2RQ5A

Solution structure of the at-rich interaction domain (arid) of jumonji/jarid2
Total Genus 31
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
31
sequence length
121
structure length
121
Chain Sequence
GPLGSLGRRWGPNVQRLACIKKHLRSQGITMDELPLIGGCELDLACFFRLINEMGGMQQVTDLKKWNKLADMLRIPKTAQDRLAKLQEAYCQYLLSYDSLSPEEHRRLEKEVLMEKEILEK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Protein Jumonji
publication title Solution structure of the AT-rich interaction domain of Jumonji/JARID2
pubmed doi rcsb
source organism Mus musculus
molecule tags Transcription
total genus 31
structure length 121
sequence length 121
ec nomenclature
pdb deposition date 2009-02-06
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.60 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 ARID DNA-binding domain 2rq5A00
2JRZA 2KK0A 5K4LA 2YQEA 1KN5A 2LM1A 4LJXA 2JXJA 1C20A 2LI6A 1KKXA 1IG6A 2RQ5A 5CEHA 1KQQA 2CXYA 2OEHA 2EQYA 2EH9A 1RYUA
chains in the Genus database with same CATH superfamily
3J81j 3UPQA 4BJQA 1IV8A 5JUMA 5ALTA 4KLUA 4DSEA 4IS7A 4F4WA 5EWFA 2LPEA 1N61A 5DQGA 4ACOA 3BS7A 2BPGA 4F4KA 1ZQGA 4DS4A 3H0LB 4J03A 8ICGA 5J2GA 4I28A 3TQ1A 3QU2A 2ZUCA 2Z7JA 4JV0A 2Y9UA 3HP6A 1XO1A 3GIMA 2E1EA 3F5EA 4ED0A 5J0XA 3GILA 2QB0A 2R8GA 1QCKA 5L1JA 4GC7A 2WB1C 3PSPA 2KKVA 5J0YA 3MR5A 4DQSA 2P35A 3ZDEA 4P0PA 1N48A 5ALOA 2GH1A 4NL9A 4DOAA 4DF8A 4KLFA 1ZQCA 2W54A 5KFFA 3UMBA 3WK6A 2RLTA 2W9MA 3Q8MA 2F1HA 4RPZA 3IHQB 1NK8A 4I2HA 5KT7A 2IBKA 4QZBA 2KK0A 5AKGA 4YFKA 8ICFA 3WK9A 4ED3A 4J9PA 4GFJA 1Z3EB 5G5HA 2RP5A 2HDOA 2HBJA 4QWDA 2P6UA 4MEYA 4QIWF 3HKZF 2B6GA 1S10A 3KHHA 4M9JA 3JPQA 3KKAA 4NLGA 4DCCA 2V4RA 2KP7A 2A1JB 1HUOA 5KNIA 9ICAA 2MSNA 3RB3A 4Q8EA 2W43A 2BZFA 2PKEA 4DLEA 2JMGA 4U7CA 3N7RC 2M0NA 2I9GA 1Q8KA 1LV5A 2EAMA 1X9MA 3RAXA 2AJQA 2VA8A 2IOHA 8ICSA 3MFHA 2NYVA 1S0MA 4J9OA 4Z6CA 1S0VA 1X6JA 1LB2B 4O5KA 4ECUA 5AK5A 1UA0A 3PNCA 1U48A 3CW2C 5AKIA 5ALJA 4PHEA 4F4YA 2QB0B 2IMWP 1ZQSA 4YCXA 4P4OA 3M8SA 4IQVA 2K8BB 3C5FA 2XO7A 1ZQPA 3HX0A 4P0PB 9ICMA 3RB6A 4DL4A 3RB0A 2NO4A 3BJYA 4O3MA 2W8LA 3CRXA 3V7LA 1SKWA 4UARA 1QLNA 2BDUA 4Y2XA 3RBDA 4F2SA 1N60A 4KN7A 1SV0C 1SWWA 4B9MA 3AQFA 5KFCA 4QZDA 1F0MA 3MABA 4DL3A 4Q43A 2DBYA 8ICIA 1MSWD 1JUDA 4CF5A 2H3QA 2XCAA 1NKBA 4ECQA 3MGIA 1OXJA 2HHQA 1QSYA 3ZDBA 3L3FX 2KZMA 4NLZA 1V9PA 3QZ7A 3JPSA 3TFSA 4UAZA 2KJ8A 4EZ6A 2K89A 2D8CA 2AQ4A 8ICRA 5CR0A 1RG6A 3C29A 2IA6A 5KFAA 2LI6A 4JB3A 7ICQA 2CRXA 1SXDA 4KLIA 4FO6A 4RQ8A 2C28A 3C23A 3E2EA 1LVHA 5J0RA 9ICCA 2EAPA 3BDPA 2YMPA 4C80A 9ICUA 1A0PA 1DGJA 1ZYQA 3M6ZA 5AHXA 3PR4A 5DDYA 4M0AA 1X9XA 5KFQA 5KFIA 5C0YA 1DK2A 4FFDA 2KKPA 4G9BA 3THVA 3SAHA 2ZG6A 4TUSA 4FS1A 5GTHU 3NRWA 3SZ2A 3QU9A 2EH9A 4M9GA 5AM5A 1DGSA 3H7IA 2FLNA 5ALXA 3E0FA 2ODGA 3BQ0A 5KFJA 3RRGA 3RH6A 1SIJA 4P0QA 4CE6A 4KLHA 3V6HA 2VKQA 3LK9A 4BXOA 5EWGA 3PO4A 1X66A 4O3QA 4QZIA 4B9VA 2OHFA 3QXGA 5D49A 4OO1J 5IIOA 1ZQXA 1J97A 4YVZA 4CCHA 4QZEA 3WK5A 4I27A 1M6YA 4R65A 3UQ0A 2HHXA 2OXOA 4QIWC 3HKZC 3O0FA 5ALVA 3MC1A 4DFPA 4RQ1A 4ECYA 3G6YA 5KL1B 3V6KA 2V9WA 3N7SC 5DQIA 4YP3A 2W11A 5KFVA 3JPNA 2KD1A 5DG8A 5KTQA 2BQRA 1JXEA 3A0BU 2QB1A 4UB1A 2JEIA 5J2DA 1CEZA 2H3VA 4IRKA 3AUOA 4PHAA 2ZUBA 5A0LA 3AN1A 3ISBA 5AICA 1HIWA 1WWUA 1L3VA 5IIKA 4O3SA 5KFLA 1TK8A 3MDCA 3IRUA 4UATA 3RFAA 1EXNA 1UCVA 4YMNA 1YZ6A 3DV9A 2W3SA 3NUQA 3SV4A 4KLDA 5AI9A 5EE9A 1KW4A 4KTQA 3DEEA 1NK6A 4O0IA 9ICHA 3TFRA 1JXLA 5B5EU 4UAYA 1ZQ1C 2ZTEA 9ICFA 1K1QA 3QEBZ 3C1YA 3RR7A 4RQ3A 4DFKA 2QARA 1NK4A 5KAFU 3WKBA 2LYHA 2F1JA 2FI1A 4C8LA 4P0QB 5L1MA 1D8LA 1HUZA 2WF9A 1C7YA 4DS5A 3Q8QB 2JZBA 4BXOB 2ZTDA 2J6UA 2ATLA 3GQCA 4JV2A 8ICVA 3UM9A 4UQGA 3H4BA 3FM9A 1X2IA 1QSSA 3QUCA 2HVIA 1NK7A 1ZQMA 4TUQA 5FP0A 1KFDA 5DB8A 1ZQZA 3PW2A 8ICYA 3KHLA 5ALGA 1JMSA 2GWSA 5AM1A 2BDPA 2EQYA 4C0ZA 7ICLA 3LVVA 1T4GA 2YMQA 3ICXA 3QE9Y 3OJUA 2LYAA 3PSFA 4IQTA 4YD1A 9ICJA 2QLTA 3OTQA 3OSPA 3QX7A 4DL5A 3H8MA 4QZCA 2WHEA 2WFAA 3D6JA 4US9A 4ELUA 4PH5A 2E1FA 5L1IA 7ICOA 3TAQA 2KV2A 9ICQA 5DDMA 2G09A 1ZETA 4C4SA 4RT3A 1MC8A 5AM3A 4LVSA 2E8NA 1WUDA 2WF7A 2KNJA 3TADC 4F50A 4WJ3B 2WAQF 1JX4A 4ELVA 4RUCA 2RHFA 3L5KA 5KT6A 1TAMA 3EPGA 3ZDDA 4MFCA 1Z4OA 4DSFA 5J2BA 4LJXA 2P6RA 4KLLA 4I2JA 4KLEA 4DQPA 1DRGA 1KSPA 5DGAA 1S76D 1RXWA 2OM6A 1BPZA 3PR5B 3T3FA 2QARB 4KMOB 2KSOA 1QTMA 3RJJA 3ORYA 2F76X 4B9SA 5KFNA 3D2QA 2UVWA 3KBBA 1NJZA 1D9DA 2PMZF 5HHHA 2KICA 2JR5A 1F5SA 3PW4A 7ICVA 5B66U 2JZBB 3PW0A 2W3RA 1TVAA 1UT8A 9ICKA 3VCBA 1TK0A 1XWLA 4LZGA 1ED1A 4O5EA 2MUTA 4KLSA 2E8OA 2YY6A 1RQLA 8ICMA 2KEYA 7ICRA 3PSTA 1ZQNA 4YG2A 4O3RA 3PSIA 4KLOA 5DKWA 2DFLA 3MBYA 1BGXT 4EEKA 2LBOA 4NY8A 1N63A 4MF2A 3K75D 4NLNA 4KN4A 5CA7A 4GXJA 1U47A 1BPXA 3UMGA 3OHBA 2BCRA 4ECRA 3AU2A 2P66A 1BPBA 1SZHA 5DQHA 2YX8A 4KLGA 2BPFA 3SI8A 5L9XA 3IN5A 1COKA 1QQ7A 3LWMA 1NJYA 3CP8A 2DPIA 3I1YA 3KOOA 3VC8A 2IHNA 4J9SA 5EWEA 1RZTA 5KT2A 1XSLA 3C2MA 1ZQFA 3HWTA 1ZQLA 2HBMA 1H38A 5ALLA 5ALDA 5EE0A 7ICKA 4ZH4A 5J2HA 1S97A 1NJXA 3PVXA 4C8NA 5KFUA 5J0WA 2ZJ5A 2NRWA 2KSOB 4P4PA 4XRHA 1JALA 3PZPA 3PO5A 1MN8A 3ZD9A 4YR3A 2Y0SF 3K1RB 1WCLA 4IR9A 1ZQWA 3K4GA 4UAVA 4QW9A 2G0AA 5IIIA 1S0OA 4UBCA 4NXZA 4I2FA 2H5XA 4C7ZA 5AI5A 1NK0A 2H3FA 2MUTB 4F72A 1L3SA 5DBAA 7ICUA 4I2BA 1Z19A 4DO9A 5DBBA 4DWIA 1L8LA 1FFUA 4UBBA 2KN7A 2R8KA 4UAWA 4LZDA 1ZD5A 2RDJA 2FE9A 1V97A 5KG0A 1KFSA 1D8YA 3BQ7A 5KG4A 3Q8LA 3OJSA 2OYYA 4JUZA 4F5NA 5ALFA 1RYSA 2R8JA 4A8EA 2WTFA 2KHVA 2PFOA 3T5HA 5HNKA 1V85A 1TV9A 2B0CA 2Q0ZX 5JU5A 2ZIVA 4X5VA 4BDPA 3I28A 2WF6A 4DOBA 4NV0A 3V7JA 7ICIA 2KJ9A 2AH5A 1ZQIA 5F9NA 2XICA 2BCVA 2XY6A 4BWMA 1N5XA 3SEIA 5TZVA 5ALEA 3OHAA 1SL0A 4NLKA 1S5LU 5J2KA 4YQWA 2XCPA 5AIAA 2HOFA 5KFXA 5EE3A 1NKCA 2ZJ8A 1J2NA 1ZQBA 3HW8A 2KMDA 4HYKA 3SQIA 5HMLA 5DB6A 9ICXA 3WKEA 1KTQA 2GO7A 3G6VA 1PK1A 2HCFA 3GIJA 3B0YA 2G06A 1RPLA 1SXEA 3BQ2A 4CRXA 1S8OA 1SV0A 3NASA 1L3TA 3RJEA 2NV3A 1ZRNA 4Y2VA 5KG3A 2IOFK 2BQUA 9ICPA 2ASJA 2F44A 4YMOA 2ZIUA 9ICBA 2LKYA 2AHOB 4XQ8A 2KZZA 5IILA 1L7MA 4F4ZA 4GIBA 4F2RA 2IHMA 5DLFA 4NJ8A 4AYBF 3C5GA 3EW9A 4J9KA 5CRXA 2C22A 4FZLA 4Z6EA 3TI0A 4DSJA 5J8YC 2CPRA 2YMLA 4J9MA 5ALZA 3QEAZ 4RQ2A 5HMMA 2XGPA 2FMQA 8ICWA 4OJPA 1ZQRA 5BPCA 5HHIA 1XC9A 4RQ4A 2JV3A 2ZIVB 1Z4NA 3PX0A 2G07A 3WKDA 4FS2A 4C8MA 8ICLA 5KT3A 1KFTA 3V72A 1SV4A 5F9LA 3TANA 1PUZA 5L1LA 1NOMA 3K1ZA 3RH4A 1NK5A 5KFHA 4ECWA 2ASLA 2ES6A 1JN3A 4I2CA 1UPHA 2KIWA 1BVSA 4DQQA 1SKSA 4ED6A 5ALSA 1X9WA 2KFZA 4R66A 3C1ZA 5J0OA 3PY8A 1RDFA 5KFRA 1DXSA 1NZPA 3JPOA 3B0XA 4JWNA 5GTIU 2EDUA 2AGOA 3MR6A 1Q3UA 5G5GA 2I5HA 3IP4B 2AQ0A 5ALHA 1TAQA 4YD2A 1Q46A 3QU7A 2RQ5A 3NVVA 1KLNA 1PK1B 2R8IA 4MEXA 2ZJAA 5CP2A 2WF8A 2M9NA 4YN4A 2HHUA 1PZNA 1B22A 2MA1A 3FAHA 4FZNA 5D4BA 1L5UA 2DQNB 3RJKA 4PGYA 4Y2UA 9ICSA 3GU3A 2BCQA 5ALIA 2R18A 2LHTA 4AP9A 3PW5A 2ZIUB 1XNSA 5CHGA 4MFAA 3N7PD 2G08A 2DF4B 8ICAA 4DL6A 3C21A 3F2DA 1FIQA 3NVZA 1X42A 2Y1JA 8ICXA 2K4EA 4R64A 7ICTA 4U6PA 1D8BA 4RQ6A 4GC6A 5DB9A 5J2JA 5AM0A 3MR3A 4KX5A 1BPDA 3M9NB 2KZ3A 3RJHA 1HJPA 1VLBA 1ZQYA 2N1RA 1T8EA 1RYUA 3KZIU 4I2DA 3RF9A 2DPJA 2F2AB 3M6KA 2V4QA 8ICTA 3E58A 3RJIA 3IM1A 5AM2A 3GV8B 4F93B 3ALRA 7ICGA 2MU2A 1SL1A 2DKXA 2VIXA 2XIDA 1BPEA 3QUQA 5KG1A 1ZQQA 4R63A 4GXKA 1Z1BA 1ZQVA 2KFNA 5EOZA 4M9NA 1ZQHA 1N5WA 3PMNA 2CN1A 1PVQA 4YXJA 2ZXIA 5AK3A 4XUSA 3RH5A 2F3NA 3SAFA 5T14A 2L5YA 4IL6U 3NS1A 2PFPA 4IRDA 4PJ0U 3U26A 2R8HA 2W9CA 3HRDD 5DGBA 2KG5A 2KVSA 4Y2YA 4Y2TA 4JMUA 2RRDA 2Y9TA 4OJ6A 5J0QA 4K4GA 4FE3A 4QWEA 1JROA 3EYZA 2VJ5A 3N97B 1F44A 3Q8PB 1VDVA 2B21A 4DFDA 2FJ6A 3RB4A 2EAOA 3PMLA 1NK9A 2EZXA 2IOFA 4RQNA 1KDHA 4GLXA 4KX3A 1DOQA 2UVRA 3JPPA 4UB8U 1U45A 4F5OA 8ICJA 4ED8A 2PXIA 4AYBC 1NNLA 4EBCA 4KLMA 3KD3A 7ICJA 4M2YA 1CRXA 1ZQDA 1BNOA 5C5JA 3V7KA 4P2HA 1LKYA 7ICEA 3AMZA 4QWBA 2FMPA 5KFMA 3EWAA 4EX6A 5KFWA 1ZQTA 4DFJA 5AK6A 4B9LA 3H8JA 2O6KA 5D46A 1X40A 2I6XA 4O3NA 3BZKA 1KEJA 5J0PA 5J0TA 1YT3A 5H2FU 1TKDA 4DSIA 1QQ5A 3TADA 1N2XA 2HI0A 4RPXA 2Y1IA 2W7PA 4B6JA 5K4LA 3GDXA 5EE1A 3M1YA 4F5QA 2LM1A 2D3DA 2EANA 2HW3A 5HP4A 2LMRA 4F5RA 4UB6U 5DG7A 4EBDA 3R9KA 2E5SA 4C7YA 4P4MA 1YZ7A 2W7OA 1S0NA 2DWQA 4M47A 3AU6A 2W9CB 3D2SA 3NVWA 3NGDA 5J29A 3KTQA 1T94A 1OW5A 4K4IA 2NO5A 4RU9A 3Q8SB 1ZD3A 5DLGA 3N4MB 1X6IA 3QU4A 4US8A 4KMUA 1UA1A 4IC9A 4JK1A 3H0MB 3BZCA 4I2GA 5HR7A 9ICIA 4KLJA 2G5HB 1IXRA 4RUAA 2I1QA 2JHDA 2HHVA 1L6NA 3I76A 4C8OA 2VA3A 5AKYA 4F71A 3ISDA 5ALPA 4UB2A 4ECVA 3NVYA 4KITB 4OJOA 5J0SA 1Y88A 4ED2A 1D9FA 5ALKA 2F8KA 2HOIA 2ISOA 4R8UA 5KAIU 1JIHA 1Q3VA 5KFYA 4OJ5A 4Q44A 3C2LA 2YB4A 3WU2U 4RNMA 2ZTCA 3SAGA 5J2CA 3L4PA 8ICOA 4PZOA 1LKYB 1BNPA 1PVRA 1XS9D 2ZIWA 5KFGA 3T5KA 1ZQOA 4NM1A 1ZD4A 4C4RA 5E79U 3SD7A 4I2AA 7ICNA 5KT4A 3BQ1A 5TISU 4QZFA 3F2CA 3S6JA 1U4BA 2FMSA 4EX7A 3KZXA 2JGAA 4B9NA 4M9LA 3A0HU 3JPTA 4E0DA 3AEVA 1K1SA 4DF4A 1C20A 2NRVA 4Y2RA 1FFVA 1SB3C 2ALZA 2FPKA 4JV1A 4QZAA 4J9NA 2E3TA 4EYHB 3DDHA 3UXOA 1FO4A 3ZDAA 1TK5A 4CNQA 3H40A 4B9UA 3CNHA 3H0RB 1XU4A 2FPMA 4ECSA 3GZFA 2A3VA 2XY5A 1NZBA 8ICHA 4TURA 2HHWA 4NLBA 4O5CA 5IINA 2BR0A 1QSLA 4NL9C 3Q8RB 4Y2QA 3AL0B 1T7PA 3CYMA 3MFIA 5KT5A 1RYRA 3AM9A 2KVCA 3QNMA 3F2BA 2HMXA 1MQ2A 3IDWA 5ALRA 1U9LA 3M9MB 2PFNA 1ZQEA 2ZIXA 2OCEA 2E8MA 1ZQJA 5L1KA 1UQVA 3T5LA 4QWCA 5AK4A 4QZ9A 2AU0A 9ICNA 2G5IB 2KOBA 2Q4TA 4RNNA 8ICEA 5ALUA 1IIPA 4C4TA 4G3IA 2CXYA 2FPLA 4BX9C 4GXIA 4YXMA 1ZOLA 1VJ5A 3PX4A 3OGUA 5IIJA 5AI4A 1JI7A 2JRZA 3H4DA 5KFDA 3KKAC 1SGGA 2UVVA 3UMCA 4ED7A 9ICEA 1Z00A 4R8UB 4J9RA 3GV7B 2FLPA 5KG5A 1TFRA 2W04A 2KHQA 4BWJA 8ICUA 1A6SA 3QUTA 4PGXA 1RQNA 1CI4A 5AI6A 2DGZA 2UVUA 2ZIWB 1QQ6A 3FDSA 3LVWA 5KG6A 4F91B 2KTQA 4M6WA 1T3QA 1XSPA 4QZ8A 3SYZA 1L7OA 5JTIA 1GO3F 2F77X 2H3ZA 2OH2A 4UASA 4BGDA 2K4HA 3FC4A 3EZ5A 2YN4A 3H8WA 2HBLA 2PFQA 4J9LA 3PV8A 2WAQC 4MFFA 1NKEA 3QZ8A 3OPXA 4QJFB 2VANA 1FEZA 4RQ7A 4DFMA 3M8RA 2ESEA 1UHUA 2JEFA 7ICFA 5F3XB 4OD0A 2HHSA 1RXVA 4CF4A 5KL8B 1S77D 1AQ6A 5AI8A 3WK8A 1O03A 5KFPA 3T79A 1BPYA 3LDAA 2HBKA 2MRLA 5KFBA 4NM2A 3RTVA 4O9MA 2A19A 3TACB 2NRZA 4YR2A 3EPIA 2K4IA 4PHDA 2PMZC 3V6JA 1B43A 2ZIXB 3GV5B 5CEHA 1J2MA 4Y2PA 4NLCA 1O08A 5AKHA 3C2KA 3HPOA 4TQSA 3TAPA 4I29A 4DL7A 5J8YA 1ECWA 1PK3A 2BKEA 4PL2A 2W9BA 1WCNA 3QU5A 2XGQA 1P7DA 2J6SA 3WKCA 2KJ5A 9ICVA 3IG8A 3ZDCA 1ZD2P 4CF3A 4PZNA 4EBEA 1Z00B 2K8AA 1SKRA 3RBEA 2K8CB 2DL0A 3IG5A 2J6TA 3OSNA 9ICRA 2JH7A 3WK4A 3N28A 2JH1A 4FBTA 1RM6C 2XI9A 1DK3A 2MAXA 4M9HA 4M6WB 3RRHA 4DLGA 4EEYA 4Y2SA 1XO0A 2AXTU 1MA7A 4KLTA 2JEGA 5AKXA 4QZGA 3KHRA 1V38A 1WWVA 4ECXA 3FYHA 5KFZA 2BQ3A 4DEZA 5KFOA 3M9OB 4DQIA 4PHPA 4M04A 4I2EA 1KQQA 3ED5A 4TUPA 4OCZA 2NRXA 1Z1VA 5J2EA 1N62A 3KHGA 3HILA 2FLLA 2YTUA 4UB5A 5J2IA 4IRCA 2C2EA 2WF5A 3BS5A 4EYIB 2ASDA 4I2IA 4K4HA 7ICSA 4YR0A 4XA5A 4F4XA 4F92B 1S9FA 3WK7A 2Y0SC 2BHNA 2QKQA 3GIIA 1ZQAA 2W03A 2YMMA 3SV3A 3LYSA 1COOA 2KIVA 3TARA 2K60A 3MR2A 1KN5A 2YQEA 4B9TA 3RR8A 1TAUA 3SENA 1PVPA 1X9SA 3HJEA 1TE2A 1L7PA 5ALYA 2W9BB 1MQ3A 4F5PA 3BQTA 2DKZA 2H3IA 1L3UA 2ZUDA 3Q8KA 2PI5A 3MGHA 3LWLA 1WYGA 2E8PA 2VA2A 2W9AA 4JWMA 4PL1A 4EENA 4OJLA 1SZPA 2LYBA 2YB1A 2JEJA 1L7NA 4IQUA 2HSZA 1SL2A 4QW8A 2HOQA 1B4FA 3RJGA 3MGVA 5J0UA 8ICBA 2GOLA 4Z6DA 5HR6A 8ICCA 1ZQUA 4PPXA 3KFUF 3NRZA 4RZRA 4Z6FA 3PW7A 2GLEA 2BCSA 4FZMA 2VJ4A 2OWOA 2WB1F 3UXNA 3ETRA 4RPYA 2F1IA 3ISCA 1L8OA 2AGPA 4DL2A 4TQRA 4UB3A 3B9JA 4HAIA 9ICGA 2ISPA 4ECTA 2XY7A 5AKEA 1KBUA 3ONNA 5DG9A 5BOMA 8ICNA 4RQ5A 2EZYA 1N56A 1ZXIA 3IV6A 5KFEA 9ICLA 4C8KA 4FBUA 9ICOA 2W55A 1URJA 3MDAA 2K4PA 4RQ0A 1U49A 4EZ9A 1NJWA 5AIBA 5ALQA 1KRPA 4UAUA 4J9QA 4Q8FA 5DBCA 7ICHA 3BS5B 1AROP 3G6XA 2OEHA 3SMVA 2XC9A 4UW9A 8ICKA 3EUB2 4IQWA 5CWRA 2A1AA 1XSNA 2HHTA 1K5OA 4F3OA 4RT2A 5KG2A 5ALMA 4YMMA 4DSLA 1NI3A 3F5AA 5AM4A 4ECZA 2BGWA 5BOLA 2DUYA 4RNOA 5CJ7A 3UQ2A 4QWAA 5IIMA 9ICWA 2C2RA 4EELA 1ZJMA 3WKAA 5KFTA 4DOCA 4MHVA 2LM4A 1OUQA 1KKXA 4DQRA 1IM4A 4RQMA 3JPRA 4ELTA 4QNLA 5ALNA 2W8KA 3PX6A 2KE7A 3HT3A 1HEKA 5CB1A 4ED1A 3QUBA 3AQEA 4Y2JA 4QZHA 1ZQKA 4ICAA 3D2NA 3TKAA 8ICZA 8ICPA 3UXPA 5J2AA 2JXJA 8ICQA 9ICTA 2FDRA 4CDGA 1IG6A 2RDIA 7ICPA 1ZRMA 4MF8A 2BPCA 5AKKA 5AI0A 5JRTA 1KL9A 4O3OA 3M7DA 4KLQA 5AKJA 2NRTA 4UB4A 3ZI4A 3T5JA 1T3NA 2D6FC 2AGQA 3C28A 1A77A 3H8SA 5J2FA 4O3PA 4PGQA 2HVHA 1JRPA 1UT5A 2BCUA 2F8LA 3GFKB 2XVTA 3ETLA 3QYPA 3RJFA 4BUGA 4USAA 4IR1A 1B0XA 3ZD8A 3RAQA 5AKLA 1QH9A 5DB7A 1ZJNA 2C2DA 5AKZA 5KFSA 2PI4A 2EZZA 5ALWA 3GIKA 4NWIA 5KG7A 3SR6A 4DSKA 3NTUA 4F8RA 1WG8A 4ZOHC 7ICMA 1SWVA 3F53A 1CUKA 1A76A 2A1JA 4Q45A 5KFKA 4CGZA 2ZXHA
chains in the Genus database with same CATH topology
2JRZA 2KK0A 5K4LA 2YQEA 1KN5A 2LM1A 4LJXA 2JXJA 1C20A 2LI6A 1KKXA 1IG6A 2RQ5A 5CEHA 1KQQA 2CXYA 2OEHA 2EQYA 2EH9A 1RYUA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2JRZ A;  2KK0 A;  5K4L A;  2YQE A;  1KN5 A;  2LM1 A;  4LJX A;  2JXJ A;  1C20 A;  2LI6 A;  1KKX A;  1IG6 A;  2RQ5 A;  5CEH A;  1KQQ A;  2CXY A;  2OEH A;  2EQY A;  2EH9 A;  1RYU A; 
#chains in the Genus database with same CATH topology
 3J81 j;  3UPQ A;  4BJQ A;  1IV8 A;  5JUM A;  5ALT A;  4KLU A;  4DSE A;  4IS7 A;  4F4W A;  5EWF A;  2LPE A;  1N61 A;  5DQG A;  4ACO A;  3BS7 A;  2BPG A;  4F4K A;  1ZQG A;  4DS4 A;  3H0L B;  4J03 A;  8ICG A;  5J2G A;  4I28 A;  3TQ1 A;  3QU2 A;  2ZUC A;  2Z7J A;  4JV0 A;  2Y9U A;  3HP6 A;  1XO1 A;  3GIM A;  2E1E A;  3F5E A;  4ED0 A;  5J0X A;  3GIL A;  2QB0 A;  2R8G A;  1QCK A;  5L1J A;  4GC7 A;  2WB1 C;  3PSP A;  2KKV A;  5J0Y A;  3MR5 A;  4DQS A;  2P35 A;  3ZDE A;  4P0P A;  1N48 A;  5ALO A;  2GH1 A;  4NL9 A;  4DOA A;  4DF8 A;  4KLF A;  1ZQC A;  2W54 A;  5KFF A;  3UMB A;  3WK6 A;  2RLT A;  2W9M A;  3Q8M A;  2F1H A;  4RPZ A;  3IHQ B;  1NK8 A;  4I2H A;  5KT7 A;  2IBK A;  4QZB A;  2KK0 A;  5AKG A;  4YFK A;  8ICF A;  3WK9 A;  4ED3 A;  4J9P A;  4GFJ A;  1Z3E B;  5G5H A;  2RP5 A;  2HDO A;  2HBJ A;  4QWD A;  2P6U A;  4MEY A;  4QIW F;  3HKZ F;  2B6G A;  1S10 A;  3KHH A;  4M9J A;  3JPQ A;  3KKA A;  4NLG A;  4DCC A;  2V4R A;  2KP7 A;  2A1J B;  1HUO A;  5KNI A;  9ICA A;  2MSN A;  3RB3 A;  4Q8E A;  2W43 A;  2BZF A;  2PKE A;  4DLE A;  2JMG A;  4U7C A;  3N7R C;  2M0N A;  2I9G A;  1Q8K A;  1LV5 A;  2EAM A;  1X9M A;  3RAX A;  2AJQ A;  2VA8 A;  2IOH A;  8ICS A;  3MFH A;  2NYV A;  1S0M A;  4J9O A;  4Z6C A;  1S0V A;  1X6J A;  1LB2 B;  4O5K A;  4ECU A;  5AK5 A;  1UA0 A;  3PNC A;  1U48 A;  3CW2 C;  5AKI A;  5ALJ A;  4PHE A;  4F4Y A;  2QB0 B;  2IMW P;  1ZQS A;  4YCX A;  4P4O A;  3M8S A;  4IQV A;  2K8B B;  3C5F A;  2XO7 A;  1ZQP A;  3HX0 A;  4P0P B;  9ICM A;  3RB6 A;  4DL4 A;  3RB0 A;  2NO4 A;  3BJY A;  4O3M A;  2W8L A;  3CRX A;  3V7L A;  1SKW A;  4UAR A;  1QLN A;  2BDU A;  4Y2X A;  3RBD A;  4F2S A;  1N60 A;  4KN7 A;  1SV0 C;  1SWW A;  4B9M A;  3AQF A;  5KFC A;  4QZD A;  1F0M A;  3MAB A;  4DL3 A;  4Q43 A;  2DBY A;  8ICI A;  1MSW D;  1JUD A;  4CF5 A;  2H3Q A;  2XCA A;  1NKB A;  4ECQ A;  3MGI A;  1OXJ A;  2HHQ A;  1QSY A;  3ZDB A;  3L3F X;  2KZM A;  4NLZ A;  1V9P A;  3QZ7 A;  3JPS A;  3TFS A;  4UAZ A;  2KJ8 A;  4EZ6 A;  2K89 A;  2D8C A;  2AQ4 A;  8ICR A;  5CR0 A;  1RG6 A;  3C29 A;  2IA6 A;  5KFA A;  2LI6 A;  4JB3 A;  7ICQ A;  2CRX A;  1SXD A;  4KLI A;  4FO6 A;  4RQ8 A;  2C28 A;  3C23 A;  3E2E A;  1LVH A;  5J0R A;  9ICC A;  2EAP A;  3BDP A;  2YMP A;  4C80 A;  9ICU A;  1A0P A;  1DGJ A;  1ZYQ A;  3M6Z A;  5AHX A;  3PR4 A;  5DDY A;  4M0A A;  1X9X A;  5KFQ A;  5KFI A;  5C0Y A;  1DK2 A;  4FFD A;  2KKP A;  4G9B A;  3THV A;  3SAH A;  2ZG6 A;  4TUS A;  4FS1 A;  5GTH U;  3NRW A;  3SZ2 A;  3QU9 A;  2EH9 A;  4M9G A;  5AM5 A;  1DGS A;  3H7I A;  2FLN A;  5ALX A;  3E0F A;  2ODG A;  3BQ0 A;  5KFJ A;  3RRG A;  3RH6 A;  1SIJ A;  4P0Q A;  4CE6 A;  4KLH A;  3V6H A;  2VKQ A;  3LK9 A;  4BXO A;  5EWG A;  3PO4 A;  1X66 A;  4O3Q A;  4QZI A;  4B9V A;  2OHF A;  3QXG A;  5D49 A;  4OO1 J;  5IIO A;  1ZQX A;  1J97 A;  4YVZ A;  4CCH A;  4QZE A;  3WK5 A;  4I27 A;  1M6Y A;  4R65 A;  3UQ0 A;  2HHX A;  2OXO A;  4QIW C;  3HKZ C;  3O0F A;  5ALV A;  3MC1 A;  4DFP A;  4RQ1 A;  4ECY A;  3G6Y A;  5KL1 B;  3V6K A;  2V9W A;  3N7S C;  5DQI A;  4YP3 A;  2W11 A;  5KFV A;  3JPN A;  2KD1 A;  5DG8 A;  5KTQ A;  2BQR A;  1JXE A;  3A0B U;  2QB1 A;  4UB1 A;  2JEI A;  5J2D A;  1CEZ A;  2H3V A;  4IRK A;  3AUO A;  4PHA A;  2ZUB A;  5A0L A;  3AN1 A;  3ISB A;  5AIC A;  1HIW A;  1WWU A;  1L3V A;  5IIK A;  4O3S A;  5KFL A;  1TK8 A;  3MDC A;  3IRU A;  4UAT A;  3RFA A;  1EXN A;  1UCV A;  4YMN A;  1YZ6 A;  3DV9 A;  2W3S A;  3NUQ A;  3SV4 A;  4KLD A;  5AI9 A;  5EE9 A;  1KW4 A;  4KTQ A;  3DEE A;  1NK6 A;  4O0I A;  9ICH A;  3TFR A;  1JXL A;  5B5E U;  4UAY A;  1ZQ1 C;  2ZTE A;  9ICF A;  1K1Q A;  3QEB Z;  3C1Y A;  3RR7 A;  4RQ3 A;  4DFK A;  2QAR A;  1NK4 A;  5KAF U;  3WKB A;  2LYH A;  2F1J A;  2FI1 A;  4C8L A;  4P0Q B;  5L1M A;  1D8L A;  1HUZ A;  2WF9 A;  1C7Y A;  4DS5 A;  3Q8Q B;  2JZB A;  4BXO B;  2ZTD A;  2J6U A;  2ATL A;  3GQC A;  4JV2 A;  8ICV A;  3UM9 A;  4UQG A;  3H4B A;  3FM9 A;  1X2I A;  1QSS A;  3QUC A;  2HVI A;  1NK7 A;  1ZQM A;  4TUQ A;  5FP0 A;  1KFD A;  5DB8 A;  1ZQZ A;  3PW2 A;  8ICY A;  3KHL A;  5ALG A;  1JMS A;  2GWS A;  5AM1 A;  2BDP A;  2EQY A;  4C0Z A;  7ICL A;  3LVV A;  1T4G A;  2YMQ A;  3ICX A;  3QE9 Y;  3OJU A;  2LYA A;  3PSF A;  4IQT A;  4YD1 A;  9ICJ A;  2QLT A;  3OTQ A;  3OSP A;  3QX7 A;  4DL5 A;  3H8M A;  4QZC A;  2WHE A;  2WFA A;  3D6J A;  4US9 A;  4ELU A;  4PH5 A;  2E1F A;  5L1I A;  7ICO A;  3TAQ A;  2KV2 A;  9ICQ A;  5DDM A;  2G09 A;  1ZET A;  4C4S A;  4RT3 A;  1MC8 A;  5AM3 A;  4LVS A;  2E8N A;  1WUD A;  2WF7 A;  2KNJ A;  3TAD C;  4F50 A;  4WJ3 B;  2WAQ F;  1JX4 A;  4ELV A;  4RUC A;  2RHF A;  3L5K A;  5KT6 A;  1TAM A;  3EPG A;  3ZDD A;  4MFC A;  1Z4O A;  4DSF A;  5J2B A;  4LJX A;  2P6R A;  4KLL A;  4I2J A;  4KLE A;  4DQP A;  1DRG A;  1KSP A;  5DGA A;  1S76 D;  1RXW A;  2OM6 A;  1BPZ A;  3PR5 B;  3T3F A;  2QAR B;  4KMO B;  2KSO A;  1QTM A;  3RJJ A;  3ORY A;  2F76 X;  4B9S A;  5KFN A;  3D2Q A;  2UVW A;  3KBB A;  1NJZ A;  1D9D A;  2PMZ F;  5HHH A;  2KIC A;  2JR5 A;  1F5S A;  3PW4 A;  7ICV A;  5B66 U;  2JZB B;  3PW0 A;  2W3R A;  1TVA A;  1UT8 A;  9ICK A;  3VCB A;  1TK0 A;  1XWL A;  4LZG A;  1ED1 A;  4O5E A;  2MUT A;  4KLS A;  2E8O A;  2YY6 A;  1RQL A;  8ICM A;  2KEY A;  7ICR A;  3PST A;  1ZQN A;  4YG2 A;  4O3R A;  3PSI A;  4KLO A;  5DKW A;  2DFL A;  3MBY A;  1BGX T;  4EEK A;  2LBO A;  4NY8 A;  1N63 A;  4MF2 A;  3K75 D;  4NLN A;  4KN4 A;  5CA7 A;  4GXJ A;  1U47 A;  1BPX A;  3UMG A;  3OHB A;  2BCR A;  4ECR A;  3AU2 A;  2P66 A;  1BPB A;  1SZH A;  5DQH A;  2YX8 A;  4KLG A;  2BPF A;  3SI8 A;  5L9X A;  3IN5 A;  1COK A;  1QQ7 A;  3LWM A;  1NJY A;  3CP8 A;  2DPI A;  3I1Y A;  3KOO A;  3VC8 A;  2IHN A;  4J9S A;  5EWE A;  1RZT A;  5KT2 A;  1XSL A;  3C2M A;  1ZQF A;  3HWT A;  1ZQL A;  2HBM A;  1H38 A;  5ALL A;  5ALD A;  5EE0 A;  7ICK A;  4ZH4 A;  5J2H A;  1S97 A;  1NJX A;  3PVX A;  4C8N A;  5KFU A;  5J0W A;  2ZJ5 A;  2NRW A;  2KSO B;  4P4P A;  4XRH A;  1JAL A;  3PZP A;  3PO5 A;  1MN8 A;  3ZD9 A;  4YR3 A;  2Y0S F;  3K1R B;  1WCL A;  4IR9 A;  1ZQW A;  3K4G A;  4UAV A;  4QW9 A;  2G0A A;  5III A;  1S0O A;  4UBC A;  4NXZ A;  4I2F A;  2H5X A;  4C7Z A;  5AI5 A;  1NK0 A;  2H3F A;  2MUT B;  4F72 A;  1L3S A;  5DBA A;  7ICU A;  4I2B A;  1Z19 A;  4DO9 A;  5DBB A;  4DWI A;  1L8L A;  1FFU A;  4UBB A;  2KN7 A;  2R8K A;  4UAW A;  4LZD A;  1ZD5 A;  2RDJ A;  2FE9 A;  1V97 A;  5KG0 A;  1KFS A;  1D8Y A;  3BQ7 A;  5KG4 A;  3Q8L A;  3OJS A;  2OYY A;  4JUZ A;  4F5N A;  5ALF A;  1RYS A;  2R8J A;  4A8E A;  2WTF A;  2KHV A;  2PFO A;  3T5H A;  5HNK A;  1V85 A;  1TV9 A;  2B0C A;  2Q0Z X;  5JU5 A;  2ZIV A;  4X5V A;  4BDP A;  3I28 A;  2WF6 A;  4DOB A;  4NV0 A;  3V7J A;  7ICI A;  2KJ9 A;  2AH5 A;  1ZQI A;  5F9N A;  2XIC A;  2BCV A;  2XY6 A;  4BWM A;  1N5X A;  3SEI A;  5TZV A;  5ALE A;  3OHA A;  1SL0 A;  4NLK A;  1S5L U;  5J2K A;  4YQW A;  2XCP A;  5AIA A;  2HOF A;  5KFX A;  5EE3 A;  1NKC A;  2ZJ8 A;  1J2N A;  1ZQB A;  3HW8 A;  2KMD A;  4HYK A;  3SQI A;  5HML A;  5DB6 A;  9ICX A;  3WKE A;  1KTQ A;  2GO7 A;  3G6V A;  1PK1 A;  2HCF A;  3GIJ A;  3B0Y A;  2G06 A;  1RPL A;  1SXE A;  3BQ2 A;  4CRX A;  1S8O A;  1SV0 A;  3NAS A;  1L3T A;  3RJE A;  2NV3 A;  1ZRN A;  4Y2V A;  5KG3 A;  2IOF K;  2BQU A;  9ICP A;  2ASJ A;  2F44 A;  4YMO A;  2ZIU A;  9ICB A;  2LKY A;  2AHO B;  4XQ8 A;  2KZZ A;  5IIL A;  1L7M A;  4F4Z A;  4GIB A;  4F2R A;  2IHM A;  5DLF A;  4NJ8 A;  4AYB F;  3C5G A;  3EW9 A;  4J9K A;  5CRX A;  2C22 A;  4FZL A;  4Z6E A;  3TI0 A;  4DSJ A;  5J8Y C;  2CPR A;  2YML A;  4J9M A;  5ALZ A;  3QEA Z;  4RQ2 A;  5HMM A;  2XGP A;  2FMQ A;  8ICW A;  4OJP A;  1ZQR A;  5BPC A;  5HHI A;  1XC9 A;  4RQ4 A;  2JV3 A;  2ZIV B;  1Z4N A;  3PX0 A;  2G07 A;  3WKD A;  4FS2 A;  4C8M A;  8ICL A;  5KT3 A;  1KFT A;  3V72 A;  1SV4 A;  5F9L A;  3TAN A;  1PUZ A;  5L1L A;  1NOM A;  3K1Z A;  3RH4 A;  1NK5 A;  5KFH A;  4ECW A;  2ASL A;  2ES6 A;  1JN3 A;  4I2C A;  1UPH A;  2KIW A;  1BVS A;  4DQQ A;  1SKS A;  4ED6 A;  5ALS A;  1X9W A;  2KFZ A;  4R66 A;  3C1Z A;  5J0O A;  3PY8 A;  1RDF A;  5KFR A;  1DXS A;  1NZP A;  3JPO A;  3B0X A;  4JWN A;  5GTI U;  2EDU A;  2AGO A;  3MR6 A;  1Q3U A;  5G5G A;  2I5H A;  3IP4 B;  2AQ0 A;  5ALH A;  1TAQ A;  4YD2 A;  1Q46 A;  3QU7 A;  2RQ5 A;  3NVV A;  1KLN A;  1PK1 B;  2R8I A;  4MEX A;  2ZJA A;  5CP2 A;  2WF8 A;  2M9N A;  4YN4 A;  2HHU A;  1PZN A;  1B22 A;  2MA1 A;  3FAH A;  4FZN A;  5D4B A;  1L5U A;  2DQN B;  3RJK A;  4PGY A;  4Y2U A;  9ICS A;  3GU3 A;  2BCQ A;  5ALI A;  2R18 A;  2LHT A;  4AP9 A;  3PW5 A;  2ZIU B;  1XNS A;  5CHG A;  4MFA A;  3N7P D;  2G08 A;  2DF4 B;  8ICA A;  4DL6 A;  3C21 A;  3F2D A;  1FIQ A;  3NVZ A;  1X42 A;  2Y1J A;  8ICX A;  2K4E A;  4R64 A;  7ICT A;  4U6P A;  1D8B A;  4RQ6 A;  4GC6 A;  5DB9 A;  5J2J A;  5AM0 A;  3MR3 A;  4KX5 A;  1BPD A;  3M9N B;  2KZ3 A;  3RJH A;  1HJP A;  1VLB A;  1ZQY A;  2N1R A;  1T8E A;  1RYU A;  3KZI U;  4I2D A;  3RF9 A;  2DPJ A;  2F2A B;  3M6K A;  2V4Q A;  8ICT A;  3E58 A;  3RJI A;  3IM1 A;  5AM2 A;  3GV8 B;  4F93 B;  3ALR A;  7ICG A;  2MU2 A;  1SL1 A;  2DKX A;  2VIX A;  2XID A;  1BPE A;  3QUQ A;  5KG1 A;  1ZQQ A;  4R63 A;  4GXK A;  1Z1B A;  1ZQV A;  2KFN A;  5EOZ A;  4M9N A;  1ZQH A;  1N5W A;  3PMN A;  2CN1 A;  1PVQ A;  4YXJ A;  2ZXI A;  5AK3 A;  4XUS A;  3RH5 A;  2F3N A;  3SAF A;  5T14 A;  2L5Y A;  4IL6 U;  3NS1 A;  2PFP A;  4IRD A;  4PJ0 U;  3U26 A;  2R8H A;  2W9C A;  3HRD D;  5DGB A;  2KG5 A;  2KVS A;  4Y2Y A;  4Y2T A;  4JMU A;  2RRD A;  2Y9T A;  4OJ6 A;  5J0Q A;  4K4G A;  4FE3 A;  4QWE A;  1JRO A;  3EYZ A;  2VJ5 A;  3N97 B;  1F44 A;  3Q8P B;  1VDV A;  2B21 A;  4DFD A;  2FJ6 A;  3RB4 A;  2EAO A;  3PML A;  1NK9 A;  2EZX A;  2IOF A;  4RQN A;  1KDH A;  4GLX A;  4KX3 A;  1DOQ A;  2UVR A;  3JPP A;  4UB8 U;  1U45 A;  4F5O A;  8ICJ A;  4ED8 A;  2PXI A;  4AYB C;  1NNL A;  4EBC A;  4KLM A;  3KD3 A;  7ICJ A;  4M2Y A;  1CRX A;  1ZQD A;  1BNO A;  5C5J A;  3V7K A;  4P2H A;  1LKY A;  7ICE A;  3AMZ A;  4QWB A;  2FMP A;  5KFM A;  3EWA A;  4EX6 A;  5KFW A;  1ZQT A;  4DFJ A;  5AK6 A;  4B9L A;  3H8J A;  2O6K A;  5D46 A;  1X40 A;  2I6X A;  4O3N A;  3BZK A;  1KEJ A;  5J0P A;  5J0T A;  1YT3 A;  5H2F U;  1TKD A;  4DSI A;  1QQ5 A;  3TAD A;  1N2X A;  2HI0 A;  4RPX A;  2Y1I A;  2W7P A;  4B6J A;  5K4L A;  3GDX A;  5EE1 A;  3M1Y A;  4F5Q A;  2LM1 A;  2D3D A;  2EAN A;  2HW3 A;  5HP4 A;  2LMR A;  4F5R A;  4UB6 U;  5DG7 A;  4EBD A;  3R9K A;  2E5S A;  4C7Y A;  4P4M A;  1YZ7 A;  2W7O A;  1S0N A;  2DWQ A;  4M47 A;  3AU6 A;  2W9C B;  3D2S A;  3NVW A;  3NGD A;  5J29 A;  3KTQ A;  1T94 A;  1OW5 A;  4K4I A;  2NO5 A;  4RU9 A;  3Q8S B;  1ZD3 A;  5DLG A;  3N4M B;  1X6I A;  3QU4 A;  4US8 A;  4KMU A;  1UA1 A;  4IC9 A;  4JK1 A;  3H0M B;  3BZC A;  4I2G A;  5HR7 A;  9ICI A;  4KLJ A;  2G5H B;  1IXR A;  4RUA A;  2I1Q A;  2JHD A;  2HHV A;  1L6N A;  3I76 A;  4C8O A;  2VA3 A;  5AKY A;  4F71 A;  3ISD A;  5ALP A;  4UB2 A;  4ECV A;  3NVY A;  4KIT B;  4OJO A;  5J0S A;  1Y88 A;  4ED2 A;  1D9F A;  5ALK A;  2F8K A;  2HOI A;  2ISO A;  4R8U A;  5KAI U;  1JIH A;  1Q3V A;  5KFY A;  4OJ5 A;  4Q44 A;  3C2L A;  2YB4 A;  3WU2 U;  4RNM A;  2ZTC A;  3SAG A;  5J2C A;  3L4P A;  8ICO A;  4PZO A;  1LKY B;  1BNP A;  1PVR A;  1XS9 D;  2ZIW A;  5KFG A;  3T5K A;  1ZQO A;  4NM1 A;  1ZD4 A;  4C4R A;  5E79 U;  3SD7 A;  4I2A A;  7ICN A;  5KT4 A;  3BQ1 A;  5TIS U;  4QZF A;  3F2C A;  3S6J A;  1U4B A;  2FMS A;  4EX7 A;  3KZX A;  2JGA A;  4B9N A;  4M9L A;  3A0H U;  3JPT A;  4E0D A;  3AEV A;  1K1S A;  4DF4 A;  1C20 A;  2NRV A;  4Y2R A;  1FFV A;  1SB3 C;  2ALZ A;  2FPK A;  4JV1 A;  4QZA A;  4J9N A;  2E3T A;  4EYH B;  3DDH A;  3UXO A;  1FO4 A;  3ZDA A;  1TK5 A;  4CNQ A;  3H40 A;  4B9U A;  3CNH A;  3H0R B;  1XU4 A;  2FPM A;  4ECS A;  3GZF A;  2A3V A;  2XY5 A;  1NZB A;  8ICH A;  4TUR A;  2HHW A;  4NLB A;  4O5C A;  5IIN A;  2BR0 A;  1QSL A;  4NL9 C;  3Q8R B;  4Y2Q A;  3AL0 B;  1T7P A;  3CYM A;  3MFI A;  5KT5 A;  1RYR A;  3AM9 A;  2KVC A;  3QNM A;  3F2B A;  2HMX A;  1MQ2 A;  3IDW A;  5ALR A;  1U9L A;  3M9M B;  2PFN A;  1ZQE A;  2ZIX A;  2OCE A;  2E8M A;  1ZQJ A;  5L1K A;  1UQV A;  3T5L A;  4QWC A;  5AK4 A;  4QZ9 A;  2AU0 A;  9ICN A;  2G5I B;  2KOB A;  2Q4T A;  4RNN A;  8ICE A;  5ALU A;  1IIP A;  4C4T A;  4G3I A;  2CXY A;  2FPL A;  4BX9 C;  4GXI A;  4YXM A;  1ZOL A;  1VJ5 A;  3PX4 A;  3OGU A;  5IIJ A;  5AI4 A;  1JI7 A;  2JRZ A;  3H4D A;  5KFD A;  3KKA C;  1SGG A;  2UVV A;  3UMC A;  4ED7 A;  9ICE A;  1Z00 A;  4R8U B;  4J9R A;  3GV7 B;  2FLP A;  5KG5 A;  1TFR A;  2W04 A;  2KHQ A;  4BWJ A;  8ICU A;  1A6S A;  3QUT A;  4PGX A;  1RQN A;  1CI4 A;  5AI6 A;  2DGZ A;  2UVU A;  2ZIW B;  1QQ6 A;  3FDS A;  3LVW A;  5KG6 A;  4F91 B;  2KTQ A;  4M6W A;  1T3Q A;  1XSP A;  4QZ8 A;  3SYZ A;  1L7O A;  5JTI A;  1GO3 F;  2F77 X;  2H3Z A;  2OH2 A;  4UAS A;  4BGD A;  2K4H A;  3FC4 A;  3EZ5 A;  2YN4 A;  3H8W A;  2HBL A;  2PFQ A;  4J9L A;  3PV8 A;  2WAQ C;  4MFF A;  1NKE A;  3QZ8 A;  3OPX A;  4QJF B;  2VAN A;  1FEZ A;  4RQ7 A;  4DFM A;  3M8R A;  2ESE A;  1UHU A;  2JEF A;  7ICF A;  5F3X B;  4OD0 A;  2HHS A;  1RXV A;  4CF4 A;  5KL8 B;  1S77 D;  1AQ6 A;  5AI8 A;  3WK8 A;  1O03 A;  5KFP A;  3T79 A;  1BPY A;  3LDA A;  2HBK A;  2MRL A;  5KFB A;  4NM2 A;  3RTV A;  4O9M A;  2A19 A;  3TAC B;  2NRZ A;  4YR2 A;  3EPI A;  2K4I A;  4PHD A;  2PMZ C;  3V6J A;  1B43 A;  2ZIX B;  3GV5 B;  5CEH A;  1J2M A;  4Y2P A;  4NLC A;  1O08 A;  5AKH A;  3C2K A;  3HPO A;  4TQS A;  3TAP A;  4I29 A;  4DL7 A;  5J8Y A;  1ECW A;  1PK3 A;  2BKE A;  4PL2 A;  2W9B A;  1WCN A;  3QU5 A;  2XGQ A;  1P7D A;  2J6S A;  3WKC A;  2KJ5 A;  9ICV A;  3IG8 A;  3ZDC A;  1ZD2 P;  4CF3 A;  4PZN A;  4EBE A;  1Z00 B;  2K8A A;  1SKR A;  3RBE A;  2K8C B;  2DL0 A;  3IG5 A;  2J6T A;  3OSN A;  9ICR A;  2JH7 A;  3WK4 A;  3N28 A;  2JH1 A;  4FBT A;  1RM6 C;  2XI9 A;  1DK3 A;  2MAX A;  4M9H A;  4M6W B;  3RRH A;  4DLG A;  4EEY A;  4Y2S A;  1XO0 A;  2AXT U;  1MA7 A;  4KLT A;  2JEG A;  5AKX A;  4QZG A;  3KHR A;  1V38 A;  1WWV A;  4ECX A;  3FYH A;  5KFZ A;  2BQ3 A;  4DEZ A;  5KFO A;  3M9O B;  4DQI A;  4PHP A;  4M04 A;  4I2E A;  1KQQ A;  3ED5 A;  4TUP A;  4OCZ A;  2NRX A;  1Z1V A;  5J2E A;  1N62 A;  3KHG A;  3HIL A;  2FLL A;  2YTU A;  4UB5 A;  5J2I A;  4IRC A;  2C2E A;  2WF5 A;  3BS5 A;  4EYI B;  2ASD A;  4I2I A;  4K4H A;  7ICS A;  4YR0 A;  4XA5 A;  4F4X A;  4F92 B;  1S9F A;  3WK7 A;  2Y0S C;  2BHN A;  2QKQ A;  3GII A;  1ZQA A;  2W03 A;  2YMM A;  3SV3 A;  3LYS A;  1COO A;  2KIV A;  3TAR A;  2K60 A;  3MR2 A;  1KN5 A;  2YQE A;  4B9T A;  3RR8 A;  1TAU A;  3SEN A;  1PVP A;  1X9S A;  3HJE A;  1TE2 A;  1L7P A;  5ALY A;  2W9B B;  1MQ3 A;  4F5P A;  3BQT A;  2DKZ A;  2H3I A;  1L3U A;  2ZUD A;  3Q8K A;  2PI5 A;  3MGH A;  3LWL A;  1WYG A;  2E8P A;  2VA2 A;  2W9A A;  4JWM A;  4PL1 A;  4EEN A;  4OJL A;  1SZP A;  2LYB A;  2YB1 A;  2JEJ A;  1L7N A;  4IQU A;  2HSZ A;  1SL2 A;  4QW8 A;  2HOQ A;  1B4F A;  3RJG A;  3MGV A;  5J0U A;  8ICB A;  2GOL A;  4Z6D A;  5HR6 A;  8ICC A;  1ZQU A;  4PPX A;  3KFU F;  3NRZ A;  4RZR A;  4Z6F A;  3PW7 A;  2GLE A;  2BCS A;  4FZM A;  2VJ4 A;  2OWO A;  2WB1 F;  3UXN A;  3ETR A;  4RPY A;  2F1I A;  3ISC A;  1L8O A;  2AGP A;  4DL2 A;  4TQR A;  4UB3 A;  3B9J A;  4HAI A;  9ICG A;  2ISP A;  4ECT A;  2XY7 A;  5AKE A;  1KBU A;  3ONN A;  5DG9 A;  5BOM A;  8ICN A;  4RQ5 A;  2EZY A;  1N56 A;  1ZXI A;  3IV6 A;  5KFE A;  9ICL A;  4C8K A;  4FBU A;  9ICO A;  2W55 A;  1URJ A;  3MDA A;  2K4P A;  4RQ0 A;  1U49 A;  4EZ9 A;  1NJW A;  5AIB A;  5ALQ A;  1KRP A;  4UAU A;  4J9Q A;  4Q8F A;  5DBC A;  7ICH A;  3BS5 B;  1ARO P;  3G6X A;  2OEH A;  3SMV A;  2XC9 A;  4UW9 A;  8ICK A;  3EUB 2;  4IQW A;  5CWR A;  2A1A A;  1XSN A;  2HHT A;  1K5O A;  4F3O A;  4RT2 A;  5KG2 A;  5ALM A;  4YMM A;  4DSL A;  1NI3 A;  3F5A A;  5AM4 A;  4ECZ A;  2BGW A;  5BOL A;  2DUY A;  4RNO A;  5CJ7 A;  3UQ2 A;  4QWA A;  5IIM A;  9ICW A;  2C2R A;  4EEL A;  1ZJM A;  3WKA A;  5KFT A;  4DOC A;  4MHV A;  2LM4 A;  1OUQ A;  1KKX A;  4DQR A;  1IM4 A;  4RQM A;  3JPR A;  4ELT A;  4QNL A;  5ALN A;  2W8K A;  3PX6 A;  2KE7 A;  3HT3 A;  1HEK A;  5CB1 A;  4ED1 A;  3QUB A;  3AQE A;  4Y2J A;  4QZH A;  1ZQK A;  4ICA A;  3D2N A;  3TKA A;  8ICZ A;  8ICP A;  3UXP A;  5J2A A;  2JXJ A;  8ICQ A;  9ICT A;  2FDR A;  4CDG A;  1IG6 A;  2RDI A;  7ICP A;  1ZRM A;  4MF8 A;  2BPC A;  5AKK A;  5AI0 A;  5JRT A;  1KL9 A;  4O3O A;  3M7D A;  4KLQ A;  5AKJ A;  2NRT A;  4UB4 A;  3ZI4 A;  3T5J A;  1T3N A;  2D6F C;  2AGQ A;  3C28 A;  1A77 A;  3H8S A;  5J2F A;  4O3P A;  4PGQ A;  2HVH A;  1JRP A;  1UT5 A;  2BCU A;  2F8L A;  3GFK B;  2XVT A;  3ETL A;  3QYP A;  3RJF A;  4BUG A;  4USA A;  4IR1 A;  1B0X A;  3ZD8 A;  3RAQ A;  5AKL A;  1QH9 A;  5DB7 A;  1ZJN A;  2C2D A;  5AKZ A;  5KFS A;  2PI4 A;  2EZZ A;  5ALW A;  3GIK A;  4NWI A;  5KG7 A;  3SR6 A;  4DSK A;  3NTU A;  4F8R A;  1WG8 A;  4ZOH C;  7ICM A;  1SWV A;  3F53 A;  1CUK A;  1A76 A;  2A1J A;  4Q45 A;  5KFK A;  4CGZ A;  2ZXH A; 
#chains in the Genus database with same CATH homology
 2JRZ A;  2KK0 A;  5K4L A;  2YQE A;  1KN5 A;  2LM1 A;  4LJX A;  2JXJ A;  1C20 A;  2LI6 A;  1KKX A;  1IG6 A;  2RQ5 A;  5CEH A;  1KQQ A;  2CXY A;  2OEH A;  2EQY A;  2EH9 A;  1RYU A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...