2L5YA

Nmr structure of calcium-loaded stim2 ef-sam.
Total Genus 49
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
49
sequence length
150
structure length
150
Chain Sequence
GSHMASTEEDRFSLEALQTIHKQMDDDKDGGIEVEESDEFIREDMKYKDATNKHSHLHREDKHITIEDLWKRWKTSEVHNWTLEDTLQWLIEFVELPQYEKNFRDNNVKGTTLPRIAVHEPSFMISQLKISDRSHRQKLQLKALDVVLFG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Auto-inhibitory role of the EF-SAM domain of STIM proteins in store-operated calcium entry.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Signaling protein
molecule keywords Stromal interaction molecule 2
total genus 49
structure length 150
sequence length 150
ec nomenclature
pdb deposition date 2010-11-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07647 SAM_2 SAM domain (Sterile alpha motif)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.50 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 Transcription Factor, Ets-1 2l5yA02
1.10.238.180 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 Recoverin; domain 1 2l5yA01
1SV0A 1B4FA 3SENA 5JTIA 1SXDA 3KKAA 2KSOA 2Y9UA 4RQMA 1DXSA 1SXEA 2K60A 4MHVA 2EAPA 2GLEA 2K4PA 3HILA 1SV4A 3BS5A 2ES6A 1UCVA 1PK1A 5JU5A 1X66A 2E8MA 1V85A 4RQNA 2E8PA 1V38A 4NL9C 2JV3A 1UQVA 1OXJA 2D8CA 1X40A 2Y9TA 3TADC 3BS7A 1SGGA 2LMRA 5L1MA 3KKAC 2D3DA 4PZOA 1JI7A 1LKYA 1WWUA 3IDWA 5F3XB 2F8KA 1PK3A 2KMDA 2QARB 3BS5B 1COKA 2DKZA 1F0MA 4IS7A 2EANA 5J8YA 2DL0A 2FE9A 1PK1B 2EAMA 2ESEA 3K1RB 1LKYB 2F44A 1Z1VA 2KIVA 2E8NA 1WWVA 2QARA 1OW5A 1SV0C 2L5YA 2KSOB 2KE7A 2DKXA 3TADA 5J8YC 1KW4A 2QKQA 2E8OA 2QB0B 2F3NA 4PZNA 2EAOA 1RG6A 3BQ7A 4NL9A 2KG5A 4NJ8A 1X9XA 1B0XA 2YTUA 3TACB 2QB1A 3H8MA 5JRTA 2LPEA 2QB0A 5KNIA 3SEIA 2B6GA
chains in the Genus database with same CATH superfamily
3T5HA 2F1HA 2LV7A 4KLLA 1JSAA 1N62A 5DGBA 1UP5A 5DG7A 2KKVA 2WF5A 5EE9A 1TOPA 4OVNF 4DOBA 5E79U 1SMGA 1DGSA 4DS4A 2KIWA 3F2DA 4I2JA 8ICYA 2KJ8A 2NRWA 3F45A 4DLGA 1TNWA 5GTIU 2IOHA 5CEHA 3KTQA 1ZACA 3UO9A 1F70A 3V72A 1NJZA 4MHVA 3B87A 1L7PA 1SV4A 1IH0A 7ICOA 1T7PA 2PI5A 3L4LA 1HJPA 2ZN9A 4CE6A 4AYBC 1A0PA 2PMZF 4OR9B 4IRKA 5AM1A 2ZIUA 2LE9B 1KFUL 4ED7A 5AIBA 2WF6A 2YX8A 1JXEA 2K7BA 1OZOA 3MABA 7ICVA 1YURA 3PALA 3V7JA 2HQWA 3DF0A 3WK5A 4LZDA 2PFNA 4GXKA 2JPTA 3GK2A 2BL0B 4B9NA 1TFRA 2L98A 3E58A 4MZJA 2XCPA 4DQRA 3PVXA 5H2FU 1MUXA 3N7PD 4E0DA 3VROA 1D1OA 3EVUA 4FZLA 4J9KA 5HHIA 4XUSA 2E1FA 3GK1A 2WCHA 1AUIB 2JGAA 4P2HA 1CNPA 1KSOA 2KFHA 1ZD3A 1B22A 3BQ0A 2F44A 1XFUO 1B1GA 2GH1A 4NDBA 4N1FA 3IQQA 4YGEB 5IIOA 2H3IA 4J9RA 1ZQYA 4O9MA 5ER4X 4QJ5B 4DQPA 5I2LA 5KFYA 2XGPA 7ICEA 1OW5A 2P35A 1ZQVA 1CB1A 1MSWD 1Y1AA 9ICUA 2K7DA 4ZOHC 4F72A 1V9PA 5C5JA 2KBMA 4I2HA 4DF8A 3TAPA 3NXAA 2EGDA 2BHNA 2K8MB 3SIAA 3TDIA 3TUYC 3EG5B 3N97B 3HPOA 1NK0A 5ALDA 9ICQA 4I2GA 5KFVA 2RP5A 1K95A 5KTQA 3H0MB 2HHTA 5DLGA 1UHNA 2DFLA 1HT9A 4DCCA 3PV8A 1KK8B 3CABA 1UHJA 1ZOTB 4CF5A 1L2OB 3CDNA 2WB1C 5KFAA 5L1LA 4ECZA 4BY5A 4TQSA 4ED0A 1NZPA 2CXYA 1QQ5A 3EKHA 5AHXA 4JV0A 1ECWA 1JFJA 1TE2A 2AAOA 1DELA 3EW9A 5KFZA 5F6TA 4I5KA 1HQVA 1QLNA 3AKBA 5KAIU 3MR5A 3O6BA 2R8GA 4YR3A 3RH5A 3IVTA 5JOLA 2WNDA 5KT6A 1URJA 4UAVA 4KLIA 2MAZA 4NL9C 1D8LA 1XSPA 1PZNA 1UQVA 2UVRA 5KG1A 3EVVA 1JROA 5ALXA 1YTZC 2QPTA 7ICRA 3PO5A 2V4RA 1T8EA 5KFDA 2MJWB 1CMGA 1CM4A 4RNMA 3O78A 2ISPA 1S8OA 2G2BA 1QSSA 4UARA 2VANA 4MBEA 2W8LA 2MRDA 3JPOA 1QTXA 2F2OA 5F3XB 5DG9A 4GAOA 1X6JA 1F0MA 5KG6A 2HHWA 1KK7Z 1ZQXA 2LLTA 4UB5A 2XIDA 1SL1A 3T5JA 3CZ0A 1TWOA 3WKEA 2Y4QA 3GIKA 8ICFA 1L3SA 1CKKA 3BUXB 1X9SA 3RJJA 5ALPA 1AQ6A 3MGIA 1TUZA 4OJ5A 3SMVA 5A0LA 1BPEA 5ALUA 5KT7A 5DKQA 2NYVA 1ZQQA 1AP4A 4FZNA 4EYHB 2KSOB 3B88A 2C2EA 2OEHA 1CM1A 5AM0A 3SV3A 5KG2A 3TADA 4R66A 4ZH4A 3E2EA 2Q91A 1SK6D 4CIDA 5I94A 4NLGA 1ZUZA 1Y1UA 3H8WA 4X5VA 2R8IA 3RB3A 2EAOA 2M7NA 2WC6A 5KG4A 2R8KA 3ISCA 2ODGA 3V6HA 2VA8A 3LL8B 1X6IA 1SBJA 1RJVA 4OJPA 4EZ6A 2WCBA 5ER5A 1C7YA 4ED3A 1KEJA 5CA7A 4HRGA 2QACA 3CZTX 1DEKA 2DWQA 9ICTA 3SJSA 2Y5IA 1XFRA 3KHHA 2LVIA 1CLLA 1NOMA 5AKHA 3MFIA 4RPYA 4M9NA 2CN1A 2FJYA 3TS5C 3ETRA 2BL0C 3SD7A 3GV5B 1TIZA 2ZJ5A 2F2AB 2NZ0A 4GGNA 2OPOA 3JPQA 1N60A 9ICXA 1ZJNA 2LHTA 3VRPA 1MF8B 1F55A 4UQGA 5L1IA 2EC6C 4GC7A 1IKUA 1N0YA 2QEBA 4B6JA 1HEKA 1Y6WA 1ZXIA 3OHAA 3IRUA 1QV0A 3T79A 3UNWA 3QU2A 3EWAA 1SKWA 3A4UB 4RNNA 2PYQA 1ZYQA 5DLFA 4BXOA 2LP3A 4N5XA 4BJQA 3SG4A 3JPSA 1S76D 4Y2YA 4NLNA 3NSIA 1D8BA 2W9CB 1S0MA 2IHMA 2LVKA 8ICRA 1SZPA 9ICGA 1BPBA 1YRUB 1F54A 4ECSA 1A29A 3RF9A 3MGHA 1SL9A 3T3FA 3KKAC 2D3DA 4PZOA 2BBNA 4J9LA 5IIJA 2UVUA 5ALLA 1JI7A 4EEKA 1SCMC 1DMOA 3SG2A 2QARB 4KLTA 1COKA 3PW5A 4O3PA 5KFFA 4RQ5A 4Y2TA 3RJFA 3FDSA 5DKRA 3BZCA 2EHBA 3FS7A 2RDIA 2DL0A 2ZTDA 3KZIU 2L2EA 3C2LA 5CP2A 1SKTA 2KAVA 8ICAA 3UPQA 2W54A 2BE6A 1RM6C 4EBEA 4MN0A 3PY8A 5AI4A 4EBCA 2KNJA 1XSLA 2KICA 1SNLA 5KTYA 3DD4A 1C3YA 1YR5A 1XS9D 1E8AA 1XC9A 1M46A 1SB3C 2V9WA 2CT9A 3BQTA 5EE1A 3EK4A 2E3TA 3GZFA 4IQTA 4O5EA 1NX0A 4INXA 3PMLA 2JXJA 4DFJA 1ZQ1C 3A0HU 7ICTA 1JIHA 2HETA 1U5IA 2WCKA 5I8NA 1RG6A 5AKYA 4YD2A 2ZXHA 1K1SA 2M1KB 3QMEA 1GQMA 3SS3A 1ZQEA 5CJ7A 1ZQBA 2LVVA 2QB0A 2K4IA 4FFDA 5IILA 4YFKA 3UXNA 1CI4A 3SENA 1CUKA 3CWGA 4JV2A 8ICNA 1VJ5A 2WCFA 4M04A 1U47A 2M1UA 4JKTA 1PRWA 2BQRA 4CF3A 2KD1A 3WKCA 3RH6A 5EL2A 1XK4A 3WNXB 3NVZA 3NS1A 1FFVA 2NXQA 1HUZA 2KI4C 2G5HB 1EG4A 1BU3A 2K8AA 5AKJA 2KHNA 4PL1A 4YN4A 2WC8A 1L8OA 3BUMB 5ALFA 4YMMA 3ZDCA 4NV0A 2CNPA 5AKLA 5JU5A 1NCYA 5C0YA 3M8SA 4RQNA 3NGDA 2E8PA 9ICSA 1S1EA 4UAZA 4MFCA 5CWRA 3VRQA 3LK0A 2IOFA 3R9KA 1IJ5A 1NNLA 2PKEA 4EYIB 2O60A 2M9GA 4Y2UA 3RH4A 3CLNA 1UA1A 4DRWA 3LLEA 2Q4TA 2Y9TA 5CRXA 1UURA 5J0RA 1Y0VH 4QZ9A 8ICIA 4MSPA 1B43A 2BDPA 1AJ5A 4I5NB 4JMUA 1J2MA 3M9OB 4YMNA 2LUXA 1ZRNA 5KT5A 3H40A 9ICCA 2BQ3A 2MHHA 1SZHA 4UPGA 2AU0A 1F5SA 1ZQFA 3D78A 5ALWA 1RYSA 7ICQA 1SRAA 2AH5A 3DEEA 1WDCB 3CR5X 5EWEA 5KT2A 4D1EA 3MSEB 1WCLA 4DUQA 4UB8U 5KSZA 1F44A 2PI4A 1ALVA 4QW8A 4ZCVA 4PJ0U 3B9JA 2ZKMX 2OS8B 3PFVA 3CW2C 3C21A 1JUOA 3UMBA 4B9UA 1N65A 2OH2A 3QRXA 1NK7A 3JVTB 1KWOB 5AK6A 5BPCA 2I9GA 3V6KA 3DVKA 1JC2A 2ZUBA 3SG7A 5DQHA 1XFWO 2PQLA 5AKIA 5ALEA 1ZQAA 4J9NA 5CB1A 1CTRA 2KZMA 2KHVA 2ZG6A 2HQ8A 1YUSA 1A77A 3ICXA 3KHLA 1S10A 2QDIA 4PPXA 4JPZB 4MVFA 4EX7A 1B4FA 1MXLC 3BXKA 1R6PA 1XFXO 8ICPA 1BLQA 4BX9C 4UASA 4I2IA 4YG2A 1ZRMA 3S0BA 2A1AA 2WCJA 3GV7B 1ZQGA 3DXLA 4YGAA 1Q8KA 4BGDA 4QWEA 4TUSA 1NUBA 2JZBB 2WFAA 2I2RE 1ZQKA 5EOZA 3N4MB 1B8CA 2BCVA 4C4TA 5IIMA 3D2SA 2WOSA 1BR4B 1SL2A 3FM9A 4F7FA 2RLTA 3NSLA 2XY6A 4ICAA 2HI0A 3QE9Y 4P5OE 3QZ8A 3IN5A 4L9MA 2VIXA 5ALSA 3JPNA 9ICAA 3I5GC 3WK6A 1A75A 1S6IA 1S0VA 3OGUA 1V1GA 3L3FX 1TCOB 2H2KA 1D8YA 3C2KA 5KG5A 4LJXA 4I2AA 3DZTA 2OXOA 4MF2A 5FI6A 5CHGA 2W04A 2ZIXB 3FIAA 5KG7A 2K8CB 5FI2A 3D76A 4Y2JA 4PH5A 2XY7A 1K94A 4FTGA 3FYHA 2YMMA 1NK8A 4DFMA 4TURA 3TANA 3AEVA 1OMDA 2JRFA 2J6SA 9ICIA 3PNCA 2P6BB 4GFJA 1RPLA 1QV1A 3HP6A 4QIWC 1TKDA 1IIOA 1KWOC 3I5IB 1BNOA 4DL5A 4GPLB 1KQQA 1J1DA 3WK7A 2ERBA 4DLEA 4ELUA 2LUCA 2HBJA 3QNMA 3RB0A 1AJ4A 2W9MA 2F8PA 4CNQA 5GQQC 1KQVA 2LM4A 2K8BB 2MUTB 4ETOA 4RQ3A 2OTGB 2A4JA 3LCPC 5AKEA 4O3SA 1ZQNA 2H3QA 2M0NA 2KAYA 4U6PA 2ASDA 4QJ3B 1XU4A 2W7OA 4DL7A 2L5YA 1DGJA 4YXMA 2FMQA 5J0YA 3TFSA 2K61A 3JTDC 3SR6A 2W43A 5KFIA 2VA3A 4O5CA 2ZJ8A 1SW8A 3WKBA 3VGOA 1XFZO 5D3OA 1J7OA 5DICA 1BG1A 4WJ3B 3ZWHA 3G6YA 1BOCA 5KFTA 1Q46A 1RTP1 3TI0A 3BQ7A 4ZCUA 3H8JA 2LANA 3ZDDA 5I2OA 5J0UA 2PVBA 2ISDA 1XYDA 5HMMA 8ICWA 1FI6A 1W7JB 4RQ6A 1Q80A 2JEFA 5IINA 1DJXA 3OX6A 4K4IA 2HOQA 4AOMA 3H4BA 3I1YA 2YMQA 3D2QA 4MF8A 1LKJA 2FDRA 5CSFA 1IQ5A 4I2EA 2KSOA 5ALYA 1DXSA 4Q43A 3KZXA 4QZEA 4CDGA 3CYZA 4P0PA 4DFKA 2W9AA 1RYRA 4JD9A 3VRNA 8ICHA 2BECA 2F8LA 1T3QA 5D4BA 1YUTA 4KLFA 3EVRA 4USLA 3E3RA 2BPFA 1RXVA 3IM1A 4QJ4B 1MQ3A 2WTFA 1TN4A 4F4YA 3RTVA 5FI7A 2E8MA 2E1EA 1QSYA 1KL9A 1ZQDA 2VJ5A 3L47A 5AEQA 5PALA 3RZSA 1EG3A 3T5KA 3E0FA 7ICMA 2F76X 4E68A 3S0AA 1QASA 3U26A 2E30A 1DOQA 4XJKA 3TADC 3PSTA 1JFKA 2PFPA 5AXIA 1S26D 4XQ8A 2HVHA 4O3RA 4UAYA 1C20A 1LV5A 4GIBA 1R2UA 5CR0A 1COOA 3EPIA 1ZQOA 5HR6A 3OP0A 5HNKA 5J2JA 3IG8A 4C80A 4CPVA 2KVSA 1F4OA 5DQIA 2YMPA 2BNXA 4CRXA 3H4SE 3RAXA 5KL8B 9ICHA 2YY6A 8ICXA 3KHEA 1Z3EB 2KOBA 3MC1A 3ZD9A 4JWQA 1PK1B 1QLKA 3BUOB 2ESEA 2M29A 3PSRA 2P6UA 1J1EA 1DT7B 3RB6A 4XA5A 4JK1A 4MEXA 3AU6A 1V1FA 1WWVA 2KOTA 4PE4A 5DGAA 3DF0B 2G06A 4UB4A 5KFUA 3SAFA 2UVVA 3V6JA 1IGVA 1WCNA 4AQIA 1YX8A 4M0AA 4C0ZA 4DL3A 3TKAA 2W03A 1WRZA 2KJ5A 1J97A 4HREE 5KFSA 5CSIA 8ICEA 1KTQA 1SCMB 2K7OA 3ZI4A 1BJFA 4DCKA 1TAUA 2WORA 4F5NA 1Z19A 3IQOA 2C2DA 2ZN8A 1X9XA 1B0XA 2HHSA 3C23A 2Y1NA 3H4DA 5TISU 1DJIA 3UQ2A 5G08A 2M7LA 3M1YA 1NCXA 4ECVA 1FF1A 5HLOA 3QU4A 2JTZA 1PULA 1WRLA 2KFFA 2L4HA 2G0AA 4Z6CA 3O0FA 5KFOA 2PXIA 4RT2A 2AQ0A 5IBWA 1KFTA 3KKAA 2TN4A 3VRRA 4WRIA 2Y9UA 1EXRA 4RQ4A 3PJIA 4QWAA 5AERA 3FAHA 1PVPA 1SXEA 1V97A 3EYZA 1JF2A 1IM4A 4GGFC 3VC8A 5TZVA 1KKXA 3EK8A 1ZMZA 3BFBA 5DKNA 3CZ1A 4QZ8A 1AVSA 3PN7C 3PATA 3O2PA 2EH9A 1EJ3A 4C0LA 3H7IA 1J7PA 4DEZA 4GNKB 4C8MA 1SL0A 2K0JA 2LYBA 2PRUA 2FLPA 5AI0A 4RUCA 3RR7A 1M45A 1X40A 5KFGA 4M2PA 2NCPA 5BOMA 1RQLA 3Q8LA 3KHGA 3GILA 3BS7A 8ICTA 1SGGA 2N1RA 3SS4A 4M47A 1RROA 3PSPA 2JZIA 1CDLA 3F53A 3RJGA 3AL0B 4TNCA 2F1JA 4BWJA 8ICUA 2AGOA 2MUTA 4RQ7A 3RM1A 5EE0A 4GBAA 5T14A 2FMPA 2MA1A 1KFXL 3S0FA 1LKYB 3GIIA 4J03A 1MXEA 1J2NA 4UW9A 2C28A 1SL7A 1N61A 4GFTA 3NSOA 4QZIA 3AMZA 4ICBA 3C1YA 2JT0A 3GOFA 2XY5A 3MBYA 9ICEA 3HT3A 2G07A 2W9CA 2HW3A 1RK9A 3PM2A 2LHIA 1A4PA 1L3TA 3FWCA 5AKKA 2P6RA 1S6JA 2KJ9A 1YRTB 1U4BA 2QKQA 4CFRA 1PVAA 4ORCB 2UVWA 2HOIA 2FCEA 1RDFA 4G3IA 1DQEA 4JB3A 2BZFA 1KSMA 2I7AA 3M6KA 1OW4A 3OB1B 3ZDBA 2WF8A 3ZDEA 3M6ZA 4ED6A 9ICWA 2AGQA 2KVCA 2JZBA 2B6GA 3WU2U 5DQGA 1IWQA 4IL1A 2GGZA 2H8VA 2Q4UA 2FJUB 5IIIA 3DY9A 3WXAA 1S0OA 2K2AA 2W7PA 2FCDA 4PALA 3GK4X 3OBVA 2PFOA 1ZQZA 2ZUCA 1GO3F 1IRJA 4I5LB 5KFLA 4Y2RA 4N1GA 1BVSA 4YR2A 1QIWA 3NRZA 2BPCA 5AM4A 4FS1A 2NCOA 4INWA 1UT8A 4C8OA 2KHQA 2KV2A 9ICFA 1IJ6A 1IQ3A 3BQ2A 2KI6C 5HKYA 4YP3A 1BF5A 3MR6A 4Z6EA 3FE9A 4PDZA 4UATA 1TNXA 2H3FA 2E6WA 3K4GA 2D8CA 2CRXA 1BT6A 4M2OA 3PW2A 5ALOA 3AQEA 2GV5A 1U49A 2L50A 4C0KA 1T3NA 4P0QA 3QUTA 1Z00B 2JEJA 3SS5A 1B4CA 3QU9A 3LDAA 2H3ZA 3DDHA 3IV6A 1KK8C 1QSLA 4J9PA 2FPMA 3KPXA 5DB9A 4DS7A 2F2PA 2JH7A 1CDPA 1UHHA 3QUQA 2F8KA 3SIBA 1KSPA 4HYKA 4YRUA 1SIJA 1RZTA 3Q8MA 2I94A 5J8YA 2LMUA 3O4XA 4CLNA 2LHLA 2BKEA 2L2CA 2M9NA 2DBYA 4UBCA 2M0RA 5B5EU 1S3PA 1TUJA 2G09A 1QX2A 4ECYA 1SCVA 9ICLA 2BCXA 2MLFC 1XFVO 1J7QA 1NK4A 4DL2A 1ALWA 1TTXA 2CPRA 3PN7B 1YT3A 1NP8A 4F71A 2ZXIA 2ALZA 7ICFA 2WAQF 4Q44A 4CF4A 3Q8QB 3B0XA 1X2IA 2KI6D 3NTUA 2KKPA 2VJ4A 3NHTA 2ZIXA 4PGYA 2JXCA 4GXJA 4K4HA 2BAPA 2LYAA 4Y2PA 5BPJA 1JBAA 4QZDA 1ZJMA 5JUMA 3MR3A 3Q8IA 1H8BA 1UA0A 4EZ9A 7ICKA 4QIWF 4KLSA 1CLMA 3QU5A 3G6XA 7ICLA 1FW4A 5AKGA 3PW4A 4YXJA 5KT4A 4RPXA 4I2DA 4YGDB 1UWOA 1JWDA 1M6YA 2K4EA 2LCPA 1LVHA 4PE7A 4RQMA 2Y1MA 1SWWA 2Z7JA 3HX4A 2LM1A 3OPXA 1WDCC 1IIPA 2PFQA 4MEYA 3MGVA 2BCSA 2C22A 2KFGA 1ZQIA 1FI5A 4DWIA 3BS5A 5HHHA 3ZDAA 3RRHA 3QXGA 2MRLA 5J0WA 4NLCA 3BFHA 5DDYA 3OJUA 4Y2VA 2JEGA 1XO0A 1NK6A 1KFDA 4IR1A 4I2CA 4YVZA 3RJKA 2JWWA 2HSZA 4Y2QA 5HMLA 3RJIA 1JF0A 3BOWA 3MDCA 1FPWA 5ALIA 2ZNDA 1L7OA 1YZ7A 4UB6U 4QWDA 4NQGA 1BGXT 1SPYA 3QEBZ 4DF4A 4KLUA 4QWCA 4MLWA 2GO7A 2KMDA 1IXRA 5FP0A 5KG0A 4ECWA 3KBBA 2W55A 3K1ZA 7ICSA 4PHAA 1ZQHA 4CGZA 2OCEA 4I5JA 3TZ1A 2JHDA 3SZ2A 3B0YA 2H3VA 3NRWA 3NVWA 5IIKA 4C4SA 1WLMA 1RFJA 4R1EA 1CDMA 2KLDA 2AQ4A 3FC4A 4DFPA 1J7RA 1NKBA 1ZQUA 8ICJA 8ICMA 3LK9A 1K96A 4PE1A 1FEZA 5J0SA 4HRHA 1C7VA 1X02A 5KAFU 3JPTA 1PALA 2ASLA 5ALTA 4ECTA 5J2FA 2KAXA 2YN4A 3V7KA 2JH1A 1SKSA 3K75D 1KW4A 2HMXA 3Q8RB 2K2FA 1RQNA 3OTQA 4NM2A 1DK3A 2ISOA 1OUQA 5J2IA 2HPSA 1K9UA 1QXPA 1O08A 5ALMA 4ED2A 4F5RA 2QB1A 3H8MA 1B47A 2JTTA 3OGNA 4GUKA 1IG6A 3H8SA 4G9BA 2M3WA 1WUDA 5DBAA 4IQVA 2NRVA 3UM9A 2KBIA 2LVJA 4KTQA 4DSIA 3NASA 3JVTC 4P2YB 4OJLA 1MC8A 2AGPA 2LI6A 4YBHB 5ALVA 5ALGA 4KMOB 5EE3A 1N56A 1ZD2P 2W11A 1EH2A 5J0QA 3THVA 7ICHA 2P71A 3EK7A 4WQ3A 3B6XA 8ICLA 3PLFB 4IQUA 3UXPA 1Z2CB 4QZBA 1DGVA 3I5IC 5ALZA 3A0BU 1Q3VA 2GWSA 4OKHA 1QVIZ 1OXJA 1ODBA 5HL1A 2DGZA 3F5EA 1DJYA 4YGCB 3TDZA 4MEWA 4KLHA 4PHJA 3PSFA 3CR2A 3CS1A 4BWMA 4MFAA 2CBLA 3AAKA 1FO4A 3OJSA 2EDUA 1HIWA 1RECA 3BYAA 1QCKA 1SWVA 2KGBC 4NLZA 2D8NA 5ALJA 4EELA 2IOFK 4O0IA 4KLOA 1S5LU 1NZBA 2JT3A 3V2LA 4DL6A 4DOAA 2DKZA 2WC5A 4Z6FA 2EZZA 2ZTCA 4F2SA 1YZ6A 2FE9A 3RRGA 2EQYA 5L1KA 2RQ5A 3M9NB 4RQ1A 1UUSA 2I18A 3JPRA 1PVBA 3QU7A 2NLNA 4OV2A 4DOCA 1KFSA 2GOLA 1OOGA 5L9XA 9ICNA 2J6TA 1KQMC 2I1QA 2ZNEA 3I76A 1W9ZA 4USAA 4KX5A 1VLBA 2JU0A 1WYGA 2LBOA 1O03A 3PW7A 4F4WA 2KEYA 4DQQA 5AM5A 4I2FA 1QQ6A 3ONNA 3MDAA 2J6UA 2BBMA 4RT3A 4B9MA 3NGVA 4MRYA 3B7AA 4C8LA 4PZNA 3M9MB 4B9SA 2F1IA 3H0RB 2HDOA 1NKCA 3QZ7A 1QLSA 4PL2A 1ORGA 4A4CA 4F4XA 1YX7A 4DL4A 1NX3A 3AN1A 2WAQC 3HCMA 1NX2A 1JUDA 8ICZA 2XCAA 1JMSA 1K1QA 4O3QA 4RNOA 2BCUA 2O5GA 1RYUA 3WK4A 4F5PA 4I29A 3AQFA 3S0GA 1KRPA 4KLJA 3RJHA 1PVRA 1CFPA 1LA3A 1K8UA 4J9SA 1QIVA 2WCMA 1ZETA 4DQIA 3SG6A 3NHIA 2PASA 2ZFDA 2EAPA 2ZIWA 3QUCA 4HAIA 1RXWA 2PSRA 1MWNA 4M9LA 5AKZA 1NKEA 3TARA 1PUZA 2KPHA 1CFCA 2EZXA 1X66A 1XSNA 2KN7A 1CRXA 3HRDD 3C2MA 4XYNA 3HKZF 4KMUA 2CCMA 2JXLA 8ICQA 5KFEA 1ZQWA 4R64A 1K9KA 1DF0B 4YI8A 5KFWA 1FIQA 2A3VA 5HP4A 3PX6A 2I6XA 1YVHA 4F8RA 1SR6C 2FLLA 4GC6A 2EZYA 3MFHA 5HKWA 1ZQJA 5J2KA 4PGQA 3GDXA 8ICCA 4OD0A 4F91B 4TQRA 3PSIA 4P4MA 2JQ6A 3ZNIA 2V53A 5AK4A 4PHNA 2F33A 1SL8A 4YCXA 2NRZA 2ATLA 1XO5A 4RQ8A 2XGQA 4LVSA 1SR6B 2L51A 2LLUA 7ICGA 1KLNA 1A6SA 4IJ7A 3K1RB 4PE0A 4QZHA 3K21A 9ICPA 2KK0A 2KIVA 2F77X 2ASJA 1NCZA 3KD3A 2AUCA 3CNHA 1UT5A 3C28A 1U48A 2HHUA 2I5HA 4XJKB 2K7CA 1JRPA 5AM3A 4P0QB 1SV0C 3PO4A 1U5IB 4IRDA 2F3ZA 4GLXA 1ZQMA 1XO1A 2DKXA 5AIAA 3B86A 4F2RA 1S36A 2GGMA 1LA0A 4UAUA 3BQ1A 2AMIA 4CCHA 1GGWA 2QB0B 4KN4A 3ISBA 1DK2A 2V4QA 5AFPA 5DBCA 1SSEB 2OS8C 3L4AA 5JJGA 4NL9A 3SQIA 4NY8A 1X9MA 3CR4X 3FWBA 1TK0A 1CMFA 4ECUA 3WHTB 2FLNA 1PSBA 4MRXA 5KG3A 5J29A 2HHQA 4P4PA 1JALA 3SEIA 3SAHA 2MLEC 1T4GA 3OSNA 4YR0A 3HWTA 1KFXS 3RBDA 5FYXA 1KDHA 2JR5A 5J0XA 2ZRTA 3TFRA 4AYBF 4F50A 9ICBA 3ICBA 2WCLA 3KO0A 1JX4A 1YVLA 2H61C 1CDNA 1SYMA 3RJEA 3A8RA 2JRZA 4QWBA 3F5AA 2WB1F 4QZGA 4DSLA 2RGIA 1NX1A 3R1PA 2B21A 1AK8A 5DG8A 2KZZA 1Z1BA 2ZJAA 1P7DA 1MQ1A 1D9DA 5D69A 2OM6A 3AAJA 4NDCA 2K89A 2KFNA 1CFDA 1QVIY 3JPPA 4M2QA 1K2HA 3RBEA 5KFKA 3OX5A 3ORYA 5B8IB 3GIMA 1HUOA 5EWGA 2PALA 3ALRA 1NJYA 4R8UB 3IF7A 3GV8B 3BJYA 9ICMA 1OOFA 1NPQA 2LC5A 5KFXA 2FI1A 4R65A 2OWOA 4IL6U 3HKZC 5F9NA 1Z4OA 1L6NA 2L5XB 3KF9A 1ZQLA 3Q8SB 4EX6A 4M2YA 4PCWA 4IC9A 2IA6A 4FO6A 4C8NA 1GM0A 2BPGA 2EANA 2KQ6A 2R2IA 3J81j 3SAGA 1K90D 4ELTA 1BR1B 5J2DA 1L7ZA 4I2BA 8ICSA 4M6WB 3D0YB 1BPXA 5AK5A 4HSZA 2EAMA 2JT8A 2LP2A 1DJHA 3M0WA 3BZKA 4BUGA 4JWNA 5CSNA 4F0ZB 2WF7A 4FBTA 2E8NA 1XA5A 3AKAA 4RQ2A 2JC2A 1GJYA 1OE9B 2HBLA 4DSEA 4O3OA 3Q8KA 3CP8A 4QZFA 3R72A 1ZD4A 3G6VA 3EUB2 4KX3A 4EBDA 2PMYA 1UPHA 5EWFA 4UB3A 8ICKA 4Q04A 2F3NA 3PZPA 5AKXA 2KP7A 4UAWA 3LYSA 7ICNA 1QX7A 4EENA 2YTUA 4NM1A 3I28A 5D46A 4KN7A 5JRTA 4KITB 3QUBA 2VKQA 1MA7A 5CPVA 4YGBB 2BCRA 1SV0A 4R63A 1Z4NA 2L0PA 1K9PA 2M8UA 4DO9A 1BPDA 5I2QA 1Z4HA 3N7HA 4JV1A 1WLZA 1K5OA 3AM9A 5ALHA 1WRKA 3BFAA 4GXIA 3ZD8A 5ALRA 1M63B 2KLEA 1DJGA 3N7SC 2JULA 5TNCA 3IG5A 1C07A 4MZLA 1QTMA 5D7FA 2K4PA 3S6JA 3NVVA 2KI4B 2R8JA 1N5XA 3AU2A 2P66A 3PM8A 1NWDA 2YQEA 3GIJA 5J0OA 1F4QA 1N48A 5F9LA 4O3MA 1MHOA 3S0EA 3S0DA 1NJWA 3DVEA 4RZRA 4F5OA 2NRTA 1QH9A 2KFZA 2B1UA 2FOTA 5KFJA 4I27A 1L3VA 1NK9A 4IR9A 9ICOA 1AROP 4QNLA 2NV3A 1A03A 1CLBA 1Y88A 5L1MA 3BQ3A 4BDPA 2SCPA 5DBBA 3IDWA 2ZIUB 2W3RA 3TQ1A 5J0TA 4M9HA 1PK0D 2IS9A 1ZQRA 5CSJA 4UB1A 5HKZA 1Q3UA 2QLTA 2ZIWB 1B9AA 1NSHA 3GU3A 2Y0SF 4DQSA 2AJQA 2LKYA 2C2RA 5AI9A 5G5GA 1T14A 1OQPA 2IBKA 3C29A 4UB2A 4Y2SA 8ICGA 1UHIA 2KQYA 2Y0SC 3QEAZ 2LM5A 4Q8FA 2XC9A 1XFYO 3LK1A 2XI9A 3RR8A 2AXTU 4FS2A 1OOIX 1TNPA 3KOOA 2KGRA 1S5GY 1Z00A 2MAXA 4C7YA 3CZ2A 2YGUA 4F93B 2JMGA 2E8OA 4YQWA 4U7CA 7ICPA 1A76A 2BCAA 3KFUF 2DPJA 1D9FA 3NUQA 4ELVA 2KG5A 2FPLA 5DDMA 2A1JA 3D74A 3UXOA 2JNFA 2BQUA 5AANA 4DIRA 3D6JA 5KFBA 3I5HC 1ZQPA 2QEOA 1ZQSA 5BOLA 3SYZA 8ICOA 3LWMA 4DSJA 3PMNA 5K89A 1TAMA 3D77A 2BR0A 2BDUA 1BMOA 4O5KA 4ECXA 1NJXA 2ZTEA 3OHBA 3WK9A 1DRGA 4NLKA 3DVJA 5AI5A 1XNSA 5DB6A 4ECQA 3KEVA 3CRXA 2JEIA 2XVTA 4F92B 3F2CA 3DV9A 2IHNA 1DJZA 1K93D 4KYNA 1QQ7A 3SG3A 5ALNA 1N63A 2ES6A 4A8EA 1ZQTA 2MU2A 1V85A 5HLVA 1ZQCA 1CFFA 4PHDA 5ALQA 2OYYA 4PGXA 3PW0A 1OOHA 3RAQA 2JV3A 4C8KA 7ICJA 2CXJA 1L7MA 3ED5A 1S77D 4J9QA 1N2XA 3WKAA 1TCFA 9ICJA 4QJFB 5AM2A 1UHUA 4ORBB 4OJOA 3IP4B 1B7TY 5KFRA 2DOQA 4LZGA 2LMRA 1RWYA 1JN3A 4OJ6A 2DPIA 2H61A 4B9LA 1LS8A 1SY9A 5J2EA 3TDUA 9ICKA 1WWUA 3H0LB 3BUWB 1S9FA 3BS5B 4C0JA 4KLDA 3SG5A 3HJEA 4PHPA 2CTNA 4IS7A 2NRXA 1S97A 3PX4A 2ZIVB 2RDJA 3R1OA 4OCZA 3HW8A 1JXLA 2BCBA 3VB1A 1LB2B 1X9WA 4TUQA 1H38A 9ICVA 2HBMA 4O3NA 7ICIA 1SKRA 5K4LA 1QWVA 3VCBA 4KLQA 2FPKA 3C5FA 3TAQA 3I5GB 3EKJA 4ORAB 3M8RA 5J3XA 3MR2A 5KT3A 2KE7A 1KBUA 5KFQA 5J2GA 1MR8A 3WK8A 1BODA 3LVWA 4K4GA 3T5LA 1DF0A 4JUZA 1QX5B 5KU1A 2Q0ZX 4UBBA 1L5UA 2LLSA 3BOWB 2O6KA 4J9MA 2FMSA 4DSKA 4B9TA 2HHXA 2MSNA 3N7RC 5AI6A 1G33A 4US8A 3QX7A 2LAPA 3BJHA 1BNPA 1FFUA 4US9A 2W3SA 4Y2XA 8ICVA 4Q8EA 1M31A 4PHMA 1TVAA 2BKHB 2BE4A 1ZOLA 1PSRA 1H4BA 3ISDA 4DSFA 1TAQA 2R8HA 4U8DA 2VRGA 3I5FC 3ETLA 3D0YA 3M7DA 2IMWP 1VDVA 1B8LA 1MQ2A 1T94A 5AI8A 5JTIA 2PMZC 4Z6DA 1U9LA 1SXDA 4XRHA 1IG5A 1NK5A 1TV9A 1W7IB 4M9GA 3CYMA 2BCQA 2G5IB 4IRCA 3L5KA 9ICRA 2SASA 3R1VA 1WG8A 2LYHA 1M39A 1X42A 2K60A 2W8KA 2DUYA 5GTHU 4Q45A 3LWLA 3HILA 4BY4A 2L4IA 1UCVA 2Y1IA 3V7LA 1L2OC 1TRFA 2EC6B 2P70A 2B0CA 5KFPA 1L3UA 4QW9A 3OB2B 4PHKA 1TK8A 2JPOA 1F71A 1TNQA 3D10A 3RLZA 2A19A 4RPZA 1NI3A 4F3OA 1VRKA 4FQTA 3LVVA 1UHKA 5D49A 5HR7A 2COLB 2MA2A 1AHRA 2XICA 1L8LA 2KZ3A 1KFUS 3CGAA 2Y1JA 1ZFSA 3RFAA 2LMVA 2LNKA 1U45A 2G08A 3HX0A 1LKYA 4RQ0A 1OMVA 1PK3A 4BXOB 1NYAA 1CEZA 3I5HB 3GQCA 2WCEA 4A4BA 3NVYA 1S6CA 1B8RA 2QEHA 4C4RA 2AHOB 3QYPA 1QS7A 4OO1J 1FBVA 1Z1VA 5ALKA 4AQJA 2M49B 2ZRSA 2RHFA 4KLMA 5DB7A 4YI9A 2QARA 4MFFA 4R8UA 2LMTA 2YMLA 3BDPA 4QZAA 1EL4A 1N2DA 1KQMB 3C5GA 1S5GZ 2BKIB 2OHFA 4I28A 5J8YC 4JWMA 2HVIA 2OTGC 2HBKA 4C7ZA 5J2HA 4B9VA 4FE3A 3Q8PB 3KHRA 3BUNB 3I5FB 4TUPA 1LINA 3C1ZA 4YMOA 2YB1A 4PHEA 4KLGA 5KL1B 3UMCA 3GFKB 4NJ8A 2ZIVA 2W9BB 4FQOA 1KN5A 1ZD5A 2HHVA 2WF9A 4GGFA 3IHQB 3JTDB 4FZMA 2QEVA 1DGUA 5AICA 3RB4A 4J9OA 4NLBA 4IQWA 1BPYA 4P4OA 5AK3A 1TK5A 1XVJA 1XWLA 1OZSA 3O4YA 5DB8A 1BPZA 3EZ5A 1L7NA 4KLEA 1OOJA 4NXZA 1C3ZA 1EXNA 3FE6A 2XO7A 5J2CA 2M97A 1KCYA 4YD1A 2KSPA 3DVMA 2GLEA 1ED1A 1LXFC 3D73A 1GGZA 2WHEA 2HF5A 3DYEA 3TUYB 1PK1A 4F4KA 4NDDA 3WKDA 1V38A 5DKWA 1DC1A 4ED8A 2D6FC 1OMRA 2BGWA 2A1JB 2MBXA 2G9BA 7ICUA 3D75A 2GTEA 4RU9A 2KNEA 3FE8A 1B7TZ 3L4PA 1S0NA 1WY9A 1OSAA 3SI8A 4JQ0D 4NWIA 1NIWA 1J55A 1A75B 2H5XA 3UMGA 5KFCA 1LVCD 1XK4C 3PR5B 3EPGA 1Y1XA 4OCIA 4QZCA 5KFMA 2KYFA 4CFQA 2KDHA 2E5SA 5J2AA 4DS5A 1G8IA 2KTQA 1KK7Y 2K4HA 3K1EA 2NO4A 3PR4A 4M9JA 5B66U 2RRDA 4ED1A 4FBUA 5L1JA 4OZDA 3OSPA 5KFNA 3PX0A 4ACOA 1MN8A 3CTNA 5G5HA 3F2BA 1QATA 4F4ZA 3SV4A 2NO5A 4P0PB 1P28A 3OHMB 2R18A 4EEYA 2F3YA 1F8HA 1IV8A 5HYDA 8ICBA 4ECRA 3WHUB 3D2NA 2W9BA 4F5QA 4AP9A 2HCFA 1PVQA 3UQ0A 4DFDA 3C1VA 2KYCA 5J0PA 2ZUDA 4MZKA 3TS5B 2JOJA 1N5WA 1DVIA 1DJWA 4PT1A 2DF4B 1DTLA 2YB4A 1G4YR 3TACB 5J2BA 2HOFA 3N28A 2FJ6A 5KFHA 1YUUA 1A2XA 2DQNB 2JNXA 1C7WA 4WQ2A 3AUOA 2LPEA 1QJTA 4RUAA 5KNIA 2VA2A 3NSKA 4M6WA
chains in the Genus database with same CATH topology
1SV0A 1B4FA 3SENA 5JTIA 1Z4HA 1SXDA 1DEKA 3KKAA 3OBVA 2KSOA 4JKTA 2Y9UA 4I5LB 4RQMA 1DXSA 2KLEA 3KEVA 1SXEA 2K60A 3UO9A 4MHVA 2EAPA 2GLEA 2K4PA 1DELA 4KYNA 3HILA 1SV4A 4I5KA 3BS5A 2ES6A 1UCVA 1PK1A 5FI7A 5JU5A 3IVTA 1X66A 2E8MA 1V85A 4RQNA 1Z2CB 2E8PA 1V38A 3UNWA 1DC1A 4NL9C 2JV3A 1UQVA 5HL1A 1OXJA 2D8CA 1X40A 4MEWA 5FI6A 5FI2A 3SS5A 2Y9TA 3TADC 3BS7A 1SGGA 2LMRA 4I5NB 5L1MA 3KKAC 2D3DA 4PZOA 3SS4A 1JI7A 1LKYA 1WWUA 3IDWA 5F3XB 2F8KA 1PK3A 2KMDA 2QARB 4GAOA 3BS5B 1COKA 2DKZA 2BNXA 1F0MA 4IS7A 2EANA 5J8YA 2DL0A 2FE9A 3O4XA 1PK1B 4GBAA 4IJ7A 2EAMA 2ESEA 3K1RB 1LKYB 4I5JA 2F44A 1Z1VA 2KIVA 2E8NA 1WWVA 2KLDA 1W9ZA 2QARA 1OW5A 1SV0C 2L5YA 2KSOB 2KE7A 3PM2A 2DKXA 3TADA 5J8YC 5D3OA 1KW4A 2QKQA 2YGUA 5I94A 2E8OA 2QB0B 2F3NA 2BAPA 4PZNA 2EAOA 3EG5B 1RG6A 3BQ7A 4NL9A 2KG5A 4NJ8A 1X9XA 1B0XA 2YTUA 3TACB 3SS3A 2QB1A 3H8MA 5JRTA 2LPEA 2QB0A 5KNIA 3SEIA 2B6GA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1SV0 A;  1B4F A;  3SEN A;  5JTI A;  1SXD A;  3KKA A;  2KSO A;  2Y9U A;  4RQM A;  1DXS A;  1SXE A;  2K60 A;  4MHV A;  2EAP A;  2GLE A;  2K4P A;  3HIL A;  1SV4 A;  3BS5 A;  2ES6 A;  1UCV A;  1PK1 A;  5JU5 A;  1X66 A;  2E8M A;  1V85 A;  4RQN A;  2E8P A;  1V38 A;  4NL9 C;  2JV3 A;  1UQV A;  1OXJ A;  2D8C A;  1X40 A;  2Y9T A;  3TAD C;  3BS7 A;  1SGG A;  2LMR A;  5L1M A;  3KKA C;  2D3D A;  4PZO A;  1JI7 A;  1LKY A;  1WWU A;  3IDW A;  5F3X B;  2F8K A;  1PK3 A;  2KMD A;  2QAR B;  3BS5 B;  1COK A;  2DKZ A;  1F0M A;  4IS7 A;  2EAN A;  5J8Y A;  2DL0 A;  2FE9 A;  1PK1 B;  2EAM A;  2ESE A;  3K1R B;  1LKY B;  2F44 A;  1Z1V A;  2KIV A;  2E8N A;  1WWV A;  2QAR A;  1OW5 A;  1SV0 C;  2L5Y A;  2KSO B;  2KE7 A;  2DKX A;  3TAD A;  5J8Y C;  1KW4 A;  2QKQ A;  2E8O A;  2QB0 B;  2F3N A;  4PZN A;  2EAO A;  1RG6 A;  3BQ7 A;  4NL9 A;  2KG5 A;  4NJ8 A;  1X9X A;  1B0X A;  2YTU A;  3TAC B;  2QB1 A;  3H8M A;  5JRT A;  2LPE A;  2QB0 A;  5KNI A;  3SEI A;  2B6G A; 
#chains in the Genus database with same CATH topology
 3T5H A;  2F1H A;  2LV7 A;  4KLL A;  1JSA A;  1N62 A;  5DGB A;  1UP5 A;  5DG7 A;  2KKV A;  2WF5 A;  5EE9 A;  1TOP A;  4OVN F;  4DOB A;  5E79 U;  1SMG A;  1DGS A;  4DS4 A;  2KIW A;  3F2D A;  4I2J A;  8ICY A;  2KJ8 A;  2NRW A;  3F45 A;  4DLG A;  1TNW A;  5GTI U;  2IOH A;  5CEH A;  3KTQ A;  1ZAC A;  3UO9 A;  1F70 A;  3V72 A;  1NJZ A;  4MHV A;  3B87 A;  1L7P A;  1SV4 A;  1IH0 A;  7ICO A;  1T7P A;  2PI5 A;  3L4L A;  1HJP A;  2ZN9 A;  4CE6 A;  4AYB C;  1A0P A;  2PMZ F;  4OR9 B;  4IRK A;  5AM1 A;  2ZIU A;  2LE9 B;  1KFU L;  4ED7 A;  5AIB A;  2WF6 A;  2YX8 A;  1JXE A;  2K7B A;  1OZO A;  3MAB A;  7ICV A;  1YUR A;  3PAL A;  3V7J A;  2HQW A;  3DF0 A;  3WK5 A;  4LZD A;  2PFN A;  4GXK A;  2JPT A;  3GK2 A;  2BL0 B;  4B9N A;  1TFR A;  2L98 A;  3E58 A;  4MZJ A;  2XCP A;  4DQR A;  3PVX A;  5H2F U;  1MUX A;  3N7P D;  4E0D A;  3VRO A;  1D1O A;  3EVU A;  4FZL A;  4J9K A;  5HHI A;  4XUS A;  2E1F A;  3GK1 A;  2WCH A;  1AUI B;  2JGA A;  4P2H A;  1CNP A;  1KSO A;  2KFH A;  1ZD3 A;  1B22 A;  3BQ0 A;  2F44 A;  1XFU O;  1B1G A;  2GH1 A;  4NDB A;  4N1F A;  3IQQ A;  4YGE B;  5IIO A;  2H3I A;  4J9R A;  1ZQY A;  4O9M A;  5ER4 X;  4QJ5 B;  4DQP A;  5I2L A;  5KFY A;  2XGP A;  7ICE A;  1OW5 A;  2P35 A;  1ZQV A;  1CB1 A;  1MSW D;  1Y1A A;  9ICU A;  2K7D A;  4ZOH C;  4F72 A;  1V9P A;  5C5J A;  2KBM A;  4I2H A;  4DF8 A;  3TAP A;  3NXA A;  2EGD A;  2BHN A;  2K8M B;  3SIA A;  3TDI A;  3TUY C;  3EG5 B;  3N97 B;  3HPO A;  1NK0 A;  5ALD A;  9ICQ A;  4I2G A;  5KFV A;  2RP5 A;  1K95 A;  5KTQ A;  3H0M B;  2HHT A;  5DLG A;  1UHN A;  2DFL A;  1HT9 A;  4DCC A;  3PV8 A;  1KK8 B;  3CAB A;  1UHJ A;  1ZOT B;  4CF5 A;  1L2O B;  3CDN A;  2WB1 C;  5KFA A;  5L1L A;  4ECZ A;  4BY5 A;  4TQS A;  4ED0 A;  1NZP A;  2CXY A;  1QQ5 A;  3EKH A;  5AHX A;  4JV0 A;  1ECW A;  1JFJ A;  1TE2 A;  2AAO A;  1DEL A;  3EW9 A;  5KFZ A;  5F6T A;  4I5K A;  1HQV A;  1QLN A;  3AKB A;  5KAI U;  3MR5 A;  3O6B A;  2R8G A;  4YR3 A;  3RH5 A;  3IVT A;  5JOL A;  2WND A;  5KT6 A;  1URJ A;  4UAV A;  4KLI A;  2MAZ A;  4NL9 C;  1D8L A;  1XSP A;  1PZN A;  1UQV A;  2UVR A;  5KG1 A;  3EVV A;  1JRO A;  5ALX A;  1YTZ C;  2QPT A;  7ICR A;  3PO5 A;  2V4R A;  1T8E A;  5KFD A;  2MJW B;  1CMG A;  1CM4 A;  4RNM A;  3O78 A;  2ISP A;  1S8O A;  2G2B A;  1QSS A;  4UAR A;  2VAN A;  4MBE A;  2W8L A;  2MRD A;  3JPO A;  1QTX A;  2F2O A;  5F3X B;  5DG9 A;  4GAO A;  1X6J A;  1F0M A;  5KG6 A;  2HHW A;  1KK7 Z;  1ZQX A;  2LLT A;  4UB5 A;  2XID A;  1SL1 A;  3T5J A;  3CZ0 A;  1TWO A;  3WKE A;  2Y4Q A;  3GIK A;  8ICF A;  1L3S A;  1CKK A;  3BUX B;  1X9S A;  3RJJ A;  5ALP A;  1AQ6 A;  3MGI A;  1TUZ A;  4OJ5 A;  3SMV A;  5A0L A;  1BPE A;  5ALU A;  5KT7 A;  5DKQ A;  2NYV A;  1ZQQ A;  1AP4 A;  4FZN A;  4EYH B;  2KSO B;  3B88 A;  2C2E A;  2OEH A;  1CM1 A;  5AM0 A;  3SV3 A;  5KG2 A;  3TAD A;  4R66 A;  4ZH4 A;  3E2E A;  2Q91 A;  1SK6 D;  4CID A;  5I94 A;  4NLG A;  1ZUZ A;  1Y1U A;  3H8W A;  4X5V A;  2R8I A;  3RB3 A;  2EAO A;  2M7N A;  2WC6 A;  5KG4 A;  2R8K A;  3ISC A;  2ODG A;  3V6H A;  2VA8 A;  3LL8 B;  1X6I A;  1SBJ A;  1RJV A;  4OJP A;  4EZ6 A;  2WCB A;  5ER5 A;  1C7Y A;  4ED3 A;  1KEJ A;  5CA7 A;  4HRG A;  2QAC A;  3CZT X;  1DEK A;  2DWQ A;  9ICT A;  3SJS A;  2Y5I A;  1XFR A;  3KHH A;  2LVI A;  1CLL A;  1NOM A;  5AKH A;  3MFI A;  4RPY A;  4M9N A;  2CN1 A;  2FJY A;  3TS5 C;  3ETR A;  2BL0 C;  3SD7 A;  3GV5 B;  1TIZ A;  2ZJ5 A;  2F2A B;  2NZ0 A;  4GGN A;  2OPO A;  3JPQ A;  1N60 A;  9ICX A;  1ZJN A;  2LHT A;  3VRP A;  1MF8 B;  1F55 A;  4UQG A;  5L1I A;  2EC6 C;  4GC7 A;  1IKU A;  1N0Y A;  2QEB A;  4B6J A;  1HEK A;  1Y6W A;  1ZXI A;  3OHA A;  3IRU A;  1QV0 A;  3T79 A;  3UNW A;  3QU2 A;  3EWA A;  1SKW A;  3A4U B;  4RNN A;  2PYQ A;  1ZYQ A;  5DLF A;  4BXO A;  2LP3 A;  4N5X A;  4BJQ A;  3SG4 A;  3JPS A;  1S76 D;  4Y2Y A;  4NLN A;  3NSI A;  1D8B A;  2W9C B;  1S0M A;  2IHM A;  2LVK A;  8ICR A;  1SZP A;  9ICG A;  1BPB A;  1YRU B;  1F54 A;  4ECS A;  1A29 A;  3RF9 A;  3MGH A;  1SL9 A;  3T3F A;  3KKA C;  2D3D A;  4PZO A;  2BBN A;  4J9L A;  5IIJ A;  2UVU A;  5ALL A;  1JI7 A;  4EEK A;  1SCM C;  1DMO A;  3SG2 A;  2QAR B;  4KLT A;  1COK A;  3PW5 A;  4O3P A;  5KFF A;  4RQ5 A;  4Y2T A;  3RJF A;  3FDS A;  5DKR A;  3BZC A;  2EHB A;  3FS7 A;  2RDI A;  2DL0 A;  2ZTD A;  3KZI U;  2L2E A;  3C2L A;  5CP2 A;  1SKT A;  2KAV A;  8ICA A;  3UPQ A;  2W54 A;  2BE6 A;  1RM6 C;  4EBE A;  4MN0 A;  3PY8 A;  5AI4 A;  4EBC A;  2KNJ A;  1XSL A;  2KIC A;  1SNL A;  5KTY A;  3DD4 A;  1C3Y A;  1YR5 A;  1XS9 D;  1E8A A;  1XC9 A;  1M46 A;  1SB3 C;  2V9W A;  2CT9 A;  3BQT A;  5EE1 A;  3EK4 A;  2E3T A;  3GZF A;  4IQT A;  4O5E A;  1NX0 A;  4INX A;  3PML A;  2JXJ A;  4DFJ A;  1ZQ1 C;  3A0H U;  7ICT A;  1JIH A;  2HET A;  1U5I A;  2WCK A;  5I8N A;  1RG6 A;  5AKY A;  4YD2 A;  2ZXH A;  1K1S A;  2M1K B;  3QME A;  1GQM A;  3SS3 A;  1ZQE A;  5CJ7 A;  1ZQB A;  2LVV A;  2QB0 A;  2K4I A;  4FFD A;  5IIL A;  4YFK A;  3UXN A;  1CI4 A;  3SEN A;  1CUK A;  3CWG A;  4JV2 A;  8ICN A;  1VJ5 A;  2WCF A;  4M04 A;  1U47 A;  2M1U A;  4JKT A;  1PRW A;  2BQR A;  4CF3 A;  2KD1 A;  3WKC A;  3RH6 A;  5EL2 A;  1XK4 A;  3WNX B;  3NVZ A;  3NS1 A;  1FFV A;  2NXQ A;  1HUZ A;  2KI4 C;  2G5H B;  1EG4 A;  1BU3 A;  2K8A A;  5AKJ A;  2KHN A;  4PL1 A;  4YN4 A;  2WC8 A;  1L8O A;  3BUM B;  5ALF A;  4YMM A;  3ZDC A;  4NV0 A;  2CNP A;  5AKL A;  5JU5 A;  1NCY A;  5C0Y A;  3M8S A;  4RQN A;  3NGD A;  2E8P A;  9ICS A;  1S1E A;  4UAZ A;  4MFC A;  5CWR A;  3VRQ A;  3LK0 A;  2IOF A;  3R9K A;  1IJ5 A;  1NNL A;  2PKE A;  4EYI B;  2O60 A;  2M9G A;  4Y2U A;  3RH4 A;  3CLN A;  1UA1 A;  4DRW A;  3LLE A;  2Q4T A;  2Y9T A;  5CRX A;  1UUR A;  5J0R A;  1Y0V H;  4QZ9 A;  8ICI A;  4MSP A;  1B43 A;  2BDP A;  1AJ5 A;  4I5N B;  4JMU A;  1J2M A;  3M9O B;  4YMN A;  2LUX A;  1ZRN A;  5KT5 A;  3H40 A;  9ICC A;  2BQ3 A;  2MHH A;  1SZH A;  4UPG A;  2AU0 A;  1F5S A;  1ZQF A;  3D78 A;  5ALW A;  1RYS A;  7ICQ A;  1SRA A;  2AH5 A;  3DEE A;  1WDC B;  3CR5 X;  5EWE A;  5KT2 A;  4D1E A;  3MSE B;  1WCL A;  4DUQ A;  4UB8 U;  5KSZ A;  1F44 A;  2PI4 A;  1ALV A;  4QW8 A;  4ZCV A;  4PJ0 U;  3B9J A;  2ZKM X;  2OS8 B;  3PFV A;  3CW2 C;  3C21 A;  1JUO A;  3UMB A;  4B9U A;  1N65 A;  2OH2 A;  3QRX A;  1NK7 A;  3JVT B;  1KWO B;  5AK6 A;  5BPC A;  2I9G A;  3V6K A;  3DVK A;  1JC2 A;  2ZUB A;  3SG7 A;  5DQH A;  1XFW O;  2PQL A;  5AKI A;  5ALE A;  1ZQA A;  4J9N A;  5CB1 A;  1CTR A;  2KZM A;  2KHV A;  2ZG6 A;  2HQ8 A;  1YUS A;  1A77 A;  3ICX A;  3KHL A;  1S10 A;  2QDI A;  4PPX A;  4JPZ B;  4MVF A;  4EX7 A;  1B4F A;  1MXL C;  3BXK A;  1R6P A;  1XFX O;  8ICP A;  1BLQ A;  4BX9 C;  4UAS A;  4I2I A;  4YG2 A;  1ZRM A;  3S0B A;  2A1A A;  2WCJ A;  3GV7 B;  1ZQG A;  3DXL A;  4YGA A;  1Q8K A;  4BGD A;  4QWE A;  4TUS A;  1NUB A;  2JZB B;  2WFA A;  2I2R E;  1ZQK A;  5EOZ A;  3N4M B;  1B8C A;  2BCV A;  4C4T A;  5IIM A;  3D2S A;  2WOS A;  1BR4 B;  1SL2 A;  3FM9 A;  4F7F A;  2RLT A;  3NSL A;  2XY6 A;  4ICA A;  2HI0 A;  3QE9 Y;  4P5O E;  3QZ8 A;  3IN5 A;  4L9M A;  2VIX A;  5ALS A;  3JPN A;  9ICA A;  3I5G C;  3WK6 A;  1A75 A;  1S6I A;  1S0V A;  3OGU A;  1V1G A;  3L3F X;  1TCO B;  2H2K A;  1D8Y A;  3C2K A;  5KG5 A;  4LJX A;  4I2A A;  3DZT A;  2OXO A;  4MF2 A;  5FI6 A;  5CHG A;  2W04 A;  2ZIX B;  3FIA A;  5KG7 A;  2K8C B;  5FI2 A;  3D76 A;  4Y2J A;  4PH5 A;  2XY7 A;  1K94 A;  4FTG A;  3FYH A;  2YMM A;  1NK8 A;  4DFM A;  4TUR A;  3TAN A;  3AEV A;  1OMD A;  2JRF A;  2J6S A;  9ICI A;  3PNC A;  2P6B B;  4GFJ A;  1RPL A;  1QV1 A;  3HP6 A;  4QIW C;  1TKD A;  1IIO A;  1KWO C;  3I5I B;  1BNO A;  4DL5 A;  4GPL B;  1KQQ A;  1J1D A;  3WK7 A;  2ERB A;  4DLE A;  4ELU A;  2LUC A;  2HBJ A;  3QNM A;  3RB0 A;  1AJ4 A;  2W9M A;  2F8P A;  4CNQ A;  5GQQ C;  1KQV A;  2LM4 A;  2K8B B;  2MUT B;  4ETO A;  4RQ3 A;  2OTG B;  2A4J A;  3LCP C;  5AKE A;  4O3S A;  1ZQN A;  2H3Q A;  2M0N A;  2KAY A;  4U6P A;  2ASD A;  4QJ3 B;  1XU4 A;  2W7O A;  4DL7 A;  2L5Y A;  1DGJ A;  4YXM A;  2FMQ A;  5J0Y A;  3TFS A;  2K61 A;  3JTD C;  3SR6 A;  2W43 A;  5KFI A;  2VA3 A;  4O5C A;  2ZJ8 A;  1SW8 A;  3WKB A;  3VGO A;  1XFZ O;  5D3O A;  1J7O A;  5DIC A;  1BG1 A;  4WJ3 B;  3ZWH A;  3G6Y A;  1BOC A;  5KFT A;  1Q46 A;  1RTP 1;  3TI0 A;  3BQ7 A;  4ZCU A;  3H8J A;  2LAN A;  3ZDD A;  5I2O A;  5J0U A;  2PVB A;  2ISD A;  1XYD A;  5HMM A;  8ICW A;  1FI6 A;  1W7J B;  4RQ6 A;  1Q80 A;  2JEF A;  5IIN A;  1DJX A;  3OX6 A;  4K4I A;  2HOQ A;  4AOM A;  3H4B A;  3I1Y A;  2YMQ A;  3D2Q A;  4MF8 A;  1LKJ A;  2FDR A;  5CSF A;  1IQ5 A;  4I2E A;  2KSO A;  5ALY A;  1DXS A;  4Q43 A;  3KZX A;  4QZE A;  4CDG A;  3CYZ A;  4P0P A;  4DFK A;  2W9A A;  1RYR A;  4JD9 A;  3VRN A;  8ICH A;  2BEC A;  2F8L A;  1T3Q A;  5D4B A;  1YUT A;  4KLF A;  3EVR A;  4USL A;  3E3R A;  2BPF A;  1RXV A;  3IM1 A;  4QJ4 B;  1MQ3 A;  2WTF A;  1TN4 A;  4F4Y A;  3RTV A;  5FI7 A;  2E8M A;  2E1E A;  1QSY A;  1KL9 A;  1ZQD A;  2VJ5 A;  3L47 A;  5AEQ A;  5PAL A;  3RZS A;  1EG3 A;  3T5K A;  3E0F A;  7ICM A;  2F76 X;  4E68 A;  3S0A A;  1QAS A;  3U26 A;  2E30 A;  1DOQ A;  4XJK A;  3TAD C;  3PST A;  1JFK A;  2PFP A;  5AXI A;  1S26 D;  4XQ8 A;  2HVH A;  4O3R A;  4UAY A;  1C20 A;  1LV5 A;  4GIB A;  1R2U A;  5CR0 A;  1COO A;  3EPI A;  1ZQO A;  5HR6 A;  3OP0 A;  5HNK A;  5J2J A;  3IG8 A;  4C80 A;  4CPV A;  2KVS A;  1F4O A;  5DQI A;  2YMP A;  2BNX A;  4CRX A;  3H4S E;  3RAX A;  5KL8 B;  9ICH A;  2YY6 A;  8ICX A;  3KHE A;  1Z3E B;  2KOB A;  3MC1 A;  3ZD9 A;  4JWQ A;  1PK1 B;  1QLK A;  3BUO B;  2ESE A;  2M29 A;  3PSR A;  2P6U A;  1J1E A;  1DT7 B;  3RB6 A;  4XA5 A;  4JK1 A;  4MEX A;  3AU6 A;  1V1F A;  1WWV A;  2KOT A;  4PE4 A;  5DGA A;  3DF0 B;  2G06 A;  4UB4 A;  5KFU A;  3SAF A;  2UVV A;  3V6J A;  1IGV A;  1WCN A;  4AQI A;  1YX8 A;  4M0A A;  4C0Z A;  4DL3 A;  3TKA A;  2W03 A;  1WRZ A;  2KJ5 A;  1J97 A;  4HRE E;  5KFS A;  5CSI A;  8ICE A;  1KTQ A;  1SCM B;  2K7O A;  3ZI4 A;  1BJF A;  4DCK A;  1TAU A;  2WOR A;  4F5N A;  1Z19 A;  3IQO A;  2C2D A;  2ZN8 A;  1X9X A;  1B0X A;  2HHS A;  3C23 A;  2Y1N A;  3H4D A;  5TIS U;  1DJI A;  3UQ2 A;  5G08 A;  2M7L A;  3M1Y A;  1NCX A;  4ECV A;  1FF1 A;  5HLO A;  3QU4 A;  2JTZ A;  1PUL A;  1WRL A;  2KFF A;  2L4H A;  2G0A A;  4Z6C A;  3O0F A;  5KFO A;  2PXI A;  4RT2 A;  2AQ0 A;  5IBW A;  1KFT A;  3KKA A;  2TN4 A;  3VRR A;  4WRI A;  2Y9U A;  1EXR A;  4RQ4 A;  3PJI A;  4QWA A;  5AER A;  3FAH A;  1PVP A;  1SXE A;  1V97 A;  3EYZ A;  1JF2 A;  1IM4 A;  4GGF C;  3VC8 A;  5TZV A;  1KKX A;  3EK8 A;  1ZMZ A;  3BFB A;  5DKN A;  3CZ1 A;  4QZ8 A;  1AVS A;  3PN7 C;  3PAT A;  3O2P A;  2EH9 A;  1EJ3 A;  4C0L A;  3H7I A;  1J7P A;  4DEZ A;  4GNK B;  4C8M A;  1SL0 A;  2K0J A;  2LYB A;  2PRU A;  2FLP A;  5AI0 A;  4RUC A;  3RR7 A;  1M45 A;  1X40 A;  5KFG A;  4M2P A;  2NCP A;  5BOM A;  1RQL A;  3Q8L A;  3KHG A;  3GIL A;  3BS7 A;  8ICT A;  1SGG A;  2N1R A;  3SS4 A;  4M47 A;  1RRO A;  3PSP A;  2JZI A;  1CDL A;  3F53 A;  3RJG A;  3AL0 B;  4TNC A;  2F1J A;  4BWJ A;  8ICU A;  2AGO A;  2MUT A;  4RQ7 A;  3RM1 A;  5EE0 A;  4GBA A;  5T14 A;  2FMP A;  2MA1 A;  1KFX L;  3S0F A;  1LKY B;  3GII A;  4J03 A;  1MXE A;  1J2N A;  4UW9 A;  2C28 A;  1SL7 A;  1N61 A;  4GFT A;  3NSO A;  4QZI A;  3AMZ A;  4ICB A;  3C1Y A;  2JT0 A;  3GOF A;  2XY5 A;  3MBY A;  9ICE A;  3HT3 A;  2G07 A;  2W9C A;  2HW3 A;  1RK9 A;  3PM2 A;  2LHI A;  1A4P A;  1L3T A;  3FWC A;  5AKK A;  2P6R A;  1S6J A;  2KJ9 A;  1YRT B;  1U4B A;  2QKQ A;  4CFR A;  1PVA A;  4ORC B;  2UVW A;  2HOI A;  2FCE A;  1RDF A;  4G3I A;  1DQE A;  4JB3 A;  2BZF A;  1KSM A;  2I7A A;  3M6K A;  1OW4 A;  3OB1 B;  3ZDB A;  2WF8 A;  3ZDE A;  3M6Z A;  4ED6 A;  9ICW A;  2AGQ A;  2KVC A;  2JZB A;  2B6G A;  3WU2 U;  5DQG A;  1IWQ A;  4IL1 A;  2GGZ A;  2H8V A;  2Q4U A;  2FJU B;  5III A;  3DY9 A;  3WXA A;  1S0O A;  2K2A A;  2W7P A;  2FCD A;  4PAL A;  3GK4 X;  3OBV A;  2PFO A;  1ZQZ A;  2ZUC A;  1GO3 F;  1IRJ A;  4I5L B;  5KFL A;  4Y2R A;  4N1G A;  1BVS A;  4YR2 A;  1QIW A;  3NRZ A;  2BPC A;  5AM4 A;  4FS1 A;  2NCO A;  4INW A;  1UT8 A;  4C8O A;  2KHQ A;  2KV2 A;  9ICF A;  1IJ6 A;  1IQ3 A;  3BQ2 A;  2KI6 C;  5HKY A;  4YP3 A;  1BF5 A;  3MR6 A;  4Z6E A;  3FE9 A;  4PDZ A;  4UAT A;  1TNX A;  2H3F A;  2E6W A;  3K4G A;  2D8C A;  2CRX A;  1BT6 A;  4M2O A;  3PW2 A;  5ALO A;  3AQE A;  2GV5 A;  1U49 A;  2L50 A;  4C0K A;  1T3N A;  4P0Q A;  3QUT A;  1Z00 B;  2JEJ A;  3SS5 A;  1B4C A;  3QU9 A;  3LDA A;  2H3Z A;  3DDH A;  3IV6 A;  1KK8 C;  1QSL A;  4J9P A;  2FPM A;  3KPX A;  5DB9 A;  4DS7 A;  2F2P A;  2JH7 A;  1CDP A;  1UHH A;  3QUQ A;  2F8K A;  3SIB A;  1KSP A;  4HYK A;  4YRU A;  1SIJ A;  1RZT A;  3Q8M A;  2I94 A;  5J8Y A;  2LMU A;  3O4X A;  4CLN A;  2LHL A;  2BKE A;  2L2C A;  2M9N A;  2DBY A;  4UBC A;  2M0R A;  5B5E U;  1S3P A;  1TUJ A;  2G09 A;  1QX2 A;  4ECY A;  1SCV A;  9ICL A;  2BCX A;  2MLF C;  1XFV O;  1J7Q A;  1NK4 A;  4DL2 A;  1ALW A;  1TTX A;  2CPR A;  3PN7 B;  1YT3 A;  1NP8 A;  4F71 A;  2ZXI A;  2ALZ A;  7ICF A;  2WAQ F;  4Q44 A;  4CF4 A;  3Q8Q B;  3B0X A;  1X2I A;  2KI6 D;  3NTU A;  2KKP A;  2VJ4 A;  3NHT A;  2ZIX A;  4PGY A;  2JXC A;  4GXJ A;  4K4H A;  2BAP A;  2LYA A;  4Y2P A;  5BPJ A;  1JBA A;  4QZD A;  1ZJM A;  5JUM A;  3MR3 A;  3Q8I A;  1H8B A;  1UA0 A;  4EZ9 A;  7ICK A;  4QIW F;  4KLS A;  1CLM A;  3QU5 A;  3G6X A;  7ICL A;  1FW4 A;  5AKG A;  3PW4 A;  4YXJ A;  5KT4 A;  4RPX A;  4I2D A;  4YGD B;  1UWO A;  1JWD A;  1M6Y A;  2K4E A;  2LCP A;  1LVH A;  4PE7 A;  4RQM A;  2Y1M A;  1SWW A;  2Z7J A;  3HX4 A;  2LM1 A;  3OPX A;  1WDC C;  1IIP A;  2PFQ A;  4MEY A;  3MGV A;  2BCS A;  2C22 A;  2KFG A;  1ZQI A;  1FI5 A;  4DWI A;  3BS5 A;  5HHH A;  3ZDA A;  3RRH A;  3QXG A;  2MRL A;  5J0W A;  4NLC A;  3BFH A;  5DDY A;  3OJU A;  4Y2V A;  2JEG A;  1XO0 A;  1NK6 A;  1KFD A;  4IR1 A;  4I2C A;  4YVZ A;  3RJK A;  2JWW A;  2HSZ A;  4Y2Q A;  5HML A;  3RJI A;  1JF0 A;  3BOW A;  3MDC A;  1FPW A;  5ALI A;  2ZND A;  1L7O A;  1YZ7 A;  4UB6 U;  4QWD A;  4NQG A;  1BGX T;  1SPY A;  3QEB Z;  4DF4 A;  4KLU A;  4QWC A;  4MLW A;  2GO7 A;  2KMD A;  1IXR A;  5FP0 A;  5KG0 A;  4ECW A;  3KBB A;  2W55 A;  3K1Z A;  7ICS A;  4PHA A;  1ZQH A;  4CGZ A;  2OCE A;  4I5J A;  3TZ1 A;  2JHD A;  3SZ2 A;  3B0Y A;  2H3V A;  3NRW A;  3NVW A;  5IIK A;  4C4S A;  1WLM A;  1RFJ A;  4R1E A;  1CDM A;  2KLD A;  2AQ4 A;  3FC4 A;  4DFP A;  1J7R A;  1NKB A;  1ZQU A;  8ICJ A;  8ICM A;  3LK9 A;  1K96 A;  4PE1 A;  1FEZ A;  5J0S A;  4HRH A;  1C7V A;  1X02 A;  5KAF U;  3JPT A;  1PAL A;  2ASL A;  5ALT A;  4ECT A;  5J2F A;  2KAX A;  2YN4 A;  3V7K A;  2JH1 A;  1SKS A;  3K75 D;  1KW4 A;  2HMX A;  3Q8R B;  2K2F A;  1RQN A;  3OTQ A;  4NM2 A;  1DK3 A;  2ISO A;  1OUQ A;  5J2I A;  2HPS A;  1K9U A;  1QXP A;  1O08 A;  5ALM A;  4ED2 A;  4F5R A;  2QB1 A;  3H8M A;  1B47 A;  2JTT A;  3OGN A;  4GUK A;  1IG6 A;  3H8S A;  4G9B A;  2M3W A;  1WUD A;  5DBA A;  4IQV A;  2NRV A;  3UM9 A;  2KBI A;  2LVJ A;  4KTQ A;  4DSI A;  3NAS A;  3JVT C;  4P2Y B;  4OJL A;  1MC8 A;  2AGP A;  2LI6 A;  4YBH B;  5ALV A;  5ALG A;  4KMO B;  5EE3 A;  1N56 A;  1ZD2 P;  2W11 A;  1EH2 A;  5J0Q A;  3THV A;  7ICH A;  2P71 A;  3EK7 A;  4WQ3 A;  3B6X A;  8ICL A;  3PLF B;  4IQU A;  3UXP A;  1Z2C B;  4QZB A;  1DGV A;  3I5I C;  5ALZ A;  3A0B U;  1Q3V A;  2GWS A;  4OKH A;  1QVI Z;  1OXJ A;  1ODB A;  5HL1 A;  2DGZ A;  3F5E A;  1DJY A;  4YGC B;  3TDZ A;  4MEW A;  4KLH A;  4PHJ A;  3PSF A;  3CR2 A;  3CS1 A;  4BWM A;  4MFA A;  2CBL A;  3AAK A;  1FO4 A;  3OJS A;  2EDU A;  1HIW A;  1REC A;  3BYA A;  1QCK A;  1SWV A;  2KGB C;  4NLZ A;  2D8N A;  5ALJ A;  4EEL A;  2IOF K;  4O0I A;  4KLO A;  1S5L U;  1NZB A;  2JT3 A;  3V2L A;  4DL6 A;  4DOA A;  2DKZ A;  2WC5 A;  4Z6F A;  2EZZ A;  2ZTC A;  4F2S A;  1YZ6 A;  2FE9 A;  3RRG A;  2EQY A;  5L1K A;  2RQ5 A;  3M9N B;  4RQ1 A;  1UUS A;  2I18 A;  3JPR A;  1PVB A;  3QU7 A;  2NLN A;  4OV2 A;  4DOC A;  1KFS A;  2GOL A;  1OOG A;  5L9X A;  9ICN A;  2J6T A;  1KQM C;  2I1Q A;  2ZNE A;  3I76 A;  1W9Z A;  4USA A;  4KX5 A;  1VLB A;  2JU0 A;  1WYG A;  2LBO A;  1O03 A;  3PW7 A;  4F4W A;  2KEY A;  4DQQ A;  5AM5 A;  4I2F A;  1QQ6 A;  3ONN A;  3MDA A;  2J6U A;  2BBM A;  4RT3 A;  4B9M A;  3NGV A;  4MRY A;  3B7A A;  4C8L A;  4PZN A;  3M9M B;  4B9S A;  2F1I A;  3H0R B;  2HDO A;  1NKC A;  3QZ7 A;  1QLS A;  4PL2 A;  1ORG A;  4A4C A;  4F4X A;  1YX7 A;  4DL4 A;  1NX3 A;  3AN1 A;  2WAQ C;  3HCM A;  1NX2 A;  1JUD A;  8ICZ A;  2XCA A;  1JMS A;  1K1Q A;  4O3Q A;  4RNO A;  2BCU A;  2O5G A;  1RYU A;  3WK4 A;  4F5P A;  4I29 A;  3AQF A;  3S0G A;  1KRP A;  4KLJ A;  3RJH A;  1PVR A;  1CFP A;  1LA3 A;  1K8U A;  4J9S A;  1QIV A;  2WCM A;  1ZET A;  4DQI A;  3SG6 A;  3NHI A;  2PAS A;  2ZFD A;  2EAP A;  2ZIW A;  3QUC A;  4HAI A;  1RXW A;  2PSR A;  1MWN A;  4M9L A;  5AKZ A;  1NKE A;  3TAR A;  1PUZ A;  2KPH A;  1CFC A;  2EZX A;  1X66 A;  1XSN A;  2KN7 A;  1CRX A;  3HRD D;  3C2M A;  4XYN A;  3HKZ F;  4KMU A;  2CCM A;  2JXL A;  8ICQ A;  5KFE A;  1ZQW A;  4R64 A;  1K9K A;  1DF0 B;  4YI8 A;  5KFW A;  1FIQ A;  2A3V A;  5HP4 A;  3PX6 A;  2I6X A;  1YVH A;  4F8R A;  1SR6 C;  2FLL A;  4GC6 A;  2EZY A;  3MFH A;  5HKW A;  1ZQJ A;  5J2K A;  4PGQ A;  3GDX A;  8ICC A;  4OD0 A;  4F91 B;  4TQR A;  3PSI A;  4P4M A;  2JQ6 A;  3ZNI A;  2V53 A;  5AK4 A;  4PHN A;  2F33 A;  1SL8 A;  4YCX A;  2NRZ A;  2ATL A;  1XO5 A;  4RQ8 A;  2XGQ A;  4LVS A;  1SR6 B;  2L51 A;  2LLU A;  7ICG A;  1KLN A;  1A6S A;  4IJ7 A;  3K1R B;  4PE0 A;  4QZH A;  3K21 A;  9ICP A;  2KK0 A;  2KIV A;  2F77 X;  2ASJ A;  1NCZ A;  3KD3 A;  2AUC A;  3CNH A;  1UT5 A;  3C28 A;  1U48 A;  2HHU A;  2I5H A;  4XJK B;  2K7C A;  1JRP A;  5AM3 A;  4P0Q B;  1SV0 C;  3PO4 A;  1U5I B;  4IRD A;  2F3Z A;  4GLX A;  1ZQM A;  1XO1 A;  2DKX A;  5AIA A;  3B86 A;  4F2R A;  1S36 A;  2GGM A;  1LA0 A;  4UAU A;  3BQ1 A;  2AMI A;  4CCH A;  1GGW A;  2QB0 B;  4KN4 A;  3ISB A;  1DK2 A;  2V4Q A;  5AFP A;  5DBC A;  1SSE B;  2OS8 C;  3L4A A;  5JJG A;  4NL9 A;  3SQI A;  4NY8 A;  1X9M A;  3CR4 X;  3FWB A;  1TK0 A;  1CMF A;  4ECU A;  3WHT B;  2FLN A;  1PSB A;  4MRX A;  5KG3 A;  5J29 A;  2HHQ A;  4P4P A;  1JAL A;  3SEI A;  3SAH A;  2MLE C;  1T4G A;  3OSN A;  4YR0 A;  3HWT A;  1KFX S;  3RBD A;  5FYX A;  1KDH A;  2JR5 A;  5J0X A;  2ZRT A;  3TFR A;  4AYB F;  4F50 A;  9ICB A;  3ICB A;  2WCL A;  3KO0 A;  1JX4 A;  1YVL A;  2H61 C;  1CDN A;  1SYM A;  3RJE A;  3A8R A;  2JRZ A;  4QWB A;  3F5A A;  2WB1 F;  4QZG A;  4DSL A;  2RGI A;  1NX1 A;  3R1P A;  2B21 A;  1AK8 A;  5DG8 A;  2KZZ A;  1Z1B A;  2ZJA A;  1P7D A;  1MQ1 A;  1D9D A;  5D69 A;  2OM6 A;  3AAJ A;  4NDC A;  2K89 A;  2KFN A;  1CFD A;  1QVI Y;  3JPP A;  4M2Q A;  1K2H A;  3RBE A;  5KFK A;  3OX5 A;  3ORY A;  5B8I B;  3GIM A;  1HUO A;  5EWG A;  2PAL A;  3ALR A;  1NJY A;  4R8U B;  3IF7 A;  3GV8 B;  3BJY A;  9ICM A;  1OOF A;  1NPQ A;  2LC5 A;  5KFX A;  2FI1 A;  4R65 A;  2OWO A;  4IL6 U;  3HKZ C;  5F9N A;  1Z4O A;  1L6N A;  2L5X B;  3KF9 A;  1ZQL A;  3Q8S B;  4EX6 A;  4M2Y A;  4PCW A;  4IC9 A;  2IA6 A;  4FO6 A;  4C8N A;  1GM0 A;  2BPG A;  2EAN A;  2KQ6 A;  2R2I A;  3J81 j;  3SAG A;  1K90 D;  4ELT A;  1BR1 B;  5J2D A;  1L7Z A;  4I2B A;  8ICS A;  4M6W B;  3D0Y B;  1BPX A;  5AK5 A;  4HSZ A;  2EAM A;  2JT8 A;  2LP2 A;  1DJH A;  3M0W A;  3BZK A;  4BUG A;  4JWN A;  5CSN A;  4F0Z B;  2WF7 A;  4FBT A;  2E8N A;  1XA5 A;  3AKA A;  4RQ2 A;  2JC2 A;  1GJY A;  1OE9 B;  2HBL A;  4DSE A;  4O3O A;  3Q8K A;  3CP8 A;  4QZF A;  3R72 A;  1ZD4 A;  3G6V A;  3EUB 2;  4KX3 A;  4EBD A;  2PMY A;  1UPH A;  5EWF A;  4UB3 A;  8ICK A;  4Q04 A;  2F3N A;  3PZP A;  5AKX A;  2KP7 A;  4UAW A;  3LYS A;  7ICN A;  1QX7 A;  4EEN A;  2YTU A;  4NM1 A;  3I28 A;  5D46 A;  4KN7 A;  5JRT A;  4KIT B;  3QUB A;  2VKQ A;  1MA7 A;  5CPV A;  4YGB B;  2BCR A;  1SV0 A;  4R63 A;  1Z4N A;  2L0P A;  1K9P A;  2M8U A;  4DO9 A;  1BPD A;  5I2Q A;  1Z4H A;  3N7H A;  4JV1 A;  1WLZ A;  1K5O A;  3AM9 A;  5ALH A;  1WRK A;  3BFA A;  4GXI A;  3ZD8 A;  5ALR A;  1M63 B;  2KLE A;  1DJG A;  3N7S C;  2JUL A;  5TNC A;  3IG5 A;  1C07 A;  4MZL A;  1QTM A;  5D7F A;  2K4P A;  3S6J A;  3NVV A;  2KI4 B;  2R8J A;  1N5X A;  3AU2 A;  2P66 A;  3PM8 A;  1NWD A;  2YQE A;  3GIJ A;  5J0O A;  1F4Q A;  1N48 A;  5F9L A;  4O3M A;  1MHO A;  3S0E A;  3S0D A;  1NJW A;  3DVE A;  4RZR A;  4F5O A;  2NRT A;  1QH9 A;  2KFZ A;  2B1U A;  2FOT A;  5KFJ A;  4I27 A;  1L3V A;  1NK9 A;  4IR9 A;  9ICO A;  1ARO P;  4QNL A;  2NV3 A;  1A03 A;  1CLB A;  1Y88 A;  5L1M A;  3BQ3 A;  4BDP A;  2SCP A;  5DBB A;  3IDW A;  2ZIU B;  2W3R A;  3TQ1 A;  5J0T A;  4M9H A;  1PK0 D;  2IS9 A;  1ZQR A;  5CSJ A;  4UB1 A;  5HKZ A;  1Q3U A;  2QLT A;  2ZIW B;  1B9A A;  1NSH A;  3GU3 A;  2Y0S F;  4DQS A;  2AJQ A;  2LKY A;  2C2R A;  5AI9 A;  5G5G A;  1T14 A;  1OQP A;  2IBK A;  3C29 A;  4UB2 A;  4Y2S A;  8ICG A;  1UHI A;  2KQY A;  2Y0S C;  3QEA Z;  2LM5 A;  4Q8F A;  2XC9 A;  1XFY O;  3LK1 A;  2XI9 A;  3RR8 A;  2AXT U;  4FS2 A;  1OOI X;  1TNP A;  3KOO A;  2KGR A;  1S5G Y;  1Z00 A;  2MAX A;  4C7Y A;  3CZ2 A;  2YGU A;  4F93 B;  2JMG A;  2E8O A;  4YQW A;  4U7C A;  7ICP A;  1A76 A;  2BCA A;  3KFU F;  2DPJ A;  1D9F A;  3NUQ A;  4ELV A;  2KG5 A;  2FPL A;  5DDM A;  2A1J A;  3D74 A;  3UXO A;  2JNF A;  2BQU A;  5AAN A;  4DIR A;  3D6J A;  5KFB A;  3I5H C;  1ZQP A;  2QEO A;  1ZQS A;  5BOL A;  3SYZ A;  8ICO A;  3LWM A;  4DSJ A;  3PMN A;  5K89 A;  1TAM A;  3D77 A;  2BR0 A;  2BDU A;  1BMO A;  4O5K A;  4ECX A;  1NJX A;  2ZTE A;  3OHB A;  3WK9 A;  1DRG A;  4NLK A;  3DVJ A;  5AI5 A;  1XNS A;  5DB6 A;  4ECQ A;  3KEV A;  3CRX A;  2JEI A;  2XVT A;  4F92 B;  3F2C A;  3DV9 A;  2IHN A;  1DJZ A;  1K93 D;  4KYN A;  1QQ7 A;  3SG3 A;  5ALN A;  1N63 A;  2ES6 A;  4A8E A;  1ZQT A;  2MU2 A;  1V85 A;  5HLV A;  1ZQC A;  1CFF A;  4PHD A;  5ALQ A;  2OYY A;  4PGX A;  3PW0 A;  1OOH A;  3RAQ A;  2JV3 A;  4C8K A;  7ICJ A;  2CXJ A;  1L7M A;  3ED5 A;  1S77 D;  4J9Q A;  1N2X A;  3WKA A;  1TCF A;  9ICJ A;  4QJF B;  5AM2 A;  1UHU A;  4ORB B;  4OJO A;  3IP4 B;  1B7T Y;  5KFR A;  2DOQ A;  4LZG A;  2LMR A;  1RWY A;  1JN3 A;  4OJ6 A;  2DPI A;  2H61 A;  4B9L A;  1LS8 A;  1SY9 A;  5J2E A;  3TDU A;  9ICK A;  1WWU A;  3H0L B;  3BUW B;  1S9F A;  3BS5 B;  4C0J A;  4KLD A;  3SG5 A;  3HJE A;  4PHP A;  2CTN A;  4IS7 A;  2NRX A;  1S97 A;  3PX4 A;  2ZIV B;  2RDJ A;  3R1O A;  4OCZ A;  3HW8 A;  1JXL A;  2BCB A;  3VB1 A;  1LB2 B;  1X9W A;  4TUQ A;  1H38 A;  9ICV A;  2HBM A;  4O3N A;  7ICI A;  1SKR A;  5K4L A;  1QWV A;  3VCB A;  4KLQ A;  2FPK A;  3C5F A;  3TAQ A;  3I5G B;  3EKJ A;  4ORA B;  3M8R A;  5J3X A;  3MR2 A;  5KT3 A;  2KE7 A;  1KBU A;  5KFQ A;  5J2G A;  1MR8 A;  3WK8 A;  1BOD A;  3LVW A;  4K4G A;  3T5L A;  1DF0 A;  4JUZ A;  1QX5 B;  5KU1 A;  2Q0Z X;  4UBB A;  1L5U A;  2LLS A;  3BOW B;  2O6K A;  4J9M A;  2FMS A;  4DSK A;  4B9T A;  2HHX A;  2MSN A;  3N7R C;  5AI6 A;  1G33 A;  4US8 A;  3QX7 A;  2LAP A;  3BJH A;  1BNP A;  1FFU A;  4US9 A;  2W3S A;  4Y2X A;  8ICV A;  4Q8E A;  1M31 A;  4PHM A;  1TVA A;  2BKH B;  2BE4 A;  1ZOL A;  1PSR A;  1H4B A;  3ISD A;  4DSF A;  1TAQ A;  2R8H A;  4U8D A;  2VRG A;  3I5F C;  3ETL A;  3D0Y A;  3M7D A;  2IMW P;  1VDV A;  1B8L A;  1MQ2 A;  1T94 A;  5AI8 A;  5JTI A;  2PMZ C;  4Z6D A;  1U9L A;  1SXD A;  4XRH A;  1IG5 A;  1NK5 A;  1TV9 A;  1W7I B;  4M9G A;  3CYM A;  2BCQ A;  2G5I B;  4IRC A;  3L5K A;  9ICR A;  2SAS A;  3R1V A;  1WG8 A;  2LYH A;  1M39 A;  1X42 A;  2K60 A;  2W8K A;  2DUY A;  5GTH U;  4Q45 A;  3LWL A;  3HIL A;  4BY4 A;  2L4I A;  1UCV A;  2Y1I A;  3V7L A;  1L2O C;  1TRF A;  2EC6 B;  2P70 A;  2B0C A;  5KFP A;  1L3U A;  4QW9 A;  3OB2 B;  4PHK A;  1TK8 A;  2JPO A;  1F71 A;  1TNQ A;  3D10 A;  3RLZ A;  2A19 A;  4RPZ A;  1NI3 A;  4F3O A;  1VRK A;  4FQT A;  3LVV A;  1UHK A;  5D49 A;  5HR7 A;  2COL B;  2MA2 A;  1AHR A;  2XIC A;  1L8L A;  2KZ3 A;  1KFU S;  3CGA A;  2Y1J A;  1ZFS A;  3RFA A;  2LMV A;  2LNK A;  1U45 A;  2G08 A;  3HX0 A;  1LKY A;  4RQ0 A;  1OMV A;  1PK3 A;  4BXO B;  1NYA A;  1CEZ A;  3I5H B;  3GQC A;  2WCE A;  4A4B A;  3NVY A;  1S6C A;  1B8R A;  2QEH A;  4C4R A;  2AHO B;  3QYP A;  1QS7 A;  4OO1 J;  1FBV A;  1Z1V A;  5ALK A;  4AQJ A;  2M49 B;  2ZRS A;  2RHF A;  4KLM A;  5DB7 A;  4YI9 A;  2QAR A;  4MFF A;  4R8U A;  2LMT A;  2YML A;  3BDP A;  4QZA A;  1EL4 A;  1N2D A;  1KQM B;  3C5G A;  1S5G Z;  2BKI B;  2OHF A;  4I28 A;  5J8Y C;  4JWM A;  2HVI A;  2OTG C;  2HBK A;  4C7Z A;  5J2H A;  4B9V A;  4FE3 A;  3Q8P B;  3KHR A;  3BUN B;  3I5F B;  4TUP A;  1LIN A;  3C1Z A;  4YMO A;  2YB1 A;  4PHE A;  4KLG A;  5KL1 B;  3UMC A;  3GFK B;  4NJ8 A;  2ZIV A;  2W9B B;  4FQO A;  1KN5 A;  1ZD5 A;  2HHV A;  2WF9 A;  4GGF A;  3IHQ B;  3JTD B;  4FZM A;  2QEV A;  1DGU A;  5AIC A;  3RB4 A;  4J9O A;  4NLB A;  4IQW A;  1BPY A;  4P4O A;  5AK3 A;  1TK5 A;  1XVJ A;  1XWL A;  1OZS A;  3O4Y A;  5DB8 A;  1BPZ A;  3EZ5 A;  1L7N A;  4KLE A;  1OOJ A;  4NXZ A;  1C3Z A;  1EXN A;  3FE6 A;  2XO7 A;  5J2C A;  2M97 A;  1KCY A;  4YD1 A;  2KSP A;  3DVM A;  2GLE A;  1ED1 A;  1LXF C;  3D73 A;  1GGZ A;  2WHE A;  2HF5 A;  3DYE A;  3TUY B;  1PK1 A;  4F4K A;  4NDD A;  3WKD A;  1V38 A;  5DKW A;  1DC1 A;  4ED8 A;  2D6F C;  1OMR A;  2BGW A;  2A1J B;  2MBX A;  2G9B A;  7ICU A;  3D75 A;  2GTE A;  4RU9 A;  2KNE A;  3FE8 A;  1B7T Z;  3L4P A;  1S0N A;  1WY9 A;  1OSA A;  3SI8 A;  4JQ0 D;  4NWI A;  1NIW A;  1J55 A;  1A75 B;  2H5X A;  3UMG A;  5KFC A;  1LVC D;  1XK4 C;  3PR5 B;  3EPG A;  1Y1X A;  4OCI A;  4QZC A;  5KFM A;  2KYF A;  4CFQ A;  2KDH A;  2E5S A;  5J2A A;  4DS5 A;  1G8I A;  2KTQ A;  1KK7 Y;  2K4H A;  3K1E A;  2NO4 A;  3PR4 A;  4M9J A;  5B66 U;  2RRD A;  4ED1 A;  4FBU A;  5L1J A;  4OZD A;  3OSP A;  5KFN A;  3PX0 A;  4ACO A;  1MN8 A;  3CTN A;  5G5H A;  3F2B A;  1QAT A;  4F4Z A;  3SV4 A;  2NO5 A;  4P0P B;  1P28 A;  3OHM B;  2R18 A;  4EEY A;  2F3Y A;  1F8H A;  1IV8 A;  5HYD A;  8ICB A;  4ECR A;  3WHU B;  3D2N A;  2W9B A;  4F5Q A;  4AP9 A;  2HCF A;  1PVQ A;  3UQ0 A;  4DFD A;  3C1V A;  2KYC A;  5J0P A;  2ZUD A;  4MZK A;  3TS5 B;  2JOJ A;  1N5W A;  1DVI A;  1DJW A;  4PT1 A;  2DF4 B;  1DTL A;  2YB4 A;  1G4Y R;  3TAC B;  5J2B A;  2HOF A;  3N28 A;  2FJ6 A;  5KFH A;  1YUU A;  1A2X A;  2DQN B;  2JNX A;  1C7W A;  4WQ2 A;  3AUO A;  2LPE A;  1QJT A;  4RUA A;  5KNI A;  2VA2 A;  3NSK A;  4M6W A; 
#chains in the Genus database with same CATH homology
 1SV0 A;  1B4F A;  3SEN A;  5JTI A;  1Z4H A;  1SXD A;  1DEK A;  3KKA A;  3OBV A;  2KSO A;  4JKT A;  2Y9U A;  4I5L B;  4RQM A;  1DXS A;  2KLE A;  3KEV A;  1SXE A;  2K60 A;  3UO9 A;  4MHV A;  2EAP A;  2GLE A;  2K4P A;  1DEL A;  4KYN A;  3HIL A;  1SV4 A;  4I5K A;  3BS5 A;  2ES6 A;  1UCV A;  1PK1 A;  5FI7 A;  5JU5 A;  3IVT A;  1X66 A;  2E8M A;  1V85 A;  4RQN A;  1Z2C B;  2E8P A;  1V38 A;  3UNW A;  1DC1 A;  4NL9 C;  2JV3 A;  1UQV A;  5HL1 A;  1OXJ A;  2D8C A;  1X40 A;  4MEW A;  5FI6 A;  5FI2 A;  3SS5 A;  2Y9T A;  3TAD C;  3BS7 A;  1SGG A;  2LMR A;  4I5N B;  5L1M A;  3KKA C;  2D3D A;  4PZO A;  3SS4 A;  1JI7 A;  1LKY A;  1WWU A;  3IDW A;  5F3X B;  2F8K A;  1PK3 A;  2KMD A;  2QAR B;  4GAO A;  3BS5 B;  1COK A;  2DKZ A;  2BNX A;  1F0M A;  4IS7 A;  2EAN A;  5J8Y A;  2DL0 A;  2FE9 A;  3O4X A;  1PK1 B;  4GBA A;  4IJ7 A;  2EAM A;  2ESE A;  3K1R B;  1LKY B;  4I5J A;  2F44 A;  1Z1V A;  2KIV A;  2E8N A;  1WWV A;  2KLD A;  1W9Z A;  2QAR A;  1OW5 A;  1SV0 C;  2L5Y A;  2KSO B;  2KE7 A;  3PM2 A;  2DKX A;  3TAD A;  5J8Y C;  5D3O A;  1KW4 A;  2QKQ A;  2YGU A;  5I94 A;  2E8O A;  2QB0 B;  2F3N A;  2BAP A;  4PZN A;  2EAO A;  3EG5 B;  1RG6 A;  3BQ7 A;  4NL9 A;  2KG5 A;  4NJ8 A;  1X9X A;  1B0X A;  2YTU A;  3TAC B;  3SS3 A;  2QB1 A;  3H8M A;  5JRT A;  2LPE A;  2QB0 A;  5KNI A;  3SEI A;  2B6G A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...