5EE3A

Complex structure of osychf1 with amp-pnp
Total Genus 110
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
110
sequence length
374
structure length
357
Chain Sequence
ERPILGRFSSHLKIGIVGLPNVGKSTFFNIVTKLSIPAENFPFCTIDPNEARVYVPDERFDWLCQLYKPKSEVSAYLEINDIALGNAFLSHIRAVDGIFHVLRAFEDKDSVDPVRDLETIGEELRLKDIEFVQNKIDDLEKSMKRSNDKQLKLEHELCEKVKAHLEDGKDVRFGDWKSADIEILNTFQLLTAKPVVYLVNMSEKDYQRKKNKFLPKIHAWVQEHGGETIIPFSCAFERLLADMPPDEAAKYCAENQIASVIPKIIKTGFAAIHLIYFFTAGPDEVKCWQIRRQTKAPQAAGTIHTDFERGFICAEVMKFDDLKELGSESAVKAAGKYRQEGKTYVVQDGDIIFFKFN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title ATP binding by the P-loop NTPase OsYchF1 (an unconventional G protein) contributes to biotic but not abiotic stress responses
pubmed doi rcsb
source organism Oryza sativa subsp. japonica
molecule tags Hydrolase
molecule keywords Obg-like ATPase 1
total genus 110
structure length 357
sequence length 374
chains with identical sequence B
ec nomenclature ec 3.6.5.-:
pdb deposition date 2015-10-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01926 MMR_HSR1 50S ribosome-binding GTPase
A PF06071 YchF-GTPase_C Protein of unknown function (DUF933)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.300 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 TGS-like domain 5ee3A03
3.10.20.30 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 5ee3A02
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 5ee3A01
3AEFB 3LX8A 2YINC 3B1XA 2HXSA 4JLVA 2O8CB 1IJEA 3ZVMA 5EE1A 1QHYA 5IF9A 1NIJA 4KSBA 1B0UA 4QJ5A 3ZZ0A 3KFVA 4NYMQ 1V43A 1F0ZA 2BS4B 2IYYA 2QTHA 2ZJ8A 4JLBA 1QVRA 1JALA 1TKGA 1FRDA 2J0QA 3N70A 4AY2A 2J7PA 1Z63A 1VKJA 3RRMA 3CF2A 1KAOA 4KLZA 5GJBA 4O25A 1KK1A 4PHHA 2VHCA 5FTLA 1G41A 3Q5EA 4UNQA 2XSZA 4JKYA 4DSTA 4Y0VA 2QMUA 1OIWA 1VIYA 2WOOA 3C5HA 3Q8XB 4TQ9A 4PSKA 1NG1A 3A1VA 1W47A 2CCGA 1KYIA 1OV4A 1ZM3A 2J59A 2JJ1D 3B1VA 4R71A 4LJ9A 3W6PA 5LPNA 3EC1A 4PFSA 3GFTA 1SXJE 2C98A 3K0SA 4KO8A 3AE1B 5JCPA 1XD9A 3U3JA 3HU1A 2P6UA 4TT3A 2C2HA 4V0ME 3AVQA 5A4JA 4TN1A 1R7SA 2J3EA 1KI9A 3RVBA 1QG2A 2OO7A 1E2EA 3WY9A 1AS0A 3K70D 1EWQA 1GNPA 2KBEA 3FAHA 3I72A 1XNJA 2PZEA 3SEAA 4LHWA 4QC2A 4GFDA 4TYWA 3NC1C 4QBGB 1NLFA 2FFHA 4PPNA 4EFMA 2WP9B 1YR8A 4OQXA 1L4YA 4BZQA 4URXR 3RC8A 5EZ5A 3BH6A 3R7WA 2WPDA 3DO6A 4KHZA 5FBLB 2PVGC 4F91B 4BEBA 2QTFA 3R9WA 1P5ZB 1E2FA 4QG7A 1R0YA 1FFHA 5EZ6B 2GK7A 4M1TA 2W3SA 2H1LA 3ZS8A 5C2JB 1XP8A 4HUQB 4NYMR 2NO7A 2BM0A 4J0QA 2ZS9A 2O52A 3NS1A 1H8EA 3DHWC 1ZNWA 4OQLA 3DZ8A 4UJ5A 3QIAA 1NN1A 4LHZA 2J7PD 4Q18A 1KK2A 1YJIA 2ASEA 4V0OA 3Q7PA 2GVDC 1VECA 3BIFA 3C15C 4URZR 1ZJ6A 3SYLA 5FPKA 1VJKA 3AF4A 4HRSA 3CB4A 5KU1A 4NTZA 2KSQA 2WDQB 1YZGA 5A5GA 2A5FA 2AL7A 3T15A 3QEJA 2ZSBA 1IJFA 1DGJA 4NU0A 2ZJAA 1XRJA 4KU4A 1GIAA 4HEJA 4V0KA 2W83A 4TMZA 4D81A 2JJ1A 2F9MA 1JXMA 2WQYB 3L0PA 4FN5A 3OEHD 4GP7A 2VF7A 4M21A 3A1UA 3THOA 2QI9C 2OZEA 1X86B 1YVDA 1E96A 1QDEA 3MWLA 4N58A 1KK0A 1TUIA 1OXUA 1KJWA 1DVRA 4HB4A 1KKLA 4PHFA 3W5UB 5FBQB 3B6EA 4KAXA 1CBUA 2Q3FA 3WBJA 1K6MA 4B71A 1UDWA 1E2MA 3TQFA 1EGAA 2ZREA 3SFZA 2OXRA 4Q1AA 3W8NA 1SKYB 2ZRPA 1OFHA 1E9SA 4WWMA 3K70C 4S35A 4C30A 2KB0A 3I5XA 1OW3B 1ZIOA 2F1HA 4DSOA 4DUGD 1G8YA 4YT0B 2VP6A 2O8BA 3IUYA 2AD5A 2JLRA 4GBMA 5CJ2A 5F3WB 4DJTA 2IHBA 5CLLA 1W4RA 2V9PA 4ZO4A 4Q48A 1E4VA 3FOZA 3VX4A 5FL7D 4WQMA 1FOEB 4JLOA 1H8ED 3PUZA 5LB2A 5J4YA 2K5UA 3UG7A 3R20A 3BRWD 1OYWA 4OQFA 4RY2A 4JSTA 2AFIE 5CB6A 4C7OB 1CKEA 2FEOA 4G5QA 2MSCB 1VPLA 3PJRA 2MMCA 4RVCA 3ADKA 4TYPA 4QBFA 1ROEA 3C8UA 4Q1BA 1KF6B 1TF5A 3WYAA 5H92C 4M1KA 5FPHA 1P2SA 1NEKB 1DG1G 3L82B 3HRDD 3LXFA 1RZ3A 1TQ2A 3NHBA 4LC1A 4N1AA 4Q4AA 4XVRA 2UZ3A 2QSZA 4ZDJA 3UATA 4C80A 5DI3A 1US8A 4R9UC 4HAVA 4B3BA 4RZXA 4KVAA 1E0KA 2EKIA 3QSYA 3OEHA 2WJJA 1L7VC 5CIWA 1E1QD 3GLGE 4OJKA 1Z28A 4TZ6A 4Q9KA 4G3XA 5DN6A 1GZSA 3GEHA 3FE2A 4OYHA 3RABA 1WGKA 1E2IA 4M1OA 4P0TA 3AQ4A 4UXHA 1Z0AA 4NBSA 5KDOA 4JJZA 4JT2A 4PO9A 3J81k 3REGA 1DAEA 1ZU5A 2K22A 2ZRKA 2QP4A 3B13B 1E98A 3BS4A 2GESA 2PEZA 3GQBA 3NH9A 1E99A 4BEJA 3EWAA 4TMWA 4YXWA 3HDTA 4TYQA 2XZPA 3B1YA 5JI2E 2IS2A 1E2GA 1YR7A 2QZ4A 3DZDA 1Z0JA 5H70A 1KDPA 4NONA 1ZYUA 5AJYA 3WNCA 3THWB 4KYUA 5TV2A 3G82C 4UKDA 2G0TA 1VLBA 2PVOD 4PO8A 2FNAA 4LX0A 3P63A 5JSZB 2IEZA 4NCIA 3QEOA 4YDHB 2Z5FA 3GD7A 3B2FA 3BIID 4M22A 5KPDA 1U99A 1W36D 3VNUA 5KSYA 3ADDA 4XVUA 1P7CA 1G18A 2ANBA 1TMKA 3JZAA 1GVNB 1BKDR 2JDID 4DLTA 5J47A 2OFXA 3CONA 4E09A 3IO3A 4A8JA 3C14C 5FUVA 1MABA 2KAJA 1AJEA 4CIDA 4LRWA 1T0HB 3KFXA 1TQDA 5JFGA 1IUEA 1GTVA 1VYUA 1SVIA 4Z54A 1FTNA 2IHYA 4V0MA 4URVR 4YTMB 1QOBA 4CYMA 5TMPA 3WYFA 3THXB 2IYUA 4QGAA 3H2YA 2ZRHA 1X8LA 1CR2A 5DE3A 5CK5A 2Q3MA 2GZHA 2QEQA 5HCIA 2XTMA 4TLDA 4PC1A 5FUWA 2RH5A 4NYJR 3UMFA 4PQFA 4RFSB 3WRYC 1NNEA 4DT1A 1E1QA 1W4CA 4TLEA 2OLKA 4ZKEA 3LY5A 1F2TA 3ZVNA 2PBRA 1A70A 5BYJA 4B3CA 1PV4A 4MDEA 4EPVA 3CX8A 1FFUA 4FIDA 5EUMA 2PJRA 1NKTA 3WBKA 2J5XA 4LHVA 1KO8A 4L16A 2VHQA 3VAAA 2QAGC 3O8BA 1ZU4A 2GCOB 3FYHA 4UNPA 4RSGA 5AUPB 3CZPA 4MRSA 1E3MA 3D7MA 4WZ6A 1SVMA 1P9NA 4KFTA 1DAMA 3OESA 4A2WA 5E7IA 1FP7A 4RZ2A 1ZBDA 4F4JA 3O8CA 3FKSD 1Z29A 5LB4A 4BFZA 2FBWB 2FE4A 1DAKA 2M56B 1LS1A 1OH7A 5JJLA 4I1SA 1L0VB 1P6XA 4PANA 2CE7A 1C4OA 4Q9IA 1KRHA 4BLQA 3KQKA 3KKMA 4TL8A 4PC6A 2V7QD 4YSZB 2HJGA 3TVTA 4I4LA 4BASA 4GZLA 2XTZA 2F1JA 1N5KA 2O0KA 2ZSDA 2UZIR 3PUXA 3SN6A 1E9CA 1G21E 4BWYA 5G3ZA 2YOHA 3T5DA 3AV0B 1P3JA 2OFOA 2A3RA 3LXRA 4LCBA 2LEKA 1FNNA 2FA9A 4F4CA 1S0UA 2FPKA 4GZMA 4DSNA 1T5LA 1UADA 4HLQB 2G88A 3X2SA 1D8TA 3TAUA 2HV8A 3MSXA 1EFCA 1F2UA 3RSOA 2X19A 2CNWD 1VCMA 2GCNA 4HZIA 1LB1B 1CIPA 1MO4A 2V4ZA 1ZNXA 5HCNA 5FR1A 1IM2A 1E79A 3KJEA 2FEMA 1EFTA 2QPTA 2RGXA 3K0CA 3KWLA 1G1MA 3AF3A 3GEEA 4XTRA 2O8CA 2HUPA 1DO0A 2VPPA 3BERA 1X1RA 4E22A 4US0R 2GEDA 2WJGA 2NIPA 3NHAA 4DCNA 1RIFA 2XOKD 5AUIA 4AG5A 5K8IA 1XO3A 4NCKA 1NI3A 3U44B 1R0WA 2C8VA 1OH8A 1QOGA 1A2KC 3EXAA 3WNDA 2QGNA 2WSSD 3FHOA 4Q66C 3BAFA 3W9YA 2DWPA 4OHYA 1YZUA 3CNOA 4QHTA 2R6AA 4R2IA 2IEYA 4ZIRA 3VRBB 2IC5A 3T61A 4C0JA 3AEDB 1T8TA 5J4HA 2V7QA 5DIFA 1U8ZA 4U00A 3GEIA 2ERXA 3AH8A 3QVVA 4XSHA 3RWOA 2R62A 2YJTD 4LYFA 5TB5A 4XOIA 2CJOA 3U3RA 2QUZA 3CZQA 1PFDA 1NN3A 4OK6A 1RYHA 3PR1A 3LW8A 2IUSA 1KSGA 1N0WA 3QF4B 2PKOA 1RC8A 1DO2A 4GOKA 4A8JC 3O47A 1JQ4A 1FTSA 1KGDA 2ZU6A 1ESNA 4JKIA 2J0UB 4P4SA 6Q21A 3DKVA 4GL2A 4YSXB 1L6UA 4OHXA 1B23P 5DI9A 2F1IA 3WHKA 2Q3HA 1EG7A 3SR0A 1XZPA 3NG1A 4TSFA 1J70A 3U3MA 1QHSA 4HDOB 1E2HA 4IDOA 4AG6A 4DWJA 2C95A 2XZLA 1XEXA 1LV7A 4Q7JB 2WAYA 3EIQA 4G0NA 4LBVA 3T1TA 1UF9A 2QA5A 1E2LA 3MWKA 2Q9AA 2ZR7A 2VTKA 1J7BA 1VTKA 3GLIA 1KFYB 2NGRA 4LI0A 4UXIA 1G7SA 1P73A 3CPHA 4URUR 1S3SA 2PLRA 3ZH9B 2EYQA 2IYXA 1AA9A 3W3ZB 2QQEA 3EZ9A 3BH7A 3IIJA 4LHYA 4WAUA 2G6BA 3FDIA 4WXPA 5LBIA 2MJ3A 4PAQA 1YR9A 5IT5A 4EQ6B 5CLQA 2F3RA 3KQHA 2FH5B 3CUEF 5J5CA 1IN6A 4XD7A 4CEJB 4NYJQ 1T4GA 1P2TA 1ZUD2 2R6GA 3U7FB 4DDUA 5TVKA 1L4UA 2VA8A 1KJYA 1N6IA 3B82A 3V4RA 2DBYA 1G291 4YC7A 1OXSC 1HV8A 4QNMA 1GKUB 1VG8A 1YZLA 2QL6A 2JLYA 3PEWA 3KTAB 2QT1A 2VO1A 4KFRA 1NJGA 5CDFE 2DCUA 4L8GA 2FOLA 3PQCA 2OCYC 3OFND 5FBVB 1M34E 3OAAD 1E9BA 3B1WA 4C0BA 3KQUA 2REOA 4RD0A 3I3SR 2CHQA 3AUYA 4A0HA 5HE8A 3A1WA 2YWEA 5B2ZA 2C03A 2H5EA 2QMOA 4YONB 3VHXA 1LNZA 5L8VA 1G8PA 4TSFD 2OT3B 1NKSA 1OT3A 1E9DA 3FMFA 2C04A 1G7CA 4HAZA 1XXHA 4IXMA 4TLBA 2RGCA 3ND9A 1EK0A 1I4DD 3NC0C 4KSCA 2Y8EA 5CITA 4KBFA 2QSYA 3RLFA 2GEVA 1ZINA 2LCFA 1TUEA 2PCLA 5AWFC 4DIDA 4RCYA 2J1LA 4B3DA 3NVYA 4OJQA 1W0KA 2GJKA 1KI6B 2O0JA 3K9NA 2H57A 4XJXA 5BQ5A 3FFAA 1W2HA 3QENA 4FMBB 1H8HD 4TL9A 2WJVA 1II9A 5EE0A 4MKHA 1Z22A 2HYDA 2AKAB 1X8KA 2FV8A 3GFPA 3B5JA 5EJEA 1E0AA 3X1YA 3SQXA 1Q1EA 2BBWA 2J46A 4OBEA 1CULC 2PCJA 1VDZA 3C5CA 5C4GB 4ASUD 2DWQA 1ZC3A 2FJUA 3AEZA 1A2BA 3PCRB 1G8GA 4Q01A 3AH7A 1Z5ZA 1TQ4A 1AIPA 4PSAA 1ZP0B 1NVUQ 1TX4B 5JJIA 2J41A 1AK2A 5L3SA 4DDTA 1G3RA 3RPFC 3EG5A 4LYAA 3OEED 4URYR 3AE3B 2JLVA 1IONA 3LH5A 1WXQA 3KQLA 2PIAA 2NO6A 1EXMA 4PX9A 4PO1A 4PPGA 1FMJA 5KO2A 5FBRB 4XWAA 1LY1A 2FZ4A 2O5VA 3PG5A 4PZZA 1A7JA 3B78A 2X2EA 2B7CA 4D4KA 4P33A 2ONKA 3TE6A 4ZV4A 3PO0A 2P6NA 5G5HA 1VHLA 1I4TD 3LWNA 4X8MA 4HAXA 5ELXA 1J90A 2XITA 1E9RA 2OV2A 2H88B 2A5JA 1VHTA 2FX3A 1N6HA 3NBFA 5IK2D 2H8KA 4YTPB 3GJ4A 3OZXA 1QHHA 4A2QA 2BEJA 2ZQ5A 3P1JA 4GP6A 3U61B 3TIFA 4UNSA 4I1OA 3CPJB 1DPFA 2GNOA 3F0TA 1JRPA 2NOAA 1BO6A 1KDTA 2NTYC 2LWIA 1OE0A 4FI3C 1W0KD 1Z0IA 1ZAKA 1R5NA 1S9HA 1Z6AA 4NL4H 4N0DA 3DPUA 1SVWA 3DKPA 1TTTA 3B9QA 5EP4A 3LLUA 4Q00A 1QBKC 1NVID 1RRFA 1UBCA 2VP4A 4DDWA 3GJ3A 4HDQB 5CK4A 1G19A 4XVQA 4DCSA 4QXAA 1SKQA 2G83A 4C0HA 4DB4A 3P26A 2JIZA 1FP6A 5DI3B 1FM0D 2J0VA 4MYHA 3RAPR 3N5CA 1C9KA 3KL4A 2JLUA 5EE3A 5CM8B 4ZCMA 3LB8C 2ODWA 2XNDD 3HR8A 3BJIC 4FCWA 2CVHA 1GRRA 1COWD 5C4MA 2A9KA 1GL6A 1XTIA 1VCOA 1KAGA 4LDJA 1T3QA 1GPXA 4IDIA 4DEXA 3TUZC 4DVGA 1OH6A 3K09A 3TR0A 1JJ7A 3CWQA 2J9RA 2D3WA 1AM4D 2AWOA 3A4MA 4EUNA 4NDZA 3PEYA 1CRPA 4DLYA 3CX7A 3LV8A 4BFXA 2CL7X 4D26A 1KZ7B 2C9OA 4MKFA 3BORA 2CK3A 4A1FA 1IXZA 3KZ1E 1Q1BA 1XCPA 5E7JA 4CW7A 1ZD1A 4LHXA 3O8DA 2ECKA 4KXFB 2IA5A 1SXJC 3WCQA 4FCTA 1Z0KA 3AKCA 3L0SA 1YKSA 3VR2A 1WCV1 4ARZB 3RS7A 3E2IA 1HY3A 4IVPA 2OESA 3AEEB 4C0SA 1E0ZA 1G16A 1E2NA 4XH9B 1Q0UA 1AQUA 1OYYA 2IYWA 3KDSE 3QG5A 4YQFA 1UJ2A 3SR6A 4A8JB 2ACZB 2VP9A 4EIWA 1E1RA 4FMCB 1G7RA 4Q7LA 1W48A 2CCJA 3LQQA 4N59A 4JZKA 4MH0R 4JJKA 1MR3F 2AD1A 1QOFA 3T5GA 4B3XA 1K5DA 1MV5A 1XBTA 2J7KA 2R44A 2WBLC 2YKGA 2FG5A 2XNDA 2WKPA 1N6RA 2F55A 4YXWD 1XJCA 1YE8A 4JVSB 1COWA 5J4KA 3D6TB 4HROA 2NG1A 1DS6A 4NHOA 3QE0A 4C0KA 4PPFA 1M8PA 5EXTA 2GJ8A 5F98A 3RRYA 2QU8A 3ETLA 1N5LA 3BGWA 3CRVA 1UBEA 2FPLA 3U60B 5DNYB 4MYCA 3TSZA 1FL9A 2ZI3A 2ZSFA 3RRNA 3A1TA 2GETA 3ZDQA 3BOSA 1XMSA 2O8BB 1KO1A 1S8FA 3RC3A 1WF3A 3TGPA 2ZRBA 2ZYWX 3K0FB 4NP6A 1X3SA 5EP2A 1UFQA 2CL6X 3TRFA 4D80A 1DAGA 1Z8FA 4LWZA 2ANCA 4BFWA 4A9AA 4EPYA 5GVRA 3UMSA 3VQTA 1RFLA 5FI1B 1K5GA 1OQQA 1U90A 4YMTA 2JLXA 3BFKA 1XTSA 2GK6A 2B8WA 3LRPA 5JSZA 1SXJA 4KBGA 1F5NA 2AWNA 3QKSB 1MT0A 4MKIA 2W6IA 4JLJA 1E9FA 2ZI7A 5EXPA 1PLJA 4QKQA 1NJFA 1J7AA 5D3MA 4BZPA 4U5XA 3OE7A 4DCVA 1JB1A 2GJSA 3SBDA 3VKGA 4TMKA 3SJCA 3AV8A 2D2EA 2WPDD 2BMJA 1KO5A 3AGQA 4V0LA 3GLFA 5L3QA 2KI5A 2WIAA 4WVFA 1FZQA 4UXJA 2YV5A 4L5BA 4AYXA 2P2LA 3GJ8A 1EWYC 4W5WA 2O8EB 3Q9LA 5JCZA 1EX6A 1VG0B 3UKDA 3ICEA 4DKXA 4LJYA 2Q21A 4II7A 2XXAA 2OILA 3V9PA 3SJBA 1NYRA 1JNYA 3FKSA 2VRWA 3L8ZA 4DLUA 1J8MF 1N5IA 4AYTA 4C7YA 3GLGA 2KBFA 4Z8XA 2XJ9A 3KUCA 3R8CA 1G3UA 1L2TA 4DEYA 121PA 1Z3IX 3QPVA 3GJ6A 1W0JD 3ZZUA 4BZXA 2GBLA 4IRUB 1S4QA 5C46F 2UKDA 2QPOA 1G3IA 4L9SA 3BH0A 2IS6A 1WMSA 4CZ2A 4HI0E 1CJKC 1RJ9A 1N25A 3VTKA 2FPMA 3AE7B 5JLJA 1GUAA 2ORWA 2WM9B 2ZJOA 2X77A 4JLKA 5FI0B 2ZEJA 2IK8A 2DFKB 4LZZA 4HYYA 1CJVC 1U0JA 4HLUC 1JEEA 4PC3A 2HLDA 1HE1C 3AE2B 3MLEA 5M04A 2E3TA 1F6BA 2AR7A 2YNMA 4LC0A 2WSMA 4IDNA 5HPYB 1OIVA 2IX3A 2CLSA 2QMHA 2W6ID 1P75A 2WWXA 2IT1A 4Q1EA 3AN1A 1CP2A 2DY1A 3GJ7A 3SJZA 4A2PA 2DB3A 3L0OA 2CNWA 2J87A 2JASA 1XLQA 1QG4A 2QMEA 2QROA 1G8HA 4R98A 1NBMA 3WMFA 4DUGA 1UDXA 3TKLA 3AVTA 3W6NA 4TWZA 3P4RB 1UEJA 1N3BA 2R9VA 2W6JD 3NXSA 3PV0A 4US8A 3SE0A 3VKWA 1DADA 2G1EA 2J0UA 2ZJBA 2ZU0C 2VF8A 3V00A 2XJ4A 3KKNA 1ETUA 2WS3B 4G5SA 3CIRB 2H92A 4JL5A 4GMXA 4JT4A 3U4QA 3L0IB 1TAGA 4LYJA 3I92A 2NO1A 2OXCA 2BDTA 2P3SA 2ZYTX 4ZKDA 2MJDA 2YWFA 2ZE6A 3FVQA 1UAAA 3H0KA 3UK6A 4Q1CA 4FINA 1ESMA 2PH1A 2YVUA 3LAWA 2NQ2C 2HCBA 4IOKA 4B73A 1W0JA 1KDOA 1NRJB 3E70C 4A15A 2GAOA 1P9WA 5FBWB 4L4UA 2JLWA 1QHXA 2DR3A 3KB1A 4G5RA 2WOJA 4D0GA 2WHXA 4YMWA 2OM2A 5EXSA 1DOAA 1TKEA 1R6BX 4YMSA 2EFHB 4D0NA 4D82A 5KOYA 2ZRNA 4FMDB 5JMTA 1UM8A 3Q5DA 3VR4A 1RVDA 5G41A 4KX6B 3U3OA 2PZGA 1S3GA 2AFHE 1JI0A 1NENB 2O0HA 2RGGA 3IPXA 3QKRA 1XLNA 4P6VF 2ATVA 2HLDD 3U44A 4AD8A 2W3RA 4ACAA 3I8XA 3K09C 2B76B 3IQXA 5HKKD 2Z43A 4GOJA 4JLNA 4QOSA 4N6EB 4ZCIA 2BBSA 2GA8A 2ZRMA 2IW3A 4NCHA 3CW2A 1YZNA 1GG2A 3EASA 1P72A 4M8NE 5G40A 5SZIA 4B6EA 4DT1B 4NCNA 3O8RA 2HF9A 2F6RA 3IBGA 1N61A 2ZJYA 3LX5A 5JI3E 3ICQB 3UXMA 4D25A 3VR1A 3CRQA 2VIIA 5TARA 2JX5A 1MRNA 1Z83A 1YRAA 2ZYVX 3QKRB 3ZIAA 1I2DA 2W6JA 3IEVA 4D6PA 1W2GA 3U6BA 1WA5A 2PMDA 1N63A 1LTQA 5KNCA 3FKQA 2QJLA 1T6NA 2VQSA 3QBVA 4CT4B 2OBMA 4LK2A 1WWTA 3JVUA 3ZD7A 1KMHA 2GXUA 3QPUA 3M0EA 1G6OA 2NO9A 3SHWA 5JHGB 5FUXA 1FIQA 3QJYA 4MGIR 2ZRFA 5DSZA 2GJ9A 3D3QA 4XD7D 2OCBA 1S1CA 3ZZTA 1D2MA 3QQ5A 2I1VB 1IAQA 1QT9A 1OKKD 2CHVA 1F3OA 2OCAA 1Z08A 2FSFA 3SHFA 4BFUA 4B76A 1CZPA 1VYVA 2G9NA 3SNHA 2V3CC 5AUOB 1SHKA 3RANA 1IY2A 3TR5A 3CWZA 3SBEA 3IQWA 5G3YA 4B3GA 1M7BA 1E32A 3AVYA 1GP2A 1Z6GA 4Q1FA 1I2MA 2FZLA 2KWIA 3TH5A 2CBZA 3B85A 3ADCA 5CIQA 1NVXQ 2HXYA 4BE7B 1V5WA 3OAAA 3NDPA 3LDAA 1NVVQ 1XJ0A 1IY0A 3FTQA 1XF9A 4WOPA 1ZNZA 2OG2A 1VCIA 1II8A 1JQLB 1IXSB 3NVAA 2UVQA 3LQRA 1DE0A 4M0LA 4TYNA 2GZAA 3CF6R 4BFSA 1P2VA 1JBKA 4RD3A 4Z51A 1SVSA 1XMIA 1GKIA 1F2TB 1RRGA 4YDSA 3GLFB 3LVRE 3DVLA 1UEIA 2VSOA 2GJAA 5CJPA 4EPWA 4MQBA 3U5ZB 3ZS9A 2Z6VA 3KJIA 4O2RA 1X1SA 4OQMA 4XWOA 4RFVA 1ZD9A 4ABYA 4Z8YA 2O8EA 5K8TA 4JX1C 3KXKA 2GF9A 2P65A 2IBMA 1N2CE 4L9WA 1R5OA 2XB2A 1TF7A 3H1TA 1AN0A 1Q20A 1IN5A 4XSGA 4F93B 1KSJA 1M2OB 2H7VA 5J4VA 4Q4AB 4V0NA 1SB3C 4FWTA 5EXXA 1E6CA 2D2FA 3B2EA 2AK2A 2WAXA 4LJ5A 5K8LA 1OFTA 2ZTSA 1YZKA 3MD0A 4WW0A 521PA 2RGNA 4ITRC 1KZGB 3EZFA 3VHLB 1GILA 1CXZA 1A1VA 1U81A 3U7GA 3W6OA 1UKZA 4MRPA 4URWR 3IIKA 4JVMA 3EPKA 1R0XA 2BBOA 2EFEB 4ILEA 2IWRA 4DLXA 2RGEA 1G4UR 1KMQA 2GCPA 1RWSA 3AVUA 3AEAB 3QKTA 3REFA 4DLZA 3MWYW 2EFCB 2PT7A 3FFBA 5FPYA 1RKBA 2YWHA 1Q1QA 1OF1A 4D4JA 4LPSA 2VSFA 3NH6A 2O8FA 2IXGA 1PDXA 2CJWB 1NP6A 4KITB 5GVSA 2XZOA 4HB3A 3I32A 2ODNA 5AUKA 1TF2A 1CR4A 1YZQA 1F60A 4MUBA 1NVWQ 1E0JA 3ETRA 2Z83A 5CYOA 3OIYA 1MH1A 2HCJB 4N0EA 1N5XA 2HT1A 4B74A 3RHFA 2QRZA 4TMTA 3TW4A 4C4PA 4JWSC 4JWUC 3CBQA 2W00A 1U0HC 2X8AA 2A5DA 2QY9A 1KOFA 2WWGA 3T12A 2PEYA 3GLHB 2QT0A 1KO4A 4IOLA 2ODEA 4TTPA 2EFDB 1QOAA 2Q9CA 1E2QA 4KVGA 2ZSEA 4ZCLA 2HJVA 3LO5A 1KIMA 3IPYA 3K0EA 2W2TA 2JLSA 4I99A 1JEDA 3VU9A 2GTPA 3L4PA 2WMNB 2IYZA 3GLGB 3QUSA 1U9IA 5D3QA 2HF8A 3TK1A 5KNBA 2ZJ2A 3AE6B 2BCGY 3P4XA 5KPJA 2FFBA 2XTNA 2HTME 3IKJA 4LSGA 1YR6A 3LFUA 1BOFA 1T5IA 2ZUDA 1CRQA 4A92A 3PUYA 4GNKA 4QBHA 1J99A 1MKYA 2Q5WD 2IYRA 3NBXX 3P32A 1M7GA 4CEIA 5JRJA 2IS4A 1LF5A 5GJCA 3MRSA 1OXVA 1RM6C 3VU9B 2WDRB 4C0AC 1I4LD 5L3VA 1PUTA 4TTQA 1FXIA 1SIJA 2BKEA 1K8RA 3AF0A 2I4IA 3DMDA 4M1SA 1N60A 2FDCA 3T34A 4YMVA 1GAQB 4M9SA 3A1SA 1SGWA 3I8SA 1DOYA 1ZP6A 2V8OA 4OI4A 3HU3A 5GJVC 4HLDA 2AN9A 2YWGA 1JR3D 1YZTA 1E69A 2JLQA 4RZUA 3WP0A 3FMIA 3GLFE 2CL0X 2ZUCA 3A4NA 4GI7A 5KYKA 1MO6A 2K5PA 1GL7A 3DM5A 3RS4A 1II8B 4AC9A 5IRCD 4RD2A 4LJ7A 2B92A 2HDNB 1CLUA 3MFYA 1E7PB 1ZVQA 4IFEA 4Q9JA 1XLOA 3AP3A 3LBHA 1KI8A 3RYTC 4JVNA 5JJKA 1YQ3B 1N62A 3LNCA 4QM7A 1E9MA 4EJSA 2BMEA 1Z0FA 3R9IA 1E1RD 3U4QB 3SFVA 4UNRA 3M1IA 2H18A 2V55B 4IVRA 4TZ0A 3D8BA 3N2EA 4ZIRB 3SJAA 5BN5A 4X8OA 2QPAA 2ORIA 4WXRA 1TKYA 1R8SA 1T0JB 3P4PB 2QP9X 1FNMA 2ERYA 3AB3A 3CX6A 4A6PA 4B33A 3GLIE 4A36A 1SULA 3T1OA 3W9CB 1D5CA 4W5HA 2IUUA 2MH7A 3OFNA 1OHHD 2BJVA 1XTKA 3L8YA 2OHFA 2IUTA 2NZJA 1G64A 1AYFA 3QG1A 3KTAA 4QGGA 5C2TB 1JECA 3QY0A 5MPOA 1V97A 3VKHA 3F8TA 4LPKA 1EFRA 1E2PA 3DDCA 5EUQB 5H68A 2JQRB 1XD8A 4GRAA 4Q4HA 3QXXA 3KKPA 1KI1A 3ZYYX 4LV6A 4LV8B 3VR3A 1T9HA 2CE2X 3X1XA 1QLBB 5JZVA 3K8YA 3BWDD 3OF5A 3SYNA 1XPUA 2BC9A 4B47A 1KDRA 4EPXA 2AHOA 5JRZA 3NRZA 2MJEA 4LY6A 4XTCS 3VFDA 4H1UA 4LBZA 3W3AA 5DHFA 2QP3A 2V6IA 3ABVB 1NMZA 3VX3A 4JLMA 3QPWA 3M4YA 3CR8A 4M9ZA 1CS4C 3I4LA 4R2HA 3F3YA 5FOSA 1NY6A 1RPZA 3MJHA 1NF3A 4ASUA 3H84A 1IBRA 3QBTA 1NSFA 4GT1A 2Q0HA 4C9BA 4ZHPA 1N6KA 2ZE8A 4FW9A 2R6FA 2QBYA 3RSLA 1HUQA 5B57C 5F9HA 4U02A 2PZFA 4P31A 3WNBA 4Q9LA 1NN5A 1P60A 1Z07A 3CNLA 5DN6D 3K0CC 5HE9A 1CTQA 4K8OA 3PITA 5SZJA 5LDDC 2VHJA 2QENA 3NBYC 1S9DA 4JSYA 1FXAA 4PXAA 3A37A 3I1FA 4IHQA 4FD2A 3G5UA 4B34A 4JS0A 5C3JB 3LLMA 4B2PA 1G6HA 3TBKA 3EZ2A 3SS8A 3T06B 3TLXA 1N0UA 3NEJA 5FFMA 3THWA 5KDLA 4M2LA 1KY3A 2WICA 3SOPA 5H8YE 1HH4A 4Q7KA 4DBLC 1LW7A 1UKEA 2Z4SA 2H17A 2W0SA 1ZIPA 3NWJA 3LA6A 4B48A 1SVOA 4M53A 5A0FA 5EP1A 5JWOA 3GPLA 5DLQC 1Q57A 4HB2A 3IEUA 4CEIB 2OEPA 3D31A 1HQCA 2R6CA 1ZUHA 2GXSA 2ZXUA 4RZ3A 1XX6A 1ANKA 4MGKR 5CYPA 1G5PA 2JDIA 5FTJA 4OQNA 4D0LB 3FMPB 2WJHA 2ZM5A 1D6JA 3WYGA 5C1BA 4IOJA 3S1AA 5FOUA 5FOXA 4BUJA 4DLSA 2W0MA 2GF0A 1GAJA 4O2LA 4TQAA 4TLCA 1NMYA 2C5LA 1CJEA 2B21A 2XB4A 3MGCA 4FWIB 4A0RA 2VYFA 1XXHE 3IILA 1ONBA 2EFGA 1KY2A 1ZCAA 1HEIA 4PQRA 3OIUA 1WQ1R 621PA 1U0LA 1N5WA 3PIRA 2XNSA 2WWYA 3H86A 4RKFA 3ZLJA 4C7ZA 4PHGA 1IN8A 2ONJA 5FTNA 1XD2B 2NPIA 2QAGA 4JLAA 1YRBA 3BC1A 4Q19A 1WE2A 1Z47A 1XPRA 4CEHA 5LD2C 5BN4A 4C7OA 2Q6TA 4L15A 3X1DA 3AKYA 2WIBA 5JS8A 3TUJC 1JPNA 4MKGA 3BB4A 4BFTA 5KHOC 1AQYA 4AWXA 3C4JA 2P6RA 2FN4A 3H4MA 1Q1ZA 2DPXA 4EDHA 2O8DA 3AP1A 3CM0A 4Q02A 3SC3A 2QRNA 4IDHA 2ZUBA 4DSUA 4QL3A 4NPHA 4Q9HA 3SI7A 2JJ2D 4H1VA 3B2GA 2XAUA 3C7KA 5JBQA 1CR0A 1XJQA 3GLIB 2WZQA 3GLHE 4CT5A 5K8UA 1XTQA 1JQJC 3EA0A 5TDHA 1G3MA 2L52A 1IN7A 2XXAB 3K0FA 3V4FA 2FU5C 2RGDA 4LTUA 1YJJA 1DG3A 4JBYA 4LJAA 4PC2A 1E10A 2ZRAA 2WKRA 1WYGA 4QBIA 5J4LA 2D7DA 4YMUA 2BV3A 2RB4A 5EE9A 4ZDIA 4M1YA 1EX7A 1GNQA 2RMKA 2O8DB 2IYSA 4DLRA 1XEFA 5GJWC 4KI0A 2ZITA 2DWOA 2WWFA 4W7SA 1M6NA 1TJEA 1QVAA 4LGMA 2EWVA 1ZW6A 4M4SA 3C41J 2ZI5A 2OSBA 1GNRA 4D2IA 4JL6A 3IHWA 5DGXA 1KI2A 4FXCA 4MITA 3GFOA 2QE7D 1GM5A 1W46A 1NBME 3F5FA 4HUQA 4V03A 1P4SA 1S2MA 2CMKA 2FMXA 5TXGA 2D4HA 3NTUA 1ZUIA 5BW8A 3ZIAD 1I7HA 3HUIA 3LXXA 3K0AB 2BMDA 5JS7A 4AIIA 1B9RA 3BXZA 3IGFA 1ZRHA 3LD9A 1S96A 1WRBA 3MWJA 4Q4JA 3TSWA 4AYWA 1Z6TA 3LBNA 4E03A 2YC2C 4P4TA 1OB5A 1ELOA 3ZVRA 1XFAA 1D9ZA 2OUKA 4BLOA 1Y3AA 4MRNA 1PUIA 3VR8B 2I3BA 3HU2A 4EFLA 5AR1A 3B9JA 1BMFA 1EFHA 2IXEA 2VH5R 3UIEA 4NE2A 2MSDB 2I1QA 2D06A 3R8FA 421PA 1Z2AA 3QNUA 2ZVQX 4POAA 2H16A 3ZQ6A 2CEAA 1D9XA 3GJ0A 3QVUA 3PEVA 4IEIA 5EP3A 2G1JA 1CF4A 2WVJA 2G77B 1W5TA 2F43B 3ADBA 2LKCA 1TNDA 4JYBA 1R7RA 1CEEA 3AVWA 5FTMA 4G5OA 3NEYA 2KMMA 2JGNA 5AJXA 2ZRGA 1OFFA 4ARZA 4KFUA 4DIEA 3G0HA 1UKVY 2G0NA 2NMVA 3OE7D 2JA1A 2GVZC 4V02A 3CIOA 1KHTA 4I81A 1KSFX 1RYJA 3DWMA 1BH2A 1E2KA 4G01B 5FL3A 3U3KA 1KSHA 1R8QA 3HYTA 3CF0A 3WMEA 4C0LA 2QE7A 5JEEA 1TL7C 1XEXB 3AKDA 1G5TA 2EWWA 1PJRA 2FSHA 4ERNA 2RHDA 2Z4RA 4DXAA 2FFAA 1SQ5A 2GZDA 2WDVB 5IHPA 4IDPA 1FMLA 1ZUNB 4TMVA 2REXB 4MRVA 1WRIA 1LVGA 2XOKA 5JWHA 4A82A 2CXXA 1GOTA 1XEWY 2F3TA 3E1SA 2D74A 2GBLC 5FOVA 2CDNA 1PZNA 1QHIA 4JBXA 221PA 4OI1A 1WP9A 1E9AA 5KDDA 5JHHB 1XB2A 5DYIA 1BMFD 2DFNA 4JL8A 3HYRA 3NDBB 3ND8A 4DCUA 4JYCA 3THXA 4BPBA 4NCJA 1FX0A 2R6DA 3BB3A 3I62A 1QHHB 1T91A 3T35A 1RE0A 1U94A 1UWMA 2VSXA 5E4FA 4X8LA 1HQYE 2P5SA 4AKHA 3HVZA 4DC9A 3KKQA 1ZD8A 3ZVLA 5HZKA 4EFNA 1L8QA 4DLWA 4RFSA 5GADl 1DAFA 1HYQA 3DM9B 3MG9A 2BBTA 1KNQA 3ZJYA 3UPUA 1GWNA 4NYIR 1Z6YA 1BYIA 1PLLA 4Q4HB 3U7EB 2F1RA 3U7HB 3CKLA 5JWRA 4QM6A 1YQTA 2BJWA 1U98A 4LJ6A 2KE5A 1JR3E 3IDQA 1OXTA 2GAAA 4I1UA 3UMRA 3K9GA 2IS1A 3EA5A 2PX0A 1XPOA 2AXNA 4JLDA 1X8JA 1N6PA 1FMAD 5L3SB 2DYKA 5LD2B 3QXCA 1II0A 4MDFA 1QRAA 3TVDA 3UWOA 4CDGA 3QXHA 3HWSA 1HURA 1DAHA 4YTNB 4KFSA 1HT2E 2JATA 2ODBA 3K9HA 3CWIA 1E9EA 4ZHOA 5BYKA 2FFQA 1G3QA 3CLVA 3X1ZA 1IHUA 2EYUA 2ATXA 2ZJZA 3ASZA 3EARA 1QHGA 4BLTA 2NZ8A 2TMKA 1Q3TA 2AXPA 3L2OB 2VBCA 4KODA 2WWWA 3SU8A 4AKEA 1WB9A 2A78A 3AEBB 3WP1B 1Z6XA 2VHTA 3QKUA 4Q21A 1V8CA 2WWIA 2ZRCA 3AVVA 2QNRA 2G3YA 2VEDA 1OPXA 3NBZC 1HE8B 2B7BA 3AF1A 5HTKA 3B8HA 1ZNYA 1N6LA 1J7CA 2AX4A 1MRSA 3T1VA 2L0XA 3LVQE 3JZMA 3DL0A 3P4YA 2RKOA 1Y63A 5AUQA 4HATA 1NIPA 4TLAA 3MMPA 1TEVA 2QQ0A 2X2FA 3M6AA 4OK3A 3K70B 2JLZA 3R7WB 3THYB 4F4IA 3HP1A 3K1JA 3RNLA 4QNRA 4BRUA 3BE4A 3Q7QA 2BVNA 4P4SB 5D3MB 2EQBA 4B35A 3DWGC 1VYTA 4CRWB 2RGNC 3CR7A 4Y0AA 1CJMA 3OHMA 5DH9A 2XEXA 1OSNA 4BFVA 1G7TA 4O3MA 1M7HA 2QM7A 1UBGA 4DLVA 1VG1A 4HDCA 3RDPA 1CU1A 2C99A 1NSTA 5EE5B 1T3LA 5FTKA 2QAJA 3AF2A 2XX3A 2BIFA 3GJXC 3HJNA 1L5PA 1TADA 4QHSA 3U2QA 1QF9A 4C3ZA 4BFYA 2WV9A 1DBSA 1G4AE 1NN0A 3FMOB 4C2TA 3W34A 2EW1A 2V1UA 2ZROA 2QBYB 3EIHA 5DHAA 4R7ZA 3IIMA 1DTSA 4IFBA 5KSOA 1XXHB 3NVWA 1T3SA 1XMJA 4GOXA 4B2IA 4MUAA 1H8HA 5CDFA 3K0AA 1QF6A 1XCMA 3JVVA 3UANA 3RS3A 3WXMA 3B60A 5IK2A 4US2R 5P21A 3MJRA 1BIFA 4PC7A 4PQYA 2HYIC 2QTVB 721PA 1AKYA 1AKEA 3K53A 1GL9B 1G20E 5GXGB 1ZM4A 2WU2B 5AUNB 1QZXA 1TQ6A 3AUXA 5B58C 2FF7A 5HZHA 4WA7A 1A5TA 1SVKA 1BS1A 4A6XA 4CEJA 2G1KA 1OKKA 2J0SA 3EZ6A 4BGDA 2CU3A 1J7KA 5UKDA 1Q3HA 3AKEA 4HZUA 2ZR0A 3EW9A 2BCJQ 4AK9A 3OEEA 5TY0A 1XTJA 1Z0DA 4ZDWA 4QJ4A 3UG6A 3QXJA 1O87A 3T1QA 1OB2A 4X8HA 1FPMA 1KK3A 2C9YA 3A58B 4KLNA 1EESA 1OHHA 1YHNA 4M1WA 3CH4B 1F2UB 1E94E 1DAIA 1NLZA 1A82A 4HLUA 4F92B 5KNDA 2AKYA 3DMNA 4OI2A 5JECA 2W58A 1R2QA 5ANRB 1T3HA 2O8FB 1CJUC 4XWKA 4LUCA 4BLRA 1G9XA 4OK5A 1W36C 4U7DA 1FUKA 1IXRC 2OAQ1 4XIGS 3PVSA 2IWHA 3ZYCA 4EKDA 3WHLA 2WJYA 1U2RA 3FHCB 2XSZD 1MABB 4DZZA 3EX7C 3PEUA 2MSEB 4LOAA 2OCPA 2BEKA 2D62A 4ZOHC 2OFWA 2ZE5A 4FMCF 1Q22A 1JJVA 4D4LA 3TNFA 1FRRA 3SQWA 4DDVA 2FSGA 3CRRA 4A0FA 1JPJA 1XD2A 2QAGB 1KO7A 3Q72A 1US8B 1N6OA 2CK3D 3MCAA 3UWKA 4M1MA 5AJVB 3VR5A 4FMDF 2A7QA 4JVLA 4IEEA 5L3RA 4YSYB 2JIZD 3E5HA 3SZRA 2A2ZA 4TT3D 5E95A 1D2NA 3RRZA 2ZJ5A 1GITA 4ZI3A 5F9FA 2VP5A 1DELA 3W5JA 3EIEA 3A6PC 3AB5A 821PA 2BMFA 2ZRLA 4QFMA 3VMFA 1FQJA 4F38A 1NYQA 2WJIA 1GRQA 3AM9A 4PAOA 1P9RA 4WZAE 5FPTA 2JEOA 4NH0A 3TAHA 3I5YA 1GDDA 4EJSC 2PL3A 2D7CA 3ONWA 2ZIAA 1GRNA 4B6FA 2ZI9A 1NY5A 4C0QC 1H65A 5L3QB 4LJ4A 4Q4LA 1IOZA 2VP0A 3ZQJA 1JR6A 1KI7A 1SZPA 1PUJA 5FOTA 1FFVA 2SHKA 4C2UA 2C77A 4JIMA 5HR5A 1RFKA 4Z1MA 2IL1A 2CJWA 1Q44A 2IF0A 4LBWA 4PPQA 3TMKA 1U8YA 2YYZA 4W5JA 3U6KA 2CJNA 3EUB2 1ZM2A 1DOIA 1FUUA 1SF0A 1N6NA 1AS2A 1IY1A 3GJ5A 1P62B 2P5TB 5DISB 1OIXA 1W44A 4ESVA 3Q3JB 4BLSA 3PUVA 4EQ6A 2QN6A 3PUWA 2ZVPX 3P27A 4NZYA 2BKUA 4I1VA 1CR1A 1EWRA 4TYYA 1DOXA 2ZRDA 2A5GA 2ZI4A 1R5BA 3Q85A 2OE2A 1RJ9B 3FPAA 2WU5B 3B7GA 3FWYA 4ZPXA 5G53C 8OHMA 3TUIC 3TSOA 5H8WA 4FCVA 1R10A 3L43A 5E7MA 2A30A 1W7AA 1SXJD 4MRRA 3AE8B 4B3FX 1VIAA 4PTLA 3NVVA 2Y5CA 1JXOA 4US9A 4PZYA 1AZSC 1M1YE 2IYTA 2ZR9A 1ZMXA 2WWHA 4IDQA 2N0SB 4Q03A 3AM1A 2N46A 1LF0A 4PSVA 1XWIA 2E9SA 4D4MA 4E07A 1IQPA 2B6HA 2GCOA 1KJZA 3EPJA 4QRHA 1ZCBA 2ZPTX 4TL6A 5FPSA 3BK7A 3AE9B 2YC4C 1RYFA 3IBYA 3KUDA 3DOEA 5JEDA 2M19A 2V6JA 1P61B 1M74A 4GDFA 2HT6A 2REBA 4UQOA 3RS5A 3AGPA 4O0MA 4P4UA 5FL7A 2VP2A 2ZI6A 3NIBA 3A4LA 2ZETA 4A4DA 2IYVA 1P2UA 1OQRA 2N42A 2ZS8A 3AVOA 2JJ2A 3QF7A 4KV9A 2CVFA 3OIWA 3A36A 4Z1MD 1FO4A 2C78A 2P0EA 3BBPA 3GMTA 3RWMB 3VNVA 4B44A 4CF7A 5SZKB 3FB4A 4US1R 5AJWA 5F2EA 2FGJA 4LBYA 4B32A 3WMGA 1U8AA 2DHRA 1JR3A 4EPTA 3EAQA 1XTRA 4H9GA 3IO5A 5J40A 2WLBA 4TQUS 3AVXA 4B43A 3ASYA 1NVVR 1WBBA 3CNNA 3LBIA 4M9XA 1GSIA 2KJQA 4LV5B 4Q47A 1KI4A 4WIAA 1TEXA 3FGNA 4LYHA 3W90A 4B75A 2C9CA 3MAAC 3QOFA 3PXGA 1LFDB 2P67A 4HLCA 4FXPA 3AVPA 1TPZA 5KUTA 2ZRJA 2F43A 4PHTA 3VRAB 1HTWA 2GXQA 3SFDB 3PFIA 5H1YA 2PMKA 3WRXC 4CVNA 1FW6A 2BWJA 3DEFA 1MO3A 1E2JA 4HAYA 1YJ5A 3EZ7A 2JJ8A 4HZUB 3QXSA 4BLPA 3BD9A 4IXNA 1NBMD 5KSZA 1CJTC 2WTUA 4BRWA 1JWAD 2Z0MA 3THYA 3PENA 4LJ8A 1YU9A 1G5RA 1IN4A 3TW8B 2X1VA 4KCGA 1SHZA 1EFRD 2F9LA 2GRJA 2FGKA 4RD1A 4QGHA 3FHTA 2RHMA 1KMHB 4KYIB 2LKDA 1ZM9A 4USAA 3KJGA 3QI2A 4N3NA 2CLDX 1RRCA 3AMZA 4KJZA 2L83A 4P32A 1PVOA 2H89B 4TTRA 3P20A 2W54A 2E87A 4Q4JB 4TMXA 1HT1E 2GDJA 2ZSAA 5AJZA 1ODFA 5B64A 3AP2A 3I73A 4PAMA 1SKYE 4F7WA 1OFUX 3LW7A 1OXXK 3QF4A 4RJLA 1PLKA 1JAIA 1TU3A 4HAUA 2QORA 4OHVA 3NKVA 3C16C 2AK3A 3P4QB 1W49A 2CHGA 4IKEA 4ON9A 4BQSA 4AKIA 4RKEA 4GSYA 1TU4A 1FQKA 4IW3B 3CH5A 1AGRA 1XLPA 4MA4A 2QIEB 1UKYA 4ZDKA 2BS2B 2FWRA 1W4BA 3EWSA 3P4SB 2WMOB 1E2DA 5CB8A 5FUYA 2BHRA 2IF2A 2R8RA 4GMDA 2RCNA 1D2EA 2AX5A 3NVZA 4ESHA 1G17A 2Q9BA 1GFIA 4PR0A 4UNNA 3TQCA 3ZGXA 1DARA 1ZXIA 1MOZA 1GKYA 5FOWA 1J8YF 2K9XA 3AECB 1S1MA 2VHUA 3KXIA 3MUFA 3CPEA 2V54A 3HPQA 3B9PA 2QM8A 4K46A 5DYGA 3GP8A 1ZM7A 2R2AA 5BWMA 4HSEA 3KQNA 1QHNA 5BXQC 3K9LA 5CM9C 4WBSA 2NPFA 3KXLA 1NLYA 1Z06A 1W1WA 2ZAMA 1DEKA 3KKOA 3HPRA 4GPTA 5SZHB 1XCGB 4NKRA 4RD4A 1NMXA 2R65A 4S2EA 2F7SA 1R0ZA 2HEIA 2BM1A 2PLFA 4OL0A 2IXFA 2ZE7A 1UPTA 2BOVA 4MYUA 2DFTA 1LS6A 2IYQA 2OBNA 1XMVA 2E1RA 2YOGA 4JBWA 4UJ3A 1JW9D 1KNXA 3SFEB 3GCGA 3CRMA 3GLHA 4OKSA 3EPLA 4ITKA 4CGZA 4HAWA 3CO5A 1WDTA 1G8FA 5HKKA 2QG6A 2RGBA 3KB2A 4AKGA 5B30A 1SVLA 4RCZA 1OH5A 2BT6A 1F48A 1X6VA 2YZ2A 3X1WA 1KKMA 3EC2A 4IVQA 5EQTA 3SYKA 2J45A 4RD6A 1FX0B 2B8TA 4BECA 4E5UA 1AGPA 3W5VB 1O3YA 2A5YB 2DFLA 2OLJA 1W4AA 3FC4A 3S1AB 1R4AA 1AS3A 2V1XA 2W55A 2QGZA 1RRPA 1KTVA 4Q5IA 1C1YA 2YHSA 1KI3A 1WBDA 4EPRA 4P3YA 1VMAA 4DHEA 2EVWX 4G1UC 4B2LA 2RAPA 1E4YA 2CLCX 3KX2A 1OFIA 3W8RA 4W9MC 3BFXA 5DO9A 1OLOA 1JAHA 1E79D 2JAQA 2GEUA 2GILA 1XZQA 4ACBA 5FR2A 3R9XA 2GXAA 5KSPA 4Q1DA 4CEHB 1J2JA 1TYGB 3ECCA 1YQ4B 2ZS7A 3SDZA 4JMPA 4AI6A 3IHLA 1E0SA 4K81B 1N5JA 5AK0A 1W5SA 4A0GA 4QHYA 4AURA 5C18A 3W5IA 2VL7A 1EFUA 3ZD6A 2WSSA 1NL3A 2FSIA 2ORVA 1BYUA 1VDVA 2RGAA 3CRW1 4G5GA 3AEGB 4HB0A 4WZBE 4HUTA 3I61A 3B1ZA 1SXJB 1N0VC 1XEWX 3N2IA 1Z2CA 3A8TA 4QGFA 4IJMA 1XU4A 1XDBA 3TJZA 5G5GA 2PJZA 2JCSA 4DCTA 4NMMA 2ZAOA 4M9QA 3HR7A 2OBLA 1MO5A 4DRZA 4ZI2A 1AWDA 2GWHA 3RS2A 4Q7MB 4YXDB 2OAP1 4TL7A 1A4RA 4IOMA 2XGJA 1L6VA 4OHWA 1JROA 4DB2A 1ZOYB 2PT5A 4YLGA 1NG9A 2ZYUX 2GKSA 1KI6A 4JLPA 3AE4B 1VG9B 2CCKA 5FH9A 2W2XA 3VR6A 3BB1A 1ZC4A 1AZTA 4QJ3A 5BN3A 1E6EB 3P1MA 3BFVA 2GHIA 2YOFA 2PX3A 2BS3B 2IYLD 1HA3A 1OJLA 4OI0A 3AE5B 3OIVA 4MGYR 1T8UA 2ZRIA 1Q21A 3EPHA 1Q12A 3QKSA 1W36B 2VLIA 4OHZA 4PZLA 3KJHA 4MYTA 4NYIQ 5IDVA 1JWBD 1RW4A 5KTYA 3VR9B 2W2VA 2WKQA 3DOFA 1U9IC 2MMGA 4EJSB 1UBFA 2ZANA 2N1BA 2C96A 5E3HA 2EU8A 3RS0A 1VCNA 2NO0A 4MGZR 4EAQA
chains in the Genus database with same CATH superfamily
4WBXC 2YINC 9ICMA 4S1PA 3CW8X 1KTIA 4UZEA 4F46A 3KG2A 3OM0A 2GHTA 3ODGA 3G1UA 4M7OA 1Z63A 5KVVA 1Z7BA 3GCZA 1HX7A 3KM0A 1KK1A 5BRNA 4NE7A 2QRJA 2FY8A 3C21A 3QVKA 4PSKA 3T4EA 4W8GA 3SSAA 3OJOA 1UDAA 2MSKA 5I3ZA 4F06A 3SDSA 4IUYA 1SUEA 2P6UA 2D3CA 1JU4A 1SXEA 4PX2A 1NUUA 3K30A 1YR8A 5CFMA 1IGCA 2XGMA 4AAYA 1E2FA 4Z9AA 3L7DA 5KFQA 2I3DA 1ULZA 4I2IA 1POXA 3WB1A 4Z6KA 2GZ3A 2VDUE 3OT1B 3A7EA 5A5GA 2BEVA 4UFNA 1Z38A 3HXPA 5DTJA 4KDEA 4EBCA 4FN5A 3A1UA 3S2UA 2IIVA 3D3NA 3V7JA 1V9LA 1MGPA 3WX0A 3CJTA 3B6EA 3ELBA 1K6MA 2HA2A 1CE8B 1EGAA 1AK9A 4UQGA 5EINA 5DLGA 1CDZA 2P4UA 1PJZA 2VP6A 1IM4A 2AOWA 2C54A 2V9PA 2QTRA 4ZO7A 1N92A 4FFBB 1FOEB 3TQTA 3PUZA 1ECJA 4RWEA 3UG7A 1A9TA 1NW3A 5HFNA 3HLTA 4TWIA 1TTQB 1NGSA 1R4MB 4QBFA 4Q1BA 4YNBA 5BMIA 3T7SA 2JI7A 3Q3GE 1KU0A 3PHJA 3UATA 4OJTA 3GIIA 4KR7A 3HO1A 1E1QD 2HK7A 3QPDA 3QVXA 2N1VA 4TZ6A 3Q3JA 4LZPA 3K71B 1AB6A 4GEGA 2IW1A 2GF2A 2HTEA 1Z0AA 4DJFC 4EHJA 3LP5A 4GDMA 2RPQA 4RKYA 4DMKA 2E4YA 2H5IA 3UPTA 3MFIA 1ZJ5A 4HQRA 1AX9A 4ZXPA 3ADDA 3N07A 1G18A 2RHHA 3GYBA 2HCTA 4OXRA 4HDRB 5FUVA 8ICOA 3OM9A 4DOBA 4OHUA 4Z54A 1S0NA 3WGQA 2XUDA 1ZQOA 5I8PA 4CR6A 5D1NA 2GA9A 2QLFA 2I2DA 1YR1A 1QNFA 2YN4A 2LGJA 3DOUA 4R2LA 4KFCA 1KMMA 5EG5A 2C1XA 2L2QA 4Y98A 4HFRA 4C5BA 5IWCA 4YI5A 2HHSA 3MQ4A 2VK8A 1L0VB 2PRKA 3QKIA 3N1YC 1V39A 3F74A 5DG8A 4BASA 3JVIA 5IG2A 3RIEA 3VO1A 1NDDA 3FPFA 5G3ZA 3T5DA 1P3JA 1YRYE 4D9MA 3I37X 2GN1A 1IMJA 4C4ZA 2PS1A 4Y2PA 3PHHA 2E55A 1X7XA 4OXYA 3VZSA 4JJ4A 2EELA 2V4ZA 4V38A 4UOEA 2XWSA 2FEMA 1U49A 1EFTA 3RSHA 1RWOA 1PJ3A 2IHKA 4IIXA 2O8CA 1TIFA 1S9FA 3P9CA 2Y0EA 2WY2D 5A4KA 2IEGA 2CLOB 5FYQA 4MUFA 3U44B 4MPTA 3I52A 1JHUA 3DKKA 5B3KA 1T9GR 2WSSD 1M8FA 4F5YA 5K6AA 2D3BA 4HN4B 3ZY6A 3RTCA 3B5IA 3L7LA 1A69A 2WJWA 3I39X 2ERXA 5J2HA 2JK0A 2NAFA 2WZCA 4IQFA 4M89A 3JATB 3QELA 4ZYZA 5HKOA 2V9WA 4KN9S 3ADPA 3ENZA 1D2AA 4YRLA 3EIQA 3FCSB 3H7AA 2BFDA 4M0UA 2H1IA 2HZBA 3ENVA 4MGZE 1QH1A 1WIWA 4OXXA 2SKEA 4RHXA 4UDOA 1M6EX 1XN4A 3R6GA 5JC1A 4EQ6B 2E49A 2D00A 2HQOA 1AT1A 5IM5A 4ME6A 4TTVA 1CJCA 3EHDA 2IODA 3MUNA 1OXSC 1GKUB 5KTNA 4N7BA 5CDFE 2WYVA 2O20A 3BT7A 3R09A 4A0HA 2GEBA 1L4EA 2LYAA 1NFRA 1RNLA 4B4DA 3QNMA 1NYTA 4D57A 2C7RA 1I4DD 2EJBA 2Y8EA 2GEVA 5KJ6A 5MF6A 4GR9A 4RCYA 3LTNC 1KI6B 4HLEA 5G1OA 3PX0A 1CUWA 1MA3A 4X84A 3C1YA 2FV8A 5EERA 3V7NA 3CMCO 1HDRA 2AUTA 2X14A 3C5CA 3JPOA 5HCUA 5AW1A 1JEQA 1AXRA 3C1TA 4K1RB 1TX4B 5CDSA 1JQ5A 3OEED 1DV1A 5EGNA 3AE3B 1Z4KA 2PIAA 4KN8A 1VYHA 5GMVA 4PPGA 1FMJA 2Q7OE 2FZ4A 2O5VA 4GWGA 2NTEA 2B7CA 4P33A 3WIUA 5LQAA 2EL7A 1PVDA 4OOEA 1E9RA 3A27A 4DFJA 2C42A 9ICVA 3F67A 4HQNA 3EC7A 4BQPA 2ZQ5A 3OZBA 4HD8A 1SE2A 1NQUA 1XWFA 3O9MA 1ZQFA 3ZDXB 3IC5A 1A9XB 4RTJA 2MRPA 2KX7A 1K6XA 1Y3DE 3VBCA 3UMYA 2P90A 3HX0A 1GZUA 1RRFA 4KEAA 5ALKA 1ZQTA 1IHYA 3UXNA 4GKKB 1N8SA 3U7ZA 3NJRA 2WE7A 4LJXA 2JJYA 1DUSA 1VCOA 3JWHA 2A9FA 2R4TA 4RTLA 1OWMA 3CWQA 2J9RA 4UEOA 8ICLA 2FXIA 1YOVA 1YJXA 1JWAB 1ORVA 2KQ4X 1EB8A 2CUZA 1S1QB 3LC2O 3GE3C 4LHXA 5AM5A 3WCQA 4JHLA 4KXYA 4IVPA 1QP7A 1QCYA 1T24A 3RR8A 4BNXA 1FFSA 4BMVA 4N40A 3U4GA 4P8RA 3BIWA 3T5GA 4F3YA 4X0EA 4L0DA 2ZZNA 3IV7A 3JQDA 4YXJA 4K5QA 2HRRA 1PP4A 2QDKA 2NG1A 3GZ4A 4K4GA 2UAGA 3PFHA 5F98A 3N28A 4UUNA 2ZSFA 3B08A 3QEBZ 2AN5A 5AVRA 3A4RA 1OZFA 1XOIA 4FBGA 4YJKA 3RT7A 3VQTA 1M1UA 1K5GA 2O2GA 3BFKA 4LVCA 3GRZA 2WG1A 1C7YA 3HO6A 4QPDA 4JLJA 4RDXA 5IJ9B 2WPDD 3PXXA 4GG1A 1UWXA 1IVSA 2VS1A 3EFBA 3TFRA 3LUAA 4GUDA 3ICEA 1EX6A 2X8JB 1HEZE 1I4HA 1CV2A 2XCPA 4BN4A 3APFA 3L8ZA 3I58A 3R2JA 3FKYA 2IZOA 4GM1A 3GLGA 1IPFA 2KBFA 3EXHC 3KUCA 4LE2A 4UFOA 3R8CA 4C6TB 4NFYA 2QPOA 2E5SA 4RVGA 2BCRA 2ZJOA 5HFJA 3VR4D 3QHPA 2FJ0A 2V96A 3PNLA 2X0NA 2GKOA 2LV8A 4NC9A 5HPYB 2Z8YM 3IDOA 4ENSA 2IT1A 3BCHA 1G8HA 2RC5A 3C0KA 4H7HA 3EH1A 2R9VA 2RARA 2W6JD 5KFVA 2K1FA 4US8A 3Q3FA 3RFFA 4E5MA 4UD2A 1ZQHA 1ETUA 5FDFA 4DA7A 1Q7CA 3RH4A 2P3SA 2X4IA 4G0VA 2PBFA 3I83A 1QLJA 1S2DA 2PH1A 4B73A 2W11A 1WR1A 2N3ZA 3FNRA 3IVMA 1WUIS 4X3CA 4X95A 1RVDA 4UCXA 1EBFA 4KX6B 3OPYB 2AFHE 3QVGA 4E11A 3JALA 4IWNA 1XLNA 3HVKA 2HLDD 8ICRA 4DT1B 1GG2A 4KXMA 2PGOA 2J52A 4C0WA 3J9CA 3OU7A 3T5AA 3TD9A 2P2ZA 1YRAA 4COKA 1KE2A 4YGYA 2IHTA 3NDIA 1NJ1A 1NJ8A 1R66A 3SHWA 2JHPA 2BR5A 4ZC1A 2OCBA 5KTTA 2BGRA 1JKJA 1XCOA 3VNQA 1ZHHA 3WC4A 3SYTA 1O0SA 4YRRA 3RU2A 3K20A 3MTGA 2B4YA 1T4CB 5G2NA 1T1SA 1U02A 4RXTA 1VZ2A 3LQRA 4FEAA 2B5WA 4BFSA 1FPYA 2MAXA 1GKIA 5CEEA 1P7DA 3GNLA 3GLFB 3LVRE 5A3VA 2VSOA 1ACJA 3H16A 1LJ8A 3LYSA 1ABBA 1QONA 1NONA 1G2PA 2UUCB 4QT4A 4RVSA 1W85A 4UATA 1Z75A 2P7IA 2HBJA 4DL6A 2W6NA 3TS1A 3BKWA 1SE4A 4MWGA 5I9BA 4EO9A 3SLKA 1P1AA 2F8SA 3FFBA 5FPYA 1Q1QA 2YN2A 1GDHA 4P2GA 4HY3A 2ZLBA 4UC0A 3I32A 4KBYA 5AI9A 4AUEA 1YZQA 2ZB7A 1I0LA 3OX4A 3KEFA 2LR0A 4S0ZA 3JR7A 3IOYA 3DE6X 4NECA 3NHRA 3ZI4A 2NUTB 4Q16A 4B5LA 4WZBA 2P4EA 3ILVA 4BAXA 1WY7A 1WE6A 3BRCA 1M66A 2NTNA 2JAUA 3S5UA 1WGHA 1UDCA 1M1ZA 2JVJA 3R8BA 4FLHA 1DMSA 2XY7A 1J42A 5TF0A 1F9EA 2PDAA 4B8WA 2XY5A 2HREA 3T34A 4M9SA 4S0XA 1SGWA 3KHGA 4D8VA 4HYTA 5SYAA 4FYXA 2O2IA 4KMSA 1PGXA 4RD2A 2AC7A 3RYTC 3WFIA 4QM7A 4IJQA 4EWLA 4PYMA 1Z5NA 1TKYA 1R8SA 1C3OA 3UFXB 1DJNA 1RI1A 2DGDA 2NZJA 3EMDA 3M6LA 2VG8A 3E58A 1KP9A 4LPKA 2DZJA 2MIIA 1E2PA 2DLDA 4Q4HA 4LF9B 3ZYYX 2BUCA 5JRZA 3JPSA 3DC2A 1X7GA 4D41A 1T1JA 5EHZA 5ALFA 1XJWA 2PXXA 3ZXVA 2Q0HA 4C9BA 4ZHPA 4PYOA 2PUHA 2R6FA 2QBYA 2PWAA 4GZ3A 3K8OE 3PITA 5BSTA 3TBKA 2P9BA 3RBVA 4JJ8A 3T5BA 1HH4A 5D6JB 2KS6A 5TX7A 1B15A 3TDNA 4B4WA 1WB5A 1XVIA 1S3SG 3RREA 3ZK7A 2HLNA 5CYPA 2LPEA 4FZVA 4OQNA 2ZM5A 3IT3A 4RIHA 3F1KA 4IHJA 1EFPA 4N76A 2WX1A 3EF0A 3UV3A 4PHGA 2XA1A 1QDLB 1DC7A 3RYTA 1UR5A 2NPIA 5AM1A 2A57A 3ZTYA 2Q6TA 1A5ZA 5K3BA 1MPEA 4G4SO 2MA9B 3CM0A 1DX4A 1ESCA 3BGDA 5K8UA 4MZDA 4RPKA 1JQJC 5TDHA 1KH3A 2FUEA 4KLMA 4YROA 2AFIB 2ZWIA 2ST1A 4YMOA 2D7DA 4M1YA 3NAGA 2HJ8A 2WWFA 1X9GA 2RHBA 3LDFA 3MWEA 3UAXA 3A9KA 2FPRA 4HZGA 2I1JA 2EBFX 5JPCA 2D4HA 2FEPA 4PT5A 1TQHA 3LD9A 1GTL1 1JT2A 2V6BA 4Z86A 3OZEA 3U3DA 4BLOA 2EGGA 2KFZA 2HHJA 5B1EA 2K89A 2WF6A 1I3MA 2O57A 1P18A 3ICCA 1RM3A 2RH9B 5EP3A 2WVJA 4B4UA 3TDKA 2YMPA 2GN2A 5BQOA 1MBZA 2JZCA 4A10A 2G9UA 3E22A 3B3FA 2QSUA 2DLCX 3NHUA 1QV6A 4F1WA 1KSFX 2PU7A 2P2SA 3OZUA 4TM7A 2Q4EA 3G49A 3TZ6A 5JEEA 8ICPA 1CC1S 1WCWA 3T3EA 1PJ4A 3VC2A 3ZDZB 1Y1QA 2C8LA 2CNKA 5JO9A 2GBLC 1SK8A 2FUG1 3HVUA 4JU8A 1E9AA 2ZT7A 4BN0A 4L50A 2R6DA 1U94A 2QB5A 2B3AA 1EFVA 3WLRA 2FLLA 1WEKA 1GWNA 2PSDA 4OQEA 3IOMA 3F5EA 2AXTU 3NATA 4B09A 4OJ5A 4KQIA 2HR1A 1BG6A 1U3UA 1WU7A 4I1UA 4UM5A 3HCCA 3G89A 5EZYB 2DUWA 1MC4A 3AJRA 4ZYNA 3PGKA 4GXNA 4CDGA 3H2ZA 1IOWA 5EWFA 3C3JA 2DUYA 3F8SA 3HUDA 1LRJA 1JIJA 4TUQA 4RU9A 2Y71A 3WLQA 2N7JA 3R7QA 2QL9A 2EZZA 2I38A 2YIMA 3WB9A 3JZMA 4TLAA 7ICSA 1C4AA 1X92A 3I6IA 1JMYA 3THYB 2BH2A 3HP1A 2WXNA 2YMMA 2C4UA 4KREA 2FMPA 1XZKA 1VE1A 3GRRA 4JI1B 2HOFA 3EYAA 3RDPA 1V47A 4C3ZA 1L5PA 1SN7A 8ADHA 3EQ9A 3U0VA 1R88A 3L6CA 4R7ZA 3R8XA 3NVWA 1T3SA 5CDFA 3PZ7A 2OVFA 2O0LA 3H4BA 4BQFA 1WGYA 3WISA 1G20E 4CL8A 5K03A 4QUJA 4DYVA 3VOSA 3TGLA 3NMUF 4DJEC 1Z2OX 1DAIA 3H40A 2ZVOA 3RTDA 1T3HA 3Q40A 4QULA 4D4HA 4BLRA 1X15A 3QEKA 5FNVB 3X1KA 1IXRC 3ZYCA 1U2RA 4Q37A 4OX9Y 1TZ1A 3LOUA 4WJ3B 2CXUA 4DDVA 2ZUUA 2QG9A 5DHSA 1L9KA 1EFAA 1D03A 2PH5A 5L3RA 3C2MA 2C5BA 3L07A 5KNDH 2YWDA 1PNQA 3W5JA 3TXYA 3A6PC 3BBLA 3FYUA 3LZ6A 2GNAA 1JJFA 1UBUS 3RS8A 3B51X 3AIOA 3V6LA 2ADMA 4MOWA 5HR5A 3U6KA 4QDKA 2KKPA 3GPBA 3P8ZA 5E7QA 1K6EA 3Q3JB 5CHGA 1SGHA 2XF2A 2H1VA 4KMUA 1E4OA 2WU5B 1VJCA 3BQTA 3TSOA 8ICBA 1T0IA 5IDXA 1X6JA 2PWYA 5JNSA 4GKJB 1R4NI 3KHTA 1IZYA 5D2MB 1FYFA 3AE9B 3TIVA 3VJRA 2M19A 4DRXB 1WO8A 3NIBA 3COWA 1U7XA 2H7CA 2ZETA 5TEVA 1P2UA 1U3FA 2PKEA 3RWMB 1UQVA 1FCCC 3VNVA 4Y7DA 4CF7A 3WMGA 5AFSA 4RA6B 4U7TB 1FUIA 2WLBA 4R8KA 1TAHA 4IH9A 1V45E 3S2AA 3VR0A 5FI3A 2KJQA 5IC6A 4LQCA 5KWVA 3EFOB 5DNUA 5E1DA 1M6HA 4E0BA 5FWDA 2P9ZA 4V1CB 4WJLA 4B2YA 2I8CA 1RM0A 3UOWA 1WW8A 1NBMD 4X92A 4NY8A 4NJEB 5JYEA 4W5TA 1IN4A 5CRXA 4U39A 4NAUA 1C29B 4WOBA 2VHWA 4OJPA 1DKRA 1ECPA 3SX4A 3QZUA 4CV2A 1DK3A 4N54A 5LLTA 1ODFA 1Q10A 3UGTA 3EFHA 4DLKA 4UM7A 3I3OA 3OLYA 1CUXA 5I7FA 3WKAA 5JADA 3IPRA 4I6NB 3O3OB 3SEIA 1SKSA 1QB7A 3DL4A 1SJHD 2E0IA 2R8RA 2IITA 1ICIA 3M33A 1U7DA 3JQ8A 2WXMA 5C7IO 2HU5A 2QD5A 3LP6A 3FVWA 1GKYA 1HR0B 1CUHA 4NBTA 3AECB 4MR8A 3CPEA 4FFVA 4FZMA 1RLOA 5BWMA 3IV9A 1W1WA 3KKOA 3HPRA 1TXGA 4NKRA 2MYPA 4UBBA 3B9RA 1ISJA 3REQA 1L5LA 3C6MA 1T1IA 3SHTA 4WDRA 3GROA 3DHEA 4ZRDA 3MAGA 4E5UA 4BNGA 1OGIA 4DVJA 4BQNA 4B2LA 4EE2A 2RAPA 3BFXA 2P1DA 3NYQA 2NW6A 2GILA 3VDRA 3O13A 3DONA 3GMSA 2IOFK 3IT4B 4B6OA 3RBAA 1NF8A 1EFUA 5FWNA 3ZD6A 2Y1FA 3UK0A 3W7VA 3UKOA 1N0VC 3H8VA 4R3UC 3WLOA 5T4FA 1JDNA 2C9DA 4Y1FA 4XLZA 2GWHA 5A5FA 3C6XA 1SL1A 3B1KA 5LA6B 2REQA 3A2NA 5D5HA 1UCFA 4TS3A 3AE4B 5CA0B 5FH9A 3TFSA 2Q1UA 2XYGA 2LRWA 3BB1A 3P1MA 1YKGA 3DVRX 1HORA 2P77A 3EPHA 2Q1XA 1M3SA 5KG5A 5JQWA 3KJHA 2YZMA 1JWBD 3VYWA 3RU7A 2W2VA 5TZVA 2QY6A 2X0RA 1ILEA 4K0RA 1MU0A 3PE3A 5E2IA 4J7AA 2ZUEA 1QR2A 4KSBA 3KFVA 4NYMQ 1HZZC 3GILA 4YJDA 3T52A 2WD8A 3EGVA 4NOMA 3N70A 2ZNVC 2HXGA 1M2HA 1HQDA 4QYSA 1QYWA 4D44A 3OPNA 1CNFA 1WR6E 1YR2A 2G72A 3MAJA 3HU1A 2OO7A 1E2EA 4DUYB 3GJSA 3SCZA 4LHWA 4QBGB 2IKSA 1FC0A 2DKZA 1E5XA 4KHZA 1P0FA 3K94A 1I1OA 3DOWA 5AKZA 2W3SA 1X0VA 4NH4A 4NYMR 4J0QA 4FEYA 4N7JA 2RRDA 4Q18A 4LGVA 4WJNA 4LY9A 4URZR 3ER6A 1C81A 5J2UA 3ZU4A 1FS4A 1CEQA 3SBOA 4I1YA 2WFLA 4NU0A 3T4UA 1KL7A 4Q3AA 2JJ1A 5KHAA 5EWGA 1RQ7A 1YVDA 2MYNA 1UD7A 4AF7A 2PTGA 2E6KA 5JANA 1AROP 3C3KA 2PTHA 4CU2A 6CHYA 4G0YA 4X5OA 1P74A 2BFOA 4KZPA 1EP2B 4MVJP 3VX4A 1YUBA 3DQQA 1H8ED 4G1MB 2AFIE 4B9VA 5BUQA 3PJRA 5IH7A 1P2SA 4LC1A 1K1EA 1CY2A 1RBYA 2X8LA 1Z12A 2HPHA 1ZLXA 1U48A 1F6WA 1GU7A 3V4ZA 5E4TA 4KH1A 4UXHA 3J81k 3REGA 1E98A 2C61A 5EKDA 2JGDB 4LZJA 5H70A 2RDGA 4GMHA 3GZFA 4QTUB 3WNCA 1JXQA 3IP7A 4E46A 3MC1A 1M0TA 5LM3A 1LRKA 2IH4A 1NJ5A 3AFMA 2J4XA 3AJ9A 1UQTA 1Y9ZA 1NTRA 2DAJA 4PC1A 5C0OE 4YO7A 1A70A 4RESA 1JDSA 3E9MA 1E5TA 3FYUB 3EFCA 2L7RA 1EVKA 5C1IA 4QEDA 4RPGA 3GC6A 3OESA 1X13A 1FTYA 5IMSA 3D59A 1D1TA 4HPPA 2X2OA 2BGJA 1I36A 1E0DA 2J9XB 2BVCA 4O8ZA 4DZRA 4I4LA 1G59A 2M1XA 5ILGA 2VSQA 3OPXA 2MSED 3KYCA 5D46A 1BXGB 4TTIA 3E6AA 4DSNA 1CUZA 1QCZA 3X2SA 1F8XA 4KKXB 5HCNA 2HW8A 1UPUA 5KFWA 3KWLA 3PF8A 8ICQA 4TV8B 1YI8A 4I55B 2VNHA 4RLQA 3AI5A 2DWPA 3GBVA 3GUCA 2IEYA 2VYNA 1N7JA 4N03A 4C0JA 3RUEA 4U2BA 3ANNA 1KAHA 1NN3A 1L4DB 3BICA 4BWFB 1W75A 1KGDA 4O5AA 1L6UA 1L7BA 4YCJA 3O8QA 2Q3HA 4KGRA 4O2BB 2C2OA 3HRKA 2QLBA 4GYJA 1VKZA 1BH6A 2LDXA 5BMVF 2PLRA 3MC8A 1OREA 1P7FA 3ZVVA 3RFUA 1T4GA 3U7FB 4BU0A 3OF2A 1PWHA 4QOGA 3PSTA 2VHXA 1TIBA 1VG8A 1G5FA 3E4DA 4ZJYA 2VO1A 1OXMA 4KB5A 2VR1A 3OUTA 3VH1A 3OEWA 1XI2A 2JBHA 4RLFA 2OC9A 2EXXA 3U4HA 4OJOA 5B2ZA 4AX4A 5L8VA 5I7AA 3L3BA 1MNAA 4IXMA 2B4TO 3KVVA 1QOQB 4ECZA 5CITA 4ZAXA 1V38A 2LCFA 4I9HA 1MIHA 4DXHA 4TL9A 3WAOA 1II9A 3OU6A 4X1IB 2VZ0A 5I8ZA 1HGXA 2AKAB 5BNTA 3GFPA 2BBWA 1VBNA 5FBHA 4MV6A 4ASUD 4EEKA 2FF5A 1ZP0B 1NPTO 1NJSA 2M17A 2JAOA 3W3AH 3NTQA 2Y6UA 2VDLB 3RB6A 5D86A 2IZVB 5HR6A 3L3FX 3PY8A 4X9XA 3WLTA 2G80A 2H88B 3I45A 1VHTA 3WO0A 5HQJA 2Z6QA 7ICNA 2C0CA 4XIJA 4MWZA 4P34A 1U0RA 3LUDA 1BO6A 1XXLA 1Z0IA 1ZAKA 2XVAA 3RJFA 4KLSA 1TM4E 4MV7A 3VR5D 4DGSA 2IO1B 1I9CA 3WGMA 2NZ2A 4JL9A 4KKJA 1ZK3A 2ZYHA 5D7NA 3N5CA 3ML8A 2YJZA 4OXNA 3AR7A 1KAGA 4A5SA 3PEYA 1CRPA 1UP4A 5EY5B 3JSVA 3PFCA 1CS0A 1U2QA 2XQIA 2JHGA 3SVTA 3W4IA 1F06A 3WJ2A 1JR2A 3T5HA 4YQFA 5AVXA 5BMGA 2VAMA 3C5WP 3QPBA 2VP9A 4TUUA 2PQ2A 4BGUA 3UA4A 2E4UA 4ZRPA 4JVSB 3W7AA 1MRZA 4QW8A 3NANA 4PPFA 5EXTA 2GJ8A 3C45A 3NGDA 3S2IA 4EGJA 3MQFA 3SC6A 4HGOA 1R8XA 9GPBA 1FRZA 2G08A 3ZRCA 2JLXA 3VUYA 1J2UA 2CVOA 1N1EA 1WETA 2YHIA 3OX3A 4DDGD 2PS9A 4W1QA 1LV5A 4PWZA 4GQIA 4QIWF 4C6TA 3IUSA 3Q69A 3T9LA 1BXRB 4PYKA 2B1JA 2GLXA 3V9PA 1T5OA 1NYRA 3AHHA 1GYQA 1I0ZA 1N5IA 2J9ZB 1CZUA 5C46F 2E1EA 4RSRA 2FPMA 1ZDXA 4X7MA 4REZA 4LZZA 1GD1O 3M5PA 4PC3A 5A9SB 3LOQA 1VP9A 2OO5C 3VSBA 1E7SA 4DC0A 2FUNB 4WGFA 3JZIA 5F73A 4H0NA 1VMDA 1CP2A 4CM3A 2J87A 2B7LA 1L0BA 3FSGA 3OVMA 1A97A 2JHCA 3ELWA 2OWEA 1I94B 2F17A 4NV0A 1S3FA 4WAAA 4EUKA 1SH7A 3DE4X 2H92A 3EAFA 2VJMB 1V16A 2AMFA 2ZPYA 2HK6A 1B7GO 2YVUA 4IOKA 4KZ0A 5KOYA 2KQSA 5HKBA 3E8MA 4UHFA 2RGGA 1KOLA 2CLEB 4WXEA 4XDCA 2Z43A 3AW9A 4BP9A 2QVCA 4DCJA 2I6FA 1AGXA 3H05A 1TVMA 4DQDA 4LF4B 1I2DA 4G85A 2CEKA 3MJVA 2XADA 1I2AA 5B58T 3BRQA 1PJ8A 4NPCA 2V3SA 3JVUA 3NP7A 3MHTA 3QJYA 4G50A 4PHPA 3BL8A 1QUFA 3CWZA 1NJ6A 4XARA 1YBVA 3F2CA 1AN9A 5JHBA 2X4GA 4EW3A 4YR7A 2ILTA 3OM8A 3NIGB 3BWYA 3ZS9A 4HNTA 1ZCZA 1HQKA 1PGOA 4OQMA 2AGPA 5K8TA 2B0CA 1Q20A 1CZLA 4YPFA 4MUHA 521PA 2RGNA 3Q3IA 1GILA 4JQOA 3U7GA 1G9TA 4CETA 3N8HA 4TKVB 1NJYA 2WE8A 1PJBA 2VK2A 4AVYA 3AEAB 3NQ41 2EFCB 2NXEA 4PRLA 2CNBA 2KWUB 3QOWA 5KZMB 2IXGA 3FBTA 5TLSA 3R2TA 4MEYA 1ZCFA 2Z83A 1TGZB 1NUHA 3OIYA 1N5XA 5K3EA 3R41A 3JASA 3MCUA 2PGXA 2KP7A 2YXLA 2X8AA 2P2DA 3D4IA 1E3WB 4KLLA 2A1UB 2BWES 3IN5A 3MTBA 3Q8MA 1GEGA 2OYSA 3FOFC 4IMIB 2FFBA 1NFQA 3V1KA 4WNYA 4GNKA 2WYQA 5DIZA 3LG2A 3Q88A 4G1BA 2CJFA 3DAGA 2BYTA 2UU7A 1I4LD 1NUAA 3Q7EA 3W9BA 4TTQA 3PXAA 3NY5A 4G63A 1THMA 3N9YC 1JFFB 1A0PA 4MVWA 1EQ2A 1KI8A 1N77A 1JIKA 3NLLA 1T0JB 3P4PB 1IWBB 4DNFA 2D1TA 4MA0A 1PG0A 1D8LA 2V7UA 5HFAA 5EN4A 2P7HA 1QLNA 3L8YA 1N0IA 1FNVA 3MNFA 4MUJA 4DBGA 3A9RA 1RBQA 5KYYB 5B4UA 2UYOA 3ZHVA 1XD8A 5IN5A 3KKPA 2JFUA 1TMYA 4B47A 4E74A 3K8ZA 4LY6A 3UWMA 4DR2B 3EOBI 1YWGO 4NJCA 5CFRA 1U9CA 4R2HA 1NY6A 2EARA 4GT1A 3W6UA 4CIAA 1MJFA 3UFBA 3RASA 5FF9A 5JH7B 5JSQA 2I91A 3EZ2A 1QZZA 4HYQA 1P0MA 5GOTA 2XGGA 2N7DA 4OJNA 1PK1A 4HNRA 1XKTA 2YTUA 1G21A 2R6CA 3SF8B 4U2GA 3TFOA 2SICE 3DZJA 1YQ9A 5FOXA 4RTRA 2A1TS 3ZDCA 4MV3A 3T5KA 621PA 1U0LA 1N5WA 3SNKA 3H86A 2DT5A 4RKFA 3ZLJA 4C7ZA 4GQBA 3COYA 2FVXA 1H9BA 3N8KA 1MJGM 3HBFA 1YUNA 4JI4B 1NW8A 5EYPB 4G2TA 4B6PA 4BL5A 4MGYE 2ETVA 2F8KA 1ZOIA 3P0EA 2DPXA 1X14A 1M4VA 3PJDA 3SI7A 2JJ2D 1L5YA 4KR0A 4H15A 2MYTA 3MWEB 1FXUA 4HXGA 4CCHA 3V4LA 4ZI7A 5CHVC 4JBYA 3MJ4A 1EGQA 1CE8A 5KTRA 3WVNA 1XEFA 5GJWC 1JH8A 2H1WA 2FPPA 3ZIMA 5CB4B 2PUJA 1Z4IA 1GNRA 4D2IA 2C1EA 4MITA 3GFOA 3PRYA 1ZQGA 1P4SA 2OCXA 4ED7A 2NUAB 1OLXA 3X43A 1B9RA 3OAWA 1JV2B 4QJBA 2ZAIA 4E03A 2YC2C 3TOZA 4HWTA 5D7BA 4EFLA 4UE2A 1BMFA 5JSKA 2PZLA 4R16A 4ONEA 3RNGC 1M8GA 4CIXA 2D2VA 1YL5A 4MYRA 1W25A 1X7ZB 1ZESA 1NXTA 2JGNA 1NVDA 5AJXA 3OQOA 1JE0A 1E7UA 1LBHA 2IH2A 1WGDA 1QAOA 1OY1A 3QTBA 4E3CA 1VZ8A 5EAIA 3NFRA 4ZVTA 5I5EA 4EB0A 3AJEA 3NBAA 4A82A 1JXLA 1D5XC 221PA 4I7EA 3OUUA 3NBMA 1ACLA 1RWQA 1T91A 4HWSA 4QFDA 1MQAA 4DC9A 3NWBA 4NU5A 2BR0A 3OCYA 5U1PA 2JFGA 4BB6A 4KE7A 4LJ6A 2HVIA 4BKMA 2R68A 1AMNA 4JIOU 4J9LA 1YZ7A 5D3IB 4YUYA 1PEAA 1KIFA 5ESRA 2XLBA 3JWEA 1WY5A 4KLAA 5B3LA 1WX8A 3EARA 4BLTA 1NU8A 4Z9FA 2VBCA 2BFNA 2CXYA 4F6RB 2Y5PA 2B7BA 1AY0A 4CDRA 2JB9A 4ZV7A 4PZPA 3LVQE 3P4YA 2EEZA 4R1OA 2FSUA 2C2BA 3CIFA 4W82A 4EJMA 3WR5A 4BRUA 3OJXA 3BE4A 1X7XB 1F44A 4MQ4A 1Z18A 2UYQA 4BFVA 1OSNA 4M83A 4O3MA 3ZIUA 3CURA 3OHPA 4JQYA 2FWMX 1SEBD 1UFOA 3PDJA 4XCVA 3WOHA 4N5MA 4FE3A 1FDSA 3TVYA 2KPOA 3K0AA 3JVVA 2AMVA 4L02A 4MROA 4IVNA 1QQ5A 1AKYA 1ZGGA 1L4BA 1SZDA 1VHQA 4CEJA 4BGDA 4NULA 1FW8A 5IIJA 3UF0A 1MI0A 2WUDA 3IL2A 1GY8A 4R1MA 1OB2A 1T2EA 2AKYA 2BFDB 2H2FA 1E8WA 2ICAA 4ED6A 4CV3A 3O6VA 1G9XA 3OX1A 1XLTC 4EKDA 2WJYA 3PEUA 3OLQA 3FBWA 1XO1A 3C7DB 4P0QA 4ZPJA 3UJPA 1SV4A 1EP3B 5JDIA 2FJ6A 4G23A 4EDFA 3H0RB 2A2ZA 2ZJ5A 2C58A 1LDEA 3DBHB 3QX1A 4QXRA 4X7BA 2UXCB 4F38A 3AM9A 4WZAE 4E33A 2YFYA 3DB2A 4RJ2A 3F5QA 4S1TA 3KOMA 1CR6A 5AVYA 1GRNA 1E6WA 5HF5A 5CA1B 4D0SA 1OI4A 1KI7A 3OWXA 2JH8A 5KL1B 1MHXA 1RXIA 3NVKI 2QLJA 2FQQA 2R87A 1CR1A 3NDJA 3GMIA 3PBKA 4JBLA 2C3YA 4IF4A 1E66A 2RMMA 3OFSA 5KX5F 2OV6A 3DWFA 2PGNA 3TTTA 4ALLA 1MAHA 4PG6A 1I14A 3HRIA 5KC8A 3C3WA 2V6JA 1P61B 3ZXYA 1M74A 2VP2A 4CKYA 4OUDA 1TRKA 2DYMA 1OWPA 2CVFA 5BT8A 3JAMA 4PIVA 2C78A 2HDOA 2QZZA 4NLBA 1QOPB 3BX1A 1E1YA 3IALA 1XN1A 4BVUC 2LIVA 1A5RA 1GSIA 3OLZA 3IHKA 2R2OA 4PHTA 3TEMA 2C2YA 2KHVA 4BKGA 3EZ7A 4YAWA 3J81j 5EUCA 4BTVA 4XCQA 4F6CA