2L5YA

Nmr structure of calcium-loaded stim2 ef-sam.
Total Genus 49
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
49
sequence length
150
structure length
150
Chain Sequence
GSHMASTEEDRFSLEALQTIHKQMDDDKDGGIEVEESDEFIREDMKYKDATNKHSHLHREDKHITIEDLWKRWKTSEVHNWTLEDTLQWLIEFVELPQYEKNFRDNNVKGTTLPRIAVHEPSFMISQLKISDRSHRQKLQLKALDVVLFG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Stromal interaction molecule 2
publication title Auto-inhibitory role of the EF-SAM domain of STIM proteins in store-operated calcium entry.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Signaling protein
total genus 49
structure length 150
sequence length 150
ec nomenclature
pdb deposition date 2010-11-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07647 SAM_2 SAM domain (Sterile alpha motif)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.50 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 Transcription Factor, Ets-1 2l5yA02
1.10.238.180 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 Recoverin; domain 1 2l5yA01
2KIVA 5JU5A 4NL9A 2KSOB 2JV3A 2LPEA 1LKYB 1B4FA 4RQMA 1UCVA 2E8NA 1UQVA 1WWVA 2FE9A 3TACB 5J8YC 2F8KA 1OXJA 1SXDA 2GLEA 3IDWA 2YTUA 1X40A 2DL0A 1PK1A 2KE7A 1Z1VA 1SV0C 3BS7A 2QB0B 3KKAC 1SXEA 3TADA 2D3DA 2QB1A 2KMDA 2EAMA 3BQ7A 2F44A 4NJ8A 1SV0A 5KNIA 2E8MA 1V85A 5F3XB 4PZNA 2F3NA 3H8MA 1SV4A 2DKXA 3K1RB 2ESEA 1X9XA 4MHVA 2QARA 2D8CA 2KG5A 1DXSA 5J8YA 3BS5A 1KW4A 2Y9UA 3HILA 1SGGA 2EANA 5JTIA 1WWUA 5JRTA 2KSOA 3KKAA 1RG6A 1F0MA 2Y9TA 1LKYA 2EAPA 5L1MA 1JI7A 1PK1B 4IS7A 3SEIA 2B6GA 4NL9C 2K4PA 2K60A 3SENA 1B0XA 2L5YA 2QB0A 1COKA 2QARB 2LMRA 1PK3A 2ES6A 3BS5B 4PZOA 2DKZA 2QKQA 1V38A 2E8OA 4RQNA 3TADC 2E8PA 1X66A 2EAOA 1OW5A
chains in the Genus database with same CATH superfamily
3ETLA 5JU5A 1UUSA 1IGVA 2KNJA 4QJ5B 5DDYA 4ELTA 2HOIA 3KF9A 4DFKA 3RB3A 4GXJA 2FE9A 4UAYA 2E5SA 1ZQOA 1RQLA 2G0AA 2OH2A 2KVCA 5FP0A 1B7TY 4BWJA 1ZQTA 2KQ6A 3C1VA 1B8RA 1NJYA 1Z4OA 3TDZA 5EE0A 2KJ9A 1T3NA 1SV0C 1CDPA 1X6JA 2ZUBA 5HKYA 3OB1B 3AN1A 2BBNA 3WK5A 3TADA 4N5XA 4KLFA 2HHXA 3D6JA 4QZGA 1BOCA 2W04A 4PT1A 1LVCD 3V6JA 3VC8A 2I1QA 3MFIA 1EG3A 1SV4A 5IINA 5AM4A 1RWYA 4I2BA 3BQ1A 3PSTA 1D9FA 3M9MB 4DOCA 7ICIA 3OGNA 2H3IA 1RQNA 1X6IA 8ICMA 4PALA 1ZYQA 4EBEA 4DSLA 2Y9UA 5D49A 2NXQA 3ISDA 2ZUDA 1QH9A 2WC6A 1WYGA 1V97A 3RB4A 2WB1F 1S6CA 4JWQA 1MQ2A 1FI5A 2WFAA 2HQ8A 3CTNA 1OOJA 4K4HA 4ICAA 3RH6A 1SL0A 5KTYA 2ZN8A 1X9MA 2JHDA 1S10A 2BL0C 3V7LA 1CKKA 2JULA 2R18A 1BPEA 1TK5A 8ICCA 2KLEA 1ZQQA 4R66A 3Q8QB 1KBUA 1PUZA 5CSNA 2DPJA 2H3QA 1LKJA 4I5JA 4RT2A 2VANA 2PKEA 3RTVA 2PFNA 1DK3A 4ECZA 2WC5A 4J9MA 4RQ2A 4XUSA 3RM1A 1XSLA 4F92B 2LHTA 2M9GA 3VB1A 3WNXB 5KT7A 1KQMB 2E8OA 1FIQA 1V38A 1ZQMA 3OTQA 3ONNA 4Y2XA 1MHOA 3TUYB 5B66U 4I5KA 4Q43A 2W8LA 9ICXA 1CEZA 4QZDA 1K9PA 5J0OA 3IV6A 1BODA 4YXMA 1G8IA 2VA3A 1XFWO 4N1GA 2R8JA 5HMLA 2CT9A 2BAPA 4MZKA 2RDIA 1Z3EB 3PATA 3RB6A 1ZQNA 2ERBA 8ICPA 3SAFA 2ZUCA 3ORYA 5KG6A 3JTDC 4INWA 2KFGA 1QXPA 1QASA 3M8SA 4UAWA 3T5LA 3V6KA 4TUSA 2IHMA 5FI7A 3NVWA 2G2BA 3IDWA 5KG5A 4JV1A 3SV4A 1QSLA 3FE9A 4IC9A 4CGZA 3K21A 4PDZA 4QZIA 2NO5A 4DO9A 2YGUA 3M8RA 4O3QA 2B1UA 4MRXA 1WDCB 3TAPA 3TQ1A 2W43A 2EZZA 1M39A 1NKCA 8ICHA 2LVJA 2G5HB 3DY9A 1FFUA 4QIWF 2HPSA 1YZ7A 4ED1A 2NZ0A 3VGOA 2GH1A 4DOBA 4CPVA 4UBCA 2KI4C 1ZOTB 3H4BA 2I9GA 4MHVA 2CTNA 3PFVA 3OB2B 3UXNA 3NVZA 4DL7A 5IIMA 5AEQA 2B0CA 4RZRA 1ZETA 2ASJA 1SL8A 1SR6B 2LAPA 4RQ8A 1ZRNA 1CDLA 2I5HA 9ICQA 3TI0A 5KFPA 1JWDA 3HP6A 1QLNA 1KWOC 3BUMB 3VRNA 4ZOHC 4M47A 4LJXA 3S6JA 3UMBA 2KIWA 5L1KA 4M2QA 1D1OA 9ICJA 5L1MA 1XO0A 5AKEA 3Q8IA 2C2DA 4GGFA 1PVQA 4UATA 5FYXA 2FOTA 2K4PA 2WF8A 3PSPA 3M6ZA 4RQ6A 1XS9D 1C7WA 1NPQA 2ZNEA 3D0YB 4UASA 1BT6A 4Z6FA 3SV3A 1L3SA 1SY9A 1MF8B 3AKAA 2CXJA 7ICFA 4ORAB 1NZBA 4BXOB 4YGCB 3FC4A 3K75D 1NCYA 5CPVA 4KX5A 4KTQA 2F1JA 1RDFA 1NK7A 2CCMA 3AAKA 1TAMA 1KFSA 1N62A 2JU0A 3KEVA 1QCKA 2XI9A 1NJZA 2JH7A 3FE8A 1B8LA 4GPLB 2R8HA 4AP9A 2YX8A 1K93D 3GIMA 2BGWA 3ZI4A 4YQWA 3HX0A 3PX6A 7ICNA 1S5GZ 3I5FB 2HQWA 1DT7B 3WHTB 3PX0A 3HKZC 1OOFA 1A0PA 3IF7A 4I5LB 4EEKA 1Y1UA 5DBBA 3RFAA 2DWQA 1PVPA 1UHUA 3RBEA 1O03A 1NX3A 3QMEA 2ZJ5A 3OHAA 2P70A 3S0FA 3PALA 3V6HA 4DS5A 2XGPA 7ICEA 2JT0A 5ALFA 2MA2A 5BPJA 1ZUZA 4C7YA 4ICBA 5AXIA 2ZJAA 4OD0A 3EZ5A 4YFKA 3E2EA 5J0TA 1WCNA 4B9MA 2M8UA 2KKVA 1JC2A 2JNXA 1SXEA 3D0YA 2HBJA 4DSEA 3NS1A 1A6SA 4OR9B 3S0EA 5AKJA 4KLIA 4Z6CA 4P0QB 2VIXA 2EAMA 3BQ7A 2F44A 1YVLA 1ZQXA 1NK9A 3E0FA 1S0MA 4BXOA 9ICVA 4MEYA 5F9NA 2L5XB 3B7AA 4D1EA 1VJ5A 2HF5A 4F5NA 5KFHA 1YR5A 8ICBA 4WJ3B 3T5HA 3N7SC 2MRLA 4US8A 4I2AA 2FCEA 2ZXHA 2P71A 3C2KA 4C0JA 4J9OA 3KZXA 2QLTA 1SGGA 1P28A 4F71A 4GC6A 5JRTA 2J6TA 4GGNA 1A75B 3F53A 5AM5A 4PE1A 4WRIA 3KKAA 2K8CB 7ICKA 4KLHA 3AKBA 1J7OA 1YTZC 4MRYA 3B87A 2G5IB 2H3VA 5ALIA 4ED3A 1TNWA 3EVVA 5CRXA 2JR5A 2A1JB 3NVYA 4ECSA 1SK6D 1RTP1 1YURA 1IIPA 2HVIA 1TCOB 2M7LA 3BUOB 4GFTA 3CZ2A 1Z4NA 3SMVA 2AMIA 3MSEB 7ICMA 4O0IA 4FZMA 4YCXA 4F72A 2K89A 2UVUA 1HJPA 3PMLA 3PJIA 5JJGA 3SZ2A 1NKEA 3SS4A 2ZTDA 2CPRA 4A4BA 1ZFSA 4OJ5A 2P66A 4OKHA 4P0QA 2KVSA 3RJJA 1TNXA 4IQUA 4OCIA 3V7KA 1SKRA 5KFSA 1X42A 2MLFC 1KRPA 2P6UA 3CGAA 1DEKA 1EXNA 3GIJA 4BX9C 4ECRA 4YN4A 4B9LA 1T14A 2CBLA 4RQ3A 4E0DA 2LPEA 1LKYB 3K1ZA 3RBDA 1XK4C 1CFPA 2PASA 4QW8A 1B47A 4RQMA 1YRTB 2E8NA 1ZQSA 2DPIA 1WY9A 1XFYO 2H3FA 4PE0A 2IA6A 4RUCA 1OOGA 1A75A 7ICLA 8ICLA 2VRGA 2WAQF 4L9MA 2HOFA 4M9GA 5HYDA 2OCEA 5DB8A 2KTQA 1CDMA 2A1JA 2M97A 3WHUB 3QZ7A 4UARA 5AI0A 3CR5X 1XO5A 1Y1AA 3Q8RB 3AL0B 3L4AA 9ICBA 3V72A 2KMDA 2ZIWB 1J7RA 1BPYA 5AI4A 4F4ZA 4FQOA 2EH9A 3KO0A 3D10A 1SRAA 2L0PA 2LE9B 5K4LA 2BCVA 3D78A 4USLA 1IQ3A 3SIAA 1COOA 3PN7B 4QJFB 4IL6U 3DVJA 1WRZA 2WCLA 3WKBA 1FEZA 1QS7A 3N28A 4HRGA 3D75A 9ICNA 2LVIA 3JPRA 2GO7A 8ICEA 1PZNA 2M1UA 3EW9A 2QDIA 1RYRA 1XU4A 4DCCA 2PI5A 3OJSA 1MR8A 2DF4B 2JWWA 2RQ5A 1DGSA 1ZXIA 3QUQA 3DYEA 5AKZA 1CMFA 2E3TA 3R9KA 4CRXA 4LZDA 3WK9A 1OMDA 1AHRA 3OHBA 1LKYA 1MQ3A 2EC6B 1OUQA 3EK8A 4GNKB 4MZJA 4MEXA 2JZIA 3NVVA 4GFJA 5IILA 4UQGA 3HX4A 2K7OA 4CCHA 2EHBA 2C28A 5ALRA 3BFAA 2JEJA 3SENA 1UURA 1OZOA 3K4GA 3QU9A 5BPCA 5ALHA 1N48A 1NX0A 1S76D 1EH2A 2K0JA 1ZQKA 3KFUF 3SQIA 4HYKA 4J9RA 2B21A 2PI4A 3ZWHA 4YR0A 4F2RA 1CFCA 2ZIWA 2ES6A 3R1PA 2QKQA 1NK0A 3MGVA 1LS8A 3CZ0A 2JNFA 4XJKB 1IM4A 4I2IA 1RK9A 2QEVA 2K4HA 1JBAA 3GFKB 4DOAA 4MBEA 2JEGA 4NL9A 1PVRA 1KQQA 1N65A 2GV5A 3B6XA 4KLDA 1CM4A 1U47A 1RECA 1ZD3A 5BOMA 1ZOLA 5J0PA 3PZPA 3GV7B 3CR4X 4FTGA 3NSOA 2L2EA 5AKHA 2JOJA 3D2QA 7ICRA 3NHIA 5G08A 3RH4A 3RR7A 2LUCA 2AGQA 1U4BA 5HHHA 1TAUA 4GUKA 5K89A 3D73A 2KQYA 3S0AA 1S5GY 4DUQA 4UB1A 2Y5IA 3Q8MA 4KLMA 1SKTA 2KFHA 1SPYA 2I7AA 1SCMC 2E1EA 1TV9A 1UHHA 3AQEA 2D3DA 3NSKA 2JH1A 1DJYA 2QB1A 2FJYA 2C22A 2NLNA 3LWMA 3D74A 1BG1A 3PNCA 1SKWA 3ISCA 2ZIVB 5AM0A 1M6YA 5HKZA 5TISU 5ALDA 2P6BB 2WF6A 1JFJA 2I94A 5J8YA 1YZ6A 1Z4HA 2WCFA 2L2CA 4XJKA 1NX1A 1R6PA 5AI8A 4C4TA 5KG7A 4LZGA 4QZ8A 1RYUA 1OZSA 3O4YA 1RG6A 3A0HU 1BF5A 3PW2A 3F2DA 2HMXA 1JI7A 4QWCA 4IS7A 1JXEA 2FPKA 5D7FA 3N7HA 1BNOA 1JMSA 2R2IA 5AIBA 3PSIA 2RLTA 2BCBA 5J2HA 3PW7A 1X9WA 2OM6A 3TFSA 1ZQWA 5EE9A 2M1KB 3HJEA 2JXCA 3CS1A 5ALNA 1PALA 4B9UA 4DLGA 4QWEA 2MAXA 1L7MA 5F9LA 4MVFA 2MA1A 1KDHA 1MQ1A 4PE7A 2EGDA 1EL4A 3OJUA 4MF2A 3NUQA 3THVA 4FE3A 5IIKA 4Q8FA 1KFXS 1C3YA 1PK3A 4DSKA 2PQLA 4IQWA 4DSFA 2FLLA 1MN8A 1ZQYA 3DDHA 4RQNA 2E6WA 2BQRA 5DGBA 1XFUO 3UPQA 4IJ7A 3C2LA 2XY7A 2ZIVA 3CYMA 1N60A 3F2CA 4J03A 3FDSA 2MBXA 2JV3A 2WC8A 4YR3A 9ICKA 2AAOA 2XY6A 3IHQB 4PJ0U 3ZNIA 4F2SA 3QZ8A 4KN4A 5G5GA 2NO4A 1A2XA 3N97B 1BMOA 3H40A 1K1SA 4QWBA 1MWNA 4TQSA 5AI6A 3ZD8A 1SB3C 2C2RA 3TFRA 1JF2A 4FS2A 1NK8A 2BL0B 3F45A 5ALTA 1IV8A 5J2EA 4QW9A 2K2FA 4TUQA 3T3FA 4IR9A 2HSZA 4ECTA 1ZQVA 4OJ6A 4K4GA 4BY5A 2DBYA 1LINA 2OHFA 1PSBA 2KE7A 2F1HA 1B43A 4M9HA 4Q8EA 2L51A 3WKDA 4DSJA 5J2BA 4ZCUA 1L2OC 3UO9A 3CABA 5G5HA 4AQIA 4RQ0A 4F91B 3WKCA 4AOMA 4WQ2A 1SV0A 5KNIA 2E8MA 2IS9A 4PZNA 1U49A 2Y0SC 2V9WA 2UVWA 2M9NA 4ORCB 3A8RA 3RJGA 2PMZC 3QUCA 1UHNA 2HBLA 4JB3A 5HR7A 1CM1A 1ZQHA 2JZBB 4RU9A 3QEBZ 4NDCA 1RXWA 3OX5A 4F0ZB 2SCPA 4BJQA 1QIWA 2KN7A 1A03A 2KZMA 1Z00B 2IOHA 2EANA 5JTIA 4ACOA 1XFXO 4Y2SA 4XYNA 4RPYA 1IIOA 3MGHA 5D3OA 1U48A 2JPOA 1KFUL 1NCXA 4EENA 4NXZA 3SEIA 5J0QA 2HVHA 4Y2UA 1D9DA 8ICOA 1F4QA 2KNEA 3EUB2 4I2FA 3LYSA 4Y2PA 2OS8B 1X02A 1QQ7A 5AHXA 3HPOA 5AK3A 4I28A 3B0XA 3SD7A 4UPGA 2ZRTA 4YI8A 1KCYA 2W3RA 3BDPA 3H4DA 2RGIA 5JUMA 3QYPA 1N5XA 1JX4A 3OSPA 3T5JA 4PHNA 1JSAA 5IIIA 3ETRA 3BS5B 5ALWA 4ECVA 1U45A 1QV1A 1S9FA 3M0WA 2VA8A 1OSAA 3TADC 2PFQA 4LVSA 2HHQA 1M46A 1NKBA 2EAOA 3C29A 9ICLA 1OW4A 2KJ8A 3CZTX 2LP2A 2JZBA 5GQQC 3O78A 4JKTA 3ZDDA 4CF5A 4US9A 5KFVA 2EZYA 5AKIA 1TUJA 1C3ZA 3NRZA 2KGRA 4P2HA 1Z00A 3KHGA 2M7NA 1XC9A 4R63A 3H0LB 2I6XA 1Y88A 4UB3A 4F4WA 4M2YA 1QATA 2W9BB 2F8KA 1NK5A 1SWVA 2NRWA 1ZQAA 4ECYA 4O3MA 1NK6A 5EE1A 1CUKA 1QV0A 3I5GC 1NWDA 1ALWA 4QWAA 4O5CA 1J1EA 9ICWA 5DB7A 5TZVA 4GLXA 5KT6A 1SZPA 5IIOA 7ICJA 4TURA 3DZTA 5HHIA 1RYSA 2Y1IA 2A1AA 9ICMA 5EE3A 5JOLA 8ICTA 1QQ5A 2F2AB 5J3XA 1CLBA 1S0OA 1YX8A 1X9XA 1Y1XA 2H61C 4NLBA 4F3OA 5J2IA 1DJHA 3LVVA 3BS5A 1KW4A 3MDAA 2XIDA 4B9NA 1GQMA 1TK0A 1OMRA 2Q4TA 3AU2A 4ECQA 2YMLA 2KICA 4C8KA 5KFIA 2V53A 3GV8B 1L8OA 1V1GA 1UHJA 3JPOA 3ZDCA 1T8EA 2ZFDA 3I5IC 2HW3A 3KZIU 3GIIA 1ZJMA 1Q46A 3VCBA 4P2YB 4M9LA 1AP4A 4PGXA 1IJ6A 3D2NA 1RPLA 2W9BA 4YGBB 2IOFA 5KFYA 4DFMA 1NJWA 5D69A 2YMQA 5KFGA 4DFDA 8ICYA 1A4PA 3TARA 1ZQRA 1PVBA 1JUDA 4EYHB 1BR1B 1BR4B 1S3PA 3WK8A 1V1FA 1SZHA 1ZQLA 2QARB 2K8MB 4RT3A 4O5KA 2KI6C 4IRDA 3TZ1A 3SIBA 2ZTEA 1S5LU 3SAHA 3PW0A 3ZDBA 5KG3A 3OX6A 4BGDA 3WKEA 2BCRA 3SG5A 1UHIA 1EJ3A 2KSOB 2H3ZA 4BDPA 2VJ5A 4RNOA 4A4CA 4MSPA 1U5IB 1HT9A 3QX7A 3M6KA 2BKIB 3TACB 2XGQA 1KSOA 5I2LA 1DTLA 3QU4A 1UPHA 1KQMC 5HP4A 2ZNDA 4R1EA 4B6JA 1ED1A 3IRUA 1L7OA 4NLCA 2ASDA 4JPZB 3QE9Y 1X40A 1N2DA 4FZNA 5ALLA 4DRWA 1SBJA 4PCWA 4PHPA 4TQRA 3ED5A 1C7YA 3SR6A 2KFZA 3AQFA 2EQYA 1SSEB 2BE4A 7ICGA 2O6KA 2GTEA 4GBAA 4USAA 4ELVA 1XNSA 3SG3A 1V85A 9ICRA 2OTGC 2WF7A 5TNCA 5CEHA 4WQ3A 3LVWA 5DQHA 1N2XA 3MBYA 1H8BA 4FO6A 3G6YA 4NLGA 4IR1A 2QARA 1JF0A 4UW9A 2QEOA 2KOBA 4UAVA 3C2MA 2WTFA 1CDNA 5BOLA 2LHIA 2O5GA 3HILA 2LMUA 1TOPA 1WDCC 2HHSA 2KPHA 3SG4A 4EBCA 5ALYA 1WLZA 4OCZA 3D2SA 4YBHB 1FFVA 1KL9A 2WF9A 2UVRA 1BNPA 3Q8PB 1M63B 5DQGA 1LXFC 1MC8A 3UXPA 2H5XA 2KSOA 5AK4A 2LYAA 1U5IA 4PHAA 4KYNA 1PK1B 1IXRA 2R8KA 1SCVA 5KFAA 3SS3A 5ALEA 1B0XA 4M9JA 2JQ6A 1SR6C 5KT5A 1C20A 2G9BA 1FF1A 1Q3VA 2NV3A 4YMOA 2BHNA 1T4GA 4QZFA 4UAZA 4ORBB 1D8YA 2JEFA 2KV2A 4IQTA 1IG6A 3LL8B 3F5AA 3QUTA 4MZLA 3L4LA 5J0YA 1CNPA 3KHLA 3WU2U 4PZOA 1XO1A 5ALOA 2LM1A 3OPXA 3GK4X 1J2NA 3PR5B 3L5KA 2DOQA 1ZQDA 4C0LA 1CMGA 4OO1J 4F50A 1OE9B 1BPXA 1Q8KA 3UQ2A 2JTZA 1X66A 2YB1A 3OSNA 4M0AA 3PSFA 4UB6U 4DQSA 2PYQA 3B9JA 1AVSA 1ZQZA 4F5PA 2ZXIA 1F8HA 1B22A 1DK2A 1WWVA 2WB1C 1X9SA 2FCDA 1SNLA 1HIWA 1J7PA 3CLNA 3IN5A 5KL1B 1LV5A 1QX7A 2NCPA 5HLVA 5AKKA 2GLEA 1UA0A 1PK1A 1WLMA 1B1GA 1PK0D 3V7JA 2VA2A 2BKEA 2NYVA 4FQTA 3KKAC 1A77A 8ICJA 1UA1A 5ALQA 4CFRA 3HCMA 3DD4A 1LA3A 2BCUA 3WK6A 8ICGA 2KEYA 1L3VA 5E79U 1Z1BA 1OOHA 3FM9A 3EYZA 1IJ5A 1HQVA 1NYAA 5DICA 1AQ6A 5J2AA 8ICFA 4Y2RA 5J2GA 4GC7A 4RUAA 5ALJA 4NM2A 2ESEA 5DBCA 2D8CA 2A4JA 1GGWA 3UMCA 2A3VA 3UM9A 5DGAA 3N4MB 3AEVA 3VRRA 5AFPA 1T3QA 3RH5A 4MEWA 8ICSA 2BKHB 1DC1A 5T14A 1ZD2P 2AGPA 4PGYA 5ALXA 4NWIA 3PMNA 2IHNA 1NUBA 3BQ2A 2BECA 2QPTA 5I94A 4KMUA 3MR5A 4O3PA 3I1YA 2MRDA 3CR2A 8ICIA 4EX7A 5AM1A 4Y2TA 2AH5A 8ICZA 4J9KA 2K7BA 4IL1A 3H7IA 3RJHA 1MXLC 1HUOA 3TAQA 2GOLA 4JK1A 2MAZA 1SCMB 1B9AA 5ALSA 2YQEA 2LMVA 1BU3A 2BBMA 5DDMA 2W54A 2Z7JA 3RZSA 4PHMA 3CRXA 2M0RA 4KLJA 2QACA 1UT5A 3G6XA 2MLEC 1J2MA 1Y6WA 4PL2A 4QIWC 3SYZA 1OOIX 3H8JA 2F2PA 4KN7A 3MR3A 3CWGA 3TKAA 3E58A 2XCAA 3LDAA 3V2LA 4EELA 5KFZA 1K90D 1OW5A 3ZD9A 7ICSA 2GGMA 2HETA 4XQ8A 5AKXA 5DG8A 4OJOA 4Q44A 2WCMA 2KYCA 1GGZA 5ER5A 2FJUB 3I76A 5FI6A 4EBDA 3GILA 1QLKA 2DFLA 4DF4A 4MFFA 1UQVA 2KK0A 3LK0A 9ICIA 3EKJA 2JT8A 2PALA 1F54A 4C0ZA 2IMWP 2COLB 1BLQA 3IG8A 2HHWA 2WCJA 5ALZA 5L9XA 2E30A 3UXOA 1SXDA 1DGJA 2NRTA 1ZQCA 3NGVA 1JUOA 1TNQA 4F5OA 1NSHA 3IQQA 3KTQA 3O6BA 3JPPA 1RZTA 1O08A 2VKQA 4DWIA 2G08A 4Y2YA 5HR6A 2CXYA 4C7ZA 3NHTA 2W03A 3BUNB 2KBMA 4KLQA 3EK4A 4C80A 4YGDB 3WKAA 3I28A 1Y0VH 3EPGA 4XRHA 5KSZA 2TN4A 4YR2A 4M2OA 1ZQFA 2AXTU 4KITB 4I2CA 3JVTC 1ECWA 2M29A 1DXSA 5AIAA 2BPCA 4QZ9A 3R72A 3AM9A 4GXIA 3VROA 1W9ZA 1KKXA 1WWUA 2VJ4A 4F4XA 2JEIA 2L4IA 3ZDAA 3M1YA 1MXEA 1TKDA 3SAGA 3L47A 1NZPA 3PM8A 4AYBC 1L8LA 3BOWB 4UB2A 1Z19A 1UWOA 1G4YR 1NNLA 3PN7C 4ELUA 2JTTA 4QZAA 4PHEA 4KLSA 1QVIZ 4NL9C 3S0BA 3RR8A 3A4UB 3DV9A 3OP0A 3WK4A 4DFJA 3KBBA 2ZTCA 2JC2A 4NQGA 4UB4A 1KK7Z 1ODBA 2AQ0A 1SMGA 4MFCA 1CLLA 2ZIUB 1T94A 3ALRA 4CF3A 4RQ7A 1L2OB 3BXKA 2FPLA 1RJVA 2BPFA 2KSPA 2FMPA 2EC6C 5EL2A 4RQ1A 1XWLA 3NRWA 3MDCA 2GGZA 2HHVA 3T79A 2JT3A 4I2GA 3I5HC 2WF5A 4DLEA 2BCSA 4DL2A 2V4QA 5AK6A 4ZCVA 3NSIA 3EG5B 1C07A 2FLPA 1BJFA 7ICPA 3C21A 4ECUA 1WG8A 1IG5A 5DKWA 2BCAA 1K9UA 2ATLA 1DF0B 4J9PA 3MR6A 3SS5A 1CTRA 3Q8SB 1K2HA 2KBIA 9ICPA 4OJPA 1TN4A 3GIKA 3D76A 5KFQA 5D46A 3JPQA 5J8YC 4UB5A 5HL1A 3PY8A 1AK8A 3BOWA 5AM2A 3C5GA 4P4PA 4O3RA 1CLMA 2QEBA 1YT3A 2NRXA 3CYZA 2DL0A 3TS5C 4U8DA 1KLNA 1F4OA 1Z1VA 5KAFU 2KAYA 2DQNB 2L50A 1J55A 2EDUA 3S0DA 5KFTA 4IRKA 4F5QA 2E1FA 1F55A 1L7NA 3F2BA 1QSSA 1BPBA 1JN3A 1U9LA 7ICOA 3DXLA 1IWQA 3BJHA 5ALUA 2ZIUA 5CB1A 4KLGA 4HREE 2ISOA 5KFDA 5KFBA 4OVNF 3RAQA 1ZQJA 8ICRA 4Z6DA 8ICNA 3QU5A 5J2KA 1BPDA 5CJ7A 2MSNA 1ZD4A 5C0YA 3HKZF 4P4OA 2J6UA 1H38A 1PRWA 2W7OA 1KK8C 2W7PA 2YY6A 4P4MA 2JXLA 5KTQA 1IRJA 2MJWB 4F8RA 5KFLA 1DF0A 1RXVA 2Y9TA 1L6NA 5L1IA 1NJXA 4QWDA 5J0WA 1GM0A 3KHHA 2KGBC 2RHFA 3JPNA 1F44A 2WAQC 1YUUA 4DEZA 4TUPA 4DQPA 4F7FA 2KAVA 3IP4B 2L5YA 4QZCA 4YRUA 4JWNA 4QJ3B 1UP5A 2YB4A 4GXKA 4M2PA 9ICTA 2H2KA 3GK1A 5L1JA 2LCPA 4Q04A 4R8UB 2BCQA 3JTDB 2R8IA 3HT3A 2XICA 1IKUA 9ICGA 5KFNA 4UAUA 2BDPA 2PVBA 2W55A 4GIBA 3KPXA 1L7ZA 2LM4A 2F8LA 1LVHA 1NI3A 3E3RA 2OYYA 1TWOA 4C8LA 4KLEA 4PGQA 4DCKA 2E8PA 2Y1NA 1OQPA 3DVKA 2ZRSA 1GO3F 3SJSA 1WRKA 3HW8A 1PULA 5L1LA 3OGUA 1LA0A 2G06A 4O9MA 4M6WB 1FO4A 4CFQA 3AU6A 1ZQ1C 1JRPA 3SI8A 4AQJA 5CSFA 2LLUA 2QEHA 5I8NA 3LCPC 1DMOA 3I5IB 4QJ4B 4YXJA 2F1IA 1YX7A 2KI4B 1M45A 5GTIU 1N61A 2PFPA 1YUTA 2LBOA 5I2OA 1WCLA 3GU3A 1KFUS 3DF0B 2YN4A 3OBVA 3SG2A 5B5EU 3PO4A 5KFMA 1KWOB 1TNPA 1L7PA 3PM2A 2F3NA 4FZLA 5EOZA 3T5KA 1F5SA 2C2EA 4PE4A 3BUXB 3K1EA 2DKXA 4NDBA 4YMNA 5KFXA 1QX2A 3Q8KA 3SG7A 4R8UA 2M3WA 2F2OA 3MR2A 2OXOA 5KFJA 5AI5A 2M0NA 4C4SA 5DKRA 1J1DA 2H61A 5J2DA 3BJYA 3H4SE 3BQTA 5AICA 5CWRA 3EKHA 1ZD5A 2Q0ZX 5ALKA 2Q4UA 1JXLA 5J2CA 9ICEA 2EAPA 4M6WA 1AJ5A 4HAIA 1ZACA 7ICHA 2B6GA 2ALZA 1ZQGA 2BQUA 3MC1A 3O4XA 3RLZA 2F8PA 2WCEA 2ISDA 1ZMZA 4K4IA 1M31A 1JROA 3B86A 5HMMA 5DBAA 2I2RE 2HBMA 1ORGA 4DQRA 4PPXA 9ICUA 4DSIA 3DF0A 4EYIB 2OTGB 5DG7A 1T7PA 5F6TA 1TFRA 2PSRA 2ASLA 2JRFA 5CSIA 1QVIY 3BFBA 5IBWA 3UMGA 3RF9A 2W8KA 3MFHA 4X5VA 2OEHA 5ALVA 2OS8C 5DQIA 3ZDEA 3NSLA 1KK7Y 3B88A 2LVKA 4ED6A 5KL8B 1BVSA 2FDRA 2KIVA 2IBKA 7ICVA 1DELA 5AKLA 2ODGA 1B4FA 2KJ5A 2MU2A 5KG2A 3AUOA 2RRDA 3RRHA 4MF8A 5DLFA 5KFEA 1TAQA 3QRXA 4C4RA 1ZQUA 4DS4A 5ALPA 2XCPA 4EZ9A 4I29A 3OHMB 2YTUA 1DGVA 1URJA 1GJYA 4ED0A 1K9KA 2ISPA 1V9PA 1SIJA 4I2HA 4G3IA 5C5JA 2WCHA 1TRFA 1XVJA 3BS7A 1L3TA 4O3OA 2KYFA 2M49B 4C8OA 2K4EA 1S97A 3Q8LA 3BQ0A 4NJ8A 3NTUA 1XYDA 1XSPA 2LC5A 4JWMA 4B9TA 2OPOA 5KFUA 5KG0A 4RPXA 7ICTA 2K61A 2YMMA 5ALMA 2AJQA 3DVEA 3EVUA 2LLTA 2FMSA 4QZBA 2JRZA 1ZQEA 1QX5B 2F3YA 4OZDA 4M9NA 3TUYC 3C5FA 4JV0A 1NP8A 4TNCA 2V4RA 1L5UA 4CNQA 1S6IA 1K96A 4JV2A 1A76A 7ICQA 3WXAA 2KD1A 8ICVA 1W7JB 1G33A 4GGFC 2UVVA 3G6VA 1F0MA 4KLOA 1D8BA 9ICSA 1S8OA 2BCXA 3CDNA 2AHOB 4I2JA 3GDXA 3C23A 3PR4A 2AUCA 3H8WA 1TTXA 1XFRA 4NDDA 5FI2A 1ZRMA 4AYBF 2PXIA 4I5NB 1DRGA 3NASA 4HRHA 5CHGA 5CA7A 2LHLA 2LKYA 4KLUA 2FI1A 1QQ6A 4NLZA 2HDOA 7ICUA 3RJFA 1Q80A 1ZQBA 5AKGA 3ICBA 3LWLA 2NRVA 4QNLA 3IM1A 5HKWA 5AERA 4RQ4A 4E68A 4Y2QA 5ALGA 4YP3A 2D8NA 1QLSA 4F4KA 2CNPA 2BQ3A 4PL1A 1C7VA 2KOTA 2RP5A 4CE6A 3C1YA 4UBBA 4J9SA 1NX2A 4FBUA 1OMVA 5AK5A 4JD9A 4RQ5A 4U7CA 3FS7A 5CSJA 3ICXA 1N5WA 3O0FA 1S36A 1MSWD 3KD3A 3IG5A 3BYAA 1XFZO 4MFAA 2DGZA 2K8AA 3RRGA 2HHTA 1DJIA 1VRKA 2KHVA 1NIWA 4JUZA 4M04A 1P7DA 5J2FA 4NY8A 2YMPA 2IOFK 4JMUA 3KHRA 4ED2A 3N7PD 2MUTB 1SL1A 3RAXA 3RJEA 5DG9A 2LMTA 4IQVA 9ICAA 3PVXA 1PSRA 3LK1A 3BUWB 2LLSA 2WCBA 1BGXT 1TCFA 5J29A 4N1FA 1XK4A 4B9VA 1MUXA 1W7IB 5J2JA 3JPTA 2HBKA 5J0SA 2W11A 4C8MA 4C0KA 3H8SA 3EPIA 4NLKA 2LV7A 3I5FC 5KFRA 4R65A 2KDHA 1B4CA 3N7RC 2HOQA 3AAJA 4UB8U 1CB1A 2KAXA 1SWWA 3J81j 3TANA 1SL9A 1YRUB 2XY5A 4DL3A 1CI4A 2LI6A 3RJKA 4DL5A 1H4BA 1ZQIA 9ICCA 1S0NA 4DL6A 4YGAA 4R64A 2W9CB 3A0BU 3BZCA 2CRXA 2DUYA 3L3FX 1EXRA 4G9BA 2WORA 3DVMA 1ZQPA 2KI6D 1SL2A 2HI0A 3QU7A 1E8AA 4ETOA 3FE6A 4NV0A 2LYHA 8ICQA 3QU2A 3BZKA 1B8CA 2A19A 1SW8A 3IQOA 4BY4A 2KKPA 2F33A 2JXJA 2R8GA 4I2DA 4Z6EA 2Y0SF 3L4PA 4J9LA 5ER4X 1KN5A 2PMZF 2MUTA 2ZJ8A 1Q3UA 4YMMA 3VRPA 1SYMA 9ICHA 2BPGA 4XA5A 1B7TZ 1DJZA 2LYBA 3TDIA 8ICKA 2WCKA 1YUSA 2WNDA 1S1EA 1KEJA 3JVTB 3KHEA 5DB9A 2I18A 1K5OA 4INXA 4EZ6A 4KLLA 2HHUA 1X2IA 4GAOA 2F76X 1WRLA 3GQCA 2NCOA 2P35A 3R1OA 1HEKA 4YVZA 2LNKA 5D4BA 1UCVA 4PHDA 2AU0A 4CF4A 8ICWA 1JFKA 1SL7A 2O60A 4OJLA 2ZKMX 1QSYA 3D77A 3FWBA 2JPTA 2L98A 5KT4A 3FIAA 2Y4QA 1DVIA 1XSNA 2WOSA 5KFFA 8ICAA 2PFOA 1OXJA 1S26D 5IIJA 1TE2A 3GK2A 2FMQA 4P0PB 2K8BB 5J0UA 5I2QA 5KT2A 2W9CA 2LUXA 2SASA 4JQ0D 8ICXA 1CFFA 1S77D 2KHNA 3BFHA 3FWCA 1Z2CB 1AROP 2FPMA 2KLDA 3CP8A 4QZHA 2BNXA 1RM6C 1KQVA 5KFCA 1TK8A 2AQ4A 2JMGA 1S6JA 2LM5A 1K94A 2PRUA 3PLFB 3EK7A 3I5HB 3B0YA 5DKNA 4O3NA 1L3UA 5KFKA 1LB2B 2WHEA 2KG5A 2BZFA 4B9SA 5KT3A 3MGIA 1NK4A 3NGDA 4NLNA 4ECXA 1UHKA 4CDGA 2FLNA 3IVTA 4MLWA 2P6RA 1JIHA 1J97A 1K1QA 2EZXA 4U6PA 3QEAZ 1ALVA 3CZ1A 5EWGA 1XFVO 3FYHA 4KX3A 4C8NA 4YGEB 4CLNA 5KU1A 5J0XA 2LANA 4ED8A 2GWSA 4DF8A 3LLEA 4KMOB 2F3ZA 5DKQA 1DOQA 1VDVA 3ISBA 1JALA 2FJ6A 3HRDD 1CRXA 5A0LA 1WUDA 2G07A 4P5OE 1F70A 3H0MB 1N63A 5DLGA 3UNWA 3GOFA 3TS5B 2ZIXB 4FS1A 2Y1JA 2XVTA 2KFFA 2OWOA 4ECWA 1R2UA 3PX4A 2KZZA 3BQ3A 4P0PA 4QZEA 4O5EA 1ZJNA 2W9MA 2Y1MA 1FW4A 2W3SA 1SKSA 4CIDA 1K8UA 3QXGA 3F5EA 3H0RB 3DEEA 5AM3A 2DKZA 2BE6A 2K7DA 2CN1A 1DJGA 1QWVA 2PMYA 1EG4A 1TIZA 4RNNA 4ED7A 5CR0A 2Q91A 4DL4A 5KFWA 2BR0A 2N1RA 2KP7A 1FI6A 1VLBA 5CP2A 2W9AA 2RDJA 3WK7A 3GV5B 4F5RA 2HCFA 1KK8B 1KFDA 2K7CA 1J7QA 3CW2C 3QNMA 4BWMA 4RNMA 9ICOA 5J0RA 3EVRA 1N56A 4J9NA 4YI9A 1TUZA 2LP3A 4F93B 1QJTA 1XA5A 1KFXL 1K95A 4EX6A 1FPWA 2QB0B 5KG1A 3U26A 5EWFA 3SG6A 2F77X 5AI9A 2ZIXA 4DQQA 5B8IB 2BDUA 1QIVA 2AGOA 4NM1A 5F3XB 4Y2JA 3H8MA 3EWAA 4Y2VA 5HLOA 4RPZA 5DB6A 1YVHA 3HWTA 2ZN9A 3MABA 4J9QA 2D6FC 3K1RB 5HNKA 2ZG6A 3M9OB 1NOMA 1KSMA 4YD1A 1AJ4A 3QUBA 5EWEA 2MHHA 1DJXA 5KFOA 3O2PA 1FBVA 4PHJA 3PO5A 4YD2A 5GTHU 2KZ3A 1DQEA 2L4HA 3GZFA 4FBTA 2JGAA 2NRZA 4PH5A 4Q45A 4HSZA 2KHQA 3R1VA 3PV8A 3M9NB 4IRCA 2K2AA 5H2FU 4BUGA 4DQIA 1DGUA 3UQ0A 4A8EA 4I27A 4I2EA 3LK9A 1KFTA 1KTQA 3M7DA 2J6SA 1KSPA 4FFDA 3AMZA 5AKYA 2G09A 3PW4A 1QTXA 3NXAA 2K60A 4MN0A 5PALA 1S0VA 3C28A 1N0YA 4ZH4A 5KG4A 3S0GA 2XC9A 1DJWA 4YG2A 4EEYA 1AUIB 4KLTA 1TVAA 5AANA 4DIRA 1RFJA 1F71A 1CFDA 1QTMA 4OV2A 3PW5A 3JPSA 2QB0A 3PSRA 1COKA 1A29A 4DS7A 3RB0A 2K4IA 2H8VA 2LMRA 4O3SA 8ICUA 1IH0A 3VRQA 1PVAA 3CNHA 4DFPA 3FAHA 3RJIA 3C1ZA 1BPZA 2XO7A 4PHKA 1NCZA 1UT8A 1RROA 2LVVA 5KAIU 3TDUA 1MA7A 4F4YA 1D8LA 3I5GB 3KOOA 9ICFA 1IQ5A 2KFNA 1HUZA
chains in the Genus database with same CATH topology
2KIVA 5JU5A 4GAOA 4NL9A 2KSOB 1DELA 2JV3A 4JKTA 2LPEA 1LKYB 3SS5A 1B4FA 5FI6A 4I5LB 2BAPA 4RQMA 1UCVA 2E8NA 1UQVA 1WWVA 2FE9A 3TACB 5J8YC 5HL1A 5FI7A 2F8KA 1OXJA 1SXDA 2GLEA 3IDWA 2YTUA 1X40A 2DL0A 1PK1A 2KE7A 1Z1VA 1SV0C 2YGUA 3BS7A 2QB0B 3KKAC 3OBVA 1SXEA 3TADA 3UO9A 1Z2CB 2D3DA 2QB1A 2KMDA 2KLDA 2EAMA 3BQ7A 2F44A 4NJ8A 1SV0A 2BNXA 4GBAA 5KNIA 2E8MA 1V85A 5F3XB 3PM2A 4PZNA 2F3NA 3H8MA 1SV4A 2DKXA 3K1RB 2ESEA 1X9XA 4MHVA 2QARA 2D8CA 2KG5A 1DXSA 5J8YA 3BS5A 1KW4A 2Y9UA 1Z4HA 3HILA 1W9ZA 3IVTA 1SGGA 2EANA 5JTIA 4MEWA 1WWUA 5JRTA 1DC1A 2KSOA 5D3OA 3KKAA 1RG6A 1F0MA 2Y9TA 1LKYA 2EAPA 4KYNA 5L1MA 1JI7A 1PK1B 4IS7A 3SEIA 2B6GA 5I94A 4NL9C 3O4XA 2K4PA 2K60A 3SS3A 3UNWA 3SENA 1B0XA 2KLEA 5FI2A 2L5YA 4I5NB 4I5JA 2QB0A 3SS4A 1COKA 2QARB 2LMRA 1PK3A 2ES6A 3BS5B 4PZOA 3KEVA 2DKZA 2QKQA 1V38A 2E8OA 4RQNA 3TADC 4IJ7A 1DEKA 3EG5B 2E8PA 4I5KA 1X66A 2EAOA 1OW5A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2KIV A;  5JU5 A;  4NL9 A;  2KSO B;  2JV3 A;  2LPE A;  1LKY B;  1B4F A;  4RQM A;  1UCV A;  2E8N A;  1UQV A;  1WWV A;  2FE9 A;  3TAC B;  5J8Y C;  2F8K A;  1OXJ A;  1SXD A;  2GLE A;  3IDW A;  2YTU A;  1X40 A;  2DL0 A;  1PK1 A;  2KE7 A;  1Z1V A;  1SV0 C;  3BS7 A;  2QB0 B;  3KKA C;  1SXE A;  3TAD A;  2D3D A;  2QB1 A;  2KMD A;  2EAM A;  3BQ7 A;  2F44 A;  4NJ8 A;  1SV0 A;  5KNI A;  2E8M A;  1V85 A;  5F3X B;  4PZN A;  2F3N A;  3H8M A;  1SV4 A;  2DKX A;  3K1R B;  2ESE A;  1X9X A;  4MHV A;  2QAR A;  2D8C A;  2KG5 A;  1DXS A;  5J8Y A;  3BS5 A;  1KW4 A;  2Y9U A;  3HIL A;  1SGG A;  2EAN A;  5JTI A;  1WWU A;  5JRT A;  2KSO A;  3KKA A;  1RG6 A;  1F0M A;  2Y9T A;  1LKY A;  2EAP A;  5L1M A;  1JI7 A;  1PK1 B;  4IS7 A;  3SEI A;  2B6G A;  4NL9 C;  2K4P A;  2K60 A;  3SEN A;  1B0X A;  2L5Y A;  2QB0 A;  1COK A;  2QAR B;  2LMR A;  1PK3 A;  2ES6 A;  3BS5 B;  4PZO A;  2DKZ A;  2QKQ A;  1V38 A;  2E8O A;  4RQN A;  3TAD C;  2E8P A;  1X66 A;  2EAO A;  1OW5 A; 
#chains in the Genus database with same CATH topology
 3ETL A;  5JU5 A;  1UUS A;  1IGV A;  2KNJ A;  4QJ5 B;  5DDY A;  4ELT A;  2HOI A;  3KF9 A;  4DFK A;  3RB3 A;  4GXJ A;  2FE9 A;  4UAY A;  2E5S A;  1ZQO A;  1RQL A;  2G0A A;  2OH2 A;  2KVC A;  5FP0 A;  1B7T Y;  4BWJ A;  1ZQT A;  2KQ6 A;  3C1V A;  1B8R A;  1NJY A;  1Z4O A;  3TDZ A;  5EE0 A;  2KJ9 A;  1T3N A;  1SV0 C;  1CDP A;  1X6J A;  2ZUB A;  5HKY A;  3OB1 B;  3AN1 A;  2BBN A;  3WK5 A;  3TAD A;  4N5X A;  4KLF A;  2HHX A;  3D6J A;  4QZG A;  1BOC A;  2W04 A;  4PT1 A;  1LVC D;  3V6J A;  3VC8 A;  2I1Q A;  3MFI A;  1EG3 A;  1SV4 A;  5IIN A;  5AM4 A;  1RWY A;  4I2B A;  3BQ1 A;  3PST A;  1D9F A;  3M9M B;  4DOC A;  7ICI A;  3OGN A;  2H3I A;  1RQN A;  1X6I A;  8ICM A;  4PAL A;  1ZYQ A;  4EBE A;  4DSL A;  2Y9U A;  5D49 A;  2NXQ A;  3ISD A;  2ZUD A;  1QH9 A;  2WC6 A;  1WYG A;  1V97 A;  3RB4 A;  2WB1 F;  1S6C A;  4JWQ A;  1MQ2 A;  1FI5 A;  2WFA A;  2HQ8 A;  3CTN A;  1OOJ A;  4K4H A;  4ICA A;  3RH6 A;  1SL0 A;  5KTY A;  2ZN8 A;  1X9M A;  2JHD A;  1S10 A;  2BL0 C;  3V7L A;  1CKK A;  2JUL A;  2R18 A;  1BPE A;  1TK5 A;  8ICC A;  2KLE A;  1ZQQ A;  4R66 A;  3Q8Q B;  1KBU A;  1PUZ A;  5CSN A;  2DPJ A;  2H3Q A;  1LKJ A;  4I5J A;  4RT2 A;  2VAN A;  2PKE A;  3RTV A;  2PFN A;  1DK3 A;  4ECZ A;  2WC5 A;  4J9M A;  4RQ2 A;  4XUS A;  3RM1 A;  1XSL A;  4F92 B;  2LHT A;  2M9G A;  3VB1 A;  3WNX B;  5KT7 A;  1KQM B;  2E8O A;  1FIQ A;  1V38 A;  1ZQM A;  3OTQ A;  3ONN A;  4Y2X A;  1MHO A;  3TUY B;  5B66 U;  4I5K A;  4Q43 A;  2W8L A;  9ICX A;  1CEZ A;  4QZD A;  1K9P A;  5J0O A;  3IV6 A;  1BOD A;  4YXM A;  1G8I A;  2VA3 A;  1XFW O;  4N1G A;  2R8J A;  5HML A;  2CT9 A;  2BAP A;  4MZK A;  2RDI A;  1Z3E B;  3PAT A;  3RB6 A;  1ZQN A;  2ERB A;  8ICP A;  3SAF A;  2ZUC A;  3ORY A;  5KG6 A;  3JTD C;  4INW A;  2KFG A;  1QXP A;  1QAS A;  3M8S A;  4UAW A;  3T5L A;  3V6K A;  4TUS A;  2IHM A;  5FI7 A;  3NVW A;  2G2B A;  3IDW A;  5KG5 A;  4JV1 A;  3SV4 A;  1QSL A;  3FE9 A;  4IC9 A;  4CGZ A;  3K21 A;  4PDZ A;  4QZI A;  2NO5 A;  4DO9 A;  2YGU A;  3M8R A;  4O3Q A;  2B1U A;  4MRX A;  1WDC B;  3TAP A;  3TQ1 A;  2W43 A;  2EZZ A;  1M39 A;  1NKC A;  8ICH A;  2LVJ A;  2G5H B;  3DY9 A;  1FFU A;  4QIW F;  2HPS A;  1YZ7 A;  4ED1 A;  2NZ0 A;  3VGO A;  2GH1 A;  4DOB A;  4CPV A;  4UBC A;  2KI4 C;  1ZOT B;  3H4B A;  2I9G A;  4MHV A;  2CTN A;  3PFV A;  3OB2 B;  3UXN A;  3NVZ A;  4DL7 A;  5IIM A;  5AEQ A;  2B0C A;  4RZR A;  1ZET A;  2ASJ A;  1SL8 A;  1SR6 B;  2LAP A;  4RQ8 A;  1ZRN A;  1CDL A;  2I5H A;  9ICQ A;  3TI0 A;  5KFP A;  1JWD A;  3HP6 A;  1QLN A;  1KWO C;  3BUM B;  3VRN A;  4ZOH C;  4M47 A;  4LJX A;  3S6J A;  3UMB A;  2KIW A;  5L1K A;  4M2Q A;  1D1O A;  9ICJ A;  5L1M A;  1XO0 A;  5AKE A;  3Q8I A;  2C2D A;  4GGF A;  1PVQ A;  4UAT A;  5FYX A;  2FOT A;  2K4P A;  2WF8 A;  3PSP A;  3M6Z A;  4RQ6 A;  1XS9 D;  1C7W A;  1NPQ A;  2ZNE A;  3D0Y B;  4UAS A;  1BT6 A;  4Z6F A;  3SV3 A;  1L3S A;  1SY9 A;  1MF8 B;  3AKA A;  2CXJ A;  7ICF A;  4ORA B;  1NZB A;  4BXO B;  4YGC B;  3FC4 A;  3K75 D;  1NCY A;  5CPV A;  4KX5 A;  4KTQ A;  2F1J A;  1RDF A;  1NK7 A;  2CCM A;  3AAK A;  1TAM A;  1KFS A;  1N62 A;  2JU0 A;  3KEV A;  1QCK A;  2XI9 A;  1NJZ A;  2JH7 A;  3FE8 A;  1B8L A;  4GPL B;  2R8H A;  4AP9 A;  2YX8 A;  1K93 D;  3GIM A;  2BGW A;  3ZI4 A;  4YQW A;  3HX0 A;  3PX6 A;  7ICN A;  1S5G Z;  3I5F B;  2HQW A;  1DT7 B;  3WHT B;  3PX0 A;  3HKZ C;  1OOF A;  1A0P A;  3IF7 A;  4I5L B;  4EEK A;  1Y1U A;  5DBB A;  3RFA A;  2DWQ A;  1PVP A;  1UHU A;  3RBE A;  1O03 A;  1NX3 A;  3QME A;  2ZJ5 A;  3OHA A;  2P70 A;  3S0F A;  3PAL A;  3V6H A;  4DS5 A;  2XGP A;  7ICE A;  2JT0 A;  5ALF A;  2MA2 A;  5BPJ A;  1ZUZ A;  4C7Y A;  4ICB A;  5AXI A;  2ZJA A;  4OD0 A;  3EZ5 A;  4YFK A;  3E2E A;  5J0T A;  1WCN A;  4B9M A;  2M8U A;  2KKV A;  1JC2 A;  2JNX A;  1SXE A;  3D0Y A;  2HBJ A;  4DSE A;  3NS1 A;  1A6S A;  4OR9 B;  3S0E A;  5AKJ A;  4KLI A;  4Z6C A;  4P0Q B;  2VIX A;  2EAM A;  3BQ7 A;  2F44 A;  1YVL A;  1ZQX A;  1NK9 A;  3E0F A;  1S0M A;  4BXO A;  9ICV A;  4MEY A;  5F9N A;  2L5X B;  3B7A A;  4D1E A;  1VJ5 A;  2HF5 A;  4F5N A;  5KFH A;  1YR5 A;  8ICB A;  4WJ3 B;  3T5H A;  3N7S C;  2MRL A;  4US8 A;  4I2A A;  2FCE A;  2ZXH A;  2P71 A;  3C2K A;  4C0J A;  4J9O A;  3KZX A;  2QLT A;  1SGG A;  1P28 A;  4F71 A;  4GC6 A;  5JRT A;  2J6T A;  4GGN A;  1A75 B;  3F53 A;  5AM5 A;  4PE1 A;  4WRI A;  3KKA A;  2K8C B;  7ICK A;  4KLH A;  3AKB A;  1J7O A;  1YTZ C;  4MRY A;  3B87 A;  2G5I B;  2H3V A;  5ALI A;  4ED3 A;  1TNW A;  3EVV A;  5CRX A;  2JR5 A;  2A1J B;  3NVY A;  4ECS A;  1SK6 D;  1RTP 1;  1YUR A;  1IIP A;  2HVI A;  1TCO B;  2M7L A;  3BUO B;  4GFT A;  3CZ2 A;  1Z4N A;  3SMV A;  2AMI A;  3MSE B;  7ICM A;  4O0I A;  4FZM A;  4YCX A;  4F72 A;  2K89 A;  2UVU A;  1HJP A;  3PML A;  3PJI A;  5JJG A;  3SZ2 A;  1NKE A;  3SS4 A;  2ZTD A;  2CPR A;  4A4B A;  1ZFS A;  4OJ5 A;  2P66 A;  4OKH A;  4P0Q A;  2KVS A;  3RJJ A;  1TNX A;  4IQU A;  4OCI A;  3V7K A;  1SKR A;  5KFS A;  1X42 A;  2MLF C;  1KRP A;  2P6U A;  3CGA A;  1DEK A;  1EXN A;  3GIJ A;  4BX9 C;  4ECR A;  4YN4 A;  4B9L A;  1T14 A;  2CBL A;  4RQ3 A;  4E0D A;  2LPE A;  1LKY B;  3K1Z A;  3RBD A;  1XK4 C;  1CFP A;  2PAS A;  4QW8 A;  1B47 A;  4RQM A;  1YRT B;  2E8N A;  1ZQS A;  2DPI A;  1WY9 A;  1XFY O;  2H3F A;  4PE0 A;  2IA6 A;  4RUC A;  1OOG A;  1A75 A;  7ICL A;  8ICL A;  2VRG A;  2WAQ F;  4L9M A;  2HOF A;  4M9G A;  5HYD A;  2OCE A;  5DB8 A;  2KTQ A;  1CDM A;  2A1J A;  2M97 A;  3WHU B;  3QZ7 A;  4UAR A;  5AI0 A;  3CR5 X;  1XO5 A;  1Y1A A;  3Q8R B;  3AL0 B;  3L4A A;  9ICB A;  3V72 A;  2KMD A;  2ZIW B;  1J7R A;  1BPY A;  5AI4 A;  4F4Z A;  4FQO A;  2EH9 A;  3KO0 A;  3D10 A;  1SRA A;  2L0P A;  2LE9 B;  5K4L A;  2BCV A;  3D78 A;  4USL A;  1IQ3 A;  3SIA A;  1COO A;  3PN7 B;  4QJF B;  4IL6 U;  3DVJ A;  1WRZ A;  2WCL A;  3WKB A;  1FEZ A;  1QS7 A;  3N28 A;  4HRG A;  3D75 A;  9ICN A;  2LVI A;  3JPR A;  2GO7 A;  8ICE A;  1PZN A;  2M1U A;  3EW9 A;  2QDI A;  1RYR A;  1XU4 A;  4DCC A;  2PI5 A;  3OJS A;  1MR8 A;  2DF4 B;  2JWW A;  2RQ5 A;  1DGS A;  1ZXI A;  3QUQ A;  3DYE A;  5AKZ A;  1CMF A;  2E3T A;  3R9K A;  4CRX A;  4LZD A;  3WK9 A;  1OMD A;  1AHR A;  3OHB A;  1LKY A;  1MQ3 A;  2EC6 B;  1OUQ A;  3EK8 A;  4GNK B;  4MZJ A;  4MEX A;  2JZI A;  3NVV A;  4GFJ A;  5IIL A;  4UQG A;  3HX4 A;  2K7O A;  4CCH A;  2EHB A;  2C28 A;  5ALR A;  3BFA A;  2JEJ A;  3SEN A;  1UUR A;  1OZO A;  3K4G A;  3QU9 A;  5BPC A;  5ALH A;  1N48 A;  1NX0 A;  1S76 D;  1EH2 A;  2K0J A;  1ZQK A;  3KFU F;  3SQI A;  4HYK A;  4J9R A;  2B21 A;  2PI4 A;  3ZWH A;  4YR0 A;  4F2R A;  1CFC A;  2ZIW A;  2ES6 A;  3R1P A;  2QKQ A;  1NK0 A;  3MGV A;  1LS8 A;  3CZ0 A;  2JNF A;  4XJK B;  1IM4 A;  4I2I A;  1RK9 A;  2QEV A;  2K4H A;  1JBA A;  3GFK B;  4DOA A;  4MBE A;  2JEG A;  4NL9 A;  1PVR A;  1KQQ A;  1N65 A;  2GV5 A;  3B6X A;  4KLD A;  1CM4 A;  1U47 A;  1REC A;  1ZD3 A;  5BOM A;  1ZOL A;  5J0P A;  3PZP A;  3GV7 B;  3CR4 X;  4FTG A;  3NSO A;  2L2E A;  5AKH A;  2JOJ A;  3D2Q A;  7ICR A;  3NHI A;  5G08 A;  3RH4 A;  3RR7 A;  2LUC A;  2AGQ A;  1U4B A;  5HHH A;  1TAU A;  4GUK A;  5K89 A;  3D73 A;  2KQY A;  3S0A A;  1S5G Y;  4DUQ A;  4UB1 A;  2Y5I A;  3Q8M A;  4KLM A;  1SKT A;  2KFH A;  1SPY A;  2I7A A;  1SCM C;  2E1E A;  1TV9 A;  1UHH A;  3AQE A;  2D3D A;  3NSK A;  2JH1 A;  1DJY A;  2QB1 A;  2FJY A;  2C22 A;  2NLN A;  3LWM A;  3D74 A;  1BG1 A;  3PNC A;  1SKW A;  3ISC A;  2ZIV B;  5AM0 A;  1M6Y A;  5HKZ A;  5TIS U;  5ALD A;  2P6B B;  2WF6 A;  1JFJ A;  2I94 A;  5J8Y A;  1YZ6 A;  1Z4H A;  2WCF A;  2L2C A;  4XJK A;  1NX1 A;  1R6P A;  5AI8 A;  4C4T A;  5KG7 A;  4LZG A;  4QZ8 A;  1RYU A;  1OZS A;  3O4Y A;  1RG6 A;  3A0H U;  1BF5 A;  3PW2 A;  3F2D A;  2HMX A;  1JI7 A;  4QWC A;  4IS7 A;  1JXE A;  2FPK A;  5D7F A;  3N7H A;  1BNO A;  1JMS A;  2R2I A;  5AIB A;  3PSI A;  2RLT A;  2BCB A;  5J2H A;  3PW7 A;  1X9W A;  2OM6 A;  3TFS A;  1ZQW A;  5EE9 A;  2M1K B;  3HJE A;  2JXC A;  3CS1 A;  5ALN A;  1PAL A;  4B9U A;  4DLG A;  4QWE A;  2MAX A;  1L7M A;  5F9L A;  4MVF A;  2MA1 A;  1KDH A;  1MQ1 A;  4PE7 A;  2EGD A;  1EL4 A;  3OJU A;  4MF2 A;  3NUQ A;  3THV A;  4FE3 A;  5IIK A;  4Q8F A;  1KFX S;  1C3Y A;  1PK3 A;  4DSK A;  2PQL A;  4IQW A;  4DSF A;  2FLL A;  1MN8 A;  1ZQY A;  3DDH A;  4RQN A;  2E6W A;  2BQR A;  5DGB A;  1XFU O;  3UPQ A;  4IJ7 A;  3C2L A;  2XY7 A;  2ZIV A;  3CYM A;  1N60 A;  3F2C A;  4J03 A;  3FDS A;  2MBX A;  2JV3 A;  2WC8 A;  4YR3 A;  9ICK A;  2AAO A;  2XY6 A;  3IHQ B;  4PJ0 U;  3ZNI A;  4F2S A;  3QZ8 A;  4KN4 A;  5G5G A;  2NO4 A;  1A2X A;  3N97 B;  1BMO A;  3H40 A;  1K1S A;  4QWB A;  1MWN A;  4TQS A;  5AI6 A;  3ZD8 A;  1SB3 C;  2C2R A;  3TFR A;  1JF2 A;  4FS2 A;  1NK8 A;  2BL0 B;  3F45 A;  5ALT A;  1IV8 A;  5J2E A;  4QW9 A;  2K2F A;  4TUQ A;  3T3F A;  4IR9 A;  2HSZ A;  4ECT A;  1ZQV A;  4OJ6 A;  4K4G A;  4BY5 A;  2DBY A;  1LIN A;  2OHF A;  1PSB A;  2KE7 A;  2F1H A;  1B43 A;  4M9H A;  4Q8E A;  2L51 A;  3WKD A;  4DSJ A;  5J2B A;  4ZCU A;  1L2O C;  3UO9 A;  3CAB A;  5G5H A;  4AQI A;  4RQ0 A;  4F91 B;  3WKC A;  4AOM A;  4WQ2 A;  1SV0 A;  5KNI A;  2E8M A;  2IS9 A;  4PZN A;  1U49 A;  2Y0S C;  2V9W A;  2UVW A;  2M9N A;  4ORC B;  3A8R A;  3RJG A;  2PMZ C;  3QUC A;  1UHN A;  2HBL A;  4JB3 A;  5HR7 A;  1CM1 A;  1ZQH A;  2JZB B;  4RU9 A;  3QEB Z;  4NDC A;  1RXW A;  3OX5 A;  4F0Z B;  2SCP A;  4BJQ A;  1QIW A;  2KN7 A;  1A03 A;  2KZM A;  1Z00 B;  2IOH A;  2EAN A;  5JTI A;  4ACO A;  1XFX O;  4Y2S A;  4XYN A;  4RPY A;  1IIO A;  3MGH A;  5D3O A;  1U48 A;  2JPO A;  1KFU L;  1NCX A;  4EEN A;  4NXZ A;  3SEI A;  5J0Q A;  2HVH A;  4Y2U A;  1D9D A;  8ICO A;  1F4Q A;  2KNE A;  3EUB 2;  4I2F A;  3LYS A;  4Y2P A;  2OS8 B;  1X02 A;  1QQ7 A;  5AHX A;  3HPO A;  5AK3 A;  4I28 A;  3B0X A;  3SD7 A;  4UPG A;  2ZRT A;  4YI8 A;  1KCY A;  2W3R A;  3BDP A;  3H4D A;  2RGI A;  5JUM A;  3QYP A;  1N5X A;  1JX4 A;  3OSP A;  3T5J A;  4PHN A;  1JSA A;  5III A;  3ETR A;  3BS5 B;  5ALW A;  4ECV A;  1U45 A;  1QV1 A;  1S9F A;  3M0W A;  2VA8 A;  1OSA A;  3TAD C;  2PFQ A;  4LVS A;  2HHQ A;  1M46 A;  1NKB A;  2EAO A;  3C29 A;  9ICL A;  1OW4 A;  2KJ8 A;  3CZT X;  2LP2 A;  2JZB A;  5GQQ C;  3O78 A;  4JKT A;  3ZDD A;  4CF5 A;  4US9 A;  5KFV A;  2EZY A;  5AKI A;  1TUJ A;  1C3Z A;  3NRZ A;  2KGR A;  4P2H A;  1Z00 A;  3KHG A;  2M7N A;  1XC9 A;  4R63 A;  3H0L B;  2I6X A;  1Y88 A;  4UB3 A;  4F4W A;  4M2Y A;  1QAT A;  2W9B B;  2F8K A;  1NK5 A;  1SWV A;  2NRW A;  1ZQA A;  4ECY A;  4O3M A;  1NK6 A;  5EE1 A;  1CUK A;  1QV0 A;  3I5G C;  1NWD A;  1ALW A;  4QWA A;  4O5C A;  1J1E A;  9ICW A;  5DB7 A;  5TZV A;  4GLX A;  5KT6 A;  1SZP A;  5IIO A;  7ICJ A;  4TUR A;  3DZT A;  5HHI A;  1RYS A;  2Y1I A;  2A1A A;  9ICM A;  5EE3 A;  5JOL A;  8ICT A;  1QQ5 A;  2F2A B;  5J3X A;  1CLB A;  1S0O A;  1YX8 A;  1X9X A;  1Y1X A;  2H61 C;  4NLB A;  4F3O A;  5J2I A;  1DJH A;  3LVV A;  3BS5 A;  1KW4 A;  3MDA A;  2XID A;  4B9N A;  1GQM A;  1TK0 A;  1OMR A;  2Q4T A;  3AU2 A;  4ECQ A;  2YML A;  2KIC A;  4C8K A;  5KFI A;  2V53 A;  3GV8 B;  1L8O A;  1V1G A;  1UHJ A;  3JPO A;  3ZDC A;  1T8E A;  2ZFD A;  3I5I C;  2HW3 A;  3KZI U;  3GII A;  1ZJM A;  1Q46 A;  3VCB A;  4P2Y B;  4M9L A;  1AP4 A;  4PGX A;  1IJ6 A;  3D2N A;  1RPL A;  2W9B A;  4YGB B;  2IOF A;  5KFY A;  4DFM A;  1NJW A;  5D69 A;  2YMQ A;  5KFG A;  4DFD A;  8ICY A;  1A4P A;  3TAR A;  1ZQR A;  1PVB A;  1JUD A;  4EYH B;  1BR1 B;  1BR4 B;  1S3P A;  3WK8 A;  1V1F A;  1SZH A;  1ZQL A;  2QAR B;  2K8M B;  4RT3 A;  4O5K A;  2KI6 C;  4IRD A;  3TZ1 A;  3SIB A;  2ZTE A;  1S5L U;  3SAH A;  3PW0 A;  3ZDB A;  5KG3 A;  3OX6 A;  4BGD A;  3WKE A;  2BCR A;  3SG5 A;  1UHI A;  1EJ3 A;  2KSO B;  2H3Z A;  4BDP A;  2VJ5 A;  4RNO A;  4A4C A;  4MSP A;  1U5I B;  1HT9 A;  3QX7 A;  3M6K A;  2BKI B;  3TAC B;  2XGQ A;  1KSO A;  5I2L A;  1DTL A;  3QU4 A;  1UPH A;  1KQM C;  5HP4 A;  2ZND A;  4R1E A;  4B6J A;  1ED1 A;  3IRU A;  1L7O A;  4NLC A;  2ASD A;  4JPZ B;  3QE9 Y;  1X40 A;  1N2D A;  4FZN A;  5ALL A;  4DRW A;  1SBJ A;  4PCW A;  4PHP A;  4TQR A;  3ED5 A;  1C7Y A;  3SR6 A;  2KFZ A;  3AQF A;  2EQY A;  1SSE B;  2BE4 A;  7ICG A;  2O6K A;  2GTE A;  4GBA A;  4USA A;  4ELV A;  1XNS A;  3SG3 A;  1V85 A;  9ICR A;  2OTG C;  2WF7 A;  5TNC A;  5CEH A;  4WQ3 A;  3LVW A;  5DQH A;  1N2X A;  3MBY A;  1H8B A;  4FO6 A;  3G6Y A;  4NLG A;  4IR1 A;  2QAR A;  1JF0 A;  4UW9 A;  2QEO A;  2KOB A;  4UAV A;  3C2M A;  2WTF A;  1CDN A;  5BOL A;  2LHI A;  2O5G A;  3HIL A;  2LMU A;  1TOP A;  1WDC C;  2HHS A;  2KPH A;  3SG4 A;  4EBC A;  5ALY A;  1WLZ A;  4OCZ A;  3D2S A;  4YBH B;  1FFV A;  1KL9 A;  2WF9 A;  2UVR A;  1BNP A;  3Q8P B;  1M63 B;  5DQG A;  1LXF C;  1MC8 A;  3UXP A;  2H5X A;  2KSO A;  5AK4 A;  2LYA A;  1U5I A;  4PHA A;  4KYN A;  1PK1 B;  1IXR A;  2R8K A;  1SCV A;  5KFA A;  3SS3 A;  5ALE A;  1B0X A;  4M9J A;  2JQ6 A;  1SR6 C;  5KT5 A;  1C20 A;  2G9B A;  1FF1 A;  1Q3V A;  2NV3 A;  4YMO A;  2BHN A;  1T4G A;  4QZF A;  4UAZ A;  4ORB B;  1D8Y A;  2JEF A;  2KV2 A;  4IQT A;  1IG6 A;  3LL8 B;  3F5A A;  3QUT A;  4MZL A;  3L4L A;  5J0Y A;  1CNP A;  3KHL A;  3WU2 U;  4PZO A;  1XO1 A;  5ALO A;  2LM1 A;  3OPX A;  3GK4 X;  1J2N A;  3PR5 B;  3L5K A;  2DOQ A;  1ZQD A;  4C0L A;  1CMG A;  4OO1 J;  4F50 A;  1OE9 B;  1BPX A;  1Q8K A;  3UQ2 A;  2JTZ A;  1X66 A;  2YB1 A;  3OSN A;  4M0A A;  3PSF A;  4UB6 U;  4DQS A;  2PYQ A;  3B9J A;  1AVS A;  1ZQZ A;  4F5P A;  2ZXI A;  1F8H A;  1B22 A;  1DK2 A;  1WWV A;  2WB1 C;  1X9S A;  2FCD A;  1SNL A;  1HIW A;  1J7P A;  3CLN A;  3IN5 A;  5KL1 B;  1LV5 A;  1QX7 A;  2NCP A;  5HLV A;  5AKK A;  2GLE A;  1UA0 A;  1PK1 A;  1WLM A;  1B1G A;  1PK0 D;  3V7J A;  2VA2 A;  2BKE A;  2NYV A;  4FQT A;  3KKA C;  1A77 A;  8ICJ A;  1UA1 A;  5ALQ A;  4CFR A;  3HCM A;  3DD4 A;  1LA3 A;  2BCU A;  3WK6 A;  8ICG A;  2KEY A;  1L3V A;  5E79 U;  1Z1B A;  1OOH A;  3FM9 A;  3EYZ A;  1IJ5 A;  1HQV A;  1NYA A;  5DIC A;  1AQ6 A;  5J2A A;  8ICF A;  4Y2R A;  5J2G A;  4GC7 A;  4RUA A;  5ALJ A;  4NM2 A;  2ESE A;  5DBC A;  2D8C A;  2A4J A;  1GGW A;  3UMC A;  2A3V A;  3UM9 A;  5DGA A;  3N4M B;  3AEV A;  3VRR A;  5AFP A;  1T3Q A;  3RH5 A;  4MEW A;  8ICS A;  2BKH B;  1DC1 A;  5T14 A;  1ZD2 P;  2AGP A;  4PGY A;  5ALX A;  4NWI A;  3PMN A;  2IHN A;  1NUB A;  3BQ2 A;  2BEC A;  2QPT A;  5I94 A;  4KMU A;  3MR5 A;  4O3P A;  3I1Y A;  2MRD A;  3CR2 A;  8ICI A;  4EX7 A;  5AM1 A;  4Y2T A;  2AH5 A;  8ICZ A;  4J9K A;  2K7B A;  4IL1 A;  3H7I A;  3RJH A;  1MXL C;  1HUO A;  3TAQ A;  2GOL A;  4JK1 A;  2MAZ A;  1SCM B;  1B9A A;  5ALS A;  2YQE A;  2LMV A;  1BU3 A;  2BBM A;  5DDM A;  2W54 A;  2Z7J A;  3RZS A;  4PHM A;  3CRX A;  2M0R A;  4KLJ A;  2QAC A;  1UT5 A;  3G6X A;  2MLE C;  1J2M A;  1Y6W A;  4PL2 A;  4QIW C;  3SYZ A;  1OOI X;  3H8J A;  2F2P A;  4KN7 A;  3MR3 A;  3CWG A;  3TKA A;  3E58 A;  2XCA A;  3LDA A;  3V2L A;  4EEL A;  5KFZ A;  1K90 D;  1OW5 A;  3ZD9 A;  7ICS A;  2GGM A;  2HET A;  4XQ8 A;  5AKX A;  5DG8 A;  4OJO A;  4Q44 A;  2WCM A;  2KYC A;  1GGZ A;  5ER5 A;  2FJU B;  3I76 A;  5FI6 A;  4EBD A;  3GIL A;  1QLK A;  2DFL A;  4DF4 A;  4MFF A;  1UQV A;  2KK0 A;  3LK0 A;  9ICI A;  3EKJ A;  2JT8 A;  2PAL A;  1F54 A;  4C0Z A;  2IMW P;  2COL B;  1BLQ A;  3IG8 A;  2HHW A;  2WCJ A;  5ALZ A;  5L9X A;  2E30 A;  3UXO A;  1SXD A;  1DGJ A;  2NRT A;  1ZQC A;  3NGV A;  1JUO A;  1TNQ A;  4F5O A;  1NSH A;  3IQQ A;  3KTQ A;  3O6B A;  3JPP A;  1RZT A;  1O08 A;  2VKQ A;  4DWI A;  2G08 A;  4Y2Y A;  5HR6 A;  2CXY A;  4C7Z A;  3NHT A;  2W03 A;  3BUN B;  2KBM A;  4KLQ A;  3EK4 A;  4C80 A;  4YGD B;  3WKA A;  3I28 A;  1Y0V H;  3EPG A;  4XRH A;  5KSZ A;  2TN4 A;  4YR2 A;  4M2O A;  1ZQF A;  2AXT U;  4KIT B;  4I2C A;  3JVT C;  1ECW A;  2M29 A;  1DXS A;  5AIA A;  2BPC A;  4QZ9 A;  3R72 A;  3AM9 A;  4GXI A;  3VRO A;  1W9Z A;  1KKX A;  1WWU A;  2VJ4 A;  4F4X A;  2JEI A;  2L4I A;  3ZDA A;  3M1Y A;  1MXE A;  1TKD A;  3SAG A;  3L47 A;  1NZP A;  3PM8 A;  4AYB C;  1L8L A;  3BOW B;  4UB2 A;  1Z19 A;  1UWO A;  1G4Y R;  1NNL A;  3PN7 C;  4ELU A;  2JTT A;  4QZA A;  4PHE A;  4KLS A;  1QVI Z;  4NL9 C;  3S0B A;  3RR8 A;  3A4U B;  3DV9 A;  3OP0 A;  3WK4 A;  4DFJ A;  3KBB A;  2ZTC A;  2JC2 A;  4NQG A;  4UB4 A;  1KK7 Z;  1ODB A;  2AQ0 A;  1SMG A;  4MFC A;  1CLL A;  2ZIU B;  1T94 A;  3ALR A;  4CF3 A;  4RQ7 A;  1L2O B;  3BXK A;  2FPL A;  1RJV A;  2BPF A;  2KSP A;  2FMP A;  2EC6 C;  5EL2 A;  4RQ1 A;  1XWL A;  3NRW A;  3MDC A;  2GGZ A;  2HHV A;  3T79 A;  2JT3 A;  4I2G A;  3I5H C;  2WF5 A;  4DLE A;  2BCS A;  4DL2 A;  2V4Q A;  5AK6 A;  4ZCV A;  3NSI A;  3EG5 B;  1C07 A;  2FLP A;  1BJF A;  7ICP A;  3C21 A;  4ECU A;  1WG8 A;  1IG5 A;  5DKW A;  2BCA A;  1K9U A;  2ATL A;  1DF0 B;  4J9P A;  3MR6 A;  3SS5 A;  1CTR A;  3Q8S B;  1K2H A;  2KBI A;  9ICP A;  4OJP A;  1TN4 A;  3GIK A;  3D76 A;  5KFQ A;  5D46 A;  3JPQ A;  5J8Y C;  4UB5 A;  5HL1 A;  3PY8 A;  1AK8 A;  3BOW A;  5AM2 A;  3C5G A;  4P4P A;  4O3R A;  1CLM A;  2QEB A;  1YT3 A;  2NRX A;  3CYZ A;  2DL0 A;  3TS5 C;  4U8D A;  1KLN A;  1F4O A;  1Z1V A;  5KAF U;  2KAY A;  2DQN B;  2L50 A;  1J55 A;  2EDU A;  3S0D A;  5KFT A;  4IRK A;  4F5Q A;  2E1F A;  1F55 A;  1L7N A;  3F2B A;  1QSS A;  1BPB A;  1JN3 A;  1U9L A;  7ICO A;  3DXL A;  1IWQ A;  3BJH A;  5ALU A;  2ZIU A;  5CB1 A;  4KLG A;  4HRE E;  2ISO A;  5KFD A;  5KFB A;  4OVN F;  3RAQ A;  1ZQJ A;  8ICR A;  4Z6D A;  8ICN A;  3QU5 A;  5J2K A;  1BPD A;  5CJ7 A;  2MSN A;  1ZD4 A;  5C0Y A;  3HKZ F;  4P4O A;  2J6U A;  1H38 A;  1PRW A;  2W7O A;  1KK8 C;  2W7P A;  2YY6 A;  4P4M A;  2JXL A;  5KTQ A;  1IRJ A;  2MJW B;  4F8R A;  5KFL A;  1DF0 A;  1RXV A;  2Y9T A;  1L6N A;  5L1I A;  1NJX A;  4QWD A;  5J0W A;  1GM0 A;  3KHH A;  2KGB C;  2RHF A;  3JPN A;  1F44 A;  2WAQ C;  1YUU A;  4DEZ A;  4TUP A;  4DQP A;  4F7F A;  2KAV A;  3IP4 B;  2L5Y A;  4QZC A;  4YRU A;  4JWN A;  4QJ3 B;  1UP5 A;  2YB4 A;  4GXK A;  4M2P A;  9ICT A;  2H2K A;  3GK1 A;  5L1J A;  2LCP A;  4Q04 A;  4R8U B;  2BCQ A;  3JTD B;  2R8I A;  3HT3 A;  2XIC A;  1IKU A;  9ICG A;  5KFN A;  4UAU A;  2BDP A;  2PVB A;  2W55 A;  4GIB A;  3KPX A;  1L7Z A;  2LM4 A;  2F8L A;  1LVH A;  1NI3 A;  3E3R A;  2OYY A;  1TWO A;  4C8L A;  4KLE A;  4PGQ A;  4DCK A;  2E8P A;  2Y1N A;  1OQP A;  3DVK A;  2ZRS A;  1GO3 F;  3SJS A;  1WRK A;  3HW8 A;  1PUL A;  5L1L A;  3OGU A;  1LA0 A;  2G06 A;  4O9M A;  4M6W B;  1FO4 A;  4CFQ A;  3AU6 A;  1ZQ1 C;  1JRP A;  3SI8 A;  4AQJ A;  5CSF A;  2LLU A;  2QEH A;  5I8N A;  3LCP C;  1DMO A;  3I5I B;  4QJ4 B;  4YXJ A;  2F1I A;  1YX7 A;  2KI4 B;  1M45 A;  5GTI U;  1N61 A;  2PFP A;  1YUT A;  2LBO A;  5I2O A;  1WCL A;  3GU3 A;  1KFU S;  3DF0 B;  2YN4 A;  3OBV A;  3SG2 A;  5B5E U;  3PO4 A;  5KFM A;  1KWO B;  1TNP A;  1L7P A;  3PM2 A;  2F3N A;  4FZL A;  5EOZ A;  3T5K A;  1F5S A;  2C2E A;  4PE4 A;  3BUX B;  3K1E A;  2DKX A;  4NDB A;  4YMN A;  5KFX A;  1QX2 A;  3Q8K A;  3SG7 A;  4R8U A;  2M3W A;  2F2O A;  3MR2 A;  2OXO A;  5KFJ A;  5AI5 A;  2M0N A;  4C4S A;  5DKR A;  1J1D A;  2H61 A;  5J2D A;  3BJY A;  3H4S E;  3BQT A;  5AIC A;  5CWR A;  3EKH A;  1ZD5 A;  2Q0Z X;  5ALK A;  2Q4U A;  1JXL A;  5J2C A;  9ICE A;  2EAP A;  4M6W A;  1AJ5 A;  4HAI A;  1ZAC A;  7ICH A;  2B6G A;  2ALZ A;  1ZQG A;  2BQU A;  3MC1 A;  3O4X A;  3RLZ A;  2F8P A;  2WCE A;  2ISD A;  1ZMZ A;  4K4I A;  1M31 A;  1JRO A;  3B86 A;  5HMM A;  5DBA A;  2I2R E;  2HBM A;  1ORG A;  4DQR A;  4PPX A;  9ICU A;  4DSI A;  3DF0 A;  4EYI B;  2OTG B;  5DG7 A;  1T7P A;  5F6T A;  1TFR A;  2PSR A;  2ASL A;  2JRF A;  5CSI A;  1QVI Y;  3BFB A;  5IBW A;  3UMG A;  3RF9 A;  2W8K A;  3MFH A;  4X5V A;  2OEH A;  5ALV A;  2OS8 C;  5DQI A;  3ZDE A;  3NSL A;  1KK7 Y;  3B88 A;  2LVK A;  4ED6 A;  5KL8 B;  1BVS A;  2FDR A;  2KIV A;  2IBK A;  7ICV A;  1DEL A;  5AKL A;  2ODG A;  1B4F A;  2KJ5 A;  2MU2 A;  5KG2 A;  3AUO A;  2RRD A;  3RRH A;  4MF8 A;  5DLF A;  5KFE A;  1TAQ A;  3QRX A;  4C4R A;  1ZQU A;  4DS4 A;  5ALP A;  2XCP A;  4EZ9 A;  4I29 A;  3OHM B;  2YTU A;  1DGV A;  1URJ A;  1GJY A;  4ED0 A;  1K9K A;  2ISP A;  1V9P A;  1SIJ A;  4I2H A;  4G3I A;  5C5J A;  2WCH A;  1TRF A;  1XVJ A;  3BS7 A;  1L3T A;  4O3O A;  2KYF A;  2M49 B;  4C8O A;  2K4E A;  1S97 A;  3Q8L A;  3BQ0 A;  4NJ8 A;  3NTU A;  1XYD A;  1XSP A;  2LC5 A;  4JWM A;  4B9T A;  2OPO A;  5KFU A;  5KG0 A;  4RPX A;  7ICT A;  2K61 A;  2YMM A;  5ALM A;  2AJQ A;  3DVE A;  3EVU A;  2LLT A;  2FMS A;  4QZB A;  2JRZ A;  1ZQE A;  1QX5 B;  2F3Y A;  4OZD A;  4M9N A;  3TUY C;  3C5F A;  4JV0 A;  1NP8 A;  4TNC A;  2V4R A;  1L5U A;  4CNQ A;  1S6I A;  1K96 A;  4JV2 A;  1A76 A;  7ICQ A;  3WXA A;  2KD1 A;  8ICV A;  1W7J B;  1G33 A;  4GGF C;  2UVV A;  3G6V A;  1F0M A;  4KLO A;  1D8B A;  9ICS A;  1S8O A;  2BCX A;  3CDN A;  2AHO B;  4I2J A;  3GDX A;  3C23 A;  3PR4 A;  2AUC A;  3H8W A;  1TTX A;  1XFR A;  4NDD A;  5FI2 A;  1ZRM A;  4AYB F;  2PXI A;  4I5N B;  1DRG A;  3NAS A;  4HRH A;  5CHG A;  5CA7 A;  2LHL A;  2LKY A;  4KLU A;  2FI1 A;  1QQ6 A;  4NLZ A;  2HDO A;  7ICU A;  3RJF A;  1Q80 A;  1ZQB A;  5AKG A;  3ICB A;  3LWL A;  2NRV A;  4QNL A;  3IM1 A;  5HKW A;  5AER A;  4RQ4 A;  4E68 A;  4Y2Q A;  5ALG A;  4YP3 A;  2D8N A;  1QLS A;  4F4K A;  2CNP A;  2BQ3 A;  4PL1 A;  1C7V A;  2KOT A;  2RP5 A;  4CE6 A;  3C1Y A;  4UBB A;  4J9S A;  1NX2 A;  4FBU A;  1OMV A;  5AK5 A;  4JD9 A;  4RQ5 A;  4U7C A;  3FS7 A;  5CSJ A;  3ICX A;  1N5W A;  3O0F A;  1S36 A;  1MSW D;  3KD3 A;  3IG5 A;  3BYA A;  1XFZ O;  4MFA A;  2DGZ A;  2K8A A;  3RRG A;  2HHT A;  1DJI A;  1VRK A;  2KHV A;  1NIW A;  4JUZ A;  4M04 A;  1P7D A;  5J2F A;  4NY8 A;  2YMP A;  2IOF K;  4JMU A;  3KHR A;  4ED2 A;  3N7P D;  2MUT B;  1SL1 A;  3RAX A;  3RJE A;  5DG9 A;  2LMT A;  4IQV A;  9ICA A;  3PVX A;  1PSR A;  3LK1 A;  3BUW B;  2LLS A;  2WCB A;  1BGX T;  1TCF A;  5J29 A;  4N1F A;  1XK4 A;  4B9V A;  1MUX A;  1W7I B;  5J2J A;  3JPT A;  2HBK A;  5J0S A;  2W11 A;  4C8M A;  4C0K A;  3H8S A;  3EPI A;  4NLK A;  2LV7 A;  3I5F C;  5KFR A;  4R65 A;  2KDH A;  1B4C A;  3N7R C;  2HOQ A;  3AAJ A;  4UB8 U;  1CB1 A;  2KAX A;  1SWW A;  3J81 j;  3TAN A;  1SL9 A;  1YRU B;  2XY5 A;  4DL3 A;  1CI4 A;  2LI6 A;  3RJK A;  4DL5 A;  1H4B A;  1ZQI A;  9ICC A;  1S0N A;  4DL6 A;  4YGA A;  4R64 A;  2W9C B;  3A0B U;  3BZC A;  2CRX A;  2DUY A;  3L3F X;  1EXR A;  4G9B A;  2WOR A;  3DVM A;  1ZQP A;  2KI6 D;  1SL2 A;  2HI0 A;  3QU7 A;  1E8A A;  4ETO A;  3FE6 A;  4NV0 A;  2LYH A;  8ICQ A;  3QU2 A;  3BZK A;  1B8C A;  2A19 A;  1SW8 A;  3IQO A;  4BY4 A;  2KKP A;  2F33 A;  2JXJ A;  2R8G A;  4I2D A;  4Z6E A;  2Y0S F;  3L4P A;  4J9L A;  5ER4 X;  1KN5 A;  2PMZ F;  2MUT A;  2ZJ8 A;  1Q3U A;  4YMM A;  3VRP A;  1SYM A;  9ICH A;  2BPG A;  4XA5 A;  1B7T Z;  1DJZ A;  2LYB A;  3TDI A;  8ICK A;  2WCK A;  1YUS A;  2WND A;  1S1E A;  1KEJ A;  3JVT B;  3KHE A;  5DB9 A;  2I18 A;  1K5O A;  4INX A;  4EZ6 A;  4KLL A;  2HHU A;  1X2I A;  4GAO A;  2F76 X;  1WRL A;  3GQC A;  2NCO A;  2P35 A;  3R1O A;  1HEK A;  4YVZ A;  2LNK A;  5D4B A;  1UCV A;  4PHD A;  2AU0 A;  4CF4 A;  8ICW A;  1JFK A;  1SL7 A;  2O60 A;  4OJL A;  2ZKM X;  1QSY A;  3D77 A;  3FWB A;  2JPT A;  2L98 A;  5KT4 A;  3FIA A;  2Y4Q A;  1DVI A;  1XSN A;  2WOS A;  5KFF A;  8ICA A;  2PFO A;  1OXJ A;  1S26 D;  5IIJ A;  1TE2 A;  3GK2 A;  2FMQ A;  4P0P B;  2K8B B;  5J0U A;  5I2Q A;  5KT2 A;  2W9C A;  2LUX A;  2SAS A;  4JQ0 D;  8ICX A;  1CFF A;  1S77 D;  2KHN A;  3BFH A;  3FWC A;  1Z2C B;  1ARO P;  2FPM A;  2KLD A;  3CP8 A;  4QZH A;  2BNX A;  1RM6 C;  1KQV A;  5KFC A;  1TK8 A;  2AQ4 A;  2JMG A;  1S6J A;  2LM5 A;  1K94 A;  2PRU A;  3PLF B;  3EK7 A;  3I5H B;  3B0Y A;  5DKN A;  4O3N A;  1L3U A;  5KFK A;  1LB2 B;  2WHE A;  2KG5 A;  2BZF A;  4B9S A;  5KT3 A;  3MGI A;  1NK4 A;  3NGD A;  4NLN A;  4ECX A;  1UHK A;  4CDG A;  2FLN A;  3IVT A;  4MLW A;  2P6R A;  1JIH A;  1J97 A;  1K1Q A;  2EZX A;  4U6P A;  3QEA Z;  1ALV A;  3CZ1 A;  5EWG A;  1XFV O;  3FYH A;  4KX3 A;  4C8N A;  4YGE B;  4CLN A;  5KU1 A;  5J0X A;  2LAN A;  4ED8 A;  2GWS A;  4DF8 A;  3LLE A;  4KMO B;  2F3Z A;  5DKQ A;  1DOQ A;  1VDV A;  3ISB A;  1JAL A;  2FJ6 A;  3HRD D;  1CRX A;  5A0L A;  1WUD A;  2G07 A;  4P5O E;  1F70 A;  3H0M B;  1N63 A;  5DLG A;  3UNW A;  3GOF A;  3TS5 B;  2ZIX B;  4FS1 A;  2Y1J A;  2XVT A;  2KFF A;  2OWO A;  4ECW A;  1R2U A;  3PX4 A;  2KZZ A;  3BQ3 A;  4P0P A;  4QZE A;  4O5E A;  1ZJN A;  2W9M A;  2Y1M A;  1FW4 A;  2W3S A;  1SKS A;  4CID A;  1K8U A;  3QXG A;  3F5E A;  3H0R B;  3DEE A;  5AM3 A;  2DKZ A;  2BE6 A;  2K7D A;  2CN1 A;  1DJG A;  1QWV A;  2PMY A;  1EG4 A;  1TIZ A;  4RNN A;  4ED7 A;  5CR0 A;  2Q91 A;  4DL4 A;  5KFW A;  2BR0 A;  2N1R A;  2KP7 A;  1FI6 A;  1VLB A;  5CP2 A;  2W9A A;  2RDJ A;  3WK7 A;  3GV5 B;  4F5R A;  2HCF A;  1KK8 B;  1KFD A;  2K7C A;  1J7Q A;  3CW2 C;  3QNM A;  4BWM A;  4RNM A;  9ICO A;  5J0R A;  3EVR A;  1N56 A;  4J9N A;  4YI9 A;  1TUZ A;  2LP3 A;  4F93 B;  1QJT A;  1XA5 A;  1KFX L;  1K95 A;  4EX6 A;  1FPW A;  2QB0 B;  5KG1 A;  3U26 A;  5EWF A;  3SG6 A;  2F77 X;  5AI9 A;  2ZIX A;  4DQQ A;  5B8I B;  2BDU A;  1QIV A;  2AGO A;  4NM1 A;  5F3X B;  4Y2J A;  3H8M A;  3EWA A;  4Y2V A;  5HLO A;  4RPZ A;  5DB6 A;  1YVH A;  3HWT A;  2ZN9 A;  3MAB A;  4J9Q A;  2D6F C;  3K1R B;  5HNK A;  2ZG6 A;  3M9O B;  1NOM A;  1KSM A;  4YD1 A;  1AJ4 A;  3QUB A;  5EWE A;  2MHH A;  1DJX A;  5KFO A;  3O2P A;  1FBV A;  4PHJ A;  3PO5 A;  4YD2 A;  5GTH U;  2KZ3 A;  1DQE A;  2L4H A;  3GZF A;  4FBT A;  2JGA A;  2NRZ A;  4PH5 A;  4Q45 A;  4HSZ A;  2KHQ A;  3R1V A;  3PV8 A;  3M9N B;  4IRC A;  2K2A A;  5H2F U;  4BUG A;  4DQI A;  1DGU A;  3UQ0 A;  4A8E A;  4I27 A;  4I2E A;  3LK9 A;  1KFT A;  1KTQ A;  3M7D A;  2J6S A;  1KSP A;  4FFD A;  3AMZ A;  5AKY A;  2G09 A;  3PW4 A;  1QTX A;  3NXA A;  2K60 A;  4MN0 A;  5PAL A;  1S0V A;  3C28 A;  1N0Y A;  4ZH4 A;  5KG4 A;  3S0G A;  2XC9 A;  1DJW A;  4YG2 A;  4EEY A;  1AUI B;  4KLT A;  1TVA A;  5AAN A;  4DIR A;  1RFJ A;  1F71 A;  1CFD A;  1QTM A;  4OV2 A;  3PW5 A;  3JPS A;  2QB0 A;  3PSR A;  1COK A;  1A29 A;  4DS7 A;  3RB0 A;  2K4I A;  2H8V A;  2LMR A;  4O3S A;  8ICU A;  1IH0 A;  3VRQ A;  1PVA A;  3CNH A;  4DFP A;  3FAH A;  3RJI A;  3C1Z A;  1BPZ A;  2XO7 A;  4PHK A;  1NCZ A;  1UT8 A;  1RRO A;  2LVV A;  5KAI U;  3TDU A;  1MA7 A;  4F4Y A;  1D8L A;  3I5G B;  3KOO A;  9ICF A;  1IQ5 A;  2KFN A;  1HUZ A; 
#chains in the Genus database with same CATH homology
 2KIV A;  5JU5 A;  4GAO A;  4NL9 A;  2KSO B;  1DEL A;  2JV3 A;  4JKT A;  2LPE A;  1LKY B;  3SS5 A;  1B4F A;  5FI6 A;  4I5L B;  2BAP A;  4RQM A;  1UCV A;  2E8N A;  1UQV A;  1WWV A;  2FE9 A;  3TAC B;  5J8Y C;  5HL1 A;  5FI7 A;  2F8K A;  1OXJ A;  1SXD A;  2GLE A;  3IDW A;  2YTU A;  1X40 A;  2DL0 A;  1PK1 A;  2KE7 A;  1Z1V A;  1SV0 C;  2YGU A;  3BS7 A;  2QB0 B;  3KKA C;  3OBV A;  1SXE A;  3TAD A;  3UO9 A;  1Z2C B;  2D3D A;  2QB1 A;  2KMD A;  2KLD A;  2EAM A;  3BQ7 A;  2F44 A;  4NJ8 A;  1SV0 A;  2BNX A;  4GBA A;  5KNI A;  2E8M A;  1V85 A;  5F3X B;  3PM2 A;  4PZN A;  2F3N A;  3H8M A;  1SV4 A;  2DKX A;  3K1R B;  2ESE A;  1X9X A;  4MHV A;  2QAR A;  2D8C A;  2KG5 A;  1DXS A;  5J8Y A;  3BS5 A;  1KW4 A;  2Y9U A;  1Z4H A;  3HIL A;  1W9Z A;  3IVT A;  1SGG A;  2EAN A;  5JTI A;  4MEW A;  1WWU A;  5JRT A;  1DC1 A;  2KSO A;  5D3O A;  3KKA A;  1RG6 A;  1F0M A;  2Y9T A;  1LKY A;  2EAP A;  4KYN A;  5L1M A;  1JI7 A;  1PK1 B;  4IS7 A;  3SEI A;  2B6G A;  5I94 A;  4NL9 C;  3O4X A;  2K4P A;  2K60 A;  3SS3 A;  3UNW A;  3SEN A;  1B0X A;  2KLE A;  5FI2 A;  2L5Y A;  4I5N B;  4I5J A;  2QB0 A;  3SS4 A;  1COK A;  2QAR B;  2LMR A;  1PK3 A;  2ES6 A;  3BS5 B;  4PZO A;  3KEV A;  2DKZ A;  2QKQ A;  1V38 A;  2E8O A;  4RQN A;  3TAD C;  4IJ7 A;  1DEK A;  3EG5 B;  2E8P A;  4I5K A;  1X66 A;  2EAO A;  1OW5 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...