2L5YA

Nmr structure of calcium-loaded stim2 ef-sam.
Total Genus 49
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
49
sequence length
150
structure length
150
Chain Sequence
b'GSHMASTEEDRFSLEALQTIHKQMDDDKDGGIEVEESDEFIREDMKYKDATNKHSHLHREDKHITIEDLWKRWKTSEVHNWTLEDTLQWLIEFVELPQYEKNFRDNNVKGTTLPRIAVHEPSFMISQLKISDRSHRQKLQLKALDVVLFG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Stromal interaction molecule 2
publication title Auto-inhibitory role of the EF-SAM domain of STIM proteins in store-operated calcium entry.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Signaling protein
total genus 49
structure length 150
sequence length 150
ec nomenclature
pdb deposition date 2010-11-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07647 SAM_2 SAM domain (Sterile alpha motif)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.50 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 Transcription Factor, Ets-1 2l5yA02
1.10.238.180 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 Recoverin; domain 1 2l5yA01
2KSOB 1JI7A 5JRTA 3SEIA 2KG5A 2K60A 1X66A 2D3DA 3BS7A 3KKAC 1X40A 2QB0A 5F3XB 2Y9TA 4PZOA 2QARA 1SV0A 2F8KA 2EANA 2L5YA 4PZNA 1LKYA 1WWUA 4NL9C 1F0MA 1WWVA 2LMRA 3BQ7A 1X9XA 5L1MA 1PK3A 2LPEA 3BS5B 1SV0C 1PK1A 1UQVA 2JV3A 2B6GA 1OW5A 4NJ8A 3TACB 1LKYB 1RG6A 5JTIA 2Y9UA 2ESEA 2KIVA 3IDWA 2D8CA 4MHVA 1B0XA 1SXEA 1COKA 2E8MA 2KE7A 2QB0B 2QB1A 2QARB 2EAMA 2ES6A 2DKZA 2KSOA 2F3NA 2YTUA 4RQMA 3K1RB 1DXSA 1KW4A 2E8PA 1SGGA 4IS7A 5JU5A 5J8YA 1PK1B 1B4FA 1SV4A 3HILA 3TADA 1V85A 2DKXA 1Z1VA 2DL0A 5J8YC 3BS5A 2EAPA 2EAOA 3SENA 2F44A 3TADC 2QKQA 1UCVA 2E8NA 3H8MA 2FE9A 4NL9A 2GLEA 2KMDA 2K4PA 1OXJA 1V38A 4RQNA 3KKAA 2E8OA 1SXDA 5KNIA
chains in the Genus database with same CATH superfamily
2HHUA 1NZPA 3IHQB 1AP4A 2FJUB 2I9GA 3K1EA 3QU2A 4GC6A 2RHFA 5J0TA 1D9FA 4INWA 3C2KA 5BPJA 2D3DA 5J2BA 1Z2CB 1K2HA 1JX4A 2W04A 3I5IB 5BOMA 3QEAZ 2ATLA 2GOLA 4DIRA 1LKYA 1QX2A 1MN8A 2K0JA 2FPMA 4YR3A 4IR1A 5ER5A 2AGQA 2ZRTA 1NJWA 4RQ0A 3D2QA 3BS5B 2KP7A 4DSIA 3AL0B 5KG0A 4YXMA 3BUOB 2H2KA 4YR0A 1OOJA 5ALVA 2Y1IA 3D0YA 1YX8A 2CTNA 3TDUA 2ESEA 2KIVA 1FEZA 5KFWA 1NUBA 3F5AA 1MHOA 4M9GA 2HBLA 4J9LA 1WLZA 1ZQHA 1UHNA 3QMEA 4FFDA 3RBDA 3R9KA 3KPXA 1BPXA 4DS4A 4PHEA 2WF6A 5C0YA 1JRPA 4GAOA 4MN0A 4ED7A 2C2RA 4CE6A 3PW0A 2KSPA 2P6BB 2BDPA 2YX8A 2JRZA 1GQMA 2LI6A 4M2PA 1JIHA 4RQMA 4EEKA 1KK7Z 2RLTA 1ZQDA 9ICGA 3BQ1A 5ALNA 1J2NA 3HRDD 4PHMA 1K5OA 4KLQA 4X5VA 1SV4A 2W7OA 3NS1A 3B0YA 2IOFK 3R72A 3IP4B 3RFAA 5F9LA 1QSYA 1U9LA 5J8YC 5KT6A 3BQ2A 2NLNA 4QZGA 4ED2A 2XVTA 1TAMA 2F1IA 3SJSA 1CFFA 3KHEA 1XA5A 4FBUA 1YRTB 3RR8A 1S6JA 4E68A 1V97A 4CF4A 8ICCA 3L4LA 4P0QA 1ZD5A 3U26A 5J29A 4RQ1A 4K4IA 3ZI4A 5J0PA 3VROA 7ICEA 2BHNA 1XO0A 4YBHB 2W8LA 2JNXA 1L2OB 1QATA 4MRXA 1DGJA 2NRVA 4F5QA 3NSLA 5CHGA 1JF2A 2FCEA 1VJ5A 3BS7A 1DQEA 5AIAA 1C3YA 4F5OA 5J0QA 1JUDA 4C0ZA 3EKJA 1SV0A 1LINA 2KD1A 1SCVA 1K96A 2F8KA 5IIOA 1NCYA 3TZ1A 2K4EA 3PZPA 1B22A 4QIWC 1BVSA 4KLDA 1RROA 2KFGA 2PKEA 2Q4TA 2BDUA 3V72A 3RF9A 4MEWA 2OCEA 2W9BB 8ICAA 4PHDA 2PFNA 1B4CA 2ZIVB 9ICEA 3D10A 1ZQVA 1N2XA 4MZJA 2E30A 4Q44A 1WDCC 3H7IA 2B6GA 2FLPA 5CEHA 4OJ5A 4TUQA 2PRUA 4EBEA 4RUCA 4UAWA 1VRKA 1LA0A 1YVLA 4K4GA 5D49A 4RPXA 1ECWA 3MR5A 1S8OA 5KG3A 1AK8A 3DVEA 7ICSA 8ICFA 1ZYQA 1YVHA 1BR4B 4IL1A 1TKDA 1S77D 2HVHA 2NXQA 4PDZA 4DF4A 1TTXA 2KI6C 1J2MA 1SSEB 3C23A 4Z6EA 1A75B 3BUWB 3ED5A 4O3RA 1TUZA 3C5GA 1F71A 2F8LA 2JT0A 1YRUB 4DSKA 2LM5A 4I2BA 4AQJA 2UVVA 2BE6A 2XO7A 5AEQA 2F3NA 5G5HA 2JH7A 5EE0A 4C4SA 3NVZA 1X2IA 4RNOA 3CW2C 1J7PA 1ZQAA 2GTEA 4M9JA 3FS7A 4PE7A 3GDXA 4R64A 5TISU 4RU9A 2C2DA 5G08A 3HP6A 1D8YA 1MQ2A 4BWMA 5FYXA 2E5SA 4JV0A 1D8BA 5KFQA 2LUXA 2IOFA 4ZCUA 2NCPA 1IWQA 4PCWA 4D1EA 1LVHA 2MU2A 1A0PA 3QU4A 4ECXA 4Y2XA 1KWOC 3Q8QB 3HWTA 4EBDA 1ZQEA 3I76A 2BCBA 1QASA 3K21A 3QU9A 3UQ2A 2G08A 2RDJA 5KFVA 3NVVA 4K4HA 3SG7A 4QWEA 3ISBA 2PMZC 3I5GC 2MRDA 2FLNA 2IA6A 1DJZA 3LVVA 2IMWP 1SYMA 3KD3A 4QWCA 1A29A 1C3ZA 3NHIA 8ICIA 3H8JA 3E58A 5ALIA 2VRGA 2JR5A 2NRZA 5KG5A 2ODGA 4UQGA 5AKZA 1F54A 5EWEA 3CP8A 3EPIA 4KMUA 4IQUA 4RT3A 2EHBA 1BOCA 5KL1B 2K4IA 1BJFA 3RZSA 3N7PD 3S0EA 4PZNA 2NO5A 5DB9A 1TUJA 3CR5X 4O5KA 2ZIWA 3QNMA 1TVAA 4DRWA 1X9XA 1PVRA 3EVRA 2CT9A 3HT3A 3DVJA 2ZTDA 3D75A 5DB6A 4JKTA 4IQVA 3M9OB 2M49B 1VDVA 1U4BA 2HHWA 4OV2A 5HLOA 4JWNA 4JK1A 4B9VA 1GGWA 3BOWB 1ZQPA 3GZFA 2EH9A 2HPSA 3MR3A 2JTZA 2BR0A 1SPYA 2W43A 3MC1A 1TV9A 5DG8A 2WFAA 4N5XA 1ZQYA 4J9OA 1N56A 2HVIA 2LC5A 1K9KA 3S0BA 2AU0A 3EK8A 3CTNA 5IIMA 1YURA 2JTTA 3UQ0A 3FWBA 5CR0A 2QEHA 4CDGA 1SWVA 2MAXA 3THVA 3LK0A 3ONNA 2G2BA 2ZTCA 1MXLC 4CLNA 2AHOB 3DZTA 4DS7A 2F76X 2DKZA 2GH1A 2V4QA 1L7ZA 4C80A 5CSFA 2M9GA 4QZ8A 2KI6D 1ODBA 3Q8PB 1AHRA 4ZOHC 2Y0SC 1NYAA 2TN4A 5JU5A 3RB0A 1ZQJA 4FS2A 4TQSA 3PR5B 1ZUZA 2ZIXA 3F2CA 3PN7B 2K8BB 2JXLA 4FS1A 1IIOA 4E0DA 3SAFA 1XFRA 2VANA 1Y0VH 1ZQTA 3SZ2A 5AI0A 3NHTA 3WKCA 4LZDA 1L5UA 3BS5A 1GJYA 1KKXA 1WY9A 2GGZA 2LMTA 3O2PA 1QXPA 2F44A 9ICOA 1UWOA 3F2DA 2MA1A 4NM2A 2I2RE 4F91B 1FI5A 5K89A 2JOJA 2KMDA 3GK4X 4MF8A 3WK4A 4F72A 5CRXA 1TNWA 4BY4A 2PMYA 2QACA 2K89A 4NDDA 3Q8RB 1SL7A 1NCXA 2OTGC 1M46A 2E8OA 3OHAA 1SXDA 2Q0ZX 3HJEA 5AIBA 3TAPA 2KSOB 3C1YA 1YZ6A 1AROP 1DGSA 3DXLA 3JTDB 2JQ6A 3AU6A 4OJLA 2WNDA 1YR5A 3WHTB 2BBNA 2W3RA 1QCKA 4OJOA 3RBEA 2P71A 1J7RA 2W11A 2BZFA 1KFXS 2HW3A 2F2PA 2ZG6A 3PVXA 3LCPC 2EZZA 4IL6U 3C2LA 2KGRA 3I5HB 5KU1A 5KTYA 2FJ6A 3OHBA 1ZETA 4DCKA 3F2BA 1K95A 3S0GA 1N63A 3GIKA 8ICMA 3LWMA 1OW5A 5KL8B 1NK9A 5L1KA 2DF4B 3MGHA 4YGDB 2H61C 2LLSA 5KFPA 2KHNA 3EK4A 1SIJA 2Q91A 2Y9UA 2M7NA 5AANA 3D76A 3IG5A 5BPCA 4MRYA 5DDYA 1IGVA 1SR6C 3PX6A 1ZQOA 4A4BA 2K7DA 8ICHA 4AP9A 5JOLA 3UXOA 2HDOA 2Y0SF 5ALLA 3CYMA 4MHVA 4YGCB 4YG2A 1KN5A 1HJPA 2ASDA 4DS5A 4FBTA 3TFRA 4GFJA 3KHGA 7ICFA 4NLZA 3HX4A 3LLEA 1URJA 3I5FC 1DJWA 4DLEA 3N7RC 4B6JA 1FF1A 2WCJA 2EAMA 9ICKA 1J55A 3LDAA 5CJ7A 1T8EA 3C21A 1YUTA 2CXJA 5KG6A 2LYAA 5AI6A 4EELA 4EX6A 2AXTU 4IS7A 2LKYA 2KZMA 1PK1B 3HCMA 4P5OE 3HILA 1F4OA 1LKJA 1QVIY 2BKIB 3DVMA 2LLUA 4J9SA 2LYBA 3M1YA 3RB3A 4O3QA 1SRAA 2ZIVA 5AKLA 1QLKA 4UB6U 1MXEA 1L3UA 3PJIA 4UW9A 7ICNA 5L1IA 1QX5B 4I27A 3UMCA 1IJ6A 4NL9A 4KTQA 1NX3A 1DGVA 4BGDA 1Z4NA 1ZRMA 4BX9C 5ALPA 3OTQA 4R8UB 2FOTA 1S0OA 1AQ6A 2OS8C 3SMVA 2RRDA 4OO1J 2P6RA 5KAIU 2W9CB 1A75A 3MFIA 3SEIA 1CMFA 2K8CB 2MAZA 3NTUA 2XICA 1YT3A 1EJ3A 2F1HA 1X40A 3GIJA 3BJYA 3KFUF 5ALRA 1KSOA 5KFRA 5KT3A 3GIMA 2HHXA 5J0UA 1XO1A 4YQWA 4UBCA 1JFKA 5L9XA 1M31A 2JHDA 2C2EA 1Z3EB 4DO9A 4BDPA 5EL2A 1SV0C 2YMMA 1HUOA 2BKHB 2L50A 4C8OA 3Q8MA 1X9MA 2QEOA 1FPWA 3ETRA 5CPVA 1X6JA 5J2CA 3JPRA 4Y2RA 1KFSA 2H8VA 1MA7A 3DDHA 5DGAA 1PRWA 2OWOA 1RK9A 3ZWHA 4FZMA 2E1FA 3RJKA 2M8UA 2LE9B 2PALA 4HRHA 5AM1A 2KTQA 4QWDA 1D1OA 1NJXA 1WUDA 2AQ4A 4DSEA 5EWFA 5KFNA 3MR2A 4ED0A 5B8IB 3BUXB 2R8KA 3SG4A 2K2FA 2JC2A 2ZN9A 4QW9A 3LWLA 4ACOA 9ICMA 3JPSA 2WCMA 4DCCA 3CYZA 3FC4A 3JPTA 2JULA 3NVYA 3RR7A 3EVVA 3RH4A 3WXAA 3CLNA 4YGBB 5AHXA 4UBBA 1QIVA 4BY5A 3EVUA 4M9NA 3Q8KA 3RJJA 4DSLA 1AJ4A 3V6JA 2LUCA 4FQOA 4QNLA 4XA5A 1Z1VA 4YI8A 3B86A 4RQ6A 2KYCA 2LHIA 3KOOA 5K4LA 2CRXA 2HOQA 2NCOA 3JVTC 1NSHA 3OPXA 2JNFA 1Y88A 5HR6A 2I6XA 5D4BA 1L8LA 1A6SA 3IG8A 2KI4B 4NDBA 1UCVA 3TS5C 2H3ZA 1CLLA 2K4PA 4UB4A 3BOWA 1SL0A 2K8AA 5EWGA 5HMLA 4DOAA 3T5KA 9ICAA 4PL2A 4I5JA 1ZJNA 3QRXA 1S0MA 1Q80A 1KQMB 1QSLA 5CB1A 5ER4X 9ICBA 4NQGA 4I2CA 1ZQNA 1R6PA 1FO4A 1IG6A 5IIKA 1TK0A 4M6WB 2XGQA 2KG5A 5ALZA 4RZRA 3QXGA 1WRLA 3S0FA 3TANA 4NLKA 2DUYA 3M9MB 1FW4A 4B9TA 3SG3A 3T3FA 1EG3A 4YVZA 3LK9A 3H4SE 2BGWA 2L5YA 4EENA 4KLIA 5KT4A 2L51A 1QSSA 1SKTA 3TFSA 3E3RA 2XCPA 2O6KA 4TUPA 3KZXA 5AM4A 2JEJA 2JGAA 2G06A 4PHPA 1N2DA 2CXYA 2Y5IA 9ICRA 5B66U 2JV3A 4KLEA 5J0SA 3I1YA 1CTRA 3H4BA 5AICA 1N61A 2MUTB 5HP4A 2HBMA 1B1GA 3SI8A 2LLTA 3E2EA 1RYUA 3QX7A 5KFDA 3BQ3A 2BCXA 5DKRA 2HBJA 2XY5A 4NLNA 3V6KA 5EE9A 4ZH4A 4J9NA 2ZRSA 2M1UA 1C7WA 3WKBA 5HHIA 4EEYA 4J9MA 3BZKA 3RJIA 2BPFA 4F3OA 2PFQA 1KSPA 1KTQA 3OP0A 1LV5A 1QH9A 3QUBA 1KK8B 4CCHA 3O4XA 4YD1A 1NCZA 4DL7A 4JWMA 2JZIA 3BFAA 2KSOA 3BJHA 1UA1A 1K9PA 1RXWA 2ZJ8A 1AVSA 1PVBA 2M0NA 2A1JB 3OSNA 4Q8EA 4I2EA 3FWCA 5AKKA 9ICUA 1PSBA 3SS5A 5E79U 5KG4A 1HEKA 1RPLA 1S10A 3H0RB 4BXOB 5KG1A 3F45A 2O5GA 2KBIA 3PSFA 3SQIA 4KITB 4MFFA 3BUMB 3FE6A 1BPYA 2A19A 3L3FX 3I5IC 2KHVA 5ALSA 1F44A 2IOHA 4TURA 1OZOA 3MGVA 4Q8FA 1ALVA 1B8RA 5ALQA 4KLUA 2ASJA 2I7AA 4YGEB 5ALMA 2YMLA 1U45A 4U6PA 2R8GA 1ZD2P 4I5KA 7ICPA 3D6JA 3T79A 4I28A 2AJQA 1BNOA 3RAQA 9ICLA 2FMQA 2Y1JA 8ICXA 4O3SA 4GNKB 3MGIA 3V7LA 3KF9A 3M0WA 2KFNA 4FE3A 1BU3A 4US8A 1L6NA 3ICBA 2GWSA 1HT9A 1F70A 1N5WA 1V1GA 2VA2A 3UXPA 1X9SA 7ICHA 1NX2A 7ICGA 1G33A 2KICA 1ZQMA 5KG2A 4ED3A 2F3YA 4CIDA 1UHHA 1TN4A 3SD7A 3KO0A 5AI4A 5CWRA 3IVTA 3OGUA 3TDIA 1F5SA 1B43A 4C7ZA 1ZQQA 1Z00B 2XY7A 1PK1A 3Q8SB 1ZQGA 1ZQFA 1U49A 5AKGA 1YZ7A 1WDCB 3TACB 1Q3VA 5AKIA 2WF9A 2LBOA 4YN4A 2R2IA 4M04A 1BMOA 5ALKA 4MEYA 4IRKA 3BFBA 1TAUA 4QJ3B 1FFUA 1L7OA 2PQLA 1XFVO 1SW8A 5J2KA 4Y2QA 3S6JA 1IQ5A 4F2RA 3O0FA 4DFKA 2GGMA 1NIWA 3O78A 3K1ZA 4HAIA 4OJ6A 2KYFA 2OEHA 1TOPA 4FQTA 4HYKA 4R63A 1N48A 3F5EA 3SAHA 4R8UA 5AI9A 2AAOA 1IIPA 2QB1A 2VA3A 2W9CA 1WCNA 1S1EA 5CSJA 1SB3C 5GTIU 3SIBA 4F8RA 1Y1XA 1LVCD 1S5GY 1SGGA 1QQ5A 5J0RA 3MABA 7ICJA 5J2FA 2ALZA 1DVIA 3CWGA 4B9NA 2H3IA 2BPCA 8ICZA 1NWDA 5FI6A 2PVBA 1V85A 5KFSA 3CR2A 3IM1A 3MR6A 4Y2SA 4YFKA 4M9HA 5HKYA 5T14A 5I8NA 3H40A 1KCYA 4KLHA 2KVCA 2NRTA 3UPQA 2YY6A 1IH0A 3M6ZA 4PHJA 2BL0C 4B9LA 1UUSA 3SYZA 1KWOB 4HRGA 1TE2A 5J2HA 3BZCA 5DKWA 1B7TY 1UHUA 4MSPA 4ORAB 3UNWA 2O60A 2DPIA 2KAYA 4EZ6A 3QEBZ 1B9AA 2J6UA 1V38A 4KN7A 3PW2A 4RQNA 4FTGA 3MBYA 3PM2A 5IIJA 4NL9C 4MFCA 3B6XA 1MQ1A 5J3XA 4CFQA 4DFJA 1UHKA 2JZBA 5AKJA 4U8DA 3RAXA 3K4GA 2B21A 1TRFA 1QLSA 2PYQA 3ZNIA 1M39A 5KT2A 1DTLA 4USLA 3KHRA 2QEVA 3NXAA 2KKPA 3D73A 1CDLA 2EANA 2LMUA 1BPDA 3OSPA 4QZCA 1ZQKA 1J7OA 3JPPA 4QIWF 1F0MA 5EE3A 1XFXO 3QUCA 3S0AA 9ICWA 1PK3A 4J9RA 3V2LA 2L98A 5I2LA 4RQ7A 4PGYA 3GV5B 8ICVA 4EZ9A 1S0VA 2JEFA 3B87A 4WJ3B 2ISPA 2LHLA 4PALA 2WCLA 4KN4A 2QPTA 3O6BA 3D74A 5AM5A 4RQ3A 3L47A 2KOTA 2D8CA 4YI9A 4I5NB 2WOSA 2G07A 1PZNA 4M47A 4RUAA 4F92B 3AAJA 5L1LA 4QJ5B 2IHMA 2WC8A 1SMGA 2G0AA 8ICRA 1K93D 4AYBC 3A8RA 2XIDA 1T3QA 1NK7A 4QZDA 1QIWA 2FDRA 3QU5A 4I2AA 2QARB 2B0CA 3NGDA 2HHQA 2EZYA 1BNPA 1K8UA 3N7SC 3L4AA 4DL2A 3HW8A 4QZAA 2YGUA 4Y2VA 5KFHA 4M6WA 1S0NA 5KFXA 5F6TA 3L4PA 1RJVA 3ZDAA 4R65A 4JMUA 2JT3A 2KGBC 5ALFA 5KSZA 2ASLA 8ICQA 4B9UA 2FI1A 4C0LA 4EYHB 2DPJA 1PVQA 3T5HA 4KLGA 1DF0B 3GK2A 4O5CA 3UXNA 1UT8A 2LNKA 2W55A 1ZQRA 2QKQA 2MUTA 1KEJA 4RT2A 1RTP1 4DEZA 3H8MA 2HOIA 2KFZA 3WK6A 2Y1MA 3VRRA 1PVAA 1L7MA 1C7VA 1OOIX 2M9NA 4WRIA 2AQ0A 2PMZF 2XI9A 3SIAA 5I94A 4U7CA 4ED1A 3N4MB 1SKWA 1YUSA 3RB6A 2OTGB 1S76D 4PGXA 1ZQXA 2BKEA 4GPLB 5D7FA 2EZXA 4L9MA 1COOA 2W9AA 2JEIA 4MBEA 2YB1A 1RQNA 3PSPA 2OH2A 4YD2A 5ALJA 4GGFA 4QWBA 3WK9A 2KJ9A 1DJHA 1L7NA 3SR6A 4Y2PA 3DD4A 3IF7A 3VRQA 3GIIA 3C29A 1PUZA 1ZQ1C 4KLSA 1ZJMA 4GXJA 1AUIB 3BQ7A 2KLDA 5L1MA 2A1JA 4BUGA 3ZDCA 1OOFA 1TCFA 5AI8A 2HHSA 4Y2UA 2JPOA 2XY6A 4B9MA 4ELVA 4AYBF 4M2OA 5DICA 1L3VA 4NY8A 1RQLA 3TQ1A 1LKYB 2ZN8A 1XS9D 1KRPA 3C1VA 2L4HA 2W9MA 2JXCA 1RZTA 8ICJA 4NLCA 1OE9B 3GK1A 1IG5A 3PFVA 2Z7JA 3SAGA 3R1PA 2FPKA 2K2AA 1C7YA 1OQPA 4RPYA 2J6TA 5DLGA 1U47A 5KFOA 1DJIA 3M8RA 2HQ8A 4KYNA 4I29A 1PALA 5KTQA 1XO5A 2LYHA 2QB0B 4LVSA 8ICNA 3CZ2A 2E1EA 2JEGA 2RP5A 3OBVA 4UAYA 5DQIA 2WB1C 1NKEA 1TIZA 3WKEA 2XC9A 9ICIA 1XK4A 4M2YA 1N62A 3RJHA 1Y1UA 1CFCA 3NRWA 3UMGA 3ZDDA 1G8IA 4OZDA 4F4ZA 4QZEA 2ZKMX 4QZIA 2FCDA 5AK5A 1ED1A 1SZHA 3QZ8A 4USAA 2F77X 4Q43A 4GGNA 3TADA 2KIWA 2DKXA 1C07A 5KFBA 2KOBA 3E0FA 3LVWA 2EDUA 3IV6A 5KFFA 2BE4A 3PW7A 1QTMA 4PHNA 8ICBA 4PE0A 1L7PA 1Z00A 2ZJ5A 1RYSA 2HQWA 3Q8LA 1KQVA 4Z6DA 2FE9A 4J03A 5KT7A 5ALXA 4ICBA 3KHHA 2D6FC 1DELA 1RM6C 1SWWA 3GU3A 5KFCA 3NUQA 1S6CA 2DFLA 1SK6D 3I5HC 3SG5A 3VGOA 4DOBA 4DQSA 2H3VA 3KHLA 4TQRA 2MSNA 3EZ5A 4DL5A 4IJ7A 3OX5A 2W9BA 1ZRNA 3AN1A 4CF5A 3T5JA 2EC6B 2K60A 1B47A 3LYSA 1X66A 9ICFA 4Z6FA 2LHTA 4GIBA 4TNCA 3BYAA 1TNPA 4A4CA 1NK0A 4HREE 2KFFA 1WWUA 2NRXA 3NGVA 3M6KA 2V9WA 2I1QA 4F4KA 1SZPA 3V7JA 1WWVA 3PR4A 2MBXA 7ICVA 4ECRA 3J81j 1S9FA 2PI5A 2K61A 4DFPA 2MJWB 5DB7A 4DQRA 1UQVA 5ALYA 3T5LA 4C8KA 4NDCA 3H8SA 4HSZA 1ZD3A 5KFTA 3NASA 5KAFU 1GO3F 2R8HA 4AOMA 3C5FA 5JUMA 4ECSA 4O0IA 5AK6A 2PXIA 3AKBA 3M8SA 2XCAA 2JRFA 1WG8A 3EUB2 2L4IA 5KFYA 7ICKA 5DBBA 3FDSA 1SNLA 3NSKA 4UPGA 4ED8A 3KZIU 1AJ5A 2K8MB 1DK3A 5JJGA 5ALWA 2JXJA 4CPVA 1UHIA 1TNXA 2YQEA 8ICKA 3M7DA 5DBCA 3BDPA 3PY8A 2KFHA 3KEVA 2BCVA 1XWLA 5J2IA 4JWQA 3ZD9A 1D8LA 1ZXIA 4UB2A 3G6VA 2W7PA 5FI2A 2BQ3A 1UT5A 1OSAA 1KL9A 1BGXT 5FI7A 3QUTA 1KFUS 1OUQA 1K90D 4RQ5A 1XU4A 2QLTA 4I2JA 2C22A 1KFUL 2NYVA 5L1JA 5GTHU 7ICIA 2NV3A 3VC8A 1B4FA 9ICQA 4ELTA 5KFUA 4ECWA 1A4PA 2W54A 3PX0A 4YR2A 1SY9A 2DL0A 2BCUA 2H3QA 2UVUA 2KK0A 4C7YA 1OMVA 2OM6A 2IS9A 4FO6A 1ZQLA 3PM8A 2YMPA 5KFZA 2ZUBA 1DJYA 1QTXA 2GLEA 5ALOA 5D69A 1RFJA 1JXEA 4IQWA 1HIWA 1RDFA 1NK8A 1YTZC 4WQ3A 3WU2U 3CABA 1KK7Y 4BWJA 4OVNF 5J2JA 1CDNA 1SL9A 3ISDA 2VA8A 4KLMA 2WCBA 2WHEA 1BPBA 2BQUA 5IILA 2PFOA 3RJEA 4GXIA 8ICTA 2KLEA 4ECTA 1MF8B 4PZOA 2QARA 1N60A 3AQEA 1TK5A 1DRGA 2DQNB 4IC9A 3IQOA 4TUSA 4OCZA 7ICTA 3FE8A 2F8PA 5DG9A 1L3SA 1SL8A 2JWWA 2WC6A 4J9KA 2ZIUB 4PE4A 5DB8A 1NKCA 1WRKA 3OB1B 2RGIA 3UO9A 1CRXA 4NJ8A 4GFTA 5ALUA 3NSOA 3M9NB 1SCMC 2LMVA 9ICSA 2YB4A 3PATA 3RLZA 2ZIWB 1DF0A 1QVIZ 4DLGA 2Y1NA 9ICXA 1DMOA 2BCSA 4MVFA 3TDZA 7ICOA 2I18A 8ICWA 3ZD8A 1DEKA 3ETLA 1B0XA 4NLGA 3BFHA 4OD0A 1SXEA 5F9NA 1ZQIA 1QWVA 2LVVA 1E8AA 2G9BA 4ECQA 1XC9A 2PI4A 3PMNA 1K94A 3AKAA 2KI4C 4RPZA 1JSAA 4DOCA 2K4HA 4C8MA 3BQ0A 1RYRA 2YTUA 4UB1A 5DQHA 1MQ3A 4KMOB 2W3SA 1XNSA 2ZXIA 1DXSA 1S97A 2E8PA 4F4WA 4P0PB 2FLLA 1CDPA 1GGZA 1ZFSA 1JXLA 5DKQA 5AERA 2FMPA 4F5NA 4IRDA 4UB3A 2VIXA 8ICPA 3WHUB 3QYPA 3LL8B 1JF0A 5HLVA 1CLBA 3DV9A 2LVJA 1TFRA 4UAZA 1IXRA 3F53A 3PW4A 2BCQA 5KFAA 3DF0B 4CRXA 4C4TA 4ZCVA 3TUYC 4GXKA 1NK4A 1CFPA 1B8LA 1QJTA 3SENA 9ICJA 2PFPA 2ZIXB 1NPQA 5DLFA 4M2QA 3H4DA 1LA3A 1K1QA 4JPZB 3G6XA 4O3PA 4DL6A 4C8LA 1OXJA 1F55A 1O03A 4RQ8A 2K7BA 2H61A 3SS3A 2WTFA 4KLJA 4F7FA 5CA7A 3VRNA 3TI0A 2L2EA 3ZDBA 1BF5A 2P35A 2ZXHA 5H2FU 3CNHA 4NXZA 4QZ9A 4OCIA 5HKWA 4ICAA 4QWAA 3CZ1A 5ALDA 3QE9Y 4LZGA 3ISCA 3O4YA 3MFHA 4XYNA 1B8CA 3A0HU 1MWNA 2QB0A 1JBAA 5F3XB 2IHNA 4UASA 5HR7A 1ZQWA 4Q45A 4XJKB 1KK8C 4XQ8A 3TAQA 2F2OA 3LK1A 5AK3A 4GGFC 1XFWO 1W9ZA 3AAKA 2KJ5A 2HHVA 4MFAA 4F50A 3AUOA 2L2CA 4DWIA 1OMRA 2NRWA 1T14A 1XSPA 2KV2A 1K9UA 1NKBA 2AUCA 1VLBA 5AKYA 3OJUA 2H3FA 5J0OA 3CR4X 5DQGA 1Z1BA 1TAQA 2ZUCA 3NRZA 5CSIA 1DJGA 5ALGA 7ICRA 2HSZA 1NK6A 2SCPA 3OHMB 3CZTX 4F2SA 1Y1AA 4KX3A 1CLMA 1P7DA 2JMGA 3GQCA 2OPOA 2BNXA 2E8MA 3FYHA 5HNKA 2V53A 1ZMZA 1EG4A 4ETOA 4YMOA 1XFZO 1OOHA 4QJ4B 1FIQA 3PALA 1OMDA 3K75D 3H8WA 1NZBA 4PE1A 2QEBA 2FJYA 2COLB 3C2MA 5IIIA 5KFEA 4YP3A 2ZFDA 4ECYA 1X02A 1FFVA 3IRUA 3CRXA 1XK4C 1DC1A 5J2DA 3RRGA 2AGOA 1O08A 1S36A 1X42A 4UAVA 4G3IA 1XYDA 1OW4A 1QQ7A 2EAPA 1XVJA 2DWQA 3TADC 1NX0A 4O5EA 3EPGA 4I2GA 2BL0B 2DBYA 3SS4A 4RNMA 2R8JA 1A2XA 1ZD4A 4I2FA 1H8BA 1CM4A 3KKAA 4QW8A 3FIAA 2BPGA 1L2OC 1JALA 1K1SA 2ISOA 1LXFC 5EE1A 2W03A 2KJ8A 1KLNA 1J1EA 4JB3A 4NM1A 2HI0A 4O3OA 2YN4A 4QZHA 1PK0D 1U48A 2LM1A 1TWOA 3HPOA 4R1EA 3ICXA 2KHQA 2Y9TA 4F93B 5KFJA 2NZ0A 5J2EA 1L3TA 2I5HA 1A76A 1M6YA 4ECVA 5KFMA 4UARA 4ORBB 2BQRA 2LPEA 2F3ZA 3OGNA 3WNXB 3I5GB 1Z4HA 1KDHA 2OHFA 3AQFA 3NVWA 7ICMA 2K7CA 2CNPA 1MR8A 8ICLA 3B7AA 3CDNA 4CNQA 1IJ5A 4AQIA 4O9MA 1JMSA 3PMLA 8ICGA 4DL4A 2CCMA 5AM0A 3ZDEA 1D9DA 3IDWA 4JQ0D 2E6WA 3WK7A 1RWYA 2KPHA 5D46A 4B9SA 2KAXA 1QS7A 8ICSA 1SBJA 1JC2A 1IV8A 4UATA 3TKAA 5C5JA 3VCBA 5DDMA 3PSTA 9ICTA 3MDAA 4F71A 2P66A 1C20A 4GC7A 3MSEB 2F33A 2WCHA 2OYYA 4KLTA 4FZNA 1OZSA 4CF3A 2K7OA 2PASA 1W7JB 8ICYA 3RH6A 1JN3A 2ZNDA 1KW4A 2BECA 1NI3A 1ZOLA 1JWDA 4DL3A 4ECUA 5DG7A 4DF8A 3GOFA 1KBUA 3N7HA 5CP2A 2LVKA 2WCFA 5KFIA 1ALWA 2HMXA 2A1AA 4INXA 3UM9A 4MEXA 2LVIA 2ZIUA 1HQVA 1ZQBA 1W7IB 1Q3UA 2WORA 3GV7B 9ICPA 4M0AA 2G5HB 3EW9A 3EK7A 3PX4A 1WCLA 3AU2A 1DT7B 5AXIA 2VJ5A 4O3MA 2LP2A 4J9QA 2RQ5A 3G6YA 7ICUA 1CM1A 3PSRA 1ZQCA 2I94A 3VB1A 3PSIA 1N0YA 5HHHA 5AM3A 3EYZA 3R1VA 1HUZA 5HL1A 5JTIA 2A4JA 2AMIA 3QZ7A 4Q04A 3FM9A 4YMNA 2EGDA 2QDIA 2C28A 2E3TA 3H0MB 5KG7A 1X6IA 2KVSA 1U5IB 3IN5A 2MA2A 1EL4A 4C0KA 3N97B 1DOQA 3QU7A 4GLXA 4P4MA 1MUXA 4YRUA 9ICCA 8ICUA 1Q46A 2VKQA 3OJSA 3D2NA 1XSNA 8ICOA 2M0RA 1PVPA 4PT1A 1Z4OA 4YMMA 5A0LA 2M3WA 2CBLA 3QUQA 3B0XA 3AMZA 4I5LB 5HYDA 2R18A 4P0PA 1S6IA 3B88A 2Q4UA 5J0YA 1NNLA 5B5EU 4DSFA 1S5GZ 1JFJA 2ISDA 4PPXA 1CKKA 5G5GA 4FZLA 4XUSA 2FMSA 3PO4A 4Y2YA 3DF0A 2LP3A 4KLFA 1ZQUA 4P4PA 1F4QA 1ORGA 3RRHA 1PULA 2BBMA 3SV4A 3DYEA 2AH5A 3KTQA 1FBVA 4DQQA 4JV1A 2HBKA 5J0XA 2CPRA 2NO4A 4R66A 2RDIA 2H5XA 1M63B 2BAPA 1CNPA 4DUQA 4IR9A 2FPLA 2KE7A 2ZNEA 1S5LU 4BXOA 2D8NA 4NWIA 4F4XA 3MDCA 3DVKA 5KFKA 1B7TZ 4I2IA 3WKAA 5J2AA 2LV7A 1MC8A 3CZ0A 1N5XA 2KZ3A 2DGZA 2WAQC 4A8EA 3H0LB 1H38A 3SV3A 2OXOA 4Y2JA 3PN7C 5AM2A 1UURA 2L5XB 5J8YA 1ZACA 3I28A 5KFLA 1ZQSA 1SR6B 3ALRA 4XJKA 1S26D 1BPZA 8ICEA 4JUZA 1ZOTB 1TK8A 4IQTA 4O3NA 3RTVA 2KQ6A 2Y4QA 9ICVA 2WF5A 3D0YB 3TARA 1P28A 2SASA 4MF2A 1UA0A 1SKRA 2DOQA 3I5FB 3S0DA 2EAOA 4C8NA 1F8HA 5TNCA 1NOMA 5I2OA 1N65A 2MLFC 3HKZC 4UAUA 4Y2TA 2M7LA 1KFXL 5GQQC 4I2DA 3GFKB 3EWAA 4DFMA 1XFYO 5HKZA 4OKHA 3SG6A 5PALA 3HX0A 3PO5A 3JTDC 2MLEC 1CI4A 3PNCA 2WF8A 4PJ0U 5JRTA 2PSRA 2JU0A 3RM1A 3UMBA 4KLOA 3CGAA 3JPNA 3WK8A 1T3NA 1CFDA 3GILA 1QQ6A 3B9JA 2CN1A 4YCXA 2JPTA 1GM0A 1KFTA 4BJQA 1CUKA 3A0BU 4GUKA 5KFGA 1NK5A 4JD9A 4DQIA 1X9WA 3IQQA 2BCAA 2LCPA 4EX7A 1S3PA 3ORYA 4MZKA 4IRCA 1BR1B 2KNEA 4PH5A 2OS8B 2WCKA 2WCEA 4N1FA 4OJPA 1QV1A 3RJGA 2L0PA 1J7QA 2P6UA 1H4BA 1T7PA 2M29A 4PHKA 4P0QB 4CFRA 2EQYA 2WAQF 1G4YR 4US9A 2M1KB 1XFUO 1WLMA 5DKNA 4GBAA 3D78A 2P70A 2V4RA 2LM4A 9ICNA 1BLQA 4J9PA 1CMGA 1QV0A 3V7KA 1LS8A 3A4UB 1CB1A 1SKSA 3VRPA 2JT8A 5AFPA 4QZFA 2N1RA 4N1GA 2GO7A 2KKVA 1R2UA 5HMMA 2KZZA 4F5RA 1EXNA 1DGUA 2WB1F 4F4YA 2JH1A 3HKZF 2KN7A 3C28A 3CS1A 1XSLA 2HF5A 1MSWD 2KQYA 1L8OA 1NX1A 5BOLA 5AI5A 2KDHA 5ALTA 2BCRA 2KAVA 2WF7A 1EXRA 1SL2A 2EC6C 2KNJA 3KBBA 3R1OA 1QX7A 4ED6A 2J6SA 4ORCB 3BXKA 3L5KA 9ICHA 5EOZA 1JUOA 5D3OA 4PL1A 1BPEA 2E8NA 4UB8U 5AKHA 1KQQA 2ZTEA 2F2AB 1YX7A 3EG5B 3DEEA 1ZQZA 5AK4A 3OX6A 3AEVA 3WKDA 4DFDA 4ECZA 1NP8A 2ZUDA 3BQTA 1JI7A 1LB2B 5J2GA 1BG1A 1TNQA 3SG2A 3KKAC 3V6HA 3FAHA 4G9BA 1WRZA 5DGBA 2G09A 3JVTB 3NSIA 2MHHA 3PLFB 5IBWA 1FI6A 1T94A 2XGPA 5IINA 5FP0A 2W8KA 3EKHA 2GV5A 4PGQA 2JZBB 3TS5B 2LMRA 2UVRA 1J1DA 1DK2A 1YUUA 1PSRA 2AGPA 5J0WA 1SL1A 3BUNB 2F1JA 4ELUA 2M97A 1NJZA 2HHTA 4M9LA 5CSNA 1RG6A 3D2SA 4NV0A 1BODA 4JV2A 4QJFB 4Z6CA 4QZBA 4EYIB 1OOGA 1SCMB 2YMQA 5AKXA 1V9PA 4MZLA 1IRJA 2HOFA 3GV8B 2IBKA 2UVWA 1IKUA 4YXJA 1KFDA 7ICLA 2HCFA 4P2YB 4NLBA 1COKA 1TCOB 4P4OA 3OB2B 1V1FA 2B1UA 4F0ZB 3DY9A 3N28A 1CEZA 4RQ2A 3Q8IA 1EH2A 3JPOA 1Q8KA 4UB5A 2ES6A 5TZVA 1J97A 3WK5A 3PW5A 1M45A 2LAPA 5I2QA 3AM9A 4RNNA 1U5IA 2G5IB 7ICQA 3K1RB 1WYGA 5ALHA 4YGAA 4LJXA 4PHAA 2MRLA 4EBCA 2ZJAA 3D77A 3RB4A 1BT6A 4F5PA 1NJYA 1UP5A 4KX5A 2LANA 3FE9A 2ERBA 1UHJA 1RXVA 2WC5A 3PV8A 1CDMA 4XRHA 3JPQA 3RJFA 4KLLA 3C1ZA 4C4RA 2R8IA 5DBAA 4RQ4A 2VJ4A 4I2HA 1IQ3A 4WQ2A 5AKEA 3TUYB 1RECA 1T4GA 1QLNA 1IM4A 3RH5A 1A77A 1UPHA 4P2HA 4OR9B 2HETA 4DSJA 1KQMC 5ALEA 2A3VA 1KSMA 5KT5A 4MLWA 4DQPA 2KBMA 1A03A 1Z19A 1DJXA 1Y6WA 1JROA 4C0JA 2KEYA 4CGZA 5KNIA
chains in the Genus database with same CATH topology
2KSOB 1JI7A 5JRTA 3SEIA 2KG5A 2K60A 1X66A 2D3DA 1Z2CB 3BS7A 3KKAC 1X40A 2QB0A 2KLEA 5F3XB 2Y9TA 4PZOA 2QARA 1SV0A 2F8KA 2EANA 2L5YA 4PZNA 1LKYA 1WWUA 4NL9C 1F0MA 4MEWA 1WWVA 2LMRA 3BQ7A 1X9XA 4I5LB 2KLDA 3IVTA 5L1MA 4IJ7A 1PK3A 2LPEA 3BS5B 1SV0C 1W9ZA 1PK1A 1UQVA 2JV3A 1Z4HA 4JKTA 2B6GA 3UO9A 1OW5A 4NJ8A 3TACB 1LKYB 1RG6A 5JTIA 2Y9UA 2ESEA 2KIVA 3IDWA 1DEKA 2D8CA 4MHVA 1B0XA 4I5NB 4GBAA 1SXEA 2BAPA 1COKA 2BNXA 3O4XA 2E8MA 4GAOA 4KYNA 3KEVA 2KE7A 2QB0B 2QB1A 2QARB 2EAMA 3OBVA 2ES6A 2DKZA 2KSOA 2F3NA 2YTUA 4RQMA 5FI2A 2YGUA 3K1RB 5FI7A 1DXSA 1KW4A 2E8PA 1SGGA 4IS7A 5JU5A 3SS5A 5J8YA 1PK1B 1B4FA 1SV4A 3HILA 3TADA 5FI6A 1V85A 2DKXA 1DC1A 1Z1VA 2DL0A 5J8YC 3BS5A 2EAPA 5D3OA 2EAOA 3SENA 2F44A 3TADC 2QKQA 1UCVA 2E8NA 3H8MA 2FE9A 4NL9A 2GLEA 2KMDA 2K4PA 1DELA 3SS4A 3UNWA 1OXJA 4I5KA 3EG5B 3SS3A 4I5JA 1V38A 4RQNA 3KKAA 2E8OA 3PM2A 5HL1A 5I94A 1SXDA 5KNIA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2KSO B;  1JI7 A;  5JRT A;  3SEI A;  2KG5 A;  2K60 A;  1X66 A;  2D3D A;  3BS7 A;  3KKA C;  1X40 A;  2QB0 A;  5F3X B;  2Y9T A;  4PZO A;  2QAR A;  1SV0 A;  2F8K A;  2EAN A;  2L5Y A;  4PZN A;  1LKY A;  1WWU A;  4NL9 C;  1F0M A;  1WWV A;  2LMR A;  3BQ7 A;  1X9X A;  5L1M A;  1PK3 A;  2LPE A;  3BS5 B;  1SV0 C;  1PK1 A;  1UQV A;  2JV3 A;  2B6G A;  1OW5 A;  4NJ8 A;  3TAC B;  1LKY B;  1RG6 A;  5JTI A;  2Y9U A;  2ESE A;  2KIV A;  3IDW A;  2D8C A;  4MHV A;  1B0X A;  1SXE A;  1COK A;  2E8M A;  2KE7 A;  2QB0 B;  2QB1 A;  2QAR B;  2EAM A;  2ES6 A;  2DKZ A;  2KSO A;  2F3N A;  2YTU A;  4RQM A;  3K1R B;  1DXS A;  1KW4 A;  2E8P A;  1SGG A;  4IS7 A;  5JU5 A;  5J8Y A;  1PK1 B;  1B4F A;  1SV4 A;  3HIL A;  3TAD A;  1V85 A;  2DKX A;  1Z1V A;  2DL0 A;  5J8Y C;  3BS5 A;  2EAP A;  2EAO A;  3SEN A;  2F44 A;  3TAD C;  2QKQ A;  1UCV A;  2E8N A;  3H8M A;  2FE9 A;  4NL9 A;  2GLE A;  2KMD A;  2K4P A;  1OXJ A;  1V38 A;  4RQN A;  3KKA A;  2E8O A;  1SXD A;  5KNI A; 
#chains in the Genus database with same CATH topology
 2HHU A;  1NZP A;  3IHQ B;  1AP4 A;  2FJU B;  2I9G A;  3K1E A;  3QU2 A;  4GC6 A;  2RHF A;  5J0T A;  1D9F A;  4INW A;  3C2K A;  5BPJ A;  2D3D A;  5J2B A;  1Z2C B;  1K2H A;  1JX4 A;  2W04 A;  3I5I B;  5BOM A;  3QEA Z;  2ATL A;  2GOL A;  4DIR A;  1LKY A;  1QX2 A;  1MN8 A;  2K0J A;  2FPM A;  4YR3 A;  4IR1 A;  5ER5 A;  2AGQ A;  2ZRT A;  1NJW A;  4RQ0 A;  3D2Q A;  3BS5 B;  2KP7 A;  4DSI A;  3AL0 B;  5KG0 A;  4YXM A;  3BUO B;  2H2K A;  4YR0 A;  1OOJ A;  5ALV A;  2Y1I A;  3D0Y A;  1YX8 A;  2CTN A;  3TDU A;  2ESE A;  2KIV A;  1FEZ A;  5KFW A;  1NUB A;  3F5A A;  1MHO A;  4M9G A;  2HBL A;  4J9L A;  1WLZ A;  1ZQH A;  1UHN A;  3QME A;  4FFD A;  3RBD A;  3R9K A;  3KPX A;  1BPX A;  4DS4 A;  4PHE A;  2WF6 A;  5C0Y A;  1JRP A;  4GAO A;  4MN0 A;  4ED7 A;  2C2R A;  4CE6 A;  3PW0 A;  2KSP A;  2P6B B;  2BDP A;  2YX8 A;  2JRZ A;  1GQM A;  2LI6 A;  4M2P A;  1JIH A;  4RQM A;  4EEK A;  1KK7 Z;  2RLT A;  1ZQD A;  9ICG A;  3BQ1 A;  5ALN A;  1J2N A;  3HRD D;  4PHM A;  1K5O A;  4KLQ A;  4X5V A;  1SV4 A;  2W7O A;  3NS1 A;  3B0Y A;  2IOF K;  3R72 A;  3IP4 B;  3RFA A;  5F9L A;  1QSY A;  1U9L A;  5J8Y C;  5KT6 A;  3BQ2 A;  2NLN A;  4QZG A;  4ED2 A;  2XVT A;  1TAM A;  2F1I A;  3SJS A;  1CFF A;  3KHE A;  1XA5 A;  4FBU A;  1YRT B;  3RR8 A;  1S6J A;  4E68 A;  1V97 A;  4CF4 A;  8ICC A;  3L4L A;  4P0Q A;  1ZD5 A;  3U26 A;  5J29 A;  4RQ1 A;  4K4I A;  3ZI4 A;  5J0P A;  3VRO A;  7ICE A;  2BHN A;  1XO0 A;  4YBH B;  2W8L A;  2JNX A;  1L2O B;  1QAT A;  4MRX A;  1DGJ A;  2NRV A;  4F5Q A;  3NSL A;  5CHG A;  1JF2 A;  2FCE A;  1VJ5 A;  3BS7 A;  1DQE A;  5AIA A;  1C3Y A;  4F5O A;  5J0Q A;  1JUD A;  4C0Z A;  3EKJ A;  1SV0 A;  1LIN A;  2KD1 A;  1SCV A;  1K96 A;  2F8K A;  5IIO A;  1NCY A;  3TZ1 A;  2K4E A;  3PZP A;  1B22 A;  4QIW C;  1BVS A;  4KLD A;  1RRO A;  2KFG A;  2PKE A;  2Q4T A;  2BDU A;  3V72 A;  3RF9 A;  4MEW A;  2OCE A;  2W9B B;  8ICA A;  4PHD A;  2PFN A;  1B4C A;  2ZIV B;  9ICE A;  3D10 A;  1ZQV A;  1N2X A;  4MZJ A;  2E30 A;  4Q44 A;  1WDC C;  3H7I A;  2B6G A;  2FLP A;  5CEH A;  4OJ5 A;  4TUQ A;  2PRU A;  4EBE A;  4RUC A;  4UAW A;  1VRK A;  1LA0 A;  1YVL A;  4K4G A;  5D49 A;  4RPX A;  1ECW A;  3MR5 A;  1S8O A;  5KG3 A;  1AK8 A;  3DVE A;  7ICS A;  8ICF A;  1ZYQ A;  1YVH A;  1BR4 B;  4IL1 A;  1TKD A;  1S77 D;  2HVH A;  2NXQ A;  4PDZ A;  4DF4 A;  1TTX A;  2KI6 C;  1J2M A;  1SSE B;  3C23 A;  4Z6E A;  1A75 B;  3BUW B;  3ED5 A;  4O3R A;  1TUZ A;  3C5G A;  1F71 A;  2F8L A;  2JT0 A;  1YRU B;  4DSK A;  2LM5 A;  4I2B A;  4AQJ A;  2UVV A;  2BE6 A;  2XO7 A;  5AEQ A;  2F3N A;  5G5H A;  2JH7 A;  5EE0 A;  4C4S A;  3NVZ A;  1X2I A;  4RNO A;  3CW2 C;  1J7P A;  1ZQA A;  2GTE A;  4M9J A;  3FS7 A;  4PE7 A;  3GDX A;  4R64 A;  5TIS U;  4RU9 A;  2C2D A;  5G08 A;  3HP6 A;  1D8Y A;  1MQ2 A;  4BWM A;  5FYX A;  2E5S A;  4JV0 A;  1D8B A;  5KFQ A;  2LUX A;  2IOF A;  4ZCU A;  2NCP A;  1IWQ A;  4PCW A;  4D1E A;  1LVH A;  2MU2 A;  1A0P A;  3QU4 A;  4ECX A;  4Y2X A;  1KWO C;  3Q8Q B;  3HWT A;  4EBD A;  1ZQE A;  3I76 A;  2BCB A;  1QAS A;  3K21 A;  3QU9 A;  3UQ2 A;  2G08 A;  2RDJ A;  5KFV A;  3NVV A;  4K4H A;  3SG7 A;  4QWE A;  3ISB A;  2PMZ C;  3I5G C;  2MRD A;  2FLN A;  2IA6 A;  1DJZ A;  3LVV A;  2IMW P;  1SYM A;  3KD3 A;  4QWC A;  1A29 A;  1C3Z A;  3NHI A;  8ICI A;  3H8J A;  3E58 A;  5ALI A;  2VRG A;  2JR5 A;  2NRZ A;  5KG5 A;  2ODG A;  4UQG A;  5AKZ A;  1F54 A;  5EWE A;  3CP8 A;  3EPI A;  4KMU A;  4IQU A;  4RT3 A;  2EHB A;  1BOC A;  5KL1 B;  2K4I A;  1BJF A;  3RZS A;  3N7P D;  3S0E A;  4PZN A;  2NO5 A;  5DB9 A;  1TUJ A;  3CR5 X;  4O5K A;  2ZIW A;  3QNM A;  1TVA A;  4DRW A;  1X9X A;  1PVR A;  3EVR A;  2CT9 A;  3HT3 A;  3DVJ A;  2ZTD A;  3D75 A;  5DB6 A;  4JKT A;  4IQV A;  3M9O B;  2M49 B;  1VDV A;  1U4B A;  2HHW A;  4OV2 A;  5HLO A;  4JWN A;  4JK1 A;  4B9V A;  1GGW A;  3BOW B;  1ZQP A;  3GZF A;  2EH9 A;  2HPS A;  3MR3 A;  2JTZ A;  2BR0 A;  1SPY A;  2W43 A;  3MC1 A;  1TV9 A;  5DG8 A;  2WFA A;  4N5X A;  1ZQY A;  4J9O A;  1N56 A;  2HVI A;  2LC5 A;  1K9K A;  3S0B A;  2AU0 A;  3EK8 A;  3CTN A;  5IIM A;  1YUR A;  2JTT A;  3UQ0 A;  3FWB A;  5CR0 A;  2QEH A;  4CDG A;  1SWV A;  2MAX A;  3THV A;  3LK0 A;  3ONN A;  2G2B A;  2ZTC A;  1MXL C;  4CLN A;  2AHO B;  3DZT A;  4DS7 A;  2F76 X;  2DKZ A;  2GH1 A;  2V4Q A;  1L7Z A;  4C80 A;  5CSF A;  2M9G A;  4QZ8 A;  2KI6 D;  1ODB A;  3Q8P B;  1AHR A;  4ZOH C;  2Y0S C;  1NYA A;  2TN4 A;  5JU5 A;  3RB0 A;  1ZQJ A;  4FS2 A;  4TQS A;  3PR5 B;  1ZUZ A;  2ZIX A;  3F2C A;  3PN7 B;  2K8B B;  2JXL A;  4FS1 A;  1IIO A;  4E0D A;  3SAF A;  1XFR A;  2VAN A;  1Y0V H;  1ZQT A;  3SZ2 A;  5AI0 A;  3NHT A;  3WKC A;  4LZD A;  1L5U A;  3BS5 A;  1GJY A;  1KKX A;  1WY9 A;  2GGZ A;  2LMT A;  3O2P A;  1QXP A;  2F44 A;  9ICO A;  1UWO A;  3F2D A;  2MA1 A;  4NM2 A;  2I2R E;  4F91 B;  1FI5 A;  5K89 A;  2JOJ A;  2KMD A;  3GK4 X;  4MF8 A;  3WK4 A;  4F72 A;  5CRX A;  1TNW A;  4BY4 A;  2PMY A;  2QAC A;  2K89 A;  4NDD A;  3Q8R B;  1SL7 A;  1NCX A;  2OTG C;  1M46 A;  2E8O A;  3OHA A;  1SXD A;  2Q0Z X;  3HJE A;  5AIB A;  3TAP A;  2KSO B;  3C1Y A;  1YZ6 A;  1ARO P;  1DGS A;  3DXL A;  3JTD B;  2JQ6 A;  3AU6 A;  4OJL A;  2WND A;  1YR5 A;  3WHT B;  2BBN A;  2W3R A;  1QCK A;  4OJO A;  3RBE A;  2P71 A;  1J7R A;  2W11 A;  2BZF A;  1KFX S;  2HW3 A;  2F2P A;  2ZG6 A;  3PVX A;  3LCP C;  2EZZ A;  4IL6 U;  3C2L A;  2KGR A;  3I5H B;  5KU1 A;  5KTY A;  2FJ6 A;  3OHB A;  1ZET A;  4DCK A;  3F2B A;  1K95 A;  3S0G A;  1N63 A;  3GIK A;  8ICM A;  3LWM A;  1OW5 A;  5KL8 B;  1NK9 A;  5L1K A;  2DF4 B;  3MGH A;  4YGD B;  2H61 C;  2LLS A;  5KFP A;  2KHN A;  3EK4 A;  1SIJ A;  2Q91 A;  2Y9U A;  2M7N A;  5AAN A;  3D76 A;  3IG5 A;  5BPC A;  4MRY A;  5DDY A;  1IGV A;  1SR6 C;  3PX6 A;  1ZQO A;  4A4B A;  2K7D A;  8ICH A;  4AP9 A;  5JOL A;  3UXO A;  2HDO A;  2Y0S F;  5ALL A;  3CYM A;  4MHV A;  4YGC B;  4YG2 A;  1KN5 A;  1HJP A;  2ASD A;  4DS5 A;  4FBT A;  3TFR A;  4GFJ A;  3KHG A;  7ICF A;  4NLZ A;  3HX4 A;  3LLE A;  1URJ A;  3I5F C;  1DJW A;  4DLE A;  3N7R C;  4B6J A;  1FF1 A;  2WCJ A;  2EAM A;  9ICK A;  1J55 A;  3LDA A;  5CJ7 A;  1T8E A;  3C21 A;  1YUT A;  2CXJ A;  5KG6 A;  2LYA A;  5AI6 A;  4EEL A;  4EX6 A;  2AXT U;  4IS7 A;  2LKY A;  2KZM A;  1PK1 B;  3HCM A;  4P5O E;  3HIL A;  1F4O A;  1LKJ A;  1QVI Y;  2BKI B;  3DVM A;  2LLU A;  4J9S A;  2LYB A;  3M1Y A;  3RB3 A;  4O3Q A;  1SRA A;  2ZIV A;  5AKL A;  1QLK A;  4UB6 U;  1MXE A;  1L3U A;  3PJI A;  4UW9 A;  7ICN A;  5L1I A;  1QX5 B;  4I27 A;  3UMC A;  1IJ6 A;  4NL9 A;  4KTQ A;  1NX3 A;  1DGV A;  4BGD A;  1Z4N A;  1ZRM A;  4BX9 C;  5ALP A;  3OTQ A;  4R8U B;  2FOT A;  1S0O A;  1AQ6 A;  2OS8 C;  3SMV A;  2RRD A;  4OO1 J;  2P6R A;  5KAI U;  2W9C B;  1A75 A;  3MFI A;  3SEI A;  1CMF A;  2K8C B;  2MAZ A;  3NTU A;  2XIC A;  1YT3 A;  1EJ3 A;  2F1H A;  1X40 A;  3GIJ A;  3BJY A;  3KFU F;  5ALR A;  1KSO A;  5KFR A;  5KT3 A;  3GIM A;  2HHX A;  5J0U A;  1XO1 A;  4YQW A;  4UBC A;  1JFK A;  5L9X A;  1M31 A;  2JHD A;  2C2E A;  1Z3E B;  4DO9 A;  4BDP A;  5EL2 A;  1SV0 C;  2YMM A;  1HUO A;  2BKH B;  2L50 A;  4C8O A;  3Q8M A;  1X9M A;  2QEO A;  1FPW A;  3ETR A;  5CPV A;  1X6J A;  5J2C A;  3JPR A;  4Y2R A;  1KFS A;  2H8V A;  1MA7 A;  3DDH A;  5DGA A;  1PRW A;  2OWO A;  1RK9 A;  3ZWH A;  4FZM A;  2E1F A;  3RJK A;  2M8U A;  2LE9 B;  2PAL A;  4HRH A;  5AM1 A;  2KTQ A;  4QWD A;  1D1O A;  1NJX A;  1WUD A;  2AQ4 A;  4DSE A;  5EWF A;  5KFN A;  3MR2 A;  4ED0 A;  5B8I B;  3BUX B;  2R8K A;  3SG4 A;  2K2F A;  2JC2 A;  2ZN9 A;  4QW9 A;  3LWL A;  4ACO A;  9ICM A;  3JPS A;  2WCM A;  4DCC A;  3CYZ A;  3FC4 A;  3JPT A;  2JUL A;  3NVY A;  3RR7 A;  3EVV A;  3RH4 A;  3WXA A;  3CLN A;  4YGB B;  5AHX A;  4UBB A;  1QIV A;  4BY5 A;  3EVU A;  4M9N A;  3Q8K A;  3RJJ A;  4DSL A;  1AJ4 A;  3V6J A;  2LUC A;  4FQO A;  4QNL A;  4XA5 A;  1Z1V A;  4YI8 A;  3B86 A;  4RQ6 A;  2KYC A;  2LHI A;  3KOO A;  5K4L A;  2CRX A;  2HOQ A;  2NCO A;  3JVT C;  1NSH A;  3OPX A;  2JNF A;  1Y88 A;  5HR6 A;  2I6X A;  5D4B A;  1L8L A;  1A6S A;  3IG8 A;  2KI4 B;  4NDB A;  1UCV A;  3TS5 C;  2H3Z A;  1CLL A;  2K4P A;  4UB4 A;  3BOW A;  1SL0 A;  2K8A A;  5EWG A;  5HML A;  4DOA A;  3T5K A;  9ICA A;  4PL2 A;  4I5J A;  1ZJN A;  3QRX A;  1S0M A;  1Q80 A;  1KQM B;  1QSL A;  5CB1 A;  5ER4 X;  9ICB A;  4NQG A;  4I2C A;  1ZQN A;  1R6P A;  1FO4 A;  1IG6 A;  5IIK A;  1TK0 A;  4M6W B;  2XGQ A;  2KG5 A;  5ALZ A;  4RZR A;  3QXG A;  1WRL A;  3S0F A;  3TAN A;  4NLK A;  2DUY A;  3M9M B;  1FW4 A;  4B9T A;  3SG3 A;  3T3F A;  1EG3 A;  4YVZ A;  3LK9 A;  3H4S E;  2BGW A;  2L5Y A;  4EEN A;  4KLI A;  5KT4 A;  2L51 A;  1QSS A;  1SKT A;  3TFS A;  3E3R A;  2XCP A;  2O6K A;  4TUP A;  3KZX A;  5AM4 A;  2JEJ A;  2JGA A;  2G06 A;  4PHP A;  1N2D A;  2CXY A;  2Y5I A;  9ICR A;  5B66 U;  2JV3 A;  4KLE A;  5J0S A;  3I1Y A;  1CTR A;  3H4B A;  5AIC A;  1N61 A;  2MUT B;  5HP4 A;  2HBM A;  1B1G A;  3SI8 A;  2LLT A;  3E2E A;  1RYU A;  3QX7 A;  5KFD A;  3BQ3 A;  2BCX A;  5DKR A;  2HBJ A;  2XY5 A;  4NLN A;  3V6K A;  5EE9 A;  4ZH4 A;  4J9N A;  2ZRS A;  2M1U A;  1C7W A;  3WKB A;  5HHI A;  4EEY A;  4J9M A;  3BZK A;  3RJI A;  2BPF A;  4F3O A;  2PFQ A;  1KSP A;  1KTQ A;  3OP0 A;  1LV5 A;  1QH9 A;  3QUB A;  1KK8 B;  4CCH A;  3O4X A;  4YD1 A;  1NCZ A;  4DL7 A;  4JWM A;  2JZI A;  3BFA A;  2KSO A;  3BJH A;  1UA1 A;  1K9P A;  1RXW A;  2ZJ8 A;  1AVS A;  1PVB A;  2M0N A;  2A1J B;  3OSN A;  4Q8E A;  4I2E A;  3FWC A;  5AKK A;  9ICU A;  1PSB A;  3SS5 A;  5E79 U;  5KG4 A;  1HEK A;  1RPL A;  1S10 A;  3H0R B;  4BXO B;  5KG1 A;  3F45 A;  2O5G A;  2KBI A;  3PSF A;  3SQI A;  4KIT B;  4MFF A;  3BUM B;  3FE6 A;  1BPY A;  2A19 A;  3L3F X;  3I5I C;  2KHV A;  5ALS A;  1F44 A;  2IOH A;  4TUR A;  1OZO A;  3MGV A;  4Q8F A;  1ALV A;  1B8R A;  5ALQ A;  4KLU A;  2ASJ A;  2I7A A;  4YGE B;  5ALM A;  2YML A;  1U45 A;  4U6P A;  2R8G A;  1ZD2 P;  4I5K A;  7ICP A;  3D6J A;  3T79 A;  4I28 A;  2AJQ A;  1BNO A;  3RAQ A;  9ICL A;  2FMQ A;  2Y1J A;  8ICX A;  4O3S A;  4GNK B;  3MGI A;  3V7L A;  3KF9 A;  3M0W A;  2KFN A;  4FE3 A;  1BU3 A;  4US8 A;  1L6N A;  3ICB A;  2GWS A;  1HT9 A;  1F70 A;  1N5W A;  1V1G A;  2VA2 A;  3UXP A;  1X9S A;  7ICH A;  1NX2 A;  7ICG A;  1G33 A;  2KIC A;  1ZQM A;  5KG2 A;  4ED3 A;  2F3Y A;  4CID A;  1UHH A;  1TN4 A;  3SD7 A;  3KO0 A;  5AI4 A;  5CWR A;  3IVT A;  3OGU A;  3TDI A;  1F5S A;  1B43 A;  4C7Z A;  1ZQQ A;  1Z00 B;  2XY7 A;  1PK1 A;  3Q8S B;  1ZQG A;  1ZQF A;  1U49 A;  5AKG A;  1YZ7 A;  1WDC B;  3TAC B;  1Q3V A;  5AKI A;  2WF9 A;  2LBO A;  4YN4 A;  2R2I A;  4M04 A;  1BMO A;  5ALK A;  4MEY A;  4IRK A;  3BFB A;  1TAU A;  4QJ3 B;  1FFU A;  1L7O A;  2PQL A;  1XFV O;  1SW8 A;  5J2K A;  4Y2Q A;  3S6J A;  1IQ5 A;  4F2R A;  3O0F A;  4DFK A;  2GGM A;  1NIW A;  3O78 A;  3K1Z A;  4HAI A;  4OJ6 A;  2KYF A;  2OEH A;  1TOP A;  4FQT A;  4HYK A;  4R63 A;  1N48 A;  3F5E A;  3SAH A;  4R8U A;  5AI9 A;  2AAO A;  1IIP A;  2QB1 A;  2VA3 A;  2W9C A;  1WCN A;  1S1E A;  5CSJ A;  1SB3 C;  5GTI U;  3SIB A;  4F8R A;  1Y1X A;  1LVC D;  1S5G Y;  1SGG A;  1QQ5 A;  5J0R A;  3MAB A;  7ICJ A;  5J2F A;  2ALZ A;  1DVI A;  3CWG A;  4B9N A;  2H3I A;  2BPC A;  8ICZ A;  1NWD A;  5FI6 A;  2PVB A;  1V85 A;  5KFS A;  3CR2 A;  3IM1 A;  3MR6 A;  4Y2S A;  4YFK A;  4M9H A;  5HKY A;  5T14 A;  5I8N A;  3H40 A;  1KCY A;  4KLH A;  2KVC A;  2NRT A;  3UPQ A;  2YY6 A;  1IH0 A;  3M6Z A;  4PHJ A;  2BL0 C;  4B9L A;  1UUS A;  3SYZ A;  1KWO B;  4HRG A;  1TE2 A;  5J2H A;  3BZC A;  5DKW A;  1B7T Y;  1UHU A;  4MSP A;  4ORA B;  3UNW A;  2O60 A;  2DPI A;  2KAY A;  4EZ6 A;  3QEB Z;  1B9A A;  2J6U A;  1V38 A;  4KN7 A;  3PW2 A;  4RQN A;  4FTG A;  3MBY A;  3PM2 A;  5IIJ A;  4NL9 C;  4MFC A;  3B6X A;  1MQ1 A;  5J3X A;  4CFQ A;  4DFJ A;  1UHK A;  2JZB A;  5AKJ A;  4U8D A;  3RAX A;  3K4G A;  2B21 A;  1TRF A;  1QLS A;  2PYQ A;  3ZNI A;  1M39 A;  5KT2 A;  1DTL A;  4USL A;  3KHR A;  2QEV A;  3NXA A;  2KKP A;  3D73 A;  1CDL A;  2EAN A;  2LMU A;  1BPD A;  3OSP A;  4QZC A;  1ZQK A;  1J7O A;  3JPP A;  4QIW F;  1F0M A;  5EE3 A;  1XFX O;  3QUC A;  3S0A A;  9ICW A;  1PK3 A;  4J9R A;  3V2L A;  2L98 A;  5I2L A;  4RQ7 A;  4PGY A;  3GV5 B;  8ICV A;  4EZ9 A;  1S0V A;  2JEF A;  3B87 A;  4WJ3 B;  2ISP A;  2LHL A;  4PAL A;  2WCL A;  4KN4 A;  2QPT A;  3O6B A;  3D74 A;  5AM5 A;  4RQ3 A;  3L47 A;  2KOT A;  2D8C A;  4YI9 A;  4I5N B;  2WOS A;  2G07 A;  1PZN A;  4M47 A;  4RUA A;  4F92 B;  3AAJ A;  5L1L A;  4QJ5 B;  2IHM A;  2WC8 A;  1SMG A;  2G0A A;  8ICR A;  1K93 D;  4AYB C;  3A8R A;  2XID A;  1T3Q A;  1NK7 A;  4QZD A;  1QIW A;  2FDR A;  3QU5 A;  4I2A A;  2QAR B;  2B0C A;  3NGD A;  2HHQ A;  2EZY A;  1BNP A;  1K8U A;  3N7S C;  3L4A A;  4DL2 A;  3HW8 A;  4QZA A;  2YGU A;  4Y2V A;  5KFH A;  4M6W A;  1S0N A;  5KFX A;  5F6T A;  3L4P A;  1RJV A;  3ZDA A;  4R65 A;  4JMU A;  2JT3 A;  2KGB C;  5ALF A;  5KSZ A;  2ASL A;  8ICQ A;  4B9U A;  2FI1 A;  4C0L A;  4EYH B;  2DPJ A;  1PVQ A;  3T5H A;  4KLG A;  1DF0 B;  3GK2 A;  4O5C A;  3UXN A;  1UT8 A;  2LNK A;  2W55 A;  1ZQR A;  2QKQ A;  2MUT A;  1KEJ A;  4RT2 A;  1RTP 1;  4DEZ A;  3H8M A;  2HOI A;  2KFZ A;  3WK6 A;  2Y1M A;  3VRR A;  1PVA A;  1L7M A;  1C7V A;  1OOI X;  2M9N A;  4WRI A;  2AQ0 A;  2PMZ F;  2XI9 A;  3SIA A;  5I94 A;  4U7C A;  4ED1 A;  3N4M B;  1SKW A;  1YUS A;  3RB6 A;  2OTG B;  1S76 D;  4PGX A;  1ZQX A;  2BKE A;  4GPL B;  5D7F A;  2EZX A;  4L9M A;  1COO A;  2W9A A;  2JEI A;  4MBE A;  2YB1 A;  1RQN A;  3PSP A;  2OH2 A;  4YD2 A;  5ALJ A;  4GGF A;  4QWB A;  3WK9 A;  2KJ9 A;  1DJH A;  1L7N A;  3SR6 A;  4Y2P A;  3DD4 A;  3IF7 A;  3VRQ A;  3GII A;  3C29 A;  1PUZ A;  1ZQ1 C;  4KLS A;  1ZJM A;  4GXJ A;  1AUI B;  3BQ7 A;  2KLD A;  5L1M A;  2A1J A;  4BUG A;  3ZDC A;  1OOF A;  1TCF A;  5AI8 A;  2HHS A;  4Y2U A;  2JPO A;  2XY6 A;  4B9M A;  4ELV A;  4AYB F;  4M2O A;  5DIC A;  1L3V A;  4NY8 A;  1RQL A;  3TQ1 A;  1LKY B;  2ZN8 A;  1XS9 D;  1KRP A;  3C1V A;  2L4H A;  2W9M A;  2JXC A;  1RZT A;  8ICJ A;  4NLC A;  1OE9 B;  3GK1 A;  1IG5 A;  3PFV A;  2Z7J A;  3SAG A;  3R1P A;  2FPK A;  2K2A A;  1C7Y A;  1OQP A;  4RPY A;  2J6T A;  5DLG A;  1U47 A;  5KFO A;  1DJI A;  3M8R A;  2HQ8 A;  4KYN A;  4I29 A;  1PAL A;  5KTQ A;  1XO5 A;  2LYH A;  2QB0 B;  4LVS A;  8ICN A;  3CZ2 A;  2E1E A;  2JEG A;  2RP5 A;  3OBV A;  4UAY A;  5DQI A;  2WB1 C;  1NKE A;  1TIZ A;  3WKE A;  2XC9 A;  9ICI A;  1XK4 A;  4M2Y A;  1N62 A;  3RJH A;  1Y1U A;  1CFC A;  3NRW A;  3UMG A;  3ZDD A;  1G8I A;  4OZD A;  4F4Z A;  4QZE A;  2ZKM X;  4QZI A;  2FCD A;  5AK5 A;  1ED1 A;  1SZH A;  3QZ8 A;  4USA A;  2F77 X;  4Q43 A;  4GGN A;  3TAD A;  2KIW A;  2DKX A;  1C07 A;  5KFB A;  2KOB A;  3E0F A;  3LVW A;  2EDU A;  3IV6 A;  5KFF A;  2BE4 A;  3PW7 A;  1QTM A;  4PHN A;  8ICB A;  4PE0 A;  1L7P A;  1Z00 A;  2ZJ5 A;  1RYS A;  2HQW A;  3Q8L A;  1KQV A;  4Z6D A;  2FE9 A;  4J03 A;  5KT7 A;  5ALX A;  4ICB A;  3KHH A;  2D6F C;  1DEL A;  1RM6 C;  1SWW A;  3GU3 A;  5KFC A;  3NUQ A;  1S6C A;  2DFL A;  1SK6 D;  3I5H C;  3SG5 A;  3VGO A;  4DOB A;  4DQS A;  2H3V A;  3KHL A;  4TQR A;  2MSN A;  3EZ5 A;  4DL5 A;  4IJ7 A;  3OX5 A;  2W9B A;  1ZRN A;  3AN1 A;  4CF5 A;  3T5J A;  2EC6 B;  2K60 A;  1B47 A;  3LYS A;  1X66 A;  9ICF A;  4Z6F A;  2LHT A;  4GIB A;  4TNC A;  3BYA A;  1TNP A;  4A4C A;  1NK0 A;  4HRE E;  2KFF A;  1WWU A;  2NRX A;  3NGV A;  3M6K A;  2V9W A;  2I1Q A;  4F4K A;  1SZP A;  3V7J A;  1WWV A;  3PR4 A;  2MBX A;  7ICV A;  4ECR A;  3J81 j;  1S9F A;  2PI5 A;  2K61 A;  4DFP A;  2MJW B;  5DB7 A;  4DQR A;  1UQV A;  5ALY A;  3T5L A;  4C8K A;  4NDC A;  3H8S A;  4HSZ A;  1ZD3 A;  5KFT A;  3NAS A;  5KAF U;  1GO3 F;  2R8H A;  4AOM A;  3C5F A;  5JUM A;  4ECS A;  4O0I A;  5AK6 A;  2PXI A;  3AKB A;  3M8S A;  2XCA A;  2JRF A;  1WG8 A;  3EUB 2;  2L4I A;  5KFY A;  7ICK A;  5DBB A;  3FDS A;  1SNL A;  3NSK A;  4UPG A;  4ED8 A;  3KZI U;  1AJ5 A;  2K8M B;  1DK3 A;  5JJG A;  5ALW A;  2JXJ A;  4CPV A;  1UHI A;  1TNX A;  2YQE A;  8ICK A;  3M7D A;  5DBC A;  3BDP A;  3PY8 A;  2KFH A;  3KEV A;  2BCV A;  1XWL A;  5J2I A;  4JWQ A;  3ZD9 A;  1D8L A;  1ZXI A;  4UB2 A;  3G6V A;  2W7P A;  5FI2 A;  2BQ3 A;  1UT5 A;  1OSA A;  1KL9 A;  1BGX T;  5FI7 A;  3QUT A;  1KFU S;  1OUQ A;  1K90 D;  4RQ5 A;  1XU4 A;  2QLT A;  4I2J A;  2C22 A;  1KFU L;  2NYV A;  5L1J A;  5GTH U;  7ICI A;  2NV3 A;  3VC8 A;  1B4F A;  9ICQ A;  4ELT A;  5KFU A;  4ECW A;  1A4P A;  2W54 A;  3PX0 A;  4YR2 A;  1SY9 A;  2DL0 A;  2BCU A;  2H3Q A;  2UVU A;  2KK0 A;  4C7Y A;  1OMV A;  2OM6 A;  2IS9 A;  4FO6 A;  1ZQL A;  3PM8 A;  2YMP A;  5KFZ A;  2ZUB A;  1DJY A;  1QTX A;  2GLE A;  5ALO A;  5D69 A;  1RFJ A;  1JXE A;  4IQW A;  1HIW A;  1RDF A;  1NK8 A;  1YTZ C;  4WQ3 A;  3WU2 U;  3CAB A;  1KK7 Y;  4BWJ A;  4OVN F;  5J2J A;  1CDN A;  1SL9 A;  3ISD A;  2VA8 A;  4KLM A;  2WCB A;  2WHE A;  1BPB A;  2BQU A;  5IIL A;  2PFO A;  3RJE A;  4GXI A;  8ICT A;  2KLE A;  4ECT A;  1MF8 B;  4PZO A;  2QAR A;  1N60 A;  3AQE A;  1TK5 A;  1DRG A;  2DQN B;  4IC9 A;  3IQO A;  4TUS A;  4OCZ A;  7ICT A;  3FE8 A;  2F8P A;  5DG9 A;  1L3S A;  1SL8 A;  2JWW A;  2WC6 A;  4J9K A;  2ZIU B;  4PE4 A;  5DB8 A;  1NKC A;  1WRK A;  3OB1 B;  2RGI A;  3UO9 A;  1CRX A;  4NJ8 A;  4GFT A;  5ALU A;  3NSO A;  3M9N B;  1SCM C;  2LMV A;  9ICS A;  2YB4 A;  3PAT A;  3RLZ A;  2ZIW B;  1DF0 A;  1QVI Z;  4DLG A;  2Y1N A;  9ICX A;  1DMO A;  2BCS A;  4MVF A;  3TDZ A;  7ICO A;  2I18 A;  8ICW A;  3ZD8 A;  1DEK A;  3ETL A;  1B0X A;  4NLG A;  3BFH A;  4OD0 A;  1SXE A;  5F9N A;  1ZQI A;  1QWV A;  2LVV A;  1E8A A;  2G9B A;  4ECQ A;  1XC9 A;  2PI4 A;  3PMN A;  1K94 A;  3AKA A;  2KI4 C;  4RPZ A;  1JSA A;  4DOC A;  2K4H A;  4C8M A;  3BQ0 A;  1RYR A;  2YTU A;  4UB1 A;  5DQH A;  1MQ3 A;  4KMO B;  2W3S A;  1XNS A;  2ZXI A;  1DXS A;  1S97 A;  2E8P A;  4F4W A;  4P0P B;  2FLL A;  1CDP A;  1GGZ A;  1ZFS A;  1JXL A;  5DKQ A;  5AER A;  2FMP A;  4F5N A;  4IRD A;  4UB3 A;  2VIX A;  8ICP A;  3WHU B;  3QYP A;  3LL8 B;  1JF0 A;  5HLV A;  1CLB A;  3DV9 A;  2LVJ A;  1TFR A;  4UAZ A;  1IXR A;  3F53 A;  3PW4 A;  2BCQ A;  5KFA A;  3DF0 B;  4CRX A;  4C4T A;  4ZCV A;  3TUY C;  4GXK A;  1NK4 A;  1CFP A;  1B8L A;  1QJT A;  3SEN A;  9ICJ A;  2PFP A;  2ZIX B;  1NPQ A;  5DLF A;  4M2Q A;  3H4D A;  1LA3 A;  1K1Q A;  4JPZ B;  3G6X A;  4O3P A;  4DL6 A;  4C8L A;  1OXJ A;  1F55 A;  1O03 A;  4RQ8 A;  2K7B A;  2H61 A;  3SS3 A;  2WTF A;  4KLJ A;  4F7F A;  5CA7 A;  3VRN A;  3TI0 A;  2L2E A;  3ZDB A;  1BF5 A;  2P35 A;  2ZXH A;  5H2F U;  3CNH A;  4NXZ A;  4QZ9 A;  4OCI A;  5HKW A;  4ICA A;  4QWA A;  3CZ1 A;  5ALD A;  3QE9 Y;  4LZG A;  3ISC A;  3O4Y A;  3MFH A;  4XYN A;  1B8C A;  3A0H U;  1MWN A;  2QB0 A;  1JBA A;  5F3X B;  2IHN A;  4UAS A;  5HR7 A;  1ZQW A;  4Q45 A;  4XJK B;  1KK8 C;  4XQ8 A;  3TAQ A;  2F2O A;  3LK1 A;  5AK3 A;  4GGF C;  1XFW O;  1W9Z A;  3AAK A;  2KJ5 A;  2HHV A;  4MFA A;  4F50 A;  3AUO A;  2L2C A;  4DWI A;  1OMR A;  2NRW A;  1T14 A;  1XSP A;  2KV2 A;  1K9U A;  1NKB A;  2AUC A;  1VLB A;  5AKY A;  3OJU A;  2H3F A;  5J0O A;  3CR4 X;  5DQG A;  1Z1B A;  1TAQ A;  2ZUC A;  3NRZ A;  5CSI A;  1DJG A;  5ALG A;  7ICR A;  2HSZ A;  1NK6 A;  2SCP A;  3OHM B;  3CZT X;  4F2S A;  1Y1A A;  4KX3 A;  1CLM A;  1P7D A;  2JMG A;  3GQC A;  2OPO A;  2BNX A;  2E8M A;  3FYH A;  5HNK A;  2V53 A;  1ZMZ A;  1EG4 A;  4ETO A;  4YMO A;  1XFZ O;  1OOH A;  4QJ4 B;  1FIQ A;  3PAL A;  1OMD A;  3K75 D;  3H8W A;  1NZB A;  4PE1 A;  2QEB A;  2FJY A;  2COL B;  3C2M A;  5III A;  5KFE A;  4YP3 A;  2ZFD A;  4ECY A;  1X02 A;  1FFV A;  3IRU A;  3CRX A;  1XK4 C;  1DC1 A;  5J2D A;  3RRG A;  2AGO A;  1O08 A;  1S36 A;  1X42 A;  4UAV A;  4G3I A;  1XYD A;  1OW4 A;  1QQ7 A;  2EAP A;  1XVJ A;  2DWQ A;  3TAD C;  1NX0 A;  4O5E A;  3EPG A;  4I2G A;  2BL0 B;  2DBY A;  3SS4 A;  4RNM A;  2R8J A;  1A2X A;  1ZD4 A;  4I2F A;  1H8B A;  1CM4 A;  3KKA A;  4QW8 A;  3FIA A;  2BPG A;  1L2O C;  1JAL A;  1K1S A;  2ISO A;  1LXF C;  5EE1 A;  2W03 A;  2KJ8 A;  1KLN A;  1J1E A;  4JB3 A;  4NM1 A;  2HI0 A;  4O3O A;  2YN4 A;  4QZH A;  1PK0 D;  1U48 A;  2LM1 A;  1TWO A;  3HPO A;  4R1E A;  3ICX A;  2KHQ A;  2Y9T A;  4F93 B;  5KFJ A;  2NZ0 A;  5J2E A;  1L3T A;  2I5H A;  1A76 A;  1M6Y A;  4ECV A;  5KFM A;  4UAR A;  4ORB B;  2BQR A;  2LPE A;  2F3Z A;  3OGN A;  3WNX B;  3I5G B;  1Z4H A;  1KDH A;  2OHF A;  3AQF A;  3NVW A;  7ICM A;  2K7C A;  2CNP A;  1MR8 A;  8ICL A;  3B7A A;  3CDN A;  4CNQ A;  1IJ5 A;  4AQI A;  4O9M A;  1JMS A;  3PML A;  8ICG A;  4DL4 A;  2CCM A;  5AM0 A;  3ZDE A;  1D9D A;  3IDW A;  4JQ0 D;  2E6W A;  3WK7 A;  1RWY A;  2KPH A;  5D46 A;  4B9S A;  2KAX A;  1QS7 A;  8ICS A;  1SBJ A;  1JC2 A;  1IV8 A;  4UAT A;  3TKA A;  5C5J A;  3VCB A;  5DDM A;  3PST A;  9ICT A;  3MDA A;  4F71 A;  2P66 A;  1C20 A;  4GC7 A;  3MSE B;  2F33 A;  2WCH A;  2OYY A;  4KLT A;  4FZN A;  1OZS A;  4CF3 A;  2K7O A;  2PAS A;  1W7J B;  8ICY A;  3RH6 A;  1JN3 A;  2ZND A;  1KW4 A;  2BEC A;  1NI3 A;  1ZOL A;  1JWD A;  4DL3 A;  4ECU A;  5DG7 A;  4DF8 A;  3GOF A;  1KBU A;  3N7H A;  5CP2 A;  2LVK A;  2WCF A;  5KFI A;  1ALW A;  2HMX A;  2A1A A;  4INX A;  3UM9 A;  4MEX A;  2LVI A;  2ZIU A;  1HQV A;  1ZQB A;  1W7I B;  1Q3U A;  2WOR A;  3GV7 B;  9ICP A;  4M0A A;  2G5H B;  3EW9 A;  3EK7 A;  3PX4 A;  1WCL A;  3AU2 A;  1DT7 B;  5AXI A;  2VJ5 A;  4O3M A;  2LP2 A;  4J9Q A;  2RQ5 A;  3G6Y A;  7ICU A;  1CM1 A;  3PSR A;  1ZQC A;  2I94 A;  3VB1 A;  3PSI A;  1N0Y A;  5HHH A;  5AM3 A;  3EYZ A;  3R1V A;  1HUZ A;  5HL1 A;  5JTI A;  2A4J A;  2AMI A;  3QZ7 A;  4Q04 A;  3FM9 A;  4YMN A;  2EGD A;  2QDI A;  2C28 A;  2E3T A;  3H0M B;  5KG7 A;  1X6I A;  2KVS A;  1U5I B;  3IN5 A;  2MA2 A;  1EL4 A;  4C0K A;  3N97 B;  1DOQ A;  3QU7 A;  4GLX A;  4P4M A;  1MUX A;  4YRU A;  9ICC A;  8ICU A;  1Q46 A;  2VKQ A;  3OJS A;  3D2N A;  1XSN A;  8ICO A;  2M0R A;  1PVP A;  4PT1 A;  1Z4O A;  4YMM A;  5A0L A;  2M3W A;  2CBL A;  3QUQ A;  3B0X A;  3AMZ A;  4I5L B;  5HYD A;  2R18 A;  4P0P A;  1S6I A;  3B88 A;  2Q4U A;  5J0Y A;  1NNL A;  5B5E U;  4DSF A;  1S5G Z;  1JFJ A;  2ISD A;  4PPX A;  1CKK A;  5G5G A;  4FZL A;  4XUS A;  2FMS A;  3PO4 A;  4Y2Y A;  3DF0 A;  2LP3 A;  4KLF A;  1ZQU A;  4P4P A;  1F4Q A;  1ORG A;  3RRH A;  1PUL A;  2BBM A;  3SV4 A;  3DYE A;  2AH5 A;  3KTQ A;  1FBV A;  4DQQ A;  4JV1 A;  2HBK A;  5J0X A;  2CPR A;  2NO4 A;  4R66 A;  2RDI A;  2H5X A;  1M63 B;  2BAP A;  1CNP A;  4DUQ A;  4IR9 A;  2FPL A;  2KE7 A;  2ZNE A;  1S5L U;  4BXO A;  2D8N A;  4NWI A;  4F4X A;  3MDC A;  3DVK A;  5KFK A;  1B7T Z;  4I2I A;  3WKA A;  5J2A A;  2LV7 A;  1MC8 A;  3CZ0 A;  1N5X A;  2KZ3 A;  2DGZ A;  2WAQ C;  4A8E A;  3H0L B;  1H38 A;  3SV3 A;  2OXO A;  4Y2J A;  3PN7 C;  5AM2 A;  1UUR A;  2L5X B;  5J8Y A;  1ZAC A;  3I28 A;  5KFL A;  1ZQS A;  1SR6 B;  3ALR A;  4XJK A;  1S26 D;  1BPZ A;  8ICE A;  4JUZ A;  1ZOT B;  1TK8 A;  4IQT A;  4O3N A;  3RTV A;  2KQ6 A;  2Y4Q A;  9ICV A;  2WF5 A;  3D0Y B;  3TAR A;  1P28 A;  2SAS A;  4MF2 A;  1UA0 A;  1SKR A;  2DOQ A;  3I5F B;  3S0D A;  2EAO A;  4C8N A;  1F8H A;  5TNC A;  1NOM A;  5I2O A;  1N65 A;  2MLF C;  3HKZ C;  4UAU A;  4Y2T A;  2M7L A;  1KFX L;  5GQQ C;  4I2D A;  3GFK B;  3EWA A;  4DFM A;  1XFY O;  5HKZ A;  4OKH A;  3SG6 A;  5PAL A;  3HX0 A;  3PO5 A;  3JTD C;  2MLE C;  1CI4 A;  3PNC A;  2WF8 A;  4PJ0 U;  5JRT A;  2PSR A;  2JU0 A;  3RM1 A;  3UMB A;  4KLO A;  3CGA A;  3JPN A;  3WK8 A;  1T3N A;  1CFD A;  3GIL A;  1QQ6 A;  3B9J A;  2CN1 A;  4YCX A;  2JPT A;  1GM0 A;  1KFT A;  4BJQ A;  1CUK A;  3A0B U;  4GUK A;  5KFG A;  1NK5 A;  4JD9 A;  4DQI A;  1X9W A;  3IQQ A;  2BCA A;  2LCP A;  4EX7 A;  1S3P A;  3ORY A;  4MZK A;  4IRC A;  1BR1 B;  2KNE A;  4PH5 A;  2OS8 B;  2WCK A;  2WCE A;  4N1F A;  4OJP A;  1QV1 A;  3RJG A;  2L0P A;  1J7Q A;  2P6U A;  1H4B A;  1T7P A;  2M29 A;  4PHK A;  4P0Q B;  4CFR A;  2EQY A;  2WAQ F;  1G4Y R;  4US9 A;  2M1K B;  1XFU O;  1WLM A;  5DKN A;  4GBA A;  3D78 A;  2P70 A;  2V4R A;  2LM4 A;  9ICN A;  1BLQ A;  4J9P A;  1CMG A;  1QV0 A;  3V7K A;  1LS8 A;  3A4U B;  1CB1 A;  1SKS A;  3VRP A;  2JT8 A;  5AFP A;  4QZF A;  2N1R A;  4N1G A;  2GO7 A;  2KKV A;  1R2U A;  5HMM A;  2KZZ A;  4F5R A;  1EXN A;  1DGU A;  2WB1 F;  4F4Y A;  2JH1 A;  3HKZ F;  2KN7 A;  3C28 A;  3CS1 A;  1XSL A;  2HF5 A;  1MSW D;  2KQY A;  1L8O A;  1NX1 A;  5BOL A;  5AI5 A;  2KDH A;  5ALT A;  2BCR A;  2KAV A;  2WF7 A;  1EXR A;  1SL2 A;  2EC6 C;  2KNJ A;  3KBB A;  3R1O A;  1QX7 A;  4ED6 A;  2J6S A;  4ORC B;  3BXK A;  3L5K A;  9ICH A;  5EOZ A;  1JUO A;  5D3O A;  4PL1 A;  1BPE A;  2E8N A;  4UB8 U;  5AKH A;  1KQQ A;  2ZTE A;  2F2A B;  1YX7 A;  3EG5 B;  3DEE A;  1ZQZ A;  5AK4 A;  3OX6 A;  3AEV A;  3WKD A;  4DFD A;  4ECZ A;  1NP8 A;  2ZUD A;  3BQT A;  1JI7 A;  1LB2 B;  5J2G A;  1BG1 A;  1TNQ A;  3SG2 A;  3KKA C;  3V6H A;  3FAH A;  4G9B A;  1WRZ A;  5DGB A;  2G09 A;  3JVT B;  3NSI A;  2MHH A;  3PLF B;  5IBW A;  1FI6 A;  1T94 A;  2XGP A;  5IIN A;  5FP0 A;  2W8K A;  3EKH A;  2GV5 A;  4PGQ A;  2JZB B;  3TS5 B;  2LMR A;  2UVR A;  1J1D A;  1DK2 A;  1YUU A;  1PSR A;  2AGP A;  5J0W A;  1SL1 A;  3BUN B;  2F1J A;  4ELU A;  2M97 A;  1NJZ A;  2HHT A;  4M9L A;  5CSN A;  1RG6 A;  3D2S A;  4NV0 A;  1BOD A;  4JV2 A;  4QJF B;  4Z6C A;  4QZB A;  4EYI B;  1OOG A;  1SCM B;  2YMQ A;  5AKX A;  1V9P A;  4MZL A;  1IRJ A;  2HOF A;  3GV8 B;  2IBK A;  2UVW A;  1IKU A;  4YXJ A;  1KFD A;  7ICL A;  2HCF A;  4P2Y B;  4NLB A;  1COK A;  1TCO B;  4P4O A;  3OB2 B;  1V1F A;  2B1U A;  4F0Z B;  3DY9 A;  3N28 A;  1CEZ A;  4RQ2 A;  3Q8I A;  1EH2 A;  3JPO A;  1Q8K A;  4UB5 A;  2ES6 A;  5TZV A;  1J97 A;  3WK5 A;  3PW5 A;  1M45 A;  2LAP A;  5I2Q A;  3AM9 A;  4RNN A;  1U5I A;  2G5I B;  7ICQ A;  3K1R B;  1WYG A;  5ALH A;  4YGA A;  4LJX A;  4PHA A;  2MRL A;  4EBC A;  2ZJA A;  3D77 A;  3RB4 A;  1BT6 A;  4F5P A;  1NJY A;  1UP5 A;  4KX5 A;  2LAN A;  3FE9 A;  2ERB A;  1UHJ A;  1RXV A;  2WC5 A;  3PV8 A;  1CDM A;  4XRH A;  3JPQ A;  3RJF A;  4KLL A;  3C1Z A;  4C4R A;  2R8I A;  5DBA A;  4RQ4 A;  2VJ4 A;  4I2H A;  1IQ3 A;  4WQ2 A;  5AKE A;  3TUY B;  1REC A;  1T4G A;  1QLN A;  1IM4 A;  3RH5 A;  1A77 A;  1UPH A;  4P2H A;  4OR9 B;  2HET A;  4DSJ A;  1KQM C;  5ALE A;  2A3V A;  1KSM A;  5KT5 A;  4MLW A;  4DQP A;  2KBM A;  1A03 A;  1Z19 A;  1DJX A;  1Y6W A;  1JRO A;  4C0J A;  2KEY A;  4CGZ A;  5KNI A; 
#chains in the Genus database with same CATH homology
 2KSO B;  1JI7 A;  5JRT A;  3SEI A;  2KG5 A;  2K60 A;  1X66 A;  2D3D A;  1Z2C B;  3BS7 A;  3KKA C;  1X40 A;  2QB0 A;  2KLE A;  5F3X B;  2Y9T A;  4PZO A;  2QAR A;  1SV0 A;  2F8K A;  2EAN A;  2L5Y A;  4PZN A;  1LKY A;  1WWU A;  4NL9 C;  1F0M A;  4MEW A;  1WWV A;  2LMR A;  3BQ7 A;  1X9X A;  4I5L B;  2KLD A;  3IVT A;  5L1M A;  4IJ7 A;  1PK3 A;  2LPE A;  3BS5 B;  1SV0 C;  1W9Z A;  1PK1 A;  1UQV A;  2JV3 A;  1Z4H A;  4JKT A;  2B6G A;  3UO9 A;  1OW5 A;  4NJ8 A;  3TAC B;  1LKY B;  1RG6 A;  5JTI A;  2Y9U A;  2ESE A;  2KIV A;  3IDW A;  1DEK A;  2D8C A;  4MHV A;  1B0X A;  4I5N B;  4GBA A;  1SXE A;  2BAP A;  1COK A;  2BNX A;  3O4X A;  2E8M A;  4GAO A;  4KYN A;  3KEV A;  2KE7 A;  2QB0 B;  2QB1 A;  2QAR B;  2EAM A;  3OBV A;  2ES6 A;  2DKZ A;  2KSO A;  2F3N A;  2YTU A;  4RQM A;  5FI2 A;  2YGU A;  3K1R B;  5FI7 A;  1DXS A;  1KW4 A;  2E8P A;  1SGG A;  4IS7 A;  5JU5 A;  3SS5 A;  5J8Y A;  1PK1 B;  1B4F A;  1SV4 A;  3HIL A;  3TAD A;  5FI6 A;  1V85 A;  2DKX A;  1DC1 A;  1Z1V A;  2DL0 A;  5J8Y C;  3BS5 A;  2EAP A;  5D3O A;  2EAO A;  3SEN A;  2F44 A;  3TAD C;  2QKQ A;  1UCV A;  2E8N A;  3H8M A;  2FE9 A;  4NL9 A;  2GLE A;  2KMD A;  2K4P A;  1DEL A;  3SS4 A;  3UNW A;  1OXJ A;  4I5K A;  3EG5 B;  3SS3 A;  4I5J A;  1V38 A;  4RQN A;  3KKA A;  2E8O A;  3PM2 A;  5HL1 A;  5I94 A;  1SXD A;  5KNI A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...