2RQ5A

Solution structure of the at-rich interaction domain (arid) of jumonji/jarid2
Total Genus 31
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
31
sequence length
121
structure length
121
Chain Sequence
GPLGSLGRRWGPNVQRLACIKKHLRSQGITMDELPLIGGCELDLACFFRLINEMGGMQQVTDLKKWNKLADMLRIPKTAQDRLAKLQEAYCQYLLSYDSLSPEEHRRLEKEVLMEKEILEK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Transcription
molecule keywords Protein Jumonji
publication title Solution structure of the AT-rich interaction domain of Jumonji/JARID2
pubmed doi rcsb
source organism Mus musculus
total genus 31
structure length 121
sequence length 121
ec nomenclature
pdb deposition date 2009-02-06
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.60 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 ARID DNA-binding domain 2rq5A00
1RYUA 2LI6A 2JXJA 2EH9A 5K4LA 1KN5A 1KKXA 2JRZA 2CXYA 4LJXA 2OEHA 2KK0A 1KQQA 1IG6A 2LM1A 5CEHA 2EQYA 2RQ5A 1C20A 2YQEA
chains in the Genus database with same CATH superfamily
2WFAA 1BPEA 4O3RA 2ZIWB 4DSKA 4QZBA 1SKWA 1TK0A 2HHXA 5KFNA 2HHSA 2EAOA 3HRDD 4I2IA 1N56A 3C21A 4K4IA 1K1QA 3HW8A 4I29A 1K5OA 5CHGA 1T3NA 2ASDA 2KJ5A 2W03A 4DQIA 4K4HA 3WK9A 2RQ5A 3PSTA 2E8PA 2K8AA 1TAQA 1PK1B 5KFAA 3G6YA 1X66A 2J6TA 3SZ2A 2G07A 3VCBA 2RHFA 3HP6A 4IR1A 3WK7A 9ICRA 1L5UA 1U45A 2O6KA 4PHDA 1ZQXA 4FZNA 4MF8A 8ICBA 1B0XA 3H4BA 5ALDA 8ICGA 1L7PA 5KFFA 2HHTA 2HBLA 7ICSA 1NKBA 3QX7A 2Y1IA 9ICTA 3MR6A 4Y2RA 4YD2A 3B0YA 2DL0A 3RR8A 1SV0C 4Y2UA 3N28A 2Y0SF 3UXOA 3UM9A 4PHEA 3TKAA 5KFPA 5J0QA 1CI4A 1MSWD 2UVWA 1QQ5A 4UB5A 2R8JA 4DOAA 4DCCA 4ECXA 1N61A 1D8YA 2RLTA 3T5JA 8ICSA 7ICQA 2B0CA 1ZQZA 4PGYA 4ED1A 4ELTA 4EX6A 5DQIA 4I2BA 2YQEA 4RQ7A 1DGSA 2L5YA 1F5SA 5J0PA 3ALRA 3HJEA 4IS7A 2FE9A 3KZXA 3NVYA 3SR6A 5DBBA 1ZQMA 1S77D 4LJXA 3M6KA 5ALKA 2C2RA 5KFDA 1TK5A 1MC8A 3GZFA 4YFKA 4KMUA 2PI5A 1C20A 1Z1VA 3H0LB 1LB2B 4O3QA 4ED6A 5ALMA 7ICTA 2PFOA 2VA8A 1KKXA 3DEEA 5J0XA 4QJFB 5KFUA 2DUYA 5DBAA 2LM4A 4DOBA 3TARA 2W9BB 2NRVA 3UPQA 4O5EA 4OJLA 3WKAA 2C22A 5HMLA 1PVQA 3Q8SB 2Y1JA 4DS5A 2LI6A 4QZIA 2DBYA 5L1LA 3Q8QB 1NJYA 4O5KA 5ALWA 2ZIUB 4J9OA 2YTUA 5KFOA 2BCUA 1U48A 2KKVA 3MFIA 3GIKA 4NLBA 2ZJ8A 3MGIA 3RJIA 3EYZA 9ICMA 2DKXA 5KFEA 4UW9A 5J2IA 1NJXA 5L1IA 5AIBA 2HHVA 5L1JA 8ICNA 2ASLA 2EAMA 1IM4A 3SAFA 5DDMA 4F4ZA 4I2CA 4NL9C 3KHLA 2UVUA 4PPXA 2MAXA 1J2MA 8ICMA 3KHHA 4GFJA 2R8HA 1QTMA 2OHFA 1TKDA 5ALSA 3H4DA 3F5AA 5C5JA 4P2HA 4R64A 4NJ8A 2JV3A 5KFTA 3GIIA 2WAQF 3C29A 2YMQA 2BPCA 4DL7A 3BJYA 2C28A 1NZPA 5CRXA 1X2IA 3GDXA 5D4BA 3ONNA 4FZMA 4YR3A 4DL3A 4QZFA 2LBOA 3IRUA 4Y2QA 1FFUA 1T94A 1UQVA 4EBDA 3PZPA 4P0PA 2ES6A 2KV2A 2Y0SC 3ISDA 1NOMA 2GO7A 3QEAZ 4DSIA 4Z6CA 1D8BA 1B22A 5AI5A 1DGJA 3RJKA 3G6XA 3PW0A 2VA3A 5EE1A 2DFLA 1S8OA 2VJ5A 4F4KA 3CW2C 5ALXA 5HR6A 5AM5A 4BJQA 3ETLA 3NVWA 4EZ6A 3RH6A 1X9MA 8ICFA 1EXNA 1ZD5A 1OUQA 1LKYA 1JIHA 2KD1A 2FPMA 2Z7JA 2KMDA 1UA0A 4C8NA 4UB1A 1SKRA 5AKZA 2D8CA 4IQUA 3OTQA 4Z6DA 5BOLA 2BQRA 1ZETA 4KLJA 5ALRA 4YP3A 2BQ3A 3PMNA 3KFUF 7ICOA 5IIMA 2CRXA 5J0RA 3AM9A 3C5FA 4QWCA 1KLNA 3PNCA 2OWOA 3ICXA 4OD0A 2E1FA 2PKEA 5J0UA 1BPBA 3L3FX 3JPSA 1TV9A 4O3OA 3NTUA 3WKDA 2LYBA 2C2DA 5J2HA 1QCKA 3Q8PB 5ALUA 3E2EA 2JEGA 5KG0A 5J8YA 3LYSA 1AQ6A 2K4EA 7ICIA 4IQWA 4C8MA 1SZPA 2GWSA 1N5XA 2XO7A 4FS1A 1KFTA 4I2AA 4F3OA 7ICPA 3FM9A 2NYVA 5ALYA 5HHIA 5AKHA 4Y2JA 4YXJA 2XIDA 3CNHA 7ICEA 3VC8A 4UQGA 4RQ8A 3GILA 1NZBA 4KLSA 4GXIA 4DSJA 3FYHA 2JMGA 2KFNA 2PXIA 3LVWA 3LWMA 4DSEA 1N2XA 5AI0A 4DQPA 5J2FA 2ODGA 3QNMA 2Q0ZX 1ZQUA 1COKA 4ED3A 2WAQC 3TACB 4BWMA 2E8MA 2OM6A 3UMCA 1QSYA 4RT3A 4J9NA 8ICCA 1RDFA 4F8RA 5KL8B 4YD1A 1COOA 3OJSA 2ZUDA 4UATA 4NM1A 4OJOA 5KT7A 3PV8A 1ZQHA 5ALQA 5KFHA 3SQIA 4C80A 3OGUA 3MFHA 1N60A 4C4TA 5L9XA 2GOLA 1V9PA 2I9GA 5E79U 3V7KA 1NKCA 3THVA 2CN1A 3BQ7A 2K60A 5G5HA 1A0PA 1S0VA 3QUBA 1BPZA 3B9JA 4M0AA 1YZ6A 4C4SA 3D2NA 2ZIVB 2JEFA 5AI6A 1N48A 3KHGA 4UB8U 3D2SA 2E1EA 3WK8A 2KICA 4GXKA 5DG9A 1XNSA 3BQTA 5ALNA 4O5CA 4CF3A 5DBCA 1J2NA 3LK9A 1T8EA 4UBBA 2G06A 1OW5A 1SL2A 2KJ9A 3HILA 4QIWF 4FE3A 2AHOB 1ZQTA 3MR2A 4KLDA 4PZOA 3QYPA 4DL5A 3CP8A 4CGZA 1JUDA 2KZ3A 2BPFA 5IINA 3JPQA 4RQNA 1RZTA 3H8JA 2JZBA 3F53A 2VKQA 2ZIXA 4PJ0U 9ICSA 9ICHA 2B21A 4GIBA 1ZQLA 3QE9Y 3SYZA 4KLQA 2XI9A 3F2CA 4F92B 3MGVA 3Q8MA 7ICKA 4RNNA 1X9SA 1DXSA 5J29A 8ICAA 5CB1A 5HP4A 3JPNA 2BKEA 3M8SA 4PH5A 1S0NA 4UAYA 2ZTDA 4QW8A 2KKPA 3WKBA 2ISOA 4YCXA 4C8KA 5EE0A 4IRDA 3QEBZ 3QU9A 2JHDA 3PY8A 2PI4A 2Y9TA 1FO4A 1MQ2A 1YZ7A 3SENA 5CWRA 2J6SA 2KTQA 1SV0A 1KRPA 1Z00B 4I2EA 2AXTU 3M9MB 1N62A 5JRTA 2AGQA 2F1JA 3EWAA 2KSOA 2LKYA 2G08A 4DF8A 1BVSA 3OSPA 4YXMA 1RYUA 4UB6U 9ICOA 2KN7A 4QZ8A 2QB1A 4OJ6A 5KT3A 5J0SA 4ELUA 3NRWA 5KT6A 2AQ4A 2XCPA 3SV4A 4E0DA 3ISCA 4KLHA 4IR9A 3FAHA 2AGPA 1ZJNA 3U26A 5GTHU 4KLUA 3FC4A 2LMRA 4UAWA 4Z6EA 2GH1A 1X6IA 3NVZA 9ICUA 3RR7A 1JROA 3BQ2A 5AK6A 8ICZA 3TADC 5AM1A 2NRZA 3Q8RB 2EAPA 1VJ5A 4Y2VA 4QWAA 4YMMA 4BDPA 5HNKA 1FIQA 5ALJA 5HHHA 3OSNA 4LZDA 2XCAA 4IQVA 1BPDA 1ZQBA 4M9NA 5EE3A 2JGAA 2YB4A 1V38A 3M6ZA 3SV3A 1O03A 4OO1J 1ZQWA 4M2YA 2IMWP 1D9FA 4ECRA 4QIWC 2FMPA 3RB4A 3MR5A 3PO4A 1IXRA 4J9PA 2Y9UA 4I2DA 2EZYA 1TFRA 2BDPA 2K89A 3SAGA 3C5GA 4MFCA 5ALEA 5ALTA 3B0XA 4EX7A 1JMSA 3AU6A 8ICWA 1ZQKA 5AHXA 3LVVA 5D49A 3WU2U 3JPRA 3PVXA 3N7SC 1QH9A 1L3VA 4GC7A 2IOFA 2OH2A 4J9SA 1NKEA 2FPKA 1LVHA 1OXJA 1U4BA 3C1ZA 3H0RB 5DLFA 2N1RA 2ZTCA 3FDSA 5DQHA 5DG8A 5ALVA 4NL9A 1X6JA 5AKLA 5AIAA 1JRPA 3G6VA 2IHMA 1RQLA 3PR4A 1KW4A 3ZDBA 4EELA 2UVRA 2Q4TA 4KLOA 4PHPA 5KNIA 3C23A 3BQ1A 2W7OA 4ED0A 5B66U 2HI0A 5HR7A 4IRCA 4JUZA 3IHQB 4F5RA 4XUSA 4O3MA 5J2BA 3J81j 5DB8A 5KFKA 1NJZA 1O08A 1N63A 2IOFK 5T14A 5CJ7A 2YX8A 2HSZA 4B6JA 1RYRA 3PSFA 3Q8KA 3IG5A 4TUQA 4F5OA 3UQ0A 5KFXA 3T5LA 2HOQA 3T3FA 4QWEA 8ICYA 2BCQA 2JEJA 3MDCA 1KDHA 2P6UA 5KG7A 5ALGA 4CE6A 1BGXT 1B4FA 3E0FA 5IIIA 2H5XA 5CEHA 2BPGA 2EQYA 9ICQA 1P7DA 1MA7A 2GLEA 5EE9A 1YT3A 2F1IA 5EWFA 3RAXA 1HEKA 1NK8A 2W9AA 3KTQA 4KLEA 5J2EA 5KFIA 1ZQYA 4J9MA 3AU2A 2WTFA 4EYIB 2LHTA 4JWMA 4RT2A 1KFDA 4JV1A 3RFAA 3A0HU 5ALHA 1LKYB 2G5IB 4O9MA 2K4HA 5KAIU 8ICPA 4MFFA 2FDRA 4GC6A 5KT5A 1ED1A 2XVTA 1NNLA 2FPLA 1ZQVA 1ZRNA 4KLTA 4DO9A 3NRZA 2PMZF 3I76A 5EWGA 4M9JA 2IBKA 5IIJA 1SWVA 4PL1A 4YR2A 5AK3A 4QWDA 4YMOA 4OCZA 4Q8FA 5ALZA 1PZNA 4EBEA 4F5NA 1ZOLA 1TE2A 3C28A 9ICEA 3T5HA 3GV5B 5KG6A 1S5LU 2MSNA 3RH5A 4J03A 4A8EA 2KK0A 4QZDA 4XRHA 4P4MA 3ZDEA 5J0YA 4QW9A 2NRTA 2W54A 4UARA 3H7IA 1Z4NA 4B9NA 2NRXA 7ICMA 4F72A 2AU0A 5DGBA 1NK6A 4UB2A 3EPIA 5ALLA 3BQ0A 4R65A 5J2CA 5AK4A 2B6GA 2ZUBA 3WK6A 4DL2A 1WG8A 2MA1A 3TQ1A 2K8CB 2NO5A 1RQNA 2LPEA 3NS1A 5KFCA 4DQRA 3V6JA 4JMUA 3ZDCA 4DS4A 2H3VA 3WK4A 4Y2YA 1UA1A 1GO3F 3PMLA 2KFZA 1JN3A 2ZXHA 2ZG6A 2M9NA 2EH9A 4M9GA 2EZZA 2VA2A 3IV6A 2YN4A 1ZRMA 1L8LA 2A1JB 4QZAA 7ICRA 4F4YA 4DFPA 4ECZA 5DDYA 4RUCA 2G09A 3KHRA 5C0YA 1FFVA 5ALPA 2BQUA 2ZUCA 5AM0A 3H8MA 4F4XA 9ICGA 2DWQA 3JPTA 4KLLA 5TZVA 8ICOA 2JEIA 2WHEA 3S6JA 4QZHA 4P4OA 2FJ6A 1ZQIA 4ECTA 4FBUA 4YG2A 2H3QA 3KZIU 5DGAA 2RP5A 4R8UB 2OCEA 3BZKA 5IIOA 5DG7A 2V4QA 2QB0A 2F1HA 3AUOA 3ISBA 4C7YA 9ICCA 2PFQA 2RRDA 4DFDA 4BGDA 3CRXA 2MUTB 4ICAA 1RPLA 5TISU 1HUZA 1XWLA 5J2GA 3BS5B 4HYKA 2ZJ5A 3D2QA 5EWEA 1IG6A 1KL9A 2JR5A 4NLKA 3K1RB 2W55A 3OHBA 5ALIA 1UCVA 9ICFA 4GLXA 1JI7A 1RXVA 2R8KA 2PMZC 2BGWA 4O3PA 3RJFA 2HVIA 1UT8A 2FLPA 4IL6U 1S97A 1JXLA 4M6WB 4BXOA 8ICVA 2G0AA 5KT2A 4ED2A 2XGPA 3MR3A 2PFPA 5CP2A 1ZXIA 3PX4A 3KKAA 4F2SA 2HW3A 5J2AA 4FZLA 4WJ3B 3H8WA 2K4PA 5J2KA 4UAZA 2JZBB 8ICTA 4DOCA 4TQRA 2K8BB 5DB9A 5AI8A 1NJWA 2LYAA 2CXYA 2EDUA 5KL1B 3N97B 1ZD2P 1MQ3A 3QUTA 7ICLA 3Q8LA 4O0IA 1X9XA 4JB3A 3UMBA 4ECYA 2YMMA 1C7YA 4TURA 4YVZA 1Z19A 1ZD3A 3KOOA 1XO0A 4LVSA 2D6FC 2OYYA 4USAA 5CA7A 3HPOA 4QZEA 3AMZA 4DQQA 9ICXA 1TVAA 1HUOA 1S9FA 4JK1A 5AM4A 4ECVA 4AYBF 4RU9A 3PO5A 2RDJA 5AI9A 1A77A 4B9TA 1S0OA 3RRHA 2E5SA 2FI1A 4ZOHC 4C4RA 2W9MA 3UXNA 3RRGA 5DKWA 3L4PA 5KG1A 4NY8A 3NVVA 1HJPA 5AKKA 5J0WA 1JALA 5D46A 2KSOB 1JXEA 1ZQCA 2DPIA 1S0MA 3TADA 2NRWA 4RQ6A 3GIMA 4FS2A 4IC9A 4P0QA 5AI4A 4US9A 3RJJA 4RQ0A 2FMQA 3IG8A 4ECSA 4RPXA 1RYSA 1RXWA 1F44A 3AQEA 1T7PA 4NWIA 4Y2SA 3BDPA 3DV9A 4EYHB 7ICGA 2KNJA 8ICUA 5AM3A 2HHUA 4B9VA 3BS7A 3KKAC 5EOZA 3WKEA 1A6SA 9ICWA 4EBCA 4DSLA 1Q3VA 1Z4OA 1ZQNA 4YR0A 5KG5A 4EEKA 2W9CA 1Y88A 1T4GA 1SWWA 2A1AA 1WYGA 2JH7A 4KLFA 3DDHA 1F0MA 2ZIVA 3RBEA 4PHAA 3NUQA 4TUPA 2XGQA 4X5VA 1QLNA 1SGGA 8ICQA 3ZDDA 4Q45A 1BPYA 5AKGA 2BDUA 4F50A 4Q43A 1JX4A 3TAPA 2WB1F 1ZQJA 4MEXA 2R8GA 1SL0A 2KP7A 2DGZA 4Y2XA 4UB4A 4P4PA 3ZD8A 3SMVA 5HMMA 1XU4A 3PSPA 1TK8A 1K1SA 5J0TA 2C2EA 5KFGA 3AL0B 1H38A 3AEVA 3UMGA 1S10A 3JPPA 2QKQA 3MBYA 1U47A 4QZCA 1PVPA 1NI3A 3AQFA 2I5HA 1L8OA 2KIVA 4YN4A 9ICNA 4UAVA 3HT3A 2OEHA 1AROP 3PX0A 2AGOA 5KG4A 3H40A 1ZYQA 2HBKA 1XC9A 8ICXA 3V7LA 1X42A 4U7CA 1XSLA 1X40A 2NO4A 2KJ8A 3KBBA 4AYBC 1NK7A 3JPOA 4JV2A 4C8LA 3RB6A 3RJGA 2R8IA 3GIJA 4BWJA 5KG3A 4QZ9A 4KX3A 1L7MA 4RQMA 4RUAA 1A76A 3RB3A 5F9LA 1QQ7A 2BZFA 5L1KA 1ZQFA 2QARA 3A0BU 4C7ZA 1DK3A 2VIXA 2HBJA 4F93B 4G9BA 4J9LA 1Z00A 4KN7A 3HKZF 2G5HB 3MDAA 4BUGA 3V72A 2AQ0A 1SXDA 2XC9A 1ZQOA 5KFBA 1PUZA 9ICVA 3N7PD 4O3NA 4B9SA 4RNMA 2F76X 2DF4B 5KFWA 4DFMA 1KBUA 2XY6A 4Y2TA 8ICLA 5DQGA 1PVRA 4YQWA 4I2HA 2FMSA 2BCVA 1TAUA 2ZIWA 9ICAA 3PSIA 9ICPA 1NK9A 5B5EU 1QSSA 2HMXA 2WF7A 4DSFA 2KHQA 2A19A 4DFJA 3IN5A 1LV5A 2IA6A 1Q3UA 5JU5A 2KE7A 2H3IA 4PL2A 2VJ4A 1PK1A 3RTVA 3SEIA 2KOBA 5J0OA 4C8OA 1ZD4A 2WB1C 3SAHA 3T5KA 1XS9D 2P6RA 1UPHA 3F2BA 3HX0A 3GFKB 2FLLA 5DB7A 3HWTA 4ELVA 4EENA 4RPYA 2V4RA 3QXGA 4B9MA 1Q46A 5KFMA 2BHNA 1L7NA 4KITB 2HOFA 4P0PB 3LWLA 4JWNA 1KTQA 3F5EA 1QQ6A 2ALZA 2EANA 5AICA 5AM2A 3M7DA 4NLCA 3V7JA 2UVVA 5DB6A 3PR5B 2I6XA 2E3TA 3MGHA 1HIWA 3K4GA 4TQSA 1QSLA 4XA5A 4DF4A 2W8LA 1WCNA 2BCRA 2IOHA 2KEYA 3D6JA 3IP4B 9ICKA 2R18A 3RF9A 1N5WA 4DLEA 2HHQA 2KG5A 5KAFU 4C0ZA 1ZQQA 2KZMA 4QZGA 4PGXA 4DL4A 2JRZA 4DEZA 5KFJA 2D3DA 2YY6A 1Z3EB 5AKIA 2H3ZA 4KN4A 2W3SA 3TI0A 4I2GA 4F5QA 1L3SA 5KFYA 4BX9C 2W7PA 4R63A 3K75D 3SD7A 3RBDA 1URJA 3UQ2A 3RH4A 4IQTA 3HKZC 1IIPA 3ZDAA 4ED7A 1X9WA 4K4GA 2FLNA 1CRXA 3N4MB 1ZQRA 2F77X 4F2RA 4MF2A 2BCSA 2ATLA 4UBCA 3I28A 3EPGA 4I27A 3M8RA 2W43A 2JXJA 4ECUA 3QUCA 4J9KA 3PW5A 3GU3A 5K4LA 2K4IA 2W9BA 4US8A 4QWBA 1NK4A 3L5KA 1DRGA 5KFLA 3V6HA 1XSPA 7ICFA 2WF9A 2LYHA 2OXOA 3I1YA 2ZIUA 4KLMA 1BNPA 3O0FA 4J9QA 1M6YA 4KX5A 3NASA 3ZI4A 2QLTA 2XY5A 2QB0B 5J2DA 4HAIA 8ICJA 5ALFA 2XY7A 1NK5A 4RQ3A 5KG2A 1ZQSA 5JTIA 3QU4A 3EZ5A 4MEYA 4CNQA 4DQSA 1RM6C 3NGDA 3QU5A 2ESEA 4NLNA 7ICJA 3N7RC 3ZD9A 5KFQA 2YMPA 1BPXA 1VDVA 1KN5A 1VLBA 1IV8A 1ZQ1C 3ORYA 1SKSA 4RQ5A 4RQ4A 4BXOB 3WKCA 5KFSA 1CUKA 4CF4A 2HHWA 4FFDA 2MU2A 4PGQA 3QU7A 3IM1A 3OPXA 2HBMA 2F3NA 5KTQA 2DPJA 4NLGA 9ICLA 2HDOA 2DQNB 4DWIA 2AJQA 4NV0A 4F91B 2YB1A 4LZGA 1WWUA 4EEYA 2KVSA 1ZJMA 3QZ7A 2RDIA 3GV8B 3TFRA 2BR0A 3AN1A 3ED5A 8ICHA 2KVCA 1XSNA 4NLZA 2H3FA 4FBTA 3T79A 4DFKA 3RAQA 1TAMA 2LM1A 4Z6FA 3TANA 2VANA 8ICRA 1WCLA 5F9NA 3RB0A 3EW9A 3K1ZA 2ISPA 4GXJA 5F3XB 2WF6A 1V85A 2W11A 4OJ5A 2ZTEA 2P66A 4KLIA 2XICA 3F2DA 3PX6A 2JH1A 3SI8A 3LDAA 2KHVA 2HVHA 1SZHA 1RG6A 4F71A 5IIKA 3IDWA 3E58A 4ECQA 4CDGA 4P0QB 4ZH4A 5A0LA 1B43A 2ZIXB 2A1JA 5KT4A 5KFVA 1U49A 4M9HA 5BOMA 3QU2A 3M9OB 1S76D 4KLGA 8ICKA 2EZXA 5AKYA 1KQQA 2I1QA 3TFSA 3GV7B 2ASJA 2HCFA 4UASA 5G5GA 4Q44A 2W8KA 1ECWA 1U9LA 9ICBA 3M1YA 3RJHA 3MC1A 5AK5A 1KEJA 1J97A 1CEZA 2W9CB 1Z1BA 4R8UA 5J8YC 5CR0A 9ICIA 8ICEA 5AKXA 3C1YA 3PW4A 4I2JA 3H8SA 5KFZA 1SB3C 2IHNA 2PFNA 3EUB2 4YMNA 2MUTA 4G3IA 2W3RA 3C2KA 4O3SA 4OJPA 5DLGA 2HOIA 1L3TA 3BS5A 4CRXA 7ICHA 7ICNA 4ACOA 4NXZA 2E8NA 3QZ8A 4IRKA 2NV3A 2J6UA 2WF8A 4RPZA 3PW7A 5J2JA 5IILA 3KD3A 4KTQA 4FO6A 1L7OA 1NK0A 4M6WA 4PZNA 2AH5A 2KIWA 2MRLA 1KFSA 1ZQGA 3WK5A 4M9LA 1SL1A 4EZ9A 4M04A 1UHUA 1WWVA 4RZRA 5AKJA 2F8KA 2F2AB 3TAQA 2ZJAA 4DLGA 5L1MA 1T3QA 3V6KA 4RQ2A 5H2FU 4NM2A 4XQ8A 2V9WA 2DKZA 3RJEA 3ETRA 3OJUA 1PK3A 4ECWA 1D9DA 1BNOA 4JV0A 1XO1A 4I2FA 1Q8KA 4J9RA 4UAUA 3BZCA 2W04A 1FEZA 4TUSA 2WF5A 1ZQDA 2KZZA 2F44A 4MHVA 9ICJA 1SIJA 1WUDA 4B9LA 3QUQA 4AP9A 5FP0A 5JUMA 4R66A 4Q8EA 4CCHA 3C2MA 2P35A 1SXEA 2QARB 4MFAA 1D8LA 4RQ1A 1ZQAA 8ICIA 1KSPA 4F4WA 1MN8A 2ZXIA 5ALOA 4ED8A 3PW2A 1L3UA 1ZQEA 1UT5A 3CYMA 1DK2A 5KFRA 4U6PA 3MABA 2M0NA 2F8LA 3R9KA 1SV4A 4M47A 5BPCA 1L6NA 2A3VA 1DOQA 3M9NB 4UB3A 2YMLA 3OHAA 4RNOA 1V97A 4KMOB 5AKEA 7ICVA 4B9UA 3H0MB 4QNLA 5GTIU 4DL6A 3C2LA 4CF5A 4I28A 2E8OA 1ZQPA 3GQCA 2CPRA 3UXPA 4Y2PA 4F5PA 7ICUA
chains in the Genus database with same CATH topology
1RYUA 2LI6A 2JXJA 2EH9A 5K4LA 1KN5A 1KKXA 2JRZA 2CXYA 4LJXA 2OEHA 2KK0A 1KQQA 1IG6A 2LM1A 5CEHA 2EQYA 2RQ5A 1C20A 2YQEA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1RYU A;  2LI6 A;  2JXJ A;  2EH9 A;  5K4L A;  1KN5 A;  1KKX A;  2JRZ A;  2CXY A;  4LJX A;  2OEH A;  2KK0 A;  1KQQ A;  1IG6 A;  2LM1 A;  5CEH A;  2EQY A;  2RQ5 A;  1C20 A;  2YQE A; 
#chains in the Genus database with same CATH topology
 2WFA A;  1BPE A;  4O3R A;  2ZIW B;  4DSK A;  4QZB A;  1SKW A;  1TK0 A;  2HHX A;  5KFN A;  2HHS A;  2EAO A;  3HRD D;  4I2I A;  1N56 A;  3C21 A;  4K4I A;  1K1Q A;  3HW8 A;  4I29 A;  1K5O A;  5CHG A;  1T3N A;  2ASD A;  2KJ5 A;  2W03 A;  4DQI A;  4K4H A;  3WK9 A;  2RQ5 A;  3PST A;  2E8P A;  2K8A A;  1TAQ A;  1PK1 B;  5KFA A;  3G6Y A;  1X66 A;  2J6T A;  3SZ2 A;  2G07 A;  3VCB A;  2RHF A;  3HP6 A;  4IR1 A;  3WK7 A;  9ICR A;  1L5U A;  1U45 A;  2O6K A;  4PHD A;  1ZQX A;  4FZN A;  4MF8 A;  8ICB A;  1B0X A;  3H4B A;  5ALD A;  8ICG A;  1L7P A;  5KFF A;  2HHT A;  2HBL A;  7ICS A;  1NKB A;  3QX7 A;  2Y1I A;  9ICT A;  3MR6 A;  4Y2R A;  4YD2 A;  3B0Y A;  2DL0 A;  3RR8 A;  1SV0 C;  4Y2U A;  3N28 A;  2Y0S F;  3UXO A;  3UM9 A;  4PHE A;  3TKA A;  5KFP A;  5J0Q A;  1CI4 A;  1MSW D;  2UVW A;  1QQ5 A;  4UB5 A;  2R8J A;  4DOA A;  4DCC A;  4ECX A;  1N61 A;  1D8Y A;  2RLT A;  3T5J A;  8ICS A;  7ICQ A;  2B0C A;  1ZQZ A;  4PGY A;  4ED1 A;  4ELT A;  4EX6 A;  5DQI A;  4I2B A;  2YQE A;  4RQ7 A;  1DGS A;  2L5Y A;  1F5S A;  5J0P A;  3ALR A;  3HJE A;  4IS7 A;  2FE9 A;  3KZX A;  3NVY A;  3SR6 A;  5DBB A;  1ZQM A;  1S77 D;  4LJX A;  3M6K A;  5ALK A;  2C2R A;  5KFD A;  1TK5 A;  1MC8 A;  3GZF A;  4YFK A;  4KMU A;  2PI5 A;  1C20 A;  1Z1V A;  3H0L B;  1LB2 B;  4O3Q A;  4ED6 A;  5ALM A;  7ICT A;  2PFO A;  2VA8 A;  1KKX A;  3DEE A;  5J0X A;  4QJF B;  5KFU A;  2DUY A;  5DBA A;  2LM4 A;  4DOB A;  3TAR A;  2W9B B;  2NRV A;  3UPQ A;  4O5E A;  4OJL A;  3WKA A;  2C22 A;  5HML A;  1PVQ A;  3Q8S B;  2Y1J A;  4DS5 A;  2LI6 A;  4QZI A;  2DBY A;  5L1L A;  3Q8Q B;  1NJY A;  4O5K A;  5ALW A;  2ZIU B;  4J9O A;  2YTU A;  5KFO A;  2BCU A;  1U48 A;  2KKV A;  3MFI A;  3GIK A;  4NLB A;  2ZJ8 A;  3MGI A;  3RJI A;  3EYZ A;  9ICM A;  2DKX A;  5KFE A;  4UW9 A;  5J2I A;  1NJX A;  5L1I A;  5AIB A;  2HHV A;  5L1J A;  8ICN A;  2ASL A;  2EAM A;  1IM4 A;  3SAF A;  5DDM A;  4F4Z A;  4I2C A;  4NL9 C;  3KHL A;  2UVU A;  4PPX A;  2MAX A;  1J2M A;  8ICM A;  3KHH A;  4GFJ A;  2R8H A;  1QTM A;  2OHF A;  1TKD A;  5ALS A;  3H4D A;  3F5A A;  5C5J A;  4P2H A;  4R64 A;  4NJ8 A;  2JV3 A;  5KFT A;  3GII A;  2WAQ F;  3C29 A;  2YMQ A;  2BPC A;  4DL7 A;  3BJY A;  2C28 A;  1NZP A;  5CRX A;  1X2I A;  3GDX A;  5D4B A;  3ONN A;  4FZM A;  4YR3 A;  4DL3 A;  4QZF A;  2LBO A;  3IRU A;  4Y2Q A;  1FFU A;  1T94 A;  1UQV A;  4EBD A;  3PZP A;  4P0P A;  2ES6 A;  2KV2 A;  2Y0S C;  3ISD A;  1NOM A;  2GO7 A;  3QEA Z;  4DSI A;  4Z6C A;  1D8B A;  1B22 A;  5AI5 A;  1DGJ A;  3RJK A;  3G6X A;  3PW0 A;  2VA3 A;  5EE1 A;  2DFL A;  1S8O A;  2VJ5 A;  4F4K A;  3CW2 C;  5ALX A;  5HR6 A;  5AM5 A;  4BJQ A;  3ETL A;  3NVW A;  4EZ6 A;  3RH6 A;  1X9M A;  8ICF A;  1EXN A;  1ZD5 A;  1OUQ A;  1LKY A;  1JIH A;  2KD1 A;  2FPM A;  2Z7J A;  2KMD A;  1UA0 A;  4C8N A;  4UB1 A;  1SKR A;  5AKZ A;  2D8C A;  4IQU A;  3OTQ A;  4Z6D A;  5BOL A;  2BQR A;  1ZET A;  4KLJ A;  5ALR A;  4YP3 A;  2BQ3 A;  3PMN A;  3KFU F;  7ICO A;  5IIM A;  2CRX A;  5J0R A;  3AM9 A;  3C5F A;  4QWC A;  1KLN A;  3PNC A;  2OWO A;  3ICX A;  4OD0 A;  2E1F A;  2PKE A;  5J0U A;  1BPB A;  3L3F X;  3JPS A;  1TV9 A;  4O3O A;  3NTU A;  3WKD A;  2LYB A;  2C2D A;  5J2H A;  1QCK A;  3Q8P B;  5ALU A;  3E2E A;  2JEG A;  5KG0 A;  5J8Y A;  3LYS A;  1AQ6 A;  2K4E A;  7ICI A;  4IQW A;  4C8M A;  1SZP A;  2GWS A;  1N5X A;  2XO7 A;  4FS1 A;  1KFT A;  4I2A A;  4F3O A;  7ICP A;  3FM9 A;  2NYV A;  5ALY A;  5HHI A;  5AKH A;  4Y2J A;  4YXJ A;  2XID A;  3CNH A;  7ICE A;  3VC8 A;  4UQG A;  4RQ8 A;  3GIL A;  1NZB A;  4KLS A;  4GXI A;  4DSJ A;  3FYH A;  2JMG A;  2KFN A;  2PXI A;  3LVW A;  3LWM A;  4DSE A;  1N2X A;  5AI0 A;  4DQP A;  5J2F A;  2ODG A;  3QNM A;  2Q0Z X;  1ZQU A;  1COK A;  4ED3 A;  2WAQ C;  3TAC B;  4BWM A;  2E8M A;  2OM6 A;  3UMC A;  1QSY A;  4RT3 A;  4J9N A;  8ICC A;  1RDF A;  4F8R A;  5KL8 B;  4YD1 A;  1COO A;  3OJS A;  2ZUD A;  4UAT A;  4NM1 A;  4OJO A;  5KT7 A;  3PV8 A;  1ZQH A;  5ALQ A;  5KFH A;  3SQI A;  4C80 A;  3OGU A;  3MFH A;  1N60 A;  4C4T A;  5L9X A;  2GOL A;  1V9P A;  2I9G A;  5E79 U;  3V7K A;  1NKC A;  3THV A;  2CN1 A;  3BQ7 A;  2K60 A;  5G5H A;  1A0P A;  1S0V A;  3QUB A;  1BPZ A;  3B9J A;  4M0A A;  1YZ6 A;  4C4S A;  3D2N A;  2ZIV B;  2JEF A;  5AI6 A;  1N48 A;  3KHG A;  4UB8 U;  3D2S A;  2E1E A;  3WK8 A;  2KIC A;  4GXK A;  5DG9 A;  1XNS A;  3BQT A;  5ALN A;  4O5C A;  4CF3 A;  5DBC A;  1J2N A;  3LK9 A;  1T8E A;  4UBB A;  2G06 A;  1OW5 A;  1SL2 A;  2KJ9 A;  3HIL A;  4QIW F;  4FE3 A;  2AHO B;  1ZQT A;  3MR2 A;  4KLD A;  4PZO A;  3QYP A;  4DL5 A;  3CP8 A;  4CGZ A;  1JUD A;  2KZ3 A;  2BPF A;  5IIN A;  3JPQ A;  4RQN A;  1RZT A;  3H8J A;  2JZB A;  3F53 A;  2VKQ A;  2ZIX A;  4PJ0 U;  9ICS A;  9ICH A;  2B21 A;  4GIB A;  1ZQL A;  3QE9 Y;  3SYZ A;  4KLQ A;  2XI9 A;  3F2C A;  4F92 B;  3MGV A;  3Q8M A;  7ICK A;  4RNN A;  1X9S A;  1DXS A;  5J29 A;  8ICA A;  5CB1 A;  5HP4 A;  3JPN A;  2BKE A;  3M8S A;  4PH5 A;  1S0N A;  4UAY A;  2ZTD A;  4QW8 A;  2KKP A;  3WKB A;  2ISO A;  4YCX A;  4C8K A;  5EE0 A;  4IRD A;  3QEB Z;  3QU9 A;  2JHD A;  3PY8 A;  2PI4 A;  2Y9T A;  1FO4 A;  1MQ2 A;  1YZ7 A;  3SEN A;  5CWR A;  2J6S A;  2KTQ A;  1SV0 A;  1KRP A;  1Z00 B;  4I2E A;  2AXT U;  3M9M B;  1N62 A;  5JRT A;  2AGQ A;  2F1J A;  3EWA A;  2KSO A;  2LKY A;  2G08 A;  4DF8 A;  1BVS A;  3OSP A;  4YXM A;  1RYU A;  4UB6 U;  9ICO A;  2KN7 A;  4QZ8 A;  2QB1 A;  4OJ6 A;  5KT3 A;  5J0S A;  4ELU A;  3NRW A;  5KT6 A;  2AQ4 A;  2XCP A;  3SV4 A;  4E0D A;  3ISC A;  4KLH A;  4IR9 A;  3FAH A;  2AGP A;  1ZJN A;  3U26 A;  5GTH U;  4KLU A;  3FC4 A;  2LMR A;  4UAW A;  4Z6E A;  2GH1 A;  1X6I A;  3NVZ A;  9ICU A;  3RR7 A;  1JRO A;  3BQ2 A;  5AK6 A;  8ICZ A;  3TAD C;  5AM1 A;  2NRZ A;  3Q8R B;  2EAP A;  1VJ5 A;  4Y2V A;  4QWA A;  4YMM A;  4BDP A;  5HNK A;  1FIQ A;  5ALJ A;  5HHH A;  3OSN A;  4LZD A;  2XCA A;  4IQV A;  1BPD A;  1ZQB A;  4M9N A;  5EE3 A;  2JGA A;  2YB4 A;  1V38 A;  3M6Z A;  3SV3 A;  1O03 A;  4OO1 J;  1ZQW A;  4M2Y A;  2IMW P;  1D9F A;  4ECR A;  4QIW C;  2FMP A;  3RB4 A;  3MR5 A;  3PO4 A;  1IXR A;  4J9P A;  2Y9U A;  4I2D A;  2EZY A;  1TFR A;  2BDP A;  2K89 A;  3SAG A;  3C5G A;  4MFC A;  5ALE A;  5ALT A;  3B0X A;  4EX7 A;  1JMS A;  3AU6 A;  8ICW A;  1ZQK A;  5AHX A;  3LVV A;  5D49 A;  3WU2 U;  3JPR A;  3PVX A;  3N7S C;  1QH9 A;  1L3V A;  4GC7 A;  2IOF A;  2OH2 A;  4J9S A;  1NKE A;  2FPK A;  1LVH A;  1OXJ A;  1U4B A;  3C1Z A;  3H0R B;  5DLF A;  2N1R A;  2ZTC A;  3FDS A;  5DQH A;  5DG8 A;  5ALV A;  4NL9 A;  1X6J A;  5AKL A;  5AIA A;  1JRP A;  3G6V A;  2IHM A;  1RQL A;  3PR4 A;  1KW4 A;  3ZDB A;  4EEL A;  2UVR A;  2Q4T A;  4KLO A;  4PHP A;  5KNI A;  3C23 A;  3BQ1 A;  2W7O A;  4ED0 A;  5B66 U;  2HI0 A;  5HR7 A;  4IRC A;  4JUZ A;  3IHQ B;  4F5R A;  4XUS A;  4O3M A;  5J2B A;  3J81 j;  5DB8 A;  5KFK A;  1NJZ A;  1O08 A;  1N63 A;  2IOF K;  5T14 A;  5CJ7 A;  2YX8 A;  2HSZ A;  4B6J A;  1RYR A;  3PSF A;  3Q8K A;  3IG5 A;  4TUQ A;  4F5O A;  3UQ0 A;  5KFX A;  3T5L A;  2HOQ A;  3T3F A;  4QWE A;  8ICY A;  2BCQ A;  2JEJ A;  3MDC A;  1KDH A;  2P6U A;  5KG7 A;  5ALG A;  4CE6 A;  1BGX T;  1B4F A;  3E0F A;  5III A;  2H5X A;  5CEH A;  2BPG A;  2EQY A;  9ICQ A;  1P7D A;  1MA7 A;  2GLE A;  5EE9 A;  1YT3 A;  2F1I A;  5EWF A;  3RAX A;  1HEK A;  1NK8 A;  2W9A A;  3KTQ A;  4KLE A;  5J2E A;  5KFI A;  1ZQY A;  4J9M A;  3AU2 A;  2WTF A;  4EYI B;  2LHT A;  4JWM A;  4RT2 A;  1KFD A;  4JV1 A;  3RFA A;  3A0H U;  5ALH A;  1LKY B;  2G5I B;  4O9M A;  2K4H A;  5KAI U;  8ICP A;  4MFF A;  2FDR A;  4GC6 A;  5KT5 A;  1ED1 A;  2XVT A;  1NNL A;  2FPL A;  1ZQV A;  1ZRN A;  4KLT A;  4DO9 A;  3NRZ A;  2PMZ F;  3I76 A;  5EWG A;  4M9J A;  2IBK A;  5IIJ A;  1SWV A;  4PL1 A;  4YR2 A;  5AK3 A;  4QWD A;  4YMO A;  4OCZ A;  4Q8F A;  5ALZ A;  1PZN A;  4EBE A;  4F5N A;  1ZOL A;  1TE2 A;  3C28 A;  9ICE A;  3T5H A;  3GV5 B;  5KG6 A;  1S5L U;  2MSN A;  3RH5 A;  4J03 A;  4A8E A;  2KK0 A;  4QZD A;  4XRH A;  4P4M A;  3ZDE A;  5J0Y A;  4QW9 A;  2NRT A;  2W54 A;  4UAR A;  3H7I A;  1Z4N A;  4B9N A;  2NRX A;  7ICM A;  4F72 A;  2AU0 A;  5DGB A;  1NK6 A;  4UB2 A;  3EPI A;  5ALL A;  3BQ0 A;  4R65 A;  5J2C A;  5AK4 A;  2B6G A;  2ZUB A;  3WK6 A;  4DL2 A;  1WG8 A;  2MA1 A;  3TQ1 A;  2K8C B;  2NO5 A;  1RQN A;  2LPE A;  3NS1 A;  5KFC A;  4DQR A;  3V6J A;  4JMU A;  3ZDC A;  4DS4 A;  2H3V A;  3WK4 A;  4Y2Y A;  1UA1 A;  1GO3 F;  3PML A;  2KFZ A;  1JN3 A;  2ZXH A;  2ZG6 A;  2M9N A;  2EH9 A;  4M9G A;  2EZZ A;  2VA2 A;  3IV6 A;  2YN4 A;  1ZRM A;  1L8L A;  2A1J B;  4QZA A;  7ICR A;  4F4Y A;  4DFP A;  4ECZ A;  5DDY A;  4RUC A;  2G09 A;  3KHR A;  5C0Y A;  1FFV A;  5ALP A;  2BQU A;  2ZUC A;  5AM0 A;  3H8M A;  4F4X A;  9ICG A;  2DWQ A;  3JPT A;  4KLL A;  5TZV A;  8ICO A;  2JEI A;  2WHE A;  3S6J A;  4QZH A;  4P4O A;  2FJ6 A;  1ZQI A;  4ECT A;  4FBU A;  4YG2 A;  2H3Q A;  3KZI U;  5DGA A;  2RP5 A;  4R8U B;  2OCE A;  3BZK A;  5IIO A;  5DG7 A;  2V4Q A;  2QB0 A;  2F1H A;  3AUO A;  3ISB A;  4C7Y A;  9ICC A;  2PFQ A;  2RRD A;  4DFD A;  4BGD A;  3CRX A;  2MUT B;  4ICA A;  1RPL A;  5TIS U;  1HUZ A;  1XWL A;  5J2G A;  3BS5 B;  4HYK A;  2ZJ5 A;  3D2Q A;  5EWE A;  1IG6 A;  1KL9 A;  2JR5 A;  4NLK A;  3K1R B;  2W55 A;  3OHB A;  5ALI A;  1UCV A;  9ICF A;  4GLX A;  1JI7 A;  1RXV A;  2R8K A;  2PMZ C;  2BGW A;  4O3P A;  3RJF A;  2HVI A;  1UT8 A;  2FLP A;  4IL6 U;  1S97 A;  1JXL A;  4M6W B;  4BXO A;  8ICV A;  2G0A A;  5KT2 A;  4ED2 A;  2XGP A;  3MR3 A;  2PFP A;  5CP2 A;  1ZXI A;  3PX4 A;  3KKA A;  4F2S A;  2HW3 A;  5J2A A;  4FZL A;  4WJ3 B;  3H8W A;  2K4P A;  5J2K A;  4UAZ A;  2JZB B;  8ICT A;  4DOC A;  4TQR A;  2K8B B;  5DB9 A;  5AI8 A;  1NJW A;  2LYA A;  2CXY A;  2EDU A;  5KL1 B;  3N97 B;  1ZD2 P;  1MQ3 A;  3QUT A;  7ICL A;  3Q8L A;  4O0I A;  1X9X A;  4JB3 A;  3UMB A;  4ECY A;  2YMM A;  1C7Y A;  4TUR A;  4YVZ A;  1Z19 A;  1ZD3 A;  3KOO A;  1XO0 A;  4LVS A;  2D6F C;  2OYY A;  4USA A;  5CA7 A;  3HPO A;  4QZE A;  3AMZ A;  4DQQ A;  9ICX A;  1TVA A;  1HUO A;  1S9F A;  4JK1 A;  5AM4 A;  4ECV A;  4AYB F;  4RU9 A;  3PO5 A;  2RDJ A;  5AI9 A;  1A77 A;  4B9T A;  1S0O A;  3RRH A;  2E5S A;  2FI1 A;  4ZOH C;  4C4R A;  2W9M A;  3UXN A;  3RRG A;  5DKW A;  3L4P A;  5KG1 A;  4NY8 A;  3NVV A;  1HJP A;  5AKK A;  5J0W A;  1JAL A;  5D46 A;  2KSO B;  1JXE A;  1ZQC A;  2DPI A;  1S0M A;  3TAD A;  2NRW A;  4RQ6 A;  3GIM A;  4FS2 A;  4IC9 A;  4P0Q A;  5AI4 A;  4US9 A;  3RJJ A;  4RQ0 A;  2FMQ A;  3IG8 A;  4ECS A;  4RPX A;  1RYS A;  1RXW A;  1F44 A;  3AQE A;  1T7P A;  4NWI A;  4Y2S A;  3BDP A;  3DV9 A;  4EYH B;  7ICG A;  2KNJ A;  8ICU A;  5AM3 A;  2HHU A;  4B9V A;  3BS7 A;  3KKA C;  5EOZ A;  3WKE A;  1A6S A;  9ICW A;  4EBC A;  4DSL A;  1Q3V A;  1Z4O A;  1ZQN A;  4YR0 A;  5KG5 A;  4EEK A;  2W9C A;  1Y88 A;  1T4G A;  1SWW A;  2A1A A;  1WYG A;  2JH7 A;  4KLF A;  3DDH A;  1F0M A;  2ZIV A;  3RBE A;  4PHA A;  3NUQ A;  4TUP A;  2XGQ A;  4X5V A;  1QLN A;  1SGG A;  8ICQ A;  3ZDD A;  4Q45 A;  1BPY A;  5AKG A;  2BDU A;  4F50 A;  4Q43 A;  1JX4 A;  3TAP A;  2WB1 F;  1ZQJ A;  4MEX A;  2R8G A;  1SL0 A;  2KP7 A;  2DGZ A;  4Y2X A;  4UB4 A;  4P4P A;  3ZD8 A;  3SMV A;  5HMM A;  1XU4 A;  3PSP A;  1TK8 A;  1K1S A;  5J0T A;  2C2E A;  5KFG A;  3AL0 B;  1H38 A;  3AEV A;  3UMG A;  1S10 A;  3JPP A;  2QKQ A;  3MBY A;  1U47 A;  4QZC A;  1PVP A;  1NI3 A;  3AQF A;  2I5H A;  1L8O A;  2KIV A;  4YN4 A;  9ICN A;  4UAV A;  3HT3 A;  2OEH A;  1ARO P;  3PX0 A;  2AGO A;  5KG4 A;  3H40 A;  1ZYQ A;  2HBK A;  1XC9 A;  8ICX A;  3V7L A;  1X42 A;  4U7C A;  1XSL A;  1X40 A;  2NO4 A;  2KJ8 A;  3KBB A;  4AYB C;  1NK7 A;  3JPO A;  4JV2 A;  4C8L A;  3RB6 A;  3RJG A;  2R8I A;  3GIJ A;  4BWJ A;  5KG3 A;  4QZ9 A;  4KX3 A;  1L7M A;  4RQM A;  4RUA A;  1A76 A;  3RB3 A;  5F9L A;  1QQ7 A;  2BZF A;  5L1K A;  1ZQF A;  2QAR A;  3A0B U;  4C7Z A;  1DK3 A;  2VIX A;  2HBJ A;  4F93 B;  4G9B A;  4J9L A;  1Z00 A;  4KN7 A;  3HKZ F;  2G5H B;  3MDA A;  4BUG A;  3V72 A;  2AQ0 A;  1SXD A;  2XC9 A;  1ZQO A;  5KFB A;  1PUZ A;  9ICV A;  3N7P D;  4O3N A;  4B9S A;  4RNM A;  2F76 X;  2DF4 B;  5KFW A;  4DFM A;  1KBU A;  2XY6 A;  4Y2T A;  8ICL A;  5DQG A;  1PVR A;  4YQW A;  4I2H A;  2FMS A;  2BCV A;  1TAU A;  2ZIW A;  9ICA A;  3PSI A;  9ICP A;  1NK9 A;  5B5E U;  1QSS A;  2HMX A;  2WF7 A;  4DSF A;  2KHQ A;  2A19 A;  4DFJ A;  3IN5 A;  1LV5 A;  2IA6 A;  1Q3U A;  5JU5 A;  2KE7 A;  2H3I A;  4PL2 A;  2VJ4 A;  1PK1 A;  3RTV A;  3SEI A;  2KOB A;  5J0O A;  4C8O A;  1ZD4 A;  2WB1 C;  3SAH A;  3T5K A;  1XS9 D;  2P6R A;  1UPH A;  3F2B A;  3HX0 A;  3GFK B;  2FLL A;  5DB7 A;  3HWT A;  4ELV A;  4EEN A;  4RPY A;  2V4R A;  3QXG A;  4B9M A;  1Q46 A;  5KFM A;  2BHN A;  1L7N A;  4KIT B;  2HOF A;  4P0P B;  3LWL A;  4JWN A;  1KTQ A;  3F5E A;  1QQ6 A;  2ALZ A;  2EAN A;  5AIC A;  5AM2 A;  3M7D A;  4NLC A;  3V7J A;  2UVV A;  5DB6 A;  3PR5 B;  2I6X A;  2E3T A;  3MGH A;  1HIW A;  3K4G A;  4TQS A;  1QSL A;  4XA5 A;  4DF4 A;  2W8L A;  1WCN A;  2BCR A;  2IOH A;  2KEY A;  3D6J A;  3IP4 B;  9ICK A;  2R18 A;  3RF9 A;  1N5W A;  4DLE A;  2HHQ A;  2KG5 A;  5KAF U;  4C0Z A;  1ZQQ A;  2KZM A;  4QZG A;  4PGX A;  4DL4 A;  2JRZ A;  4DEZ A;  5KFJ A;  2D3D A;  2YY6 A;  1Z3E B;  5AKI A;  2H3Z A;  4KN4 A;  2W3S A;  3TI0 A;  4I2G A;  4F5Q A;  1L3S A;  5KFY A;  4BX9 C;  2W7P A;  4R63 A;  3K75 D;  3SD7 A;  3RBD A;  1URJ A;  3UQ2 A;  3RH4 A;  4IQT A;  3HKZ C;  1IIP A;  3ZDA A;  4ED7 A;  1X9W A;  4K4G A;  2FLN A;  1CRX A;  3N4M B;  1ZQR A;  2F77 X;  4F2R A;  4MF2 A;  2BCS A;  2ATL A;  4UBC A;  3I28 A;  3EPG A;  4I27 A;  3M8R A;  2W43 A;  2JXJ A;  4ECU A;  3QUC A;  4J9K A;  3PW5 A;  3GU3 A;  5K4L A;  2K4I A;  2W9B A;  4US8 A;  4QWB A;  1NK4 A;  3L5K A;  1DRG A;  5KFL A;  3V6H A;  1XSP A;  7ICF A;  2WF9 A;  2LYH A;  2OXO A;  3I1Y A;  2ZIU A;  4KLM A;  1BNP A;  3O0F A;  4J9Q A;  1M6Y A;  4KX5 A;  3NAS A;  3ZI4 A;  2QLT A;  2XY5 A;  2QB0 B;  5J2D A;  4HAI A;  8ICJ A;  5ALF A;  2XY7 A;  1NK5 A;  4RQ3 A;  5KG2 A;  1ZQS A;  5JTI A;  3QU4 A;  3EZ5 A;  4MEY A;  4CNQ A;  4DQS A;  1RM6 C;  3NGD A;  3QU5 A;  2ESE A;  4NLN A;  7ICJ A;  3N7R C;  3ZD9 A;  5KFQ A;  2YMP A;  1BPX A;  1VDV A;  1KN5 A;  1VLB A;  1IV8 A;  1ZQ1 C;  3ORY A;  1SKS A;  4RQ5 A;  4RQ4 A;  4BXO B;  3WKC A;  5KFS A;  1CUK A;  4CF4 A;  2HHW A;  4FFD A;  2MU2 A;  4PGQ A;  3QU7 A;  3IM1 A;  3OPX A;  2HBM A;  2F3N A;  5KTQ A;  2DPJ A;  4NLG A;  9ICL A;  2HDO A;  2DQN B;  4DWI A;  2AJQ A;  4NV0 A;  4F91 B;  2YB1 A;  4LZG A;  1WWU A;  4EEY A;  2KVS A;  1ZJM A;  3QZ7 A;  2RDI A;  3GV8 B;  3TFR A;  2BR0 A;  3AN1 A;  3ED5 A;  8ICH A;  2KVC A;  1XSN A;  4NLZ A;  2H3F A;  4FBT A;  3T79 A;  4DFK A;  3RAQ A;  1TAM A;  2LM1 A;  4Z6F A;  3TAN A;  2VAN A;  8ICR A;  1WCL A;  5F9N A;  3RB0 A;  3EW9 A;  3K1Z A;  2ISP A;  4GXJ A;  5F3X B;  2WF6 A;  1V85 A;  2W11 A;  4OJ5 A;  2ZTE A;  2P66 A;  4KLI A;  2XIC A;  3F2D A;  3PX6 A;  2JH1 A;  3SI8 A;  3LDA A;  2KHV A;  2HVH A;  1SZH A;  1RG6 A;  4F71 A;  5IIK A;  3IDW A;  3E58 A;  4ECQ A;  4CDG A;  4P0Q B;  4ZH4 A;  5A0L A;  1B43 A;  2ZIX B;  2A1J A;  5KT4 A;  5KFV A;  1U49 A;  4M9H A;  5BOM A;  3QU2 A;  3M9O B;  1S76 D;  4KLG A;  8ICK A;  2EZX A;  5AKY A;  1KQQ A;  2I1Q A;  3TFS A;  3GV7 B;  2ASJ A;  2HCF A;  4UAS A;  5G5G A;  4Q44 A;  2W8K A;  1ECW A;  1U9L A;  9ICB A;  3M1Y A;  3RJH A;  3MC1 A;  5AK5 A;  1KEJ A;  1J97 A;  1CEZ A;  2W9C B;  1Z1B A;  4R8U A;  5J8Y C;  5CR0 A;  9ICI A;  8ICE A;  5AKX A;  3C1Y A;  3PW4 A;  4I2J A;  3H8S A;  5KFZ A;  1SB3 C;  2IHN A;  2PFN A;  3EUB 2;  4YMN A;  2MUT A;  4G3I A;  2W3R A;  3C2K A;  4O3S A;  4OJP A;  5DLG A;  2HOI A;  1L3T A;  3BS5 A;  4CRX A;  7ICH A;  7ICN A;  4ACO A;  4NXZ A;  2E8N A;  3QZ8 A;  4IRK A;  2NV3 A;  2J6U A;  2WF8 A;  4RPZ A;  3PW7 A;  5J2J A;  5IIL A;  3KD3 A;  4KTQ A;  4FO6 A;  1L7O A;  1NK0 A;  4M6W A;  4PZN A;  2AH5 A;  2KIW A;  2MRL A;  1KFS A;  1ZQG A;  3WK5 A;  4M9L A;  1SL1 A;  4EZ9 A;  4M04 A;  1UHU A;  1WWV A;  4RZR A;  5AKJ A;  2F8K A;  2F2A B;  3TAQ A;  2ZJA A;  4DLG A;  5L1M A;  1T3Q A;  3V6K A;  4RQ2 A;  5H2F U;  4NM2 A;  4XQ8 A;  2V9W A;  2DKZ A;  3RJE A;  3ETR A;  3OJU A;  1PK3 A;  4ECW A;  1D9D A;  1BNO A;  4JV0 A;  1XO1 A;  4I2F A;  1Q8K A;  4J9R A;  4UAU A;  3BZC A;  2W04 A;  1FEZ A;  4TUS A;  2WF5 A;  1ZQD A;  2KZZ A;  2F44 A;  4MHV A;  9ICJ A;  1SIJ A;  1WUD A;  4B9L A;  3QUQ A;  4AP9 A;  5FP0 A;  5JUM A;  4R66 A;  4Q8E A;  4CCH A;  3C2M A;  2P35 A;  1SXE A;  2QAR B;  4MFA A;  1D8L A;  4RQ1 A;  1ZQA A;  8ICI A;  1KSP A;  4F4W A;  1MN8 A;  2ZXI A;  5ALO A;  4ED8 A;  3PW2 A;  1L3U A;  1ZQE A;  1UT5 A;  3CYM A;  1DK2 A;  5KFR A;  4U6P A;  3MAB A;  2M0N A;  2F8L A;  3R9K A;  1SV4 A;  4M47 A;  5BPC A;  1L6N A;  2A3V A;  1DOQ A;  3M9N B;  4UB3 A;  2YML A;  3OHA A;  4RNO A;  1V97 A;  4KMO B;  5AKE A;  7ICV A;  4B9U A;  3H0M B;  4QNL A;  5GTI U;  4DL6 A;  3C2L A;  4CF5 A;  4I28 A;  2E8O A;  1ZQP A;  3GQC A;  2CPR A;  3UXP A;  4Y2P A;  4F5P A;  7ICU A; 
#chains in the Genus database with same CATH homology
 1RYU A;  2LI6 A;  2JXJ A;  2EH9 A;  5K4L A;  1KN5 A;  1KKX A;  2JRZ A;  2CXY A;  4LJX A;  2OEH A;  2KK0 A;  1KQQ A;  1IG6 A;  2LM1 A;  5CEH A;  2EQY A;  2RQ5 A;  1C20 A;  2YQE A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...