71 A;  1C7Y A;  2GGZ A;  1C3Y A;  5J2F A;  1GM0 A;  2RQ5 A;  2E8M A;  5AM3 A;  2ZND A;  1LA3 A;  4DSL A;  4FO6 A;  1HEK A;  2WF6 A;  2CN1 A;  4FQT A;  2ZXI A;  1DGV A;  1XFR A;  5E79 U;  1PZN A;  2HQW A;  4BY5 A;  1QLS A;  2EAP A;  1AHR A;  5HP4 A;  2ODG A;  1JUO A;  4PCW A;  1HT9 A;  1TK5 A;  1S1E A;  3QEB Z;  3NVW A;  4MFF A;  3EVR A;  3OHA A;  3SAH A;  4C8L A;  4Z6F A;  3BQ1 A;  2P6R A;  4RZR A;  2AUC A;  2KAV A;  3SG2 A;  1TK0 A;  3L4P A;  4XJK B;  1ZQI A;  3D2S A;  5I2O A;  1WCL A;  1GGZ A;  2EQY A;  4UPG A;  2M8U A;  3OJU A;  4G9B A;  2F2P A;  3O78 A;  1CLL A;  3H0R B;  5DBB A;  3WK7 A;  2J6T A;  4U6P A;  4PZN A;  4M9H A;  2ZG6 A;  2PMZ C;  1ZMZ A;  4CID A;  2LYB A;  3TUY C;  1T94 A;  2W9C A;  1Z1B A;  1XVJ A;  4DOC A;  5KT3 A;  3S0F A;  9ICP A;  1COO A;  3PLF B;  4DS4 A;  1KL9 A;  1QXP A;  3UMB A;  4GIB A;  2YB1 A;  2GV5 A;  1OQP A;  5ALW A;  3RJG A;  3PST A;  1XYD A;  1K90 D;  4TUP A;  3Q8M A;  4RQ4 A;  3C2L A;  4NQG A;  3BS5 B;  5KFP A;  2LMU A;  4YR2 A;  3A4U B;  1UA0 A;  4R63 A;  2QB1 A;  2XC9 A;  2R8K A;  5KFQ A;  1MSW D;  3RRH A;  1OOG A;  4RQ3 A;  2KHQ A;  2G09 A;  1S76 D;  2I7A A;  2K8A A;  2ZIV A;  2P35 A;  5EWF A;  1B43 A;  1L7Z A;  3RB0 A;  4TUS A;  3PR5 B;  2YTU A;  3F2D A;  3T5J A;  1SWV A;  4JWN A;  4IJ7 A;  3SIA A;  9ICX A;  3PV8 A;  2O60 A;  1WCN A;  4UBB A;  4IRK A;  2DKZ A;  9ICT A;  2M49 B;  2P70 A;  2W9C B;  1RXV A;  2PMY A;  5KNI A;  3BZK A;  1DXS A;  1ZQC A;  2K2F A;  5KAF U;  1XSL A;  2PFP A;  4R66 A;  1NK5 A;  2LHL A;  1MXL C;  4EEL A;  5CSN A;  2LPE A;  5HLO A;  3F53 A;  3H8W A;  3TS5 C;  2F1I A;  2ZXH A;  4YD1 A;  1JFK A;  2LYA A;  1B47 A;  2Q0Z X;  1NKE A;  4FS1 A;  3SJS A;  2FJY A;  2JZI A;  3WKA A;  4I2F A;  5GQQ C;  2W9A A;  3T5L A;  5DB7 A;  2JRZ A;  3F5E A;  2BZF A;  1CM1 A;  1SY9 A;  2F3Y A;  2MRL A;  2AAO A;  3T3F A;  4JV2 A;  5AM5 A;  4PGY A;  1ZD2 P;  4MEW A;  5KFB A;  3D75 A;  3MC1 A;  1XO0 A;  4M9G A;  3S0B A;  1PK1 A;  5DG7 A;  2AXT U;  4GXI A;  1IIP A;  3DVJ A;  4C8O A;  1ZQA A;  2EAO A;  3D2N A;  4NM2 A;  8ICS A;  4BUG A;  3NHI A;  1X66 A;  4PZO A;  3TAN A;  8ICB A;  3PO4 A;  3EG5 B;  3OX6 A;  5J29 A;  2O5G A;  5HL1 A;  2ESE A;  1JI7 A;  1SV0 C;  1BU3 A;  2CCM A;  5KFW A;  1QLN A;  1HUO A;  2OCE A;  3NUQ A;  3QYP A;  4O3N A;  1GQM A;  1FPW A;  4P2H A;  5CSI A;  3NSL A;  4BDP A;  1FI6 A;  1ZQF A;  3RR8 A;  4QWD A;  2Y0S F;  1NK6 A;  3ETR A;  1X42 A;  2B6G A;  4DF8 A;  3OSP A;  2LC5 A;  3I76 A;  4DFP A;  2KGB C;  2Q4U A;  2KMD A;  2Q91 A;  2BL0 B;  1DEL A;  3MDC A;  2EAM A;  1U4B A;  1Z2C B;  1IWQ A;  1XWL A;  2IMW P;  1ZQW A;  4PE4 A;  1S6I A;  4C0L A;  3F45 A;  3SS5 A;  1XFY O;  3OB1 B;  4GBA A;  1BPY A;  3CZT X;  1SL1 A;  1KQQ A;  4DLE A;  4GXK A;  4GXJ A;  2YY6 A;  1XFW O;  2JWW A;  3CWG A;  1J7O A;  2BPC A;  1V1G A;  4RQ1 A;  2RDJ A;  3OX5 A;  2HBK A;  4YMM A;  2H61 A;  4DFD A;  3QU7 A;  2P66 A;  1HIW A;  1DOQ A;  3N97 B;  2DF4 B;  4F8R A;  4UB3 A;  1QSL A;  4PH5 A;  4M04 A;  1KK7 Y;  1WLZ A;  2W7P A;  2B21 A;  2QEO A;  2H5X A;  1BPX A;  4DSK A;  1HUZ A;  2M3W A;  3C5G A;  1X2I A;  3GV5 B;  1PVQ A;  3BXK A;  4WJ3 B;  4C7Z A;  3EK4 A;  3L47 A;  4F4K A;  2C2E A;  7ICR A;  4DS7 A;  1AK8 A;  4DLG A;  1PUL A;  3PFV A;  3UMG A;  4I2E A;  2RGI A;  4DOA A;  1KK8 B;  2ISD A;  1T8E A;  2LUX A;  8ICQ A;  5FI7 A;  3M9O B;  2KNE A;  1PUZ A;  3PM2 A;  3MR6 A;  2W7O A;  3QUB A;  4EZ9 A;  2BAP A;  2JMG A;  1KKX A;  4M2P A;  1S5L U;  7ICO A;  4J03 A;  2C2R A;  3PM8 A;  5CPV A;  1UT8 A;  1DMO A;  4ORA B;  1OW5 A;  1VLB A;  1NOM A;  4MZJ A;  2F1J A;  1RFJ A;  1LIN A;  1M31 A;  3ZDA A;  3H7I A;  3H8J A;  4RQ7 A;  4OV2 A;  2HHU A;  1K8U A;  3NS1 A;  2WCM A;  8ICY A;  1UWO A;  1N2D A;  2YX8 A;  3S0D A;  5KG4 A;  1SSE B;  1ZQT A;  4ECQ A;  3K1Z A;  4NJ8 A;  3B6X A;  4CPV A;  3L4A A;  1VDV A;  4C0Z A;  3K1E A;  4QNL A;  2F1H A;  3LDA A;  1CUK A;  2GH1 A;  3KHG A;  2NRZ A;  5G5G A;  4F5N A;  4MVF A;  2EZZ A;  2ATL A;  3ISB A;  1WRK A;  2A3V A;  2KDH A;  2EHB A;  4KLI A;  1ZQZ A;  1K5O A;  2ZTE A;  1C3Z A;  1NKC A;  1ZRN A;  1IJ5 A;  3AKA A;  3PVX A;  3D0Y B;  4QZI A;  4UAZ A;  3BOW A;  2G2B A;  4YI9 A;  1ZQR A;  3SR6 A;  4NV0 A;  4F92 B;  4RQ6 A;  4DSF A;  3O4Y A;  1SXE A;  1OSA A;  1JC2 A;  4FZM A;  4J9O A;  3FM9 A;  3TUY B;  4QZF A;  5HNK A;  1Q8K A;  2NRV A;  2DOQ A;  3I28 A;  1NPQ A;  2F3N A;  5KFT A;  1CFC A;  3UXN A;  4F5R A;  2VA8 A;  4F91 B;  1RYU A;  3A8R A;  4DO9 A;  4F4W A;  3Q8L A;  4YMO A;  1SL2 A;  4JV1 A;  1KWO C;  4YI8 A;  5AI9 A;  3QME A;  2A1A A;  5BOM A;  3M6Z A;  3GV7 B;  1L7M A;  4QWB A;  3IRU A;  1X6J A;  5KFX A;  1EG3 A;  1TAQ A;  2BCS A;  4KLD A;  1S0V A;  1J55 A;  1P28 A;  2BNX A;  4PHM A;  1JSA A;  5DLG A;  5JUM A;  1MQ1 A;  3WK9 A;  4DEZ A;  2ZTC A;  2L2E A;  1OZS A;  4JMU A;  4ECT A;  4P0P B;  4PE7 A;  2JGA A;  1K9K A;  7ICT A;  9ICV A;  2KLD A;  1K9P A;  2JXL A;  5AEQ A;  2ZN8 A;  4EEK A;  2ERB A;  1CMG A;  1ZOT B;  3B7A A;  4US8 A;  2QAR B;  2QEB A;  2HOQ A;  2JTT A;  3GK2 A;  3PW0 A;  1GJY A;  4M9L A;  4GGF C;  1PVA A;  4JUZ A;  4ZOH C;  4JD9 A;  2IOF K;  4NLN A;  3VRP A;  1QSY A;  5J0R A;  2LLU A;  3TS5 B;  4FBU A;  1BT6 A;  4TQS A;  1WG8 A;  3EPG A;  2FMP A;  1ALV A;  4OCI A;  4PE0 A;  5JRT A;  1EJ3 A;  5CSJ A;  1F55 A;  4KLJ A;  4BWM A;  3MBY A;  3EVU A;  2KIV A;  5AKH A;  1B8C A;  4DSE A;  1B7T Y;  1W7I B;  2N1R A;  2HF5 A;  2KLE A;  5AI5 A;  1RG6 A;  4F7F A;  1SV4 A;  4NDC A;  3ONN A;  4HRH A;  1UHJ A;  2FCD A;  1FW4 A;  2C22 A;  3IG8 A;  1PVP A;  5KFM A;  3M8R A;  3UNW A;  3ZNI A;  7ICK A;  3TDU A;  1SYM A;  2W43 A;  3HJE A;  1Q80 A;  5G08 A;  2FLN A;  2JH1 A;  4KLH A;  2LAP A;  4NLB A;  3TFS A;  1X9W A;  4EYH B;  4LZD A;  1RZT A;  2DWQ A;  4ED6 A;  4KLL A;  3BUM B;  1YUS A;  1NK7 A;  3H0M B;  3LCP C;  5GTH U;  1YR5 A;  2OEH A;  4NLZ A;  4CF5 A;  3L3F X;  2FLP A;  3PX6 A;  2TN4 A;  4OVN F;  2L5Y A;  2HQ8 A;  1DJX A;  4M6W A;  2UVR A;  1COK A;  2PAS A;  4UW9 A;  1A29 A;  5KL8 B;  4DFM A;  5AAN A;  1SGG A;  3S6J A;  3DF0 A;  3D73 A;  2K8B B;  3BQ0 A;  2VA2 A;  2HI0 A;  5ALQ A;  2MLF C;  4M9N A;  2ZIW B;  1A03 A;  4M2Q A;  5IBW A;  2DKX A;  4UAU A;  9ICM A;  3LK0 A;  4HRG A;  4B6J A;  1SCM B;  3BS7 A;  3V7J A;  2JEI A;  1BOC A;  2PKE A;  4Z6D A;  3PN7 C;  1N65 A;  5AI6 A;  1XO5 A;  1T7P A;  2G06 A;  4ICA A;  1OZO A;  2KI4 C;  1AQ6 A;  2F8L A;  3RTV A;  3PW4 A;  2CRX A;  1QVI Z;  5J0P A;  4DQI A;  3KZX A;  2CBL A;  2K4I A;  2F8K A;  3B0X A;  3F5A A;  4BXO A;  2KHN A;  3WK8 A;  4PHE A;  2Y5I A;  2LVI A;  5DQG A;  3B87 A;  1IQ3 A;  4AQI A;  4IR1 A;  5TZV A;  2R8H A;  2GTE A;  5DBA A;  8ICG A;  1SL0 A;  4O5K A;  4OJL A;  3ZDD A;  1JAL A;  4J9S A;  2LV7 A;  2BCU A;  3NXA A;  4OO1 J;  5KFN A;  4CDG A;  3KFU F;  2ISO A;  2BE4 A;  5AIA A;  4DL6 A;  1CNP A;  2LNK A;  4J9P A;  1Y1X A;  2VAN A;  2BQR A;  2KYF A;  2MAX A;  1BVS A;  1Z4H A;  3PO5 A;  2NCO A;  4N1F A;  1JFJ A;  4KMO B;  3PW2 A;  2JEJ A;  1HQV A;  4DQP A;  9ICU A;  2WCB A;  2RRD A;  2QLT A;  1B9A A;  1B8R A;  1S3P A;  3LK9 A;  4UBC A;  4KLF A;  1NX2 A;  5KG0 A;  5J0Q A;  9ICF A;  3C2M A;  1LA0 A;  1TAU A;  3GFK B;  2COL B;  5DGA A;  3CS1 A;  3RJE A;  4BXO B;  4AYB C;  3V72 A;  3PW5 A;  1FFV A;  3HIL A;  1IV8 A;  5L1M A;  1WLM A;  2BQ3 A;  4RU9 A;  1D8Y A;  2E1F A;  1H38 A;  2NO4 A;  3SQI A;  3EKH A;  1F71 A;  3K1R B;  2ZIX A;  3A0B U;  3ZWH A;  4UB4 A;  5AKK A;  5F9L A;  4RQ0 A;  1JXE A;  2FI1 A;  3A0H U;  5KFY A;  2C2D A;  3S0E A;  2WCH A;  3LVW A;  4KLQ A;  2KBM A;  4KIT B;  4IRC A;  3M6K A;  2JNF A;  3PX0 A;  3QRX A;  3WK5 A;  2YMM A;  4YGD B;  2AGP A;  1N5X A;  3AU6 A;  3HCM A;  4ORB B;  2MHH A;  4B9L A;  1D8B A;  5J2H A;  1NWD A;  4P0Q B;  4R65 A;  8ICH A;  4HYK A;  1QWV A;  2AU0 A;  3CDN A;  2WF7 A;  1KQM C;  4JWQ A;  3MR2 A;  3DEE A;  5KFS A;  5KFK A;  3I5H C;  4QZG A;  5J2K A;  4MSP A;  2BQU A;  1N48 A;  1RRO A;  4JPZ B;  1PK3 A;  7ICH A;  3R1V A;  5KG1 A;  4QZ8 A;  3RF9 A;  2WAQ F;  4JV0 A;  1L3V A;  1CB1 A;  1ED1 A;  2HHQ A;  2KZM A;  1KWO B;  2JT3 A;  5KFU A;  2JXJ A;  2Y1I A;  2F2A B;  2ZRT A;  5HKW A;  3K21 A;  2QB0 B;  4YP3 A;  2K7C A;  1UP5 A;  1G8I A;  1JXL A;  8ICP A;  5EOZ A;  4O5C A;  4YBH B;  4FBT A;  2GWS A;  3NGD A;  4K4I A;  4R1E A;  4YFK A;  4O3P A;  3WXA A;  3U26 A;  1KFX L;  1EXR A;  5J0Y A;  1CRX A;  2BGW A;  3KHR A;  1S5G Y;  2LLT A;  1F5S A;  2EZY A;  1A76 A;  2KJ8 A;  2I1Q A;  5DLF A;  4ORC B;  1Q46 A;  2KSO B;  2L2C A;  4UAT A;  4F93 B;  3CRX A;  5KT6 A;  3D76 A;  3E58 A;  2DUY A;  3PSF A;  2Y0S C;  2IHN A;  1Y6W A;  4XJK A;  1L2O B;  4WQ3 A;  1NJW A;  2BDP A;  1ZQL A;  2ZTD A;  2E5S A;  2WOR A;  4B9S A;  2A4J A;  4IQT A;  3THV A;  5D69 A;  2MBX A;  3FWB A;  4ELT A;  3RJI A;  4F5P A;  4I2H A;  4B9U A;  5ALD A;  7ICE A;  3IQO A;  1BLQ A;  2PXI A;  1DGS A;  4D1E A;  1A0P A;  3OPX A;  3SS4 A;  5FP0 A;  1DC1 A;  2W04 A;  4RPZ A;  4MF8 A;  3I5I C;  2JT0 A;  1KSO A;  2BDU A;  3SG3 A;  3AEV A;  3SYZ A;  4TUR A;  3BS5 A;  3BUW B;  3AUO A;  3IV6 A;  1S36 A;  3B9J A;  3FYH A;  3M7D A;  2PFN A;  3M0W A;  3WKE A;  1B8L A;  3B0Y A;  4C8N A;  5HML A;  3JPS A;  4IRD A;  2MA2 A;  4DIR A;  2CNP A;  2JPO A;  3KTQ A;  4R8U B;  4QJ5 B;  2Q4T A;  4DL3 A;  3T79 A;  1D1O A;  1ZQB A;  4F3O A;  2J6U A;  2HHW A;  1S77 D;  1YUU A;  2CTN A;  3FWC A;  2LMV A;  2L0P A;  8ICT A;  1P7D A;  4HRE E;  2ASD A;  2WF9 A;  3TAC B;  1QV0 A;  2F44 A;  2W03 A;  3VRN A;  4ECV A;  2Y1N A;  4ZCV A;  1UCV A;  2JNX A;  1TVA A;  3MFI A;  2WC8 A;  4J9K A;  1XC9 A;  2QAC A;  2I18 A;  2M7L A;  1XK4 A;  1AJ5 A;  4Y2P A;  1QX5 B;  4PJ0 U;  2EH9 A;  4Y2J A;  5AKL A;  1AJ4 A;  3ED5 A;  3TAD A;  4FZN A;  3M1Y A;  5AKZ A;  5J8Y A;  1OXJ A;  5KTQ A;  4DUQ A;  1CMF A;  2KEY A;  8ICM A;  1PVB A;  3ZDB A;  2OHF A;  1OUQ A;  4NLG A;  4BJQ A;  1ZFS A;  3WK6 A;  2R8J A;  3WHT B;  5EL2 A;  5AKY A;  4RQ8 A;  2WB1 C;  3NTU A;  5JTI A;  5KT5 A;  1GO3 F;  3RR7 A;  1SB3 C;  5AI0 A;  1TK8 A;  1LS8 A;  1K2H A;  4M2Y A;  2ZJA A;  2WF5 A;  3VRR A;  1RYS A;  3CGA A;  3J81 j;  3PN7 B;  5AXI A;  5C5J A;  1ZQU A;  3RM1 A;  1WUD A;  1Z3E B;  2WTF A;  1DJZ A;  2IS9 A;  2KI4 B;  1BPD A;  5AER A;  4N5X A;  2D8C A;  1X9X A;  2WCF A;  5ALV A;  4O9M A;  3VCB A;  7ICJ A;  4O3M A;  3OHM B;  4GC7 A;  2SAS A;  3WHU B;  5J2E A;  1QX7 A;  1A4P A;  3OGN A;  1ZET A;  4KLS A;  5ALO A;  3BUX B;  1BPZ A;  4Y2Y A;  3GIM A;  2F77 X;  3NVZ A;  1S5G Z;  1LKY B;  1TN4 A;  3DZT A;  5ALM A;  3MSE B;  4PL2 A;  4CFQ A;  1KRP A;  1KFD A;  1ZQD A;  3ZI4 A;  1SW8 A;  1SL7 A;  3CYM A;  3HKZ F;  3QU5 A;  2L5X B;  5L1I A;  1U49 A;  1B1G A;  4N1G A;  4E0D A;  2D3D A;  4JWM A;  4MFC A;  4KLG A;  2HHV A;  1RJV A;  4ECR A;  1F44 A;  3KHE A;  3EWA A;  5IIK A;  1LKJ A;  3DY9 A;  3D2Q A;  2GLE A;  1KDH A;  5HLV A;  4MFA A;  2ZUC A;  9ICS A;  3RJJ A;  1S6J A;  1Y88 A;  1KLN A;  1BR1 B;  3EW9 A;  4C8K A;  2BCR A;  4YGE B;  3TZ1 A;  4PHA A;  2MSN A;  2M9G A;  2KOT A;  4EBC A;  5KFC A;  2WHE A;  4XQ8 A;  4CGZ A;  1WY9 A;  4G3I A;  2JHD A;  1DJW A;  2UVV A;  3ZD8 A;  3RLZ A;  1C07 A;  1YZ7 A;  4OJ5 A;  1DTL A;  1ZQO A;  1K95 A;  1UA1 A;  1D9D A;  4QZC A;  5IIJ A;  8ICX A;  4F2R A;  4QWE A;  3C29 A;  2K2A A;  2JZB B;  2HOF A;  5C0Y A;  4P2Y B;  3KKA A;  2W11 A;  2LHI A;  2KNJ A;  4OJO A;  1QSS A;  4CE6 A;  2HDO A;  2M97 A;  3EK7 A;  3MAB A;  1FF1 A;  1SKT A;  1XA5 A;  1UQV A;  2LYH A;  1OMV A;  1U5I B;  2G07 A;  3GQC A;  2KKP A;  1VJ5 A;  5F3X B;  8ICO A;  1MR8 A;  3RB3 A;  5EWG A;  5I94 A;  3C1Y A;  5ER4 X;  4QW9 A;  1X9M A;  2Y1M A;  4DWI A;  4C4T A;  1JRP A;  2DGZ A;  7ICS A;  4RT3 A;  1UHU A;  2WC6 A;  2HHT A;  5FYX A;  2E8P A;  2FPK A;  4F4Y A;  8ICJ A;  9ICI A;  1KQM B;  3GDX A;  1PVR A;  2HCF A;  3QUQ A;  5J2A A;  2KTQ A;  2HBL A;  1NJX A;  3I5H B;  3GK4 X;  3ORY A;  1CDP A;  1QAS A;  1EXN A;  3IN5 A;  1UHI A;  4RUC A;  1M63 B;  3O6B A;  5DIC A;  2AQ4 A;  2KSP A;  1N5W A;  3C1Z A;  5CJ7 A;  2W3R A;  1X02 A;  1NX0 A;  4C80 A;  1PSB A;  3DVE A;  4ICB A;  4NM1 A;  2D6F C;  3V7K A;  1BGX T;  2JOJ A;  1TFR A;  2JRF A;  3Q8Q B;  3FS7 A;  9ICC A;  1BJF A;  5KFA A;  3MDA A;  4UB2 A;  2KBI A;  1KEJ A;  2JV3 A;  1EH2 A;  4INW A;  4M0A A;  3QEA Z;  2W8L A;  5ALK A;  5KU1 A;  2V4Q A;  1MC8 A;  2ZJ5 A;  1W9Z A;  4FQO A;  1IGV A;  3SIB A;  4PHJ A;  4Y2Q A;  3UO9 A;  3JPR A;  1K1S A;  4U8D A;  2H3F A;  3SEI A;  1KFX S;  1OMR A;  1S97 A;  1QX2 A;  3BDP A;  3E3R A;  3HX4 A;  4CCH A;  3AAJ A;  3CP8 A;  3G6X A;  3NSK A;  2WCJ A;  3AQE A;  1OE9 B;  5IIL A;  1CKK A;  3G6V A;  1QIW A;  4EEN A;  4RQ2 A;  5DQH A;  1QLK A;  1TKD A;  1ZQX A;  3D0Y A;  1MHO A;  1ZQS A;  2K7B A;  2BCX A;  2F3Z A;  5AFP A;  3I5F C;  7ICL A;  4PHP A;  1XSN A;  5HKZ A;  5B66 U;  5ALZ A;  4ECW A;  3DDH A;  2J6S A;  4C0K A;  5G5H A;  2ZIU A;  3RB4 A;  3PW7 A;  2ZFD A;  1NKB A;  7ICV A;  4GAO A;  3RJF A;  9ICK A;  1J7R A;  1J2N A;  1URJ A;  9ICL A;  4YR0 A;  2ASJ A;  4F5O A;  4PHN A;  4EX7 A;  5KG6 A;  3I5I B;  4F4Z A;  3PY8 A;  3PR4 A;  1LXF C;  3H4S E;  1DQE A;  4CNQ A;  3GIJ A;  2F33 A;  1UHK A;  5T14 A;  2LAN A;  1CDN A;  3EPI A;  3IDW A;  3QX7 A;  3CW2 C;  3WK4 A;  4WQ2 A;  3UMC A;  2E8O A;  3HX0 A;  2HBM A;  3O0F A;  2LM1 A;  4PT1 A;  4RUA A;  1TUZ A;  4FE3 A;  1V1F A;  4JQ0 D;  5HYD A;  4P0P A;  2W54 A;  4I2D A;  3SD7 A;  1U9L A;  1B22 A;  4I29 A;  1OW4 A;  3F2C A;  5KT7 A;  4QIW F;  3LVV A;  1S0O A;  2C28 A;  2XIC A;  2ZIU B;  1BPB A;  1ZQV A;  4NL9 C;  4PHD A;  3LYS A;  3N28 A;  4UQG A;  3CLN A;  1Y0V H;  1KFS A;  1G33 A;  1OOJ A;  3PML A;  3DXL A;  2QAR A;  4RNN A;  1CDM A;  3N7P D;  2ISP A;  1KFU L;  3JTD C;  1L7P A;  2WND A;  1MA7 A;  1RYR A;  4B9N A;  3I5G C;  1QH9 A;  3NRW A;  1QVI Y;  3KBB A;  3PAL A;  4DRW A;  3KHL A;  3BQ2 A;  1MXE A;  2OXO A;  5ALE A;  4OD0 A;  5J0U A;  1NZB A;  4BX9 C;  2OWO A;  3O2P A;  3AKB A;  2LMT A;  4ZH4 A;  3B88 A;  3R1P A;  3V7L A;  1YX8 A;  3VRO A;  2G9B A;  3N4M B;  2PRU A;  1X6I A;  2LLS A;  1TCO B;  3JVT C;  5I8N A;  1YVH A;  3V6J A;  1L3T A;  2DBY A;  1VRK A;  2NRW A;  2YQE A;  4RNO A;  5KFD A;  1DJY A;  2IHM A;  1XU4 A;  2Y9U A;  1JIH A;  4B9T A;  9ICO A;  1UUS A;  2JQ6 A;  3RZS A;  2HSZ A;  1U45 A;  1SR6 C;  5K89 A;  4RPX A;  4NLC A;  2OYY A;  2K8M B;  2FPM A;  1SV0 A;  4YR3 A;  2JR5 A;  1R6P A;  5ALF A;  1T4G A;  1YZ6 A;  5KFZ A;  1UHH A;  3QU9 A;  4EEY A;  3KPX A;  2KJ5 A;  4YCX A;  1ZQH A;  5IIM A;  4DQR A;  1TNW A;  4IL6 U;  5DKN A;  4CF4 A;  3EZ5 A;  5J2C A;  1DK3 A;  4KMU A;  1ZAC A;  5KFE A;  4IQW A;  4L9M A;  4BY4 A;  5I2Q A;  3DD4 A;  3SG7 A;  1Y1A A;  5BPJ A;  2R2I A;  1L8O A;  5DB8 A;  2IOF A;  2JEG A;  2ZIW A;  2QPT A;  2OM6 A;  3CTN A;  2L51 A;  3WNX B;  1B4F A;  2P6B B;  3GK1 A;  2E8N A;  1Z19 A;  3CAB A;  2LE9 B;  1J1D A;  2HOI A;  5EE1 A;  5AM1 A;  2ASL A;  4GFT A;  3NVY A;  3VGO A;  1ZQE A;  5JJG A;  5DG9 A;  1A75 B;  3RRG A;  3RH4 A;  1J7Q A;  4MEY A;  2BCA A;  1Z00 B;  3KOO A;  5CB1 A;  2KFG A;  1U48 A;  3PAT A;  2EAN A;  2BCQ A;  1ODB A;  3BUO B;  2G08 A;  4B9V A;  2K7O A;  1S26 D;  1KFT A;  1OOI X;  2WCK A;  1SMG A;  3K4G A;  4ZCU A;  2JH7 A;  2RP5 A;  3LWL A;  1CTR A;  1ZQM A;  2YN4 A;  5J2D A;  2KAX A;  4O3O A;  2K4P A;  3Q8R B;  1SZP A;  2KK0 A;  3HT3 A;  4AQJ A;  4QJF B;  1YRU B;  5DBC A;  1ZYQ A;  4GGN A;  2FOT A;  5EE0 A;  5FI2 A;  2KYC A;  2KZZ A;  5KAI U;  1V9P A;  2VJ5 A;  5J3X A;  7ICP A;  1ALW A;  2F8P A;  2WCE A;  4KN4 A;  4QZ9 A;  4YQW A;  5CEH A;  1L7O A;  3F2B A;  3FE9 A;  2W55 A;  1SL8 A;  5KG3 A;  1F8H A;  1F70 A;  1DRG A;  1XSP A;  4P4O A;  4NY8 A;  2KFN A;  1XFX O;  4TUQ A;  2JTZ A;  5AKE A;  9ICR A;  1SL9 A;  2L98 A;  4O3R A;  3HWT A;  8ICI A;  1CM4 A;  3JPN A;  2XY7 A;  3ICX A;  5AM0 A;  1OMD A;  4Q04 A;  1TOP A;  3SG6 A;  3NSO A;  4MBE A;  3LL8 B;  3SG4 A;  1RM6 C;  2MA1 A;  3C21 A;  3PSP A;  3RFA A;  3RBD A;  2OTG C;  4KYN A;  3V6K A;  2WFA A;  4DFJ A;  5AM4 A;  4RT2 A;  3H8S A;  1MWN A;  2LI6 A;  4MHV A;  4QZA A;  4P0Q A;  3C1V A;  1B4C A;  5AIC A;  4ECS A;  3K75 D;  4IQU A;  2LCP A;  2LHT A;  3AU2 A;  2HHS A;  3I5F B;  8ICK A;  4NDB A;  1MQ2 A;  4UAS A;  5IIO A;  5ALH A;  4B9M A;  5D49 A;  1NUB A;  4U7C A;  4MN0 A;  1CDL A;  5ALP A;  4Z6C A;  1SPY A;  1LB2 B;  1KQV A;  4KTQ A;  8ICW A;  3PSR A;  3MGI A;  2KN7 A;  3OHB A;  1SKS A;  3E0F A;  4ED3 A;  1K93 D;  2WF8 A;  2H3I A;  1LVC D;  1NK0 A;  3GIL A;  1NYA A;  4I2I A;  3BQ3 A;  5ALI A;  2OH2 A;  2QB0 A;  2ZN9 A;  3AMZ A;  1NP8 A;  8ICE A;  4IS7 A;  2P71 A;  2LVV A;  2FMQ A;  1JUD A;  1RWY A;  1UUR A;  2EGD A;  5L1L A;  2KAY A;  3RH5 A;  3AQF A;  1D8L A;  1NI3 A;  3H0L B;  5CP2 A;  5DKQ A;  3PMN A;  1S0N A;  3LK1 A;  1TNQ A;  4LJX A;  1JBA A;  7ICI A;  4QW8 A;  2KSO A;  2HVI A;  2CXY A;  2HW3 A;  8ICL A;  9ICA A;  1DF0 B;  3SMV A;  4DL7 A;  4Y2V A;  5DG8 A;  3C28 A;  1H8B A;  3E2E A;  5J2I A;  2VIX A;  1W7J B;  2A19 A;  2FMS A;  2MAZ A;  2RHF A;  5DDM A;  4EBE A;  1SWW A;  2LUC A;  4GGF A;  4A4B A;  3JTD B;  1NJY A;  4ECZ A;  2ZUD A;  3I5G B;  4ECY A;  1KFU S;  5KFI A;  3SV3 A;  2A1J B;  5AIB A;  2UVU A;  1Z4O A;  3EVV A;  1BOD A;  1SNL A;  1SRA A;  3IQQ A;  3KF9 A;  3HP6 A;  4OCZ A;  1J2M A;  5D7F A;  5ALG A;  1HJP A;  4Z6E A;  4PL1 A;  1ZQJ A;  2V9W A;  2KVC A;  1AUI B;  5AK3 A;  2KVS A;  2NYV A;  1XNS A;  3BFA A;  4MRX A;  1ARO P;  5CRX A;  3RAX A;  4WRI A;  3NGV A;  1DVI A;  4DL4 A;  9ICE A;  3QUC A;  1S9F A;  3JVT B;  1TNP A;  3BZC A;  2MUT B;  4YRU A;  3FC4 A;  4R8U A;  4F4X A;  4DSI A;  4C4R A;  3OB2 B;  2AMI A;  1RQN A;  1FEZ A;  4O5E A;  1NSH A;  3GU3 A;  5PAL A;  2XVT A;  1NZP A;  3RBE A;  1N56 A;  3Q8P B;  1C7W A;  1BMO A;  1NCX A;  1SR6 B;  1S0M A;  2LM4 A;  2V4R A;  2Y1J A;  4GUK A;  1BR4 B;  2ALZ A;  5BPC A;  3JPT A;  4DQS A;  2WCL A;  1JMS A;  3IHQ B;  3GIK A;  4INX A;  3UM9 A;  3UXO A;  3NRZ A;  4RQN A;  5HHI A;  4GPL B;  2IBK A;  3H8M A;  2NO5 A;  4ED2 A;  2FCE A;  2E6W A;  2NZ0 A;  5DQI A;  1X9S A;  1S8O A;  5KT4 A;  7ICU A;  3SAG A;  4XRH A;  2H61 C;  3D10 A;  3ZDE A;  4KLU A;  3PX4 A;  4FS2 A;  2I6X A;  1SZH A;  3CZ1 A;  4USA A;  4I2B A;  1O03 A;  5AKG A;  4IC9 A;  2E1E A;  3T5H A;  3GZF A;  2KG5 A;  3HRD D;  2JEF A;  3ISC A;  2OS8 C;  4FTG A;  2G5H B;  2H3Z A;  3H4D A;  4GLX A;  2NRX A;  4BWJ A;  2MJW B;  2E3T A;  3IG5 A;  5A0L A;  3FDS A;  2PYQ A;  1J1E A;  1JN3 A;  3QU4 A;  2R18 A;  4UAW A;  4YXM A;  1N60 A;  3QXG A;  3Q8S B;  4Y2T A;  4BGD A;  1TIZ A;  3MGV A;  1F4Q A;  1LKY A;  2W9B B;  1YUR A;  2PI4 A;  5KTY A;  3T5K A;  3GOF A;  4EBD A;  2K8C B;  3CR2 A;  3Q8I A;  7ICQ A;  3GII A;  1S10 A;  2MU2 A;  1QS7 A;  2O6K A;  4E68 A;  9ICN A;  3LWM A;  3TKA A;  1A2X A;  2Y4Q A;  1N62 A;  2LVK A;  4I5N B;  4UAV A;  1A77 A;  1ZD3 A;  1TV9 A;  2NLN A;  1AP4 A;  3MR5 A;  2NRT A;  5JU5 A;  2G5I B;  1EG4 A;  5BOL A;  1QIV A;  4I5J A;  4JK1 A;  2VA3 A;  3MR3 A;  1Z4N A;  2JU0 A;  1WWU A;  3BJH A;  5CR0 A;  3ZD9 A;  4AYB F;  1TUJ A;  2K60 A;  2YMP A;  3QZ7 A;  2GO7 A;  1ZQY A;  3JPO A;  2JZB A;  3BQT A;  1TCF A;  5J0W A;  3OTQ A;  1ZQN A;  2LP3 A;  2K0J A;  4QIW C;  1YVL A;  1PK0 D;  5D3O A;  3TDZ A;  1EL4 A;  1GGW A;  1MQ3 A;  2B0C A;  4RNM A;  1NNL A;  3BFH A;  1T3N A;  1U5I A;  2Y9T A;  5KSZ A;  2OTG B;  2K89 A;  2ES6 A;  1ZD5 A;  4M2O A;  4YXJ A;  4I2C A;  1QJT A;  3UQ2 A;  4C7Y A;  2FJU B;  3SZ2 A;  5L1J A;  2DFL A;  2W8K A;  4UB8 U;  1KBU A;  1SKW A;  4UB5 A;  1SCV A;  7ICF A;  8ICZ A;  3M9N B;  1CLM A;  1YRT B;  4YGC B;  4ECX A;  1ECW A;  2P6U A;  3DVK A;  3BQ7 A;  1KN5 A;  1X40 A;  2F2O A;  9ICJ A;  1CI4 A;  3BYA A;  1OOH A;  5J0S A;  2XGQ A;  2XID A;  2PVB A;  1WYG A;  2ZIV B;  3D6J A;  4XYN A;  4XUS A;  1XFZ O;  1KSP A;  3IP4 B;  1QCK A;  4I27 A;  4EX6 A;  1CFP A;  5KFG A;  2I5H A;  3L5K A;  4IL1 A;  3DYE A;  4QJ3 B;  4X5V A;  4OKH A;  1C20 A;  2M9N A;  1E8A A;  3D77 A;  1G4Y R;  1DJH A;  1DEK A;  3KO0 A;  3QE9 Y;  2M0N A;  1K96 A;  1L5U A;  5DGB A;  1JX4 A;  1SBJ A;  3D74 A;  4AOM A;  1IH0 A;  4PAL A;  2R8I A;  1K9U A;  2DPI A;  2YGU A;  3R1O A;  4UB6 U;  3C23 A;  3DVM A;  3QU2 A;  4TQR A;  2EC6 C;  4KLO A;  4IR9 A;  5AKJ A;  3TFR A;  5AK5 A;  1QTM A;  3WU2 U;  1IJ6 A;  1RTP 1;  3NSI A;  5CSF A;  3H4B A;  4FZL A;  4UB1 A;  2KPH A;  1BF5 A;  3ICB A;  3OGU A;  2KD1 A;  4RQ5 A;  4OZD A;  2DPJ A;  1QQ5 A;  1QV1 A;  3EKJ A;  2M7N A;  1PK1 B;  2BPG A;  2QDI A;  2XY5 A;  4DFK A;  5KT2 A;  4Y2X A;  3TDI A;  2ZKM X;  4QZD A;  4KLE A;  4O3Q A;  2H3Q A;  1SCM C;  2FLL A;  4OR9 B;  4ELU A;  2KOB A;  2K4H A;  4PHK A;  4MZL A;  2KQY A;  2KHV A;  4HAI A;  2R8G A;  2W9M A;  3N7R C;  2IA6 A;  3EYZ A;  1TWO A;  5AI8 A;  1XFV O;  2OPO A;  3CZ2 A;  5AHX A;  1T14 A;  2UVW A;  3NVV A;  2XY6 A;  2JT8 A;  4YD2 A;  4I5L B;  3N7S C;  3QNM A;  4Q43 A;  3G6Y A;  5HMM A;  2PFQ A;  4QZH A;  8ICF A;  3EUB 2;  4KX3 A;  9ICG A;  1Y1U A;  4I2J A;  5B8I B;  1N63 A;  1XO1 A;  3DV9 A;  1UHN A;  1NK9 A;  1R2U A;  2B1U A;  4M9J A;  3IVT A;  4DCK A;  2PMZ F;  2M1U A;  2I2R E;  3B86 A;  1WWV A;  1DK2 A;  4ECU A;  1IXR A;  1V85 A;  9ICH A;  5I2L A;  3SEN A;  2XO7 A;  1J97 A;  1A6S A;  2QEH A;  4YGB B;  1ZD4 A;  4ED7 A;  8ICC A;  4M47 A;  2JPT A;  2BHN A;  4I2G A;  1ZUZ A;  2PI5 A;  2BKE A;  4OJP A;  5GTI U;  3FAH A;  3V6H A;  1XS9 D;  1K94 A;  3BFB A;  4A4C A;  2BCV A;  2AGQ A;  1IKU A;  5DB9 A;  4I2A A;  5KFH A;  5ALX A;  3TAQ A;  2L4I A;  2KFZ A;  4KLM A;  2KIW A;  4ED0 A;  3MGH A;  4HSZ A;  4UAR A;  4LZG A;  1BNP A;  2WB1 F;  4J9Q A;  1QAT A;  3WKB A;  1NK4 A;  4CLN A;  2H3V A;  2OS8 B;  4IQV A;  3AAK A;  1FI5 A;  1U47 A;  3LLE A;  4Y2R A;  4MZK A;  2IOH A;  2HVH A;  1TAM A;  3ETL A;  2KP7 A;  1ZXI A;  2F76 X;  2LBO A;  1NIW A;  2BE6 A;  5DKR A;  4F5Q A;  3VC8 A;  3AN1 A;  2WOS A;  3C2K A;  1M46 A;  3SV4 A;  5B5E U;  1QQ6 A;  1YX7 A;  1IG6 A;  1FBV A;  4ETO A;  2BKH B;  3UQ0 A;  1ZQP A;  2KFH A;  4F0Z B;  1K1Q A;  2FJ6 A;  4MRY A;  4XA5 A;  4J9L A;  4PPX A;  3NHT A;  4CF3 A;  1RPL A;  3M9M B;  4DL2 A;  2ZUB A;  1RDF A;  3ALR A;  2AQ0 A;  1N0Y A;  1PAL A;  2EZX A;  5KFF A;  1L3S A;  4QWC A;  4US9 A;  1UT5 A;  2XI9 A;  4Q8F A;  5J2G A;  3GV8 B;  2AGO A;  2NCP A;  4QZE A;  2PSR A;  3ZDC A;  2BR0 A;  3HW8 A;  9ICQ A;  2JXC A;  7ICM A;  3SAF A;  1RQL A;  1J7P A;  3Q8K A;  2KQ6 A;  1KCY A;  4YVZ A;  1BNO A;  2KGR A;  1DJG A;  5KFL A;  1MF8 B;  1DGJ A;  2M0R A;  2XCA A;  2GGM A;  2LM5 A;  4O0I A;  1N61 A;  1A75 A;  2GOL A;  1ZOL A;  3BOW B;  4NXZ A;  2LKY A;  3RJK A;  2BCB A;  1RK9 A;  1L8L A;  1NCY A;  4JKT A;  8ICN A;  1Z00 A;  2JC2 A;  4F50 A;  2M1K B;  1LVH A;  9ICW A;  4LVS A;  2I94 A;  5ER5 A;  4DF4 A;  4KN7 A;  5ALL A;  1WDC C;  1KK7 Z;  1L2O C;  2K7D A;  1FO4 A;  3PZP A;  5HHH A;  2WAQ C;  4QWA A;  1D9F A;  2MLE C;  5J2J A;  2VRG A;  3WKD A;  3S0A A;  2E30 A;  1CFF A;  1NX1 A;  2V53 A;  4C4S A;  4MF2 A;  5J0O A;  5AI4 A;  4QJ4 B;  5EWE A;  4I5K A;  2I9G A;  2G0A A;  4A8E A;  3KHH A;  1KW4 A;  1YUT A;  4UAY A;  3CYZ A;  1L6N A;  2HPS A;  2RLT A;  3NAS A;  1MUX A;  1BG1 A;  1IM4 A;  3R9K A;  2L50 A;  5ALT A;  2EDU A;  5F6T A;  5JOL A;  5FI6 A;  3QUT A;  1V97 A;  5J0X A;  1TTX A;  4DSJ A;  1Q3U A;  5AM2 A;  4R64 A;  5CA7 A;  3QZ8 A;  2PFO A;  2KFF A;  2YMQ A;  3S0G A;  2WC5 A;  3VRQ A;  1WRL A;  2ZNE A;  5DB6 A;  5ALS A;  2HMX A;  1O08 A;  2K61 A;  1BPE A;  2QKQ A;  4O3S A;  3KD3 A;  3BJY A;  1L3U A;  1JRO A;  4TNC A;  4YG2 A;  5KL1 B;  1QTX A;  2EC6 B;  5KG2 A;  8ICU A;  4YMN A;  2QEV A;  5ALR A;  2H2K A;  1H4B A;  3SI8 A;  5HR7 A;  4Y2S A;  5KFR A;  2AJQ A;  1SIJ A;  1ZQQ A;  2VJ4 A;  2BKI B;  3VB1 A;  2HBJ A;  2H8V A;  2PAL A;  1B0X A;  1FIQ A;  3CZ0 A;  2W3S A;  3MFH A;  3KEV A;  1TNX A;  1N2X A;  2CXJ A;  1IIO A;  2BBN A;  3PJI A;  2D8N A;  4PDZ A;  4RQM A;  4C8M A;  2LP2 A;  3RJH A;  1CEZ A;  1Q3V A;  1AVS A;  1ZJM A;  1F54 A;  4Q45 A;  1YT3 A;  5KFJ A;  1V38 A;  4F2S A;  4I28 A;  1M39 A;  5ALU A;  8ICA A;  3PNC A;  5EE9 A;  3RH6 A;  1T3Q A;  3SS3 A;  2FDR A;  1TE2 A;  4YN4 A;  1XK4 C;  4GFJ A;  3JPQ A;  4C0J A;  4PE1 A;  4ED1 A;  3PSI A;  2BEC A;  5ALY A;  2L4H A;  3V2L A;  7ICG A; 
#chains in the Genus database with same CATH homology
 1X40 A;  3TAD C;  5J8Y C;  1V85 A;  1PK3 A;  3SEN A;  2DKX A;  2QB0 A;  3TAD A;  5J8Y A;  2DKZ A;  2E8P A;  1OXJ A;  2BNX A;  3OBV A;  3BS7 A;  4IS7 A;  2KG5 A;  4NL9 C;  1Z1V A;  5KNI A;  4NL9 A;  1DXS A;  2EAN A;  2QAR A;  4I5K A;  2F8K A;  2QB0 B;  1KW4 A;  2LPE A;  2KLD A;  5JTI A;  1DEK A;  2KSO A;  1F0M A;  2K4P A;  2YGU A;  2E8M A;  2QAR B;  1LKY A;  2D8C A;  1X9X A;  5FI2 A;  5FI6 A;  5FI7 A;  2KSO B;  4MEW A;  2JV3 A;  2EAP A;  3PM2 A;  2BAP A;  1PK1 A;  5JRT A;  1W9Z A;  1LKY B;  2QKQ A;  3UO9 A;  1Z4H A;  2KIV A;  2EAO A;  4I5N B;  1SXD A;  3SEI A;  1OW5 A;  2KLE A;  1X66 A;  3O4X A;  1RG6 A;  4PZO A;  1SV4 A;  2DL0 A;  1PK1 B;  3EG5 B;  2Y9U A;  2FE9 A;  5JU5 A;  2D3D A;  5HL1 A;  2ESE A;  1JI7 A;  4I5J A;  1SV0 C;  1WWU A;  3SS4 A;  2GLE A;  3HIL A;  4NJ8 A;  5L1M A;  1DC1 A;  1SV0 A;  3UNW A;  1B0X A;  4PZN A;  3KEV A;  2K60 A;  4KYN A;  3BS5 A;  3K1R B;  4RQM A;  4GAO A;  2B6G A;  5D3O A;  2KMD A;  4MHV A;  1DEL A;  2EAM A;  1Z2C B;  2Y9T A;  1V38 A;  1SXE A;  2ES6 A;  4I5L B;  3BS5 B;  3KKA C;  3SS5 A;  3TAC B;  2L5Y A;  2F44 A;  4RQN A;  3KKA A;  4GBA A;  2QB1 A;  1COK A;  2F3N A;  3H8M A;  3IDW A;  3SS3 A;  1UCV A;  1B4F A;  2E8O A;  1UQV A;  2E8N A;  4JKT A;  1SGG A;  5F3X B;  5I94 A;  2YTU A;  2LMR A;  3IVT A;  4IJ7 A;  1WWV A;  2KE7 A;  3BQ7 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...