5EE3A

Complex structure of osychf1 with amp-pnp
Total Genus 110
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
110
sequence length
374
structure length
357
Chain Sequence
ERPILGRFSSHLKIGIVGLPNVGKSTFFNIVTKLSIPAENFPFCTIDPNEARVYVPDERFDWLCQLYKPKSEVSAYLEINDIALGNAFLSHIRAVDGIFHVLRAFEDKDSVDPVRDLETIGEELRLKDIEFVQNKIDDLEKSMKRSNDKQLKLEHELCEKVKAHLEDGKDVRFGDWKSADIEILNTFQLLTAKPVVYLVNMSEKDYQRKKNKFLPKIHAWVQEHGGETIIPFSCAFERLLADMPPDEAAKYCAENQIASVIPKIIKTGFAAIHLIYFFTAGPDEVKCWQIRRQTKAPQAAGTIHTDFERGFICAEVMKFDDLKELGSESAVKAAGKYRQEGKTYVVQDGDIIFFKFN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords Obg-like ATPase 1
publication title ATP binding by the P-loop NTPase OsYchF1 (an unconventional G protein) contributes to biotic but not abiotic stress responses
pubmed doi rcsb
source organism Oryza sativa subsp. japonica
total genus 110
structure length 357
sequence length 374
chains with identical sequence B
ec nomenclature ec 3.6.5.-:
pdb deposition date 2015-10-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01926 MMR_HSR1 50S ribosome-binding GTPase
A PF06071 YchF-GTPase_C Protein of unknown function (DUF933)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.300 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 TGS-like domain 5ee3A03
3.10.20.30 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 5ee3A02
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 5ee3A01
4LV8B 3CPEA 3TVDA 1DAEA 2WHXA 4Q9IA 1E9MA 4LYFA 4IXMA 1W49A 3D31A 3TGPA 1JQLB 3QKUA 4G5GA 3CR8A 1E9RA 3NXSA 1YZLA 3OIYA 3PEYA 3KJIA 3L82B 3R9WA 1VHTA 1SVSA 2QSZA 2WWHA 5JWRA 1ZD1A 4FXCA 4RD6A 4MA4A 1EFCA 4TQUS 2JLZA 3OIUA 4F7WA 1RE0A 2NPFA 4YMVA 1KK0A 5GXGB 1LS6A 2QMEA 2R62A 2ZJYA 3K09A 5L3SB 1NL3A 2BCJQ 3BB3A 2P3SA 2PLRA 1G3UA 4ZDJA 3TQCA 1FRRA 1N60A 1F0ZA 2X2EA 1DOIA 3PUVA 1ZNZA 2OV2A 4FCTA 1SXJE 2V7QD 1FMJA 2IHYA 2A5DA 2WSMA 5KU1A 5CDFA 4XJXA 1GTVA 2WU2B 5GJBA 2ZPTX 4O2RA 1XZPA 3GJ8A 1M8PA 3TE6A 1I4LD 3AVQA 3CKLA 5LDDC 4OHXA 2NZJA 4HDOB 2JJ2A 2O0KA 1P73A 1R8QA 4WOPA 5CK4A 3P4QB 2LKCA 5DI3B 3REGA 3O8RA 1C1YA 5DNYB 4NZYA 3SI7A 3EZ2A 5B57C 2L52A 2IA5A 5FFMA 4QGHA 2XZOA 5H1YA 1OXVA 4C0AC 1DE0A 1N6RA 1OH5A 1P3JA 3O8BA 4B75A 1Z0IA 4PPQA 3X2SA 3MJHA 2R8RA 2KAJA 1I4TD 5HZHA 3TJZA 3DMNA 1E2EA 2OE2A 4NBSA 1TAGA 4Q19A 5UKDA 1FFUA 2F43B 3K9LA 4NCNA 4OI1A 3ZD6A 3BXZA 4LK2A 1YJIA 1ZNWA 4Z8XA 5EJEA 3GJ0A 3RS3A 4ZCMA 1NBME 1ZVQA 4WWMA 5JHGB 5DHFA 2A7QA 4OK3A 4HLUC 3AE9B 1VG1A 3B6EA 2CU3A 2IYYA 4NYJQ 5IK2A 1JJ7A 2XTZA 4B71A 3KQUA 2PT5A 2WJIA 3PFIA 1OFTA 4DLZA 2NPIA 3X1ZA 3GLHA 1XJQA 5F3WB 2GJ9A 5ANRB 4AYWA 3T1TA 3CNLA 2Y8EA 3JZAA 4HLQB 2QT0A 5CJ2A 1BS1A 4K46A 1R8SA 1KAOA 4WA7A 5FR1A 1NNEA 4G5SA 1LVGA 1FOEB 3GJ5A 1ETUA 2IUTA 1G21E 1ODFA 4JLNA 4BFSA 3SQWA 1JWBD 2WWGA 1W46A 1NLFA 3AV8A 4AKGA 1AS3A 5EXPA 4WBSA 1YZNA 1E9EA 4R7ZA 5HZKA 3THWB 1K6MA 4ZOHC 1SXJC 5DGXA 5CJPA 5DYGA 2F9LA 2Z4SA 5EP4A 1XNJA 5J40A 3TR0A 2VP9A 4V0MA 4PAQA 2ZRGA 3I61A 4AI6A 4JYCA 3ETRA 4M1OA 2CJWA 4OI2A 4LHYA 3WBKA 3LW7A 1D8TA 4CZ2A 2WBLC 1QG4A 3T1QA 5FI0B 4Y0AA 5FBQB 4A36A 1DEKA 3KJGA 3GFPA 1T5LA 4HDQB 3W9CB 1EESA 2K22A 2JJ1D 3W5JA 5GJCA 2ZTSA 3CNNA 4IOKA 3SNHA 4KYIB 2I1VB 1PVOA 2YKGA 3UMSA 2OAP1 5GJVC 1E1RD 1KJYA 1G41A 3FOZA 3M4YA 4XH9B 2JX5A 4Q03A 2FSIA 1BMFD 2L0XA 2XAUA 1U9IC 3OEED 1IBRA 2QAGA 1KI1A 1X3SA 4GT1A 1WBBA 2PMDA 2F55A 1P2TA 5CDFE 2KWIA 4IKEA 4LYHA 5C2TB 1HH4A 1R5OA 1E1RA 4EJSC 5CB8A 1Q1BA 2WJGA 1BMFA 1XCPA 1LNZA 1FUUA 2OFOA 2OHFA 4DLRA 3QSYA 1Z0AA 2OCYC 3HDTA 4M4SA 3HR8A 1D9ZA 1KDRA 2DHRA 4Q1BA 1L2TA 1NLZA 3W8RA 2ZETA 5JS7A 1ZM4A 3VNUA 1MO4A 3G82C 2VH5R 4GL2A 2ZJAA 4LBWA 2ZR7A 3CR7A 4CVNA 1PFDA 3R9XA 2OAQ1 3MJRA 2IS2A 2ZQ5A 1G20E 4FCVA 2IC5A 4MGYR 3V4RA 1C4OA 1YQ3B 1SXJB 2N1BA 1OT3A 2AFHE 4CYMA 1KNXA 3K70B 1SKQA 3BD9A 3EIEA 1T3SA 4HB2A 2WICA 2AN9A 3CM0A 5JI2E 5SZJA 3PJRA 4PSVA 5G3ZA 4BLRA 4G1UC 4U5XA 2CNWA 4QGAA 2ONJA 3Q7PA 2AK2A 4TMWA 2R6CA 2FFQA 4EPXA 2DWPA 2I3BA 4A6PA 3TUZC 3QQ5A 5IHPA 3CO5A 3VKWA 4CEIB 1XPRA 1XPOA 1G17A 2XOKA 3P27A 2OSBA 1VTKA 3LH5A 4Q7MB 3VKGA 4C7YA 1VCNA 4P33A 4FMCF 3I62A 1GL7A 4ZHOA 2P6NA 4XWAA 3AKDA 3RYTC 2GBLA 1GDDA 2A9KA 2ZM5A 2QRNA 1XMVA 3BIID 1EK0A 2G6BA 3GLHE 1QHSA 1E32A 1OXTA 2J59A 1ZNYA 4JJKA 4DDWA 3I5YA 2V55B 4DB4A 2GILA 4URXR 4RFVA 1PUJA 3A1VA 4JLDA 2YWFA 3VR3A 3J81k 3ZS9A 4MRNA 3ADCA 4OK5A 1OIWA 3C15C 3NKVA 4H1UA 5JWOA 4Q9JA 3K09C 1XEWY 5LD2B 4HAXA 3GLIA 4L4UA 3C8UA 3WNBA 3UG6A 4B47A 4N59A 4EJSB 2J0QA 4PPNA 4RZ2A 4ACBA 2J0VA 1AN0A 1Z28A 3ZVMA 1CJUC 3CF0A 3K0FA 3VR6A 1KAGA 3SYKA 2OILA 3O47A 3B7GA 1OJLA 1E79A 3VR9B 2FFHA 4AG6A 1NKSA 4JX1C 3RPFC 1GAQB 2ACZB 1Y3AA 1YKSA 2ZI6A 3GD7A 5HE9A 3CLVA 1KMQA 2BKUA 3JVUA 4FINA 5G5GA 1II0A 1XEXB 4YXWA 4B34A 3WHLA 3TQFA 4HUQB 6Q21A 4JLAA 5KSZA 3LVRE 1B23P 3PCRB 3G0HA 1IN5A 1P7CA 1WCV1 2GCOA 5J47A 2BMJA 3KZ1E 3LRPA 3JVVA 4LCBA 5JJLA 3K0EA 3DOFA 4QBHA 5CLQA 4WVFA 4TMXA 2CVFA 4A1FA 4AKEA 5IDVA 2ZJOA 3D7MA 5EE1A 1CJMA 1G64A 1YQTA 3ASYA 3RDPA 3WP0A 1IXZA 2CHQA 2DFKB 2HYDA 4NYIR 2GJ8A 4C3ZA 1Q20A 2W0MA 3DKVA 3I92A 3SS8A 5C4GB 3UANA 2ZVQX 3SN6A 1E2PA 3SR6A 2A5JA 3FHCB 4HRSA 3QXJA 3NBXX 1WF3A 2BBOA 2JLQA 3PIRA 1KI2A 1UFQA 4Q1CA 3AE6B 4LHXA 4D0NA 2XXAA 1NYQA 3SEAA 1T3LA 1NJFA 3ECCA 4TT3D 2F1JA 1G7SA 2CCGA 3B13B 3PUWA 2PCLA 3CZPA 3LY5A 1KYIA 3S1AB 3E5HA 5L3RA 1ZM2A 1JPNA 2E9SA 3H86A 3C5CA 4LWZA 1N5WA 4M2LA 1PV4A 4JVMA 4ESVA 1GRQA 1N6PA 3R7WB 1KDPA 1AYFA 2PX0A 5DISB 1G7RA 2VBCA 1G16A 4TT3A 4UXJA 4GNKA 4E03A 4LGMA 4ZDIA 4D0GA 2PZFA 1W36D 4P6VF 2BM1A 3X1WA 3U6KA 2O5VA 1KHTA 1KDOA 2WIAA 2YWGA 4KX6B 5G53C 4WQMA 1JBKA 1E9SA 3E2IA 4BFUA 4LYAA 1OQRA 4X8LA 3EARA 1F5NA 2PMKA 1TNDA 5HE8A 2V1UA 1UDWA 4BFZA 2B76B 4C80A 1G7CA 4IFEA 3IGFA 3K0CA 4Q4AA 1HQCA 4GZLA 5CYPA 2FF7A 4MYTA 5AR1A 1MO5A 5JI3E 1VG8A 1CRPA 1J7CA 2R44A 1N5JA 3GP8A 1OXUA 4DLTA 2IXFA 4B74A 1RFKA 3P4RB 4HB0A 1Z2AA 2BHRA 4PQRA 1D5CA 1PLKA 3QNUA 4AKHA 1Q3TA 3GLIE 1E2QA 3K1JA 4WZAE 5KO2A 4MRPA 2C8VA 1J7KA 2QAGC 2ZRPA 4I4LA 1XTJA 2NO1A 1Z6YA 4DEXA 3A1UA 2RGDA 2FA9A 2YC4C 3F5FA 1XPUA 2W2XA 2NTYC 1QOAA 1J90A 3BH7A 3MFYA 4JLOA 5FR2A 3IIMA 4BUJA 4M1SA 3GLHB 4BE7B 3VMFA 1ZIPA 4U00A 1UEJA 2ZRLA 3OEHA 4EPWA 4NE2A 2RGEA 4KAXA 5FTKA 4F38A 1NIJA 3ASZA 1EFRA 4JKIA 3CF6R 4XD7D 4JL6A 1DBSA 2YHSA 5J4LA 2RH5A 3CIRB 3T12A 2ZUDA 3MLEA 2ZITA 4JZKA 3WMGA 1NEKB 2CCJA 1NVVR 3THOA 4Q5IA 4P31A 4FMDF 4MDEA 3E1SA 4B43A 3IEUA 3NBFA 4NCIA 3I4LA 4BLSA 2C9OA 2XZLA 4RD3A 5AUIA 2GNOA 3HYTA 2CJWB 4HDCA 4UQOA 1BIFA 4CDGA 2CE2X 1Z5ZA 3NS1A 1P5ZB 1DAKA 5SZHB 4DLSA 1OIXA 4DJTA 1PZNA 2YV5A 1G8PA 1WRBA 5KUTA 3BFXA 4R2HA 1NSTA 1MKYA 2IYQA 1WRIA 1Z08A 2PCJA 3FPAA 3VRBB 2XZPA 2F43A 3BBPA 3Q85A 2RKOA 3KKPA 2GBLC 3CWQA 1JXOA 2XX3A 3DZDA 2WAXA 4XTCS 4BEBA 2VTKA 4TL6A 1ZP0B 1XBTA 3ZH9B 1OFIA 5FOWA 1VJKA 2ZRMA 5J4HA 2QJLA 3GEIA 4PHGA 4I1OA 1UEIA 4JMPA 4Q9HA 5A4JA 1ZC4A 2FMXA 1GSIA 3CWZA 1XMIA 2H8KA 4MYUA 1XB2A 3ZQJA 3QIAA 4RZUA 1J8MF 3KFVA 4EKDA 3DWMA 1X8KA 4PPFA 4G0NA 2WMNB 3U61B 3AEFB 4JVLA 2NO0A 4W5HA 1A70A 3A4NA 4LPKA 4AY2A 2WM9B 1RRPA 5JJIA 3TSWA 2GEUA 4W7SA 2L83A 3PENA 5DE3A 3AVWA 1CEEA 1G3RA 2IL1A 3SFDB 1Z3IX 4JBYA 2J0SA 2HXYA 4AYTA 4IDPA 1VDVA 2FDCA 3ICEA 1GP2A 2W83A 2VSOA 2ZS9A 3MRSA 2C77A 3T15A 2ZR9A 2FWRA 1W4RA 3BB1A 2MH7A 2OESA 2G0NA 5AJXA 5JECA 1CF4A 3FFAA 4C30A 1P75A 4NTZA 5F98A 1TUIA 3THWA 1FQJA 4OI0A 3AEZA 5BN3A 1E0ZA 1UPTA 2C5LA 3EG5A 2KE5A 3H1TA 3KFXA 5FUVA 2ZE6A 3B2FA 1WYGA 2WDRB 1IONA 3EW9A 3UPUA 1N6IA 3W34A 3LB8C 4GZMA 2XJ9A 1E1QD 1W5TA 2ZREA 4HAVA 1KJWA 1NN0A 2VP2A 4I1VA 1FNNA 2BOVA 4FI3C 4UXIA 5JRZA 1F2TB 4GP6A 1DTSA 1E6EB 3IDQA 4CT4B 4A6XA 1E4YA 1O87A 1R5BA 2CCKA 1ELOA 2NGRA 2O0JA 2V4ZA 4POAA 4E22A 1N5IA 1QHHA 4V0KA 2XTMA 3DL0A 4A15A 4KBGA 3I1FA 3GJ3A 4NPHA 5AK0A 1QVAA 2WQYB 3BORA 4N58A 5AJWA 3SJZA 3N5CA 2Z6VA 3AF0A 4QOSA 1E1QA 2W6IA 2GZAA 3VRAB 1CULC 4DCNA 4Z1MD 1XLOA 1NVUQ 3DWGC 2GVZC 3UMFA 5FBLB 4LJ7A 3VX4A 1TL7C 2PH1A 2BM0A 1A7JA 1KNQA 2IYLD 1D6JA 2QAJA 2WKQA 3TSOA 3W6OA 2AR7A 4M1KA 4V03A 2MJ3A 3UKDA 3V00A 5KTYA 2IF2A 5CLLA 2ZYWX 1LS1A 5FOXA 3T06B 4ASUD 2QT1A 2GAOA 1SKYE 1T0HB 4LYJA 2Q9BA 3TR5A 5K8LA 3DKPA 1GIAA 3GLIB 4MGIR 1X8JA 2ZXUA 4RZ3A 1H8ED 1KI8A 2ONKA 4PC3A 1QDEA 4JLJA 5EXSA 3T5DA 4A8JB 3IBYA 3U3OA 3ZDQA 1X8LA 3A1TA 2IYXA 3QXXA 1SXJD 2ZRNA 4BFWA 1JEDA 3LNCA 2ZI4A 3MCAA 3BFKA 2ZE7A 2IEYA 3BGWA 4MKHA 2VHTA 5C1BA 3L2OB 2IYWA 2JGNA 5TV2A 5KNCA 1ESNA 2HT6A 2EFDB 4MUAA 2MJEA 3P20A 2CHVA 1FUKA 3M6AA 1OSNA 1OE0A 1FTNA 3SBEA 3Q72A 1U98A 3VHXA 3FWYA 3TRFA 4LHWA 3EIQA 5EP2A 2J87A 1KI9A 2C98A 3OE7D 5CB6A 2V8OA 3MAAC 4DWJA 4TTQA 3QF7A 4EPYA 4KI0A 1NP6A 1CXZA 3K0CC 1N0VC 4CEIA 4NYJR 3U2QA 2A2ZA 1T91A 3FKSA 1LW7A 4ITRC 3RS4A 4JYBA 3WYAA 1W36C 3OFNA 3U3RA 1X86B 2VO1A 4TYPA 1RVDA 3CZQA 3C5HA 5DYIA 2OCPA 3P1MA 4NKRA 4TSFD 1T3HA 1Z83A 1V97A 2IYVA 1I7HA 5SZIA 2EFGA 5FTJA 3AVTA 2F1HA 1YHNA 3RRYA 1TU4A 2OZEA 4DBLC 3H84A 4X8MA 3EC1A 3LWNA 3A37A 3IHWA 1HT2E 4NL4H 3K0SA 1GWNA 4LJYA 4HZIA 5TVKA 1E0AA 1HQYE 2XXAB 3UK6A 1SHZA 5K8TA 4QBGB 1G5PA 3FMIA 3K53A 4PQFA 5FUXA 4D2IA 1NBMA 4EPVA 4A2WA 1N0UA 1FMAD 2FEOA 2REOA 2B8TA 2WMOB 1QOBA 2RCNA 3NIBA 4M1YA 2O8DB 1QOFA 3LX5A 4US0R 1X1RA 2IK8A 2XSZA 1LY1A 3ONWA 2PX3A 3C16C 2CMKA 3CPJB 1N3BA 1G6HA 4BZQA 3LXRA 5D3MB 2ZI7A 1PLLA 2BV3A 3KKNA 1KMHB 3Q5DA 3RHFA 3A6PC 2WIBA 1CIPA 3FGNA 4M9XA 4WXRA 1S0UA 4LDJA 3EPLA 5EE0A 4LRWA 1XEXA 4A0HA 4B2LA 2A3RA 5SZKB 3ZZ0A 3EPHA 1E99A 4E09A 1CJEA 5C46F 3Q5EA 4M22A 4MRSA 3RVBA 1FXAA 1FFHA 3AH8A 4KVAA 5L3VA 3AB3A 2ZJ5A 3WYFA 2VHUA 2V6JA 2MSDB 2FSGA 2H57A 4XTRA 3WRYC 4M53A 4BFVA 3P4XA 4LC1A 3FTQA 4ZDWA 1JR3E 4BPBA 2A30A 2YC2C 2DWQA 3X1YA 1M1YE 2F1RA 4C4PA 1GG2A 2WJJA 2XNDD 4A0RA 2X1VA 4ZDKA 2IS6A 4R98A 1C9KA 5J4KA 1YRBA 3EASA 2GDJA 4QHYA 2OBNA 4QC2A 4IFBA 3KQHA 4WZ6A 3PUYA 5KHOC 2QROA 3GJ7A 4Z51A 1VYTA 2GTPA 2JDIA 2JJ2D 3UWKA 1N6LA 2V1XA 4PC7A 2N46A 4HSEA 5TMPA 2HDNB 2WWFA 1A2KC 2XNDA 5L3QB 3P63A 2IX3A 4YSZB 2BVNA 3S1AA 1SKYB 3GQBA 2W54A 2IBMA 4P4SA 3VTKA 1Z29A 2CK3A 3ZYYX 1HTWA 1HYQA 1U0LA 3TKLA 2PKOA 1G8FA 2DR3A 2HTME 3R7WA 1RRCA 1RYFA 3B1ZA 2AXNA 2ZSDA 1NVWQ 2ZUBA 4G01B 3VR2A 2GEVA 3AE2B 4B35A 3OHMA 1DAFA 2GA8A 5G3YA 2JLWA 4A9AA 3RC3A 1U94A 1DG1G 4D0LB 4TMVA 1QVRA 3AKCA 3HU1A 3IHLA 3D6TB 3V9PA 3I5XA 1WQ1R 3UXMA 5EP3A 3CRW1 8OHMA 3TW4A 2IYSA 2W2VA 2PEZA 2ZEJA 3H2YA 3AE7B 4IRUB 5IK2D 5D3QA 5KDDA 1K5GA 1FNMA 2C03A 4KFSA 1DO2A 4LPSA 3KB2A 3AVXA 3TVTA 1XTSA 3DO6A 1SIJA 2EWWA 4DLVA 2BS4B 1P9WA 3U3KA 5KDLA 1J8YF 3QI2A 1SZPA 2QENA 4NP6A 4OQNA 3C7KA 1WWTA 1OKKA 1S8FA 4HAUA 5TXGA 3W5VB 3RS5A 1NN1A 2BS3B 3I32A 4TZ0A 2CBZA 1U0JA 2I4IA 4KHZA 2CXXA 3DZ8A 1GKUB 4GMXA 1S9HA 1HUQA 1XMJA 1DOXA 2PLFA 2ZSBA 3P4YA 1OV4A 2QP9X 2QZ4A 1U8AA 3SBDA 4C0JA 4YSYB 1N61A 1G3QA 2WJHA 3AF1A 4GSYA 4AURA 4C0QC 5CITA 1KFYB 3RS2A 3RS7A 3IIJA 1DOAA 4NCKA 4DXAA 2QM8A 2KBFA 5LBIA 2YOFA 1IXRC 3W8NA 4DDVA 1N5LA 3HRDD 1OYYA 2VF8A 2MMGA 2ZI3A 2CEAA 1OLOA 3EXAA 3MD0A 1XTQA 4WXPA 2CJOA 1E7PB 3W6PA 3WYGA 3ZJYA 1CBUA 3OAAA 1KTVA 1R0YA 3K70C 2PIAA 1OXSC 2EQBA 2ZAMA 2O8EA 1U8YA 2REBA 3W9YA 3ADDA 4C0BA 3CUEF 5EQTA 3GJ4A 3AGPA 2OBMA 3SYLA 1AZTA 3E70C 4CW7A 4EPTA 1QHHB 1UM8A 421PA 1EXMA 1E2FA 1FX0A 1CKEA 3BC1A 2PJZA 1XP8A 1DAIA 3AF4A 1L8QA 4GBMA 3TIFA 4DLWA 4R2IA 2GAAA 4URYR 4RCZA 2QPAA 2NG1A 5JHHB 1Q0UA 4EDHA 1JRPA 3MMPA 4UKDA 2WWXA 2WOOA 4Q18A 1FTSA 1GKIA 3PITA 1CS4C 2YOGA 4TTRA 4G5RA 4RKFA 1ZCAA 4YMTA 4A82A 1Z47A 1KDTA 2QG6A 3QOFA 3FHTA 4GOJA 1RFLA 3NEYA 4GMDA 3AUXA 5LD2C 1AK2A 3BB4A 3AV0B 2EYUA 4IOJA 1XO3A 4MITA 1YQ4B 2YWEA 1IY0A 1WBDA 4PTLA 4EUNA 1G4AE 1N0WA 1SVIA 2VHJA 2DFTA 3NWJA 4G5QA 3AE3B 2I1QA 2ZJ8A 3GJXC 4DLYA 4ERNA 1CJVC 2BEJA 4KCGA 1E0JA 5FPHA 1UKYA 1ZP6A 4L16A 4D4KA 2CNWD 2HT1A 1G6OA 1Z2CA 3I8XA 4TQ9A 4UJ5A 2CDNA 2FX3A 3B85A 3NVAA 1S1MA 2MSEB 3LLUA 2B7BA 2BBSA 3ZGXA 1G291 1P9RA 2XOKD 2ZUCA 4QFMA 3K0AB 4K8OA 5DN6A 1FL9A 4NCHA 3NH9A 2XB4A 4N3NA 1W0JD 4C0KA 4KODA 4P32A 3SR0A 3CF2A 5K8IA 2DCUA 2HLDA 821PA 2AL7A 4E5UA 1KGDA 2QRZA 3PUXA 1F2TA 1T3QA 3AQ4A 2O8BA 1VCOA 1XEFA 2ZAOA 4WAUA 3EZ6A 4O2LA 3QXSA 3RRMA 3KXKA 1G9XA 4BFTA 1W0JA 4Q4JA 2QEQA 3VX3A 1RYJA 4Q4HB 3KXIA 3C4JA 3X1XA 4DRZA 2XB2A 3IO5A 4LZZA 3SE0A 2GJSA 1OFFA 2QP4A 4JWUC 1G8YA 3LX8A 5FPSA 2FBWB 3AEGB 4PO9A 4S2EA 2ODNA 1SVLA 2WLBA 3FMFA 4KITB 1HEIA 4TQAA 2RGGA 1TEXA 2V6IA 4PFSA 4OJKA 4HAYA 4E07A 1ZINA 4D80A 4N6EB 1EFHA 2AKYA 4RFSB 2FFAA 1E79D 1OPXA 2W00A 1F60A 4OHYA 3FFBA 4C0LA 1HE1C 1N6HA 3AEEB 1NRJB 1JXMA 2OG2A 1JPJA 5EUQB 1GL6A 2ZRJA 3B1XA 4A8JA 5B58C 1AS0A 2H5EA 2QN6A 3B1WA 3WMEA 3NBZC 3NDBB 1CLUA 4Q00A 4FWTA 1KI3A 4YXWD 1XJCA 3K9NA 3KL4A 4XSGA 4JVSB 4FCWA 1ZAKA 3NVVA 2IXGA 3KUCA 1M7BA 2C95A 1ZOYB 3KTAA 2ZJBA 4WZBE 4C2TA 5KNDA 1IN4A 2OXRA 4KFRA 4PHHA 3ZIAA 1OYWA 4AC9A 2ZJ2A 3HR7A 3KKOA 3QE0A 1JB1A 1F3OA 4JJZA 3KJHA 2PVOD 5P21A 4TYNA 4AYXA 4NU0A 3EIHA 3I8SA 5F2EA 4B6FA 5BN5A 1Z6XA 3K9HA 1RM6C 3WNDA 4IXNA 3BS4A 2MSCB 1KK1A 2ZE8A 3D8BA 3IBGA 1CTQA 5EE3A 2Z43A 2W2TA 3PQCA 2BC9A 4F93B 3T34A 4TYYA 3F3YA 2Z0MA 5TDHA 4FN5A 2ECKA 4CEJB 2O8FA 2J46A 1W48A 4HAZA 3JZMA 1P2UA 2WOJA 1U0HC 2D4HA 3N70A 2A78A 5JEEA 1E2JA 3HWSA 3TW8B 4D82A 1NKTA 1YJJA 1E94E 3HPQA 1MT0A 1CR4A 2WU5B 5BYJA 3PV0A 1EX6A 1TQDA 3NDPA 1QT9A 1OIVA 3IQXA 1W44A 1HT1E 2LWIA 2C99A 5DIFA 2VP0A 3UWOA 4DDTA 3N2EA 5KNBA 4BGDA 3RRZA 4IW3B 4HZUA 5BQ5A 4CIDA 4CF7A 2JLUA 1R7SA 3B5JA 3KKMA 3DEFA 4V0OA 4EQ6B 4GOXA 1HE8B 2WKRA 3FDIA 1JROA 2GZDA 2O8DA 1S4QA 3GFTA 2JEOA 2BT6A 1OFUX 2QY9A 2RHDA 3TH5A 3F0TA 2DBYA 2ZROA 4P4SB 4BLQA 4RD0A 1HY3A 4FD2A 2C2HA 2YINC 2ZE5A 1PUTA 3AGQA 4IEEA 3BFVA 4QG7A 2ZVPX 3EZ9A 4IVQA 3FC4A 3QKSB 4GPTA 2YNMA 1TTTA 5D3MA 3Q3JB 1AS2A 4JL8A 1KMHA 3R8FA 1L4UA 2EWVA 4OQFA 2QGZA 2X8AA 1XTRA 1G8HA 4RJLA 5FOSA 3M1IA 2G1EA 1VHLA 2FSFA 4BLTA 4BFYA 3AMZA 3OIVA 5TB5A 4A2QA 1GRRA 2WP9B 2DYKA 1KZ7B 1BO6A 2OFWA 2W58A 3K9GA 1Z0DA 2QE7A 5FTNA 1TKEA 4FMCB 5CIWA 4GDFA 3IPYA 1T0JB 4PC6A 4IEIA 3UATA 4QJ3A 2RGCA 1Z0JA 4OQLA 3KQNA 5IT5A 4QKQA 1MH1A 3HU2A 4QHSA 3PEVA 4Q1DA 1ZD8A 1DARA 2D74A 1G3IA 3VR5A 2KMMA 4B6EA 3SHFA 2IYZA 2AX4A 5FOUA 3OEHD 4XOIA 3DM9B 2Q9CA 4C2UA 3GEHA 3CRVA 4IDIA 2RAPA 1EFRD 3H0KA 4A92A 4IJMA 1XMSA 2AD5A 3KXLA 4DUGA 5JCZA 3QKRB 1GZSA 4F91B 4YQFA 1KSHA 3CX8A 5EZ6B 3BIFA 4XSHA 1W5SA 2J5XA 3CBQA 1E9AA 1NI3A 3CRQA 3NVZA 2OXCA 3EA5A 1ZM3A 1X6VA 3QG1A 1AQYA 4IVPA 4PX9A 2ATVA 3SJBA 2W0SA 4MGZR 3NG1A 5H68A 3VU9B 2ZYTX 3LO5A 5L3QA 2OBLA 3CW2A 1HURA 1W0KD 3LVQE 4DIEA 5DSZA 1NF3A 4HATA 2VQSA 5KYKA 2R65A 3NBYC 4LBYA 4G5OA 3GCGA 1FW6A 4RD1A 1NG9A 1KKLA 1DAGA 1Z8FA 5G40A 3W3ZB 2LEKA 4Q1FA 1N25A 2ZRBA 4P3YA 2FGKA 2O8EB 4Q7JB 3OZXA 1PJRA 1W0KA 4XIGS 4YMUA 4JBXA 1EWRA 2FOLA 2EW1A 4BQSA 2A5YB 1T5IA 3T1OA 3A4MA 1SQ5A 3GJ6A 2J41A 1FX0B 2VRWA 2W6JD 4IOMA 4JSTA 5AWFC 4PAMA 5FOVA 2DFLA 1KSFX 5E95A 1W4AA 4CRWB 1IOZA 5JS8A 4TYWA 3PEUA 1II8B 4G3XA 4A0GA 4BLOA 1DOYA 1CZPA 1A82A 1E9FA 1YR9A 4PO1A 2HCBA 3EA0A 5A5GA 2G1KA 2J7PD 4PZZA 5HCIA 2FSHA 2HCJB 2UVQA 1G5TA 2W6JA 4GI7A 4V0NA 4HUTA 1D9XA 2ZI5A 2RHMA 2PEYA 1OXXK 4ESHA 1S2MA 4LHZA 2O8CB 2ERYA 2QBYB 2K5PA 3VNVA 1E10A 2J1LA 2RGXA 4ZHPA 1L0VB 1MO3A 4OKSA 4R9UC 1GILA 4RCYA 3WRXC 4A8JC 5FBVB 1SVMA 4HLCA 1AZSC 2J7PA 4QNRA 3DDCA 2H89B 3A8TA 1H65A 1WGKA 4Q1EA 4AD8A 1K8RA 4OQMA 3RSOA 2WZQA 1EWQA 1RPZA 1N5XA 1VLBA 4DLUA 3GLGE 4TL8A 3REFA 3EWSA 4OHZA 4NMMA 3B8HA 1E0SA 1G8GA 3B78A 2WV9A 5FL3A 1XJ0A 1G7TA 121PA 4Q02A 1XD2A 2FPKA 3AEDB 4KFUA 4OHVA 1N2CE 2GXQA 2J7KA 1J7BA 1IN7A 2D62A 2OM2A 3U60B 4H1VA 1ZD9A 2W6ID 4ILEA 3NHAA 1BYIA 2QPOA 4NCJA 1N6NA 2O8BB 1CJTC 2QMUA 3NRZA 2EVWX 3SU8A 4XWKA 5FUYA 2HEIA 3QVVA 4Q4JB 4D25A 2CL6X 1IM2A 2DWOA 2WSSD 5H70A 1KIMA 2WJYA 4N0DA 1CR0A 1TX4B 1M7HA 3QENA 5FTMA 2VPPA 3WXMA 1JWAD 2CE7A 2HUPA 3LBIA 1J70A 3ZYCA 4DT1B 1D2EA 3P4PB 3EAQA 5JCPA 2R6FA 4QNMA 2QUZA 1Z0KA 2QGNA 2EFEB 1IY2A 1W1WA 3THXA 1JI0A 3ZVRA 4ZI2A 4B3XA 2WSSA 3T1VA 1OFHA 4M1MA 1JR3A 3FAHA 1YRAA 1UBCA 3QF4A 3WY9A 2IUSA 2ORWA 3VHLB 5JMTA 3MSXA 3KDSE 1JQ4A 3CH5A 1US8B 3BRWD 3LBNA 4QBFA 3K70D 2EKIA 2IF0A 1OF1A 3KUDA 1YZUA 2FZLA 2W55A 1SVKA 3KTAB 3MWYW 3NVYA 1UKEA 4FMDB 1E4VA 1XF9A 1ZU5A 2J0UB 2HJVA 4MKFA 2D3WA 1AM4D 4BWYA 1FZQA 2N42A 3ICQB 3AKEA 3FKSD 5HKKA 3X1DA 1UAAA 4DSTA 3KKQA 4Q48A 1AKYA 3K0AA 1M7GA 4YMSA 2J45A 2NOAA 2BEKA 3EZFA 2ZSFA 4US8A 3OFND 4B2PA 5FOTA 4D4LA 1XU4A 1KRHA 5FL7D 2IUUA 4IDOA 4DDUA 3KQLA 3IEVA 5J4YA 4OHWA 1L6VA 1DVRA 2FG5A 2JLXA 2FH5B 5FH9A 4ON9A 3AVUA 1XD9A 1VCIA 3B9JA 1N5KA 1OB2A 4K81B 3EZ7A 2KBEA 4US1R 4QRHA 3W6NA 2H17A 1Q22A 4TL9A 1P9NA 2O8FB 2WDQB 2OLKA 3BE4A 4AG5A 5AUNB 1ZXIA 2P65A 1W4BA 4QHTA 2OT3B 3QPVA 5AUQA 5FL7A 3W5IA 4Q4HA 3B82A 1QOGA 2HV8A 1NBMD 2D2EA 4PHTA 1WB9A 1NJGA 3OF5A 4M9ZA 2HYIC 3OESA 2QTVB 3LV8A 1WE2A 3ABVB 4HAWA 2FE4A 3AM1A 5JRJA 2AKAB 4PAOA 5E7MA 4C0HA 2XSZD 3ADKA 1COWD 3RS0A 4HEJA 3B2GA 3NTUA 4JLMA 5CM8B 3A4LA 4HZUB 1FXIA 4IDNA 1KOFA 4RFSA 2GXUA 2A5FA 1T8TA 2ZU6A 4PHFA 3ZQ6A 4C0SA 1MO6A 2VP5A 5FTLA 4QM6A 3AF2A 1ZIOA 1R0WA 2OO7A 4TL7A 2DY1A 3A36A 3HYRA 2IS1A 2P2LA 5JSZB 3BERA 3U7HB 2RMKA 3AVYA 2QSYA 1GNRA 2GJKA 4LHVA 1COWA 4AIIA 4UNRA 4NYMQ 2ORIA 3FB4A 1E2LA 1DO0A 2YOHA 4M1TA 1P2SA 1EX7A 2IT1A 3CX6A 1L7VC 4NONA 2LCFA 4LOAA 2VHQA 3I73A 4OK6A 2ANBA 2YZ2A 1KO7A 1W2HA 1R6BX 3ZZTA 1U2RA 2OCAA 2JIZA 1Z22A 4D6PA 2Q21A 2GRJA 3B9QA 3KB1A 2VEDA 3ND9A 4GOKA 3GLGB 2F9MA 4ZKEA 3SFEB 3LQRA 3TLXA 1KZGB 2F1IA 4MKIA 1EG7A 2QM7A 1KO4A 1ZBDA 4UNPA 1YJ5A 2ZIAA 1ZJ6A 2ZSEA 3SFVA 3SZRA 4AKIA 2JLRA 1KSGA 1VYVA 3U4QB 1LF0A 1F48A 5M04A 4CEJA 4ZIRA 1VG9B 1Z6TA 2BBTA 4Z8YA 4RD2A 2AXPA 1R0XA 2CLSA 5HR5A 2H88B 2QQ0A 4F4IA 1IAQA 1D2NA 2JDID 1E2HA 1E2NA 3QBTA 2B21A 1NMZA 1R4AA 3CX7A 2NO6A 5GJWC 1AQUA 1V5WA 3TAUA 4YSXB 3U3JA 2ODWA 5FBRB 1PUIA 2VP4A 1RZ3A 3CRMA 2MJDA 2GJAA 4D26A 2FGJA 1L4YA 2Z83A 4F4JA 4KFTA 2CK3D 2CVHA 4W9MC 1MV5A 3I72A 1OHHA 3SJCA 4BRWA 2AWOA 2WWWA 4ITKA 2ASEA 4NH0A 5LPNA 4EQ6A 4GP7A 2V9PA 2A5GA 2H16A 2OCBA 1ZUIA 2BBWA 1UDXA 1ZUNB 4PC1A 1JR6A 5EZ5A 1E2IA 1CR2A 1GM5A 1T6NA 1TADA 4P4TA 2QNRA 1RRGA 1O3YA 2FEMA 1UJ2A 4ZPXA 3P1JA 1G1MA 3QKSA 4YT0B 1OH8A 4XVUA 3KWLA 2R2AA 2IEZA 1UADA 4I1UA 1ZNXA 3MGCA 4PXAA 2GCNA 1TUEA 2B8WA 4B3CA 3C41J 3BJIC 1SHKA 3QG5A 4RVCA 2VF7A 1JAHA 2NQ2C 5E7JA 2IWRA 2N0SB 3U44B 2C78A 1NIPA 1QG2A 4CT5A 1M34E 2GXSA 1OKKD 1DADA 1NN5A 2NO9A 4LV6A 3BH6A 5IF9A 4L9WA 3AE1B 4MGKR 2V7QA 1D2MA 2IYTA 4ABYA 2ATXA 2C04A 1XLPA 2WS3B 2QL6A 5A0FA 3NH6A 1AA9A 5BW8A 2M56B 4C7OB 4NHOA 4LJ5A 1GFIA 1JNYA 2VL7A 2BMEA 4ZO4A 2WWYA 1Q21A 3CONA 2H18A 2OUKA 4EPRA 1NVID 2P67A 3L0SA 3QKRA 2QTHA 3BOSA 3W3AA 3DM5A 4B3FX 2OLJA 5CIQA 4URZR 3PG5A 4ZCLA 1J7AA 2VSFA 4OBEA 1YR6A 2G9NA 3PXGA 1T4GA 4TWZA 4YLGA 4F4CA 1YZGA 4HB4A 2VLIA 1B9RA 2OEPA 1WXQA 2PZEA 3MG9A 3OAAD 1DGJA 2BDTA 4TN1A 4IHQA 1JW9D 1KJZA 2REXB 3VU9A 1XTIA 2CJNA 3NC1C 3VR1A 1N6OA 4ARZB 2ZYUX 2R6DA 1RRFA 2O0HA 4Y0VA 4YONB 2DB3A 1S9DA 1I2DA 2W3SA 3L0IB 1E2GA 3IIKA 4LY6A 4TMZA 1FQKA 3FE2A 4N1AA 1WMSA 1GOTA 3QVUA 2BIFA 2C96A 3CPHA 1FP7A 1U90A 2VIIA 1RWSA 3VFDA 1W2GA 1XD2B 4EIWA 3D3QA 1E2DA 1QRAA 2ORVA 1I2MA 4A4DA 2ANCA 1DG3A 1EGAA 1UBEA 2C9YA 1FFVA 2GCPA 2JLSA 2P6UA 1ZMXA 4FWIB 4M1WA 2IS4A 3DPUA 2BS2B 2NZ8A 4LTUA 1TU3A 2ODEA 2XJ4A 3MWJA 1ANKA 4A0FA 1NYRA 2WPDD 2ZRIA 1FPMA 1II9A 2ZANA 4TLBA 1IN8A 4X8HA 2ZU0C 1EWYC 2RGNA 3CIOA 3VKHA 1A4RA 2AWNA 3K8YA 1LF5A 2G77B 4Q66C 4DEYA 1V8CA 2ZR0A 1II8A 4BEJA 3U7GA 4QL3A 4B3GA 1AKEA 4USAA 3VR4A 2D7CA 1JEEA 2WPDA 3DMDA 5LB2A 1CJKC 1Q1EA 2DFNA 2Q3MA 3THXB 4YTMB 3C14C 5KSYA 2CLDX 1J2JA 2V54A 1KY2A 4JKYA 4L15A 4BECA 1AWDA 1R10A 1TKYA 5FI1B 1P6XA 2ZJZA 2O8CA 2QBYA 5FUWA 1IHUA 3QF4B 5BXQC 4LSGA 3LW8A 5JEDA 4LJ6A 1T8UA 5DN6D 4B76A 4JLPA 1QLBB 4B3BA 1UBFA 2GHIA 4DSOA 2HLDD 4UJ3A 4QM7A 4DIDA 4BZXA 4JSYA 4EFLA 1OH6A 2JJ1A 1R0ZA 4JLKA 1N63A 1M74A 4URWR 5BWMA 1SGWA 3VR8B 5JFGA 3P4SB 1TYGB 4AK9A 3R20A 4M9SA 4ACAA 3IQWA 4Q9KA 5F9HA 3ZS8A 3OEEA 4TLCA 3TBKA 2R6GA 4JBWA 1EFUA 1XFAA 5KPDA 3GLFA 1QHGA 2BWJA 4URUR 4B44A 4Q47A 3SC3A 1LB1B 1NLYA 2QORA 1UKVY 1LTQA 3FHOA 3ZLJA 4O25A 1V43A 5B64A 1F6BA 5EXTA 1FO4A 4Q4LA 1Q44A 2ERXA 2X77A 1U99A 2PVGC 1XCGB 2WVJA 1BYUA 3AEBB 2P5SA 5FPTA 2WDVB 2JAQA 1Z06A 3SDZA 4DT1A 3QEJA 4KV9A 1MRSA 2GKSA 4OI4A 1VIYA 1RJ9B 3WHKA 4DKXA 1XXHA 3SYNA 1IJEA 1NSFA 4US2R 5JWHA 4TLAA 4DCUA 2ZRCA 1MR3F 2G3YA 2ZRFA 3RWMB 3ZIAD 1IJFA 3AM9A 2UZ3A 3RANA 1F2UB 2QMHA 4CEHA 3MWKA 4FXPA 5J4VA 5C4MA 1XX6A 1RW4A 2K5UA 4PPGA 1KF6B 5FBWB 1US8A 1T9HA 2QA5A 3N2IA 4JLBA 4YXDB 1G18A 4QGGA 5B2ZA 3TMKA 4QBIA 4MQBA 1S96A 3BAFA 5LB4A 4JVNA 4OL0A 1VECA 3WBJA 4WW0A 2PJRA 3CWIA 2J0UA 3R9IA 3LQQA 2RGAA 2WAYA 3UMRA 2GF0A 2JQRB 1QBKC 2HF9A 1SVOA 2IYUA 3SFZA 4C9BA 2DPXA 3TK1A 1KO8A 1S3SA 3RABA 1HA3A 1R7RA 2B7CA 1XEWX 1NENB 2Q0HA 3IKJA 2SHKA 4GRAA 4MH0R 1TQ6A 3EPJA 1VPLA 2BMDA 4V0ME 2Z4RA 3TUJC 3B9PA 2JCSA 2QPTA 4URVR 1VG0B 1PDXA 3L0OA 3A58B 4L5BA 4LV5B 3BWDD 4KXFB 3O8DA 4ZIRB 5JBQA 3WCQA 5GVRA 3ADBA 1P61B 1XRJA 1GNQA 1LFDB 1TQ2A 5KSPA 3T61A 3EC2A 2J3EA 3B60A 4V0LA 1UWMA 1J99A 2P6RA 1VDZA 2ZS8A 1Z0FA 5EP1A 1XLNA 1H8HD 2W3RA 2FN4A 2FU5C 2ODBA 1P62B 2PZGA 4JT4A 1IUEA 2XGJA 4O0MA 2AX5A 3SJAA 3LFUA 3THYB 5KSOA 1FP6A 3U3MA 4B32A 1L6UA 3U7FB 4EFMA 1E98A 3L4PA 1WP9A 1QHXA 3PEWA 4LUCA 2AFIE 3HVZA 4LBVA 5JZVA 2F6RA 1H8HA 2CLCX 3NHBA 5HCNA 1EFTA 4W5JA 5E3HA 1WDTA 4M21A 3W90A 2ZI9A 4UNQA 1QF9A 5JSZA 4MDFA 1CU1A 3AP2A 2CL7X 3GPLA 1ZW6A 3HP1A 5H8WA 4DHEA 1M2OB 1Q3HA 2QIEB 1YZKA 4Q7LA 5JJKA 2FFBA 4QGFA 1G19A 1JJVA 3FMPB 2Q6TA 2QE7D 3B1YA 4M8NE 5KPJA 3GLFE 1AJEA 5L8VA 2GK7A 4PSAA 4RZXA 2CHGA 4DLXA 2GF9A 1Z6GA 1VYUA 4YC7A 1KI6A 1KO5A 2D06A 3PO0A 4S35A 5EE5B 2GXAA 4HYYA 1NMYA 3OIWA 5HPYB 4BLPA 4NDZA 2JATA 3L0PA 4DSUA 4PO8A 3GLGA 5ELXA 1W7AA 4QXAA 4KVGA 3U6BA 4RD4A 1TF2A 2B92A 3UIEA 4DCTA 2H92A 2BJVA 1Y63A 2RGNC 4DUGD 1QF6A 1X1SA 1NG1A 1XXHE 3AVOA 3U4QA 3AN1A 1MABA 1ZUHA 3L43A 1ZRHA 4IVRA 1JAIA 3CB4A 1E2KA 4PZYA 2F7SA 1ZYUA 3Q9LA 3SOPA 3PUZA 2G88A 2EU8A 5EE9A 3KQKA 3LXXA 4D4MA 2QI9C 2R9VA 3LA6A 3HPRA 2Q5WD 1KI4A 1DAHA 4TLDA 4LI0A 2Z5FA 2V3CC 1IQPA 1JQJC 5DLQC 3V4FA 5AJZA 1W47A 2F3TA 1JECA 3ZVLA 1DELA 2G1JA 2QQEA 3AP3A 1ROEA 1ESMA 3IO3A 5DI9A 4JLVA 3TNFA 2G0TA 3O8CA 1AGRA 1K5DA 1TEVA 1G5RA 4MRRA 1XDBA 2QP3A 2D7DA 3WMFA 1DAMA 1OW3B 2FPLA 1DPFA 2FV8A 4M0LA 4DZZA 1UKZA 3GEEA 1Q12A 221PA 4MKGA 4KU4A 1ZUD2 4LBZA 4ZKDA 1YZQA 1KK2A 1E0KA 4J0QA 1GVNB 2EFHB 4FMBB 2NO7A 2WTUA 1AIPA 4HLDA 5E7IA 4BZPA 2XEXA 3NEJA 1PLJA 4DC9A 2ZRKA 1CRQA 3QPUA 1GPXA 4FIDA 1Q57A 2K9XA 4Q1AA 4KSCA 4EFNA 1E3MA 5C18A 5L3SA 4B73A 2FZ4A 3QKTA 1L5PA 4OQXA 4DCVA 2Q9AA 3QBVA 3ND8A 1GRNA 1VKJA 2Y5CA 4PZLA 2YVUA 3ZVNA 2AD1A 5AUOB 3A1SA 1GITA 4GFDA 3AE4B 2E87A 4KSBA 4YMWA 3B1VA 3U44A 3U5ZB 3LXFA 2IYRA 1JALA 3VQTA 5DI3A 4PSKA 5AUKA 2EYQA 4XD7A 2ZRDA 5DH9A 4BASA 2X2FA 3QY0A 4NYMR 4I81A 2FJUA 3LLMA 3QUSA 1QHIA 2UZIR 4JL5A 4P4UA 3ZZUA 2IHBA 4KLZA 4C7OA 3EUB2 4XVQA 3M0EA 4KYUA 3RSLA 4U7DA 1TKGA 3AKYA 3F8TA 4PR0A 1N62A 4R71A 1QHNA 4P0TA 1FRDA 2CL0X 3Q8XB 5JLJA 4RY2A 3H4MA 3T5GA 1ZM7A 1U81A 3EPKA 2GWHA 4DCSA 1Z63A 3AECB 5BYKA 5GADl 3L8YA 2G83A 3AE5B 1AGPA 2ZRHA 4ARZA 2IW3A 1LV7A 3HU3A 2X19A 1A2BA 4DVGA 2QAGB 2WWIA 1SVWA 4HROA 1CP2A 2FPMA 3AEAB 4FW9A 4II7A 1KSJA 3LBHA 3RAPR 4YTPB 2F3RA 3LDAA 4B3DA 721PA 2E1RA 4IOLA 1VMAA 3FVQA 1XZQA 1NMXA 2QTFA 4AWXA 3RRNA 1BOFA 2JLVA 5TARA 5AUPB 3EX7C 4TZ6A 3L8ZA 3GLFB 4O3MA 2PT7A 4NYIQ 4TTPA 1FMLA 1A5TA 1ONBA 4PC2A 2BJWA 3GFOA 3TUIC 3RNLA 2BMFA 2WJVA 3BH0A 4F92B 2JLYA 621PA 1NN3A 4JT2A 5BN4A 2VA8A 1JR3D 4B33A 5C3JB 1GUAA 3MWLA 3CH4B 4L9SA 2VHCA 2ZS7A 5G5HA 1OQQA 1E96A 3AE8B 1RKBA 5F9FA 4XVRA 1ZU4A 1FM0D 1QHYA 2E3TA 1W4CA 3MUFA 4CGZA 1XXHB 1TQ4A 2BCGY 3CRRA 4UNSA 2EFCB 1Q1QA 1TF7A 4LC0A 4U02A 3QXHA 2O52A 2QMOA 2PL3A 4MYCA 3EWAA 2AHOA 3AP1A 4LJAA 4Q9LA 4LJ8A 4MUBA 1BKDR 1Z07A 4Q01A 4UXHA 1IY1A 1KKMA 1OB5A 3AH7A 5HKKD 1E9CA 3TAHA 521PA 4CEHB 2LKDA 4ZI3A 2GESA 5FPYA 3AVVA 3HJNA 4UNNA 2WKPA 1NY5A 1KO1A 5GVSA 3QPWA 4JIMA 4N0EA 3QJYA 2VYFA 1YR7A 5DO9A 2GVDC 4HLUA 4C7ZA 2ZRAA 2XTNA 3IILA 4EAQA 2M19A 5K8UA 1P4SA 1YR8A 4I1SA 1XTKA 4IDQA 1RC8A 3P26A 1KY3A 1P2VA 4ZCIA 4M9QA 2UKDA 4Z1MA 2P0EA 2XITA 1TMKA 3IPXA 2QU8A 4DSNA 3LAWA 1I4DD 3PR1A 5J5CA 2JJ8A 2KB0A 2Q3FA 3K0FB 4ASUA 3BK7A 2YWHA 4MRVA 1GNPA 3I3SR 2D2FA 4OYHA 3RLFA 1E9DA 5H92C 1UF9A 2KJQA 4D81A 1G3MA 5MPOA 3QXCA 4PQYA 3LD9A 1TJEA 3FKQA 1H8EA 4KJZA 3UG7A 3WP1B 1MRNA 3DHWC 3AUYA 1RIFA 2C9CA 2AK3A 2B6HA 1SXJA 3FMOB 4PANA 1SB3C 2HJGA 1ZM9A 3DVLA 4HI0E 4D4JA 1R5NA 1YE8A 2IXEA 3W5UB 2HXSA 5E4FA 5KOYA 2H1LA 2RGBA 4TLEA 2GZHA 3Q7QA 2GCOB 2H7VA 3KJEA 4KO8A 4XWOA 1Z6AA 1YZTA 2P5TB 1OH7A 1RJ9A 1MOZA 2VSXA 1DS6A 3SHWA 4B2IA 5KDOA 2PBRA 4TYQA 1TPZA 1NVVQ 4BRUA 3NVWA 1XD8A 1P60A 1GAJA 1ZC3A 1R2QA 4Q21A 4YTNB 3P32A 2GEDA 5B30A 1IN6A 1BH2A 1E9BA 3OE7A 1F2UA 2GETA 1FIQA 5FPKA 1KI7A 1NVXQ 5CK5A 5TY0A 3FYHA 4DB2A 1SF0A 2JIZD 2NIPA 1GL9B 3NC0C 5HTKA 3WNCA 4BFXA 3SQXA 2TMKA 1G4UR 4Z54A 1U9IA 1IXSB 1S1CA 5G41A 1HV8A 4A2PA 2JASA 1M6NA 1SULA 4HB3A 1E6CA 4TSFA 5DHAA 2R6AA 4LX0A 4KBFA 4LJ9A 1S3GA 3TSZA 3AB5A 1KI6B 1U8ZA 1XCMA 3T35A 5CYOA 2NMVA 1UBGA 4EJSA 3HUIA 4ZV4A 1A1VA 5AJVB 5H8YE 5EUMA 3IUYA 4YDHB 2OFXA 2J9RA 3QEOA 4QJ4A 1ZCBA 3ETLA 2JA1A 4JWSC 4QJ5A 2VP6A 3GMTA 4IDHA 2HF8A 1TF5A 2KI5A 5AJYA 3A1WA 3PVSA 4W5WA 2YJTD 1VCMA 3AF3A 5C2JB 1WA5A 1MABB 1Q1ZA 4KLNA 4YDSA 4US9A 5CM9C 5IRCD 1GKYA 4JS0A 1YVDA 2FNAA 1YU9A 1OHHD 4TMTA 1KK3A 1XWIA 2XNSA 3CNOA 2MMCA 2RB4A 4Q7KA 4X8OA 1NY6A 1QZXA 4HUQA 1CR1A 1RYHA 2ZSAA 4V02A 2KSQA 1B0UA 3THYA 2BKEA 4LJ4A 4OJQA 3R8CA 4L8GA 3U7EB 4Q4AB 5EXXA 1VIAA 1P72A 2YYZA 2GK6A 3G5UA 3AVPA 4MYHA 3VAAA 2Q3HA 3RC8A 3DOEA 3ZD7A 3RWOA 4I99A 4RSGA 2IWHA 1XLQA 2ZYVX 4H9GA 1W36B 1E69A 3B2EA 4RKEA 1N6KA 4TMKA 1E2MA 4WIAA 4B48A 3KX2A
chains in the Genus database with same CATH superfamily
2CBXA 3R7AA 3L6RA 5KWJA 2H1WA 3CR8A 1E9RA 1BMQA 2O4UX 2ZIGA 3OP4A 1VHTA 2VDUE 5DPMA 4RZRA 5F7OA 1TS5A 3OIUA 5JAIA 4D4GA 3IJ5A 4NAHA 1ZNZA 3KR1A 2QRVA 3WBBA 1OI7A 4BKGA 2G71A 3WNVA 3V7FA 4Z99A 1TK9A 2GF2A 5T4EA 2NN3C 5FFMA 3UQAA 1RQ7A 2ATCA 2TECE 4DF3A 2CXSA 4DV0B 1E2EA 3COSA 5TR9A 4J9VA 3DL4A 1ZNWA 3TW6A 1NR7A 1NBME 1BJRE 5JHGB 3BMQA 4QECA 3UJBA 4F3CA 3KQUA 2WVHA 4C6TB 2QMQA 2G28A 3Q9SA 2OHJA 2FUKA 4C4SA 1HXHA 1KAOA 1LVGA 4I4IA 1JIKA 2HTHA 1G21E 1JWBD 1H3NA 5EXPA 5J40A 3NOVA 2Z4SA 2XYRA 3FBWA 4RBNA 2RDMA 2WIKA 3CR3C 2E6XA 3U3XA 4M38A 4LHYA 3P7MA 2A86A 4A36A 3DTVB 2A1JB 4HJRA 2W70A 3H6NA 4H15A 3MGAA 3OTGA 1N57A 4Q3DA 4B6GA 4BO0A 2P9ZA 4LC9A 5ESRA 4LECA 2V3VA 1DT5A 2QJRA 3SVLA 5B1HA 4CCAA 2HFJA 2YR0A 3S2EA 2O14A 3HFSA 4HYKA 4PTZA 2ZWOA 7ICFA 2YJZA 1XDUA 5F7JA 3KUKA 3T94A 1IMOA 1MRZA 1LLDA 1MO4A 2WJ3A 2FE1A 4EG1A 4FGWA 2GYYA 4X65B 4EEWA 1WBJB 1G20E 2HRRA 2N1BA 2P4HX 3BD9A 2XYQA 4BMPB 1FVHA 2H6EA 2I3BA 5EMNA 3TUZC 1NT2A 4J0EA 1XPOA 1VC2A 2XOKA 5G2OA 3DC2A 3WDSA 5COBA 3LF1A 1EVEA 1USKA 1BX0A 5KQGA 2P9FA 1NHWA 5CEJA 1HNWB 3GB9A 3UQBA 1AQJA 3U4EG 3A0RB 3O9MA 3R5JA 3VR3A 3N97B 4YJ3B 1TTPB 2YZNA 1Z5WA 2QD3A 4RKYA 3BIWA 1XEWY 3T7RA 4BMZA 1N5MA 1CJUC 3SSNA 4KV7A 4BNYA 1E79A 3DBOB 4AG6A 1IGCA 2BP7B 5I4DA 2G8NA 1ZD4A 6Q21A 5KSZA 3D4BA 4JZYA 2HPAA 3MGIA 3DMGA 3I2HA 3IB3A 2RHWA 2IZ5A 3AJDA 2A1UA 3ZX5A 2AG1A 2KQ4X 1U4NA 2Q29A 5BRJA 5EWLA 3FA2A 5LJLA 5C4GB 2ZVQX 5KKAA 1PW7A 1O58A 1XCOA 1I7NA 1FFCA 3PUWA 3D43A 2TSYB 1N5WA 4LJXA 1OX4A 2CNNA 4Y18A 2A9RA 5J0WA 2H5IA 1UJ5A 2PZFA 4U7PB 3KE8A 3KAPA 3EPIA 1YULA 3IGFA 2KQ7A 1BX1A 2PFPA 4MYTA 3L7JA 5EHZA 4Z6CA 4U3JB 3K1JA 3VV3A 5K7SA 2QAGC 1XTJA 1K68A 2YC4C 1GB1A 3IIMA 3RIHA 4BE7B 1PRYA 3BILA 3E27A 3GGJA 4J8PA 4WUVA 3WIOA 1WUDA 3B9RA 3RVQA 4NDNE 4B40A 3ZWMA 2X3UA 3SEQA 3C6YA 4GMFA 3BFXA 2IYQA 5CH5A 3KKPA 2QJTA 2Y3AA 4KIGA 1C14A 5BSVA 2GGSA 1GSIA 3Q0EA 4H18A 4D57A 2BSAA 3W5VA 5U4QA 2F8KA 2YFKA 2WM9B 4C6RA 1CIVA 3QYAA 3SFDB 2RB5A 2FX5A 1E7MA 1GP2A 1WCXA 2W83A 4WWOA 5LBTA 1V1RB 2WSYB 2PVCA 3BB1A 3ZI7A 1G55A 4C30A 4KXQA 4II3B 3BL8A 2XE4A 2VPQA 4KIKB 4GZMA 3CJTA 3RVMA 2O7RA 3E0XA 2OM6A 2D1RA 3SJZA 2Z6VA 4RADA 1E1QA 4CR7A 1X6IA 1SQFA 2V4UA 3ZHQA 1KNQA 3GRKA 2JKYA 1YA6A 4TKLA 5FOXA 4ZEVA 5TJHA 2G6TA 4N0MA 3IBYA 5BWNA 3TMYA 1JEDA 3KUCB 2B5OA 1JDTA 3VYRB 4P0QA 3R3JA 1Y1QA 4P2GA 1IXYA 1U5BB 1K7XB 4LHWA 1QFSA 4FT4A 2VP3A 1RP1A 2MQJA 3F8SA 1ZCFA 1O1YA 2HHCA 1P45A 2TMDA 3U2QA 1XKQA 3GXBA 3U3RA 1ZD2P 4RF0A 4KMUA 1GNTA 1Q17A 3REQA 2DH6A 2ZIWA 3N1YC 1LLUA 3FMIA 1SXHA 3L7OA 3RZFA 5LXTF 4JWNA 3NP7A 1FMAD 2FEOA 4F3OA 5DDMA 3OZWA 3ACDA 2VSNA 2OC9A 4R1QA 4JJGA 2IK8A 4RHYA 5A05A 4RS3A 3C16C 2IEIA 4DL9A 4G0YA 1KMHB 5ECWA 3GFFA 3MS2A 2WIBA 3TZLA 1V7QA 2P6PA 4L1KA 4HXYA 2PSDA 5F1PA 2PQ2A 1DRVA 3O75A 2H5JA 1YONA 2WX1A 1HJPA 4FLFA 1JBQA 3JQAB 2KE7A 2PX4A 4C0XA 8ICOA 2A30A 5A04A 3CJQA 3HI4A 4BX0A 4Q3OA 4DHWA 5BPCA 5J4KA 2EG5A 4DRYA 2E5SA 5EJ9A 2KC1A 1U3CA 4R7TA 5EERA 2XNDA 5BNTA 1BCRA 4P4SA 1BPBA 4HV4A 2HTME 4BKMA 2B3AA 2C2MA 4BNLA 1D9FA 4BWFB 2GNPA 3FNQA 5JT1A 5EP3A 1GQFA 2IYSA 4RDCA 1K5GA 1TO1E 2A0YA 3SLKA 1XTSA 3IDAA 2NXWA 2PNJA 2DCMA 4EUSA 4PGGA 4BNTA 2CBZA 8ICQA 2OV6A 2ZBDA 1D0IA 2O59A 1JTEA 2ZSBA 3ENVA 1K8RB 2PI5A 4FEAA 2QMZA 3TEZA 1BD4A 2ZTHA 4GLFA 3ZGZA 3ALRA 3ZJYA 1WDWB 3ZWQA 2NV3A 4CDNA 2PN1A 3DD1A 1XTTA 3I9FA 3V46A 4MTLA 4CM9D 2FXIA 3IKVA 2AFRA 4OJMX 2XGOA 3BXFA 4NNJA 4BAUA 4TRNA 4N82A 3ZY6A 3AERA 4JUFA 5ETJA 4F11A 4F7DA 2QG6A 1CDEA 1JWAB 1UGMA 1XO3A 3NWJA 3KVVA 3KUDB 5IVKA 1ZP6A 2I7CA 1FL9A 2A59A 4J3NA 4UUOA 3JPYA 5KREA 2AL7A 1V4VA 2J0EA 3OSNA 2LYHA 3KU4A 4KQKA 2IOQA 4Q4HB 4DRZA 5C4IA 3SE0A 1Q5WB 4ZYUA 1OFFA 2OWEA 4R1TA 4KITB 2V6IA 2QRGA 1KMNA 1SD5A 4BMOB 5YASA 4MM3A 2BVCA 3WNZA 4GM1A 2K2WA 4B6JA 1GV0A 2QN6A 5EWJA 2AU0A 3KQPA 4FWTA 1PYDA 4FCWA 4C2TA 3BWUD 1PL6A 2ZJ2A 4TV9F 2XMGA 3H4VA 1RWVA 4L9AA 4YR7A 5F2EA 3FDXA 4JV5B 1AXGA 3QPBA 1IBLB 1KK1A 5DG8A 2J46A 3E6AA 2WOJA 5JAOA 4WCVA 3HWSA 3IJRA 3PGJA 1TFUA 4DN6A 1TQDA 3E3NA 3TXXA 3N2EA 3FILB 1A1SA 3AZOA 2D5AA 3F6CA 4LDNA 2Z08A 1NF9A 4ARIA 5IPFA 2ZROA 2C2HA 4IEEA 2OCDA 2ZVPX 5LC1A 4MGYE 1DEAA 4IVQA 3LLVA 2BFOA 1AS2A 3R8FA 5HIJA 4RJLA 3MRXA 2E2WA 3DO5A 1VHLA 4X41A 3ZXUB 1SAYA 3NI2A 3ODPA 3ANYB 3TNLA 1BU8A 3PGLA 4DSIA 5KOJA 4DNFA 2PTHA 3Q8BA 2E5WA 3FBTA 4B4DA 1BXKA 2H9YA 1T24A 2E4AA 2BBCA 5FWXA 1QKKA 2H2GA 2J5RA 3HH8A 4IVPA 2W0SA 4FNGA 3LO5A 1L5VA 2G76A 2B61A 2KFZA 4HWRA 2HHUA 4Z4CA 4MKZA 1YU6A 3OD1A 2O8EB 2W8ZA 1EWRA 3ZCQA 1IWOA 2ODGA 3TX2A 3ONSA 1FX0B 3IV9A 1YRYE 5IX8A 4TYWA 1R0LA 4D92A 2P6MA 3CVWA 2XVTA 1HSOA 1VHQA 3BFPA 2IHUA 3ETGA 1BW9B 5LIRA 2VJMA 3E1GA 3KALA 3PNPA 4ID9A 3DFIA 4P5DA 1TA4A 1AF7A 4A8JC 2XUDA 2J7PA 4XIJA 3U49A 2WZQA 1EWQA 3T3GA 3UWDA 1GYPA 3GNSA 121PA 4KFUA 5HR6A 4U7FA 1D4ZA 3MDAA 2W6ID 1T5XD 4YWGG 3TIXB 4NCJA 4YP1A 3ENEA 3NRZA 1Z56C 2KJHB 4CLRB 1SUAA 3PFNA 4KMOB 3DOIA 4XLTA 5KQRA 4QNMA 1F77A 1Z0KA 4ZI2A 5HILA 3FAHA 4L74A 2EAMA 4HDKA 4C05A 1RYUA 3PSTA 2OFPA 5CIYA 1SG0A 4U6QA 1WV0A 1B1ZA 1C1DA 4H1HA 4J43A 1K89A 1U2EA 3CLTC 1AM4D 3QWZB 1AKYA 2VZKB 2BEKA 4NY8A 2DZDA 3PT9A 2DGDA 1F1BA 4I19A 1DBQA 1Q22A 2BGNA 3BE4A 2P65A 1W4BA 1XRNA 2HV8A 2AJBA 4IRCA 2D2EA 1V1PA 4F2GA 5JDIA 3VTVA 1QLWA 5JYBA 2OO7A 2DY1A 4KRYA 1X2EA 3ZOKA 1BXTA 4Z3KA 4DLLA 3CX6A 2IYPA 1XSNA 4I14A 3L8FA 3AW8A 4D6PA 1NULA 4RVHA 3CEJA 4AKIA 1N2CB 2QUJA 4LXTA 5FUQA 2BBTA 1DWPA 3TLAA 4L4SA 5HR5A 2FJ6A 2JIDA 5KG0A 5GJWC 2O48X 1BN7A 2FGJA 2Z83A 4F4JA 1UBTS 2X42A 3SJCA 5EN4A 3AY3A 5KG4A 2A5GA 2DQKA 2H16A 4JQCA 1GUYA 1DG9A 3QHTA 5J59A 4RKRA 2I2DA 4C7VA 1TADA 1ZLYA 5C35A 5CXSA 1LLFA 1ZO8A 2FLNA 1ZQMA 2O6KA 1GXSB 1ZNXA 3MGCA 2GD2A 1ICEA 4ZEXA 2PZBA 3BGOS 1VYHA 5E7JA 3QAQA 3I5AA 3JSXA 1NXWA 2PBFA 2PMWB 5BSHA 4QDJA 4AN0A 5IF9A 2O3TA 1HNZB 2IYTA 4MUKA 4D3XA 2M56B 4NHOA 4M76B 2RD0A 3NLLA 2Q5EA 3RB6A 2QTHA 3QU2A 3DZGA 3PWZA 2G3QB 5E3IA 1RACA 1EDBA 3W9UA 3EXIA 1K8ZB 2REXB 2R66A 2YW2A 1L5ZA 3O8OA 3QV1A 3TWOA 3IIKA 1GOTA 3MINB 3T7JA 2DULA 2ASQA 4QFCA 2C9YA 1O77A 4CM8A 2OYRA 2A7XA 5LYJF 1BEZA 3A3KA 1Z4KA 2WXRA 3TRHA 1QMPA 3D4LA 1NVGA 1ODJA 3MIZA 1LF5A 4GXNA 3FOFC 2FSUA 3ASUA 3MN1A 5KSYA 4L15A 1RHQA 5U1PA 1WOYA 4YT8A 4BP8A 2VWGA 5DN6D 4CMCA 1L4BA 5LKAA 2XA2A 4FJZA 1LCIA 4O6VA 2HN9A 1O0BA 1R27A 3U4AA 1SGWA 1FRQA 4ZOLF 3CC8A 4WASA 4ACAA 3IQWA 4GOMD 1FP4B 3QQPA 3UNXA 2WMYA 3ZU4A 2QORA 4MPRA 1CQPA 3L8HA 4G84A 1FO4A 1Q44A 5MFPA 2PVGC 1L4EA 4WVLA 5GOTA 3AHJA 3D59A 3C28A 1PVRA 4OOFA 2HR1A 3KVOA 2I34A 3N0RA 1N1MA 5LOVF 2FUCA 4NLZA 4O2BA 3RANA 5B12A 4MHSA 3RB3A 3C2KA 1GQQA 1DJMA 3DEKA 1LI7A 3VI3B 4TS9A 1P7FA 2PJRA 4RPJA 5GONB 4DV7B 2WT9A 3ESYA 1QBKC 4P9NA 3UCEA 2E21A 3RABA 1HA3A 4KKJA 1CQZA 1X9SA 4MH0R 2Z4RA 8ICTA 2JCSA 1PFUA 5CAEB 4LAFA 1ZHHA 2CDBA 4MF2A 1P4HA 2AEHA 2X58A 3OA2A 1XTVA 4HT3B 4MMYB 3SG0A 1KEKA 1Y7HA 1H8HD 2FU5C 3U3MA 2CF6A 2EDUA 2G4CA 1L6UA 4CMKA 3PP8A 1UBUS 1UMDA 2YNMD 3PEWA 5K0FA 2HJSA 5HCNA 1WDTA 5BT8A 1CZLA 3AP2A 1RC0A 1GAXA 1ZI6A 1NE7A 4ZJYA 2V7WA 1N9GB 4NZMA 4R8SA 3FRJA 2O3UA 1EUCB 2P11A 2G4VA 4BEVA 2OO3A 2WLTA 1YBHA 3OC0A 2C20A 2NUPB 4B7XA 3V6KA 4W9NA 4DQXA 1Y63A 4ZMSA 1KETA 4CKBA 2JZPA 2O2ZA 3NAGA 2JA2A 3HLKA 4JB0A 3DLCA 1UBHS 4AX4A 2W9CA 4EKYA 3WLAA 4DABA 1FU4A 1DELA 3IO3A 1WB4A 2FWBA 2I2XB 4TTSA 4DUYB 5IFKA 3EDCA 4DFDA 4Q44A 2XCRB 3HXQA 1KK2A 3V34A 4LF5B 4HLDA 2XNAC 2XEXA 1XTPA 3ZVVA 1NTRA 3V7JA 1NOIA 3FPCA 1Q11A 1E3MA 2Z2IA 5M3BA 5EC8A 4GFDA 3A4TA 2RH9B 1JQAA 3LXFA 5H82A 4DIMA 4V0SA 3GEGA 1ZQAA 3T7IA 3G6VA 2FJUA 3LLMA 2ZXHA 4KQIA 5LMCA 5MFZA 1APBA 5ADHA 5EJIA 4R84A 2A1IA 9ICMA 4K3CA 1Q0RA 3A0HU 4WAFA 2FPMA 4G0WA 2GFIA 3QLVA 1PX2A 1BXRA 4KXVA 3L8ZA 1WDLA 1ISIA 2E1PA 2Y0SC 2BFCB 3V4VB 3TEMA 2NU9A 1TQ8A 2B7LA 1FS5A 4TSKA 4G8BA 3SD5A 1SXIA 1E96A 3PXUA 4OGWA 4RXMA 2E3TA 2XD4A 3CRRA 1PGJA 1LBQA 3ORYA 2PZAA 3DULA 3KETA 4HVTA 3AP1A 1Z07A 4UXHA 4C89A 3THVA 3UQ2A 4BBNC 1KO1A 1UQRA 3GIIA 4KUHA 4AJKA 1HE3A 1CJCA 2IH5A 4HNSA 4ZRNA 3I30X 4KNWA 1TBEA 2QVGA 2MW5A 3HO1A 4DJDC 3PR1A 3PC4A 4EY5A 5CNIA 1E9DA 3HBAA 1G3MA 1VSQA 2I8LA 3ADPA 4NQZA 4Z9YA 1J25A 4KQ2A 3LZDA 1NI4B 5HM6A 5BNWA 1DJLA 3BXGA 3TNYA 4UBBA 3SC4A 2BD0A 2JH9A 5BR1A 2GMIC 5C5CA 3TSZA 3T35A 2FK7A 4IIHA 3ZX4A 1DDIA 4RNDB 2OV8A 3RPEA 4RA6B 5EWMA 2JR5A 3GMTA 1TUBB 2KI5A 4ZQIA 5FT9A 4L50A 4R51A 1YVDA 3UZUA 1JEJA 3OURA 1BXGB 4POOA 1XZKA 5INTA 4EY7A 2KSQA 2IYFA 3VVLA 4OJQA 2F1KA 2GK6A 1V48A 3BQTA 3PRMB 5IC5A 2JFFA 4L57A 1E8XA 4IXMA 3NGMA 1CFZA 4G5GA 2FPGB 3NAMA 3IUMA 4M88A 4WACA 5I6DA 4MA4A 3V6LA 3NBQA 3W5BA 2WXLA 2DR0A 5A0TA 2P3SA 3PC7A 3PFHA 2OV2A 3N8GA 4Z4GA 4V3CA 4PZ9A 3VO8A 1WX8A 3INNA 4YQWA 5AHKA 1T1RA 1OBHA 5C8DA 1NKBA 2IA5A 2I4OA 2KX7A 2QVYX 3AL3A 4QUDA 4W7IA 5CX1A 5PNTA 3BYZA 4BNHA 4O5OA 4IQFA 2GLXA 4RIEA 4YLEA 4BLVA 4NCNA 2XV1A 4LK2A 2JUOA 1DDGA 4FYVA 3KS9A 3AZPA 1GTSA 2H2IA 4CMAA 4CU2A 4NICA 1QGZA 3GLHA 1XJQA 4N76A 1PGNA 4BVLA 3X1MA 4TTAA 1SK9A 5CJ2A 2MTBA 4OQDA 4W9JA 4OGLA 4BFSA 3WNQA 1YZNA 1SXJC 5DYGA 2LUEA 4GBED 1D8TA 2ZRQA 3GFPA 3Q3MC 2GJ4A 4I6EA 3UMSA 1TGZB 3C3PA 3OEED 4MS4B 3RU7A 1E8YA 4ZO6A 1UBIA 4EJSC 3PY8A 3N8KA 2AN1A 1BMFA 2OFOA 1NLZA 5FIUA 1V6EA 4WESA 1NMSA 4WJOA 1TJ4A 1YQ3B 1OT3A 3BXXA 3MMZA 4HB2A 3CM0A 5F64A 3WGNA 2XAAA 3RH6A 2VCEA 1ZRNA 2ZYGA 4EPXA 3QQ5A 2A9VA 3VOBA 1Y6GA 1B1AA 3ROFA 2N7DA 1PFWA 4XA5A 4KIUA 5K3OA 1YBFA 1ZNYA 4A8XC 3Q3HA 5E38A 2JVKA 4LNHA 1NAHA 2VA3A 2ZUWA 3AUUA 3QP9A 2BKFA 2XYPA 4NBNA 2PK3A 4ZHQB 3GD7A 3AUJB 2I6FA 5A7GA 3CLHA 4DA0A 1GYRA 3MGVA 4DXDA 2E4ZA 3ZHVA 1EVIA 4L27A 2OOBB 2W0MA 3WLNA 1PR6A 4W5QA 1FZTA 3WC4A 3QZUA 1C3OB 1PJBA 3EXFB 2QSDA 1I6LA 4QYMA 3QVLA 2PCLA 3GCWA 1T9CA 1JPNA 3HRKA 3E4DA 4L51A 1QYVA 2FUNB 2PX0A 2ORYA 3FAKA 1V1MA 4GNKA 8ICCA 4P6VF 1PS8A 1KHTA 1NJWA 4WQMA 3UGKA 3A1QA 3PL5A 3GT4A 4NDAA 3O2NA 4ED3A 4IPTA 2BHSA 1AU9A 2R44A 4DQSA 2JGDA 1DBRA 2C4KA 3DCGA 2AX3A 3MAGA 3T5BA 3JSAA 2PMEA 3DW1X 3FPLA 5JSHA 1QOAA 1Z16A 3BH7A 1Y8RB 2EEZA 1X1AA 3V05A 3F6PA 3ZTCA 3H19A 5KWVA 1L5RA 2O7QA 5J4LA 2ZITA 4Q5IA 2LKYA 1DQRA 4MDEA 4NCIA 1DWQA 3OG9A 3OZ7A 2GNOA 4HDCA 3CSUA 2Y1DA 4LY3A 2GKOA 3H3FA 4G1MB 1NONA 3TDNA 3QU7A 1WUJS 4OXRA 1JXOA 2EHJA 3T3NA 4HQNA 1VJKA 3WR5A 4RJTA 3GEIA 4LTNA 2VJAA 2HOIA 2KK0A 1FS4A 5EZQA 4UHCA 1YQBA 3DWMA 1X8KA 3EA4A 3PX6A 4Z3OA 3U61B 5CWRA 3RRXA 7ABPA 3UGJA 3H7AA 1WF9A 4EZEA 2FDCA 2QIOA 2ZR9A 1U0SY 1KJ8A 1NZPA 4PSCA 2MSNA 3N7TA 3TAXA 5TF0A 2QYTA 3DA8A 2GLSA 1QORA 4NL9A 3RUIB 1F2TB 1PWZA 4HDNA 4D42A 2V98A 4ROTA 5EPUA 5LA6B 1GZVA 3PTFC 3NOBA 3EODA 4GGMX 1K5PA 4Y2GA 3UUEA 4N8DA 2HI0A 2FEAA 2RK4A 1GEGA 4MEAA 1UWCA 1QRDA 1A71A 4PVDA 4FSDA 4CL3A 2VHTA 3TUOA 2JGNA 2R8EA 3JCZA 3Q2OA 5IAJA 2D1FA 5EP2A 3TX6A 1T4CA 4XW2A 3PQ7A 3RYIA 1F20A 4CEIA 4NYJR 4G5FA 3ERCA 4W5RA 1EB8A 2G06A 2VO1A 2PFOA 3CZQA 3P1MA 1JG1A 1VL1A 4TSFD 2IYVA 1GA1A 5JMWA 5ALIA 1GZ5A 2EFGA 4MVCA 1TU4A 3KZXA 4ZV7A 3K53A 1NBMA 3L5OA 2CFTA 5KNBH 3NIBA 4LE2A 1JSLA 2RHOA 1SURA 4KQWA 4UUNA 1STOA 4ZZ0A 1ACLA 1E6WA 3PICA 3A32A 3A6PC 4RMHA 2C8JA 1VI2A 1G21A 4AWBA 4UASA 4IQTA 5J9FA 1GT6A 1FSSA 1GAEO 3UFXA 2H63A 1FXAA 4JI8B 5AVYA 1FYDA 2WD9A 2NVWA 9ICIA 3IM1A 3DVSX 3K30A 2M6RA 1TY0A 4A3OA 5CFRA 5C9ZA 2K4PA 4QWCA 4U39A 2GDJA 4D4HA 4LF7B 1VYTA 1URJA 2R1TB 5F35A 3WIVA 1AF4A 1GTJ1 1QM5A 5IJXA 1RAXA 4YSZB 4UOQA 1SKYB 5G0TA 2CN1A 2VNJA 1WGDA 3PGEA 2AXNA 3L49A 3A28A 3C8DA 5KCMA 4B3HA 1DG1G 2FHPA 5CVTA 1G20A 3HU1A 4M0CA 3JPRA 3H0MB 3H2YA 4DHJB 3DT9A 1P7EA 1FNDA 1U2DA 3PHXB 3FDZA 3RROA 1TJ5A 2QENA 4OQNA 4OMUA 4CHTA 2VTBB 2BY4A 4HAUA 1REQB 4NOMA 3DCIA 2J4FA 1XR3A 3IUBA 1FFWA 4YMLA 3PR4A 3M5PA 3GDGA 1KGSA 3DVQX 4FILA 5AVQA 3HRDD 1ZE3D 4O4IB 3W6PA 1RKQA 2DH5A 3WAKA 3SBXA 3K4QA 1TAQA 4IS3A 3GGCA 3H5LA 3GJ4A 3AGPA 3E70C 4LN1A 1Y9JA 4MVXA 2P6OA 3DF7A 3M6MD 3OX4A 3KJFA 4RK4A 1JDSA 2GK3A 2MU2A 4URYR 4MS1B 4EDHA 2C7VA 1QHFA 4QZIA 3SV3A 3DQZA 4BO1A 4OW0A 3C2MA 4YMTA 4EHLA 3PSFA 4AUKA 1X7YA 4PTLA 2VHJA 3U7ZA 5T4BA 2ZJ8A 2O57A 4TQ9A 3HGTA 5BMGA 2MSEB 5T8IA 2V7TA 4P0PB 2BH2A 4FS2A 1DJPA 2LZ0A 1ACCA 2XB4A 4KBYA 5JIBA 3F8WA 2W48A 3WB9A 3JAKB 2YS7A 5KAFU 2I7DA 3QXSA 1S10A 2NV0A 1YDHA 3SYZA 4S2EA 3E58A 3RYFB 3WL7A 3TOVA 2Q4BA 4TM7A 1TEXA 2C0CA 2Q49A 3ZY3A 4KLLA 2AOTB 4X1OA 1Y8AA 1M33A 3NVVA 3EEFA 2Y4OA 2P27A 3M9XA 4Y2VA 4AF6A 4Y2TA 4XPZA 1L3UA 3OZAA 4N49A 5T4HA 4RGYA 1V86A 3A25A 1RG6A 4M0FA 5DBFA 2DRIA 8ICNA 2V96A 5AVUA 2FSSA 1P7PA 4MR7B 3VPXA 1F8GA 2A78A 1AY0A 5KTKA 5CHWA 3DUFA 1RLJA 1OIVA 1W44A 2VP0A 3RH5A 1YFKA 3B5JA 4PXYA 4BB5A 4L0DA 4CT0A 2ASLA 3IQFA 2GZDA 1S4QA 2I54A 2XGSA 5HUHA 1X9XA 1M8FA 4FD2A 4XGRA 3U13A 5KTOA 1M1NA 3U3DA 4PPXA 6LDHA 5TSDA 5C8VA 4BQFA 3COVA 2DYKA 2ZAYA 3NJRA 3SVZA 2M0AA 5DM60 2Y99A 1M10A 4KQ6A 3MT7A 1G8MA 4UAYA 3OJUA 4XUDA 2ZATA 3HZOA 3KQNA 3GLTA 1NT4A 5F2OA 2JIMA 5K45A 2D74A 3S2AA 1G3IA 5DT9A 3IOYA 3Q88A 1KTKA 3E7DA 3R7LA 4CQNA 4H7FA 2NPTA 3RRHA 1MZVA 5H68A 2KZZA 3FYCA 2PXCA 1UELA 1ZUNA 4L4ZA 3LVQE 1DJNA 1R6AA 3NBYC 4GGQA 3RT1A 4AP6A 2Y9UA 2ZRBA 3CCCA 2FPXA 3R40A 8ICXA 1XVAA 4ZGWA 1HG0A 3O8QA 1TZ2A 4YFYA 4TURA 4BQSA 2Y0EA 1MGOA 2M1ZA 3CZ4A 1Q15A 1KYVA 5AVRA 4KOEC 4QZAA 3UJCA 4RMJA 5H5JA 2XI4A 1GT91 4UBCA 3LECA 4MYDA 4MVYA 2HCBA 3MCWA 5HCIA 2HCJB 1G5TA 4V0NA 4GI7A 5AHXA 1I14A 5JJ5A 3VNVA 2BONA 2WJZB 4RW0A 4ZHPA 1OBVA 1C5KA 1QPGA 4HYQA 3NOQA 4C07A 2EBFX 3IAHA 4CO7A 1U8XX 1HZZA 3K5WA 1CUKA 2FPKA 4PJ0U 1JKFA 1ECBA 3GGOA 1RJFA 8ICHA 3ADOA 1AARA 2RC5A 4ICUA 4MVJI 2Z8LA 4UMDA 3THRA 8ICWA 2VAVA 3QENA 4HGNA 3UMJA 3P4PB 2J32A 2QGNA 3BTVA 5FI3A 2AYZA 2INDC 4B3XA 2WB1F 2FZKA 4CIXA 5K0JA 1YVEI 4RGQA 3KDSE 3FDJA 1KJ9A 5BR8B 5ADWA 1SVKA 3KTAB 3KWFA 3RSFA 3MQ2A 2R8PA 3MBYA 1UQUA 4B2PA 4D4LA 5AHWA 5LZ2A 2A57A 3C8HA 4OHWA 2GM3A 1EFAA 3D0QA 3EHDA 4EW2A 1LPMA 3OIFA 4MLPA 4B0PA 2ZB7A 3OF5A 4M9ZA 1GRVA 1JNXX 5G0SA 4PZ0A 1Z2EA 2QUHA 1QE0A 3A4LA 3RN9C 3ZWWA 1WAMA 1YBVA 2O2XA 3A9TA 4IIYA 3EY4A 3RGGA 4IW0A 2I4RA 3H1AA 2FOXA 5GTIU 3TJMA 3BSYA 2NXJA 1XKXA 1Z22A 2VEDA 3HW8A 4F5DA 1AKNA 4ZC8A 2W2NA 5JD5A 4Z4FA 4IXWA 2Z57A 4F4IA 3SCZA 3UB3A 3ZDZB 3CX7A 1V5WA 3UAVA 1ZITA 1W93A 1KMIY 4KFTA 2JLCA 2Q2VA 1MV5A 3OBIA 4RUAA 3QH4A 1HE8A 2WJWA 4UM8B 1ZUIA 2BBWA 3D0OA 5JW6A 4YCXA 1ZZEA 4CI9A 1T2CA 2QNRA 2XT9A 3JWIA 4ZPXA 1UJ2A 3BHIA 1GPH1 3EFBA 3C41J 3DJYA 1D3ZA 1QNLA 1YJXA 5FA6A 4C2AA 2OQ2A 1NN5A 3IAXA 5A3SA 2H2DA 1E1DA 4UU7A 3MFGA 2FPIA 1UBOS 3A1FA 1I51A 2DM6A 1DKUA 1JNYA 4ZO4A 2LMRA 1JXEA 3U4DA 2EZZA 4MQFA 3VDRA 1V71A 3PK0A 2OEPA 2BDTA 3PNYA 2KTFA 5JAZA 3DWFA 3NC1C 1MJNA 2O0HA 1F9JA 4TMZA 3QVUA 2B6GA 2VIIA 2IYNA 1RRMA 3O9VA 3C7CB 5NULA 4DJEC 3OQ6A 1NRXA 5E1DA 5KWIA 3EZLA 3QNMA 1FPMA 3S6JA 2AG0A 5TPWA 4B4VA 4F8YA 1GYQA 1E1KA 5KAIU 1V8CA 1IZ0A 1II8A 3DQVA 3TR6A 3UOGA 3JPTA 4X1IB 4EG6A 1FJXA 1IZ9A 5JDIC 1TYBE 4S1NA 3RI7C 3E03A 1Q1EA 4YTMB 2XVZA 2VHYA 1Q46A 2O2JA 4DGQA 3HIZA 3KKZA 2QBYA 4R65A 5F5NA 5K03A 1T8UA 3NBUA 1UXGA 4LSMA 1MIOA 4DSOA 4BZXA 1VIDA 4QOEA 1LGRA 5JFGA 1JCKB 2P9GA 1ZOOA 1SIBE 5I7EA 1O95D 4EK9A 4GN1A 2HCFA 4X5OA 1N7HA 1E7RA 3PR3A 3BX1A 2TRSB 1H69A 5DB7A 2WM8A 1Z06A 2PMBA 3EFOA 4DCUA 1MR3F 2KWVB 3E9EA 4FXPA 2ZB3A 3ZNGC 4PPGA 4ES6A 3L08A 4DS5A 1T9HA 3N2IA 5DGTA 1G18A 4TOIA 3BAFA 3WBJA 2O4CA 1ZQYA 4G0OA 4RHEA 4HTFA 1P2BA 1UP7A 2D1QA 2DQZA 3TUJC 3BJYA 1PK8A 3D7NA 2AL6A 2DTDA 1TTNA 4ZO8A 2HIAA 1WHSA 3G2QA 2HV9A 2ODBA 3H4DA 1D6NA 5KSOA 4DL7A 4XA8A 3TMPB 5M2QA 1WZEA 4ZTBA 3UJDA 2LGJA 2VI5A 4WX2B 3UMYA 2AFIE 4LBVA 2F6RA 3DFKA 3T1HB 5JSZA 5JO9A 1GDTA 3VHQA 2XCAA 1HTBA 4CL0A 3EAGA 2FFBA 4IWYA 1K5OA 5KPJA 5EMMA 1X8XA 3U7DA 1FRVA 1XU7A 3A1DA 3GZFA 1BE8A 4YI5A 4DSUA 1NVTA 5D7BA 3P9NA 3ZW8A 3CE9A 5KTTA 4G1VA 3AVOA 3HT3A 2Y1FA 3EG9B 1S1QB 1C8VB 1QQRA 1KE1A 1VLLA 1C78A 5EE9A 5HHHA 1DAHA 5U9CA 2CFCA 5DLQC 2F3TA 4FN2A 2G1JA 1Y33E 1ESMA 1EQ2A 1K8XB 2W22A 2VDJA 3JATA 2DUMA 5ITVA 2WIJA 4PLTA 4KU4A 4NK5A 1I3MA 3M1AA 1E0KA 4PWYA 4FIDA 1Q57A 4MSUA 4ZT4A 3E2MA 5E6RB 4J1TA 2LHTA 2Y5CA 1TXGA 4PZLA 1TAUA 4ZCPA 1GITA 3AE4B 2LZ6A 3PRPB 3U44A 5L51A 3W0LB 4WLVA 1JRUA 3QY0A 3TBFA 1GG3A 2HM7A 4XIFA 3U0BA 1TYDE 2CLMB 2XGMA 3S4YA 4K3UA 3WLLA 2VSQA 3FOEC 3CY6A 1TYEB 1PVDA 4MUIA 4JOCA 2QTBA 2PGLA 1Z63A 2G83A