5EE3A

Complex structure of osychf1 with amp-pnp
Total Genus 110
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
110
sequence length
374
structure length
357
Chain Sequence
ERPILGRFSSHLKIGIVGLPNVGKSTFFNIVTKLSIPAENFPFCTIDPNEARVYVPDERFDWLCQLYKPKSEVSAYLEINDIALGNAFLSHIRAVDGIFHVLRAFEDKDSVDPVRDLETIGEELRLKDIEFVQNKIDDLEKSMKRSNDKQLKLEHELCEKVKAHLEDGKDVRFGDWKSADIEILNTFQLLTAKPVVYLVNMSEKDYQRKKNKFLPKIHAWVQEHGGETIIPFSCAFERLLADMPPDEAAKYCAENQIASVIPKIIKTGFAAIHLIYFFTAGPDEVKCWQIRRQTKAPQAAGTIHTDFERGFICAEVMKFDDLKELGSESAVKAAGKYRQEGKTYVVQDGDIIFFKFN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Obg-like ATPase 1
publication title ATP binding by the P-loop NTPase OsYchF1 (an unconventional G protein) contributes to biotic but not abiotic stress responses
pubmed doi rcsb
source organism Oryza sativa subsp. japonica
molecule tags Hydrolase
total genus 110
structure length 357
sequence length 374
chains with identical sequence B
ec nomenclature ec 3.6.5.-:
pdb deposition date 2015-10-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01926 MMR_HSR1 50S ribosome-binding GTPase
A PF06071 YchF-GTPase_C Protein of unknown function (DUF933)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.300 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 TGS-like domain 5ee3A03
3.10.20.30 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 5ee3A02
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 5ee3A01
5E4FA 4N6EB 3E1SA 3LXXA 5F9FA 5EP1A 4ZCLA 3AE8B 1YJ5A 1FMLA 3U7HB 1XMVA 3N2IA 4P0TA 1SVSA 5JI2E 1T3QA 1YU9A 1M8PA 4IDPA 3IGFA 2PH1A 2QMUA 2VBCA 3T61A 3KQHA 2BM1A 1E6EB 1UEIA 5JECA 3LNCA 1OKKA 2YKGA 3ZVMA 3PEUA 4PXAA 4UXHA 3NDBB 2W0SA 5BQ5A 1Q20A 1FRDA 2NG1A 1Z0KA 3CPHA 1N6IA 3F5FA 1UKEA 3KKMA 3KTAA 4I1SA 5L3QB 721PA 4ZV4A 3MMPA 3PUXA 5KYKA 1DS6A 3VRBB 3PITA 2REXB 4CDGA 2O8DB 3QVUA 4FCTA 3AE3B 1YZQA 3T1QA 3O47A 1TU4A 5ELXA 3CZPA 3NBXX 5CLQA 3R8CA 4DLYA 4M2LA 1XPOA 2O8FA 5CK5A 2IHYA 4MGZR 3R7WB 5KU1A 3EA0A 1GAQB 1E2HA 1E9AA 1L4YA 4ZKEA 1B23P 3B78A 1XEXB 1NIPA 1HURA 3NC0C 4W5HA 2DHRA 1J7KA 4FWTA 3AF0A 4N0DA 5G53C 1N25A 4EPTA 2E3TA 2F3TA 2FEOA 2G83A 3NVVA 2WWWA 4DLUA 1AKYA 1ZMXA 3BGWA 1T8TA 3O8BA 1VDZA 2A30A 3MWYW 1I4TD 4LYFA 2F1IA 3AVWA 4NCNA 3KB1A 4A8JB 2ECKA 1ZW6A 3GLGA 4IVRA 4QBIA 1KI1A 2ZJ2A 1Z6XA 5FI1B 1DARA 3NWJA 1I2MA 4AURA 4BQSA 3IUYA 4KHZA 5KDOA 2W6JD 3AKDA 2OSBA 4D0NA 1W48A 1G8PA 1WXQA 1OQQA 1XLNA 1ZOYB 4V0OA 5GADl 2OO7A 1CTQA 3QKRA 4KYUA 1KAGA 1XCPA 4N0EA 3AKCA 5AJXA 1EX6A 4EPXA 5L3SA 3HRDD 3NG1A 4G0NA 1A2BA 4MRNA 1IN8A 1RM6C 4MKIA 1P9RA 2Q3HA 5EP3A 1Z6GA 3BB4A 3BD9A 4MRSA 3TK1A 1OFTA 2FPKA 2GJKA 3QQ5A 1VJKA 1KI8A 4PHTA 3I32A 5L3VA 3K0AA 1YE8A 4C0SA 1ZC3A 3GJ5A 4Q4HB 4PANA 1XJ0A 3PUWA 4LSGA 2K5PA 1EWYC 2OEPA 2YOFA 4B44A 3IIJA 1XLQA 1OFFA 1G3UA 2BBOA 4MKGA 1OW3B 3AF3A 3PR1A 2KBFA 1KOFA 2O8BA 2J41A 3UMRA 3L2OB 4P33A 5DHAA 1FM0D 3MWJA 4JLVA 2ATXA 4AYTA 1SHZA 3EZ6A 1N6NA 4B3BA 121PA 4TTQA 5EP2A 4XOIA 4YSXB 1Q1ZA 2XNDD 2DFLA 2WVJA 4Q7KA 4HLDA 3AVPA 1Q3HA 4O2LA 1DAEA 5TVKA 1CLUA 3HR7A 3NH9A 1V8CA 2WJYA 4OK3A 4Y0AA 2ZRBA 2ZM5A 4QM6A 3T34A 2DWOA 2I1QA 2LKCA 1OYWA 3IDQA 3MWLA 3VR4A 3K70C 1M7GA 3U5ZB 2ZROA 4WQMA 2XITA 2ZSEA 1FRRA 3AB5A 1JXOA 3NHBA 4IKEA 5DH9A 4DEYA 4NBSA 1M1YE 4GL2A 4USAA 2GCPA 1VCNA 3D3QA 4KXFB 3KXLA 2Z4SA 1I2DA 3AEBB 3EASA 3LLUA 1E98A 2VP5A 3SFVA 1XPRA 1ZBDA 1WDTA 2EFEB 4DBLC 3KJIA 1EWQA 1AS2A 3TQCA 5DISB 1FO4A 3SJBA 2P65A 1CU1A 1DO2A 3GD7A 3H0KA 3IO5A 2VLIA 1ZD9A 2G3YA 3TQFA 2X19A 2ODNA 4BZPA 2A9KA 5EZ6B 4JYCA 3SR0A 1G3QA 4V0LA 4ZIRA 2W2VA 3K09C 2NO0A 1SXJE 1F0ZA 3C5CA 5FBRB 4BLSA 4DRZA 1TQ6A 2JEOA 2QQ0A 2PBRA 2Q9BA 3RYTC 3ZIAD 3X1YA 4KSBA 4V03A 1U8YA 5EQTA 4LBYA 1KO8A 1NN1A 3RRNA 3WNBA 4Q18A 3WHKA 1N0WA 4EFNA 3EA5A 2IYQA 1BH2A 2ZEJA 3LW7A 2B21A 3X1XA 1UBEA 1P5ZB 4GSYA 1U8ZA 2P6UA 3U3JA 2CXXA 2XB4A 4BZXA 4DT1A 3THWA 1FXIA 3DL0A 1TKYA 1QF9A 2ZXUA 2BS4B 4OQMA 1NVVQ 2ZUDA 4PTLA 4BE7B 2X1VA 4JJZA 1JB1A 1E2KA 1TMKA 4KBFA 1G9XA 1KO4A 1VCIA 1W0KD 1SVKA 4OQLA 3IQWA 4YXDB 1FNNA 1LS1A 4US9A 1ETUA 2D3WA 3OAAA 1AIPA 2Y8EA 1NBMA 2EYUA 1SXJC 3VKWA 3G0HA 1IY0A 3AE7B 1OHHA 2FSHA 4V0KA 1E9CA 2AK2A 3THOA 2PLRA 3H86A 4Q5IA 4Q1BA 1QOBA 1DAMA 2PZGA 1ZM7A 1KGDA 3K1JA 3BFKA 2VF7A 3K70B 3KKQA 3SE0A 1ELOA 2O8DA 4FIDA 1P2SA 4QBGB 5KSZA 2CCKA 4M1KA 4JVMA 3DZ8A 4BLTA 1P4SA 3R7WA 3P1MA 1QHHB 3I8SA 1GP2A 4NMMA 3V00A 1SGWA 1IXRC 2EWWA 4IXNA 3HYRA 3EPLA 4X8MA 4M1YA 1NJGA 4HATA 4UNNA 5HE8A 3U6BA 1TQ2A 4BLRA 1E7PB 1EFRD 2DFKB 5GVSA 2CCJA 5FTMA 4RKEA 4U00A 3DM5A 1JAHA 1IM2A 5KSOA 2IYZA 1C4OA 4ASUA 1GWNA 3VNUA 2EFGA 4PPGA 3FKSA 3F3YA 4HDOB 5DN6A 4A0HA 3IO3A 5E3HA 2V55B 3PVSA 2FZ4A 3QXHA 1RJ9A 2QZ4A 2BM0A 4LV6A 3ADDA 1ZXIA 4IOLA 2OAP1 3SQXA 4YONB 1UFQA 4EJSA 1LVGA 2FFHA 1E96A 4RZ2A 1XWIA 3QXJA 1G18A 4M53A 4OJQA 1UWMA 4TMTA 4B6EA 2F55A 4TZ0A 1UJ2A 2VIIA 1NVXQ 3TLXA 2CVFA 2QPTA 4AWXA 2D2FA 2QTVB 2ZRFA 4A36A 1UKZA 2BJWA 2HTME 4QHYA 2MH7A 5C3JB 2RGNA 2YC2C 2OE2A 3CO5A 1AS0A 2ZE6A 3UPUA 4KITB 1YJIA 5FOXA 4RFSA 1E2EA 3DMNA 4UNSA 1W36B 4B2LA 1N5JA 1N61A 2F1HA 4S35A 3GJ0A 3AVQA 1W4BA 4A0RA 1WBBA 4CF7A 5EUQB 1ZVQA 3FWYA 3Q7QA 3T5GA 1MO6A 2WM9B 1HTWA 5IK2D 1JALA 1KDTA 2GZHA 3HU3A 3OEHA 2J0UA 1D5CA 2NQ2C 2WJVA 3I92A 3KL4A 4L4UA 1JR6A 2GZDA 3IILA 1K5DA 2EQBA 2GAAA 3ETRA 1AA9A 2VHTA 2ZI5A 4RCYA 1G291 2OFXA 1XD2B 4QJ4A 2QBYA 2IL1A 4MGKR 4YMWA 1AN0A 4K8OA 2DBYA 3LWNA 2ZS7A 1UF9A 3G82C 2CDNA 2IEZA 4IOKA 4W5JA 1G6OA 1KI2A 2F1RA 2FBWB 2XTNA 1E9SA 1IHUA 3LFUA 1VKJA 1DOAA 3FMPB 4TMZA 3M1IA 4PO1A 2MSDB 1N6RA 2OXRA 2ACZB 3SZRA 3U44A 1R0WA 3CF0A 3EPJA 4B3GA 1A70A 4KLNA 2QROA 3QXSA 2I4IA 4UJ3A 1JNYA 5TY0A 1COWA 4B43A 2JIZD 4RD2A 3NVYA 1XEFA 1E2LA 4PHFA 4B35A 4MYCA 1XMSA 3K0CC 3PEWA 5CB8A 1OXSC 1GPXA 2EYQA 4NZYA 1AGPA 3KFVA 1T5IA 1GNRA 2XTMA 1Z0FA 3CPEA 1G7RA 1OFIA 1G7SA 3AH8A 3GEHA 2ZJOA 4LOAA 5DI3B 3WYAA 1G3RA 2O8CA 1J90A 4FCWA 1QVAA 1N3BA 3GFTA 1QRAA 1G16A 1QG4A 2DY1A 2QQEA 1F2UA 1M7HA 3X1DA 4L9WA 1PLLA 3CF2A 5HKKD 2PMDA 2ZSAA 1T4GA 2XOKD 4N3NA 2R6GA 3I1FA 1IY2A 4DLSA 2QGZA 1N5IA 1G4UR 2HT6A 4MA4A 5J47A 2ZR9A 3DO6A 4UNQA 3GLIB 2ODBA 4FW9A 2EWVA 3OIVA 1ZINA 3AEEB 1N6HA 2IYXA 4XWOA 1KI6A 2QSYA 4LX0A 1DG1G 1E0SA 4HB3A 3THYB 1CIPA 2EFHB 2Q9CA 2XJ9A 1KJZA 3GJXC 4YMUA 2IYYA 3QOFA 2WS3B 5E7JA 1OKKD 2MMGA 3VHLB 1WCV1 1ZU4A 2QM8A 3QEJA 1R7SA 4LV8B 2PJZA 1RYHA 5CLLA 5DGXA 4MDEA 3AV8A 1FX0B 2G1JA 1N0UA 1P2UA 4RZXA 2B92A 3QXXA 1L4UA 2CE7A 5FL3A 1Z47A 4C7OB 4MGIR 2XZOA 3ZLJA 4A0FA 2GKSA 2QGNA 2IUSA 4EIWA 3JZAA 4AC9A 4WZAE 4IDHA 3AEFB 1ZJ6A 3BFXA 2G0TA 1OIVA 1TEVA 2VQSA 5JJKA 3TGPA 1NJFA 3BK7A 2WWFA 3TNFA 1DVRA 4ITRC 4EUNA 3VTKA 2GBLA 4A1FA 1YZKA 1VTKA 2HYDA 2IS4A 1JW9D 2ORIA 1TADA 4HSEA 2ONKA 3KXIA 4Q9JA 1Z0IA 2VP4A 3NH6A 1US8B 4LPKA 1LF5A 2BHRA 3VU9B 2RHMA 1JR3D 3WY9A 3CX8A 3VX4A 2NPFA 1NI3A 1QHHA 2G0NA 3AVOA 4A6XA 1U90A 5SZIA 2CL0X 1CEEA 4UXJA 3LB8C 2MSCB 3W5IA 4NDZA 1KK3A 5CIQA 4US8A 3R9IA 2HCBA 3AGQA 2IYTA 4OQFA 1GM5A 3ZD6A 2QENA 1UM8A 2ZAMA 3D6TB 4NCHA 2OESA 5C46F 1G21E 3X1ZA 3KWLA 3W5VB 4PC2A 3LQQA 4UNPA 2N42A 2W6IA 3FHTA 4G5GA 3OZXA 4JMPA 5G40A 3K09A 2GA8A 3SI7A 4ACBA 3P4PB 2EVWX 1JECA 3GEIA 4HLUA 2AN9A 1WRBA 5G5HA 1KK0A 1E6CA 3MSXA 4LPSA 4LHXA 5FBLB 4MGYR 4OK6A 4OQXA 2GVDC 4TLDA 2WWGA 2YNMA 3PV0A 4ZDKA 3TR5A 2M56B 2GAOA 3KKPA 1DGJA 2NZJA 2JLXA 2FFBA 4OI4A 3AMZA 3B13B 2FSIA 4DJTA 3WRXC 4POAA 4W9MC 1OH6A 5IT5A 1XNJA 3PEVA 2NGRA 3U7GA 1J7AA 1C1YA 1XD8A 1OXXK 1ANKA 2BEJA 1L2TA 1FP7A 1VMAA 3C4JA 4PC3A 1KK1A 3A4NA 3RAPR 5JI3E 1SKYE 3IIKA 1X6VA 3U7EB 1ZIPA 5FL7A 2GXUA 3IKJA 2WSSA 3W8RA 4R7ZA 3WP1B 5AUIA 2G1EA 4ZDIA 2NIPA 1SXJA 2Q9AA 1Z6AA 4AG6A 5AUPB 4WOPA 3OE7A 3KUCA 1W7AA 4NCJA 3MLEA 1G6HA 4M9XA 4YDSA 4PAMA 1MT0A 2D06A 4LV5B 1DOXA 5FTKA 3KQUA 1K6MA 4LUCA 2OBLA 2ZTSA 4WZBE 2YWHA 4GFDA 4XWKA 1NL3A 3D31A 2WU5B 2FX3A 1X8JA 3CONA 3FB4A 4HLCA 2AXPA 1BKDR 4XWAA 3QNUA 1RRGA 5FBWB 3EAQA 1VIYA 3K0FB 2V8OA 5K8LA 1A4RA 1XMIA 4ESVA 1DAHA 2KAJA 4IEIA 2A5FA 2KJQA 2W58A 4BEJA 3OHMA 4A9AA 2EFDB 2P0EA 2AL7A 3TKLA 2ZQ5A 4X8HA 1S4QA 4HB4A 3T12A 2A5GA 2WWYA 3RRYA 4L9SA 4RZUA 2PZEA 1SQ5A 2FEMA 3IPXA 2ZAOA 4PQYA 1Q1BA 2ZSFA 2IS1A 3KQNA 2BS3B 2TMKA 4WXPA 1VPLA 1A82A 4B32A 2IYUA 3D7MA 4UNRA 4ABYA 2WV9A 2DCUA 5DI3A 4O25A 4F92B 1DAFA 1KSFX 4G3XA 4I1UA 1NMZA 4R98A 3IQXA 4ILEA 4C7YA 3ABVB 5EXTA 4BLPA 3ZZTA 1TUIA 2ZR7A 1Z83A 5ANRB 4E03A 5JEDA 3VR1A 1F5NA 3HPRA 1KO1A 1E2DA 1FTNA 1FP6A 2RMKA 2PCJA 1OB5A 1G20E 2GWHA 4TTRA 4WVFA 5IHPA 1TYGB 2BIFA 2DFTA 3GLIA 3EIEA 4JKIA 2WTUA 2CVHA 2V9PA 2QY9A 4Q1CA 1E4YA 1I7HA 2LEKA 4TYPA 3ZS8A 3CRRA 4GI7A 5G41A 2AKYA 4IW3B 1F2TB 1QHIA 2R9VA 3OAAD 2YOGA 3RS4A 2P3SA 2WOJA 2H18A 1JEDA 4D4KA 4KI0A 1AWDA 4QM7A 4IXMA 2PIAA 4HLQB 1NBMD 4H1VA 4KVAA 3AVUA 2HLDD 1OHHD 2PX3A 4C0JA 1OFUX 3BBPA 4Q66C 2A78A 2C2HA 3RS3A 2JQRB 3LDAA 3OEED 3RHFA 2C9YA 2J1LA 2QN6A 1VIAA 2DWPA 4F38A 4DSUA 1JQLB 3CH4B 2NO6A 4Q7MB 2WQYB 3FKQA 4H9GA 4D4MA 4RKFA 2QE7A 2DWQA 4B2PA 2J46A 4XD7A 4KAXA 4C9BA 2YINC 4GBMA 4EPYA 2HT1A 2OAQ1 1YZUA 4YTMB 1DOIA 2QM7A 1WBDA 4XVQA 4A8JC 1R10A 3CBQA 2R8RA 2CJWA 1N6KA 4KCGA 3T1OA 3TMKA 4QNRA 2FWRA 1SVIA 2H16A 3CR7A 4QGHA 1JROA 5GVRA 5DI9A 1XEWY 4B3XA 4DWJA 1CKEA 3CRMA 4L5BA 421PA 5JWRA 1AK2A 1N6LA 1FUUA 1XP8A 1E9RA 3VU9A 1HEIA 3FE2A 1LS6A 1US8A 3RDPA 1FL9A 2H57A 4FN5A 4NYIR 4ASUD 1NG9A 4DCVA 1XZPA 4QGGA 3NHAA 3K0CA 5DN6D 3P4SB 3B9JA 2RGCA 4CW7A 1R0XA 5CITA 4JLAA 4YC7A 2OFOA 4LJ4A 4PZZA 1XD9A 2CK3A 4PSVA 2XZLA 5H68A 1JI0A 2RB4A 1OIWA 2XXAB 2ZSDA 4KFRA 2A5DA 4URWR 3EW9A 1Y63A 4NU0A 4PC7A 4D6PA 1JPNA 2BBWA 2VH5R 4QXAA 3TW4A 2UVQA 2OFWA 2VSOA 4L16A 3AF4A 1E0ZA 1GILA 2VEDA 2G6BA 4OHZA 1YR6A 4M1TA 5A4JA 3HUIA 1G8FA 3MUFA 3FYHA 3TJZA 1R0YA 3ADCA 4DSNA 4B33A 2IYSA 2JJ1A 5AUOB 3P1JA 3A4LA 4IEEA 1GRRA 3P20A 4JLPA 1CS4C 3BC1A 3OEHD 1E3MA 1HH4A 5LB2A 3LAWA 1DELA 4NYMR 4W5WA 4CZ2A 5J4YA 5JSZB 2IXFA 2V1UA 2JAQA 3FMOB 2C78A 4ZDJA 2OLJA 5KPDA 3SNHA 3LBIA 3SR6A 4PZLA 2IA5A 4FMBB 2HCJB 5A5GA 1KO5A 3P4XA 4P4SB 1PZNA 1Z63A 1AQYA 2JLYA 3SHWA 1NSTA 5EXSA 1VG0B 2ZYWX 2WJIA 4GOXA 2LCFA 4CEIB 1EWRA 2ZRPA 2FE4A 4MYTA 2IXEA 1FFHA 1S9DA 5HZKA 4C3ZA 1R5OA 2OBNA 2WPDD 5SZJA 3K9NA 2QMEA 3B1XA 1DO0A 1P9NA 3FHOA 3W6NA 1COWD 4JS0A 2RGEA 3AE1B 4OI2A 2F9LA 3SBEA 4D4LA 4HI0E 2P6NA 1R0ZA 5FPTA 2AXNA 1TEXA 3FMIA 1DPFA 4DDVA 3BS4A 2V4ZA 2L52A 2AKAB 2GK6A 1M34E 3S1AB 3I62A 2F3RA 4RD1A 5DHFA 1RRPA 3HVZA 5B2ZA 3T1VA 2WBLC 5FOTA 5DIFA 4G5OA 3CNOA 2IYWA 5KTYA 4Q03A 4FCVA 4MYHA 2Z43A 5IDVA 1VDVA 4UJ5A 4JBXA 2G1KA 1IY1A 4TT3A 2H8KA 1KMHA 5CYOA 4TL8A 4BECA 1HY3A 4BASA 2H89B 3H84A 4NYJR 4JWSC 3NVWA 1YQ3B 4C4PA 2BKUA 2C03A 4BEBA 4M9ZA 4P3YA 2W3SA 4L15A 1FUKA 4HRSA 3LVRE 5SZKB 3UG7A 2NO1A 4DCSA 1KY2A 4Q4JB 5TB5A 4QL3A 2FFAA 2QAGB 2C04A 2VL7A 4XH9B 3I5XA 4KX6B 2JLWA 3NVAA 5FPYA 4DCUA 2AHOA 1ZC4A 2Z6VA 1FPMA 3ND8A 3QKSB 2V7QA 4O2RA 4Q21A 4ITKA 4V0MA 2C96A 2FSFA 3TVTA 4ERNA 2J0QA 4HYYA 4KBGA 4Q00A 3CX7A 5F98A 2REBA 3SYKA 3SJZA 2GBLC 4Q1AA 2IYVA 4IHQA 4QC2A 3ZJYA 1XTSA 2F9MA 1E32A 3P27A 4FI3C 1Z0DA 3MJHA 5H92C 2HJVA 3AEAB 2CLSA 1KNQA 1MOZA 2IYLD 3B1YA 3QY0A 1KRHA 1F2TA 2D7CA 1XTKA 1D2MA 1HE8B 2CHGA 1GTVA 5LDDC 4HZUB 2L83A 1UBCA 4B75A 3WXMA 2OT3B 5AJVB 4CYMA 2XSZA 4IOMA 2CJNA 2BC9A 1JAIA 1E79A 1XJQA 2R6FA 4PC1A 3FFBA 1NLZA 2ZJAA 4JT2A 3GMTA 1J8MF 2VRWA 1QHYA 3VQTA 2ZI4A 4GMXA 2VP9A 2ZRCA 2J3EA 3U6KA 4HROA 4KFUA 2CHQA 4Q19A 4B3CA 1IBRA 3PENA 4TL9A 1WQ1R 2WICA 4JL8A 3CLVA 4LBZA 4HLUC 3GQBA 1VYVA 1FOEB 1W5SA 5BYKA 2PKOA 2JLQA 3AM1A 2VHJA 1ZCAA 3Q72A 2ONJA 1MR3F 3A36A 3AUYA 1E1QA 1QVRA 1S96A 4Q1FA 3NEJA 3PXGA 2XEXA 2PT7A 1KDOA 3U4QB 4NCKA 4CEHA 1U0JA 2IK8A 4C2UA 4ARZB 2WDRB 5FI0B 1ODFA 3AE4B 3PFIA 1SULA 4QHTA 1D2NA 1R5BA 4PHGA 1CF4A 2QPOA 1RC8A 1KZGB 4IDIA 1ZM2A 5JFGA 1W36C 1JWBD 1KYIA 3L0OA 4R2IA 2ZRKA 3RSLA 3CPJB 4GDFA 1TX4B 1LF0A 3IHWA 1IN7A 4B74A 1Z2AA 2WMOB 4MKHA 3ICEA 4BRWA 3THXB 2QA5A 3TW8B 3A4MA 3T35A 2XXAA 4XSGA 3C16C 4LHWA 4CRWB 1ZP6A 2ZRNA 1RW4A 1CJMA 1QHNA 3EG5A 4JBWA 3ZVLA 1Q3TA 3VR9B 4PSAA 2ZYVX 2ZUBA 2C99A 4BLQA 5L3QA 3LXRA 5EZ5A 2G77B 4A6PA 1H8EA 1IN6A 4US2R 5KNCA 1ZUNB 1E2QA 1NIJA 3W9YA 2B7CA 1A7JA 4PPNA 1E2IA 2A5JA 3KJHA 1EXMA 1L8QA 1LNZA 3K9LA 4U02A 4BFVA 3GLIE 1PLKA 2JLUA 5SZHB 4GZLA 1J7CA 1WRIA 3NRZA 1XEXA 4C0AC 1Z2CA 1ZYUA 1ZNYA 3TSWA 1SXJD 2HF9A 2R6AA 1DBSA 3CNLA 1GAJA 3K0EA 1OIXA 3OE7D 4A15A 1IUEA 1G8YA 2W54A 4WXRA 4P4SA 1S2MA 1N5KA 3WMGA 3HDTA 2EFCB 5HZHA 1LW7A 4C0LA 1E4VA 3KJEA 1R8SA 5G3ZA 5H70A 3RRZA 5C4MA 2BCGY 4TYQA 4CVNA 4A8JA 1AQUA 1WWTA 2OLKA 4NL4H 2C5LA 4F4CA 4BFTA 1RRFA 2QIEB 3W5UB 1VYUA 5CDFA 1E2MA 4YTNB 2ZI3A 4FD2A 1V5WA 4OYHA 4XSHA 1IQPA 2JDIA 5A0FA 2DR3A 3AUXA 3SBDA 4XVRA 3AQ4A 4F4IA 1AM4D 1HQCA 3BIID 3EUB2 1CBUA 1YZNA 1GNQA 3I3SR 3A1SA 2XGJA 3KQKA 3L0PA 1OXUA 1X8KA 2SHKA 5EE1A 2MJ3A 2ZJ5A 3CB4A 3QEOA 4Q4AB 4CGZA 1E9EA 1NP6A 2IUUA 4OQNA 3BWDD 1GG2A 1Q12A 4HZIA 3ZZ0A 4F93B 2QL6A 1Z29A 1QOAA 4NKRA 4Q47A 3U2QA 1R8QA 1W0JD 2CLCX 3AECB 4JZKA 3WNDA 4CEJB 3BB3A 3W34A 1OF1A 3A1VA 5AJZA 4TZ6A 1QOFA 5DE3A 5C1BA 3SJAA 1G8GA 4Q1DA 1TU3A 1KJYA 2GF9A 4Q4HA 4G5QA 2EW1A 3AKEA 2WDVB 4LYAA 3P26A 3Q7PA 3P4QB 2CL6X 1OPXA 2V6IA 1NYRA 5J40A 1ESNA 2ZE8A 4Q4JA 1KK2A 3AE9B 2B7BA 4JLKA 1U0LA 4P4TA 4I99A 1U8AA 3KUDA 2RH5A 1XBTA 4OL0A 4DLRA 5CM9C 3CWZA 2O0JA 4Z51A 2GRJA 3EZ7A 5EXXA 2JJ2A 3WRYC 4E22A 2WMNB 2Z83A 5TARA 3B8HA 3B9QA 1DG3A 1RYFA 4QGAA 1E0KA 1QZXA 2LKDA 1FQJA 4G01B 4I4LA 1AKEA 1MO4A 3VRAB 3AVTA 4QBHA 4PFSA 1T0JB 1RZ3A 2J59A 4Q48A 2WSMA 4D4JA 3SOPA 1TTTA 2F7SA 4WBSA 4RSGA 4M4SA 4CT5A 4WA7A 4C80A 5JCPA 4LJYA 1LTQA 4BZQA 4NONA 3QG5A 4XD7D 1JXMA 1EX7A 1GVNB 3IIMA 4HB2A 4Q9LA 1KAOA 2I1VB 4DDUA 3GP8A 1HT2E 1P75A 2FA9A 2RKOA 2GETA 3VFDA 3LO5A 3UKDA 4TQ9A 1VHLA 4JLMA 4TLCA 4Y0VA 5D3MB 4M1OA 3UWKA 3EX7C 3R8FA 3DZDA 1A2KC 3MD0A 3U3OA 2QP9X 2VHQA 2FN4A 4RY2A 1R5NA 1NVID 2ZITA 3A8TA 1Z8FA 2P6RA 4RD0A 4O3MA 2WHXA 5CIWA 1Z22A 1ZU5A 3QF4B 1RPZA 3WYFA 3ASYA 2GCOB 4AI6A 3BXZA 5DLQC 2GVZC 2OG2A 2CK3D 2P5SA 2ODEA 2BMJA 2VO1A 2P67A 3B9PA 4ARZA 1DTSA 2REOA 4CT4B 5FR1A 2GILA 1DE0A 2FV8A 821PA 2HXYA 2OUKA 4JBYA 5JS8A 2AWNA 1XCGB 2B8WA 2VHUA 4HAVA 2VP2A 5EE9A 1I4LD 1ZD8A 5AJWA 6Q21A 2ZJ8A 4HAYA 4DCTA 2YWFA 4KV9A 4HUTA 1KDRA 1RVDA 2ZS9A 1E9DA 2ZU0C 4PC6A 1U9IC 4URVR 4BGDA 3TH5A 5K8TA 1KFYB 1HQYE 4B34A 4LBVA 2IW3A 2JJ1D 2WIBA 3IHLA 3V4FA 1GRQA 3L0SA 2R6CA 1MH1A 3L82B 2ANCA 5J4VA 4OK5A 3B2FA 2F43B 3ND9A 3W9CB 1SVOA 4AKGA 4NE2A 3MGCA 1OXTA 1T0HB 3PUVA 3P4RB 1ZNWA 4NH0A 5CK4A 2OHFA 5CYPA 3U3KA 2FPLA 2YJTD 4DUGA 2M19A 3OIUA 4PX9A 4II7A 4ZO4A 2KI5A 4OHXA 3BH6A 3CF6R 3E70C 4V0ME 5E7IA 5GJCA 4EPWA 1S1CA 1ZNZA 3KKNA 2QT1A 2Z0MA 1Z28A 3GLHB 2IC5A 3PUZA 5KO2A 1N62A 4URZR 2PVGC 1D9XA 1KKLA 1F6BA 2O8EB 1NG1A 1TAGA 4WW0A 4QRHA 4TQAA 5AWFC 4GNKA 3P4YA 2ZRDA 1UPTA 4NP6A 4EPRA 1SVLA 4LYJA 4LBWA 2N46A 1XO3A 1W4RA 3LA6A 4B3DA 1G7CA 3EARA 4HAXA 2C9CA 3GEEA 1JJVA 4QBFA 1NYQA 3FFAA 3I61A 2YV5A 4J0QA 4BPBA 3SYNA 1GKIA 4QJ5A 4URXR 3FTQA 1CRQA 1AYFA 2BBSA 2MSEB 3MG9A 1J2JA 2NMVA 1G41A 3LBNA 4US0R 3GLFB 3OF5A 4DLZA 3BAFA 2GDJA 4KO8A 2A3RA 1OV4A 2K22A 2JLVA 2QP4A 2YWEA 4P31A 5BN3A 1DAGA 1NVUQ 1TF2A 1KSGA 4A0GA 1SVWA 2OZEA 1TPZA 2OV2A 2QNRA 3FGNA 4TT3D 3VR3A 3VKHA 2QG6A 5KNDA 1AGRA 1YR8A 2Q3FA 1ZUD2 3QBTA 3ZYCA 4OI0A 2VHCA 3AEDB 1M74A 5FUXA 3M6AA 1GL7A 3EWAA 2C9OA 3L4PA 3L8ZA 1SKQA 4AYXA 5CJPA 3AE6B 3ZDQA 3K9GA 2ZI6A 5GJBA 4DIEA 4Z1MA 1QG2A 3O8RA 4WWMA 5GXGB 1TJEA 5JCZA 3A37A 4TSFA 4DB4A 3W8NA 3OIYA 4FINA 3DHWC 3HR8A 4MRPA 4PO8A 1RIFA 1XD2A 2YVUA 2JJ8A 3UIEA 5AUKA 4OKSA 4PR0A 4FMDB 1MV5A 3A1UA 1JPJA 4MUAA 5GJVC 1MABB 1G3IA 1M2OB 5JHGB 1T3SA 2NTYC 2CNWA 3REFA 1NSFA 2IUTA 2J5XA 4B71A 2ZI7A 1IJEA 2PEYA 3I73A 3C5HA 4YXWA 4LDJA 1L0VB 4QGFA 2GJ8A 3NBFA 2P5TB 4LWZA 5JZVA 1G4AE 3IBGA 3M4YA 3A1WA 5IRCD 2XSZD 1WF3A 4FMCB 1E79D 2WWXA 1T9HA 4LJ9A 1W44A 3BJIC 2Y5CA 2DB3A 3GLGB 1JEEA 3B5JA 1G7TA 2A5YB 4JSTA 1PUIA 5J4HA 4FWIB 2JA1A 3C15C 5K8UA 4EFLA 3LXFA 4OHVA 5TDHA 3LRPA 2OM2A 4U5XA 1NEKB 3CWIA 2VYFA 3SS8A 5JHHB 2D4HA 2OXCA 1MRNA 4H1UA 1X1RA 4LHZA 4C0QC 4KYIB 1Z08A 4M21A 3QKRB 3W6PA 4AKIA 4JT4A 3N2EA 1CR4A 5D3MA 4YQFA 2JLZA 5DNYB 2GK7A 2ZRJA 2R65A 5FPSA 3ZH9B 5L3SB 3IEVA 2K9XA 5KHOC 2ZE7A 3AKYA 1Z0JA 2W83A 4AY2A 4AD8A 3GJ7A 1BYUA 1G5RA 4C30A 1W5TA 5DYGA 2CBZA 3PIRA 1GDDA 1WGKA 2JLSA 3CIRB 2ZRAA 3AM9A 1XTJA 1X1SA 1H65A 3RANA 1NVWQ 1HUQA 3SDZA 3J81k 4OJKA 1CJEA 3F0TA 1E1RA 3QF4A 1MRSA 3K0AB 1RWSA 2ZYUX 5CDFE 4RVCA 5L3RA 1E2FA 1GL9B 4A4DA 2XB2A 5TMPA 4TYYA 1KI4A 1VG1A 2WIAA 3AF1A 1G3MA 1JRPA 3CW2A 1GUAA 2NPIA 4PQRA 1KSHA 2BT6A 2YZ2A 3LX8A 3QPWA 3AVXA 4Q9IA 2ATVA 1XLOA 3ONWA 3R20A 1S3SA 1ROEA 4RD3A 521PA 3QIAA 4ZCIA 3THYA 2FZLA 4AKHA 5AK0A 3HJNA 3EPHA 4TYNA 4IJMA 1OFHA 1SF0A 1F48A 4LJ5A 5KSPA 2Z5FA 2CHVA 2IF2A 4QOSA 2H17A 1UAAA 1ONBA 2O0HA 4LC1A 3VR6A 2HYIC 1EFTA 4D0GA 2ASEA 2WJGA 1SVMA 1HE1C 1FX0A 4TLEA 1PV4A 3TRFA 1IOZA 1H8ED 3H1TA 5L8VA 1L5PA 5EP4A 3AVYA 4JJKA 4X8LA 3Q9LA 3B2GA 4JVNA 3LX5A 3GCGA 4MQBA 3ZVNA 4C7OA 3QXCA 2GJ9A 3SU8A 1HYQA 2BVNA 2JASA 4F4JA 2F43A 1Z6TA 1HT1E 2GZAA 1WE2A 2OCYC 5FR2A 3L8YA 1LB1B 2D2EA 1JQJC 2Q21A 1OQRA 2JX5A 2WJJA 3P32A 1CR2A 2VP6A 4D25A 2YYZA 2WJHA 5FOWA 1OH7A 2WKRA 4URYR 1FZQA 3RS5A 4NCIA 4DHEA 4LZZA 3FKSD 4ZHOA 1O87A 3EC2A 4RFVA 2PVOD 4ZIRB 2VA8A 2B6HA 3EPKA 3DOEA 2H5EA 2IWHA 2ZRLA 1AZSC 1KKMA 2XNSA 3DM9B 3F8TA 2V6JA 3MFYA 2X2EA 4K81B 3AP2A 2YOHA 2ZI9A 2R62A 4QG7A 1DEKA 4NYIQ 4JVSB 3GPLA 1U0HC 1FMJA 2FGJA 2W00A 3T15A 5EE3A 3ZVRA 4YT0B 4A82A 4C0HA 2BJVA 4BUJA 1RRCA 2ORVA 2JDID 5HR5A 3NBYC 1K5GA 2JGNA 3IEUA 4R71A 4JLBA 4D0LB 4I1OA 2O5VA 2FU5C 3LLMA 1TQ4A 1XDBA 4FMCF 3EZ2A 4GOJA 4IVPA 1NY5A 3U60B 1M7BA 2GJSA 3AN1A 4DT1B 1TL7C 4DLWA 4WIAA 3DMDA 2QAGC 2IWRA 3GLFA 1PFDA 1XJCA 2YWGA 4Q7JB 4BFWA 3ADKA 2ZIAA 3O8DA 3VKGA 4MUBA 3IPYA 5IF9A 4EKDA 2ZRMA 3BERA 5LD2B 1W47A 2FDCA 4MH0R 3KB2A 4C2TA 4HAZA 4DSTA 1N60A 2QORA 2PT5A 4JYBA 2EU8A 4B3FX 2FOLA 2HUPA 4JLDA 2NO9A 2ZJYA 4QFMA 4C0BA 5B64A 1E2JA 2FFQA 3LBHA 3TVDA 2OILA 2HXSA 1EFUA 1CP2A 1JQ4A 4MYUA 3B85A 4M0LA 1G19A 2QU8A 4N59A 3DWMA 1W2GA 4NYMQ 1NF3A 1U9IA 1RYJA 3WCQA 1OJLA 1SHKA 1YHNA 3NIBA 2Q0HA 3LH5A 2DFNA 4TMKA 2FF7A 1X3SA 4DSOA 1TUEA 4UQOA 1D2EA 1EFHA 2JJ2D 2H92A 4Q02A 2A2ZA 2RGXA 1Q21A 3EZ9A 4URUR 4DDWA 4TYWA 1XPUA 1UEJA 221PA 4OBEA 2FGKA 2KSQA 4MITA 2ZPTX 3CKLA 1P9WA 4FXCA 1MABA 4KFSA 4LHYA 4ZCMA 3E2IA 2H7VA 1RKBA 2RHDA 2UZ3A 3WBJA 1JR3A 1L7VC 2AFHE 2BEKA 1UBGA 2RGBA 1P2TA 3SQWA 1Z5ZA 3R9WA 3LW8A 3HU1A 3VMFA 4BFUA 5FPKA 2UKDA 1RJ9B 4BRUA 1P72A 3K0FA 1KI9A 5J4LA 3RWMB 4RCZA 1KO7A 3C7KA 3NBZC 4EJSB 4B48A 3HYTA 3SN6A 2NOAA 3SEAA 1N6OA 1NKTA 4FXPA 4YDHB 1YJJA 1BMFA 4DB2A 3W6OA 1OE0A 4A2WA 3ADBA 4IFBA 1YRAA 4O0MA 1EK0A 3EZFA 3EIQA 4IDQA 3R9XA 1WYGA 621PA 1E99A 2WDQB 2QRNA 3TIFA 3Q85A 4LI0A 3ZGXA 4PO9A 1AS3A 2CL7X 2FNAA 2AFIE 2FPMA 1U99A 2XX3A 4RFSB 1CRPA 2ODWA 1XEWX 3K8YA 2ZS8A 1RE0A 3UATA 1E9BA 5FPHA 3G5UA 1YZTA 2OCBA 4NYJQ 1QOGA 2GXSA 2WU2B 2IXGA 1OT3A 2J0UB 4DIDA 2G88A 2HDNB 5KPJA 4LJ6A 3O8CA 5KDLA 1GL6A 3AH7A 3TAHA 4U7DA 1XU4A 2OCAA 4D2IA 2J7PA 2VF8A 5D3QA 5LPNA 4ZKDA 3AF2A 4XVUA 5G3YA 1Z3IX 2W0MA 3BOSA 2QBYB 3FMFA 4XJXA 2V3CC 3QE0A 2L0XA 1G64A 1LV7A 3N70A 3SJCA 1BOFA 1SB3C 4DCNA 2JCSA 3NC1C 1Q22A 2F1JA 1U94A 4HUQB 3FAHA 3WMFA 4I1VA 2RGGA 4R9UC 2PCLA 3JVVA 1XXHE 1TKEA 3DDCA 1IJFA 3U44B 5M04A 5FUYA 4DC9A 4DUGD 4LJ7A 2D74A 4QJ3A 4JSYA 3K70D 3H4MA 3I4LA 2N0SB 1W49A 1N63A 2J9RA 2PZFA 3LY5A 4A92A 5AUQA 4NTZA 2FH5B 1YZGA 4LY6A 2NO7A 4V0NA 4BFXA 3MRSA 2BCJQ 4D82A 1PDXA 2BWJA 2ZRGA 2DYKA 1WP9A 4YMVA 4TL7A 4TTPA 2O8CB 5E7MA 1FFUA 1XMJA 2KE5A 1KNXA 1Z06A 3GFOA 1GKYA 1NRJB 1ZD1A 2PEZA 2X8AA 3IBYA 3NTUA 1S9HA 3CX6A 4G1UC 3FPAA 2IHBA 1F2UB 3BFVA 4ESHA 3AVVA 1OLOA 4XTCS 1E0JA 2W6ID 3RS0A 4EQ6B 3GFPA 2NZ8A 1UDWA 5FTJA 2W2TA 1W2HA 3EWSA 4PQFA 2WLBA 3PUYA 1NY6A 2F6RA 3QJYA 3DOFA 4B73A 4BWYA 4CIDA 4WZ6A 2E9SA 2IBMA 5BW8A 1NVVR 3LD9A 2QUZA 2KB0A 5JRJA 1XLPA 2E87A 1KI6B 3MJRA 5JS7A 5JJLA 4AYWA 2ERXA 2WWIA 3U61B 4PHHA 3ZQJA 2XZPA 2R2AA 3EIHA 2IEYA 4KSCA 1P61B 1UADA 5E95A 4N1AA 3WP0A 2RGDA 1W36D 2AK3A 4BFZA 2QMOA 4HDQB 3Q8XB 2V1XA 1ZM9A 2VPPA 3C41J 4RJLA 2VP0A 4ACAA 2XJ4A 5BN4A 4D81A 3W90A 1N0VC 1QHGA 2OBMA 1R7RA 1G5TA 2ZU6A 3X1WA 1IN4A 3DKVA 5JWOA 1S8FA 2C95A 4HEJA 1BO6A 4TWZA 4Z1MD 5JSZA 4MDFA 1X86B 3OFNA 4P32A 2MJDA 5FL7D 4TSFD 1Q44A 1Q1EA 2HLDA 2PL3A 2WSSD 3T06B 3DKPA 3H2YA 4KLZA 1EFCA 4Q01A 1H8HA 3OEEA 2RCNA 5JWHA 4Z54A 5LB4A 5FH9A 2FMXA 1JWAD 3CM0A 3A58B 1P3JA 2MMCA 2ZSBA 5CM8B 1JBKA 5F9HA 2AWOA 1NN3A 1OH5A 1IONA 1WMSA 1QBKC 1YZLA 4PPQA 3B1ZA 3AGPA 2CNWD 4JVLA 4CEIA 4GP6A 2GNOA 4YXWD 4XTRA 2J45A 1NLFA 1XTRA 1TKGA 2R44A 2ZRHA 1C9KA 2UZIR 1E2NA 4ON9A 1VG8A 1ZNXA 2ANBA 3Q5DA 2ZREA 2WP9B 2D62A 4IFEA 4V02A 2JATA 1S0UA 1J7BA 3Q3JB 5EJEA 1G1MA 1UBFA 1CR0A 1CR1A 5LBIA 3CH5A 2W3RA 3SHFA 1QHSA 3RS2A 4JL6A 1NLYA 3SFDB 4TLAA 3S1AA 4G5RA 3TUJC 3TUIC 3QKUA 3CWQA 3GLHE 1CJKC 4KFTA 1EESA 5FUWA 3QVVA 1KZ7B 4AG5A 1E9MA 4OHWA 1ZM4A 1XXHB 1KF6B 3AEZA 2HV8A 3VNVA 2QI9C 4R2HA 2IS6A 1ZRHA 4YTPB 3PQCA 4RD4A 2GJAA 1XCMA 3KKOA 5BWMA 2YHSA 3RNLA 5B58C 5JEEA 1FTSA 1E1RD 2ZANA 1VCMA 4JL5A 3CRQA 3T5DA 1KI3A 5C18A 3TAUA 2JLRA 3ZYYX 5DO9A 5EE0A 2GXQA 1IXZA 2QAGA 3EXAA 4KJZA 1FNMA 2BDTA 5HCNA 3VAAA 2GEVA 4B2IA 2W2XA 2LWIA 1DADA 3TSOA 3VR5A 4NPHA 4JLNA 4ZI3A 3GLFE 3QKSA 3QSYA 4N58A 1P62B 2B8TA 2IYRA 3ETLA 4AKEA 3U7FB 1GSIA 2QJLA 2Z4RA 3HU2A 3FOZA 2BKEA 1ZAKA 2EKIA 1YQTA 3AV0B 3LV8A 3NKVA 3OESA 3RWOA 4Q4LA 1SXJB 1GOTA 1Q1QA 1FMAD 3DWGC 3I72A 2QP3A 1NN5A 1U81A 4OI1A 3KX2A 5H1YA 1JJ7A 1II0A 2C98A 3OIWA 2QE7D 2J87A 3B1WA 1J99A 4RZ3A 1G5PA 4HZUA 2C77A 4DLVA 3K9HA 1PLJA 1Q57A 2ERYA 4HUQA 2H88B 4IRUB 3I5YA 3PJRA 1N5XA 1P7CA 1WB9A 1PJRA 2DPXA 1TF7A 3LVQE 4DDTA 3VX3A 2WPDA 1D8TA 1R2QA 1VHTA 4LJ8A 3UMSA 4AK9A 5AUNB 2IS2A 3JVUA 3RPFC 5G5GA 3SFEB 1P2VA 4EDHA 1IN5A 2W6JA 4US1R 1T6NA 1WA5A 4GOKA 3QKTA 1PUJA 4WAUA 4QNMA 1W46A 3QPUA 5B57C 1FW6A 5GJWC 4C0KA 1FQKA 1NENB 1YVDA 1A5TA 1NNEA 5CJ2A 3MCAA 3UXMA 5F3WB 1II8B 4LGMA 1HV8A 4DKXA 1GZSA 2OCPA 4F7WA 2J7KA 3U4QA 1JR3E 4Q9KA 1E9FA 3WBKA 4M9SA 2J0VA 1E2PA 5FOUA 4D80A 3BB1A 4LHVA 4M8NE 3V9PA 1BS1A 3BORA 4DXAA 1SZPA 3W3AA 4B47A 1PVOA 2WOOA 5H8WA 4DLTA 2GHIA 2CJOA 1L6VA 5FFMA 4EQ6A 3GLGE 4D26A 2QMHA 2XTZA 4GMDA 4GPTA 1MKYA 3PCRB 1TNDA 3CNNA 3ECCA 3GJ6A 5C4GB 4M1SA 4JIMA 1GRNA 5K8IA 3ASZA 3B60A 1OB2A 3THXA 2VTKA 3NS1A 2ZJBA 1CXZA 2GESA 2GTPA 4PAOA 4Q7LA 4M22A 1KY3A 3B1VA 3NEYA 2IT1A 1KIMA 4DEXA 3B6EA 1O3YA 2ZJZA 4TN1A 2XNDA 1A1VA 2QTHA 3CIOA 1QLBB 5MPOA 3VR2A 5UKDA 4DLXA 5C2JB 4A2QA 1V43A 5KUTA 3WYGA 3K0SA 3GJ8A 4JLJA 1R4AA 2RGAA 2V54A 4IVQA 2KWIA 1J70A 2BOVA 3UWOA 4XIGS 4OHYA 3SFZA 1UKYA 4JWUC 4ZDWA 4GT1A 4YSYB 2QTFA 4Z8XA 2ZRIA 1Y3AA 4KU4A 3NDPA 3P63A 4X8OA 5C2TB 1F60A 2Q3MA 4IOJA 2AD5A 2O0KA 1XRJA 3CUEF 4YSZB 4PPFA 4DZZA 1VG9B 2FG5A 2ORWA 4M9QA 2D7DA 3VHXA 2GCNA 3K53A 2QEQA 2CJWB 5P21A 3TSZA 1P73A 1CJVC 2HEIA 3QI2A 1ZUHA 1XFAA 4MKFA 4TLBA 1KMQA 2XAUA 2G9NA 1AJEA 1FIQA 1G17A 4HAWA 5FTLA 2ZETA 2BV3A 1GIAA 3HP1A 4PZYA 2CCGA 3AEGB 1BIFA 8OHMA 4GRAA 3EC1A 1YR7A 3W3ZB 2BMDA 3BH7A 3ZIAA 3DPUA 1GFIA 3KXKA 5H8YE 3Q5EA 1MO5A 3L0IB 4UKDA 1D9ZA 2IX3A 4PAQA 3FVQA 4YLGA 2ZVQX 1PUTA 1IXSB 1E2GA 1LY1A 1CZPA 1OYYA 5TV2A 1BMFD 1X8LA 5HPYB 3C8UA 3DVLA 3DEFA 3CRW1 4GP7A 1TQDA 4LCBA 3TBKA 1E10A 1VYTA 3CZQA 1OH8A 3PG5A 4Q4AA 3PEYA 3X2SA 1K8RA 4S2EA 1U2RA 1T3LA 3AE5B 1Z6YA 4TMVA 5FOVA 4JLOA 1S1MA 3HWSA 4CEJA 1I4DD 5KDDA 3KTAB 1W0KA 1XXHA 2GF0A 1FFVA 2P2LA 2PX0A 1VCOA 4JKYA 1DAIA 2CLDX 3U3MA 2ZYTX 4ZI2A 1B9RA 1J8YF 4YMTA 2I3BA 4MRRA 2QSZA 2N1BA 1ZM3A 1M6NA 2V7QD 3N5CA 2VSXA 3RLFA 2O8FB 4MRVA 1R6BX 4E07A 3KDSE 4B6FA 2AX5A 2J7PD 1VECA 5DSZA 5BYJA 1XTQA 2BBTA 5BXQC 2O52A 3FHCB 4LRWA 1IAQA 1Z0AA 1E94E 2WAYA 3RS7A 2B76B 3W5JA 4G5SA 5FOSA 1NMYA 1YR9A 1W1WA 1E69A 1T3HA 4AIIA 1ZCBA 4BFYA 1QDEA 3QPVA 2J0SA 2W55A 1P60A 4LTUA 2K5UA 2KMMA 2ZE5A 4LJAA 3RSOA 3JZMA 4EFMA 1P6XA 2WWHA 1XTIA 3FDIA 2WKPA 3KQLA 4RD6A 1II9A 3AE2B 3E5HA 5JMTA 1GITA 3KZ1E 5JLJA 2VSFA 1YKSA 2C8VA 3B2EA 3C14C 1ZIOA 1EFRA 3PO0A 1HA3A 1OSNA 1NBME 4TL6A 3REGA 3ZQ6A 1E0AA 1U98A 1KSJA 4P4UA 1XF9A 2WAXA 3WHLA 1UKVY 5JBQA 2KBEA 2RAPA 3QF7A 1BYIA 2BMEA 4M1WA 4TQUS 1TF5A 3I8XA 1LFDB 1T8UA 2MJEA 4A2PA 5KOYA 2BMFA 4YMSA 1E1QD 2Q5WD 1S3GA 4M1MA 1AZTA 2FSGA 4Q9HA 4HAUA 1YRBA 1VLBA 3UANA 1KDPA 1N6PA 2CEAA 1ESMA 4BFSA 3V4RA 3A1TA 1T91A 1OXVA 2HJGA 2Q6TA 3NXSA 2X77A 5F2EA 2ZVPX 2CU3A 1EG7A 2QT0A 5EE5B 3BRWD 4PSKA 1FXAA 1DAKA 3UG6A 1SIJA 2H1LA 1KMHB 3BIFA 3D8BA 5JRZA 2GCOA 3WMEA 3WNCA 4KVGA 3L43A 2R6DA 4UXIA 5J5CA 1II8A 3MWKA 3FC4A 1N2CE 2PMKA 5LD2C 3ZS9A 1RFKA 2HF8A 3GJ3A 5KNBA 1W0JA 2O8BB 2QPAA 2ZR0A 5JJIA 5IK2A 3M0EA 3QBVA 3KJGA 3VR8B 4HB0A 2GEUA 5HE9A 1QF6A 3TUZC 1NMXA 4Z8YA 1KI7A 4KODA 4QHSA 4B76A 3RABA 4E5UA 2BS2B 1UDXA 5HCIA 1N5WA 3CRVA 3SYLA 3ZZUA 4IDOA 3UK6A 4K46A 1GNPA 1B0UA 1QT9A 3QENA 5EXPA 3B7GA 4ZPXA 1CJUC 1V97A 3RVBA 2A7QA 4LYHA 3TR0A 3T1TA 1CJTC 1KTVA 2YC4C 4I81A 4BLOA 2GXAA 1NN0A 1D6JA 1Z07A 5CB6A 3U3RA 2QRZA 2CE2X 4GZMA 4LC0A 5B30A 3OFND 3A6PC 2PLFA 1DOYA 1W4AA 4ZOHC 5DYIA 5AR1A 3ICQB 5BN5A 1MO3A 2GEDA 4TMWA 1CULC 5KSYA 2X2FA 1H8HD 1GKUB 1KJWA 2E1RA 1EGAA 2JIZA 3GLHA 5EUMA 4HDCA 3RC3A 5J4KA 4Q1EA 1NKSA 1QHXA 4NHOA 4DVGA 4FMDF 2O8EA 2WKQA 5HTKA 1Q0UA 3QUSA 4EJSC 4JX1C 4IDNA 3KFXA 3NVZA 2CMKA 4LK2A 3MAAC 4P6VF 3LQRA 5FTNA 3SC3A 1F3OA 4EPVA 2WZQA 3AB3A 1XZQA 3TE6A 4EAQA 1G8HA 4C7ZA 5FBVB 1ZP0B 2QAJA 2AR7A 2FJUA 5AJYA 4L8GA 1XX6A 1ZUIA 5FBQB 2AX4A 5TXGA 2RGNC 4CEHB 2IF0A 3GJ4A 4W7SA 2PJRA 2AD1A 3AP3A 4E09A 5HKKA 3ZD7A 1XB2A 1N5LA 1KHTA 2ZUCA 3HPQA 2XOKA 3UMFA 4F91B 3RRMA 3QG1A 4ZHPA 3THWB 3BE4A 1L6UA 1T5LA 3AP1A 3B82A 1SKYB 3BH0A 4QKQA 3RC8A 4TMXA 1YQ4B 1RFLA 5FUVA 3CR8A 1W4CA
chains in the Genus database with same CATH superfamily
4O2AA 3VC3A 5EP1A 2NVUB 4XIJA 4M7WA 1AMOA 1L7BA 3L77A 1Y88A 1PS8A 9GPBA 5IJ0B 4WZBB 5LDGA 5L3QB 1DS6A 3VR5D 3WMRA 5ELXA 3R8CA 2D8AA 1O5OA 3B78A 1JBEA 1HURA 3M5PA 3C39A 4L27A 3EGIA 2FDRA 2R18A 1ZXBA 3TEJA 2OJWA 4BB0A 4U6NA 3MBOA 2CYAA 4YFVA 3UMVA 1WDKA 4K9KA 3OQPA 3HN7A 1UBLS 4TKMA 4YY3B 2OSBA 1XCPA 3OJOA 5AJXA 3VYTB 3LM8A 5LXTA 5EHNA 1IN8A 4F1JA 3OIFA 1DDOA 4MRSA 1OILA 1G59A 2FPKA 3T4EA 4PHTA 2WUGA 3W8EA 4EHHA 3PQ7A 3PUWA 4PANA 2YOFA 4KJXA 4F46A 1JKFA 4YT4A 2KBFA 3ZE1B 3NWPA 4HCNB 3TTTA 1V8CA 4IDGA 2LKCA 4O1IA 3O38A 3HN2A 3H04A 4BX0A 4EMUA 1HUZA 4UHEA 3F6BX 3NR2A 4DLBA 4DBLC 5K6AC 3MS4A 4U7FA 4BNLA 3GEGA 3O8NA 1PT9A 2QV0A 4D3SA 2H5JA 3Q12A 4EZBA 4QFDA 3BDAA 3S55A 1SWWA 1BVUA 2VAWA 4EG0A 2EJBA 1ADFA 1CCWA 1PVQA 4AZWA 3GBPA 2BPCA 3B38A 4US9A 4KK4A 2G5CA 3VOSA 4Q4CA 4JP2A 2AV6A 2FSHA 2J08A 5D5QA 3PGVA 1RZUA 2PX8A 3K1JA 1MT3A 3KKQA 2WM2A 1ONPA 2DKFA 4DQUA 4RKRA 3QOXA 5IT0A 4AUEA 1BDHA 5EZYF 3V00A 4P9NA 2L2QA 4R8RA 3GROA 2F44A 3DM5A 4K9SA 4C06A 2XYQA 3VNUA 1LXCA 4FFBB 3F3YA 3IJ5A 3IO3A 5E3HA 3MAGA 3CXRA 5I7VA 4YONB 5CXUA 3DT9A 4GOMD 4O1NA 1UJ2A 3BJMA 1VRWA 4A36A 4ZYVA 5T8IA 2HTME 3CO5A 3PDUA 1Y9ZA 2GD1O 3JAKA 4OMUA 3ASUA 4U2CA 2DT8A 1YHYA 3FGPA 4AJ4A 2J0MA 2N1MA 3P7MA 4ZARA 4YIKA 3T5GA 1GB1A 1MO6A 1ZKDA 4YI5A 4PSUA 3MTGA 2CT8A 3ZTDA 4OHJA 1JDBC 5IDWA 4ELUA 4G2TA 1E9SA 1TVCA 5J17A 3SZLA 4TMZA 1IZ7A 3FNEA 1VJGA 4FEEA 3DEJA 1R0WA 1P2DA 5ECYA 4BV2A 3AXCA 3ZY4A 1PGNA 1MN6A 1VFPA 3CLRD 3V34A 1RYMA 3Q4GA 3PEWA 4WJLA 2GH1A 3DVSX 2XTMA 1Z0FA 8ICNA 4FI3F 3F73A 5LP6C 3V8QA 4RMGA 4UTPA 4KPUB 1GQOA 1TJ5A 3Q88A 3BQNB 1WGDA 1NK7A 4KXNA 5J47A 3EIUA 3GLIB 1E6UA 4CN8A 4EZEA 3CA8A 2R7KA 5IIMA 3ERCA 3VGJA 1CE8B 3NP7A 1ZU4A 2AQKA 1MJDA 1EWYA 2LD4A 4F5PA 3B52X 4MGIR 3ISJA 3VH1A 4UHDA 1JAXA 4EY7A 2UYCA 4QELA 2NBUA 2HYDA 2F3UA 5JC8A 1LF5A 3TOXA 3WY9A 2W42A 4U0KA 3A28A 1ZXHA 2VAPA 4TQ1A 1Y9AA 2XQIA 3DBRB 3LB8C 2PL5A 1KK3A 4G4SP 1UC9A 1XC7A 3ZD6A 2OESA 2R1TA 3ZDMC 1NJYA 1K6JA 3TMYA 4YR9A 3NEPX 3SI7A 1PJ3A 4GGQA 5G5HA 2INDC 4MW0A 3MSXA 4LHXA 3D7RA 1NM5A 2GAOA 2JLXA 2KS6A 1U6JA 1MIOA 3C4QA 4LI3X 1J7AA 4K5QA 2XQVA 1JKMA 3T7IA 3RIHA 1QQ6A 3O8OB 3W8RA 1Z6AA 2O2SA 4EJFA 1HC7A 3SIWA 4PYIA 9ICVA 5KFWA 1PBTA 1FZTA 3D31A 4REOA 4I55F 4S04A 4AMGA 2JGLA 4MW1A 2QVGA 4A9AA 4X8HA 5BW5A 2CDBA 3RJJA 1XHEA 2WWYA 4F21A 1NUPA 4N8DA 3M4JA 5I9MA 3K1AA 2IUEA 1ZLXA 3DXXA 1FUIA 4I8IA 5DI3A 4L8YA 3QFCA 3G23A 3S4YA 4PVCA 1P0MA 4BMZA 5F51A 1CK4A 1TCVA 4WDQA 2P4HX 1TEHA 3WIDA 2PCJA 1JWUD 3KV3O 3NYWA 4N82A 4H6WA 1T0UA 2HVHA 1Y6ZA 4UCXA 1OFUX 4Y2YA 3ZWWA 1POXA 4ZANA 5TPZD 4LZLA 4X1IB 4EPYA 1CJSA 2VDVE 1ES9A 4J9RA 1FL9A 1OXBB 5CA1F 1XZPA 2A1JB 3WL5A 3AHFA 4H7HA 1NDUA 2OFOA 1IPHA 5EY5B 1YI8A 2JF0A 3UQ2A 4DOMA 3EW9A 4X5OA 4BWFB 1TYEB 1PTKA 3WE7A 2VSOA 1Z16A 2N9XA 3FF4A 1ZOSA 3MUFA 3ZLBA 3FYHA 2G80A 5AKIA 1E3MA 3DWFA 1F20A 4TQRA 2C78A 3EDCA 1J0EA 3E4CA 3UJ6A 4YJ2F 3R3YA 2JLYA 3SHWA 1H2WA 2QG9A 1YS1X 4KLQA 2WM3A 4ND5A 1TMOA 1R0ZA 3DS8A 4KSYA 1BUIC 1R3DA 2F3RA 2OOSA 2WBLC 3UJ7A 1H4QA 4I14A 4PLZA 2NV0A 4IBOA 5KKAA 2H8KA 2WLTA 3GU3A 3FYTA 4CV0A 4R51A 4RPXA 2R66A 1N5DA 2C03A 4HWSA 4DCSA 2C04A 2V97A 3CRXA 3G8AA 1DEOA 2JLWA 2FPGA 1ZC4A 2G4VA 2Q1TA 3GDWA 3F6CA 3TVTA 4QC2A 2JD0A 1J00A 4W7IA 5HBGA 3JALA 3BWCA 3G8BA 2V7BA 1RJEA 4J0FA 4ZRMA 3SVLA 3IKLA 1QR2A 1JAYA 2OWDA 4EEKA 3BILA 3I6BA 2ZI4A 2ZRCA 3U6KA 1X70A 3EHDA 4ER7A 3TUOA 4HLUC 4U8GA 3VAZA 1M2EA 2Q99A 3FCXA 3RVPA 2H7XA 4FN2A 4IR7A 1ML4A 3JSVB 5IAJA 3ED1A 2B8JA 1E89A 4KXVA 3T8YA 3C48A 1CZOA 3M95A 2FVXA 3T35A 5T6MA 1ZQJA 3IYLW 2ZRNA 1BFKA 1CJMA 1UWXA 3MC0B 4BLQA 2G77B 2LV8A 1H85A 4RQNA 4IF4A 3MGIA 3TJMA 4G8BA 4J6FA 1MHHE 1N3LA 3IDZA 1WRIA 2GHTA 1ECWA 3TSWA 4V3CA 1VJTA 3B3FA 2XGPA 2LE0A 2EG5A 2JFOA 2G8NA 2GPWA 5HZHA 1LW7A 2NQ8A 1QRDA 4TXJA 4DADA 1QILA 2Q3CA 1P8AA 1EAMA 5A0FA 7REQA 4B5KA 3MERA 2YUTA 1HQCA 1DAPA 1TAUA 2JCYA 4QWWA 3H5AA 1R8YA 1JDPA 2R97A 3CCFA 3KB6A 4JZKA 4LDPA 3ENVA 3BB3A 4EY5A 1E66A 1WBJB 3R41A 1N8NA 1RKXA 3Q7PA 4QZDA 2ZQZA 4MVXA 5HP4A 1H9AA 4H6XA 4HGNA 2KVRA 4LJOB 1U3DA 4DDKA 2O0JA 4E22A 3GA5A 2C3PA 2GB1A 4RAQA 3FCSB 1AKEA 1PKXA 1CUAA 4BUZA 3SOPA 4RSGA 4CT5A 5G0VA 1PUXA 4RY0A 2RKOA 3VFDA 4AWJA 3LO5A 2SKDA 4MWBA 4TRRA 1GV1A 4HJGE 2GBIA 1CUHA 2ZPUA 1EF5A 4LCJA 4AM8A 1Z22A 3F3KA 3IPLA 4J1SA 5DLQC 1JYSA 3B9PA 4CDNA 4O4HF 5KG3A 2JXJA 4K6HA 5JUWA 4JBYA 1B41A 5IM5A 2RHTA 5TQ2A 4ZI7A 1JEJA 2BISA 3C45A 4Q34A 2J8ZA 3L82B 3VKFA 3G0OA 3Q1LA 4AKGA 1MC1A 4CLHA 4Y6GB 4KIKA 3BWYA 4MS4A 4EPWA 4MUYA 4MDHA 4X71A 4UTRA 3RSZA 4TQAA 4YRTA 2RAFA 4U7GA 3IXQA 3OTQA 3MR6A 2XUFA 4YWHA 4HAXA 1PYWD 1J8QA 1NQ5A 5C9ZA 1CRQA 3AR6A 2L00B 1H2BA 4DLZA 1N5OX 1HT0A 2KMDA 5HMMA 3I9NA 3STHA 2X41A 4IY1A 5HEKA 4ECEA 3R7FA 2OZEA 1NJZA 2QRVB 3B2QA 3T5PA 2KMCA 5KNDA 1YR8A 4OI0A 1KYZA 3SXPA 1MTZA 3SHOA 4UPEA 1O8BA 3U4IA 1JILA 3O8RA 3C3WA 4PO8A 4Q7QA 1YD7A 3ZCXA 4K88A 4BAGA 2C59A 3PFFA 1M2OB 2O4CA 2X3YA 3M49A 4DJAA 2YMMA 4YXWA 1L6IA 2HHQA 5DQIA 3A1WA 3INNA 4L4ZA 1ZR4A 1PFVA 3GLVA 2FMPA 2KW5A 3BHIA 4XFKA 1GL3A 1TTQB 2GJ4A 4XD2A 1U3CA 1RJDA 1K8XB 1M2FA 1WX8A 3W6PA 1CR4A 2QW0X 4A73A 4KIUA 5DNYB 3L41A 2R65A 3WWPA 3PC3A 1QU3A 4AY2A 4HXDA 1G5RA 2CBZA 3D4PA 3W4JA 5AI5A 1C7IA 2ZYUX 1CUUA 3FW1A 1NF2A 4YG2A 3QPWA 2IV3A 5JCJA 5HHHA 3ONWA 3EPHA 4B9VA 3DMTC 4MV1A 3N74A 2WJGA 5KNCD 2ZWIA 3L17A 3KOYA 1I1QB 2PKYX 1T35A 4B7XA 1WE2A 2Q21A 4EUHA 2X4DA 4OJ5A 3VJRA 1TT7A 1BN6A 1GSOA 3DOEA 3PNMA 2CL5A 2CNBA 1JDJA 1KJJA 1K7EB 1M0SA 4ZAFA 4XFDA 3IEUA 1TQ4A 4F0JA 4RLQA 3EZ2A 3LYUA 2R6R1 1A9RA 1RWMA 1AKVA 2ZIAA 4EKDA 4GQBA 1X7YA 4KEAA 3BERA 3G85A 4KPGA 4MH0R 4ENPA 4X20B 2D8MA 2PT5A 1RYEA 2P1RA 4DFMA 4WE3A 1PJ4A 4P4NA 4DFDA 2FF7A 2G0AA 2EQ5A 3ONSA 3JW8A 1GZVA 4I9NA 3KCQA 3CKLA 4LHYA 2Q5EA 1YVUA 1H2RS 5J0UA 4JEHA 3EVTA 2DCMA 3RG2A 2IW1A 2CNDA 1WM1A 4BRUA 5SY9A 1Z5GA 3NBZC 1HE2A 2KIVA 3HYTA 3FZQA 1X2BA 1JEQB 5GGXA 5I9IA 3KHGA 1D9DA 2RHGB 4PG8A 1Q17A 3JQQA 4O0IA 2CL7X 3FTEA 3VPHA 1RMYA 1P5FA 3UATA 3G5UA 1YI1A 1VBNA 1LBIA 4OP3A 2PS3A 2QARB 3ZXVA 1PR1A 2H2FA 3TZBA 2YRFA 1YTUA 3GBSA 2PWPA 3WR5A 2L0XA 5HJ7A 2JCSA 2Z8XA 3NC1C 3QVMA 4IX9A 4HUQB 4KLEA 3AR2A 2H52A 3JARA 1QIJA 2J9RA 3LY5A 1X94A 4P3OA 4XA5A 4RGNA 4EP1A 2JHGA 2PFQA 1XMXA 4EBCA 3N6VA 2X9LA 3EE6A 3NTUA 4NM2A 3AVVA 3KZVA 2PA3A 4UQGA 1JLLA 3PUYA 1NY6A 3RB4A 3O8QB 3IEIA 3WTBA 4AAYA 5DLFA 1I0IA 4Q3NA 2XVTA 1Y8RB 5T67A 2R2AA 1P61B 1B4FA 1JXEA 2DBQA 2ILVA 2PAFA 2MINA 5BRJA 2H63A 4HPPA 4FOPA 3W5DA 1VHWA 3RUHA 3R09A 4ZMBA 1Q0TA 4ZJPA 4W5NA 2JGMA 2EDUA 4XSVA 2XECA 2IO3B 2BPSA 4R2WA 2EFYA 4O3FA 4HLEA 3IQEA 1XCJA 2VJAA 2TS1A 2ZXEA 3SPXA 1W5EA 1E1KA 3NTOA 4WFJA 2KVZA 4XQEA 1VG8A 1SU6A 1UP6A 2JATA 1J7BA 3MWDA 4C5CA 1NK0A 1N9KA 3BIWA 4QSMA 3SHFA 1LD3A 2Z2KA 3SFDB 1X7XA 3VSEA 4GIBA 4M3NA 3QVVA 5TGTA 3NUHB 1TAQA 2GJAA 1V2YA 2XUGA 3GLSA 3FCYA 1E1RD 2J5KA 3OZGA 1I7DA 2PZAA 1ETHA 2X1LA 1G0NA 1P98A 4OJLA 1BRTA 3SYMA 3DB2A 3VAAA 1PNVA 2CD7A 2O05A 2R8OA 3NIDB 1HE4A 4NQZA 1EXDA 1UR5A 4PFQA 1H4VB 2R47A 4LDTD 4XDYA 1II0A 3MOSA 4PHPA 3B1WA 1J99A 4BZAA 2HRCA 3IVFA 2H2GA 3S1SA 3DCGA 4OHOA 4RHTA 1TQ8A 5FA6A 1ZN8A 3SAJA 2XT0A 2VT2A 4EL0A 1FW6A 4F1WA 4A91A 2IGGA 4LGMA 3PGKA 2A59A 2ZYSA 4R1LA 2J0VA 4N48A 2ZVNA 2R85A 1YT5A 4DLTA 1KSPA 1Z2MA 4GMDA 5LSAA 2IXAA 1KQFA 4M1SA 2JLCA 3WDLA 3JTMA 3S8MA 1TB4A 1LRLA 3GVPA 4K05A 5JAQA 2BPOA 4E32A 2F62A 1D2AA 2VXBA 5MPOA 1YOVB 2Y9UA 1ULZA 2VFAA 1YD8U 3PQFA 5EWJA 1XVTA 5BN5B 1KFKB 4QFBA 2FI1A 1ZJJA 4ZDWA 4Z8XA 2ZRIA 3FR8A 2DG2A 5LBTA 4Z3OA 3FUXA 3O2NA 3COPA 1NR5A 3F9CA 3ST7A 1ESZA 4XWWA 1EM7A 4LGYA 1XFAA 3QJZA 4HAWA 5HGXA 1RI1A 2I62A 1BIFA 3SIPA 3W5UA 3Q5EA 4D92A 5CW2A 4OFXA 1MO2A 4GP7A 1A9XA 5B58T 1P3DA 5AM1A 1C77A 4PSDA 3MIZA 3GYBA 2AE2A 1HZJA 2K2WA 2KHWB 5IANA 1TJ4A 1XQWA 5C8YB 1M6NA 2V7QD 3E3AA 4JBIA 2GEFA 3GAFA 2IOFK 2FZKA 1N5RA 4O59O 4EFOA 5BXQC 1BEUB 4LRWA 2B76B 4XYEA 1NRIA 1W1WA 1R66A 4MZDA 1ZN9A 3WQRA 3G7SA 3OPYI 4J3NA 3GCZA 2Q50A 1RKQA 1AVTA 4M8MA 5BSEA 2MQJA 3E2PA 2O3SA 4GZ5A 3MVEA 3NGDA 2QC8A 1LLQA 4RJJA 2HJGA 1QJ4A 4GL4A 4ZT3A 3SM3A 5A5VA 1P7PA 4I6JA 5JXIA 1R6DA 1YB5A 3GGJA 3GYGA 3DNMA 3KVRA 1V9PA 3B3QA 3KJGA 2HZ7A 2EJCA 5IMBA 8ICAA 1E3SA 2Z58A 3UK6A 1MPTA 3GDOA 1F17A 4YACA 2WX0A 5D7BA 4LC0A 2QTZA 1UDCA 3MQFA 1NUAA 3ICQB 1W30A 3WALA 2ZM6B 2DQKA 1SHJA 3GLHA 5LYYA 1VGVA 2XWSA 4DVJA 3AL0C 2PUAA 3GE8C 1A76A 5CUQA 2ZWMA 2IOYA 1AE1A 3I45A 4EAQA 3AMVA 4W5OA 1TM7E 2QKYA 2IF0A 2E6KA 1T2DA 4Z6KA 4NNJA 3HCBA 1GGJA 1YQ4B 4NZNA 1H2AS 1XMVA 4C7VA 1M8PA 3G68A 3A6ZA 2GPYA 1OPRA 2GOYA 4EO7A 1CPYA 4O2BB 3KKMA 2JAXA 4F7DA 2QZ9A 5AM4A 3PUXA 2HL6A 2HY7A 3MF4A 4MIOA 4WUTA 3C97A 3B9BA 3F4KA 4NESA 4MUMA 2ZULA 4WFKA 1KXZA 2CLHB 3EISA 2X5JO 3AF0A 2KDBA 5JOQA 1T5DX 1P8JA 3H2JA 2H4FA 1NZBA 1G2QA 4ZMRA 3D1VA 1P31A 3LWBA 4Q8EA 2ZJ2A 1DARA 3FILA 4CM8B 5KDOA 1IWOA 1QGOA 2CHXA 5I4KA 1FSZA 4QW8A 4JPSA 5K0GA 3AKCA 3NWOA 5LR6A 2R60A 1HPLA 2Q0ZX 1GSAA 5LU9A 3T9DA 3JCZA 2FW0A 1A2QA 4BNFA 4DBLE 3CW9A 4CO7A 1ZK4A 4IDAA 4LSGA 3WL3A 5ITVA 2AJQA 3ETCA 1K52A 4WZAA 3C3DA 1Q1ZA 3L93A 4N0MA 3DEEA 2G06A 2PEAA 1ULBA 2PWAA 1DAEA 4OK3A 2R5WA 3VPAA 2ZM5A 3T34A 2I1QA 2IA6A 5IWAB 1T0PA 1BDJA 3OU6A 1G6Q1 4KXFB 4KREA 1LB2B 2R1VB 1FTWA 4MR8B 5LQUA 5TLSA 1FO4A 2P65A 4RMJA 3IO5A 4FULA 4KN5A 2AA3A 3GJQA 3H9BA 4RXTA 4C8OA 1Z7YA 2VUTA 3E9MA 3UAXA 4RGMA 2QSUA 3CSFA 4JU8A 3X1XA 1UBEA 4V0QA 1JXAA 3BYYB 2FRXA 2R00C 3F74A 4QO7A 1QKJA 3ELDA 2NM0A 4JJZA 1G9XA 2Q0XA 1W0KD 4C6HA 4HQ0A 5I6DA 5DNAA 4H1WA 4G8JA 1NJWA 4DCJA 1AIPA 4DS5A 3IBFA 3A6LA 1MB9A 1OHHA 5HMLA 2AK2A 4EY3A 1D4FA 4LJPB 4PLPA 1SOUA 4D45A 1ZEMA 5ALKA 2QN8A 1KGDA 2VF7A 3TLZA 3NTQA 5E6SA 5L6LB 4MVJG 4FLMA 3ZWKA 3I8SA 5ALQA 4D3XA 4YUWA 3D3WB 5HE8A 1MXHA 4IIDA 1O96A 4RKEA 3GLRA 2DZMA 2N1RA 4KGDA 3JYUA 3RFFA 3UK2A 5I7SA 1JHAA 1PK1B 4GOND 1P81A 1WFYA 2LBOA 2D2FA 1T4BA 2M6RA 2RGNA 2O3RA 2WSBA 5FOXA 1KYYA 4B2LA 4IPTA 4CF7A 3QELA 4NG5A 5EUQB 1QH0A 1D5CA 2NQ2C 2WJVA 1L7XA 2CDRA 2POCA 3ETRA 1PZHA 2ATLA 1XD2B 2HIMA 5DXJA 3UC9A 3IBSA 3H05A 4AMZA 4BVFA 1YB6A 3LWNA 4QPCA 1QIEA 2IEZA 2HMAA 1SQFA 3EXHB 1KE2A 2BR0A 4ED1A 4RVNA 4JR2A 1BDMA 3D59A 3NVYA 1JX4A 5EC8A 2ZB2A 1LCIA 3CPEA 3OLYA 1OFIA 5J0YA 4M1ZA 2VK8A 3WYAA 4DMGA 4ZCRA 4FCWA 3I5AA 3T3NA 2R1ZA 4IZOA 1WDWB 5IIKA 3CF2A 4I2AA 1L3CA 2XOKD 2VJCA 1IY2A 1KL9A 4DLSA 5FI3A 4MA4A 2EFJA 2WU8A 1VPDA 3MGHA 4UU0A 4WLVA 1H2YA 5KFBA 3M5DA 4LV8B 4UCFA 2WFLA 4GLBA 4B3HA 4RTLA 4Z1OA 3LYAA 4A0FA 2C7VA 5LZ2A 3C70A 3AEFB 3BFXA 1Z4KA 3ZKWA 4DTIA 3DLBA 1SA0A 2R3SA 4RK6A 4MVYA 1GN8A 2VP4A 1L4EA 2F3NA 5I51A 1A5RA 4ZAWA 3OU2A 4QU5A 3GA0A 2NXWA 2PKRA 2X8BA 5IZCA 3WLFA 4KUGA 3X1ZA 1PI3A 3WC4A 2P40A 1AF7A 5JYDA 3SEQA 3GEIA 4QTUB 1N56A 4NE9A 3KZXA 2KDMA 2H29A 4DSKA 5JFOA 4ZOLB 3KKPA 3HLYA 3LP8A 4DJTA 2VRCA 1EE2A 1T0IA 1XD8A 4AS1A 1V6SA 3DLCA 1RG6A 3B48A 4CMIB 3IB6A 2JIPA 1C8LA 7ICNA 1K6XA 1EVKA 3AYXB 4E51A 1VSBA 3L7AA 3MJ5A 4EZ9A 3WIOA 3BQ2A 4HVLA 1X8JA 5ALUA 3DNFA 4AP4C 3EAQA 1IXRA 3DTVA 4BOYA 5TF0A 2XE4A 1ACCA 2WD7A 4KXQA 1D0IA 2PZEA 1SQ5A 2ZAOA 3CF4G 2ALJA 1J2MA 2V9HA 3E2EA 1IY9A 3IQXA 3A9TA 4C7YA 2ZR7A 3AJAA 1X9IA 5ANRB 5EWFA 4L75A 2GWHA 1JH9A 2P7HA 3EIEA 2C4WA 2CVHA 4XGQA 3SV3A 4BVAA 4HDNA 4Z7OB 1NWHA 5AK5A 4FKZA 2P5YA 3ER6A 3E3OA 2R9VA 2XUAA 2GPNA 5FR3A 3OFSA 3OLWA 4XASA 2GK3A 3PUJA 4Q66C 1DMSA 1R0LA 2KG5A 4RKFA 3QMMA 1R3UA 4RPIA 3SKXA 1H42A 2QM7A 1VE5A 1R10A 2CJWA 2A35A 3OP1A 3SGLA 3WGMA 1LS6A 1US8A 2JZNA 1OUQA 5L9XA 3B9JA 3JQ7A 4PCAA 3SSMA 1L7AA 1AQJA 2IHNA 4MH8A 4PZNA 2IKSA 3KIPA 4PSVA 1JI0A 2ZSDA 1DQSA 1R9MA 1ISFA 3EULA 1VDMA 4FZMA 1IY8A 2CR5A 1QG6A 1YK1A 5AVWA 4EELA 3SY8A 4DXFA 4RQMA 4K1XA 3DF7A 4CPDA 1RP7A 2VK2A 1JVSA 3ODGA 4D79A 2IXFA 1JIIA 1GTMA 3E56A 1E8DA 3JYLA 2XT9A 3IT4B 5JVDB 4JDUA 4JHXA 3U30A 9ICEA 2A9FA 3CLKA 4CEIB 1DOQA 2QSDA 8ICLA 1X8XA 1LK7A 2JBWA 3S2EA 3HK2A 4J0CA 4CM5A 1RWXA 1H3FA 2CLIB 1Q0HA 4GKBA 4HXFB 1ZRMA 4CLOA 1LRJA 2PMCA 1AU9A 1GT91 3ETDA 4FEGA 2QZJA 2HHJA 4UJ5A 4JBXA 2AF4C 1XL1A 1PD0A 2G4DB 3GFRA 2H1CA 4QL3A 3VNSA 2Y2VA 2JFQA 3QPDA 1WUIS 1FPMA 5A4FS 1ZQPA 1Y3HA 4WV3A 3EIWA 1D5XC 1ZDXA 3K6KA 1QH1A 3TSAA 1F2TA 4MQEB 1JUDA 1SBZA 2Y5BB 4W6QA 3OT4A 2ZTLA 5GINE 4CM4B 3V2HA 2H1OA 2LRWA 3PRMB 2AN3A 1RHQA 2D6FA 1IHDA 1QE0A 1FRFS 2JBAB 1UPHA 3AUYA 5JYBA 2L0FA 2GASA 4JJ6A 3EDOA 4ZA2A 3OVMA 1U0JA 4EA6A 1QYXA 2P6OA 3DDOA 2X0KA 3E9CA 4QHTA 2H9AA 4I4IA 1XSPA 3ZEAA 2ZRKA 3CPJB 2FIFA 3DLTA 4DR4B 1WD7A 4JV1A 1XK6A 1C0LA 3DYBA 2LTAA 4ZVKA 1WVMA 5EJFA 2ACWA 3RUIA 1FS6A 3NFRA 4X65B 4LOLA 4MS3B 4BP9A 2FW8A 3KJHA 1MG5A 4EG7A 1S76D 2XYGA 3BBLA 1C1XA 2JLUA 1SXGA 3M9NB 3L7CA 3W5SA 4D4HA 2OCKA 3RYIB 1X9MA 3UJAA 1G8YA 4WXRA 2QRKA 4P4SA 3JQAD 1SE3A 1BX0A 2WAMA 1GQYA 2W9NA 3DJFA 4JQYA 2ZQYA 1HOXA 5ALRA 4NR0A 4KGVA 1ZQKA 4MPJA 2KNJA 2JIRA 1V4VA 1YJXA 2HV9A 4LCDE 2E4YA 3AKZA 1U2GC 1X8KA 2L8JA 3OJLA 1R0RE 2GT1A 5HR6A 1K3TA 4F93B 1K0FA 3LT0A 4G0XA 1HG0A 5DE3A 1C0IA 3K94A 2PL1A 2OXEA 1K50A 4LYAA 1I2ZA 1CQXA 1KK2A 1D4BA 5CX1B 3ZCUA 3KVNA 2PMWB 3LOUA 5KYXB 4Z51A 4YRBA 3U48A 1ZYQA 3DUWA 1XVAA 4KK3A 4RS3A 1Z7BA 1QE3A 5JCPA 4DREA 4NONA 4A3PA 1A7AA 5TE9A 3WK5A 1TTPB 1ODLA 3RADC 3MTDA 5FHQA 2ETXA 5HDBB 4YCBA 3L0CA 1D6EC 3CVOA 3BEOA 5CIWA 1NASA 3JQRA 3EQZA 1VSTA 4QU8A 2VJMB 4ARZA 5IAGA 1LEHA 1TM4E 4RFLA 2XE8A 1PO7A 2O2GA 4DCTA 3EA6A 2YWFA 2ZS9A 3DAPA 4ND4A 5A3QA 2Z2ZA 3DCYA 3W2TA 2IW3A 4P86A 3PLVA 3L0SA 1MH1A 4RLSA 3IAS1 2XDAA 2BEVB 4JP8A 2IPXA 1AF4A 1KH2A 1R4NB 4YQYA 3LO8A 4PX9A 1DBWA 4A2CA 5T4FA 1J0CA 2D5CA 3DW1X 1VCHA 2PRKA 4XC2A 3IBTA 2AL3A 4H7EA 2ZCUA 3JATA 3FNRA 1VZ7A 2JHFA 3WAJA 1NYQA 1TO2E 4J0QA 3WQSB 1GKIA 5C0YA 4G9EA 3FTQA 1CS0A 3LI2A 2C5FA 3T38A 2F59A 4RACA 1Y3CE 1T2CA 3HXLA 3A6JA 2Q3FA 3ZYCA 1L8LA 4J9KA 3MPUA 3I2JA 4I50F 4LHEA 3ZDQA 2ZI6A 3DQPA 1QG2A 3I5MA 2I2CA 5GXGB 4KQ1A 2CB9A 5GPBA 3DHWC 3N7AA 4CKZA 3EDQA 3SBOA 4BMPB 3L13A 3FNHA 4RF0A 2XOEA 2XE6A 4MINA 3HDJA 1E79D 3RTVA 2UZ0A 1S4MA 2HO5A 4XWYA 2JAWA 3EFOB 1L9KA 2IZ1A 2JA1A 4B2YA 2FEAA 2NW6A 1SD5A 3H2ZA 1MRNA 2NZUG 5ES4B 5AH0A 5DN9A 3QKRB 4QT0A 1U48A 2FFJA 2FXIA 2ZCBA 1ZH2A 3ZDCA 4G0NB 1WGKA 1XZMA 5JLAA 4RETA 1X1SA 3KLBA 4ZICA 5EHGA 1QFSA 4KR6A 4UM9D 2EBHX 1UXKA 1RXUA 3R0IA 2XVZA 5D01A 4DG5A 2QX4A 3R20A 1IRXA 521PA 4AKHA 2C2KA 3VSCA 1ZH4A 4LJ5A 3MC1A 1OFHA 3SICE 4BP1A 5JAMA 1ONBA 3BGVA 4BNTA 2B6GA 3BICA 3DDCB 4BFRA 2P35A 5IJXA 3HRIA 3QX1A 2HA5A 4JVNA 1QH9A 1CDZA 3SU8A 1HYQA 3L4SO 4HDRB 4F4JA 3LY9A 5E3JA 4Q3EA 2H9IA 1XU7A 4LMBA 4ALKA 5K05A 1JIKA 1MSWD 1O54A 4LZZA 2LM1A 4RFVA 4O8CA 3QV1A 3OQHA 3E15A 2IWHA 4WHMA 1FMCA 3M3HA 1UK7A 4FDUA 1E7QA 2VHVA 3T15A 4HQKA 1YBHA 1VXRA 2CLFB 2ARKA 2YV2A 5BPHA 2Q5FA 2H2HA 1S3FA 4F4YA 3L1VA 1QGDA 3RPEA 3WNZA 4IIJB 4ECXA 1EMDA 3FPBA 1QQ5A 3I8OA 4DRYA 3H8MA 1WYWB 4O4IA 2G1PA 2HUPA 4L8LA 4J1NA 2FFQA 5K4GA 1OLXA 3IPAA 3ROTA 4PPXA 4ER6A 1RACA 2GEBA 1SHKA 3LH5A 3CVUA 1Y7IA 3OC0A 5ALOA 2BR3A 5A7FA 4QFCA 1QWSA 3DCIA 7ICHA 2PS9A 221PA 4IMRA 4I2FA 2ZBFA 5G1PA 2H7VA 5HM6A 3A6GA 9ATCA 3QBDA 4YWGG 2PUTA 1UMCB 2BEKA 1Q77A 2M98A 5JAIA 4Z9YA 2JVIA 2IZZA 3RD2A 4D3DA 3A6HA 4KUEA 4RQ0A 3I04A 4DNQA 4PZAA 2O1SA 4JT9A 2NO5A 5L3ZA 5A0LA 4A2WA 1HNZB 5IF3A 2OZLB 2MT9A 4MPDA 3R2JA 2EF1A 2FNAA 1V6CA 3RJEA 1XEWX 4WBXC 4ZRIA 1HKUA 1M10A 2IY7A 1Q0RA 4ZKDA 1PX2A 5J3JA 3IP8A 3BCSA 2W0MA 5KVQA 1PCXA 4XJXA 5CCEA 4E1AA 5AZFA 3VGPA 3N70A 1DRGA 3KW5B 2XVAA 1O08A 2R8KA 2RGGA 1XXHE 3I9KA 3BXOA 4TV9B 2HTEA 5KFPA 3N2KB 1N5MA 4NK4A 4QLAA 3SS7X 5FNVA 3NFYA 4OVVA 5LOVB 3T1HB 4G6ZA 5BSGA 3ER9A 2JKZA 1IOVA 4PLFA 4RC9A 1WP9A 4RQ3A 1PQYA 3UFBA 1YWGO 1XMJA 1GKYA 3AM3A 4PXSA 4NWIA 1S9HA 3BRWA 4YAGA 4NV1A 2KXJA 4KN8A 3KUUA 3DOFA 5A03A 2HNBA 1XRLA 2WWIA 2P7IA 4FHZA 3O95A 1Z0SA 4CKBB 2V1XA 5J0TA 3L1IA 2VP0A 1G5TA 2C95A 1M94A 1RT9A 1FSFA 4YVFA 4TSFD 2WSSD 4UMVA 5AXCA 4ETWA 1X9SA 4DIBA 3C43A 1NN3A 2ZKLA 4II2A 4JVLA 4TS3A 2B4TO 3T9BA 8ADHA 2I0FA 3R0QA 2UZIR 2H3HA 4X9XA 2ANBA 3Q3JB 3P9CA 5F2KA 4BNHA 3KT3A 1APBA 4JC5A 3CTPA 1VMIA 5JZOA 4DMCA 3WIEA 1KZ7B 3T3PB 1U4OA 1KF6B 4HQRA 3IDFA 1ZRHA 3V42A 2OQVA 3GAMA 2JFXA 5JEEA 1VCMA 3EAFA 3OUUA 2CU1A 3PT9A 3F5EA 2QAGA 5CH5A 3WXBA 3ZWPA 1J56A 4D44A 1GZ6A 2LWIA 3TSOA