5EE3A

Complex structure of osychf1 with amp-pnp
Total Genus 110
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
110
sequence length
374
structure length
357
Chain Sequence
ERPILGRFSSHLKIGIVGLPNVGKSTFFNIVTKLSIPAENFPFCTIDPNEARVYVPDERFDWLCQLYKPKSEVSAYLEINDIALGNAFLSHIRAVDGIFHVLRAFEDKDSVDPVRDLETIGEELRLKDIEFVQNKIDDLEKSMKRSNDKQLKLEHELCEKVKAHLEDGKDVRFGDWKSADIEILNTFQLLTAKPVVYLVNMSEKDYQRKKNKFLPKIHAWVQEHGGETIIPFSCAFERLLADMPPDEAAKYCAENQIASVIPKIIKTGFAAIHLIYFFTAGPDEVKCWQIRRQTKAPQAAGTIHTDFERGFICAEVMKFDDLKELGSESAVKAAGKYRQEGKTYVVQDGDIIFFKFN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title ATP binding by the P-loop NTPase OsYchF1 (an unconventional G protein) contributes to biotic but not abiotic stress responses
pubmed doi rcsb
source organism Oryza sativa subsp. japonica
molecule tags Hydrolase
molecule keywords Obg-like ATPase 1
total genus 110
structure length 357
sequence length 374
chains with identical sequence B
ec nomenclature ec 3.6.5.-:
pdb deposition date 2015-10-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01926 MMR_HSR1 50S ribosome-binding GTPase
A PF06071 YchF-GTPase_C Protein of unknown function (DUF933)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.300 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 TGS-like domain 5ee3A03
3.10.20.30 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 5ee3A02
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 5ee3A01
2NQ2C 4ZDWA 3N2IA 4YSXB 4CEIA 2GBLA 1PZNA 4L16A 3SS8A 1JXMA 1KZGB 1OXXK 1E98A 4JVSB 3SBDA 1NN1A 3AVUA 4LX0A 2A30A 1RYJA 4PSVA 2JEOA 4QNMA 4URZR 4WXRA 1CU1A 3QIAA 4PANA 3THXB 3EA5A 2X2EA 4RFVA 2WPDA 1MO4A 3LBNA 1A7JA 3IBYA 3L8YA 3TH5A 2JX5A 4DLXA 3A1SA 4C7OB 4M2LA 3ZYYX 3W9YA 3GCGA 5EJEA 2DBYA 1FNNA 2BBTA 3U5ZB 4QGGA 4PXAA 2O8BB 4KJZA 3F3YA 5DSZA 1NG1A 2BM0A 2NGRA 4EQ6B 3DM5A 4EFMA 1MOZA 4HSEA 2JLYA 2MSEB 4LYFA 2L52A 1E9AA 4YQFA 4Q4AA 3P4QB 1DADA 1BIFA 1N63A 3QXJA 2MSCB 5JEEA 3ADDA 2J0UB 2ZJ2A 1JECA 1K5GA 2A5FA 2QBYB 3WHKA 3DM9B 3WCQA 5CITA 1UEJA 3AF2A 3U7FB 4Y0VA 4OQMA 1CR4A 3FKQA 4E07A 1F2UB 1L2TA 1XJQA 2BBSA 2OFOA 1E2IA 1E9SA 2VP6A 3BRWD 4IEEA 3BFKA 1U94A 3NVYA 1JR3D 3SFVA 1CRPA 1SVMA 2IHBA 3OIYA 1YZNA 1E0AA 2JAQA 1G3RA 3QXSA 2MH7A 1GPXA 1G18A 2IYSA 4ZHOA 1RRCA 2QBYA 1SKYE 2QRZA 2JJ1D 3QKSA 4LC1A 5H92C 1E2MA 2JLUA 1DOYA 3RC3A 3OE7A 1E2DA 3KX2A 2G3YA 1F2UA 4HAYA 1AGPA 3IEUA 4M53A 2VSOA 2CK3A 2YKGA 2P5SA 3NXSA 2KWIA 4WIAA 3K0EA 3L43A 4FINA 4QBFA 3AEDB 3ZYCA 1XX6A 1W4CA 3HRDD 1ANKA 1XJCA 4LZZA 1A70A 1FL9A 1OIVA 3RS5A 2DCUA 3A6PC 4PC1A 3AKYA 4D0GA 1P4SA 4UKDA 2W55A 3BAFA 1RJ9B 4TLBA 3L82B 1LS6A 1VHLA 1Q1EA 2FSGA 5JMTA 3FMPB 3D3QA 1II0A 4GL2A 3UG7A 4UXIA 2A5YB 4N0EA 2LKDA 4GI7A 1OB2A 4MRPA 2J7KA 2JDIA 4HAUA 3F0TA 2YVUA 1KO5A 1V5WA 1TNDA 2GK7A 3N2EA 1QF9A 3TSWA 4X8OA 4X8MA 3O8DA 3AP1A 1YQ4B 4JLAA 1X6VA 2O8DB 2NTYC 2XSZD 3R7WB 1TF7A 1NG9A 3K0CA 3DMNA 4Z8XA 3T15A 4BLSA 1Z0AA 3ZS9A 5JCZA 5SZHB 5BW8A 5FTLA 4JBXA 3U7EB 2WP9B 5D3MB 2AFHE 2EW1A 3TKLA 2GESA 3W3AA 4Q9JA 1IHUA 1P2VA 1KO4A 4PAMA 3RS4A 3CPHA 3EC2A 3MUFA 4IXMA 4HLCA 4YSZB 4ON9A 1OB5A 1H8ED 1YKSA 2FU5C 3EC1A 1ZNZA 2O8EA 2REBA 2BCJQ 2OCBA 1TEVA 3BB4A 3FKSA 1FP7A 1X3SA 2RMKA 3TK1A 3GLIB 4CEJA 1RM6C 1XD2A 2LKCA 3L4PA 1NBMA 5KNBA 3VRAB 1WWTA 3LRPA 1T0HB 4BEJA 1U9IA 4AK9A 2BIFA 1XBTA 1VJKA 5KNCA 1RJ9A 4OI0A 1CKEA 2OHFA 1RE0A 1OFIA 2HT1A 1QRAA 1FNMA 3RNLA 2WTUA 3BC1A 2V7QA 3ETLA 1S96A 2GEVA 4JLVA 5SZKB 3OIVA 2ORVA 1PV4A 3UANA 3FC4A 1TU3A 1QOFA 2IYZA 4F4IA 1FP6A 3KUDA 4HZUB 3GLHE 4C0BA 4D4MA 3U2QA 4JBWA 1M7BA 5FPTA 3PQCA 1HV8A 1WYGA 1COWD 2JJ8A 3EASA 2FEOA 4C2TA 3QPUA 1ZIPA 4UJ3A 5B30A 2XOKA 1YRAA 5E4FA 2GVZC 2ZRHA 3AEGB 3NH6A 3QI2A 2JLSA 2GRJA 2FX3A 1CIPA 5D3MA 4Q47A 4DSOA 2VQSA 3D7MA 4ZO4A 3L0SA 5CYPA 2EFHB 3CF0A 2Y8EA 3ZD6A 2ZI3A 3DEFA 5CK5A 4CW7A 3KFXA 2QE7D 4FWTA 1GILA 2RHDA 1N6OA 1OV4A 1VG0B 3A1TA 3NBXX 4V03A 2ZE7A 2OAQ1 3SFDB 2OZEA 3W5JA 4E03A 1S9HA 2ZE6A 2QM7A 4W5JA 2HTME 3IPYA 4QHSA 1DBSA 4JKIA 1AS2A 4WBSA 3UATA 2Q3HA 3EIHA 4BASA 4C7OA 2ZREA 4TT3D 1G1MA 2ECKA 5BQ5A 4RZ2A 1F3OA 4XTRA 4D4JA 1ZAKA 4E22A 4M9SA 1GOTA 1SVIA 2WJIA 3G0HA 1AKYA 2WLBA 3T12A 4TTRA 2F9MA 2QN6A 2XSZA 3Q5EA 3BFVA 2B21A 4GPTA 4WAUA 5AR1A 2YWFA 2HT6A 4QBGB 1JJVA 3VKHA 2AXPA 1NF3A 2Z43A 2RGNC 3BH7A 1YRBA 3UWOA 3THWB 3SNHA 2ERYA 5KSYA 3FKSD 4JT4A 4TYNA 4F7WA 1UBFA 1HURA 2QMUA 1FFUA 1YJ5A 2NG1A 1D9ZA 2WZQA 3C15C 4UXHA 1I2MA 4DLZA 2VO1A 4HAWA 2Q9AA 3QXHA 1N6KA 3GLGA 1M2OB 2ZUBA 1U0JA 3GJ0A 4V0NA 4AD8A 1BO6A 4BLPA 2DWOA 2PZGA 3SYLA 4Q7JB 3U4QB 2IUSA 1SZPA 3ZDQA 3O8BA 3RS2A 2QQ0A 2ZI5A 4HROA 2H7VA 3E2IA 1DO2A 1IY1A 3PO0A 1PFDA 1GL7A 2ORWA 4M8NE 1NBME 3T1VA 1SVKA 1WP9A 5CJ2A 2QTHA 2WJHA 2DY1A 1II9A 1PUIA 2F55A 4G5QA 1QZXA 1S3GA 4PSAA 4TYYA 3B9QA 3KJGA 2NMVA 4C0AC 2CXXA 3NTUA 4PFSA 4NYJQ 2FDCA 1W2HA 3U4QA 2CHGA 3BB1A 4A6PA 4YXWA 3ZLJA 1XNJA 3LV8A 3WMFA 3TW8B 3OAAD 1VHTA 1E0KA 5KSOA 4IDIA 4LV6A 4PQFA 5FOUA 4DSTA 4TYWA 2AR7A 5CLQA 1OIWA 3C16C 2D2FA 3LDAA 2ZTSA 3RSLA 4AKGA 3IPXA 1ZUHA 1K6MA 2D74A 1W36B 1KF6B 2CHQA 1DAIA 1RRGA 2IYQA 2R44A 3B2EA 1FZQA 2EYUA 3VU9A 3AUYA 2WKPA 3WYFA 5BN5A 1IXZA 1NI3A 3ASYA 1ZW6A 1XJ0A 1SHKA 3AGQA 2JLRA 4IJMA 4Q1AA 3ZIAD 1T5IA 4CRWB 3GLFA 2RAPA 1X8KA 2R6GA 3WYAA 1CJEA 3IO3A 2BS4B 1E32A 1NIJA 1ZUIA 5HE9A 1G9XA 1GSIA 1HYQA 4TL6A 4YONB 3QKTA 1AM4D 4EUNA 5GJBA 2A9KA 2CMKA 3C41J 4MITA 5C4MA 1FXIA 3VX3A 3J81k 1ZXIA 4FCTA 5AUQA 2ANCA 3I8XA 5KU1A 2CLDX 2BVNA 1DE0A 4UQOA 5HZKA 3NHBA 1F5NA 2O8EB 4KVGA 3PUXA 3TR0A 4DKXA 1XEWX 3AEFB 2R6FA 2MJDA 5FBVB 2IX3A 1MT0A 4ESVA 4MUBA 5DI3A 3NIBA 1YZTA 1NKTA 5IRCD 1Q1ZA 1II8B 3EA0A 2JLWA 1U9IC 2QQEA 3GEHA 3X2SA 3DDCA 2HYIC 1G5RA 2K9XA 4HUQB 2LWIA 5BYKA 2GXAA 3W6OA 2WM9B 2AFIE 1NLYA 4XD7A 3ZS8A 2FGJA 2ZSBA 4FMCB 4M22A 2FZ4A 4WA7A 3KQUA 4V0OA 2G1JA 1LFDB 2PLFA 2WWFA 4C7YA 1DO0A 4DUGD 3QXXA 2IYXA 1II8A 4V02A 1TMKA 3CF6R 3T5GA 4AYWA 3FE2A 3OIWA 1IN4A 2ZYWX 4MUAA 1NVVR 4GOKA 4YC7A 2WJYA 3QEOA 1G3UA 1NLFA 3K0AA 4GFDA 1VG9B 4EAQA 1R7RA 2O8CB 2IS6A 1X8LA 3EAQA 1E2KA 2QT1A 4M9QA 4MH0R 5C18A 1JR6A 3U7HB 2E87A 3U3RA 2MSDB 4GMXA 3W5IA 2ODEA 4HAXA 3P4PB 3HVZA 4QG7A 3WP1B 1GZSA 5HTKA 4OYHA 2ZANA 3OAAA 1W5TA 1VCMA 5HE8A 2H89B 3CNNA 5K8IA 2OESA 1FFHA 2A78A 721PA 1UKYA 1RIFA 1QHNA 2IEZA 4G1UC 3LB8C 4EPWA 3R9WA 4NZYA 4P33A 1FUKA 3VFDA 4B2IA 3THYA 2CL6X 3L8ZA 3D31A 5JECA 2JJ2D 4IHQA 4DCSA 4U5XA 2FPMA 2GCNA 4DSNA 3CX8A 1D5CA 2ZRKA 4LOAA 4O2LA 3ONWA 3GJXC 1Z47A 4D81A 2XITA 4DDVA 1MO5A 1XCGB 3U3JA 1WE2A 2GF9A 3U44B 3HU3A 2TMKA 1SB3C 421PA 4UNPA 4C4PA 221PA 3B1ZA 2OV2A 4OK3A 3G5UA 4RD0A 2V54A 4GNKA 1F60A 4OHYA 1GAJA 4JLPA 2ZYVX 3VHLB 1ESNA 1FX0A 1SIJA 4IFBA 1J8YF 2ZJYA 4USAA 3BFXA 2HUPA 4EPXA 2IS1A 3JZAA 2P6NA 4M9ZA 1G21E 3MCAA 3AM1A 4RD2A 2QTFA 1CJMA 2W54A 2ORIA 5FOVA 3HP1A 2Q9CA 1H65A 1VYUA 4YXDB 1UF9A 3EPKA 3B2FA 2BEJA 2XNDD 2XZPA 2IYLD 2IXGA 2VYFA 3AKCA 5HCNA 4KFRA 2FG5A 1ZNYA 2Z4SA 1N25A 4Q4AB 2FSHA 1MRNA 2WMNB 4KU4A 2IXFA 1XLOA 1ESMA 2J0UA 4TN1A 5EE1A 2C95A 1OFTA 1YR9A 2W0SA 3CRRA 2OSBA 2IYYA 4NCHA 1R0YA 1E96A 4K81B 3SBEA 1N6NA 1E0ZA 2KI5A 4OHZA 3B1YA 4WZBE 5GVSA 3FVQA 3AUXA 1NSTA 4XWKA 2C98A 4ZKDA 3OEHA 2WBLC 1Z63A 3K0SA 4D25A 4FD2A 3FOZA 2NO0A 5AJWA 3B9PA 3ASZA 5E7JA 3SR0A 4FCWA 4D80A 4QM6A 2ZRNA 5JHGB 1HE8B 1TF2A 2GCOB 1JWBD 4BFWA 4PPFA 4NCNA 3KKPA 2WJJA 4RD3A 2REOA 1JAHA 2BS3B 5E7MA 1RZ3A 3ND8A 4BWYA 4L4UA 1IN7A 1CJTC 1OKKD 3IUYA 1SF0A 3PEYA 3K09C 4Q66C 4FCVA 3VR6A 3WHLA 4LV5B 1P61B 1JQJC 4GOXA 1XMJA 2VF7A 2ZR9A 3I61A 2OBNA 2JLXA 1KZ7B 5JFGA 1G6OA 2PT5A 4PO9A 1XU4A 3P20A 2ZAMA 4L9SA 2ZI4A 4PR0A 1E1RD 2MJ3A 3RABA 2IA5A 4NL4H 1JI0A 4ASUD 5HKKD 1GNPA 2J1LA 1LVGA 4FMCF 1E2PA 3CIOA 4ZKEA 3R8FA 3IO5A 1P72A 3QKSB 2CCJA 4MA4A 5EUQB 4DEXA 3ICEA 1WXQA 3RRMA 1Z0KA 1Z07A 4LBYA 1OKKA 1OXVA 2V3CC 2FFQA 1RYHA 5EXPA 1I7HA 3DKPA 3PXGA 3QE0A 2Q3MA 1LB1B 1KFYB 1VYTA 1ZC4A 2A3RA 2CLSA 3KZ1E 5JEDA 2AXNA 2WS3B 2IYWA 4BZPA 2GJ8A 3HWSA 5F3WB 4B43A 4LJ5A 1W4BA 2ZJBA 1Q3TA 1E6EB 1CF4A 4ZCIA 3VNUA 521PA 1D2EA 4YDHB 2AWNA 4NYIQ 3PENA 2ZSEA 5KDLA 1E9FA 1KI4A 3LVQE 1LY1A 3QPVA 1G7TA 2FFAA 4Q1DA 1JNYA 1OW3B 4MGZR 1OFUX 5D3QA 1IONA 1G8GA 3X1ZA 2BOVA 2HXYA 3CRVA 3CX6A 2B6HA 1KSFX 1NVUQ 1QOBA 5DN6A 3CNLA 3PG5A 1F2TB 4XSHA 1S3SA 5LPNA 3AE1B 1OFHA 3KQHA 1KI6A 4ZI3A 1AN0A 2RGBA 4Q1EA 3H2YA 4PHGA 3MWLA 2PCLA 1N60A 4AI6A 5TXGA 1E2JA 1LTQA 3ADBA 1L0VB 1DGJA 3EARA 3THYB 2J7PD 4EIWA 2BJWA 2BBOA 3AEZA 2QPAA 4A2WA 2CJOA 2VP5A 1NVXQ 3VAAA 4URVR 3GP8A 1NMYA 2FNAA 1EXMA 2BV3A 1KDRA 3KUCA 5JZVA 2WAYA 2O8FB 4NU0A 3RS0A 4NONA 2IWHA 1YQ3B 2M56B 1IN5A 2GAAA 3VR4A 1GM5A 2J0QA 1U2RA 3C5CA 3CRQA 2PEZA 2X8AA 4TTPA 4LJ9A 4ESHA 3A8TA 1Z28A 4B75A 2EWWA 2WKQA 4F4JA 1Q3HA 3FPAA 5DHAA 4JSTA 5G53C 4A0RA 1T6NA 1J70A 1NVVQ 1OLOA 4LJ6A 1IJEA 1GNQA 1FO4A 1E99A 4TMTA 4PC2A 4ACAA 1A2BA 4NYMR 2GJSA 5CM8B 3DZDA 1N6RA 4KSCA 3GPLA 2VP9A 2VBCA 2ZYUX 2JGNA 1W46A 4FN5A 4W9MC 3AEBB 1FMAD 3S1AA 4A4DA 3HPRA 1IXRC 2Q3FA 3BD9A 1KI6B 2QA5A 2PIAA 4KO8A 3ZVNA 4XIGS 4PO8A 5F2EA 2FFHA 4BFXA 2YZ2A 3DZ8A 1QVAA 1KKLA 2QP4A 2J45A 4Q4JB 5EP1A 2XNSA 1JROA 1NLZA 2CCKA 5TDHA 4DUGA 4BECA 5C2TB 2WDVB 2PVOD 4MRRA 1OH6A 2ZITA 4RFSA 4U00A 1XCMA 4LHXA 4KFSA 4LUCA 3EZ6A 3SQXA 1XPRA 3X1YA 1XP8A 3S1AB 2VP4A 1JRPA 4PQYA 5ANRB 4B3FX 1S2MA 3B1VA 5JJKA 4H1UA 2D3WA 3DOEA 5CK4A 1XFAA 1VIAA 3RRNA 3K9HA 4K46A 1H8HD 3RDPA 4C0SA 1YZGA 1KNQA 5JS7A 1Y63A 2H18A 3B1XA 3GJ7A 3RANA 1QT9A 5B2ZA 4US9A 2OUKA 4NBSA 3SYKA 5J4YA 3BWDD 1G3IA 3WNCA 3CBQA 5DE3A 2PZEA 3MGCA 3CO5A 2DWQA 3L0IB 4G5OA 4US0R 1B23P 4DZZA 1CS4C 2ZRBA 2RGXA 5FTJA 1GTVA 3LBHA 4QJ5A 1DTSA 2PVGC 4V0MA 3QSYA 1XLNA 3UIEA 3I8SA 1XEWY 2NO6A 3KJHA 1AK2A 4US2R 2E3TA 2FFBA 1XRJA 5DNYB 2DHRA 1OQQA 4US8A 2WU2B 1JXOA 1KK3A 1WBBA 3UWKA 1VG1A 1YZQA 4NMMA 4YMVA 1ODFA 4EJSC 4GRAA 5H70A 2W3RA 4A8JC 4I1VA 3BH0A 4FIDA 1N5LA 3PVSA 3B85A 4B3DA 4O0MA 2W0MA 1B0UA 1Q0UA 4LWZA 2ZSDA 4QBHA 1AKEA 3B2GA 2C77A 3SJCA 4YSYB 2EYQA 3CRMA 3QY0A 2B92A 3P27A 1ZD9A 5K8UA 1BH2A 4M1OA 4M9XA 2GAOA 3RLFA 2QORA 2B7BA 3Q3JB 1P5ZB 5JI3E 2WDQB 3REFA 3FFAA 2XTNA 4IDOA 1IN8A 1WBDA 4DIDA 4D26A 1Z29A 3LX8A 4W5HA 5FFMA 4B3CA 5G3ZA 2J0SA 1C4OA 1FQKA 4Y0AA 3A58B 2I1QA 2XTMA 3SN6A 4XVUA 5DO9A 1P73A 1Z06A 4OQFA 3D6TB 4Q1CA 3FMFA 4YMSA 1WCV1 4RJLA 1XXHA 5MPOA 4Q7LA 4FWIB 5KNDA 2ERXA 1R2QA 4OBEA 2I4IA 1Q1QA 2FWRA 4KFTA 4Q9KA 3ADCA 2K5UA 1L4UA 3DVLA 2ZSAA 5CIWA 4FXCA 1E9DA 3MRSA 3VU9B 1U90A 3FYHA 3NC1C 3W6NA 5C1BA 1N5WA 1DVRA 4EKDA 1E7PB 3CPEA 4TYQA 1QHGA 4HYYA 4IW3B 5FTNA 4G5GA 1OE0A 3PITA 4ITRC 4TLCA 4Q21A 4MYCA 4ZHPA 4URYR 2HF8A 4Q48A 1W0JD 1XPUA 3DKVA 5J4HA 4FXPA 5BWMA 1NN5A 4B6FA 4F93B 4D4KA 2OCYC 2QPTA 1ZYUA 2OFWA 1L6UA 4S35A 3TSOA 3AVVA 1Z2AA 2QSZA 3AE6B 1DOAA 4PHTA 4YXWD 2JLVA 4URXR 1CXZA 4KI0A 4Q5IA 4Q9IA 1R5OA 2WWWA 4TT3A 2QZ4A 3MWKA 2N0SB 1MKYA 2BMEA 2ZRDA 1E2NA 1N3BA 1KI7A 5FOTA 2IF2A 4WWMA 1SVOA 4TZ6A 4DWJA 5FR1A 4HB2A 2HYDA 4C0QC 3AE2B 4QGAA 1CTQA 1V43A 4DCNA 2W00A 2V8OA 3R8CA 1G3QA 3BBPA 1OH7A 3LBIA 1W1WA 1UEIA 2I3BA 3CRW1 5L3SB 2ZE8A 3AECB 5FBRB 3SE0A 5C46F 1NY6A 2ATXA 3ZIAA 5ELXA 4PPNA 1L4YA 4MGIR 4IRUB 3M4YA 4R9UC 3TNFA 3GJ6A 3HDTA 2AWOA 1T4GA 2B8WA 3OZXA 1G4UR 2HLDA 3TUJC 4C7ZA 4B35A 4A15A 1PLJA 5DYGA 2X2FA 3T61A 2NPFA 1G19A 4YDSA 3N5CA 1KO7A 3AE9B 1F48A 1NY5A 4DDWA 1G5PA 4JL5A 3U3KA 1WRIA 4B3GA 4KBGA 3GLGB 1IOZA 2ZM5A 3A4MA 2G9NA 5SZJA 2OLJA 5JBQA 3ZZUA 2Z4RA 4XD7D 2ONJA 2V55B 3TJZA 3AE5B 3MG9A 1SKQA 4BLRA 4ZIRB 1KIMA 3LFUA 3LW8A 1P9NA 3LQRA 1OH5A 1E2QA 2RGEA 1KDPA 2Q6TA 2WJVA 2HDNB 4MDEA 1VCNA 5IF9A 1G17A 2WWYA 3TBKA 2FOLA 3B5JA 1Q57A 4B73A 3QKUA 1X86B 1SXJA 2ZUCA 2PCJA 1HEIA 3CIRB 3AV0B 4HI0E 1DG3A 3AMZA 2GBLC 1YR6A 3E1SA 1Z8FA 1DAMA 1EG7A 1I4LD 3Q7PA 1CJKC 3DL0A 3IIJA 2GNOA 4RD4A 3EIEA 2FZLA 4C2UA 4D6PA 4MKGA 1VDZA 2VHTA 3H86A 4PPGA 4F4CA 2GTPA 4BZQA 1A82A 1ONBA 4BLOA 3AM9A 2D2EA 4OHXA 4YMWA 3VKGA 4LHWA 3K09A 4NYMQ 2KMMA 1JR3E 4I1SA 5E95A 1S4QA 1IN6A 3I73A 5J4KA 2OEPA 2QPOA 3BGWA 3EWAA 2XAUA 4AG6A 2QE7A 5CYOA 3P4RB 2DFTA 3QF4B 3VR2A 3UPUA 2QENA 4A92A 1FMLA 3SHFA 5B64A 4R71A 1UWMA 2PMDA 2V9PA 3VQTA 3FB4A 1NMZA 3DO6A 4BZXA 1EESA 5CLLA 3DWGC 3P63A 2ODBA 1FTNA 2ZR7A 3U3MA 3B9JA 4DEYA 1GAQB 2ZAOA 1QBKC 4D0LB 2W6IA 3AN1A 4DB2A 5KYKA 1NNEA 3BERA 3NRZA 5TARA 3Q85A 1KRHA 1W0KD 4DBLC 1CLUA 1R5BA 1IM2A 1Z6XA 1G7SA 2H57A 2Q21A 3AQ4A 3K0FA 4HUQA 1GFIA 1YHNA 1KK1A 4LJ4A 1N5XA 4FMDB 1NENB 2WSSD 3FFBA 4GP6A 1US8A 3W5UB 2ZQ5A 3E70C 2C78A 2GDJA 1J7KA 2PX3A 2DWPA 3AVXA 5F9HA 4Z54A 2YOGA 3TMKA 2UVQA 3EPHA 1YZKA 1YJIA 2HLDD 3I62A 2JQRB 2QU8A 3BK7A 1XD9A 4Q7MB 4TLAA 5FPKA 1TKGA 4V0LA 2ACZB 1SVWA 3VNVA 1WA5A 2GJKA 1EFCA 1KMQA 1NN3A 4QHTA 2HF9A 2H5EA 4AC9A 2GWHA 4HDCA 5GJWC 5CM9C 2YC2C 5EP4A 2O0JA 3WY9A 3EIQA 4YTPB 4OL0A 3V9PA 1SXJD 2REXB 4DHEA 3TW4A 1I4DD 3WRXC 4PC7A 2YOFA 2PX0A 2V7QD 3SHWA 4KFUA 5HR5A 4LHVA 5JJLA 4P0TA 3W8NA 3ZD7A 2Q0HA 3GLFB 2W6JA 2GEDA 2XGJA 4HAVA 1L5PA 1SKYB 2IBMA 3GJ8A 4DJTA 2P6RA 3Q72A 2ZYTX 3LLMA 2OXCA 3K0FB 1F0ZA 4TL8A 4A2QA 5J4LA 4A1FA 1UKEA 1PUJA 4TQUS 5DH9A 1YR8A 5EE0A 3HJNA 4TZ0A 1ZMXA 5FI1B 4HLQB 2J3EA 3T1TA 2RKOA 2WSMA 5AJXA 2ANBA 4X8LA 3CKLA 3EX7C 1OFFA 3AV8A 5FTKA 1X8JA 4IDQA 5L3SA 4KSBA 2P5TB 4JL6A 3SJAA 1QLBB 1ZIOA 4JJKA 4I4LA 4KYIB 3QXCA 5C2JB 4YTMB 2ZI6A 3QBTA 3GQBA 3FHOA 3EUB2 1BMFA 2J87A 3GMTA 1MABA 5JRJA 1T3SA 2WICA 1BOFA 4MYTA 3NG1A 2D7DA 2OE2A 2P65A 3AVPA 3RAPR 2DR3A 3QJYA 4M1KA 5IK2A 2RGGA 1V97A 4N58A 2AD1A 2GKSA 1W48A 2ZRJA 4AURA 4LCBA 4IOJA 1IUEA 4JLOA 2IS4A 4B3BA 3OEED 4Q00A 1C9KA 4LHZA 3MWJA 1FOEB 3TAHA 4Q1FA 5EE9A 4GBMA 2XJ4A 4OJKA 1FFVA 2FE4A 3HUIA 1QHSA 4J0QA 4LTUA 4WOPA 2B8TA 1R0XA 1ZCAA 5L3RA 3CWQA 5AK0A 2GA8A 1E2LA 2QT0A 1KY2A 2N1BA 1G20E 3CF2A 4JIMA 2CJNA 2F43A 4DSUA 3GJ5A 2IF0A 2QTVB 2IC5A 1W49A 2CE2X 2CVHA 1ZP6A 5C4GB 1AJEA 2N42A 3LVRE 2XJ9A 4TL9A 1T3QA 3AB5A 6Q21A 1R8SA 4NCKA 1SXJB 1TQ2A 4QBIA 2ZRIA 2J46A 1NJFA 2IYUA 1T8UA 1S8FA 4JLBA 1XF9A 3LQQA 1ZD1A 5A4JA 4OJQA 3KJEA 3QVUA 1ZC3A 3V00A 3FAHA 2HJGA 3AH8A 4M1WA 1NP6A 2V6JA 5LD2C 3W34A 3ZVLA 4DIEA 1Z83A 2KBFA 2VHUA 2O8BA 4L5BA 3FWYA 2ZJOA 4HZIA 3ADKA 2GCOA 2C8VA 2MMGA 5FI0B 3QKRA 3LH5A 3ND9A 3CR7A 4LHYA 1J90A 3SJBA 2NZ8A 2A5DA 1JEDA 2QMEA 1W4AA 2JDID 4HLUA 3C7KA 1U99A 3AKEA 4A0GA 2CL0X 4R7ZA 1ROEA 3IHWA 4TSFD 4B3XA 1TTTA 1G5TA 1GNRA 4EDHA 4MGYR 2K5PA 3C5HA 2J7PA 4DLUA 4PX9A 4Q7KA 4ACBA 4BLTA 1XMVA 1WQ1R 2F1IA 1XTJA 4BE7B 4KX6B 5FBWB 4IVQA 4JLKA 1UDWA 1G41A 3CM0A 3KKMA 4YMTA 1XEFA 2QRNA 3QG5A 1YJJA 1HT1E 2AHOA 4Q4JA 3R20A 4G5RA 1E9MA 4HDQB 4HAZA 2DPXA 4A8JB 2OILA 2PT7A 2FA9A 2GXQA 1BMFD 4UXJA 1EFUA 2YJTD 3K1JA 3PV0A 2O52A 1C1YA 1HE1C 1XTKA 3KTAB 2NPIA 1T3HA 3P4XA 3KXIA 5SZIA 2F1HA 4PPQA 1O87A 2G83A 3I1FA 2ATVA 1E9RA 1GVNB 1KY3A 5LDDC 3I32A 2ZRCA 5P21A 4Q01A 5JLJA 4A8JA 2OBLA 1XLQA 4AKEA 1M6NA 4HATA 4IEIA 4ARZA 3FHTA 3QKRB 4OHVA 1RYFA 1OT3A 2WWIA 4Z8YA 1CULC 4WQMA 1ZM9A 5BXQC 1G291 1ZINA 1XTIA 2RGNA 4TMZA 3GFOA 1ZM2A 4LV8B 1J2JA 2GZAA 3UXMA 4UNSA 3GD7A 5KPJA 4XH9B 2DFKB 3LXRA 2IYRA 2WPDD 3E5HA 4A0HA 4QFMA 3P1MA 4LGMA 1KMHB 3SOPA 4NYIR 2G0NA 4C0HA 2OFXA 1E9CA 4G01B 1DG1G 1P75A 4RCYA 2R6DA 3RPFC 3I5YA 2ZRLA 4G5SA 1YVDA 2EWVA 4JLNA 2VLIA 4I99A 1U98A 2GHIA 3LWNA 4LSGA 1XXHB 3U60B 3KKOA 2IUUA 4JS0A 1IXSB 1JB1A 4NP6A 1TKEA 2RHMA 2OO7A 4E5UA 3I5XA 1QVRA 2QP3A 3LAWA 4TMKA 1KDTA 1KI2A 1J99A 1M34E 3A4LA 2D06A 4JVMA 5TMPA 1DAFA 1DPFA 4IDHA 2GETA 1WB9A 2KBEA 4QGHA 5JS8A 1VDVA 1VKJA 2ZR0A 1OSNA 1TQDA 1XWIA 3TVTA 1E3MA 4ILEA 5EXSA 4TQAA 4QGFA 2FEMA 4C30A 2VEDA 1HQYE 1Q44A 1AIPA 1E1RA 3L0PA 2Z6VA 1MO6A 1E69A 1A2KC 3GLIA 4CEJB 2YNMA 5DLQC 4C3ZA 2VIIA 5DI9A 1U0HC 2OCPA 4JLMA 1JPJA 3KKNA 3OESA 3KFVA 5DIFA 1ZNXA 2W2TA 3DPUA 4FMBB 1TYGB 4NKRA 2IEYA 2Z83A 5FPSA 4M4SA 3ZZTA 3GLHA 4LBVA 3LW7A 2CJWB 3SDZA 4Q1BA 1JALA 1PUTA 5IT5A 3EZ7A 1BYIA 1Z5ZA 3LNCA 5M04A 1QHIA 3KQLA 4DVGA 5JCPA 3CZQA 2QAJA 1R10A 1RC8A 4OKSA 1QHYA 1U8YA 2BC9A 3Q9LA 3TIFA 1T8TA 3EZ9A 2ZJAA 4XVQA 1XTRA 4G0NA 1G8PA 4K8OA 3T5DA 3QF7A 4OI4A 2QSYA 2IHYA 4TTQA 3VMFA 1VLBA 1YQTA 1JJ7A 2ZPTX 2AK2A 4KV9A 3AH7A 1XTSA 2QUZA 3NHAA 5CJPA 3A36A 1Q21A 3BJIC 4A36A 4B44A 1ZBDA 1N6IA 5J47A 5FTMA 2GJAA 2PZFA 1W47A 1LNZA 2CDNA 5B57C 2ZRFA 4II7A 2WOJA 3RC8A 2W6JD 3B82A 3PCRB 5DGXA 1GWNA 3K8YA 2A7QA 4JYBA 2WIAA 4XJXA 5CDFE 1VCIA 2HJVA 4OQLA 1EFRA 1ZM7A 3THWA 1FRDA 2BM1A 1E79D 3ZVRA 1QHXA 1MRSA 2QIEB 2QAGC 2WVJA 1N5KA 1CJVC 2FN4A 2W2VA 2ZRMA 3TUIC 5F98A 4O3MA 1R0WA 4KLNA 3HU1A 2IK8A 1A4RA 1FXAA 2MJEA 1J8MF 5FUXA 2JA1A 5EUMA 1ZM4A 3T1OA 2RH5A 5KSPA 2VSXA 2XEXA 3KJIA 1P9RA 4IOMA 1X1SA 1FUUA 1D2NA 4P4UA 2ZXUA 1GUAA 3AF4A 1T91A 2IXEA 1CR0A 1SHZA 4GZMA 4KHZA 1FRRA 4OQNA 4TWZA 3CH5A 5AJYA 1RRPA 2EFCB 4DLYA 4IOKA 3FDIA 4GT1A 4BFZA 3KXKA 2J9RA 4UNQA 3A1VA 4FMDF 4NE2A 4UNNA 5BYJA 3K70C 2CCGA 4POAA 1E0SA 2XZLA 3EXAA 4ASUA 4D2IA 3O8RA 5G41A 1OIXA 1G8HA 3UMSA 1P62B 1UKZA 4JVNA 4L9WA 4UNRA 1U81A 4OK6A 1XCPA 4B6EA 2RCNA 3KKQA 4LJAA 5KTYA 4NHOA 1YZLA 2QNRA 4MYUA 3SFEB 3FMOB 1KHTA 4P4SA 2OCAA 5AUOB 5TVKA 3JVVA 2EFDB 1V8CA 2EFGA 1ZJ6A 2FPLA 2ZI9A 4LC0A 4GP7A 5FOWA 2L83A 2Q5WD 2QGNA 3LLUA 2R8RA 2ZIAA 1NBMD 2CVFA 4Q02A 2PLRA 1M7HA 5EZ6B 5BN4A 4N0DA 3V4RA 5J4VA 1JR3A 1ZOYB 3IKJA 4MKHA 1UPTA 3AE8B 1XB2A 4B47A 4QKQA 3AB3A 3OE7D 2FPKA 3THOA 5FUWA 1GL6A 4YMUA 3B78A 2V4ZA 1EWYC 1VG8A 1E1QD 1TX4B 3R9IA 3IILA 5A5GA 3ICQB 4TLDA 2V1UA 4U02A 2EQBA 1SULA 4D4LA 1TPZA 2JJ2A 1COWA 5FL7D 4TSFA 1N0WA 3QENA 4OI2A 1WRBA 3HYTA 5DN6D 3MJHA 1SVSA 4BFSA 1E2GA 5DISB 4FI3C 4Q4HB 3I3SR 4IXNA 2BKEA 3B6EA 3GJ3A 4P31A 3DOFA 1E2EA 4B48A 1P2UA 1VPLA 2WAXA 3D8BA 1XMSA 1QG2A 1FW6A 4CGZA 1AGRA 1KSHA 3RRYA 2P2LA 1EWRA 2LCFA 2EFEB 2JASA 4V0ME 3K70D 4EPYA 1FMJA 4GOJA 3A1UA 5AUPB 3L0OA 3K9GA 2VRWA 3F8TA 3M1IA 1JBKA 1VTKA 3EZFA 3K0AB 4JMPA 1P7CA 4QC2A 4QNRA 5A0FA 2O8CA 2CJWA 4UJ5A 2H92A 2C9CA 3DHWC 4Z1MD 4O25A 4LBZA 5JSZA 2FH5B 1EFTA 1UFQA 1Q1BA 1EX6A 1PDXA 3VR8B 3TRFA 1D8TA 2QMHA 4PZZA 4ZIRA 1KJYA 3TSZA 1XEXB 4AKHA 2O5VA 2XXAB 1EFHA 3G82C 3MMPA 4KVAA 2D4HA 2CNWD 4CEIB 2BS2B 5H8YE 2NO7A 2QROA 5AUNB 1N2CE 4A2PA 2G0TA 2NO9A 1U8ZA 4I81A 3P26A 1DAHA 4Z1MA 1S0UA 4QXAA 4BFTA 1YR7A 4AYTA 4Q4LA 1A1VA 1XD8A 1NYRA 1IY2A 2AD5A 2G88A 1JW9D 3NVAA 3Q5DA 4XWOA 2A5GA 2YINC 4R98A 2FV8A 1T5LA 3CH4B 3C4JA 3EW9A 1PVOA 4TMVA 3QOFA 2JATA 2PKOA 3I92A 5LBIA 2BKUA 2XOKD 1XZQA 4TLEA 5G40A 3PEVA 3T34A 4ERNA 2DFNA 2BMFA 3T35A 3LD9A 1KI3A 3VKWA 3NC0C 4EJSB 1QG4A 2L0XA 4N3NA 3T06B 1R5NA 4LI0A 2LEKA 2ZJ5A 3JZMA 4JKYA 5AJZA 1CBUA 2WOOA 5JSZB 3TLXA 1G3MA 4RKEA 4B71A 2CL7X 2NIPA 3IQXA 2GXSA 3I4LA 1NMXA 4LY6A 4W5WA 5AUKA 4IOLA 2EKIA 3H1TA 3HR7A 3NKVA 4LJ8A 4MDFA 3HR8A 4RZUA 3OHMA 3X1DA 1XEXA 3A4NA 3LO5A 3B60A 2IS2A 1XPOA 2QP9X 2H1LA 1S1CA 5GJCA 2EVWX 2VSFA 2KB0A 1NYQA 1Q12A 3HPQA 4X8HA 3RWMB 1QHHA 3V4FA 5KUTA 1P6XA 1M74A 3K0CC 4M1YA 4PC3A 2G77B 1BKDR 3SJZA 1VMAA 3MLEA 5L3QB 4KYUA 1Z0IA 4LYHA 1VIYA 4B2PA 3X1XA 1E9EA 4YT0B 2PBRA 2AKAB 2HCJB 4NTZA 1W36D 1CR2A 1G4AE 1P3JA 1TAGA 1IJFA 1OHHA 2HEIA 1I2DA 2GILA 3WMEA 1NRJB 4DCTA 4JVLA 2WHXA 4WZ6A 1RVDA 1RPZA 3THXA 2SHKA 2IUTA 3PUYA 3Q8XB 1E6CA 3ZH9B 3TUZC 1KO1A 1EX7A 2AN9A 4CVNA 1OYYA 5EXXA 1UJ2A 1D9XA 3KDSE 3KXLA 4PQRA 4QL3A 1JQ4A 2HV8A 2C2HA 4DC9A 3WMGA 3EG5A 2WWHA 3NH9A 2CNWA 4PAOA 2M19A 4ZDKA 3IIMA 2QY9A 5GJVC 1Q22A 1HA3A 1WMSA 1Z3IX 2ZRPA 4ZDIA 5CB6A 2CE7A 2CLCX 3B7GA 3CWZA 3SU8A 2W3SA 1BS1A 2GK6A 1L6VA 5AUIA 1CR1A 4M1SA 3QEJA 5EZ5A 3ZJYA 5C3JB 1PLLA 3IQWA 4DLWA 3SR6A 5AWFC 2UZ3A 4HDOB 5AJVB 1Q20A 4R2HA 3KQKA 1SXJC 1A5TA 1VYVA 3UKDA 1JWAD 4P32A 3RYTC 4NH0A 3CR8A 4XVRA 2QMOA 4Q4HA 1KK0A 4ZOHC 1ZD8A 5J5CA 2FMXA 4IFEA 4KITB 2VL7A 1S9DA 3MJRA 2WWXA 1W2GA 4JLJA 4MRVA 1ZUD2 2B76B 2VHCA 1JPNA 3AKDA 2CHVA 1OH8A 1XO3A 4F92B 2GF0A 4LK2A 4MKIA 5B58C 2Z0MA 3MFYA 3EZ2A 3AVTA 2CBZA 1E4VA 5G3YA 4B74A 2FGKA 3WRYC 4KXFB 5JI2E 2WKRA 2ZE5A 5JWRA 2ZRGA 1GIAA 1E4YA 2GEUA 1GG2A 1NIPA 3HU2A 4EPRA 5CDFA 3AVWA 3UG6A 4P3YA 5KHOC 1P2TA 3PUZA 4BFUA 2JLQA 1KMHA 121PA 2DFLA 1M7GA 2O0KA 3SC3A 2ZS9A 2C03A 2C96A 2YHSA 4QOSA 2XZOA 1E0JA 4C80A 2UZIR 4IDPA 4F91B 1E2FA 4H1VA 4AIIA 3DMDA 1Z6YA 1O3YA 4DT1B 2YC4C 1ZP0B 5GXGB 5FOSA 4EFLA 3A37A 3VR5A 1KI8A 3PEWA 2XXAA 3KQNA 4G3XA 1KO8A 4H9GA 4URWR 4NPHA 2NZJA 5L8VA 3NVWA 1W44A 4CF7A 1MV5A 3VX4A 4BRWA 2VHQA 3P4SB 4PAQA 4KBFA 1F2TA 1KI9A 5F9FA 1FQJA 4JT2A 5KDDA 1XMIA 1TJEA 3WNBA 1PLKA 1RKBA 3NVZA 1X1RA 4TQ9A 4RVCA 1GDDA 5FPYA 3AE4B 5K8TA 2MMCA 2O8FA 1UBCA 1QOAA 2PJZA 2X77A 4LYAA 2XNDA 1AYFA 1NVWQ 3CW2A 3IGFA 4R2IA 2BMDA 3WP0A 4W7SA 1E94E 1KAOA 1OQRA 1N5JA 2CU3A 3HYRA 5FUYA 3MD0A 1G8YA 4BUJA 2F6RA 1E1QA 1RW4A 1N6LA 4CIDA 4PZYA 4ZDJA 2V1XA 1LW7A 3KWLA 4OK5A 1DARA 2W2XA 1AQYA 2F1JA 2RGDA 1G6HA 1M8PA 1P60A 3CB4A 3H84A 4RD1A 1NJGA 1TQ4A 2KE5A 4DDTA 2H88B 1N6PA 3K53A 3LA6A 2GXUA 2IW3A 4EQ6A 4DT1A 2ONKA 1I4TD 4AY2A 2JCSA 3REGA 2QAGB 2VTKA 2C99A 1MR3F 4XWAA 5CB8A 1SVLA 4HZUA 2P6UA 4A82A 1K8RA 4N59A 1Z2CA 4RFSB 3ZQJA 1RWSA 2BDTA 3X1WA 1QHHB 4KODA 1OXUA 4L8GA 1ZU5A 2VP2A 5FL3A 2ZU0C 3H4MA 3VHXA 1AZTA 1KJWA 1XTQA 1Z6AA 2GJ9A 2QAGA 2YYZA 2YWGA 4WZAE 4GDFA 3IEVA 4CDGA 3P1JA 4FW9A 4PHHA 4ZPXA 3BIID 2W83A 2IL1A 5L3VA 5KO2A 1KJZA 4JBYA 5TY0A 3I72A 3EPJA 1Y3AA 4N1AA 4LRWA 5HKKA 3JVUA 2G1KA 1G7CA 1WF3A 1R7SA 4V0KA 3U3OA 5HZHA 3WBJA 2K22A 1KDOA 1R8QA 4US1R 4DCUA 3U6KA 1IAQA 4MKFA 2OXRA 2RGAA 1HUQA 1AWDA 4D0NA 2BBWA 2WIBA 4HUTA 1J7AA 1R6BX 1SGWA 2OAP1 1ZCBA 2R6AA 3TQFA 5JWOA 2FSFA 5H1YA 5IDVA 1AS3A 1KKMA 4AKIA 1TU4A 4RD6A 3IIKA 3CUEF 4MRSA 2ZI7A 3SEAA 1TUIA 4M0LA 2J59A 1H8EA 4WVFA 4A9AA 2WSSA 621PA 4JLDA 4KAXA 4CYMA 1KK2A 5KDOA 1ZRHA 2JJ1A 1GP2A 3L2OB 2QEQA 1RRFA 1KAGA 2V6IA 2WMOB 4CT5A 5TB5A 2E9SA 2ZETA 3QG1A 3W3ZB 2I1VB 1LV7A 1AQUA 4B76A 3FMIA 1YU9A 2PL3A 1FIQA 3WXMA 1NSFA 2HCBA 4HB4A 5EE5B 4IVPA 1G8FA 2C04A 4Q18A 4JSYA 4URUR 1EK0A 3RVBA 3R7WA 4PC6A 3NS1A 1HTWA 5FBLB 5EP3A 4M1TA 1DOIA 4CZ2A 3NVVA 4AWXA 2F9LA 2VPPA 1EFRD 3PUWA 2JIZA 3SI7A 1HQCA 1U8AA 5EP2A 5E3HA 4XTCS 2BHRA 3AEAB 2KAJA 1U0LA 2R6CA 3KL4A 3AF0A 3ZQ6A 4CEHA 4LYJA 4LPSA 3H0KA 3KTAA 4ZCLA 3LY5A 1IY0A 5KOYA 3VR9B 3RS3A 4B2LA 3T1QA 3O8CA 4P4SB 4B33A 1UM8A 3QBVA 4MGKR 4HLUC 3TE6A 4IVRA 5BN3A 1H8HA 1KSJA 3B8HA 1JQLB 4MRNA 3M0EA 4ARZB 4AYXA 1WDTA 2XX3A 2JIZD 3LXFA 3EPLA 1TL7C 2YWEA 1E10A 3CWIA 1FM0D 1CJUC 1OYWA 3GLHB 1EWQA 1N62A 3ECCA 1TKYA 3NEYA 2ZSFA 5LB2A 2HXSA 3RRZA 2VH5R 3N70A 4ABYA 4DXAA 2ZS8A 4OHWA 1UKVY 4B32A 4TMWA 4KLZA 4ZCMA 5LB4A 3VR1A 4NCJA 5CIQA 3BORA 2FF7A 1W4RA 1LS1A 1VECA 2QL6A 1CRQA 2ZUDA 4NYJR 2ODNA 4PSKA 4RSGA 1IBRA 4IKEA 4LJYA 2H16A 2DYKA 5GADl 3AP2A 1GRRA 2AX4A 4WXPA 2QGZA 1W36C 3SFZA 1XD2B 4DLSA 1TEXA 2FJUA 1QDEA 4M21A 2WU5B 1KNXA 1OPXA 1P9WA 5FBQB 5FPHA 3NDPA 1GITA 1LF5A 1N61A 2IT1A 4P4TA 3OEEA 4CEHB 2P3SA 4A6XA 5G5GA 2FBWB 3FTQA 3VRBB 1DAKA 4Q9LA 3WNDA 3OFNA 2PEYA 1Z0JA 4JZKA 2PMKA 4RCZA 5G5HA 4HLDA 4DLRA 1ZM3A 1XLPA 5E7IA 4OI1A 4LPKA 3KB1A 1KOFA 2R2AA 2ZEJA 2VHJA 1F6BA 4PZLA 2F3RA 1N5IA 1ZU4A 2OBMA 2YWHA 3KB2A 3F5FA 2WJGA 1GKUB 4JYCA 4JX1C 2VP0A 4C0JA 4I1OA 2IYVA 3QUSA 1HY3A 4BLQA 2PJRA 2F7SA 5TV2A 1NN0A 3PUVA 4IDNA 2XTZA 2OM2A 3GEEA 2WWGA 4E09A 2A5JA 2XB4A 4OQXA 4EPTA 4GSYA 4MQBA 3W90A 2H17A 2O0HA 2QM8A 1W7AA 1DEKA 2DB3A 2J5XA 2PH1A 3NDBB 5FL7A 5JJIA 1TUEA 3K9LA 1KI1A 4XOIA 4EJSA 3P4YA 1B9RA 2G1EA 2QI9C 5EQTA 2AK3A 1MH1A 1W0KA 4JWUC 4HB0A 3ZZ0A 3PJRA 3MWYW 2WDRB 1YZUA 4ZV4A 3R9XA 3AF1A 1RFKA 2D62A 2KSQA 3GEIA 2JLZA 4QHYA 3W5VB 1CEEA 2Y5CA 3UK6A 4XSGA 3QVVA 4PTLA 4ITKA 3U6BA 5KPDA 1NKSA 1MO3A 2P0EA 1Z08A 1Z0FA 3PR1A 2P67A 4Q19A 2IWRA 2ZJZA 2OLKA 4DCVA 1G7RA 3PIRA 5IK2D 3GFPA 1NEKB 3QNUA 4LBWA 1ZNWA 3AP3A 2ZS7A 5HPYB 2E1RA 3NEJA 3O47A 4BFYA 2R62A 4RKFA 3BIFA 3TQCA 4NCIA 1ZVQA 3SZRA 1KGDA 2BT6A 4DB4A 3RWOA 2NOAA 2WQYB 2GZHA 4PHFA 5L3QA 3OF5A 1IQPA 1JEEA 3DWMA 1ZUNB 5JWHA 2C9YA 1JAIA 1BYUA 2F3TA 2KJQA 1D6JA 3GFTA 1QOGA 1DAGA 3FGNA 5J40A 5UKDA 4Z51A 4NDZA 1UAAA 4U7DA 2AX5A 2OG2A 4EPVA 5DHFA 1QF6A 1T3LA 1EGAA 2J41A 3B1WA 2AL7A 3RHFA 2OT3B 3QF4A 3LX5A 3QQ5A 2VF8A 2W58A 3UMRA 3ZVMA 8OHMA 2BEKA 1NVID 4C9BA 3BXZA 1AA9A 1J7CA 2H8KA 4HRSA 3UMFA 3K70B 2BCGY 2RB4A 1L8QA 5JRZA 4DDUA 3AVQA 4BGDA 2GVDC 4JL8A 3W8RA 1N6HA 3NBFA 3P32A 4RZXA 5HCIA 3ZGXA 3GLFE 1US8B 3NBZC 2Q9BA 4BEBA 1W0JA 1Z6GA 3CZPA 1Z22A 3GJ4A 4WW0A 3TR5A 5EXTA 5K8LA 2ZRAA 5DYIA 4P6VF 1S1MA 2BMJA 1HT2E 2D7CA 3BB3A 2C9OA 3GLIE 1OF1A 2XB2A 5DI3B 2BJVA 3RSOA 3LXXA 1VCOA 2ZU6A 2AKYA 3IDQA 4GZLA 1GKIA 4YLGA 1N0VC 3ABVB 3SYNA 4M1MA 2R65A 2ZJ8A 1TADA 2FSIA 1RFLA 3W9CB 1D2MA 1T9HA 4JJZA 1KSGA 5FH9A 2CK3D 5H68A 1DELA 5GVRA 2UKDA 4Q03A 1W5SA 3BOSA 2X19A 3K9NA 3AEEB 2J0VA 4TL7A 4DRZA 4AG5A 821PA 3NBYC 3MSXA 4QM7A 3TVDA 1Z0DA 2YV5A 3WBKA 1NL3A 1XDBA 2QJLA 1E9BA 1GKYA 1OXSC 2IYTA 2NO1A 2RGCA 4BQSA 5KSZA 1OJLA 2GCPA 4A0FA 1M1YE 3CPJB 4TMXA 2X1VA 3CLVA 5FUVA 1GRQA 3AVYA 4LDJA 3TAUA 1R0ZA 4TYPA 4N6EB 3NWJA 4GMDA 3GLGE 1KYIA 1DS6A 3SQWA 2O8DA 2YOHA 5JHHB 2ZVQX 4YTNB 1OHHD 4C0KA 1LF0A 1DAEA 3BH6A 3TGPA 3OIUA 3PFIA 1HH4A 4I1UA 5LD2B 4QRHA 1L7VC 2VA8A 2BWJA 1AZSC 2Z5FA 2WV9A 1UDXA 4HEJA 5FR2A 4JWSC 2ODWA 1CP2A 2A2ZA 2W6ID 3M6AA 3PEUA 4RY2A 1SXJE 2N46A 2ZVPX 3AF3A 4PO1A 1UBGA 2G6BA 3AE3B 3BS4A 2EU8A 1MABB 3C8UA 3RS7A 1FTSA 1XZPA 3WYGA 1GRNA 4QJ4A 1J7BA 2ZROA 2CEAA 3OFND 4CT4B 3QPWA 3CNOA 4BRUA 4B34A 1K5DA 2F1RA 3B13B 4L15A 1ELOA 3MAAC 1GL9B 3W6PA 3U44A 4HB3A 1AS0A 1P2SA 4BPBA 4C0LA 4ZI2A 4DLTA 1CZPA 4Q9HA 3OEHD 3Q7QA 1Z6TA 3C14C 4D82A 5H8WA 1XXHE 1YE8A 1OXTA 3ETRA 4F38A 1R4AA 1FX0B 3VTKA 3AE7B 5EE3A 3FHCB 1SQ5A 3BE4A 4DLVA 3A1WA 5IHPA 2C5LA 4MYHA 1G64A 2QG6A 3CX7A 1TF5A 1DOXA 1UBEA 3AVOA 1E2HA 3IBGA 3U61B 4LJ7A 4EFNA 3CONA 4RZ3A 3VR3A 1ETUA 1TQ6A 3AGPA 3EWSA 4QJ3A 3IHLA 4S2EA 3U7GA 1N0UA 4KCGA 2GZDA 1E79A 2F43B 1FPMA 2B7CA 1G16A 1KTVA 2R9VA 2ASEA 1PJRA 4O2RA 1WGKA 5FOXA 4BFVA 1T0JB 1UADA
chains in the Genus database with same CATH superfamily
3PXCX 2HO4A 5IMSA 1HKHA 2FPRA 4MVJF 4QNMA 3OJUA 4F1SA 2K8AA 1EFKA 3H04A 4I36A 4IUYA 5CT6A 3A1SA 2O7SA 4IILA 3S44A 2O8BB 1RHJA 3OJCA 1ZVJA 1BPZA 1YN5A 1PDVA 1E9AA 4YQFA 4IHJB 3FLMA 2A5FA 3G88A 3DM9B 2PH5A 1UEJA 3M1LA 1YRYE 5CFLA 2XXBA 1ZKHA 2EV9A 2J0EA 4AS2A 3KVNA 3HEMA 4H6WA 3L7AA 2QBYA 1U1DA 2C3PA 3L79A 3DLBA 4N03A 4KO1S 3AEDB 5EY5B 3RRXA 3VISA 4IWOA 4YP3A 4IGIA 1AK1A 4P92A 1TPYA 3OFKA 5C8YF 3FBGA 1STOA 4KN6A 1QQTA 4MPDA 1K66A 3GLRA 1OB2A 1QF9A 1UK6A 3UTCA 1RP1A 1X6VA 2YJ6A 3QKWA 1KS2A 3WGLA 5FTLA 5BW8A 4JBXA 2WHIA 3TKLA 1ECCA 1OZHA 3WFIA 2ODPA 4Q39A 4PLWA 3SDSA 1SK9A 4CCYB 3EC1A 1X3SA 1GA1A 2HLPA 5C81A 4B0MA 1T0HB 2LV8A 4TKVA 4JPSA 4A3OA 3L7OA 4A8PA 1VLJA 2XV1A 1CVRA 1ECBA 2C9BA 5KYUA 2C60A 1ZA1A 2Y2VA 3AEGB 1ZQNA 5CU7A 3NZEA 1TK8A 1ZUD1 2AN3A 5CYPA 4BCCA 5JPCA 1WWVA 3KFXA 4MRMB 3T7RA 1OV4A 4QA9A 4QDUA 2ZAYA 2HVHA 3EYZA 3UCEA 4L1KA 5FLEX 4XTRA 2FUHB 1XR3A 3UZUA 2WT8A 3N2KB 3MTDA 1NF3A 2J6TA 4GYWA 4JIOU 2NRZA 4HDMB 1XZMA 3R0VA 1IP9A 4JBNA 1GTJ1 1SZPA 4W9EA 3N9IA 3KLMX 2GDZA 2ORWA 4RT2A 1H3FA 1WMHA 3HFSA 4HQ0A 1QZXA 4TYYA 4FBGA 4G0MA 4FM9A 2HWUA 3OZFA 4N49A 2L19A 1VB3A 5AKHA 3OAAD 4LV6A 2AR7A 1SUDA 2YIMA 1M2JA 1UZNA 1QH8B 3EDMA 4YMLA 1R18A 2EZZA 1RRGA 3ML8A 4PGFA 2YVLA 3GAFA 2H06A 3FCEA 3ULKA 4HUJA 1XC9A 2JUOA 1T5IA 2QXYA 3TQHA 1P3Y1 5IC4A 3WYAA 4CKCB 1G9XA 2W4MA 4LSMA 4MITA 1V25A 3TTTA 1VXOA 3KELA 2D2QA 2UVDA 3HCNA 2NX2A 1CY0A 3AFHA 1QU2A 4WNAB 3RCBA 2GNAA 4LXHA 1Q19A 3T5LA 4M22A 3QMWA 3CSFA 2WTBA 2M0AA 1H85A 1TMKA 1HETA 4AYWA 1N9GA 2VJMB 1E89A 4UBBA 4MZDA 4RULA 3W5IA 5EQDA 4QG7A 3WP1B 3O2SB 3OTOB 2ZANA 3BHJA 1DK3A 1FSSA 721PA 2NW6A 2JEJA 1YZ6A 1TLLA 2GCNA 4OLFA 3R40A 4D81A 4W5RA 3ZJVA 4OK3A 8ICXA 1XO1A 3I9V1 3FGZA 2RGYA 4GLFA 1RABA 4MB6A 2IS1A 3MCAA 4YR9A 1T0QC 4R01A 2M4NA 2PR7A 3SK0A 2BEJA 2YY6A 3TD9A 2VYFA 4ROSA 2EX0A 2UUBB 4CM5A 4JJAA 5AIBA 3LSYA 5CURA 1SEPA 3T94A 4GEGA 3B1YA 4U2DA 1NSTA 4BNKA 4CV3A 2WBLC 1M83A 4U4AA 8ICZA 2PL5A 5LA6F 2IU3A 2EWMA 4GMFA 2AUNA 5JUWA 2FZKA 5CT5A 1U80A 2JGIA 3ND8A 4MS4A 1XVAA 5DXFA 2E8MA 1P7FA 2CFOA 4AJOA 2BMVA 2R1VB 5CXXA 3RTBA 4OY3A 3C2LA 2AW3A 4F5QA 4EVIA 3LCRA 1ZQHA 4WD3A 2WWRA 2A3RA 1S77D 1BVRA 4MH8A 1F17A 1CEYA 4LTDA 2JAPA 3VYRB 1D2EA 2X8JA 4H2AA 4Q1DA 2VDQB 2LGDA 3OOWA 2MBQA 1HZJA 3LQ2A 4ZZIA 4X1OA 1H5QA 1QOBA 1OUQA 4YIHA 5KG1A 4QD3A 3DAOA 1BDHA 2WU3A 3U80A 2RARA 1N60A 4ZODA 1UUPA 1DGJA 4PAWA 4N8SA 9ICIA 4KKIA 5HZGA 2SNIE 3TFSA 2BLNA 4JQOA 1D0IA 3E0QA 1V7PC 4XVHA 3PPIA 2W7PA 1L7QA 3F53A 4TMTA 3JSVA 4IZOA 1XRRA 4DCGA 1W46A 2EW2A 4RA9A 2NS5A 2QA5A 3RVRA 1AF7A 4P4PA 3AV3A 4BFXA 4HAIA 2FFHA 5CXQA 2XNSA 1I2CA 3AI2A 4PGMA 3RYTA 4GVXA 3NM5A 3OTGA 2IOYA 1XUOA 2D5GA 3QJZA 2YJ3A 4XE0A 3D6FA 2BGIA 1CS4C 4JENA 3RRGA 2HHLA 3HW8A 1WG8A 2BB5A 2H9IA 3G59A 2L76A 2R1ZA 3UWKA 1PR3A 2NVWA 2FJ6A 1R9MA 3LM8A 4A16A 4A8JC 4LY0A 1QWSA 1L5UA 4W5NA 4QBHA 3L02A 1M10A 1C4WA 2M0NA 1N1DA 2GAOA 3SX4A 2X5NA 1ED1A 1EJ0A 2H31A 1P18A 1X8XA 3FOEC 1K50A 4XJTA 1IXRA 4HV4A 5T14A 2J0SA 3VOSA 3PPAA 4RJTA 3D6TB 4Q7LA 5KNDA 5DNVA 1F38A 3MQ4A 4Q9KA 3A1EA 1Y5NA 3T38A 3FYHA 3O4JA 1DVRA 3GLTA 2AE2A 3P5BA 5FTNA 1ZRNA 2Z9DA 3H6GA 1USKA 3UUGA 3FI9A 3WLAA 2O1EA 2PX4A 3W8FA 5AT1A 3NGLA 4DQVA 3ZG6A 4GM0A 2BISA 4LZOA 4GECA 4TZ6A 4TLLB 2JARA 4RU1A 1CTQA 4HPPA 3IC5A 1NW8A 2UXCB 1J1IA 1P1RA 4IDBA 2K3UA 4F4FA 3GJ6A 3PIDA 3OZXA 1RLIA 2CFTA 2X2FA 1P2FA 4KPYA 1ZLXA 4DDWA 2P3QA 1SOVA 5SZJA 3CPSA 2ONJA 1E6LA 1LPBB 9ICQA 4BV2A 3LFUA 1WCXA 3IMCA 1CJCA 4CYEA 2WWYA 4YALA 3B5JA 4RUKA 4LFAB 5AKIA 3K0HA 2ZUCA 1ZKMA 4O4LA 4D9JA 2QD2A 1CERA 1A82A 1BA3A 1GPWB 5JS1A 1Z2NX 3EWAA 4BJQA 2FMSA 2WY2D 3IL2A 5KYXA 4Y2JA 2P4HX 2JFQA 4RFBA 1PZFA 4UDUC 5JZBA 1K7SN 1V7ZA 1JEJA 4DEYA 1BJTA 3C2QA 4HDMA 2ZYGA 5MDHA 2XRZA 4RNAA 1MOSA 1SFRA 3Q3JA 4DBLC 3G9UA 4FNGA 2WSSD 2P4EA 5F9HA 2YOGA 3QHQA 2DWCA 4MW4A 4XRHA 3OFJA 1E3LA 3TTYA 1XL1A 3QELA 4V0LA 2QRJA 2NN3C 2XT0A 1A98A 1UKCA 2CBGA 1XHLA 1I4XA 4ATNA 4IXWA 1PWZA 2Q5CA 1OEYJ 2LGIA 1ZDMA 1T6ZA 2PX0A 5FBHA 1SV4A 4C5AA 2XGJA 3GJ8A 4A03A 2OXCA 2ZSJA 5J4LA 1YR8A 1O6FA 1KQOA 3DT8A 4J03A 8ICIA 4XDYA 2J5RA 4RS3A 4KGSA 4I4LA 1FNUA 2ZI6A 3L6UA 1FLVA 4JI8B 4I1IA 4MYTA 2ZIWB 2P65A 3IG5A 2W4IA 1QPGA 1NM5C 4ZGWA 4DG5A 3G7UA 1O9BA 1V37A 5KFHA 2AYYA 1RVV1 2QT0A 2IDMA 3Q8QB 3D5QA 4UFNA 4DOAA 2QTVB 5BQ3A 5E9AA 5JV5A 2XJ9A 2PKEA 2IW1A 3OEYA 5JVDF 4NCBA 4UE2A 3AB5A 3FY4A 2NNWB 3DYBA 4F4UA 5ED4A 3I28A 1Q0QA 1N6ZA 3NYIA 4ZRMA 2YHAA 5FWYA 3KOZA 1ISHA 2CMFA 3PGLA 3ND9A 2FUEA 1W4AA 4HLUA 4OCZA 5A3VA 1BUIC 3C7KA 4RY0A 2HSZA 1TTTA 2KJ5A 2J7PA 3PY8A 5BT8A 1V96A 2VHVA 3LDFA 3IE1A 1VJRA 3BMQB 3S3TA 1ZBQA 3U4GA 1GZ4A 2QLTA 2FWBA 4EHFA 1BDMA 2W8KA 3GRCA 2VJCA 3KCNA 5C37A 3KUZA 3R41A 4YT5A 5GP1A 2G5TA 4MIYA 1OT3A 2WWIA 3CS3A 5KT3A 2AC2A 3ZEIA 5BXQC 1GDHA 5IYZF 1UQVA 1QRDA 3BCSA 2L8JA 2E4WA 4XH9B 4A0HA 3U4MA 1NE7A 4LNNA 2DLCX 1TZJA 3HCFA 2Y1CA 3P4UA 5K0BA 4FS2A 3GT0A 4JS0A 1RNLA 2ZAGA 5K3DA 3HNOA 4I55F 4C8OA 1E3MA 2IGGA 2P90A 2FEMA 4ZO7A 1WYWB 4CG3A 3AM3A 4KGXA 3L40A 4S1TA 3WI7A 4JVOA 2OCPA 1Z18A 4NKRA 2Z83A 3NIGB 1DGQA 1DO8A 1O5TA 1Z6PA 2AXTU 3T5MA 2PQ0A 4YJ3A 4K9KA 1V11A 4CFZA 1QHYA 2BC9A 4C4XA 2DH5A 1QORA 1T0UA 3KQQA 1EZ1A 3PC3A 2Q5QA 1Z5UA 2HDEA 4N82A 1PD0A 3ZXIA 1UM9B 4EGCB 4HWPA 3PQ2A 5IIKA 3C6KA 3OTHA 1LGRA 1R6UA 4H7JA 1XTSA 2QUZA 2PKWA 3IPLA 4I4TF 3D2AA 4XI9A 5I45A 4M9LA 5FV7A 4DF4A 1NW6A 5TEVA 1XZGA 3HJCA 2BCEA 4D3SA 5I7WA 3KAQA 4P80A 4QYTA 4AMGA 3RJZA 4ZJPA 4MPPA 5KFXA 2P9EA 5JMOA 2H51A 1IG6A 1X1AA 4TS3A 2IXEA 4ZOEA 4UAYA 2J9RA 4PWYA 3ZGYA 3K70C 3AY0A 4QQNA 4EEXA 4LXIA 2R1TB 4KQXA 2X0EA 2K87A 2OCAA 3W9BA 4FI3F 4EG0A 2VDKB 1TU0A 2J8ZA 3AY7A 1XOIA 1UPTA 4QKQA 3DAHA 5CH3A 4J3OD 5G2NA 2V4ZA 5ICMA 4ZAZA 4JR1A 5FL7D 2NPTB 1WXDA 5DN6D 2FEXA 4XOUA 2V96A 1J33A 4RELA 3GJSA 3HFRA 5LVAA 3FSJX 3ZGNA 1ZGCA 1YBMA 9ICEA 4R40A 1KSHA 1M2EA 4J7AA 4C0WA 2MJLA 2HA2A 3KALA 1DIOB 1IHPA 2HMYB 5BYRA 1PZHA 2JI4A 3MTJA 2IUEA 5K3CA 1GLNA 1MGOA 2AMLA 2QLMA 3WQRA 1LUAA 1RQNA 1KJYA 3UC9A 4PQEA 4O4JB 4NIMA 3HWTA 5E4YA 5LZ9A 2OQVA 2Q2VA 2GN6A 2A84A 3P26A 3NOOA 3MPOA 1NYRA 1IY2A 2AD5A 4BZWA 5KFMA 3K7EA 3BJEA 3AUAA 3VOBA 2HSWA 3AZOA 2J3JA 2BMFA 4MPRA 5C8VA 3VKWA 1NVFA 1QG4A 4OQ4A 4AJKA 2ZJ5A 3I4LA 1NMXA 3OO1A 3HR7A 1GPBA 2IY1B 1PJQA 6REQB 1T5DX 5LP6A 4JX8A 5FBZA 4N12A 2E37A 2IOQA 2IBTA 3HQ4O 3PXXA 3X1XA 5I9BA 5FK9C 1L7BA 1G4AE 9ICKA 3UJNA 1A5ZA 4MW5A 4PG4A 2WJ6A 4YRPA 1E3EA 4UU1A 3G3EA 4PQRA 2IQIA 2KJ8A 3GOQA 4PAOA 3K1AB 3IKVA 1DV2A 5EHIA 4W7IA 4HGPA 1NVAA 4RKRA 3MWFA 3C3EA 1A5TA 3UKDA 3AQFA 1KK0A 4TMYA 4IFEA 1S9DA 2VJPA 5BSHA 2CBZA 2INCC 1M5TA 3GOEA 2C9DA 4G86A 1M6HA 1F5SA 3LO8A 2JLQA 3JS5A 5LZ2A 1T6BY 2ASVA 5DK6A 2KFKA 5CDGA 1NGSA 3NVMB 2NZJA 5AI5A 3V61A 4NNOA 2QVCA 4E1BA 4ZAGA 1TEZA 7ICVA 4IH4A 3KQSA 5J0XA 1A50B 1AYFA 3H9UA 4W1PA 2BMDA 2O6LA 2GYUA 1DCTA 3S8YA 1ZKDA 1E1QA 3HCPA 2PWZA 4OLJA 2V1XA 4PGAA 3VOAA 3RF9A 1E3WA 3H84A 5T4FA 1WWKA 4FDUA 4FLMA 1T3GA 2Q0QA 2D4AA 3FNHA 3ZJTA 2JIBA 3OU6A 3H4MA 3AEKB 2CSUA 5KO2A 3I72A 3R3MA 3M63B 2PAAA 5HKKA 2NXEA 1UC5B 3HC7A 4DMLA 4US1R 3V42A 4LMPA 2BYFA 1P31A 4ZRQA 1XVIA 3QFCA 5L9XA 4E5YA 4OJYA 2OHIA 4RMAA 4Q6WA 3V1KA 1TJNA 1ZRHA 3MGAA 2WMOB 5CIYA 2I1VB 1FIQA 3N6XA 3WXMA 3K9FC 4LQDA 3DWFA 5JQGF 4DSEA 4H08A 4M0PA 1U2EA 1C8VB 3GEDA 2VPPA 3PUWA 4MR9B 3VNRA 2WJ3A 1TYDE 1B1CA 3HXQA 1FU8A 4C3OB 2VJLA 2QMTA 3GW8A 3COJA 1ZXHA 3RS3A 2EW8A 3Q2AC 4PLCA 3T3FA 2JIZD 1OYWA 1CJUC 2HU8A 1TKYA 3EMBA 1CVIA 3HDYA 3I2KA 3JQ8B 1HOXA 4PY2A 2C4VA 1QDEA 3QGMA 2V0CA 1LF5A 2X9NA 3VRBB 1EM8B 4H4EA 2PEYA 3OSNA 4B3HA 2QPLA 3P9QA 4O2AA 5E7IA 5REQB 4CIAA 4LPKA 3BVGA 3KQPA 2WJGA 1D5ZC 3WLQA 4I1OA 4ARBA 3LZCA 1GY8A 4B8ZA 4EYGA 2F00A 3W90A 4FBTA 2QM8A 2J5XA 2WJWA 3RK0A 2YCLA 2Z2YA 1FYWA 1TCCA 3KZCA 4E7PA 4EGAA 2P0EA 1Z0FA 3TPZA 3PVXA 1Y42X 1VJTA 4D46A 4PG5A 1NEKB 2ZS7A 3L8CA 5HPYB 4PICA 3L1UA 3HHMA 4DIMA 2NSDA 2BT6A 1SC3A 3RWOA 3U1BA 3NXKA 1OYVA 3GMDA 3MABA 3OZBA 1YRWA 4B87A 4Z51A 1TTPB 4QYIB 2J41A 2FUNB 3VTUA 1RI4A 1NVID 1U7OA 3BE5A 3UV3A 5KJCA 4NJMB 3UMFA 1Z4LA 1L8QA 5JRZA 4JNCA 1FU4A 2GVDC 4RPJA 5A7HA 2QKYA 1ZR2A 3TR5A 2B2NA 4DV3B 3GRKA 5AM5A 2AC4A 1Q16A 3LXXA 3GWGA 4U2CA 3G2QA 4ZVKA 4ZVSA 4RDIA 2GLXA 3RREA 1TADA 3TEYA 2B8NA 4CLOA 3WYDA 3AEEB 2ZIVB 4ZRDA 4G5XA 3WBKA 4AJLA 5BRAA 3PPVA 2LMCA 5CLGA 1GRQA 1UFKA 1KFKB 5I3ZA 3HO1A 3BG5A 1LF0A 3OIUA 5LD2B 4K1XA 3L4JA 2QR5A 4FS8A 1ECWA 3L10B 3A6GA 5FR2A 2W6ID 1SZJG 3SC2A 2F1OA 4Y6GB 4AJ9A 1NA5A 4OKNA 1VKNA 3GFGA 1Z73A 1J8QA 2ZROA 3GUZA 1ELOA 4HB3A 1S3SG 4DWVA 4DLTA 1N9ZA 4F4ZA 1SOAA 1RI5A 1EXVA 2HJSA 2P9TA 1Q17A 3DAFA 1E58A 5EE3A 3A1WA 4OM8A 5EPOA 1XYGA 2JANA 4JBGA 3KEFA 4OO1J 13PKA 3EWSA 3L7MA 3U7GA 4QPZA 1FPMA 1G16A 3QJGA 2ASEA 1WGKA 2NQ2C 5AVXA 3A0HU 3RODA 4O8ZA 1NN1A 1RYJA 3RGWS 2X2EA 5AVWA 1I7DA 3X1JA 4OH7A 4C6HA 1DUVG 3C3XA 3W9YA 3IBFA 2C9ZA 4FPXA 3F7NA 5DSZA 3L0ZA 2JLYA 3CXRA 4LYFA 1OUMA 2FE8A 5F7XA 2NBUA 2PD4A 4C7BA 3WCQA 2KPOA 4Y0VA 1F2UB 1E5LA 3Q3HA 1JVNA 9ICVA 1ISSA 4DQDA 2NZXA 1RRCA 4FUTA 2QRZA 1T36A 1TK5A 3GYBA 3MMNA 1M34B 2N47A 1POWA 3HUDA 4PC1A 1OAOC 4KR0A 1RJ9B 2O0LA 3L82B 1LS6A 4NFYA 5JMTA 2Q4OA 4GI7A 1I4QA 1U0SY 3F0TA 5CT4A 1TNDA 2CDBA 2XQFA 2HRDA 1JHZA 3U5TA 3THVA 2Y2UA 5FWNA 4J9MA 4Q9JA 1KO4A 4F5ZA 1W76A 1OEYA 4GPZA 2OCBA 5EJ9A 2OAGA 3QU2A 5BYAA 4TM8A 5SYAA 4F8CB 2BIFA 2Z9CA 1OFIA 2ORVA 3RC7A 3LFHA 1FP6A 3KUDA 5TNXA 1CUGA 4KWTA 2Y9TA 2G09A 4ID9A 3EASA 3NHPA 1CNMA 5CB4A 2XOKA 4LLGM 5E4FA 1VLVA 3S5JA 1KH3A 5CNJA 2GRJA 3MC0B 3IQDB 4TWBA 1ONOA 1QJ4A 4HGYA 3L0SA 4B17A 3I34X 3ZD6A 4I4NA 3DEFA 3G2HA 4FWTA 3GZ4A 1PVDA 2W8BA 4E03A 4JKIA 4BASA 5AI9A 2P62A 2RHRA 1XD3B 5A3SA 3KV3O 4C4VB 2XK5A 2HNKA 2ZLBA 4B3JA 5AR1A 5LC1A 2KSOB 2XUIA 3JWGA 2ERYA 3UF0A 2A6PA 3C15C 4UXHA 1R1DA 4TKLA 3CKMA 5C3MA 2BCRA 5K3AA 4D9EA 3CVJA 4J0GA 3RMKC 3RS2A 2O5RA 1IY1A 3W8EA 4H2DA 2NU8A 2I6TA 3QM1A 5AJTA 1PUIA 1R4MB 1MHPA 2FDCA 1ODLA 1W93A 4O59O 3WMFA 1BMDA 5D3ZA 5E6NA 6YASA 3HA7A 4AKGA 1P7VA 1ZUHA 2WUDA 1YS4A 3NPAA 3WYFA 2F8MA 4IS2A 2JLRA 3K8ZA 2GF2A 1X8KA 1CJEA 1LV5A 3ZXUB 1GSIA 4TL6A 2ODGA 5J0PA 4JEIA 2DTEA 3I8XA 2CLDX 3PBKA 1DE0A 4KVGA 3TR0A 9ICMA 3TYXA 3U7ZA 3AEFB 3UK1A 2IX3A 3WAJA 3LUAA 3H4BA 2JLWA 1JI3A 1YONA 2PUJA 3W6OA 5C7OO 1C3JA 1P1HA 3UA3A 4DUGD 4Y8VA 1LNSA 5B2FA 2BWES 3GS2A 4EH1A 3FE2A 4YBZA 4BLUA 3C24A 4EAQA 2O8CB 4MZXA 2FPIA 2KVRA 5EUCA 2Z1NA 2N9LA 4Z4QA 1A8UA 3ZYZA 3Q8BA 5J59A 2ALZA 5L83A 3D7KA 4A8EA 4EQZA 1XZJA 1D5CA 4LOAA 1ZVKA 3NKFA 4F3CA 4QYXA 1P7ZA 4LVSA 2HHAA 1IEQA 5REQA 7ICPA 2G7MC 1W9MA 2GI4A 3B5IA 1S2GA 2H0RA 2HSDA 3PQ7A 3IMEA 1JXQA 4FHCA 4YCMA 2HQOA 4ARCA 5JARA 4H3VA 4GU2A 2Q9CA 2MSWA 1AV7A 4REQA 4OVZA 4TN1A 3VR5H 2AJDA 3WB1A 1AQLA 3PS9A 3A6HA 3OT4A 4D45A 1ZIYA 1RAEA 5IINA 2NAFA 5ADWA 2B35A 2GR9A 2ZXHA 3ETHA 1H4TA 2WJJA 2R8ZA 3IAXA 1VL6A 3EZYA 3P0IA 3VR4D 1TAHA 1KZ7B 1G6OA 2IA5A 1U8EA 1E7QA 5AICA 2A0XA 5JQGB 3R66C 1IMJA 1JHDA 1OKKA 2I2CA 5IKCM 3BGIA 4IM0A 2PE6B 5JHAA 1ZHOA 4YMMA 1GQOA 2AXNA 4B43A 3IA7A 3PLNA 4BX3A 4MUYA 3BMCA 2GD6A 2JH1A 2XWSA 2EF0A 3HYNA 2AJ8A 2I2FA 4INPA 4RABA 1IHXA 3CNLA 4XARA 4HTAA 4E46A 1WUKS 3SF8B 2X38A 1KI6A 4DZRA 4LWPA 4RHUA 4RYLA 3PJFA 5LP6C 3GBVA 4CR6A 4MWBA 2J0QA 4F6LA 5B4TA 1Q3HA 5DHAA 2AH5A 1OLOA 1B8OA 1EVLA 2JNWA 3CW9A 3DZDA 3PF8A 3SI8A 3HPRA 4PO8A 5J18A 1KKLA 3ISDA 1J2UA 4U00A 1TA4A 2NO5A 1XN4A 1KEEB 3H8HA 1FA9A 4LDQA 4C0SA 1WD7A 5JS7A 1AU9A 5KTMA 1QZEA 3EUAA 2ATLA 3FTCA 4BO1A 1XTVA 1JWUD 5HIAA 4YCNA 3QSYA 3E2MA 1B8VA 4MFFA 1DQYA 1RCTE 2ECOA 3SV4A 2XBBC 3BJYA 1Z0ZA 4U63A 4YMVA 1E3IA 3GCWA 4R8UB 1L3IA 1ORWA 3LS2A 4UW9A 1AKEA 3SJCA 3VJRA 4YSYB 3CW8X 3R2JA 3ICWA 3UEOA 2QORA 4B4VA 3P9ZA 3FPGA 4DIDA 3HM3A 3LX8A 1FFSA 1PSWA 4PZPA 3URKA 4XVUA 1C7JA 3EC7A 3FMFA 3H2HA 2M1MA 3GUUA 3BL6A 3DVLA 4YV0A 2W37A 4EB6B 2GRIA 3C23A 3D7RA 4ZYXA 1YN4A 1XQYA 4X97A 4AJJA 4OMCA 5B3KA 4L51A 4ENVA 1ZHHA 2JVIA 1CXZA 3DHNA 3PLVA 2W93A 1YHZA 2WUEA 2WG0A 5B3LA 4DCNA 1G3QA 1OH7A 4GGOA 3TD6A 2FX5A 3CRW1 1FFWA 1SIFA 2EP7A 3BL5A 5THQA 4ZP1A 5A4AA 3HCOA 2VKTA 1C8LA 1KO7A 3WALA 5AVQA 4UDYX 1WRIA 1SQSA 3ICXA 3QVMA 3LY9A 4QYSA 4P5EA 3TJZA 2Y67A 1SKQA 3KKKA 5FFNA 4OQEA 4B0OA 2WE8A 2IEGA 1YC5A 3R5TA 4AJYB 3HCDA 4R2MA 5BURA 4JOQA 4MDEA 1OAKA 3COVA 5JNWA 1B42A 2ZCJA 3AMZA 2NYUA 3P0RA 2BZSA 3IUQA 3ZD9A 1ONBA 4PSDA 1K27A 4I1SA 5E95A 4WDQA 3I73A 3BGWA 3IS3A 3VQTA 1L4FA 3SY8A 3I42A 1TZ1A 2NYVA 4FYXA 1FTNA 2GN9A 1FRZA 3HGTA 4GXNA 1WMDA 2L7RA 3KC2A 1KW4A 4UFPA 1CZNA 2NT4A 1P91A 5K0GA 3Q8LA 4A2CA 3STHA 4J76A 1T29A 4W1SA 4BJ1A 2UVPB 4S1WA 3DF9A 2WXJA 3U2SC 3KQVA 2GJKA 1KMQA 1YC2A 3SYTA 1PWXA 1IDN1 5EP4A 1E62A 3UJ7A 4KFUA 2ZIZA 3DV0A 2IHNA 2Q0HA 3WGZA 3BQ1A 3K9QO 5KTQA 1UAYA 3K8OE 3STUA 5HYVA 3AFNA 5H3LA 2V7UA 1S89A 2J3LA 1POXA 2AEMA 4YTMB 4B9UA 5G55A 3EUB2 3QYPA 4DL4A 1F9EA 1V1RA 3M5CA 3RAPR 1FF9A 1T6YA 4TUYF 3EIWA 1IUEA 3KEMA 5FIUA 1FFVA 2C5FA 4LTUA 2KACA 1AVTA 2GA8A 1E2LA 2VRBA 1QUEA 3PC6A 3FR7A 2BFWA 5CCBA 5GPBA 4KDIC 4JLBA 1RXWA 2WQ6A 3H5WA 3DL4A 4M2YA 1BFKA 1T3TA 2OQIA 2HJGA 4CN8A 1NP6A 1ZNQO 4FJ1A 5BPCA 2Y66A 4LXYA 1YBHA 5FI0B 5DKWA 2QMEA 8ATCA 1S97A 5AVRA 2VZLA 1TC2A 4AN4A 1G5TA 1GJZA 1GNRA 3CH6A 2D6FC 2D5AA 2JRHA 2QRNA 5BVGA 2O2CA 3B38A 4HDQB 3I58A 4A8JB 2Q1XA 1PJ2A 4WUTA 3UQZA 4ZTBA 1EFUA 3PV0A 4LXQA 2LTAA 5G0SA 1Z9BA 4PPQA 3I1FA 2ATVA 2AN4A 5EHNA 4BQIA 2PKXA 1L8LA 3MTIA 4R64A 1CQWA 1OGIA 1O6CA 5KPJA 4LRQA 4GZ5A 2H4FA 3RPFC 1WO8A 2JBAB 4LSGA 4MFAA 2HC9A 2PMBA 1L9KA 3DWIA 3MTGA 1ZOPA 1KZ4A 3Q7TA 2Q49A 1BFDA 1QVRA 1WDWB 2VRCD 5LN1A 3WTBA 1JSRA 5DW3A 1L9XA 2ZATA 3EULA 5IKOA 4Y6PA 2KBEA 2W11A 1A9SA 1CK1A 2EJWA 1AIPA 1W29A 1P74A 2Z6VA 4J2OA 1E69A 3IT6B 1BXGA 3L01A 5IA7A 2AOUA 5JDIC 1V9PA 1JPJA 4CM1A 1UP4A 4MAMA 1ZNXA 2GYVA 4PXYA 3GLHA 3L7YA 3BZUA 1QHIA 3KQLA 3EMKA 2Y0BA 4L3VA 2MYPA 3SQNA 1T8TA 5FFFA 1Z4IA 4G0NA 1N1EA 2JLAA 4JJ8A 4KKXB 4IZ6A 1HE3A 2I22A 5CJPA 1IM4A 1RU3A 2C84A 3APFA 3IXSA 2CDNA 1LNZA 2KLBA 1MDBA 4AP9A 1OLUA 2WIAA 5C53B 3C2KA 3VV2A 2G06A 3IR5A 1V1PB 1MA7A 1QHXA 4N8DA 2DBQA 2W2VA 5FLKA 4PS0A 2W03A 3IE2A 5KG3A 3WLFA 5D1NA 3LTNC 3TJMA 1GUAA 4PYZA 2F90A 1CR0A 3ML9A 2CB0A 3H17A 3C48A 1A72A 4YJKA 2P2NA 3DOIA 2CCGA 2AZMA 5J9FA 2B69A 2PGOA 3LSTA 2QTTA 1NBEA 3PX2A 3ZLVA 3PX6A 2O48X 5C4IA 1JQKA 3D2NA 2R25B 5TVKA 1UHUA 2XBMA 3VPHA 5DCYA 4MJ3A 4FSXA 3UCXA 1JR3A 4MQ6A 1R50A 4I8DA 1CW2B 2CWDA 1RRMA 1TLFA 1F52A 1VL2A 3LHKA 2R8IA 3IILA 4KOEC 3IKLA 3DG9A 4LCEA 4BFSA 1KL7A 1XNQB 9ICLA 4IXNA 3ACBA 1XMOB 1E2EA 3ONEA 1C29B 4D3XA 5JAMA 1VPLA 4JWMA 3ZGZA 4L8LA 9ICBA 4EITA 5J3JA 1DLIA 4EYEA 3W5DA 3M1IA 1ADCA 1XAJA 4UJ5A 1WW8A 3P9XA 2O5EA 1A9PA 4WCVA 1BZYA 4EWLA 4BQFA 2I5HA 2CKHB 2DJIA 5CT9A 3AUSA 2QMHA 2F3UA 4CKEA 3HGQA 2BQ3A 1EFHA 3W2HA 2FCRA 1VBNA 2BFDB 4E4RA 1U8XX 1A1VA 2PXHA 4KLHA 3NVAA 4IG9A 8GPBA 2H1SA 2VWPA 1T5LA 3EW9A 1Y6JA 4CXMA 4IIHA 1N57A 1PL7A 4LGVA 3O9VA 2NUAB 3D64A 2PPVA 4Q3EA 3WLIA 2G36A 1X14A 1H94A 2CXUA 4E13A 2ASQA 5JADA 3X1DA 2DFDA 1G5HA 5E6UB 1RYZA 1V6EA 1LC3A 2W9NA 1SBIA 1HZ5A 3L84A 3H9QA 4QWCA 2DBZA 1PV1A 4WWOA 4CLRA 2OHXA 4OH1A 4O1HA 3N8IA 1RVDA 3E3OA 4DWOA 2J0MA 3GZNB 4NV0A 1WQ4A 2YFKA 4DC9A 1CWUA 2M19A 4HPXB 2PZLA 2CE7A 2CLCX 4MVCA 5EZ5A 1PD1A 3ETJA 2PUDA 2I7CA 4HWTA 5C3JB 3EQZA 3V6MA 1H2EA 2WW8A 3ZXYA 2BSQA 3VHQA 2ZBPA 2JEIA 5DPWA 3VO9A 1FPYA 2CHUA 1CUIA 3PR2B 1S0OA 2NRWA 4LF4B 2VXCA 3QIVA 2HA4A 2B76B 2H0AA 5KS2A 4F92B 2GF0A 3PGJA 3MBYA 3BA6A 3O65B 3PV8A 2P7HA 2IOHA 3HU2A 4ADSG 4EPRA 1ZH2A 1LBIA 2DFLA 1M7GA 2CYCA 2XWQA 4IDPA 4F91B 4YR0A 1OFVA 4OD0A 1Y3IA 3F67A 3OT1A 5BT9A 5IS2A 5AOAA 4E32A 2VHQA 4WZBA 2P6OA 4J3JA 1D6MA 2ZULA 4M9CA 3F2CA 3ZNPA 5KTKA 4GXRA 5D5QA 3W3AD 2LVOA 4Y1RB 1CYEA 1E8WA 5HA5A 5HS4A 2FHPA 2KWCA 1U3VA 4JV0A 3OICA 4RSRA 1TM5E 2AJCA 3CLSD 1Z2EA 3N30A 1M8PA 4MULA 3UYKA 1RWKA 1VA5A 2QV7A 4MCIA 2K60A 2C99A 3AT1A 4P3PA 4F60A 2QI9F 3IEKA 1QAOA 4KODA 4KLSA 2B0CA 4JLWA 3BKWA 4YO8A 5CFOA 1W59A 3SZOA 5CJ7A 2UUOA 1F4VA 4CJXA 3T3MB 3HFGA 3K5HA 3VA7A 8ICKA 3H97A 5CNKA 1ZAYA 1XVLA 4NZPA 1AQUA 2MDTA 4FBUA 3K9WA 1G8FA 2G63A 1AROP 4LNIA 4Y9TA 2O0MA 4HDQA 2KS6A 3UT5B 5TJHA 3DWGA 2BHRA 2LXAA 2HZBA 1C5KA 3KTAA 4UU8A 4QU5A 3GLKA