5EE3A

Complex structure of osychf1 with amp-pnp
Total Genus 110
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
110
sequence length
374
structure length
357
Chain Sequence
ERPILGRFSSHLKIGIVGLPNVGKSTFFNIVTKLSIPAENFPFCTIDPNEARVYVPDERFDWLCQLYKPKSEVSAYLEINDIALGNAFLSHIRAVDGIFHVLRAFEDKDSVDPVRDLETIGEELRLKDIEFVQNKIDDLEKSMKRSNDKQLKLEHELCEKVKAHLEDGKDVRFGDWKSADIEILNTFQLLTAKPVVYLVNMSEKDYQRKKNKFLPKIHAWVQEHGGETIIPFSCAFERLLADMPPDEAAKYCAENQIASVIPKIIKTGFAAIHLIYFFTAGPDEVKCWQIRRQTKAPQAAGTIHTDFERGFICAEVMKFDDLKELGSESAVKAAGKYRQEGKTYVVQDGDIIFFKFN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title ATP binding by the P-loop NTPase OsYchF1 (an unconventional G protein) contributes to biotic but not abiotic stress responses
pubmed doi rcsb
source organism Oryza sativa subsp. japonica
molecule tags Hydrolase
molecule keywords Obg-like ATPase 1
total genus 110
structure length 357
sequence length 374
chains with identical sequence B
ec nomenclature ec 3.6.5.-:
pdb deposition date 2015-10-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01926 MMR_HSR1 50S ribosome-binding GTPase
A PF06071 YchF-GTPase_C Protein of unknown function (DUF933)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.300 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 TGS-like domain 5ee3A03
3.10.20.30 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 5ee3A02
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 5ee3A01
2O8FA 4I99A 3PEUA 4U02A 2EFHB 4X8OA 1UPTA 2REBA 5HZKA 1VG9B 4WAUA 4PC1A 5FTKA 2F9LA 2K9XA 2FSHA 1G9XA 2MSDB 3QKTA 4R7ZA 3CO5A 1LY1A 4OI1A 1P62B 2A5JA 4LJ7A 1WF3A 4P31A 1E9EA 4BECA 3MMPA 2XZLA 1QLBB 2WJHA 2WWGA 1WCV1 2FZLA 3RS5A 4EQ6A 1KZGB 1NI3A 2JLWA 1I7HA 4KBGA 3KZ1E 1P72A 1Z07A 2J41A 3U2QA 4BFXA 1GDDA 2AK3A 3FMIA 4AIIA 1KJZA 4YMSA 1PVOA 1ZXIA 3DHWC 3GFTA 2K5UA 2IXEA 4R9UC 5EUMA 4TSFD 3UKDA 3OEHD 1YR7A 4E09A 3NVVA 4LV6A 1J2JA 4JSTA 2ZQ5A 1QOBA 3W6OA 2YV5A 5G5HA 2WIAA 2CBZA 4QM6A 1JECA 1ZIOA 2QI9C 4A0RA 4N3NA 1GIAA 5AWFC 1KAOA 3WCQA 1G20E 1XXHE 2FGKA 1OKKA 4Y0AA 3R20A 2ODEA 2V55B 5G5GA 2VF8A 5DI3B 2PLFA 4I4LA 4NCJA 4V0ME 2ERXA 1DAHA 5C1BA 2ZS8A 1XNJA 1PLJA 2VHJA 1KO1A 4ZIRB 1LNZA 3CX6A 4K8OA 1TF7A 4Q21A 1WYGA 3EZFA 4D2IA 4S35A 4B75A 5A4JA 2ZE5A 3QIAA 3I73A 4CEJB 2JJ8A 5HKKD 3H86A 2J7PD 2QM7A 1E1QD 1Z6YA 1QOGA 2WU2B 3QENA 2OAQ1 5B58C 3H0KA 1AQYA 2Z43A 4TSFA 4Q4HB 1DG1G 1YRAA 1YHNA 2NG1A 5G53C 5GJVC 4RD4A 3AF1A 1E9CA 2REOA 2W00A 4YMWA 2IYSA 3RRZA 1Q57A 4BEJA 3I61A 1U81A 4C2UA 4OJQA 3B85A 1OFFA 5H68A 4KVGA 4RD2A 4X8LA 2D7CA 4LJ4A 2DR3A 3B9PA 2KSQA 5BYKA 3AM9A 5DIFA 2OE2A 1DADA 3CPJB 3GJ5A 2ZUCA 2F9MA 3LV8A 3NXSA 4NH0A 3CF2A 4PPNA 4YTPB 3GLIA 5KNDA 1G18A 1JAHA 1RYJA 3WY9A 3JVVA 4YXDB 1VLBA 1G3UA 3HDTA 2WDQB 2CE2X 1KOFA 4ILEA 5JZVA 2QBYB 2DPXA 3SJBA 4AWXA 3CX7A 1X1RA 1F6BA 4EPYA 2DB3A 1R5OA 1FUKA 3ZVMA 1WGKA 1YJJA 2OEPA 4FMCF 3AEGB 2JLXA 1KNQA 4CGZA 2YNMA 1VHTA 2ZPTX 2PEZA 2VTKA 1G19A 2ZS7A 3IPYA 4QRHA 5FL7D 4IXMA 1O87A 1XD8A 2QPAA 3GJ8A 2DHRA 1YR6A 4PAOA 2IWRA 4LHYA 2FMXA 1FO4A 1HEIA 2EKIA 3KKQA 3D7MA 5CIQA 1OHHA 3AVOA 4BZXA 2EW1A 2BJVA 1XXHA 4DUGD 4XOIA 4C0QC 3M6AA 4CRWB 3THXB 2OFOA 3MG9A 3SNHA 3WYAA 3SJAA 3L2OB 2NO9A 2UZIR 4B3BA 4FW9A 1KY2A 2FPKA 3NHAA 1G64A 1GFIA 2ORWA 4LY6A 5HR5A 4I1VA 1Z0JA 3T12A 4MGZR 3KJEA 4ZHPA 5E95A 3TLXA 4E07A 3VNUA 5GADl 4JSYA 1Q21A 2VA8A 3ZQJA 3VRBB 5IHPA 2G77B 2W6JD 2ZU0C 4GSYA 4D25A 1RYFA 1N6HA 1U9IA 1KO8A 3WHKA 4FIDA 1KI6A 2JLVA 1JRPA 1WMSA 2WSSD 3MWKA 2ZE6A 4PHFA 3NIBA 2V3CC 1Z6XA 1E69A 1VYUA 3MWJA 2MSEB 4DLZA 3R9WA 1G21E 5C2TB 4RFVA 4TMTA 1LF5A 3ZVRA 4B32A 2NO6A 4P32A 4GBMA 5CLQA 1E96A 1NKTA 4H9GA 1GL9B 2H89B 4URUR 5D3MA 3NEJA 4P4UA 1E99A 1FNNA 2GEVA 1R8SA 3L0PA 1W44A 2QSZA 3BB4A 4GOKA 1TEXA 4A6PA 4PAQA 5JFGA 2NOAA 1P61B 1Q44A 3TKLA 3V00A 2ERYA 2MSCB 3CWZA 2BMDA 2R65A 4A8JC 2R6FA 4Q4LA 1TPZA 4I1UA 1KSFX 3I62A 4QG7A 1E1RD 3OZXA 3CRRA 3TH5A 1EGAA 2ORVA 4PSVA 4V0KA 4E03A 3HUIA 2QRNA 3BFXA 4Q02A 4AG5A 1MO4A 1E9MA 2RH5A 3KFVA 1NYRA 1KYIA 2HXYA 1RW4A 3FAHA 3CNLA 3DMDA 3KUCA 1A7JA 2WWFA 4Z51A 1GUAA 2HCBA 3PITA 3ZS9A 3MJHA 4HUQB 4LJ9A 5JLJA 2WS3B 1QG2A 4RD3A 4YSXB 2XZPA 1E2PA 3AVXA 3UWOA 3QQ5A 1NMZA 1Q1QA 4PZLA 1KF6B 1E6CA 4EQ6B 4ERNA 3FFAA 1E3MA 3CIOA 1U2RA 4LHVA 2QRZA 1IM2A 3CBQA 4LRWA 1FIQA 2R9VA 1RRCA 1S4QA 2AXNA 2ZAMA 2CVFA 821PA 4J0QA 4M1SA 3IQWA 2GWHA 3K0CC 1AK2A 3RS0A 4C3ZA 5JCZA 3ONWA 4AC9A 4Q9JA 4Q4HA 3O8CA 1DO2A 1ODFA 5LDDC 1T91A 3AE2B 3A1TA 3SYKA 4TMZA 2AL7A 4ON9A 5FL7A 4AK9A 4AI6A 1Q1BA 2D2EA 4EJSA 1L6UA 1P7CA 3AE4B 3LDAA 2OILA 5E7MA 1TEVA 4TLEA 1IQPA 5AR1A 2CLCX 2WWHA 4IRUB 1IN4A 1C4OA 3IDQA 2HTME 3WNBA 4B47A 2GKSA 2ZSBA 4RFSA 2ZR9A 5FL3A 2FEOA 4PTLA 2WOJA 1XTRA 4PHTA 4BPBA 3RC8A 2I1QA 3HPRA 5TDHA 2QBYA 4YSZB 1Q12A 3N2IA 3GFOA 4ASUD 2AD1A 4B6FA 4BRUA 3VU9B 1UKEA 3HR8A 3ASZA 4NZYA 3X2SA 4EJSB 3AGQA 3W9YA 1WBBA 1GTVA 1GNQA 3KKPA 3NG1A 3GLGA 1RFKA 4XTRA 3DZDA 3P27A 1KKMA 1E2FA 4DC9A 5M04A 4HYYA 4RFSB 2ZRMA 4AURA 3B1ZA 3SN6A 4GOXA 2ZRFA 5F9HA 3W5IA 2ZJ2A 1NY6A 4JIMA 1QHXA 2CE7A 1FQKA 5FTLA 1P2VA 1XZPA 2ZRHA 1F48A 1I4LD 4AYTA 4BZPA 4YMVA 4MYCA 4OHYA 2JLSA 5JS8A 4NYMQ 5A5GA 2QN6A 3FGNA 2DWQA 3B8HA 3TAUA 5EUQB 4GRAA 2FA9A 3KFXA 5SZHB 4M2LA 1AN0A 4M21A 3BWDD 3AV0B 4M9QA 3WMGA 3U44B 4FN5A 4L8GA 5K8TA 1RRGA 3CX8A 1FTNA 5EP2A 4ACBA 1AJEA 4ABYA 1JAIA 4HZUA 1S96A 5AJXA 4BASA 3VX3A 5KHOC 1E2HA 2C77A 2A7QA 3P4XA 4UNQA 1CR2A 1W1WA 3AVVA 1NLYA 4DLWA 4Q9IA 1ZM4A 4BLTA 2FGJA 2ZRJA 5J4VA 2ZI6A 2WVJA 3E1SA 2JJ1A 1A4RA 1X6VA 2I4IA 4DLXA 3ZZ0A 1BIFA 1SB3C 4QHTA 1AGRA 4H1UA 2ODWA 1NBMA 4LOAA 1A1VA 2MJ3A 2FG5A 2H18A 1W2GA 5JHHB 2CXXA 1LV7A 2IT1A 2C95A 3K0SA 1KDOA 1KY3A 3EPLA 4URVR 4DB4A 5IK2D 3FPAA 2D7DA 4TZ6A 1G4AE 1QZXA 1Z6TA 4MQBA 4Q1EA 1Q3HA 5FOXA 1TYGB 2UVQA 2PZEA 1QHYA 2VP5A 2QU8A 2XNSA 3A4MA 1ZJ6A 4W7SA 1F2UA 1FM0D 4V0LA 4US1R 3NHBA 2F1IA 2VP6A 4JLKA 2FOLA 2O5VA 3ASYA 4OL0A 4M1OA 1NL3A 2JAQA 1WRBA 3DL0A 2ONKA 3AE9B 3H84A 3H4MA 5J4LA 1G7SA 2AR7A 1CJVC 1S3SA 4UJ3A 1HUQA 1J70A 1LVGA 1N5JA 1AS2A 4TN1A 2JLZA 4DEXA 4NMMA 5CM8B 3UG7A 3UXMA 2GF0A 2OBNA 2ZANA 3BXZA 4TLCA 3AV8A 2GRJA 1KAGA 1G8FA 3A36A 3VR1A 3VRAB 4RCZA 1P60A 4DCNA 3ZVLA 2AKAB 2PT5A 4QGAA 1E2LA 1SVKA 2RGNC 3KJGA 4CT4B 2G3YA 2GHIA 4DIEA 3Q8XB 3PEVA 3GEHA 3K09A 4LI0A 1YQ3B 1RJ9A 1II0A 2KWIA 2H88B 4YT0B 1LS6A 4QC2A 4TMWA 1IN6A 5KOYA 2YWEA 3K8YA 2FFBA 3FC4A 5HZHA 3B13B 2DY1A 2HYDA 3OAAD 2XJ9A 5CK4A 1G3RA 4DCVA 4MGKR 1N6LA 5KYKA 3J81k 5C4GB 4B6EA 3DDCA 2G1KA 1G41A 3THYB 5DYGA 3G0HA 2GBLA 2DWPA 1SVIA 3QJYA 1KDPA 3CR7A 1GNPA 5B2ZA 5EE5B 1E98A 1XLPA 4TTPA 5HE9A 4DLVA 1VDZA 2QGNA 2REXB 4QBHA 1Z28A 4CEHB 4Q7MB 4Q1BA 3FHOA 2J7KA 2BHRA 2V54A 3KDSE 1EFRD 1IUEA 1DAKA 2LKCA 4GDFA 1CRPA 3LVRE 2X2EA 1DVRA 3S1AB 2H8KA 1XTIA 4MUAA 2QP3A 4LTUA 1PUIA 1QHHB 4GI7A 1XO3A 1E0JA 2B8TA 5FR2A 3TNFA 3IHLA 3B60A 3P32A 4GZMA 3RSLA 3QBVA 1ZC3A 3B2EA 2R2AA 1TX4B 1KI6B 3WXMA 2NIPA 3BH0A 3GLIB 4EPWA 2V4ZA 2PMDA 3A1UA 1T3SA 1XEWX 1VG0B 4IVRA 5EXSA 1W36B 3I4LA 2HUPA 3AKEA 1U99A 4R71A 4O25A 4KLZA 2PX0A 4MGIR 2JGNA 3OEHA 4B71A 4NP6A 1DG3A 2W3SA 2XB4A 4AKGA 5UKDA 1ZD8A 1R5NA 1ZW6A 5KDOA 1XFAA 1W2HA 4A8JB 1W0KD 1Z5ZA 4DDVA 4HAYA 4BRWA 5CDFE 1DAMA 2LWIA 4P33A 2IYXA 3PR1A 3LVQE 5AUOB 5AUPB 4LHWA 1U90A 1K8RA 3KB2A 5FUVA 4JLDA 1T4GA 4PO1A 4KU4A 2J59A 1GSIA 2QTFA 4C7YA 5E3HA 2GAAA 3HP1A 4W9MC 4AKEA 4PR0A 2XB2A 3OFND 1R4AA 1E94E 1XP8A 3BE4A 3CW2A 2FPMA 1XWIA 4LZZA 4LV8B 1TKYA 1KMHA 2KBEA 3DMNA 1MRNA 3IO3A 2D2FA 4PHHA 5HKKA 1KI2A 2ZJ5A 4P3YA 3E5HA 1OH6A 1YVDA 3U4QA 3P4YA 1BH2A 1EFRA 2IYZA 3AB5A 3SS8A 1YR9A 1VCOA 4FXCA 2VLIA 1UBCA 3B1VA 3DEFA 4DUGA 2CK3A 4LPSA 1T5LA 4USAA 1WA5A 2G0NA 4NDZA 1OIWA 4MKHA 4BFYA 4B3DA 1NSTA 4OQFA 3OIUA 3PEYA 1JBKA 4TQ9A 4A2WA 1E1QA 1KJWA 1M7HA 1TF2A 2VP2A 1OH8A 3GLFB 3EZ2A 3QXJA 2HJVA 3B1WA 3ABVB 1P9NA 1RRFA 4FMDF 4JLMA 3VKGA 2MJDA 1COWA 4JJKA 3QKUA 2VSFA 4O0MA 4HLDA 4PFSA 2W54A 1DBSA 1V5WA 1WDTA 2J1LA 2QG6A 1H8HD 4B2LA 1R6BX 4G0NA 2GBLC 3IGFA 5C46F 2QZ4A 4ZI2A 3O47A 4JJZA 4U00A 2RB4A 1KTVA 1I4DD 2X2FA 4HAXA 5EXXA 3CPEA 2QP9X 1F2TB 1JALA 2QPTA 5JWHA 3P63A 1MH1A 4D0NA 1ZD9A 2IF0A 1K6MA 2ZSEA 5LPNA 4G5RA 4L9WA 2P5TB 1T9HA 2W2XA 1S0UA 4UXIA 4GFDA 2IYWA 3TVTA 4OHZA 1WBDA 1PFDA 2BWJA 1W4RA 3SHWA 2FEMA 4KSBA 2R6AA 5EE1A 4MRNA 4R2IA 5L3RA 2WJVA 5DI3A 3U3OA 3VR6A 2IYYA 4OHVA 1M2OB 3CLVA 4PSKA 1AZTA 1U9IC 4TLDA 3ZJYA 1JWAD 2OSBA 4L4UA 1E2JA 3W9CB 1RVDA 2G9NA 3B1XA 4Z54A 4AYXA 4EPVA 1JQJC 4NBSA 4DIDA 1TKGA 1NG9A 2V8OA 1Z0FA 3JZAA 3AECB 4N59A 1KI1A 1M8PA 1NN3A 3JZMA 2JX5A 4Q7JB 1IXRC 4KSCA 1A82A 4MKIA 4WIAA 3Q7QA 5FOUA 1FL9A 1O3YA 4LWZA 5E7JA 4C4PA 1ZM3A 1NBME 1JR3E 2QORA 3ECCA 3EIHA 3GLFE 1AKEA 1XTSA 5IRCD 3TGPA 4JLAA 1QBKC 1SKYE 4II7A 3KXLA 3KQUA 1OV4A 2R6CA 2WMNB 3CNOA 1Z22A 1ZUIA 4GP6A 4A2PA 4DXAA 2KJQA 4AKHA 2FSIA 4JL6A 3R9IA 4TMXA 5EJEA 1XJQA 2CJWA 2IS4A 3GP8A 3QF7A 4GMXA 4X8HA 4ZDKA 4Q1AA 2VIIA 2ZYVX 3C14C 2R8RA 1TU3A 1E79D 1WWTA 1G6HA 3AVYA 2G1EA 1LW7A 1RRPA 4D0LB 5FBVB 5E7IA 3LQQA 3TAHA 1W4CA 2ATXA 2YHSA 1XMVA 1CULC 2EYQA 1XX6A 1VCMA 1AIPA 2GJSA 3AP2A 3EZ7A 3T34A 2WP9B 4I81A 4QFMA 5BW8A 3G82C 1T5IA 3AUXA 3FTQA 5TY0A 4BLPA 5BN4A 2GZDA 2OLJA 3KQHA 5B30A 5FTMA 1H8ED 2CHGA 4NE2A 1FPMA 4HLCA 1OXSC 2B6HA 1U8ZA 1JPJA 1XMIA 1CF4A 1AS0A 4FMBB 3NBFA 4PQYA 1U0JA 4I1OA 3U6BA 1ZCAA 3PUZA 3LLUA 1XTJA 3DVLA 5H70A 2PLRA 2FWRA 3PQCA 2FSFA 1BKDR 1N62A 1XEXB 4NYIQ 5F9FA 4LBYA 1G5TA 2Z4SA 4MDEA 4HB3A 3AN1A 5H8WA 1VYTA 1OSNA 3CIRB 5AUKA 1YZTA 2OXRA 1NEKB 3NBYC 3FHCB 2F43B 1FTSA 2IUSA 1PUTA 1L4YA 2X77A 1W0JD 3CR8A 3QXCA 2YWGA 3V9PA 3FYHA 2FFQA 4XIGS 2OESA 2I3BA 3AUYA 3FHTA 4V0OA 4YDHB 1N0WA 5B57C 5G3YA 2QY9A 4B3XA 1P73A 4CZ2A 4DRZA 3T1TA 1GNRA 1ZNXA 2ZR0A 3EA0A 4TQUS 3ZH9B 3G5UA 5DLQC 4FINA 2WQYB 3AE1B 3U5ZB 2V7QA 3D3QA 2V6IA 2YWHA 5GJBA 2WJGA 3QBTA 2FH5B 2QMOA 3QY0A 4WW0A 2GXAA 2E3TA 1E2NA 1P9WA 5JS7A 5JSZA 1E2MA 2PVOD 2RGDA 4A6XA 4MITA 2IS2A 1R0ZA 1U94A 4NCKA 4HLQB 3T1OA 2ZRDA 5D3QA 1SKYB 4ZV4A 3B6EA 3CZPA 2H5EA 3IBYA 4GOJA 5JWRA 1JEEA 1XU4A 2NGRA 2NQ2C 4ZIRA 2P0EA 4A0GA 3BIID 4HROA 4IEIA 2VHTA 4D4LA 4Q7LA 3CNNA 4LYHA 4ITRC 4EDHA 3K9HA 5K8IA 4FCWA 2OG2A 2BBSA 4QKQA 3H2YA 5HCNA 2ZXUA 1J99A 5G41A 5J4KA 2WWYA 3VR9B 1TQ6A 4LBVA 2ZJ8A 1XPOA 4KFTA 4KFUA 2H7VA 2PH1A 3C5HA 3PUWA 1RJ9B 4JLPA 5K8UA 2EFGA 3AF4A 3FE2A 1D8TA 1P2TA 2YKGA 3B1YA 1VTKA 3AF3A 1XBTA 4IDOA 2QM8A 4O2RA 1KHTA 2C2HA 3I3SR 5JI3E 1P5ZB 1NY5A 3A1SA 1U98A 3ZZTA 5FTJA 3RS7A 4JLJA 1JR6A 2XNDD 2KBFA 3F5FA 4Q00A 1DAEA 1Z08A 2QROA 3MFYA 1XF9A 4PXAA 2JDIA 4S2EA 2PIAA 4G01B 2CL6X 1B0UA 1G3IA 4H1VA 3CUEF 1ELOA 1F2TA 3ZIAA 1YR8A 2RGXA 4Q9KA 4BLRA 5JBQA 1EFTA 4W5JA 4C7OB 1XCGB 1UBFA 4UNNA 2AX5A 1SXJB 3CRW1 3OF5A 4D4MA 2JLUA 4BFTA 4QM7A 4M1KA 4ESHA 3AKCA 3THOA 4EJSC 4URXR 4CEJA 4Z1MA 3X1WA 1NLFA 4BLOA 1OQRA 1LTQA 1E9FA 4KBFA 2ZVPX 3W90A 3UMRA 1OFTA 3A1VA 3MD0A 2IF2A 4GT1A 2FJUA 4MRVA 5LD2C 5GJCA 5FPKA 2BMJA 2VBCA 3RRYA 3U3RA 1OW3B 2WM9B 2JIZA 3C41J 4JLBA 1VHLA 1BO6A 2MJEA 5LB2A 4XSHA 3DOEA 3OE7A 4Q4JB 1FMLA 5C3JB 4JWSC 1G16A 3NVWA 2QMUA 1HE1C 3EC2A 4C0BA 1F60A 3LA6A 3BH7A 3ICQB 2O8BA 1XLNA 3W6NA 3W34A 1KSJA 4W5WA 2GXQA 2W58A 3TW4A 1PZNA 3B82A 5D3MB 2P6NA 1G8GA 3B2FA 3OIVA 3LW8A 4B76A 1UKVY 5KSPA 4IDQA 4OJKA 3RHFA 1Z29A 1S3GA 3VFDA 1NN5A 3CONA 1NRJB 1E2KA 3WRXC 1ZP6A 1I2MA 1CR4A 1J8MF 3QXXA 2VYFA 4JLVA 1UM8A 4IDPA 5JMTA 1L8QA 5JRJA 4MDFA 1GRQA 4QJ5A 4HAUA 1ZC4A 5FBLB 2FDCA 5CITA 5BXQC 4TLAA 5SZIA 1I4TD 2NTYC 4DB2A 4JVSB 3ZDQA 3LY5A 3TQFA 1YJIA 2ZI4A 5AJVB 2BS3B 4YONB 3VTKA 2IYRA 1SVMA 3WYFA 2GA8A 1AS3A 3P20A 3A1WA 3L8YA 2ZRNA 1CBUA 4O2LA 1SULA 3NC0C 1UDWA 2ZYWX 4URWR 4Q9HA 1HT1E 3LW7A 4JBYA 3AM1A 1CS4C 2CL7X 2GETA 3CRMA 3HU2A 3R8FA 1QHHA 2OCYC 1CRQA 3AF0A 2X19A 1ZNYA 3THXA 1NVID 3QI2A 3SR0A 2OUKA 4C7OA 4L9SA 4TL9A 2QJLA 3IQXA 1R0YA 1W5SA 621PA 3RAPR 5BWMA 4MRRA 1HYQA 1JPNA 3DOFA 3CWQA 2Q21A 4ZDJA 2PEYA 2XJ4A 2PBRA 2W3RA 2WJJA 4RY2A 3GLGB 2C03A 2O0KA 1VPLA 4QJ4A 2GILA 1SXJC 1TU4A 2KE5A 1RIFA 3EG5A 4KAXA 3TIFA 3HPQA 4FWIB 2E9SA 1E32A 3GJ3A 4A0FA 4JLNA 1T3LA 2W2TA 4HLUA 1IJEA 5FH9A 2WKRA 4TL8A 5E4FA 2BBOA 4F91B 1LFDB 3CH5A 1XMSA 1CU1A 1LF0A 3R7WA 3VR2A 1ZM7A 2Q0HA 1OB2A 3DZ8A 3MSXA 2B76B 2XNDA 3LD9A 4TL6A 3W3ZB 5ELXA 3FMOB 4QHYA 1L6VA 4QBFA 1XZQA 1OFIA 1OFHA 3EPHA 4KHZA 2JDID 1OE0A 2N42A 4LYFA 1XCMA 2CVHA 4HDOB 4YSYB 1FMJA 3LBNA 4A36A 3VKWA 3K1JA 3AEZA 4OBEA 4DDWA 1KRHA 1VDVA 3AQ4A 5FUYA 4XH9B 4DT1A 2OM2A 3CKLA 1N6KA 3WBKA 1VECA 3WNCA 3F0TA 4A92A 3ICEA 4BWYA 4E5UA 3EASA 5TV2A 221PA 4PC7A 3C15C 3SZRA 2WJIA 4UJ5A 1D5CA 3WHLA 3THWB 2AWOA 4MKFA 2ZVQX 3BC1A 1ZUNB 2B8WA 1S9DA 2JATA 2WAYA 4C0KA 1G291 1XMJA 4UXHA 4AG6A 1AYFA 2CCKA 4DLUA 3SYLA 2B21A 2AD5A 1E2EA 1CR0A 1CKEA 5DHFA 1JXOA 2KB0A 1SHKA 2DFTA 3SOPA 4POAA 2IEZA 1R5BA 2ODBA 2XTZA 2ZI5A 4Y0VA 1T3HA 1FUUA 4ZDIA 2ZTSA 1KZ7B 721PA 1XPRA 3CPHA 4LJ6A 1RE0A 1SXJD 3S1AA 4KYIB 4JZKA 2YC2C 5CM9C 3Q5EA 4YLGA 2RGBA 3I72A 5K8LA 5JJIA 3I1FA 1DE0A 4KX6B 1M74A 3P4PB 2Q9BA 2WWXA 1D6JA 5JECA 2O8EB 1ETUA 2IL1A 2V1UA 1OXVA 1DS6A 1AGPA 5FOWA 2F6RA 5L3QB 2PVGC 1N6PA 2BCJQ 3AE3B 4YTNB 2N1BA 3PG5A 4KVAA 3T1QA 2VEDA 3UMFA 5KPJA 4TWZA 4OK6A 2HYIC 5HPYB 1MT0A 3KXIA 1TQ2A 3ADDA 4YQFA 3EARA 1QHIA 4US0R 4C7ZA 2QAJA 2ZE7A 1RWSA 3QEJA 1LB1B 4OK3A 3QPWA 3EWSA 4WOPA 1ZIPA 2YYZA 4JS0A 5IK2A 1B9RA 3I5YA 1MKYA 1J7KA 5GJWC 4LYJA 2IS6A 2ANBA 2OT3B 4KYUA 1YQ4B 2WLBA 1SKQA 4TMKA 4K46A 1DAFA 4IDIA 3NC1C 4Q5IA 2FX3A 1JNYA 1QVAA 4XD7A 3VAAA 2PL3A 1SXJE 3IIKA 3ZZUA 3QSYA 3ZS8A 1UAAA 3QVVA 1L4UA 3K0AA 2K22A 2WICA 1YKSA 3M4YA 3RC3A 4TYNA 4PPQA 2P2LA 4C2TA 3BIFA 3QXSA 1IHUA 4KO8A 2FNAA 1CXZA 4NL4H 2IWHA 3AEFB 3W5UB 2IXGA 3EPKA 2CJWB 4M53A 1CJUC 3TJZA 3SC3A 2VP9A 4G5GA 1RPZA 3OESA 1QOAA 5FBWB 3WP0A 1KI8A 1E9RA 1E9AA 5ANRB 1JROA 3P4QB 4A9AA 1GILA 3D8BA 2HDNB 2JJ2D 3H1TA 4M9XA 2IC5A 1QF9A 2VHQA 3PVSA 3T5DA 3DKVA 2ANCA 1GL6A 2LEKA 1A2KC 1NENB 4UQOA 4BLQA 4TT3A 1GRRA 2EWWA 2ZIAA 1NJFA 4U7DA 2FN4A 4N0EA 5KPDA 4GL2A 5L3VA 1L0VB 2R62A 3BFVA 4DLRA 2Q6TA 4X8MA 3AE7B 3GJ4A 1W47A 4KLNA 1EESA 5AJZA 5IDVA 1Z0IA 1KGDA 1NKSA 1S1MA 1E4YA 2VRWA 4NYIR 1TQ4A 4DCTA 1Z2AA 3KJHA 1AA9A 1YZGA 2ZYUX 2QSYA 3MAAC 1Z83A 5GVRA 2HF8A 3K53A 4C0AC 5LBIA 2DWOA 4LPKA 4TZ0A 2CK3D 2XITA 1IY1A 2WWWA 2N46A 2ZRGA 1MABA 2IA5A 1G8PA 4M1MA 1ZM2A 2E87A 1N63A 3ADBA 4B35A 5FI0B 1YZKA 4LYAA 4BEBA 3RDPA 3AP1A 8OHMA 1JJVA 2YJTD 3TRFA 1SIJA 3A4NA 3LLMA 1E1RA 2BCGY 2WSMA 3M1IA 3Q5DA 3ETLA 4QGGA 4HB4A 2WMOB 4ITKA 4EPRA 3HR7A 5AUNB 3KQNA 5FOSA 1VJKA 1EX6A 1N5XA 2AN9A 3RABA 3SU8A 3K9LA 4XJXA 3BK7A 4IOJA 1J8YF 4CW7A 3OEEA 3X1ZA 3K09C 4ZDWA 1NJGA 2A3RA 4BE7B 1ZNWA 3SQXA 1P2UA 4A15A 2M19A 3BJIC 5L3QA 3ZGXA 4HDQB 2FFAA 1QDEA 2F43A 2RHMA 2QEQA 1W46A 3EAQA 2FBWB 5EE9A 2ZITA 5KU1A 4NCNA 2ONJA 3SFDB 3GD7A 3TR5A 4BFUA 3EPJA 2OBLA 4DWJA 2QP4A 4QXAA 3W5JA 1YE8A 1ZBDA 3MLEA 2VF7A 1M1YE 3PFIA 3U4QB 3AH8A 4JKIA 121PA 1FNMA 3HU3A 1C1YA 3IILA 3SBDA 3GLHA 3WP1B 1XD2A 3U7HB 3DM5A 4XTCS 2W0SA 1Z2CA 3HJNA 2QPOA 3QF4A 1R0WA 4HB0A 2O52A 1RKBA 4LC0A 2ZI9A 2VQSA 4QGHA 2J0VA 1P75A 3OIYA 2XTMA 1HY3A 4HZUB 3AH7A 4QNMA 4B43A 5EZ6B 3Q7PA 4OK5A 2IEYA 3AVPA 3TR0A 2C5LA 3NKVA 4LSGA 1GKYA 3P4RB 3QNUA 2YOGA 4FWTA 4NPHA 2QMHA 2JASA 4C30A 2CL0X 2OHFA 3AP3A 4N6EB 3CM0A 3MWLA 1OF1A 3ZD7A 2BDTA 3DO6A 1OXXK 1D2EA 2F7SA 3QKSA 5KNBA 3NVZA 3L4PA 3GMTA 1IN8A 4BUJA 4M9ZA 1XRJA 3IHWA 2JLRA 3WMEA 4V0NA 2OFWA 4B2PA 4ZCLA 5L3SA 2QTVB 3EW9A 1DAIA 3TE6A 4R98A 1Q1ZA 4HAVA 4TYYA 3N2EA 4JWUC 1G4UR 3NRZA 3LX8A 3VQTA 3ZLJA 3OE7D 4DJTA 2IUTA 4Q18A 4BGDA 4RJLA 2ZROA 3SI7A 5DH9A 1SGWA 2WAXA 4FXPA 4HUQA 4AKIA 3RPFC 1XXHB 1ZD1A 3TUJC 1J7AA 1OYYA 2D06A 5CYOA 2I1VB 4MUBA 1E79A 4Q48A 4DZZA 4JYBA 1PJRA 2YOHA 1Q22A 2LCFA 3QG5A 2IYQA 1IJFA 4D4KA 1W36D 1PUJA 2EQBA 2Z4RA 3TK1A 2WDRB 1VG1A 1EFCA 2C8VA 1ESMA 4JBXA 4TLBA 2A30A 1DOAA 4M1YA 5AJWA 4JX1C 5DISB 3ND9A 3RYTC 1R7SA 1IXZA 1U0LA 4MYUA 5J4HA 4O3MA 1QF6A 2IHBA 3LBIA 2Q9AA 3U44A 2GCOA 4PZZA 4GP7A 2YC4C 2BIFA 1N6OA 2PCJA 4LK2A 2N0SB 3E70C 1T6NA 2QQ0A 3FVQA 3SJCA 1W4BA 1TMKA 2CDNA 3EWAA 4PAMA 4TTQA 2V9PA 4BFSA 2J45A 2RGGA 3HRDD 5FPYA 4CEIA 1MO3A 2F1RA 2NZJA 3KX2A 4RSGA 2LKDA 1KNXA 2E1RA 3FKQA 3L0SA 3BBPA 1BYIA 3CZQA 5DE3A 2AFHE 3Q85A 3ADKA 1OXUA 1W4AA 2UZ3A 3AKYA 5L8VA 1RC8A 2O8FB 3UATA 1RFLA 3T06B 3C7KA 3O8RA 3B78A 3GJ0A 1DO0A 2CU3A 1YZQA 2ZJBA 1IONA 2GNOA 3O8DA 1L7VC 2V1XA 1N0UA 4PPFA 3KL4A 3FMPB 3QKRA 2G88A 4GNKA 2WJYA 4NTZA 3ADCA 3QF4B 4KCGA 4OHWA 4P4SA 3BOSA 4RD1A 2Z6VA 2AXPA 4KXFB 1GRNA 4URZR 1DARA 4OYHA 2R6DA 1QT9A 3PIRA 4NONA 4KI0A 3EUB2 1CLUA 3GLFA 1KK2A 4LJ5A 1MRSA 4UNSA 4G5SA 2QL6A 3TVDA 1Q3TA 1A2BA 1IN7A 2GVZC 4MH0R 1Z63A 1QHSA 1FW6A 1CJKC 5A0FA 5H1YA 5EE0A 1JJ7A 1IAQA 1Y63A 2DFKB 4Z1MD 4Q9LA 5J5CA 3AE6B 4QOSA 5HE8A 3AVWA 1TADA 2WDVB 3NH6A 2OCPA 2Q9CA 3U60B 2HLDA 4LDJA 2J3EA 3SFEB 2RKOA 1GM5A 1FZQA 1XTKA 3K70D 1UKYA 3SE0A 5FUXA 5EQTA 3KKOA 4US9A 2GJ9A 4B3FX 1KO5A 2GJKA 3LQRA 2PZGA 3TQCA 3HYRA 3SFZA 3VR4A 4EKDA 1UEJA 1KIMA 2IYVA 1OYWA 1OKKD 2EVWX 4OQXA 3SEAA 2ZRIA 1RYHA 1NBMD 2ZS9A 3RSOA 1AM4D 2HEIA 2PX3A 1EX7A 3Q72A 2IUUA 1P9RA 1NIJA 4FMCB 4V02A 1N3BA 3LH5A 4P6VF 5J47A 4ZOHC 1TUIA 2J0UB 3AVUA 5EP3A 2ODNA 2ZI7A 5AK0A 1S8FA 2ZRKA 4DT1B 5G40A 4PANA 2OAP1 1S2MA 5BQ5A 3K0AB 1UKZA 4PX9A 3EX7C 1WP9A 2ASEA 4KJZA 3NWJA 5AUQA 2O8DB 1DAGA 2MMCA 1NVWQ 2EFEB 3P1JA 3THWA 2JCSA 1KK3A 2AK2A 2XTNA 3W5VB 2BBTA 2A5YB 1ESNA 5DN6D 2GF9A 2EYUA 2F1HA 1XEXA 1GPXA 2B7CA 1QHGA 4Q66C 4TL7A 1KDTA 5B64A 1KSHA 4M22A 2SHKA 4YC7A 1XPUA 2PKOA 3R8CA 3LAWA 2WWIA 3MJRA 1JW9D 1FP6A 1FFVA 4FMDB 1E6EB 2EWVA 4LCBA 1YQTA 1J7BA 2Y8EA 5FR1A 1UDXA 3AB3A 1JXMA 1NMYA 2O8BB 3ZD6A 1D2NA 3R9XA 1R10A 2FPLA 4KFRA 1WQ1R 2EFCB 1TKEA 5KUTA 4IKEA 2GCPA 4C0HA 1F0ZA 2ZJAA 4DLSA 1B23P 2OBMA 4LHXA 3GFPA 2GDJA 2RCNA 2WIBA 2ZRAA 2R44A 1KSGA 1QG4A 4HI0E 2GEUA 1KI3A 2F3TA 4NU0A 3O8BA 1ZAKA 1T8TA 1XB2A 3ZQ6A 4QNRA 1A5TA 4XVRA 2XZOA 1FX0B 3AGPA 4XWOA 1US8A 4G5OA 1E2IA 2EU8A 2WZQA 1G17A 1QHNA 3VR8B 2BMEA 3ZYYX 1U0HC 1M7BA 4DDTA 4MRPA 1HURA 3VMFA 4JL5A 4LUCA 2OLKA 3LXFA 5DSZA 2D74A 2FU5C 5FPTA 4JT4A 4LV5B 1FFUA 5FBRB 3ND8A 2ZM5A 4JVLA 2IK8A 2WTUA 1A70A 1BS1A 3BGWA 4C0JA 1E9SA 1SVOA 3CB4A 1FXAA 2G0TA 4Q4AB 3QPUA 1HV8A 1R7RA 4IXNA 4Q01A 2QQEA 1ANKA 1K5DA 2W6ID 3CF0A 5TVKA 1OFUX 1KK0A 1H8EA 2JEOA 5J40A 4ESVA 1OIVA 3P1MA 1UWMA 4ASUA 2CCJA 4KITB 2IYUA 4CYMA 2QGZA 3MGCA 2GJAA 3GJ7A 1HT2E 4DDUA 3GQBA 3TSZA 4EIWA 3HVZA 5JI2E 3SHFA 4AYWA 3UANA 3L43A 1G7TA 4GMDA 2O8EA 4ZPXA 3D31A 1E4VA 4EFLA 1IXSB 2CHQA 2RHDA 2BT6A 3TSOA 5JJLA 1VG8A 3LX5A 4PZYA 1E0KA 1S1CA 4MYTA 4UXJA 2GCOB 4F7WA 3TUZC 1FRRA 1V8CA 5BYJA 2MH7A 1W48A 2Z0MA 1E10A 2HCJB 3DM9B 4M8NE 4CVNA 3SQWA 3FOZA 2Q3MA 5H92C 3EZ6A 3FWYA 1KDRA 1VIYA 1YJ5A 2AHOA 4FD2A 4L16A 2GVDC 1Z06A 1KMQA 4WA7A 2KAJA 3A37A 3W3AA 3T5GA 3SR6A 3QE0A 5LB4A 3GLIE 3K9NA 2G6BA 2ORIA 4OQLA 3GLGE 1K5GA 3RANA 3IUYA 1J90A 3L82B 2ZEJA 5TB5A 3WYGA 1CTQA 4N58A 4AD8A 3HYTA 5KSZA 2RAPA 1IN5A 1EWYC 2C9CA 4IW3B 2Q5WD 2G83A 3CH4B 1V43A 1JQLB 3NVAA 1PLLA 1G3MA 4FCVA 1GAJA 2CLSA 3LWNA 3BS4A 2RMKA 2JJ2A 1D9XA 3K70B 1HE8B 3GJXC 2KI5A 3AVQA 3NEYA 5F3WB 1KFYB 3A58B 3UMSA 2Y5CA 3SYNA 3A8TA 3KTAB 3SJZA 4D81A 2IXFA 2J0UA 2NPFA 2HV8A 4JVNA 1BMFA 1T8UA 1X86B 2X8AA 4DCSA 2L0XA 4TYQA 3TMKA 2XOKA 1ZU5A 3IEVA 1OB5A 3DKPA 1II9A 3KUDA 4N0DA 4OQNA 2FE4A 1XDBA 3NS1A 3EIQA 4HB2A 1BMFD 4QBGB 4F4IA 4HSEA 3B2GA 2ZSAA 3KJIA 4G1UC 4RZ3A 1TTTA 4A82A 2L83A 1OH5A 1E0AA 5AUIA 1X8LA 3LXRA 1VCIA 3Q3JB 1ONBA 2X1VA 3VX4A 1E2QA 1EK0A 3VHXA 2M56B 4M0LA 3X1XA 4F38A 1VYVA 2YZ2A 2BV3A 4OI2A 4QBIA 4RKEA 1DOYA 3VU9A 2W2VA 3GPLA 3BB3A 2J7PA 5SZJA 3B7GA 3D6TB 3GCGA 4JBWA 4Q03A 5EE3A 1SVWA 3EXAA 4XD7D 4RVCA 5KDLA 3U7EB 1ZINA 1E9DA 1G5PA 2VP4A 3U7GA 2C9YA 2A5DA 3RVBA 1E9BA 1M34E 3PV0A 1FRDA 2W6IA 3U3JA 1CR1A 3LFUA 4FI3C 4LX0A 4JKYA 4NYJR 4WZ6A 5MPOA 4OKSA 2HLDD 1XJCA 1E2DA 2IYLD 5FPHA 4YXWA 2RGCA 3AMZA 3B9JA 3KWLA 1JQ4A 1NVUQ 3OHMA 4HATA 4QJ3A 4WVFA 6Q21A 5JRZA 5KNCA 2CEAA 2JLQA 2ZJYA 2DFNA 1EFHA 5TXGA 4M1WA 3UK6A 1SQ5A 2XXAB 2WPDD 5DNYB 1VKJA 3C8UA 1ZVQA 3FDIA 3KQLA 5H8YE 1SF0A 5G3ZA 2AFIE 3VNVA 4QGFA 4TT3D 3ZYCA 2F3RA 3PUYA 2QE7D 2XGJA 4L15A 3TW8B 1DOIA 2A5FA 1JB1A 2D62A 2BVNA 1HQYE 1NN0A 4IHQA 2NMVA 3OAAA 4IDNA 3QUSA 3IIMA 2QT0A 3PUXA 3C16C 4MRSA 2WU5B 4IOKA 3JVUA 4US8A 3RWOA 1GWNA 2EFDB 3UG6A 1BOFA 4TTRA 2NPIA 4ARZB 3VR3A 4CEIB 4F93B 1AQUA 2GESA 1N60A 3MUFA 4PPGA 2RGNA 4B33A 1NNEA 2GEDA 3AVTA 3U3KA 1XLQA 1FP7A 3RRMA 3W8NA 3HWSA 2ZRCA 4U5XA 4RKFA 1TAGA 2GZHA 1OHHD 2H1LA 1C9KA 3B5JA 3I32A 1UBGA 4DHEA 3P4SB 3UPUA 3LB8C 2PMKA 1GP2A 2OV2A 4WBSA 3B9QA 1P6XA 2FZ4A 5BN5A 2ZSFA 4RCYA 2GTPA 4DLTA 4AY2A 4PC3A 1L2TA 1HH4A 4ZCMA 2P65A 3QOFA 4PO8A 1ZU4A 1VMAA 2L52A 3K9GA 2C78A 1KO7A 1Z6GA 2AKYA 1COWD 1NP6A 1II8B 1TL7C 3CRVA 1NLZA 4MYHA 4BQSA 2V6JA 3AE5B 4WZBE 3T61A 2D4HA 2F55A 3ETRA 3QKRB 3IBGA 2ZUDA 1H8HA 2BS4B 3UIEA 1T0JB 5HTKA 1ZP0B 1G6OA 1TJEA 1PDXA 4ZI3A 2G1JA 4K81B 5TMPA 2GJ8A 1R0XA 4NKRA 2GXUA 2BM0A 4HRSA 2BMFA 1N5KA 1TUEA 2XEXA 4XWKA 1WXQA 2WBLC 2CHVA 1NG1A 4NYJQ 1N25A 2WKQA 4EFNA 3X1DA 1AWDA 1UADA 3IKJA 1CJTC 1WE2A 5FUWA 1G7CA 3KKMA 5C18A 4LBWA 4URYR 3BH6A 3AEAB 1SXJA 4DCUA 4PC6A 4B44A 4DLYA 1YRBA 1JWBD 4XVQA 4BFWA 5C4MA 4QL3A 1SZPA 2NO1A 1KJYA 2GK6A 2IX3A 4PSAA 5EP4A 1XCPA 2A2ZA 2FF7A 1X1SA 1YZLA 2IHYA 2ZR7A 4LGMA 3SBEA 5F2EA 1F5NA 4IEEA 5AJYA 2CNWA 2GAOA 1N6NA 1ZUHA 3KKNA 2WV9A 1EG7A 2P6RA 2VHCA 1X8JA 1P4SA 2XSZD 1W0KA 4Q19A 2F1JA 3MWYW 3RS4A 3AF2A 1ZMXA 2JA1A 2ATVA 1FMAD 1OPXA 2NO0A 1OT3A 2CLDX 4WXRA 3BERA 5HCIA 4Q47A 1FFHA 3QVUA 1OLOA 1N5WA 4QHSA 1YU9A 3V4FA 2A5GA 2A9KA 5DI9A 3IIJA 3P26A 3R7WB 4D4JA 5JCPA 1P3JA 1NIPA 4IOLA 3NVYA 4TMVA 4YXWD 5JSZB 5KDDA 3FKSA 3GEEA 4WZAE 5EP1A 4V03A 1ROEA 2A78A 4JYCA 2ZJZA 1GL7A 2BBWA 2J5XA 2K5PA 1UBEA 4M4SA 2J46A 3BB1A 4IOMA 4BZQA 4ZKDA 1Z6AA 2WPDA 4B3CA 1J7CA 1M7GA 3LRPA 1XD9A 4HAWA 4LJ8A 2C96A 2WOOA 4LC1A 3QPVA 1ZCBA 3LNCA 5CJPA 2OCAA 3CF6R 1Z0DA 2Z5FA 4UNPA 4DVGA 3TSWA 4DSNA 1MO5A 5GVSA 3QG1A 1XTQA 1MV5A 2OO7A 2VL7A 2ZRLA 2C04A 1E2GA 2HJGA 2IW3A 3RWMB 2BOVA 2XAUA 2PT7A 1Z3IX 5JHGB 4B2IA 4B73A 2BKEA 3AEBB 2GZAA 4BFZA 2ZE8A 3OIWA 2XXAA 2PZFA 2AWNA 3K0FA 1JEDA 2CNWD 1I2DA 5JEEA 1XEFA 4PC2A 1NVXQ 1VCNA 2BEJA 1Q0UA 5FOVA 3ZVNA 5FI1B 4ACAA 1GVNB 1KO4A 1W36C 4IFBA 1QVRA 3E2IA 1XD2B 3KB1A 3KXKA 5IF9A 4TYPA 3X1YA 1CZPA 1QRAA 1L5PA 5CJ2A 2QE7A 3U61B 1F2UB 2IS1A 1KMHB 1US8B 4TQAA 4KFSA 4F4CA 1MOZA 4LJYA 4N1AA 3VHLB 4ZHOA 2QAGA 1GOTA 3HU1A 3LO5A 3MCAA 1W49A 1E0SA 2AX4A 1WRIA 4IFEA 1X3SA 4Q4JA 3PUVA 3SDZA 3OEED 3FKSD 1E0ZA 2HF9A 2HT1A 4D80A 4JMPA 4JT2A 2FSGA 1SVSA 3L0OA 4I1SA 3EZ9A 5CK5A 1ZM9A 2PJZA 3PENA 2W55A 2CJOA 3DWMA 1W0JA 1RM6C 4GPTA 4OHXA 4C80A 2DFLA 2DCUA 3TBKA 3L0IB 3REGA 2O8DA 1Z0AA 4IJMA 2P6UA 4EFMA 5GXGB 4B3GA 1CP2A 3WMFA 1DGJA 1RZ3A 2BC9A 2GXSA 2OFXA 2PCLA 3MRSA 1Z8FA 4E22A 1G8HA 3U7FB 1ZUD2 1X8KA 2Q3FA 1FXIA 2ACZB 1Y3AA 4HAZA 2OXCA 3RS2A 1SVLA 5F98A 2VPPA 4D82A 3U3MA 1UEIA 4C9BA 4MGYR 4P4TA 3A4LA 4PQRA 4W5HA 2OCBA 1CJEA 4B48A 1OH7A 5CB6A 1IY2A 3F8TA 2XSZA 1AKYA 2O0HA 2JQRB 1MABB 1S9HA 3RRNA 2J0QA 4CF7A 1N2CE 1W5TA 2D3WA 1NN1A 4JLOA 1AZSC 2H92A 4US2R 3N70A 1KK1A 4D0GA 4UNRA 4DEYA 4FCTA 2VH5R 3EC1A 5C2JB 1NF3A 5FPSA 1UF9A 4ZO4A 3BFKA 1NVVR 4OI0A 2P3SA 4IVPA 3L8ZA 5CLLA 2JLYA 3W8RA 2WSSA 1G5RA 4V0MA 3NDBB 2BS2B 2RGAA 521PA 1HTWA 1D9ZA 3WNDA 2W6JA 4RZUA 2ZRPA 4P0TA 1EWQA 2NO7A 3LXXA 4Z8XA 2B92A 5DYIA 1TQDA 4F92B 4CEHA 5JJKA 2ZU6A 1WB9A 2CJNA 3CRQA 3FB4A 1NMXA 2PJRA 2BEKA 1D2MA 1JI0A 4LJAA 3ZIAD 5FTNA 2HT6A 3QXHA 4CIDA 4DSTA 1R8QA 4A4DA 4C0LA 1HQCA 2QUZA 5EXPA 1T0HB 1XJ0A 1ZOYB 2OZEA 3SFVA 2ZAOA 3AEDB 1IBRA 4CT5A 2QAGB 2C98A 2VSOA 3IPXA 1CIPA 2QA5A 3IO5A 4A8JA 2W83A 1N6IA 1N5LA 2CCGA 4RD0A 4OQMA 4B34A 5L3SB 3A6PC 4D26A 3AKDA 3GLHE 1TNDA 4IVQA 2FV8A 4Q4AA 1PV4A 3VKHA 5SZKB 2J9RA 4RZ2A 2NZ8A 4GZLA 2H16A 5JWOA 3WRYC 1G1MA 1JR3A 4RZXA 1VIAA 1U8AA 2H57A 1OJLA 5DHAA 1W7AA 2ZRBA 2IYTA 4YDSA 4LHZA 4LBZA 4WWMA 5CIWA 3KTAA 3EIEA 4PQFA 4RD6A 1ZRHA 2XOKD 2GK7A 3C4JA 4M1TA 3UWKA 4BFVA 1Q1EA 4D6PA 4PO9A 2QT1A 4WXPA 3RLFA 3NBZC 2DBYA 1MO6A 1YZUA 5FBQB 1GAQB 2JJ1D 4EUNA 1V97A 5DO9A 2JIZD 1UFQA 4KODA 3PO0A 2Q3HA 1F3OA 3AE8B 1H65A 3CWIA 1HA3A 2P5SA 4HLUC 3NH9A 4NYMR 2O8CB 3EA5A 2QENA 4HDCA 4YTMB 1SHZA 3BRWD 5CYPA 5FOTA 1DOXA 4TYWA 3GLHB 3QEOA 2VO1A 3REFA 2W0MA 5IT5A 1DEKA 5P21A 5KTYA 3I8SA 2ZYTX 3I92A 1EWRA 1NVVQ 3NTUA 1QOFA 2YVUA 1MR3F 2GCNA 3TUIC 4M9SA 2ZETA 1U8YA 4A0HA 3K0CA 2Z83A 1Z0KA 4EPXA 1E7PB 1XLOA 1BYUA 4DSUA 2TMKA 2XX3A 1NSFA 2ZREA 3Q9LA 3VR5A 4XWAA 4KV9A 1NYQA 1JR3D 5DN6A 3F3YA 1N5IA 3NDPA 3I5XA 4C0SA 2VP0A 3W6PA 4F4JA 4IDHA 4ZCIA 1N6RA 1UJ2A 4G5QA 2QMEA 2YINC 5DGXA 4WQMA 3BD9A 2KMMA 1T3QA 4PHGA 4A1FA 3KQKA 3V4RA 1FOEB 3K70C 4XSGA 1R2QA 2FFHA 4HZIA 4HEJA 4MA4A 1OQQA 3BORA 1DPFA 1GG2A 1YZNA 4EPTA 3DWGC 1CJMA 1KKLA 2B7BA 4JL8A 4DBLC 2YWFA 1OXTA 1EFUA 4ARZA 5FFMA 4OI4A 3FFBA 4YMTA 2O8CA 4L5BA 2BJWA 3K0FB 2QNRA 3PJRA 3DPUA 5KO2A 4Q1FA 4Q7KA 2QAGC 2ZSDA 4JVMA 1Q20A 1GKIA 2ZUBA 2ZI3A 4BLSA 2UKDA 5EXTA 3OFNA 421PA 3PEWA 1IY0A 1FQJA 2P67A 1OIXA 1LS1A 1G7RA 2BM1A 3K0EA 3NBXX 2VHUA 3QKSB 4NCHA 1DELA 1FX0A 4Z8YA 2BKUA 1KI7A 1N61A 1Z47A 4G3XA 3RNLA 4EAQA 1GZSA 4CDGA 3N5CA 3BAFA 5JEDA 3U6KA 2J0SA 2DYKA 5TARA 1EXMA 2J87A 4UKDA 1DTSA 5J4YA 3C5CA 3M0EA 1P2SA 4XVUA 2IBMA 3WBJA 5KSOA 2WHXA 3THYA 3FMFA 2V7QD 4NHOA 1KI9A 4A2QA 1GITA 2YOFA 2C99A 2QTHA 1XEWY 2CMKA 2R6GA 1II8A 3T1VA 4Q1CA 4B74A 1CEEA 1N0VC 2ZJOA 2VSXA 5CB8A 1ZNZA 4R2HA 2QIEB 4NCIA 4YMUA 1IOZA 2WKPA 4Q1DA 1G3QA 4ZKEA 3AEEB 1PLKA 5LD2B 4MKGA 2HXSA 3T15A 3T35A 4DSOA 5CDFA 5KSYA 2RGEA 2H17A 5EZ5A 1TF5A 4P4SB 5BN3A 3GEIA 2MMGA 4DKXA 1G8YA 3I8XA 3GJ6A 2O0JA 2ECKA 3IEUA 3LBHA 1ZYUA 1KI4A 4HUTA 3PCRB 2C9OA 3RS3A 3PXGA 1M6NA 1GKUB
chains in the Genus database with same CATH superfamily
4PHPA 2TMDA 4U02A 3TLKA 1UBHS 3NHSA 1VG9B 1C4PA 2JGEA 2FSHA 3OJLA 4KE9A 1WF3A 1C41A 4RGOS 3VC1A 4YFKA 4G4SP 5EXDA 3HBFA 1K6JA 2GD1O 2F62A 2XA9A 2PKXA 2C07A 3IQFA 3UKDA 4HJRA 3KLBA 5AJTA 4RU9A 5K3FB 4ZO9A 3FPBA 1JECA 3OZEA 5IFLA 5C7LO 4N3NA 3EIOA 1ETHA 3VTAA 5G5GA 6REQA 4NCJA 2ZYSA 1DTWA 2CHZA 2JK0A 4GXQA 2ZE5A 3LT4A 1P0PA 3I73A 2ECOA 1EIWA 3ZQ4A 8ICWA 1UZXB 4XJTA 3DJFA 4UU7A 5AI6A 2GLSA 3CIFA 3H99A 1YRAA 3AF1A 4YMWA 1Q57A 2ZAYA 1JG2A 2HMVA 5H68A 2D7CA 1QZTA 3CPJB 3GJ5A 3DEZA 3GLIA 4Q12A 2RFLA 2VJCA 2BFBA 1G3UA 1VHDA 5L4SA 2WDQB 3FOWA 3JSAA 5DHTA 2WUFA 2FFRA 3HP6A 1TTHA 1GJRA 2I2XB 2YNMA 2Q3CA 4IXMA 4NX2A 2HCTA 4P2GA 1CQJA 2FYTA 2QG9A 2JIQA 1HEIA 3NT2A 3MCZA 3BQ1A 1YJXA 4WECA 4KR9A 4EHBA 4EYIB 2ZPUA 1R00A 4FZ5A 4I1VA 4ZHPA 3GT0A 2NR2A 2IY1B 3FUVA 1C9JA 2AR9A 4YWGG 2PWAA 1WMSA 2JZBA 3NY5A 3C1OA 3FSJX 3ELDA 1RBQA 2FWAA 1FNNA 1VPEA 4KE6A 2OKCA 5FO0A 1Z3CA 1EVZA 1YJ8A 3F4BA 4PGMA 4BIIA 3OQBA 5J17A 4BCCA 2I03A 3CKKA 1PK3A 2QU7A 1KY4A 5BSKA 1QIEA 4BB6A 4D8UA 4E31A 3AY3A 4II2B 4AO8A 1AB6A 1E2PA 1TY2A 4IKGA 4OGKA 1Z37A 1S4QA 1DLJA 2IPKD 7REQA 1KLNA 2KN5A 3E81A 4M1SA 2I6XA 4I4NA 4TSRA 3AE2B 4WLUA 1F1HA 3L77A 4EJSA 4RE6A 5E7MA 3P0FA 1Y8RC 4UOQA 3ZU3A 1OVMA 1XMXA 4BX3A 1Y8ZA 3WB9A 5EHZA 4DMFA 3CPSA 3PT9A 4NZYA 5I7RA 4EEKA 4XTRA 2CGEA 3CLUD 2B4RO 1M9NA 1UBJS 2P77A 4LJKA 4H77A 1ID1A 1O6BA 5DW3A 1PRYA 1RC1A 3R1IA 4JV0A 5IEBA 2VCEA 3E8MA 4MYCA 5FA5A 2ZYIA 1PZGA 5B7PA 3FGNA 1XLWA 2IZ6A 4O3RA 3BA1A 4A3SA 3OICA 4NJMB 1V8OA 2WD8A 4J9KA 3ENQA 2GOWA 5IDYA 3VSAA 4XFKA 3TW6A 4NFLA 4HZUA 4H27A 4BASA 2HDWA 1NLYA 1C20A 2X0NA 5JVDB 1SB3C 1NV9A 2V9ZA 4J94A 3OKFA 4DM7A 3GGOA 3KHKA 1W2GA 5BN4B 3TEMA 1S1QB 2MSED 3GIIA 4XIFA 5F2KA 4CT0A 4W7SA 2O07A 3ZRCA 3NHBA 1M0EA 3E9CA 2FOLA 3ASYA 2N1RA 1P2FA 3DL0A 1FEZA 3OT5A 4N49A 3FPHA 5ESXA 3L8EA 3C8ZA 3MRVA 1IBXB 3BXZA 3O0TA 3L49A 4CDRA 1CMXB 4NICA 2RGNC 4FMPA 3QY9A 2E8PA 3UJNA 2J6IA 5ALJA 2R84A 4TMWA 3L4JA 2YWEA 2E1EA 1NBHA 3B13B 1A9RA 4F4WA 3R23A 3JAKB 2CYCA 3A0HU 4NMWA 2OZVA 4Q7MB 4NG4A 2D3AA 2PE5A 4Q1BA 2X3UA 3SAGA 5AI0A 4AZSA 3VNQA 1Q92A 4YUAA 4FFLA 4CG0A 1YX5B 1T0PA 2PMDA 5AM4A 5C53B 2O50A 4B71A 2DUNA 2VJBA 3HCDA 4HWIB 3I2YX 5K0FA 2FE9A 1XTBA 2GAAA 2JVKA 3ER8A 3OFND 1JR4A 5TRTA 2XMRA 4X6UA 1LQBA 4A1OA 4GXJA 1SB9A 3ONFA 1XVVA 3HM6X 4U2CA 3AB5A 2VLIA 2WUDA 4EVRA 5IG2A 3JQBA 4XUSA 2G0NA 4NDZA 3JQFC 1LDBA 3KFUF 1ZETA 4TKVA 3EZ2A 4JLMA 4JJKA 3FH0A 1GUYA 4AJ1A 3IHQB 4MRMA 1LJ8A 1MDFA 4OVVA 2E6UX 3TW8A 4Q1VA 3FY4A 1EGVB 3GCZA 4HAXA 3BL5A 4UTNA 5FLXA 2PJUA 2IF0A 3NM4A 5LPNA 1H2AS 4UXIA 3GEMA 2H7CA 4PLYA 4BQNA 2R6AA 2R6HA 4TQ1A 3ZJYA 1B43A 4M0DA 2XT6A 3FAZA 1NG9A 2JFOA 1IAVA 1M8PA 3JZMA 4D41A 2VPYA 2IP1A 1R9GA 2PSSA 5HGJA 3ZBUA 3C6YA 2WYWA 1BVHA 1XNGA 1IN1A 2WMNB 1JG6A 4LMAA 3M9LA 4E21A 4MB6A 4GMXA 4LEIA 3QELA 5THXA 4KLTA 3TEYA 5FBVB 1N9KA 4BBPA 3ZY4A 4GXRA 1KJIA 4K6FA 1BDHA 3UK7A 4CF3A 2ZCUA 3SI8A 4JFAA 4X1IA 1PVVA 1DSSG 3GGPA 4XWTA 2NAPA 4O4IB 3ZDAA 5FKJA 3S81A 3THRA 2X77A 3LUBA 4RTSA 3KWVA 3TGWA 1YMVA 2QVGA 4CZ2A 4HGPA 3JPOA 3DWEX 1OVGA 2XK5A 1UWCA 3W04A 1L4GA 2BRUC 5F9LA 5JSZA 2PVOD 2RGDA 2X1HA 1GGFA 1C5KA 5EJMA 2NPTA 3CNNA 1J0DA 2ONQA 3A1CA 3MTJA 1F8YA 4HUJA 1TM1E 5HCNA 4P58A 2EJUA 3AF4A 1BDBA 2QM8A 4XIIA 1E8MA 3KAQA 5HF8A 5LXHA 1ZVJA 4S05A 2Z08A 4S2EA 1G3IA 3FNBA 4FPXA 2W8BA 1GUZA 3DQVA 1M2VB 4CEJA 2BDPA 4BLOA 4TZTA 1JJFA 3SVLA 3W90A 2IF2A 3ORSA 2C5GA 2FJUA 2VBCA 5ALRA 3ICOA 4LYEA 2YX8A 4UAJA 4WLFA 1V3TA 1HE1C 3A6JA 1ODJA 1SOAA 1VL1A 2JYEA 4ZCRA 2D2IA 1Y8QB 1J2NA 4JBLA 1RYZA 3UMCA 1SZHA 4EKUA 1CR4A 5JMTA 1B3BA 2XT0A 3S2AA 3JASB 3IT0A 5AJVB 2GA8A 1AS3A 4LK3A 1MAVA 1Y37A 4KSLC 4GPEA 3NEPX 4CMIA 1ZPDA 1RNLA 5J0QA 4YRFA 4C7OA 3AUTA 2PU5A 4WLEA 3AHFA 1NNLA 2LM4A 3GRZA 3GAFA 4XPIB 4LMPA 3TG8A 5LP6B 4QJ4A 2VUIB 5C31A 1RHQA 5CTRC 3WFIA 1DRVA 3GJ3A 5IM4A 1G63A 1GTJ1 3R3HA 4M6WB 3MSXA 4ROTA 5K0NA 2ZVDA 3AUUA 1DAPA 4OJ5A 1PDWA 4KHZA 1EHIA 2Z3ZA 5EYPA 1XCMA 5A7HA 4L51A 4UMVA 2KVRA 3CUSA 4ABTA 2OM2A 3PSAA 1VECA 4BWYA 4E5UA 4ER6A 2ZJ0A 1D5CA 4F2GA 1ZUNB 4MV9A 4C0KA 4NJMA 3Q3EA 2FVYA 1TJ3A 1TV9A 1CKEA 2BKRB 1Q1OA 4JJIA 3SOPA 4L95C 5I47A 1OX6A 4YLGA 3L92A 3Q5EA 5K8LA 3U52E 1DE0A 3ENWA 3COYA 2GAJA 3GFFA 5FOWA 3QTBA 2DBVO 3PG5A 2N1BA 3UMFA 3WGZA 3A4IA 1IM4A 4P2BA 2JXJA 2OXOA 2R8EA 3M3PA 4WOPA 4Q8FA 3NYWA 1O94A 1HR0B 2HSDA 2E6KA 1EVJA 3OU2A 4QLAA 4H6XA 2M6RA 1MC1A 4NCAA 1MXFA 1UAAA 4ZRDA 3P19A 2P2LA 3REOA 4JGGA 4J1TC 2LPEA 1HDIA 3X2EA 3TL2A 3T1YB 2WNSA 3KYDA 5E1OA 3UGQA 2Q07A 4O1MA 3MR3A 1XKLA 5IT0A 3QJGA 2HW3A 2EIXA 3PZ7A 1UMBB 3DKVA 2W2MA 1V80A 3MWDA 1J0XO 2OHXA 4E14A 2VNHA 1L0VB 2I78A 3BFVA 3D1LA 3IFWB 1QE3A 4PTYA 4GLJA 3TBLD 1W47A 4ZRNA 5BP7A 3VYWA 2VAMA 2KJHB 4KRYA 4ALIA 4FJZA 2HDOA 3A4NA 5C1OA 3MD9A 2RJ3A 4XWGA 4CW7A 3OEEA 1F9EA 2C7MB 1ZOIA 3PGMA 3QV2A 2O6VA 4BE7B 1ZNWA 2FIFA 3ZGXA 3C29A 4HDMB 4PLHA 4I5FA 3KSBC 1J0BA 4UAWA 2KS6A 4QQRA 5DOZA 1FK8A 4GR9A 3U7HB 3DPIA 4J8PA 1ZQKA 1YOVB 2DERA 1P75A 2XTMA 4YMGA 3EXEA 2WQ7A 1H9CA 1GKYA 2JASA 1PL8A 4F11A 2EW2A 2BDTA 2WU8A 3X1KA 2Y0SF 3VGPA 4BUJA 2NNWB 3UCEA 3QU9A 5L3SA 2HU7A 4QEDA 3DBRI 4XB6B 4TYYA 1PNOA 2QTZA 3ZLJA 4DJTA 2O2IA 5DH9A 1G20B 3ILSA 1HGXA 3WGTA 3S6JA 4XCQA 3BTSA 3UB4A 1U0LA 2Q9AA 4HRAA 3V3KA 2N3ZA 3EFOB 1Q3UA 2BIFA 1P7VA 1T6NA 4KQEA 4O1IA 1YUMA 2RGGA 3A05A 3R74A 1WXWA 2KFZA 2HL6A 4JN6B 2O8FB 1I0ZA 4LDPA 2WD9A 4F86A 1K1QA 2GNOA 3C6MA 4C21A 1P80A 1T9GR 4A5OA 3H17A 2VRCA 3EUB2 1CLUA 3OM0A 4DGQA 1MRSA 3PQ6A 1VJRA 3K71B 4MPJA 2R4UA 4JA2A 1IB6A 1BNOA 4Q34A 1ZH0A 3NH6A 1LSJA 2KTFA 1F4PA 3GIWA 5KVVA 3AJDA 3VHTC 3WSVA 2P9YA 3A25A 2ZWOA 3H5LA 3SEAA 4F6CA 3Q72A 1EBFA 2IUUA 4HXDA 2C97A 2GERA 3CLRC 3PRKE 1NUAA 3FZEA 3LK9A 1S2MA 3SX4A 5F7ZA 2Z6UA 2OYRA 4DHWA 5C32A 2EF1A 4XAQA 1KAEA 5F1YA 4TVBA 3ESBA 4Z6CA 1Q1NA 1U0FA 1YQTA 3NP7A 3HJHA 2XUGA 1R10A 1WQ1R 2JGMA 2NVUA 3GV7B 4LHXA 1ULUA 2EZ8A 1FP4B 2F3TA 4G2NA 2XO7A 4MW4A 4MVJG 3KPJA 2BW2A 1E3WA 2XZOA 3DW1X 1P7DA 2L1AA 2FSPA 1M66A 1U0HC 2YWJA 4MJSB 2P6OA 4LUCA 2FU5C 2OHJA 2ZM5A 2DM6A 2VNAA 2ZJ7A 1GNSA 1HV8A 4V3CA 1KLUD 2H4FA 4IXNA 3AW8A 3PDWA 4WFKA 3E0QA 3K9FC 2XXBA 3GJ7A 5EJ2A 2PH7A 3RHZA 1IXSB 4GB9A 3I64A 3EXG1 3RI7C 3LCCA 1E0KA 2G9ZA 9ICNA 1ZOOA 2PEAA 2VSQA 3TGLA 3PR3A 2J6CA 3K8OE 1YN4A 2GPNA 1PSZA 3COPA 4WY5A 2H4WA 3QE0A 3GLGE 1J90A 1AHPA 4EJ2A 2DL0A 2G83A 2UUOA 1V43A 5D87A 4JOCA 5E0OA 3PNOA 4IIFA 1VI2A 2IOFK 1ISNA 4DR5B 3LDUA 2HV8A 4B4KA 4B8ZA 2QTGA 5J18A 2BEUA 1E59A 3NS1A 5IW8A 5I5GA 3EBOA 3DOCA 1OD6A 3X1XA 1Y81A 2J7PA 5SZJA 4Q3BA 1ZINA 3PXCX 1MNQA 5EEGA 3INYA 2W6IA 4JKYA 5ALWA 5MPOA 3JALB 2HLDD 2KFNA 1C9NA 2GM4A 5FPHA 3AMZA 2DFNA 1OI7A 5I9NA 2G0AA 4XJSA 5G3ZA 2P0AA 1J24A 4TT3D 1K68A 3CW8X 1MQ8B 4NVRA 2QT0A 4MSMB 3C16C 1BOFA 1UF0A 4OJNA 4MQEA 2PXCA 1IQ0A 5EVJA 1I1OA 1DKQA 1YACA 1ORWA 4K3CA 3TDNA 2W2LD 2W2OA 1YQBA 2QW1A 1ORRA 5TJHA 1C1HA 1M6VB 1OZ0A 4K6CA 2MBHA 4XWKA 4ZAZA 1NLMA 4IGFA 5BORA 2GZSA 3TTSA 4TM7A 3QOXA 3AEAB 4DCUA 1JWBD 1NF9A 2WAAA 4XVQA 5C4MA 3AF6A 1AW7A 1DBVO 4WKOA 5EP4A 2G80A 3WBBA 1GAEO 3SBEA 1TJ5A 3GFRA 1CQIB 1FFXA 5F2EA 5A1JA 1KORA 4IEEA 3V3TA 4QJBA 2JH8A 3NV9A 3GUYA 3SXJA 1FDSA 4ZOLF 3LYAA 1PR2A 3MGAA 5KDDA 2FZWA 4Z9XA 1M6WA 4B6GA 3JQAA 1R18A 1MX3A 1U7TA 4DMRA 4QUDA 4D4IA 3NYIA 4EG7A 3UJ9A 4H1TA 2P3OA 5CLJA 3V4VB 2K7ZA 3PHLA 4CG2A 2DECA 3TLMA 1R1DA 3RSFA 5U9CA 2ECFA 1ICIA 1CHNA 4Q8EA 5BRNA 4Z0HO 1LK0A 3K0FA 4TV9A 4P4PA 2B82A 2I2DA 2MUTA 4U7HA 1TA9A 3EMKA 4JZYA 3ON5A 2VEOA 5DB9A 1WWUA 3V8BA 5BYSA 2IE0A 5DLGA 1US8B 4ZHOA 4Y2VA 5BOSA 3GLUA 3WL5A 3OEED 5CTAA 1D03A 4AKTA 4PZCA 4MQLA 4FDMA 3JPNA 4WAFA 4PLCA 3H8JA 3ORHA 4GPTA 1YNOA 3UW1A 1JYEA 3QKWA 2P6UA 3H1FA 3AIIA 1M2VA 2KOXA 3WGIA 1IWBB 3HKZC 3JVEA 3D8NA 3ZWXA 4RANA 2SICE 2H2HA 4MGYR 3GLKA 3KTFA 2OCBA 1WOMA 5HQJA 1G8SA 1D8YA 1H1LA 5FWNA 2PH5A 4UNRA 5F1OA 4FCTA 3G68A 4DV2B 2M9MA 4ZO4A 4UE3S 3IKTA 4V0MA 4MUJA 2ZULA 2UV8A 1X3LA 1S2DA 3BFJA 5IVDA 2ZU6A 4HYTA 4KZKA 3HZRA 3ER6A 4A4DA 5IMBA 1T0HB 4R9RA 1XJ0A 4BMVA 2ZAOA 2ZBGA 1ZQHA 1BE1A 4J7UA 5L3SB 3WGVA 4L4RA 2H1IA 3NGMA 2UZ4A 1PV4A 4CM6A 1J6UA 4YI3A 2XOKD 1ZESA 4ECZA 4PYQA 1PJZA 2Y0EA 1V97A 1TJ4A 1VL0A 1EWRA 1WTCA 1HETA 3CEJA 4QYMA 3K0CA 1Z0KA 4EPXA 1IZ0A 1BYUA 5DG7A 4BOZB 4KV9A 4F4JA 4YA6A 5DPSA 3ZDMC 1PGQA 1OQQA 2ZYAA 3BORA 3NTXA 4B3TB 1WIWA 1QSLA 4GZ3A 4KBYA 5EWJB 1M5TA 4MVYA 4MVJP 4ONEA 5D7NA 1Q20A 3BRWA 2KANA 3LY7A 421PA 3EUWA 3OFNA 4FIZA 2AV6A 1OIXA 4F5OA 1FX0A 1J2RA 3IRUA 3U6KA 4HADA 3MJWA 5JAIA 5KSOA 3H4BA 3VAYA 1GITA 4BU0A 5BV2P 1AXEA 1XL0A 1LTKA 5BWOA 4BBNF 1Z38A 1RD4A 5JAQA 5A5VA 3T15A 4HWKA 5IU6A 4AUMA 3ZTYA 3IEUA 4FBGA 5GMVA 2JFZA 2PQ6A 4OMDA 4QOHA 2DQSA 1SHTX 1JU4A 2EFHB 4MP6A 1BHSA 2AL3A 5JNLA 5J2FA 4XJVA 3PXEA 2NVBA 2HZBA 3M3DA 3MMPA 2H3IA 2FZLA 1F14A 3ZU2A 2EAPA 1XEEA 1SUBA 4HRYA 4JI6B 3PGVA 2K5UA 2VDQB 1YR7A 1J2JA 3AL0C 5IF3A 3R6TA 4H35A 4QM6A 3II6X 1CV2A 3AY0A 3WCQA 4ANVA 4E7OA 2B35A 2JZZA 3OZCA 3OT4A 3MTQA 2BWFA 2BKVA 1ZPSA 2Z2IA 4C2AA 3T4PA 4HNRA 3UFXA 2J7PD 4KN4A 2HVIA 3EDQA 2CDBA 1IBMB 1XCTL 4JYAB 4L74A 1E58A 3I61A 5C51B 5TGDA 4RD2A 3B9PA 1K6IA 3GW8A 3LV8A 2GN6A 4L0QA 4YTPB 4FBUA 4YQZA 1JXEA 1FUYB 2P3LA 3LLCA 1KOFA 3LKDA 4XQ0A 4Q3AA 4CM3A 1SMKA 2ZIWB 4OYLA 4RACA 3F74A 4IOIE 2ZS7A 4E88A 2B5VA 2XTAA 4CLDA 1L7EA 4KLEA 2YMPA 2R1TB 1AMNA 3WADA 2Y1KA 3U30A 3D7RA 4FDVA 4N0PA 1A2QA 3HVRA 1VZ6A 5BMVF 4ZYTA 1TZMA 3GN2A 3T12A 4J9SA 5A4IS 3M95A 1K7FB 3P97A 3OE4A 3QE9Y 3E35A 2QTBA 1LXCA 5JNVA 3TPZA 5B1SA 4RFVA 3LRXA 4B32A 3QCAA 1NKTA 2WWVD 4URUR 1VHWA 1NJ8A 2Q7XA 3D1JA 3TBFA 1KLGD 4EKEA 2H63A 5HWSA 2HRRA 1E1RD 4RENA 3TH5A 4D44A 1V26A 4YL8A 5KFTA 1MVNA 1IJKA 3U4MA 4DQ0A 2FQ1A 2WWFA 4Z51A 4GKJB 1LV8A 1F4VA 4ZPJA 1ZW1A 2AF3C 4GBGA 4MXDA 1U11A 1XCLA 3HDJA 1E3MA 5KYXB 1PW7A 1YA6A 1UK6A 1VKOA 5JJBA 4LXIA 3AUAA 3CISA 4LZOA 5JAMA 1R8JA 4TLEA 5DVZA 5KHOA 2OO5A 3ZDCA 3QE3A 5JMPA 3EGXB 2DX7A 2ZR9A 1CQPA 1CQJB 2WOJA 4Q3DA 4AMZA 3G6KA 2O2XA 2HU8A 3ELUA 2NPTB 4IDBA 1I36A 1DEOA 2HD4A 4ARUA 2B3DA 1CUEA 1GVHA 3DBHA 3DZDA 1E2FA 3OQHA 3G2PA 3GUCA 4WK6A 3W5IA 2ZJ2A 3Q0EA 1FQKA 3EFEA 1WVMA 1XZAA 2ZRHA 4CTMA 2PK3A 1FS5A 2DUYA 1B2RA 5JS8A 3WK4A 1CF2O 2QN6A 3OM8A 2H6EA 4R2MA 3M9OB 1G0NA 1P1IA 2IHMA 1WR6E 2G45B 1CUSA 2UYQA 5ALKA 4O4IA 2Q1WA 4PQEA 3ZKAA 2LBOA 4NQRA 4CCAA 2C7OA 3DE0X 4ICAA 2MJ3A 5IAKA 2Q4OA 5JRTA 1KY3A 4YFVA 1Z82A 3ZW8A 1QZXA 4G07A 1TGYA 3B7WA 2P27A 1QRRA 1TA0A 5GONF 3OJXA 3ZX5A 5LM3A 2O5VA 3ACCA 3E15A 1PEKE 3AU8A 3FSEA 5D01A 1S3SA 4DEXA 2KD0A 4ZFNA 3K7EA 3A36A 2NZVG 5J43A 4CPDA 1W6UA 5K03A 4IUMB 4H7HA 1XU9A 4R2JA 4EK9A 3JAMA 1BGWA 2P9GA 4EY4A 1VLHA 5A05A 4FR2A 2FQXA 4DC0A 2ZTHA 3VA7A 5E2BA 1C29B 1ZK1A 3QBVA 3F71A 3BH0A 1NW8A 3EXIB 1T3SA 3PFKA 4RGTA 5I7SA 1R6VA 4X3CA 2BT4A 3HWRA 1QP0A 3OD1A 4NH4A 2YWXA 1W2HA 3F4LA 4TWRA 1W0KD 4P0QA 4N76A 4CKZA 6REQB 4P33A 4JBIA 4E6EA 5AUPB 2VYQA 4YYEA 3PDIB 5DHQA 2CF6A 1PJBA 5KWSA 2J59A 1GSIA 4I3GA 4AKEA 5EJ9A 4QGBA 1E94E 1IMOA 1AKVA 3VH4B 4LV8B 1PEYA 1TKYA 2D2FA 3C8DA 5ES4B 3B1VA 5JCJA 5EJ4A 3HJEA 3S3TA 1ENFA 3SGLA 1H4SA 1BRTA 4A2WA 4YMMA 4KLUA 3QXJA 2XK5B 1ZCJA 4R8KA 1R88A 4XA5A 4F50A 1SQ0A 3LRTA 1V5WA 4UQLA 1R6BX 4C14A 4AO6A 3TZQA 1JDSA 1MJFA 4WXMA 2QP9X 1XSNA 1GGHA 1DLIA 4CHGA 5I3CA 4MUKA 1DDGA 2QWXA 4EHFA 2AEJA 1PFDA 2BGKA 3HLTA 3H9EO 1H0SA 2LASA 3QLUC 2IYYA 4F60A 1CEQA 1PD0A 1PK1A 5LOVA 4L4UA 5T7BA 5ALZA 2V8OA 1EM8B 4DCCA 4CDNA 3AIOA 2QX9A 5KFKA 2J30A 3VUYA 1QAQA 1YD7A 2VRNA 3KZVA 2XF8A 4Z4EA 2W22A 3HDQA 1X6IA 1MEJA 1ZYQA 4YP9A 3JXEA 3GXBA 5E7IA 5H16A 2GI4A 3O4JA 3H1UA 1DCFA 2EYQA 1DMSA 3T34A 1EWCA 1HDYA 2SCUB 3RU7A 3NTQA 3OF2A 4AJPA 5BN4A 3KQHA 1GSOA 2J07A 2B6HA 4XYBA 3LCRA 1RQRA 3KO8A 2OD2A 4EUKA 3PUZA 3C3BA 3LQFA 3SEBA 1X94A 3TLZA 4R0NA 1G5TA 5KMGA 5AUKA 1KVTA 2KICA 3L4BC 5IIJA 2I3BA 1YRLA 4IILA 1QYCA 4BXOA 1YB4A 1R64A 2UVDA 3TAQA 4TRJA 5C9ZA 4TQUS 5KQLA 1LBTA 4JU9A 2WNHA 1I1NA 1Z62A 3UMVA 4Y2TA 4X1OA 5T67A 2QUAA 4MITA 1CK4A 1R0ZA 3BMXA 5GM2A 1P0CA 3J81j 2H5EA 3MA0A 2IYFA 2NQ2C 2P0EA 4HROA 3LIIA 4HGZA 5GTHU 4HK2A 4A55A 1RAFA 3ZWWA 2B83A 4YGYA 4JPSA 4C89A 4BN4A 1ULSA 4JLPA 1V38A 3FE2A 4WFJA 2KE7A 2ZCBA 5FTJA 2KBFA 2D3BA 5CHFA 2QROA 4QAQA 2FK8A 5J2DA 2ODAA 1ELOA 1F2TA 3VBCA 4PSDA 2AFIB 5AM2A 4ZT6A 4O3QA 4PL2A 4IUDS 2V6FA 3SZ2A 1OREA 3ENVA 2BMJA 1PWYE 2JEFA 2R7AA 4JLBA 4DR1B 3F97A 3H7PA 3OE7A 2FRDC 1J39A 3LI2A 4S2UA 3VBEA 1U3WA 4DQVA 3W6NA 3RNAC 1YT3A 2VDPB 2PNJA 1QQRA 3HKBB 1ZJYA 5DM4A 3V4LA 3C87A 2HVHA 4CR7A 3VFDA 4PGHA 1NRJB 4CKCB 1QBGA 1J8MF 2IOHA 3AFIA 4P8RA 1I4TD 4GBJA 4C1NA 2I9PA 4BUCA 3OQJA 3VTKA 5CVUA 3H5OA 2AEFA 3L8YA 3U4HA 3CZ9A 3AM1A 1N4DA 4N82A 1AQNA 2HBJA 1TLLA 3SR0A 2FSSA 5ERYA 4AMVA 5BPCA 5BWMA 3S1SA 1MQ2A 2XB9A 4XZ3A 2CHFA 2K8CB 4RTRA 2HRBA 2XBBC 1E7WA 2IPNA 1B1AA 3ZN2A 5KG0A 4MSQB 2W2TA 1M72A 4AM8A 4TL8A 3RRGA 3ZCVA 2AMLA 4F2PA 4MI1A 4QHYA 2QD1A 2YIJA 1MW9X 1OE0A 4QJIA 2LDBA 2DF8A 1BPDA 3BL6A 1HQKA 2OQ2A 3FNFA 1BWRA 3ICEA 4RMNA 5BV1A 5TV2A 4X95A 5CVVA 5GZ6A 4AFNA 4ZH4A 2IHNA 4FFNA 5EZYF 4EA8A 4WK4B 5AM3A 3A0BU 2HHJA 4TXJA 1E2EA 1PTKA 2KB0A 2J4FA 3A1QA 1I35A 3WLHA 3BWCA 3U8ZA 1N1EA 1FUIA 4KYIB 5ITZA 2RGBA 4DSFA 2ZG6A 1ZSVA 3V8RA 4W1PA 3I6YA 5HDQA 4J29A 2P9FA 1TKBA 1C14A 5D46A 3N0WA 3ADDA 3KXIA 4ZEVA 2XR1A 1FLAA 2V7GA 4RBNA 2VDOB 2KSOB 2YYZA 1MKYA 3IEIA 3NTVA 4I36A 2WVHA 1HPLA 4EZ9A 5AVZA 4NNJB 4XUDA 4EW1A 2DKXA 5HJ7A 2Q6VA 1CJUC 2XLCA 1QOAA 1Z2MA 3SK0A 3H42B 2QUIA 3E8XA 1PGNA 4YP7A 1P1CA 2BUBA 5AO9A 1P44A 2QS9A 4UD6A 2CXQA 3D6UA 2BR0A 3AR6A 1GRRA 3U48A 3W5SA 5K99A 3CVOA 4KYVA 4QELA 4QWWA 2B1QA 3W3AH 2V6BA 5AJZA 5ES3A 3ND7A 2IZVB 4RNNA 3F73A 4DGSA 3HEAA 2PZJA 1RACA 3KVYA 1LRKA 4RJJA 4ZAGA 2XVZA 1A1SA 3U3ZA 3OURA 1O9BA 2R6R1 4AL4A 4ITKA 3RKUA 2VRRB 5FOSA 4FFWA 4RKRA 2DPMA 3VR6D 1X1DA 5KFNA 3DV2A 4J3FA 2IH2A 2DKOA 3V5NA 1KYVA 3UN1A 3TR5A 3EPJA 1ZW7A 1SE3A 2QP4A 2GLEA 1ESCA 4EUHA 5FPQA 2I3AA 4IZ6A 5SYNA 2BPCA 2N1VA 3GLHA 4AMUA 3FZGA 5FR6A 1EJ2A 3W7BA 3GDHA 4PZEA 4IMIB 2KYRA 4TQ0A 2J0VA 5LVAA 2ZTCA 1O6FA 4NOJA 3Q8WA 3L5KA 2PYZA 3VQIA 1UMDB 2IEAA 7MDHA 1PK8A 4R98A 1A4IA 4Y2RA 1I4PA 4RZHA 3MRXA 2I1VB 1JMLA 1E79A 1H8CA 2LCFA 2P1DA 3QG5A 1WXGA 3HPOA 2O06A 1VKNA 3TK1A 1IHXA 5DISB 4JI0B 4NZLB 2IHBA 3M9WA 2RHBA 2WJWA 4GP7A 2R5NA 5DDIP 4J91A 2N0SB 3CLTD 1OX4B 3EWAA 4PAMA 4BFSA 3MERA 5IN4A 1PV2A 4MK4A 3A2LA 2K89A 2C2OA 3ADKA 4UPDA 3WALA 3JQBC 1NUQA 3HGMA 4EG4A 1RAGA 3QVOA 4E94A 5C34B 4KLIA 5BPHA 2X0JA 4OYHA 1DRUA 2IJ0A 2Q28A 2HPVA 4C20A 3FFWA 3K9BA 1ZQ9A 3B0YA 1N9GB 4MQEB 4RORA 4O1NA 4NS4A 3F8SA 1VPTA 1XE3A 4Q3CA 1YX6B 2I1LA 3UPQA 3U4GA 1DEXA 1OYWA 1DXQA 1A9XA 3RIEA 3OG9A 3FROA 4V02A 1N3BA 2PO7A 4ZOHC 4MCHA 2Y0SC 5BQ5A 4F97A 3AY6A 4PX9A 5EIAA 4PYZA 5JJ5A 1FYVA 4Q66C 4PLTA 1RJFA 1Y80A 2QB1A 2AMFA 3R4CA 2ZUEA 1QPBA 2WWIA 1E6EB 4F4FA 2ACKA 4EQZA 2R4QA 1NMYA 1EB9A 1F0ZA 2Z2ZA 3BDIA 5TZVA 1QG4A 2H54A 2XQIA 4XLLA 3ZQ6A 5EVCA 2H29A 1KLVA 1FX0B 4O63O 3U1TA 1GPUA 3DMYA 2QD4A 2Q2NA 3QLUA 2R1TA 1D1QA 1PJ4A 3GJRA 1L1QA 1YRWA 3C7CB 1UWMA 2QGZA 1FDWA 4FHGA 3ZPXA 2DTDA 1HT2E 2WYIA 3K2EA 3PC8A 3C3WA 2MWMA 3LUJA 2X0EA 4F8YA 1E5LA 2H59A 4M0EA 1YJ5A 3DP7A 4B0PA 5BSWA 5G1NA 4FE7A 3F47A 1KMNA 3UPDA 4FR0A 4MMZB 2QRHA 3N2GA 2X8BA 1AKWA 1EE2A 1XEAA 4KPUB 1SKAA 4AF8A 4HGYA 1G8KA 4BJ3A 4HQNA 2JJ2A 3NEYA 4IF4A 2EGHA 2H06A 3SYNA 4CMAA 4DQRA 5K3CA 5ALYA 1DJQA 1KF0A 5K0CA 1U8CB 4XLZA 3ASVA 2DT8A 3L7NA 4P81A 3B2GA 2FPIA 4G1UC 5KC8A 3LXRA 2ERCA 4OJLA 5PGMA 3PQFA 1YTLA 2AZDA 5EESA 2P9HA 1EVYA 4PS0A 2YWBA 4MS1A 3G3EA 4JI3B 4F45A 2XPCA 1FRDA 3LFUA 4JNCA 4RVDA 2Y0DA 3DG9A 1L7NA 1WE6A 1KRPA 1JQ4A 3ZHXA 5BURA 3R8BA 1TPYA 4EEXA 2OVFA 5ALFA 3C8UA 4QGFA 3RAGA 2R79A 5CRXA 2D62A 3FBGA 1NN0A 3JVUA 3KTOA 5LZ9A 1EJBA 4ARZB 1WMHA 1XHEA 4F93B 4DWWA 1CS0A 4G0QA 5IXSA 2CUNA 2ZRCA 3WHIA 1G55A 1HBJA 3OJSA 3I32A 3K4GA 2K6GA 4XZ4A 4EUSA 4RF1A 3TMAA 1NK4A 1YDGA 4AY2A 1JMVA 1IZ9A 1CZNA 5C5JA 2G7ZA 1YZ3A 1NDUA 3OZFA 3T61A 3TWOA 1CY1A 3AR3A 1TJEA 2W8BB 5GP1A 1IHOA 3HB0A 3ESZA 4HKQA 4RDCA 4JL9A 2INCC 4YUZA 4KQXA 1NG1A 4NYJQ 3T5JA 5DMHA 1YZ7A 1TYEB 1S77D 3ELYA 3VZRA 2O14A 2UVPB 3PFHA 4BS9A 4KWIA 1ABBA 4DAOA 4WNAA 3UF8A 4BQQA 1P0IA 3DVAA 1FDTA