5EE3A

Complex structure of osychf1 with amp-pnp
Total Genus 110
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
110
sequence length
374
structure length
357
Chain Sequence
ERPILGRFSSHLKIGIVGLPNVGKSTFFNIVTKLSIPAENFPFCTIDPNEARVYVPDERFDWLCQLYKPKSEVSAYLEINDIALGNAFLSHIRAVDGIFHVLRAFEDKDSVDPVRDLETIGEELRLKDIEFVQNKIDDLEKSMKRSNDKQLKLEHELCEKVKAHLEDGKDVRFGDWKSADIEILNTFQLLTAKPVVYLVNMSEKDYQRKKNKFLPKIHAWVQEHGGETIIPFSCAFERLLADMPPDEAAKYCAENQIASVIPKIIKTGFAAIHLIYFFTAGPDEVKCWQIRRQTKAPQAAGTIHTDFERGFICAEVMKFDDLKELGSESAVKAAGKYRQEGKTYVVQDGDIIFFKFN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Obg-like ATPase 1
publication title ATP binding by the P-loop NTPase OsYchF1 (an unconventional G protein) contributes to biotic but not abiotic stress responses
pubmed doi rcsb
source organism Oryza sativa subsp. japonica
molecule tags Hydrolase
total genus 110
structure length 357
sequence length 374
chains with identical sequence B
ec nomenclature ec 3.6.5.-:
pdb deposition date 2015-10-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01926 MMR_HSR1 50S ribosome-binding GTPase
A PF06071 YchF-GTPase_C Protein of unknown function (DUF933)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.300 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 TGS-like domain 5ee3A03
3.10.20.30 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 5ee3A02
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 5ee3A01
3HU3A 3PEVA 1QOGA 2J7PA 4B73A 1EG7A 1K5GA 3TIFA 4MUAA 2ZRIA 2OXCA 5J40A 4Z1MD 1D8TA 1GL9B 1Q3TA 4C9BA 2V1UA 3NBZC 1OB5A 2WHXA 2ZRPA 3IPYA 4YMUA 3NBXX 5L3VA 1F2TB 5B58C 1FZQA 1X8LA 3ZQJA 2QTFA 1W2GA 4HUTA 2WJYA 2FNAA 1IY0A 1J7AA 3L2OB 4GPTA 3RLFA 4HAWA 4N58A 1RM6C 3CO5A 3MFYA 4LJ7A 2PX3A 1OYYA 3QKRA 4OHVA 1G4AE 1FUKA 1JJVA 4D4LA 3N70A 5DN6A 3TUIC 5KOYA 1VIYA 3EPLA 4MITA 2JLQA 4ZPXA 1J99A 3CRRA 4QRHA 3B1WA 2JEOA 3QEOA 4Q4LA 2IYWA 1YVDA 1Z6GA 4M4SA 1AN0A 4E03A 4TT3A 1DARA 1HH4A 4II7A 1OH6A 1NJGA 3REFA 4CYMA 4B47A 4ZV4A 4KXFB 2OCBA 2ODEA 5KSZA 2F3TA 2XJ9A 3EA0A 4HB0A 4BPBA 2HYIC 4G3XA 3FMPB 4FWTA 5K8LA 2WKQA 3AP2A 3AVWA 2YWEA 3T12A 5JS7A 1TEVA 3FHOA 1TF7A 1LS6A 1Q20A 1R6BX 1ZUNB 3NDBB 4PZLA 3LV8A 2J45A 2Q3HA 1E2HA 3QPUA 2NG1A 4DCNA 3NVAA 5BW8A 3M4YA 3KKPA 3K0AA 3Q9LA 4IJMA 1Z0DA 4GT1A 3H84A 4EAQA 3TUJC 1QHXA 3AV8A 3SQWA 1GKIA 1NKSA 4QJ4A 3VTKA 3ADDA 4Q9KA 3NWJA 4GMXA 4I1OA 1U81A 1XPRA 2R62A 1EFHA 1DVRA 4UXJA 2WIBA 4RKEA 1Z5ZA 2ZJ8A 2XSZA 3AEDB 2UZIR 5G5HA 4O2RA 2JJ2A 4PO8A 3A36A 5FL7D 1VDVA 2CNWA 4IXMA 4NYJR 2W2VA 1OJLA 3CWZA 3AE7B 2O8FA 2C96A 2IYUA 4Y0VA 2XOKA 4TYQA 1UBFA 2HCJB 1YR9A 2IXEA 1R0WA 1TKYA 2BBTA 4JLKA 5HCNA 2LKDA 4Q1DA 1LTQA 1FFHA 4QNRA 4V0OA 1SF0A 2WSSD 2B76B 4S2EA 1SKYE 2A9KA 3B13B 3N2IA 1Z63A 1XEXA 4Y0AA 4OI1A 1H65A 3BJIC 1QZXA 4ILEA 2H92A 4WXPA 3WBKA 4CDGA 4DEXA 4US2R 3AVUA 3BD9A 5B2ZA 3F3YA 4M1OA 4AG6A 1XMIA 3U3MA 4QGGA 1KJYA 3P1JA 2OZEA 1G5PA 3KKNA 3ZD6A 2G6BA 2GVDC 4NMMA 4OI0A 2K5PA 2IW3A 2CE2X 3B1VA 4D0NA 1HEIA 1US8B 4JVSB 5ANRB 3W5IA 2PH1A 3CM0A 1CJKC 2OEPA 1KK2A 4WAUA 1CBUA 2QMEA 2GZDA 4M8NE 5L3QA 1XO3A 2MSCB 2QENA 3QXSA 3GLFA 1X6VA 1IBRA 4M9SA 4OQFA 5CJPA 1CZPA 4OL0A 1IN5A 1F48A 4GP7A 1XB2A 4B71A 1C4OA 4MKHA 3BXZA 1M2OB 4MYCA 4NHOA 3N2EA 2BKUA 4WZBE 3IBGA 3GLIB 4JT4A 1NMZA 4KSBA 4RD1A 3T1QA 1RJ9A 5HCIA 1N0VC 3VR6A 4BASA 5A4JA 621PA 1OKKA 4Z1MA 1ZM2A 4B76A 2WQYB 1DAFA 1X8KA 4C0QC 3KX2A 2XJ4A 2QRNA 3GFTA 4USAA 2EW1A 2CJWB 5B64A 2BM1A 3X1WA 2QM8A 4IKEA 3T1OA 2CU3A 1AZTA 1II8A 5JWOA 3GEIA 1NBMA 1XWIA 5FFMA 3UK6A 2W54A 3P27A 1CXZA 4KHZA 3TW8B 4QG7A 2JLVA 4E22A 2DFLA 4EQ6A 1DAEA 1S3SA 5FTKA 3D31A 4LJAA 5J4YA 1LNZA 5FOTA 2WSMA 2NOAA 3Q7PA 4HLUC 3HR8A 3B6EA 3SFZA 4YDHB 4B3XA 2H18A 1T3HA 3I61A 1KIMA 4L8GA 2ORWA 2N1BA 4G0NA 1Z29A 4G5GA 4JBWA 1CJMA 2HXSA 5D3MB 1E2MA 2QZ4A 1ONBA 1VLBA 3UWKA 1KK3A 2DHRA 3EIQA 1XU4A 2A5YB 2YINC 1WP9A 3GFOA 4ABYA 1XDBA 1XEWX 3DVLA 3VRBB 2WM9B 1DEKA 5EXSA 2IYYA 1EX7A 1QF9A 2EYUA 3I8XA 3AE3B 3SR6A 2QP4A 4NYJQ 4LSGA 3P4XA 5FOWA 1E2EA 4D4KA 4DLVA 3H2YA 2GEVA 4HZUA 3PXGA 2FZ4A 4IVPA 4KLNA 4ZOHC 1J7CA 1LF5A 4ON9A 1EGAA 1AA9A 4HAYA 4JLMA 1G8YA 1NVID 2D7CA 1QOAA 3MRSA 3ZQ6A 1FMJA 4LJ6A 5JS8A 2AFHE 4C0LA 2IHYA 4IOMA 1KI1A 4EJSA 1N5WA 1AQYA 3TR5A 1J90A 4LYAA 1AM4D 2QPOA 5A5GA 2REOA 2CEAA 3GLGA 1EFRA 2AFIE 1MRNA 2WSSA 3PV0A 2QRZA 4PTLA 2R9VA 4FCWA 2WU2B 1N0UA 1XTRA 4PC7A 4PHTA 2J0UB 3ZVLA 4AIIA 4AY2A 4RCYA 2PVGC 4UKDA 1R5NA 1Q22A 1B0UA 5KNCA 5L3SB 3ZGXA 3KKOA 1EWYC 3QXCA 3SFDB 2WDRB 1FQKA 5DLQC 2CXXA 2CHGA 2EU8A 4OJKA 4JYBA 4KBFA 3DKVA 4HSEA 3W5JA 3DOEA 3WP1B 4FMCB 1E7PB 3QF4A 5G3YA 1H8HA 1CJEA 5CDFA 5HE8A 3B2EA 5G41A 1TU4A 2W3SA 4DBLC 4LJ8A 4LWZA 4A0HA 1SQ5A 4UXHA 1ZXIA 3P1MA 2UKDA 3FWYA 5CK5A 3OFNA 4NH0A 3IO5A 3QPWA 1SULA 2OT3B 4DCSA 1QHHB 1XLOA 4I4LA 4TMZA 1TKGA 2P6UA 4ERNA 3AVPA 3TNFA 1Z3IX 2HT1A 2KE5A 2W2TA 3RVBA 1G21E 3EASA 3NH9A 1KO7A 2ECKA 4JVLA 4WA7A 4D4JA 2QJLA 2JLRA 3ONWA 4W5JA 5FUYA 3SE0A 5B57C 2GBLA 2GZHA 3SZRA 2JX5A 1NLYA 1SXJD 1T0HB 3SJCA 3AKYA 5J4LA 1E2KA 1M6NA 2J9RA 4LHZA 2W58A 3CR7A 1SHKA 1PVOA 1EX6A 1Z07A 3CONA 4K8OA 3DO6A 2QM7A 4DWJA 2Z4SA 3WNBA 5FTNA 1R5BA 1DG3A 2RHDA 5BN4A 1I4DD 3HPRA 3VR4A 1DELA 3AKCA 3ZDQA 1SGWA 1A1VA 2GESA 3A1UA 1BIFA 1JAIA 5FUVA 1WRIA 4NBSA 4D26A 221PA 1E32A 1GUAA 4HAXA 1KF6B 2WTUA 1C1YA 2OSBA 1N5JA 3Q7QA 2CK3A 1KDTA 2O0JA 2WWXA 2QTHA 4N1AA 4TZ0A 4TTPA 5JEDA 2ZUDA 3MWKA 3QOFA 3DMDA 3ADBA 5LBIA 1U94A 4A2WA 4NP6A 5MPOA 2R8RA 4Q1CA 2XITA 2EKIA 3FFBA 4Q7LA 1E96A 5TXGA 3VHLB 2GF0A 3AE4B 4XVUA 1TQ6A 1S1MA 1QOFA 4PPFA 4B48A 4CEHB 2V6JA 4F93B 1ZW6A 2CL7X 4M1WA 1YZGA 4YDSA 3TUZC 3THXB 1N6IA 4IDOA 4IW3B 2GDJA 4A6XA 4MUBA 3ZZ0A 4E5UA 1KJWA 2FF7A 3VR2A 3IEVA 5HPYB 2AKAB 3RS0A 3GD7A 2G1EA 4LV5B 3MAAC 4ZCLA 4C7YA 1FMAD 1OXXK 2G3YA 4FIDA 2PT7A 3ZJYA 2H8KA 4DT1B 1E9BA 4LX0A 2ACZB 1ZC3A 2QAJA 2ZYTX 4NCKA 4PX9A 4I1SA 4BRUA 1SVWA 2V55B 1YZTA 4IDNA 4C3ZA 3IILA 1FTSA 1W36B 3N5CA 5BQ5A 1COWD 2IUSA 5HZKA 4Z54A 2ZI5A 4OHXA 2IT1A 4EFLA 1BO6A 1WGKA 1CULC 1OFHA 1YU9A 3DPUA 1NMYA 3DZDA 3KUDA 4GI7A 5TV2A 3X1XA 3ZVMA 3R9WA 1N5LA 1M1YE 5DGXA 1LB1B 3K09C 3VU9A 2RGXA 1VYVA 1V43A 1VHTA 2WICA 2IS4A 2BS2B 5AJZA 1L0VB 1L6UA 2IEZA 1IY2A 3K9NA 4WW0A 2FSIA 3W6OA 4B33A 2GA8A 2VL7A 1GM5A 2F9MA 1FMLA 1JB1A 1JR3D 4DLTA 4XJXA 4KFRA 1JW9D 5FBVB 4BLPA 4IDQA 1XX6A 5F2EA 4BFWA 3U2QA 4Q01A 1AS2A 1ZBDA 3W3ZB 2QSZA 3EWAA 4F4CA 1N3BA 5SZHB 1E6EB 1MR3F 1JI0A 3SJAA 4DJTA 2J3EA 3QIAA 1N5KA 4LRWA 1JALA 1IXZA 2F1IA 2ORVA 2VF7A 1E4VA 3AQ4A 2ZIAA 1S0UA 4A92A 3EZ9A 1QHGA 1G3QA 2I1VB 4YT0B 2QU8A 1JQ4A 2YVUA 4YLGA 5FBQB 3ZYCA 4XTRA 4PAOA 3A1SA 2ZSDA 4LHXA 4M1KA 1YRBA 4UNQA 3RC3A 1UEJA 4D80A 1OFFA 4JSTA 4KVAA 1NVVR 2VLIA 4QGHA 3ECCA 4DCTA 2KBEA 1P6XA 2QE7D 3ND9A 3FKQA 1JECA 2JLUA 4KBGA 2RB4A 2WV9A 3K9HA 1OXVA 4G1UC 4DDUA 1RRFA 2P67A 1NYQA 2RMKA 3ASZA 4YTMB 2A7QA 2ZRDA 3QQ5A 1G5RA 5FOUA 1Z0KA 4DSNA 5FI1B 4GZMA 1ZINA 2GAAA 2R6DA 2XNDD 5EE1A 2JLXA 2FPMA 2NQ2C 1R4AA 3DZ8A 1SB3C 1W1WA 2PL3A 3Q5EA 3OIUA 2IS6A 2J7KA 3LBHA 2PVOD 4LC0A 4ZI2A 3CRQA 2P0EA 5DISB 1X8JA 1XJQA 2Z83A 1NY5A 2FEOA 2ZAOA 4HLQB 3GCGA 3I72A 1N62A 5IK2D 5JJKA 4AKHA 2OFWA 3U3OA 2N46A 3A4LA 2HDNB 2Z5FA 1XTQA 4HATA 3NVVA 1OIWA 1EESA 1DTSA 4I99A 2RH5A 2HJVA 4HEJA 1YZNA 4AYTA 2JLYA 1E94E 1C9KA 3CRW1 4HDQB 3P4YA 3CNLA 1XEFA 5DYGA 2Q9CA 4DLRA 1XD2B 4TTRA 5CITA 3C16C 5GXGB 2OLJA 4MRSA 4UNNA 5BN3A 1O87A 3K0FB 4HB2A 5EXXA 2PLFA 4A0GA 5K8TA 2MMCA 5CM8B 2IYLD 1XLQA 1G19A 2F6RA 2BHRA 2VIIA 2W83A 5KNBA 1EFCA 1RYHA 4US9A 1HY3A 2BWJA 2JASA 2RGCA 1MRSA 1E79A 3IO3A 1SVSA 1W5TA 1SXJE 2M56B 4JWUC 2QI9C 4GZLA 3AM9A 4AYWA 2BBSA 2VH5R 3QXHA 1GG2A 4K81B 1RPZA 1ZCBA 3OEHA 1COWA 2AHOA 5JJLA 3LX8A 4N0EA 1KO4A 2VP0A 2WOJA 3VAAA 3BK7A 4TLCA 5CB8A 5DI3A 1MT0A 1BH2A 5IT5A 4BLQA 4US8A 1SKQA 2B92A 2JATA 5DHAA 3T5DA 3PUZA 4ZKEA 1Z2CA 1IJFA 1GNQA 1ZD1A 4DCUA 2VSXA 1KAOA 4E07A 3AE9B 3K1JA 4A2PA 3FHTA 1I4TD 2WJHA 2PEZA 3RHFA 4UXIA 3GLHB 2QGNA 1GRRA 3AGQA 1XPUA 3NHBA 3WP0A 1I4LD 3OHMA 1JR3A 4B75A 1RIFA 4TMVA 2ATVA 2XB4A 4DHEA 1XTJA 3FFAA 1OQQA 4LC1A 3ICEA 1FUUA 1DAIA 3C5CA 1XJCA 3H0KA 2QROA 4HYYA 5HE9A 2XXAA 1U8YA 4A6PA 1LS1A 2D7DA 4PO9A 2ZJOA 4O3MA 3MD0A 3M1IA 2L0XA 4EPXA 4YSYB 1XCGB 1G7TA 4KX6B 5J47A 1IN8A 1KDPA 5KDLA 4PXAA 1FO4A 5SZIA 3TSWA 2NO9A 4RFVA 5GJWC 1E0SA 1NVVQ 1OQRA 1NSFA 4US1R 3UKDA 5C1BA 2QIEB 1SVMA 2DCUA 2ZSFA 1F2TA 3A1WA 4YSXB 3SFEB 2DYKA 1I2MA 3QPVA 3WNCA 3JZMA 1BS1A 5LDDC 2GCOA 2O0KA 4AKGA 4M53A 5AJXA 4BFSA 3EAQA 4LK2A 3KUCA 2QE7A 2PLRA 3EX7C 2GILA 2GNOA 2JGNA 1TUEA 3S1AB 4AD8A 1AYFA 3CPEA 3FHCB 1SVKA 1P4SA 1JR6A 2G88A 5G40A 2GCPA 1KJZA 4H9GA 1RFKA 3B8HA 2XSZD 2E1RA 1BMFD 1W2HA 3KB1A 3X1YA 2XNDA 3MWJA 3UANA 1JR3E 4OHYA 4M2LA 2OCYC 3HR7A 4TMWA 2OBMA 3U61B 1TADA 1KI6B 4TYYA 1QVRA 3FB4A 3E70C 3UATA 3OEED 2BC9A 3NRZA 2D2FA 2ZAMA 3EXAA 2FDCA 5JWHA 3AE1B 4W9MC 4G01B 4PC6A 4DEYA 4C0BA 4BFZA 3D7MA 1FX0B 4R7ZA 1JPJA 4BZPA 2NGRA 1F3OA 1CJTC 5EP3A 4NPHA 3SHFA 3GPLA 1WB9A 4OQLA 4M1SA 2GEDA 4KAXA 1A2BA 1UKVY 2ZYUX 4HUQB 1VCMA 2B8WA 1SVIA 2FEMA 2ZQ5A 2AWNA 5G5GA 3E2IA 4XWKA 5F3WB 4KI0A 4LPSA 4GNKA 3P4RB 2CCJA 1AKYA 2FZLA 4M21A 1FL9A 1ZYUA 1N6PA 3QKSB 3T61A 3G82C 5AJVB 2OO7A 3I5XA 5BN5A 5B30A 1TNDA 4TLBA 2ORIA 1W48A 5KSYA 3NBYC 3U44B 2HT6A 5TARA 3QUSA 2ZJ2A 2OV2A 3EZ6A 3LBIA 3DOFA 1R8SA 4ZO4A 2RGBA 4YONB 4FWIB 1D2EA 1M7GA 3K0CC 5EZ5A 4NTZA 3UG7A 3ASYA 4TZ6A 4H1UA 4XVRA 1OKKD 1Q21A 1SVOA 1T3SA 2AXNA 4IDHA 1W47A 3NIBA 2W3RA 1JBKA 3UPUA 1SXJC 3Q85A 2I1QA 3DWGC 3CPHA 3AVVA 1E9MA 5H1YA 4PO1A 3H86A 3I5YA 4M0LA 1EFUA 3K70D 1OLOA 1TQ2A 2VHTA 1GPXA 1KNXA 2ZPTX 3T1VA 4BZQA 1XZPA 1US8A 1LVGA 1Q1BA 3DL0A 1E0ZA 1NBMD 1UKEA 1WF3A 3LLMA 4M1MA 2PMKA 4S35A 4C0SA 4V02A 3CRVA 2K9XA 2BBWA 2CBZA 3FKSA 4QHYA 4LDJA 3WNDA 3AH8A 4GL2A 3DWMA 1QG2A 4KVGA 2AD1A 4LZZA 1RWSA 4B2IA 1DOYA 3QE0A 1HE8B 1HUQA 3THOA 5C2TB 4B6FA 4URXR 3U4QB 3B7GA 1V8CA 1V97A 4W5HA 2BS3B 1D9XA 3GLIA 4GOXA 3QEJA 1D2MA 2QAGC 4V0KA 3IKJA 2ZS9A 4QBGB 2QUZA 3GP8A 1O3YA 2VHQA 2HYDA 2IS2A 2ZRLA 3TW4A 1KSJA 5C2JB 2C78A 4U7DA 3BB1A 5FUXA 4N0DA 4Q7JB 3B9PA 2CJWA 4Q19A 2ZSEA 2CMKA 4KFSA 4WOPA 3RWOA 5K8IA 1G18A 2BEJA 2XTZA 2Z0MA 3D6TB 1XD9A 2FOLA 2GK7A 4PQRA 1E9CA 4LBZA 2WWYA 2ZITA 4DRZA 4NCIA 5FOVA 4ZHPA 4JKYA 1A7JA 4NCNA 3L0IB 3SU8A 3H4MA 4M22A 2J87A 1N5XA 2O8BB 3HUIA 3HYRA 3CIRB 3QG5A 4XH9B 1G41A 5BWMA 2A5JA 2W6JA 5JZVA 3VNVA 2MJEA 2W2XA 5DE3A 1BMFA 5KPDA 3TAHA 2F7SA 1L4UA 5JFGA 1N6OA 4RZ2A 2WWHA 1EWRA 2C98A 3MWLA 3T1TA 2PCJA 4NE2A 3KKMA 4PANA 3L8ZA 2O8DB 1GSIA 1U0LA 5D3MA 1KYIA 2MSDB 1XMJA 1EFRD 1RW4A 3OEEA 2CL6X 1YQTA 1FNMA 1GRNA 1GAQB 4MYTA 1R10A 1S8FA 3PR1A 4KFUA 1P2SA 2ANCA 3GLIE 3DHWC 3QI2A 4ARZA 2IUUA 4IRUB 4XIGS 2XTMA 1UBGA 4JMPA 2EQBA 4M9ZA 3U3RA 4URWR 3UWOA 4WIAA 2M19A 5FL3A 4B43A 2KI5A 3ZVRA 1OF1A 4OHWA 1U9IA 3EA5A 2FU5C 2IYXA 4HAVA 4XD7A 5FTLA 2CHQA 2MJ3A 1KKMA 1G6HA 1W0JD 2EVWX 2AL7A 1H8HD 1RRPA 1E2NA 4L9SA 1ZIOA 4LBYA 4TTQA 1W36D 3AUYA 3SHWA 4AKIA 5L8VA 1YZQA 1HT1E 1Z6YA 2VBCA 5J4KA 3RSLA 1YR7A 3Q3JB 1P61B 5AJYA 1G4UR 1KK1A 4IFEA 2N0SB 2BJVA 4KJZA 4JLOA 3OFND 4QNMA 1N6KA 3FVQA 4BE7B 2D2EA 2PJZA 1FRRA 1L4YA 1FW6A 2ZTSA 3FOZA 4YTPB 3SEAA 1GAJA 1F2UB 3CZPA 1XJ0A 4M9QA 1Y63A 1ZMXA 3AMZA 1FM0D 3M6AA 1GL7A 2H7VA 4MYUA 3ZD7A 1WBDA 5M04A 3SFVA 3VMFA 2WWWA 4FXPA 2Y5CA 4WXRA 1XTKA 3AF1A 2YOFA 2Q9BA 3AUXA 3P4SB 3FTQA 4XOIA 1UJ2A 1DO2A 4LBVA 2BDTA 1U8ZA 4XSGA 3U5ZB 1CF4A 4CF7A 1M34E 2WMNB 1SKYB 5E7MA 2FSHA 3BB3A 5C46F 3OE7A 4AC9A 3G0HA 4KODA 2QQEA 4X8MA 4A8JA 1QHSA 1P2UA 2CLSA 4YMVA 1G3UA 1DGJA 1LFDB 1IN7A 2ZE8A 4PSKA 1J7BA 1XD8A 3AM1A 3NBFA 4TLAA 4ESVA 3B1YA 1ZUD2 3NDPA 1M7BA 1OE0A 2C9OA 3E5HA 1ZU4A 1S9DA 3LDAA 3I92A 4G5RA 4ZHOA 1W0KA 5GVSA 1AGRA 2CK3D 1A4RA 1P60A 3C8UA 4R2HA 4Q9JA 3MUFA 3UMFA 1B23P 1CR4A 3DKPA 2HLDD 2QNRA 1WA5A 3GLFE 4AG5A 3IQXA 3AEAB 3UG6A 4DLSA 2WJGA 5EJEA 1R7SA 1J8YF 2NTYC 2ZI6A 3VX4A 1KKLA 2ZXUA 2J41A 3TLXA 2GXQA 2V1XA 1L2TA 2FSGA 1GP2A 1UFQA 1KFYB 4H1VA 4HDOB 1EFTA 3W90A 4D82A 1U8AA 1IJEA 1CR2A 3W5VB 2QBYA 1UBEA 3V00A 4OQMA 3AB3A 4F4JA 2HF8A 1JEDA 3X1ZA 3NKVA 3RRYA 4MH0R 2KMMA 2A3RA 1VYUA 3RANA 4HDCA 5FOXA 2HV8A 1R2QA 2EWVA 1BKDR 4LI0A 4KSCA 5J4VA 2GTPA 3WMGA 5JI3E 4TLEA 4EDHA 5BYKA 1QOBA 1OIXA 2R6AA 2FJUA 2W6ID 4BLSA 1NBME 2FPKA 2IWHA 1PV4A 2WDQB 1FTNA 2YC4C 5SZKB 1HQYE 4BQSA 4D0GA 1ZRHA 1TAGA 4WVFA 1YQ3B 4D4MA 1GVNB 4JL8A 3KQKA 4DUGA 2ZUBA 2CJNA 4DC9A 4EPRA 4ZCIA 1TYGB 1TJEA 2QSYA 4LGMA 3IPXA 4HAZA 3RSOA 4CEHA 1FFVA 4ZIRB 1N5IA 2EWWA 1RZ3A 2Q6TA 1SZPA 2XX3A 3B5JA 3THXA 4FCTA 1Z22A 4GBMA 2Z4RA 1J7KA 3AEGB 4Q1EA 5H8WA 5LD2C 2WP9B 3QENA 4IHQA 1ELOA 2EFDB 1CKEA 2FGJA 1G16A 3RC8A 2EFHB 1DPFA 1MABB 4C0AC 3SN6A 4DT1A 1G7CA 3B85A 4C30A 1KZGB 1VG0B 1W0JA 4MYHA 1WMSA 4KU4A 4D0LB 5JBQA 1U0HC 1S1CA 4WZ6A 4CEIB 4I1VA 3VKWA 3A8TA 3GJ6A 1OPXA 5E95A 5KNDA 5FPTA 4XSHA 4F7WA 1G17A 2BM0A 2V3CC 1FOEB 1J70A 1NRJB 1NVUQ 3P26A 3LB8C 1QG4A 3EZ2A 4NYMR 1WWTA 1ANKA 1I2DA 1KY2A 5EE5B 3EPHA 2VA8A 4TMXA 3AEEB 4J0QA 3WHLA 4ZKDA 2XZOA 1CLUA 1JRPA 5J5CA 3R8FA 2WIAA 2L52A 3AGPA 4MDEA 2P5SA 3RRZA 1Q57A 2QEQA 1GILA 5BYJA 2BMJA 3I1FA 5H70A 5C18A 3L8YA 1Z6XA 3CF2A 1J8MF 3NEYA 2V8OA 4EQ6B 3AVQA 3GLGE 2PIAA 3PVSA 4HLDA 3JVVA 4TQ9A 5EE9A 3KFVA 3ZS9A 1UDXA 1ZNWA 5CLLA 2O8EB 4Z8XA 1FNNA 1Q1ZA 5JSZB 5JWRA 3VNUA 1PUTA 1E2FA 2XZPA 4U5XA 3BC1A 3OIWA 1AS3A 2Q3MA 1ZD9A 1UM8A 3KTAB 4QHTA 4LHWA 3Q72A 1E9EA 4ITRC 3JVUA 1P9RA 1XF9A 1Z06A 2IC5A 4PFSA 3AF2A 4QBFA 1N63A 2HCBA 2QQ0A 3FE2A 2V4ZA 5AJWA 3U3JA 1DOAA 1L7VC 1OT3A 2ZRMA 3SBDA 4V0MA 2SHKA 4RZXA 1CRQA 2W55A 1ZJ6A 2C77A 2HLDA 3EWSA 3OF5A 3VQTA 5CDFE 4CRWB 1L8QA 1RYFA 5KDOA 2WJIA 3SYNA 1MO4A 4KYUA 5E7JA 4D81A 3UXMA 1CJUC 4JVMA 1WBBA 4JS0A 4JWSC 5FH9A 3U6BA 1JWAD 4V0LA 1E6CA 4P33A 3TRFA 3AF4A 1TF2A 1T3QA 4DDVA 3U7HB 3WYGA 1E0AA 1CIPA 3SQXA 4LYHA 2J0QA 3C15C 4JJKA 4F92B 1FIQA 2HJGA 3C7KA 4L4UA 1ESMA 1MO6A 3F5FA 3IIJA 4OI2A 4F4IA 2A2ZA 2A5DA 4CVNA 3K9GA 1VG1A 1E79D 4PC3A 5FOSA 1E1RD 3BFXA 1U0JA 3AVXA 5JCPA 2VP2A 3AN1A 3LLUA 2W6IA 3MJHA 3EG5A 4BRWA 1KGDA 3BFVA 3OEHD 5JJIA 4IFBA 4K46A 3K70C 2KWIA 4JLDA 6Q21A 1NP6A 1A82A 3LQRA 2NPFA 2OG2A 3NS1A 1Q0UA 2ZS7A 1DOIA 1DOXA 1DAMA 1OSNA 2RCNA 2R6FA 4B3FX 4DLUA 1XLNA 1KK0A 4C2UA 4PC1A 2WJVA 4Q7MB 2D4HA 1ZU5A 2LKCA 1TPZA 3TQFA 4A8JC 4BFXA 2F3RA 3QG1A 4YXWA 2WZQA 2FX3A 2E3TA 1PUIA 1UADA 3KFXA 4EUNA 1KDRA 4NU0A 3K0FA 4DLXA 4E09A 1E2QA 2ZJAA 2DBYA 2CL0X 1N6NA 2IBMA 1OFUX 1ZNXA 3AP3A 4LV6A 4C7OB 5AUKA 3R9XA 1IUEA 3B2FA 2CVHA 2FV8A 5DIFA 3SR0A 5CK4A 2B7CA 2QMUA 4NCJA 5DHFA 3TR0A 2H16A 3SNHA 3V9PA 5E7IA 1XLPA 2RGDA 4NYMQ 4RD4A 5CIQA 2A5FA 2GHIA 4C0HA 1HA3A 4WBSA 1R7RA 3TMKA 1FXAA 3F8TA 4Q4JB 2FPLA 1L5PA 2AD5A 4URUR 3NC0C 1G3RA 3CKLA 1WCV1 1M8PA 1G291 3LFUA 1CJVC 4XTCS 2PEYA 4GDFA 1ZUIA 4D2IA 5C4MA 2AR7A 4IOLA 1OV4A 4OI4A 1IY1A 4ZDIA 1T8TA 2ZREA 4UQOA 3VRAB 1KSHA 1N2CE 1XXHB 3GLHA 4MQBA 1DAHA 4LPKA 5DYIA 4CEJB 5EE3A 2KJQA 2OBLA 3FMIA 721PA 4KCGA 2O0HA 1X1RA 3SS8A 1GTVA 1AIPA 4EPYA 3BH0A 3ZZUA 1Q12A 2F1HA 2F43B 3W3AA 121PA 2GAOA 4EJSC 1PFDA 1G64A 5FPYA 3THYB 1Z08A 1E99A 3HPQA 1N6RA 3KKQA 1NI3A 4TSFA 4F38A 2I4IA 3BORA 4NCHA 2XB2A 5UKDA 2FE4A 4IXNA 5HTKA 1NG1A 1NLZA 3GFPA 3WBJA 1T5LA 5TY0A 1G8HA 1VYTA 2V9PA 3RS4A 2ZJZA 5JRZA 2J0SA 3AH7A 2JA1A 4TN1A 2AXPA 3CX7A 1NMXA 1OH7A 1YRAA 4RSGA 4OJQA 2Y8EA 2ZRKA 3RRNA 2B7BA 1D5CA 3I32A 1RVDA 3B2GA 1NN3A 2FFBA 3LXRA 3SDZA 3KXIA 4OQXA 2CVFA 1V5WA 2DWPA 5FTMA 2YKGA 2EYQA 1OXUA 1W49A 4B34A 1XRJA 1T3LA 3AEZA 2QY9A 3S1AA 1E2IA 2V54A 1W36C 3Q5DA 3AE6B 3ZLJA 3CF0A 2ZRJA 3W6PA 2N42A 4NL4H 2HEIA 1TQ4A 2QMOA 1TTTA 821PA 2QPAA 4DDTA 1R0ZA 4LHYA 4PPGA 1NG9A 4M1TA 1IONA 4PSVA 1YR6A 1A70A 4RY2A 5DSZA 1TMKA 5J4HA 4TYWA 1KI6A 1CS4C 1G6OA 4LYFA 3GQBA 1P62B 1G8PA 5LPNA 1E1RA 1T4GA 3VR9B 4BFVA 1Q1EA 2WVJA 2A78A 2ZE6A 5GJBA 1UEIA 3QSYA 3CH5A 4QGFA 2IUTA 2AK2A 5LB2A 2C04A 4C4PA 4QC2A 2GBLC 2BV3A 3J81k 4B35A 1FX0A 3CX6A 4FMDF 2ZS8A 3K0EA 3L0OA 2QPTA 4FMDB 4FINA 2PJRA 5EQTA 1JNYA 1LF0A 2NO7A 4LYJA 4OHZA 3R7WB 1EK0A 3QKUA 4Q00A 2R44A 3OIVA 4HUQA 5HKKD 2YWGA 1E2PA 1KMQA 4FD2A 2E9SA 3EZ7A 1XFAA 2WWIA 3SBEA 4DLWA 3X1DA 1KOFA 1KI3A 2IF0A 3CF6R 3CBQA 4PAMA 3FKSD 4MRVA 3TJZA 4B3CA 1GIAA 3U44A 2K5UA 1G7RA 2OFOA 3TE6A 3I73A 2X2FA 2J59A 2YZ2A 3KQUA 3U6KA 4A9AA 3A4NA 4TYNA 2ZE7A 4Z51A 4B3GA 1TQDA 4L15A 1CR0A 2G1JA 4QBHA 4TMKA 1AS0A 3MJRA 4LTUA 1YHNA 4OKSA 5EP2A 2HTME 4R2IA 3ZZTA 2YOHA 1IXSB 4YQFA 2VP6A 2G9NA 1ESNA 2IYQA 2P3SA 2F55A 4MGIR 3EZFA 5EP4A 3BRWD 3U7GA 1DG1G 1K6MA 3IHWA 4JLVA 4LJ5A 4A4DA 1X3SA 2ONKA 1P2TA 2ONJA 2BS4B 1SXJB 4LUCA 5FPKA 4P4SB 5FPHA 2H89B 5F98A 1GL6A 5H92C 3BOSA 2RGNA 4RFSB 5CYOA 1FRDA 1UBCA 4RVCA 4EKDA 4PZZA 3ZH9B 2AX5A 1KI8A 4GMDA 5F9FA 1G5TA 2FA9A 4XWAA 2W6JD 2JJ8A 1JJ7A 1FQJA 4CIDA 1NN5A 5G53C 2JLZA 1ZOYB 2J46A 1DS6A 2MMGA 1DBSA 4BLOA 1XTIA 2FFQA 3PEWA 4URYR 2ZI3A 4LJ9A 1XEWY 1XZQA 4Q4AB 2QAGB 4P31A 4DXAA 3THWB 3WMEA 3WYAA 5JEEA 3W5UB 3I62A 2RGGA 4IOJA 3PEYA 4OQNA 4KV9A 2ANBA 1GFIA 2BBOA 1LV7A 3VKGA 5DNYB 2X77A 5K8UA 1EXMA 3KWLA 4PSAA 4BWYA 1IOZA 1Z47A 1ETUA 1FXIA 3IIMA 2LCFA 5KYKA 1NN0A 1YJJA 1YZUA 1P72A 3IHLA 1CR1A 1BYIA 3LNCA 2B8TA 3W34A 4XD7D 4C0KA 1GKUB 1TF5A 1KHTA 1EWQA 4N59A 2WBLC 3KQLA 2GJSA 4PPNA 3IGFA 3DM9B 4ACAA 1CTQA 2VO1A 3V4FA 1N61A 2ZROA 3AKEA 2UZ3A 4ACBA 4L9WA 2OCAA 1E2LA 3ZIAD 2P5TB 5AUQA 3ZVNA 4XVQA 1N60A 4PHFA 5KO2A 2O8DA 4HLUA 1VECA 2IF2A 4HRSA 4PR0A 1PDXA 4PPQA 1CEEA 3NG1A 4MRPA 1N0WA 1NVWQ 3PG5A 1HT2E 2XEXA 3W8NA 5HR5A 1T5IA 1ZP0B 3RS3A 5DO9A 3CX8A 3GJ8A 5AUPB 1QHNA 3U7EB 5KTYA 3PCRB 4EPWA 3CWQA 1E1QD 1KO1A 4YMSA 2ZJBA 5FI0B 3M0EA 2W00A 2HXYA 2FWRA 4DIDA 2VHUA 2A5GA 1T8UA 3B1XA 4Q9HA 5HKKA 5FBLB 3O47A 2O8CB 3OE7D 3TSZA 4Q9IA 2FFAA 3EIHA 2AK3A 1KZ7B 2AKYA 2G0NA 2WAXA 3RAPR 4JLPA 4DSUA 2ERXA 2E87A 2RKOA 2Z6VA 2OHFA 2VHCA 3T15A 3KB2A 4Q66C 3WHKA 4BECA 3RS7A 3AF0A 1W4AA 1W0KD 2FGKA 1W7AA 1NJFA 1G9XA 3TQCA 4ZDKA 4AI6A 2GCOB 1VG8A 2VQSA 1KNQA 1E9AA 2REBA 3GEEA 3RS5A 1XPOA 1F2UA 1VTKA 2XNSA 4JLAA 5IF9A 2PT5A 2ZRCA 3LVRE 1JEEA 1W4RA 3CLVA 5CIWA 1VCIA 3TK1A 1OHHD 1II0A 1VG9B 3HU2A 1E2GA 4QL3A 3NVYA 4LHVA 4FN5A 2H57A 4MA4A 3UMRA 4US0R 2CJOA 3KJGA 1UWMA 1P2VA 3EC2A 3LH5A 2IHBA 3FDIA 3NHAA 1ZM9A 2YHSA 2D74A 2PKOA 4HLCA 2PBRA 3T5GA 1KMHB 4Q1FA 3U7FB 1ZVQA 5L3RA 2PX0A 2X1VA 1RKBA 4A82A 4JIMA 3OIYA 1NYRA 3AVYA 2P6RA 3D8BA 2GJ9A 4TL6A 3ZS8A 2YJTD 4TMTA 1E4YA 2F1RA 4B44A 2QL6A 2AX4A 4B32A 4XWOA 1YZLA 1P3JA 2ASEA 1TU3A 4QM6A 2LEKA 5D3QA 1ODFA 1XTSA 3U60B 2ZI4A 2CCGA 4RD0A 2BMEA 3R9IA 1P5ZB 4IVQA 2JJ1D 1T91A 3FC4A 2C95A 4BEBA 2G77B 4NONA 3T06B 2L83A 3IIKA 2OXRA 4Q4HB 4R98A 8OHMA 4O25A 4DUGD 2WPDD 3SYLA 4FXCA 2WLBA 1E69A 2BOVA 5KSOA 1PLLA 3CUEF 2FBWB 5C3JB 3OESA 1M7HA 2R2AA 4BGDA 2TMKA 3C41J 2ODBA 1Z0AA 1ROEA 4I1UA 3UIEA 2IYVA 1WRBA 2ATXA 4NDZA 2BT6A 1XNJA 1T6NA 2D06A 3B1ZA 3P32A 1ZP6A 5TVKA 1GNRA 1FP6A 3KXLA 5GVRA 3KQHA 1CRPA 3A37A 4YXDB 3PUWA 3BB4A 2NO0A 2W0SA 1NN1A 1IAQA 2C9CA 4LJYA 4L5BA 4PC2A 5EE0A 2BCJQ 1AK2A 5P21A 1E9RA 2PZFA 4AWXA 1MOZA 1WDTA 1NSTA 4Q5IA 3ND8A 1A5TA 4G5QA 1VHLA 1J2JA 3QVUA 5FUWA 1RFLA 3ZIAA 1KSFX 3SOPA 1UPTA 1DE0A 4FMCF 4QJ5A 4L16A 2ODNA 1XCMA 5F9HA 4O0MA 5EZ6B 5JLJA 1PZNA 2RGNC 3OZXA 3TSOA 5IHPA 5ELXA 1D2NA 2BIFA 3GJ3A 3F0TA 3QY0A 3E1SA 4ZIRA 2J0UA 3A4MA 1KRHA 2ZI7A 2QGZA 3QKRB 2MSEB 4LY6A 4RKFA 1IXRC 3RRMA 3REGA 4DZZA 5L3SA 4OBEA 4POAA 3FYHA 4ITKA 2EFEB 5JHGB 1E1QA 2BMDA 1JAHA 1G3IA 2D3WA 2GRJA 2ZSAA 1QDEA 2H88B 1MABA 4DIEA 5LD2B 1VIAA 3L0PA 4V0NA 2KB0A 3LA6A 4CT5A 3G5UA 2DFTA 3PJRA 1Y3AA 2GJ8A 1OYWA 2QT1A 4CEIA 1WXQA 3TBKA 1AKEA 4TWZA 1JQLB 5G3ZA 1U98A 4JBXA 4GFDA 5KSPA 2ZRBA 2ZE5A 4OK3A 4AK9A 1YJIA 5CB6A 2BJWA 1KO5A 1S9HA 4X8OA 1E9DA 1KAGA 1FP7A 2MJDA 4YTNB 3K0SA 5LB4A 4TYPA 1QHHA 1I7HA 1R8QA 3RPFC 3Q8XB 1K8RA 3K0AB 4TL9A 1T0JB 1IN4A 1JXMA 3WMFA 4C80A 1KO8A 2BEKA 3K09A 4QM7A 1OHHA 3KJHA 2ZRAA 1GDDA 2WJJA 4B74A 5CYPA 3EPKA 4DB2A 2IYTA 3P63A 1LY1A 3PQCA 3HVZA 1GRQA 1U90A 1YR8A 4KLZA 1QBKC 4TLDA 4QJ3A 2O8EA 1Z0JA 4A0FA 4DDWA 1YE8A 2OBNA 2PMDA 2RHMA 1PLJA 3O8DA 5AWFC 2IWRA 4YMTA 5JSZA 2H5EA 4DLZA 3VR1A 4Q9LA 4QHSA 5GJVC 1YJ5A 3R8CA 2O8FB 4JLJA 5E4FA 3DEFA 2WS3B 5C4GB 3UMSA 2WKPA 2DPXA 3KTAA 5FBRB 1N6LA 1HE1C 1YZKA 2VSFA 2FH5B 4LCBA 5CLQA 2VP5A 1OIVA 3O8CA 2GK6A 3NC1C 1VMAA 2OFXA 3BS4A 1D9ZA 2CHVA 3WYFA 4M9XA 3ZYYX 1OB2A 2JJ1A 1XEXB 4ARZB 3GJ0A 2GZAA 1VCOA 1ZM3A 2WU5B 2R65A 2YWFA 2ZRNA 3CPJB 3KXKA 1NL3A 4NYIR 2ZR7A 3BWDD 4WZAE 5HZHA 2WPDA 3PUXA 1M74A 5H8YE 4JT2A 2HF9A 4DSOA 4FMBB 3LW7A 3CIOA 1Z6TA 2EFCB 2IL1A 2IYSA 2Q9AA 1WQ1R 3ADKA 4YXWD 4RD3A 4Q1AA 4KYIB 2UVQA 521PA 3RABA 2XZLA 3HRDD 2FSFA 1XBTA 3TVTA 3A1VA 4PHHA 5FL7A 1NIPA 3L0SA 2ERYA 1L6VA 4ZDWA 5L3QB 3GLFB 2IXFA 2A30A 3AE8B 3QJYA 2C99A 3U3KA 5EUQB 4A15A 4CGZA 1E3MA 4GRAA 3MWYW 1ZD8A 3KJIA 2GXUA 1DAKA 2KSQA 2WWFA 2AWOA 4G5SA 3LQQA 1X86B 1FPMA 1RJ9B 2GVZC 2ZR0A 1BOFA 3NVZA 3GEHA 4YSZB 4Q21A 4TL8A 4KITB 1HYQA 3FMFA 2CLCX 4KFTA 4NZYA 4Q18A 3O8BA 4QBIA 3FPAA 2FG5A 3WRXC 1Q3HA 2DWOA 3MSXA 1G20E 4BUJA 2PCLA 3K70B 1IQPA 2ZR9A 2JQRB 5AR1A 1SIJA 4Q7KA 2K22A 3PENA 1NVXQ 4B2LA 5CJ2A 1II8B 3I3SR 1UDWA 3CH4B 2ZI9A 3DM5A 2OAQ1 2VPPA 5EXTA 4A8JB 1RRGA 4JBYA 5KHOC 1OH5A 4P4TA 4Z8YA 2Q21A 1DAGA 1HURA 5DI9A 2OCPA 3WRYC 3BE4A 4C7OA 1TUIA 2VP4A 2WKRA 1VJKA 2YNMA 4X8HA 4CW7A 1RYJA 4W7SA 3T34A 3LX5A 2FFHA 3PITA 4JZKA 4P32A 4F91B 5DH9A 2ZM5A 2OUKA 3HP1A 1JQJC 1MKYA 4TSFD 2IXGA 3W6NA 5TMPA 3BIFA 1XP8A 2JIZD 4JL5A 4Q4JA 1X1SA 4RCZA 4URVR 3TVDA 2IEYA 2X19A 1DO0A 4B6EA 1CP2A 3AVTA 2NO1A 3QXXA 2Q3FA 1MO3A 4BZXA 3L4PA 2GXSA 3LAWA 4TQUS 1QHYA 3BIID 2RGEA 2F1JA 2WMOB 3RNLA 1U9IC 5E3HA 2QBYB 3LBNA 2RGAA 5A0FA 3TGPA 1QLBB 3VR8B 4MKIA 1KI9A 4WWMA 1P73A 1XXHA 3EW9A 3MMPA 3SI7A 4CEJA 2ZYWX 4D6PA 2DFNA 2P2LA 1E0KA 2V6IA 3R20A 3AEFB 4HZUB 4LV8B 1JPNA 2O52A 5EUMA 1A2KC 3BFKA 2F43A 2GWHA 2YV5A 2WDVB 1MH1A 3SC3A 4BFUA 2F9LA 3AB5A 3THYA 1R5OA 1TL7C 4MGZR 2GJAA 1Z2AA 4CZ2A 5IDVA 3DMNA 4EJSB 4O2LA 1ZNYA 4U00A 1E2JA 4URZR 4ZCMA 5IRCD 4NYIQ 1Q44A 1XMSA 4TQAA 2FMXA 3GLGB 3RYTC 3BBPA 2IS1A 3HJNA 3PUVA 3A6PC 4EPTA 4JKIA 4MGYR 2PZEA 2XTNA 3NTUA 4IVRA 4R71A 4UNRA 5AUNB 3QXJA 3C4JA 2Q5WD 5SZJA 2OILA 1NKTA 3T35A 4A0RA 2C8VA 2CDNA 3TKLA 1OXTA 1ZCAA 1ZC4A 4ESHA 4YMWA 3HDTA 4LJ4A 4RD6A 3OAAD 4PZYA 1Z0IA 2ZVPX 1JXOA 1ZUHA 1XD2A 1KY3A 4V0ME 2IYRA 2DY1A 1KI4A 3AF3A 5FR2A 3AE5B 3QF4B 4QGAA 1MV5A 2QT0A 3EC1A 1XXHE 4PQYA 1TX4B 2BKEA 5JECA 1PLKA 2JAQA 2JDID 2YOGA 2J5XA 3SJZA 3DDCA 4RZ3A 3W8RA 3A1TA 2QG6A 3L43A 4C0JA 1RRCA 1KI7A 2C2HA 4ZI3A 2Q0HA 4P0TA 5TB5A 2H17A 2NPIA 1G8GA 3ICQB 1LW7A 4N6EB 4IDPA 2NIPA 5FPSA 2GETA 3CRMA 1QRAA 3GJXC 4BLRA 4TL7A 5KPJA 2G1KA 2G0TA 2YYZA 2ZETA 1R0XA 2YWHA 3HYTA 4MRNA 2GCNA 3TAUA 3QKTA 5FBWB 4X8LA 2B21A 3R7WA 2C5LA 1GITA 2AN9A 3L82B 1E9SA 3VX3A 4IEEA 4BEJA 4JYCA 3IEUA 3JZAA 4JSYA 1ZIPA 2J1LA 4EFMA 2ZRFA 1IHUA 4KO8A 3IQWA 3NXSA 4HAUA 2ZU6A 3PFIA 5KU1A 1GOTA 3MCAA 3SJBA 4LBWA 1OFIA 4EIWA 1NF3A 3KQNA 2FN4A 3MGCA 3LO5A 4BFTA 1P9NA 1WE2A 3K9LA 1GWNA 3FMOB 3O8RA 2BMFA 3QBVA 2JIZA 2JCSA 2JLWA 2VRWA 1MO5A 3LVQE 4MDFA 1G3MA 4C7ZA 1XMVA 3NH6A 2ZEJA 4HB4A 4A2QA 3BAFA 3K0CA 1Z28A 3CW2A 2DFKB 1NEKB 3H1TA 1GKYA 1NIJA 1AWDA 4WQMA 2ZYVX 5JRJA 1AGPA 1OXSC 1W5SA 2NZJA 1SXJA 2VYFA 4P4SA 3PO0A 3QNUA 4MRRA 1F5NA 4UJ3A 3X2SA 2ZANA 2VSOA 1PJRA 3CNOA 3EUB2 4IDIA 5JMTA 3AEBB 4RFSA 1E10A 3BERA 4MKFA 1JWBD 3GMTA 1WYGA 2NZ8A 1ZM4A 3LWNA 1NLFA 3CNNA 4DLYA 2ZUCA 2IYZA 4JVNA 1W4CA 5FTJA 4ASUD 2BCGY 2W0MA 1P9WA 4B2PA 2ZRHA 4PAQA 3MG9A 4AYXA 4QOSA 5JI2E 4MKGA 4AURA 3GLHE 2XAUA 4EFNA 2QMHA 1R0YA 3D3QA 3LXXA 4P3YA 4Q48A 3AVOA 1KI2A 4W5WA 1E2DA 3ADCA 2XGJA 4QFMA 2ZJ5A 4N3NA 2V7QD 4LOAA 1GNPA 2C03A 2NO6A 4C2TA 1NNEA 1P7CA 4Q4AA 4Q02A 3VU9B 4A1FA 4PQFA 3P4PB 2QAGA 4MGKR 1H8ED 3THWA 4B3BA 3P4QB 2B6HA 3B82A 3WXMA 1RE0A 3A58B 4IOKA 3HWSA 1TEXA 4OK5A 5AUIA 1PUJA 1Z6AA 3ETLA 3TH5A 3QVVA 2MH7A 1Q1QA 3LW8A 4AKEA 3HU1A 4GOKA 3OAAA 2KAJA 4Q1BA 1FFUA 1OH8A 4P6VF 3GJ5A 3CR8A 1CU1A 2I3BA 3B60A 4HB3A 2GXAA 1U2RA 2OE2A 3SYKA 4JX1C 2J7PD 1SHZA 3QKSA 2CCKA 3CZQA 1B9RA 2QTVB 2JDIA 2BVNA 3W9CB 1AZSC 1UF9A 3P20A 2R6GA 1S4QA 2IX3A 3I8SA 1QT9A 3K8YA 2P6NA 4U02A 3VFDA 3CB4A 4DCVA 2CE7A 3LXFA 3C5HA 2GF9A 3K53A 1VPLA 2GJKA 3LD9A 2VF8A 2ZRGA 2QP3A 4JJZA 4QXAA 1T9HA 2D62A 1P75A 1VDZA 3FAHA 3RDPA 1OW3B 4RD2A 2IA5A 1K5DA 1OFTA 3PIRA 1W4BA 4UJ5A 2GKSA 2WWGA 1G8FA 5GJCA 5DN6D 4R9UC 4A36A 5TDHA 2X2EA 2NMVA 3QBTA 3AE2B 4HI0E 3AP1A 4DKXA 3GJ7A 2ZJYA 3PUYA 1IN6A 2IK8A 3C14C 1U99A 3BH7A 4GOJA 4UNPA 3NVWA 5JCZA 3EARA 4Q03A 1E0JA 2OAP1 3B9QA 2O8CA 4FW9A 4TT3D 2P65A 2REXB 3AECB 2OESA 2VHJA 1UAAA 2WOOA 1W46A 2VP9A 5EXPA 1DADA 3BGWA 3B78A 1KDOA 4D25A 1KSGA 2DWQA 3ETRA 1UKZA 4JL6A 3VHXA 1S3GA 4IEIA 2QN6A 3U4QA 4OK6A 2QA5A 2ZVQX 4GSYA 4DVGA 1RC8A 1TKEA 1ZNZA 3KDSE 1SVLA 2PZGA 1AJEA 2HUPA 1UKYA 2ZU0C 2VTKA 5AUOB 3EIEA 3VR5A 1QF6A 2GEUA 2ODWA 2J0VA 5AK0A 4DB4A 3ABVB 1BYUA 1GZSA 2JLSA 3RS2A 4YC7A 1F0ZA 1AQUA 4NKRA 1ZM7A 4UNSA 1YKSA 1KMHA 2DB3A 2JJ2D 5FR1A 2X8AA 1QHIA 2LWIA 1F60A 2ZSBA 2CNWD 3V4RA 2DR3A 3WCQA 1IM2A 3LRPA 1E98A 4P4UA 1S2MA 4G5OA 2XOKD 3WY9A 1HV8A 1NY6A 4FCVA 4BLTA 3BH6A 4V03A 2OLKA 5CM9C 2O8BA 3B9JA 3EPJA 3RWMB 3VR3A 4ZDJA 2QORA 5EP1A 4ASUA 3CWIA 1JROA 1D6JA 2RAPA 2QP9X 5IK2A 3KL4A 1VKJA 2O5VA 3AKDA 3I4LA 4BFYA 4EPVA 5KDDA 2KBFA 4M1YA 4CT4B 3IDQA 5GADl 1S96A 1Z0FA 1ZAKA 3AV0B 4Q4HA 1HTWA 4GP6A 5DI3B 4B3DA 1E9FA 5KUTA 2V7QA 5H68A 421PA 2R6CA 2WAYA 1F6BA 1Z83A 1G1MA 3KJEA 3MLEA 3IUYA 1NENB 4OYHA 4PHGA 3VKHA 1H8EA 3QF7A 1N6HA 4QKQA 4JLBA 2G83A 3IBYA 4HZIA 4RJLA 1HQCA 1G7SA 1W44A 2YC2C 2OM2A 5JHHB 3PEUA 2C9YA 1KTVA 4JLNA 2CLDX 5BXQC 1N25A 4RZUA 4DSTA 2XXAB 3GJ4A 4I81A 3KZ1E 2VEDA 2Z43A 4Q47A 3FGNA 3LY5A 4FI3C 1II9A 4HROA 1QVAA 2H1LA 2EFGA 1XCPA 3W9YA 1YQ4B 3NEJA 1VCNA 1Z8FA
chains in the Genus database with same CATH superfamily
2NU6B 1Q3TA 1KYVA 3FRJA 2XD9A 1E4EB 5LQDA 3DVAB 4HUTA 3DDSA 1ZITA 3A2NA 3CO5A 4LJ7A 2VA3A 3N1ZC 4ZTZB 1Y8CA 3B1WA 4NY1A 2KZMA 3IMCA 2J52A 2JHFA 1RFAA 3F5MA 4MUGA 3EVTA 2GM3A 3KBOA 3LUBA 3L7IA 5JUMA 1RCFA 4RNDB 2BPCA 3QPUA 1L4FA 3KKPA 3Q9LA 4I2HA 2OHVA 4QJ4A 2EZYA 4J75A 4OLJA 1HPLA 4K6FA 3MRTA 2UZIR 3G7NA 4R9RA 4ZC1A 4EY6A 3HNPA 5A62A 4YG2A 3TQOA 3ZWMA 4Q3CA 4PLYA 1XLTA 2LKDA 1SF0A 1MMFB 1QIIA 1W75A 3C5GA 4PIVA 3D3EA 4WXPA 3AVUA 4ZAWA 4NBVA 4DSLA 1U3WA 5L45A 1G5PA 3UK7A 2CE2X 4C88A 3GLFA 1X6VA 5KAIU 4GP7A 1C7YA 5INTA 1Z5GA 2N3ZA 3FLAA 1MC1A 2LW7A 1EM7A 5AI6A 3EXIB 3EQ6A 1TE2A 2OQVA 4EG3A 4D8WA 2CJWB 1RKVA 3S44A 4LF6B 1Q16A 4I2NA 2FN7A 5LNK6 1AZTA 1II8A 3E5NA 1XWIA 3RWBA 2XDQA 4C7VA 1DZ3A 3NUHB 3K2IA 2C97A 5AQEA 5L9XA 4XDGA 1PR4A 3T3OA 4B3XA 1ZQFA 1T3HA 1DIGA 5JTUA 4QZEA 2HSEA 3A14A 2A14A 2QZ4A 2XVTA 4I55B 4BMYA 2WM9B 1C0EA 1RZRA 2XN9C 2N47A 1IQ0A 1BEUB 4BNUA 5I5EA 3IPLA 1AA9A 2PYDA 3F78A 3TEXA 4LJ6A 1V35A 4IOMA 4REMA 1IPFA 3OZDA 4Z0HO 1SU6A 2ZSIA 2I65A 4J76A 1Q2XA 4KGVA 2P3QA 4KUHA 5KJEA 3WE7A 3CVJA 2CXXA 4LX8A 4IJKA 3JD3A 3HHMA 3R77A 1AARA 2J9FB 4G07A 2YYSA 3AJDA 1DUIA 1NW8A 3LIIA 1ZJYA 4M0MA 3TX6A 3O83A 1NJ8A 3EGEA 2NYUA 2P6UA 3NYRA 2OGUA 2HOIA 3TD6A 3MMXA 1UA0A 4W5JA 4ZOEA 5FUYA 2ZM6B 1CY6A 4YJ3A 5D85A 5FTNA 1J19A 2AS0A 3H87A 2GESA 4ZV7A 1AH2A 1E32A 2HK7A 4XE5A 1LD3A 2ZUDA 2BDPA 4CMKA 5KYWB 5T8KC 2ZYRA 3Q40A 1YMVA 2ZUSA 2BR3A 1EGHA 5C1DA 4RF1A 4NZOA 2DPJA 2Z2JA 2FF7A 1HM5A 4DWOA 4IJWA 1PGOA 2XEDA 1NI2A 4M98A 1T4DA 2H4HA 4P7JA 4C3ZA 4R7TA 3CTMA 4AECA 3H5IA 3K0KA 3ZVMA 5GV7A 1VYVA 1A9YA 4P4PA 3L41A 5AJZA 3VDRA 3S2EA 1P5HA 4WW0A 4B33A 1P0QA 2GPNA 2O2DA 1NZJA 3AY3A 1MB3A 3D8TA 4LNIA 3H17A 1ZBDA 4XIIA 4ZRPA 5AW9A 2ZBGA 2QMQA 4K1XA 1UC9A 3GFKB 1O2DA 4BO1A 4JP2A 4EZEA 1XSNA 3E15A 1J0GA 1CP3A 1YRBA 3RFXA 1CVLA 4EG0A 1FFXA 3OA0A 3IHPC 1OXVA 1CDOA 2FZCA 1UJ6A 4MB2A 2ORED 3QQ5A 3JS5A 4GZMA 1NJSA 1WKCA 4UPEA 3Q5EA 3UIPB 3CH6A 3F73A 1XJQA 2C7RA 4O0IA 2FEWB 4AKHA 1N62A 1T6BY 1OGJA 1NP7A 1WXMA 4Z2YA 4FYPA 1RRVA 4KR2A 4G8CA 1ZWLA 2WFMA 4D9HA 4HEJA 4TLMB 1E94E 1GZ4A 1OLSA 4DLRA 4YQEA 5GXGB 1TAHA 5E8JA 1L8AA 1X1BA 1J0CA 3JR3A 4IV0A 2VK4A 5T3YA 1G19A 3TEYA 3NUZA 2BWJA 2RGCA 1I0IA 3JPSA 2BBSA 1RPZA 2JMGA 5L7YA 3ROFA 5IT0A 3I3TB 4WJZA 1BU5A 2QN1A 2JATA 3ZV5A 1DC7A 3ZCVA 1EVJA 2KWDA 1HTTA 2WJHA 2PEZA 3D59A 3RHFA 3KVOA 3AGQA 1ZD3A 1XPJA 4QRIA 7ICUA 3SNKA 2XB4A 2L0FA 4HYYA 4I1PA 3H0KA 3H05A 4JDUA 4O3MA 4ED9A 2B94A 1CDEA 4RFVA 1JQKA 3MJVA 4US1R 4HEA6 2ZSFA 1B74A 3VKVA 2DYKA 2Y1FA 1P9DU 4D9IA 2IO3B 4DRXA 1DC4A 3CZRA 3ZD9A 5DPRA 4K9SA 1D2AA 3GIIA 1AYFA 4EDFA 4JQWC 1Z15A 3PCXA 2GCPA 2YWBA 1N6ZA 5EFOA 1IXRA 2DF4B 4DS4A 3AC0A 3ILXA 4R9SA 2YWXA 4O33A 3C6BA 2KTRB 3P2OA 3DV0B 2QM3A 4DM4A 4IDBA 2HBKA 3AKZA 1I7QB 2QHOA 5AHKA 3L6EA 1G5HA 1P0FA 2VPWA 3BE6A 3RFVA 4RQ6A 5EIEA 1WB9A 3KWVA 4KAXA 4BO5A 3ER6A 1SVIA 2LUMA 2F1OA 4AJWA 4ZT5A 1E1CB 3V34A 2I2CA 2OV2A 3LBIA 2CB0A 2VYNA 1WGDA 1U0FA 2ZOSA 3I5JC 1C3OB 3EY4A 4EK9A 4U4AA 5C0OE 1GGVA 5HSGA 4PO1A 2FJPA 4LQ4A 1NXXA 1XZPA 1LVGA 3LLMA 1B6SA 1K4KA 1CUVA 4KVGA 1B7GO 2HV9A 4ALNA 2MA1A 4RGTA 1PS9A 4FBTA 1O4VA 5C1ZA 1Y0BA 3SBXA 2ZDGA 4MUHA 2PFQA 3IXQA 5GTIU 4RC9A 4GICA 1O97C 4GLJA 1KDHA 3JQ9A 1H3FA 1W29A 1ENFA 3NWOA 1I2ZA 1A7JA 2WF9A 3JQBA 5MF6A 1RACA 5M34A 4UREA 3QYAA 1N5XA 2QZJA 3L7YA 4DF3A 2Q5OA 4RZIA 5CP2A 4TKLA 3EPIA 5IIKA 2KZZA 1QUFA 2BM8A 1N6OA 4KAAA 4OXRA 4HXDA 2MSDB 2OOBB 1W6RA 1ZRSA 1S8FA 1TCBA 4ZD6A 2MDTA 5EYPA 3DFZA 4IGFA 3AV3A 1UBGA 3C28A 5KFBA 2WA2A 2O2VA 2X7JA 3L6UA 2FU5C 7REQA 2IYXA 4LLGM 4HAVA 1UF0A 2RFLA 4UOZA 2JZCA 2AN3A 5CA7A 2MJ3A 2A1TR 3SEBA 3V2UA 1GUDA 2FQQA 1YR7A 3LC0A 1G4UR 1N6KA 7ICFA 2YWCA 4D96A 5K0EA 3F2BA 1FM0D 3EHDA 1VFNA 4WXRA 4QOGA 3IVFA 3KPUA 2YOFA 3GAFA 1UDCA 3GN1A 1ZD5A 2BDTA 5J23A 4CF7A 4CMAA 3OE7A 4PAWA 1EVLA 1Z1BA 4A8JA 1G3UA 5IBQA 3VR4D 1QWSA 3NDPA 4IICA 3I92A 3PXDA 1AGRA 2HU5A 1SIOA 1P60A 3KEGA 3GWZA 4R83A 3HDHA 3GLFE 2C00A 1ZH2A 3P9KA 1NU8A 2J41A 2EKDA 4HVLA 4R0NA 4CM1A 1IJEA 4AN1A 4LCDE 2ATEA 1UBEA 3VI3B 4D3DA 5FFNA 5DASA 1XZKA 5J4VA 4E71A 2GGSA 1G20A 4AVYA 3DBRI 2XW6A 2AQKA 1PV4A 3G89A 2FUG1 4E6EA 2RHJA 3KQKA 3P9IA 3FPEA 5JZMA 1V3UA 1Y8AA 4GXQA 1IH8A 1CUUA 3WKEA 2WP9B 3C8MA 1RAIA 3RC8A 4S1TA 1GZUA 3BMOB 1EJ2A 3DONA 2V3CC 1PEDA 2KN4A 1DBWA 1NVUQ 4NYMR 4Y2QA 4ZKDA 5A3QA 5ALOA 1OLUB 5E6SB 5F3XB 1MJHA 4UAGA 1X94A 2Y66A 2KWVB 5JWRA 3EB9A 3OIWA 3FCSB 2OCDA 2KWCA 1AHIA 4KX3A 3ZWDA 4ESEA 2E1EA 4JBIA 1YJBA 3MAJA 3L3BA 2XQIA 3VQTA 4TQSA 1M1ZA 4BMZA 3ZY4A 1FDTA 2LDXA 3GQVA 2RD0A 2R8GA 4FHZA 3LQ2A 3PA8A 1IULA 3NT2A 2H3FA 4Z4FA 3SY8A 4EHHA 2FRDC 1IBMB 2XMQA 1DAMA 2G4VA 4HGYA 4PZ9A 4ZC8A 1LBSA 3RUIB 3L13A 3IG5A 2FUHB 4RQTA 3ZPXA 2I7CA 3V9PA 2B7CA 3TR0A 3SNHA 3OUZA 4DV0B 3L7NA 3DZJA 4WOBA 1GO2A 1FXAA 3VPHA 3VH2A 1GAWA 1A88A 4YK7A 4HZGA 3A06A 3NM5A 3AETB 4FHDA 1F12A 3ZO5B 3U16A 3L0CA 4DHJB 2FEXA 3FMIA 1KC3A 2BCVA 1NXOA 3AEVA 1JS1X 8ADHA 2KV2A 4KRXA 1OD6A 5ADUS 2XB2A 2YVQA 1YQBA 3WYCA 2JA1A 4P5EA 2AXPA 1YRAA 1RWWA 3H9GA 1ZMRA 3U7RA 1NN3A 1K7SN 4MI3A 4OQXA 4CM3A 1QGDA 1ZOPA 1XAHA 1E5VA 1XRJA 3S1AA 2WF8A 5J2CA 1IONA 3EOBI 3AR9A 4QWDA 3IM1A 3V1TC 3ZDTA 2Q45A 3GQBA 4H59A 4QGFA 3L8FA 2ZUTA 5BSGA 4CM4B 1PU2A 3RFZB 4QUBA 3SR4A 4DWVA 1H9BA 3BHJA 1E2PA 1MG4A 1KXJA 5C1IA 2GERA 2QJFA 3H19A 3AK4A 3CLUC 3VPXA 5DWVA 2MBHA 1G7RA 4X93A 2HSZA 4A9AA 1GYPA 4B3GA 4Y6OA 5C5IA 4ZZ1A 2JJQA 2HTME 1XTZA 5DHPA 3EZFA 5EP4A 4POOA 3MJTA 3N39C 3IHWA 1K6XA 1P2TA 3E3MA 2EZZA 4S1VA 2PZMA 1SUPA 4JI1B 4EKDA 4G3IA 5KCMA 2CDAA 2FA9A 4M0KA 4E5NA 1WX7A 3ZJUA 5BV8A 4RGQA 4F2DA 3A0RB 1N5RA 1X80B 3C3YA 4L76A 1I80A 3WYAA 5JEEA 4JLCA 1HIWA 1QYXA 4HTFA 1PS0A 4TOIA 1YJJA 5M3BA 2OEHA 3KVNA 3JD2A 4MVJG 4P7FA 4GR5A 4ACAA 2GN2A 2QJRA 1N34B 5CUQA 1GG3A 4R1LA 3BRSA 2PAFA 1Y82A 5DGIA 1O9HA 4TTJA 4MRPA 3KQWA 5CXQA 3WGJA 1M1UA 3UENA 2B1QA 4D9NA 5TPWB 3KXPA 2QTRA 1NJ6A 3AUFA 4CQMD 1DTWA 1DC5A 1DNPA 1JRLA 4MEYA 4K4HA 3VHXB 2JGEA 2C0CA 3ICXA 3VBCA 2GCOB 1EK1A 3VSEA 3PSIA 1URPA 2JVIA 2IEIA 4HH4A 4PLHA 1NTOA 3OLQA 4RK6A 1VSVA 3IR5A 2D1SA 3LH5A 4WN9B 4X20A 2IHBA 4GGPA 3JQFA 2ZIGA 4DNPA 2L42A 1RKBA 3K5WA 3FH0A 2YJTD 3MJFA 1RXWA 2IHNA 2LEKA 1KAQA 1ZI6A 2JJ1D 1SU7A 4I6EA 1T8RA 1UOEA 3HBAA 4PFJA 1CUYA 3DV9A 4MVJP 3OJOA 5D87A 4MSUA 5KVQA 1YA4A 2ODBA 2AJCA 4RQ8A 1XNJA 2FMFA 3B1ZA 1SG0A 5GVRA 3L93A 3IAXA 4QBTA 4U2EA 8LDHA 1IAQA 4U7FA 1UKBA 1CUEA 4FR2A 4UMDA 4DQIA 5KNDD 5JH7A 3Q3IA 4TWIA 3B2NA 3SOPA 4A3SA 2EV9A 1PL8A 4IWQA 4K05A 4LGYA 4UBLA 1W85A 1IU9A 1P7DA 1Q7EA 3O94A 3GYBA 2YUIA 2ZI7A 2QGZA 4LY6A 4I8IA 3REGA 1LLQA 3GFQA 4WAFA 3K20A 3QP9A 3DDZX 4Z9BA 1JLKA 3HN2A 3VUFA 4B84A 1VIAA 1W5EA 4YUZA 1NJXA 4HGPA 4HMQA 3N3BC 5JNRA 1XKQA 4KLUA 5LU8A 4JASB 2PWBA 2FMSA 1YE5A 3HVHA 4PYMA 4R69A 2ZRAA 1I4HA 2BQ3A 3BX1A 5CYPA 4ZFNA 4Z6KA 3BZCA 3P63A 4U7PB 3CVWA 1U90A 4KLZA 3OLZA 5AWFC 1PLJA 2H5EA 3VR1A 3C7TA 1LV5A 4QHSA 2VWQA 4IMPA 1L4GA 2DPXA 4LCBA 4BTEA 1YI1A 4IW0A 2PK3A 4MQ5A 4UEKA 4HT3B 3T52A 1QKZA 1IVYA 3K4PA 4M9GA 1C8BA 1TMGE 4C2AA 1ADFA 3P2JA 1EMDA 5AHOA 5J8YA 2EANA 2CFRA 4DLLA 3U37A 2ERYA 4QQRA 3U3KA 3H1BA 1V1PA 5ALTA 3IQGX 3KJIA 2WAMA 3OU7A 1DLIA 1DYQA 1WWUA 1QK3A 1I1QB 4UOQA 4I4TB 1D7OA 2BFPA 3WRXC 2WJ3A 1KZ9A 1G20E 4MPTA 1P74A 4CODB 2JQRB 2W9BB 3SYMA 3I3SR 4F5PA 1XMPA 1A76A 2L18A 4ZOAA 1CNMA 5DIZA 5DBHX 3FPCA 4UE6A 4CW7A 3KYIB 4Q15A 4P32A 4YCXA 5T67A 1X66A 3HP1A 3ZW8A 3WL6A 3DFUA 3PSPA 2PZ8A 2R7LA 4RSMA 5AW4A 2NO1A 4AJOA 4FYMA 4WRRA 3LBNA 1B1ZA 3EW9A 3E81A 4ALJA 3V46A 2DFNA 2RAUA 2VJKA 3DTNA 2DX7A 2VC2B 4HNSA 4J1SA 2PPLA 5KG2A 5GGYA 5C35A 3WGQA 4U00A 1TAMA 2P9TA 3EK2A 4HX5A 2IS1A 5K05A 1Y9DA 4XX1A 4AJPA 4IVRA 3GA7A 3KT3A 4XE0A 4QATA 3W04A 3KR9A 2YXLA 4ZRIA 1N78A 2CZQA 4HPXB 2DY1A 1U3UA 2WUGA 3QPBA 4PQYA 4PGFA 2JAQA 1R4NA 1C30B 4A3OA 2NXWA 4P0TA 4O4JB 1P2BA 3KXDA 3DYBA 1UBKS 1CYEA 3O8OB 5JRDS 1E9SA 1I9CA 5CXXA 1QV6A 1UR5A 4RNCA 4PONA 4KO8A 4WWHA 4AJ2A 3AMVA 1GUAB 2INPE 4NLNA 1FLVA 2JCSA 3EY9A 4CHGA 3CMMA 3N2NA 2ZYVX 5GZ3A 2QY6A 1R4MI 3DWGA 1E6UA 1PJRA 4P7KA 4I2DA 1NVFA 5FR6A 2NZ8A 4UMFA 1EP3B 2IYZA 5FTJA 4KXQA 2BCGY 1VJRA 4WWPA 4GLBA 5A0TA 3H40A 1KPHA 5C1PA 1IXKA 3SHTA 1IVSA 1T2AA 2NO6A 3NNDA 1HYEA 3CW8X 4KQFA 4BAUA 3GH3A 4DL6A 5AUIA 2BHSA 4AKEA 3A6GA 1GQRA 4BVAA 1X9WA 2OHGA 3B60A 3L7MA 4XA8A 5CB4F 1NYTA 3AZQA 3O65B 1XRRA 2H1FA 2P6NA 1K1EA 4DCVA 1G2PA 2QDXA 1Z12A 3UQBA 3NTRA 1Y1TA 3GFFA 1OFTA 1M3SA 4DYHA 2Z7JA 5E6NA 4K03A 4GOJA 1CQWA 2Y9MB 3LPLA 4F7DA 1JDNA 5EXPA 3KVFB 2ZDHA 3TTVA 4D25A 2C7MB 1KSGA 4JL6A 1I1OA 2QA5A 1E1DA 5IDYA 4GSYA 1RC8A 3C3AA 2Y27A 2JI7A 1MA3A 4TVSA 1AJEA 4TVKA 2DVMA 4BQFA 4ZRJA 4QZVA 2K7ZA 9ICBA 1GPJA 2RK3A 1S3FA 4INJA 4MJ7A 1KMHA 4G0UA 2RB5A 3H2GA 2A3VA 2LWIA 3SE7A 1F60A 4G4GA 5BPFA 3V4RA 1G38A 1E98A 5IAJA 1GOZA 4M89A 3MSCA 4M2YA 2XT6A 4B3DA 4DFKA 2WAYA 1F6BA 1G1MA 1H8EA 1NQWA 3QF7A 1Z00B 2OPBA 3N2YA 5IARA 5J43A 1G7SA 3AEKB 3S3TA 1QG0A 5U1PA 2XXAB 3DXXA 3PUHA 4LFAB 3W9YA 1XZGA 1OJ7A 5KTRA 1TKCA 1QOGA 4UUPA 5DDIP 1XN4A 1D8TA 2J5QA 2WHXA 5JQGA 1D1SA 3WB1A 4B3RB 1WW3A 2G08A 4MYSA 5B7GA 4TMAB 4DLBA 3QRWA 4A1OA 1EI9A 4ZH4A 1JYSA 4RSRA 4K0RA 1T35A 2IYWA 3PSTA 3K71B 5JTTA 1ZHHA 2W8BA 1QFXA 1V8OA 1X74A 3SLGA 2O3RA 1RS0A 4GXJA 3FMPB 4JAVC 3AP2A 3AVWA 5K99A 1TEVA 4MZDA 4K3UA 1MV8A 3Q3GE 4Z3OA 3TR6A 1N77A 1NI4B 1GR0A 3KB8A 5JH7F 5EI5A 5KFVA 4UXJA 2WIBA 4YRAA 3TB4A 4ED1A 4Z6FA 3G6KA 2W2VA 2WF6A 4NOLA 4C14A 2IYUA 1AB5A 2E3JA 3PYMA 1UBFA 4IR1A 2HZBA 3SIWA 4L5CA 1ZD4A 3AUJB 3T7KA 1EM6A 5AZGA 3BJIC 4DF4A 1EZ4A 3FWHA 1MJNA 4E5VA 4ERXA 2EKQA 1KL9A 1CJKC 1I5RA 1P1HA 1CBUA 3A9KB 4E13A 3THSA 3QXSA 3AOEA 1DJMA 2E21A 4X60A 2JRCA 1NGSA 3VVBA 3H18A 3RNFC 2QXYA 4OM7A 4KSBA 1TBEA 8ICKA 4LF7B 3P97A 4B76A 5J0SA 2VDQB 2I66A 4J1NA 3IP5A 1SIUA 1L4MA 2IDZA 1GPH1 1OX5A 3H5WA 1YB4A 4QTZA 1SXQA 2Z4TA 3D8NA 4E6PA 5BVGA 2JLVA 1R0KA 4U7HA 3D31A 2DMRA 3DAYA 3EXFA 4D4GA 4Y2TA 1JG6A 2QOEA 1R8YA 3B6EA 2DR0A 4FNAA 1E62A 1CJMA 2HXSA 3UT5B 1QE3A 3UWKA 2DHRA 1I10A 4O9MA 1V45E 2CXNA 1VJ5A 5IVDA 3ILYA 5FAXA 3VRBB 3AERA 1RT9A 1X3LA 4EUEA 4JLMA 2GBJA 4M9JA 4FSDA 1KI1A 4F4XA 5EWFA 1CS0A 1JDSA 2KQUA 2YDYA 5DN9A 4AIIA 2PVGC 3LHIA 4WXYB 4LWPA 1EWYC 3QVOA 5J2HA 1SN7A 2CHGA 2EU8A 4FDMA 3BE8A 4JQYA 2XE7A 2VSNA 5G3YA 3RBVA 2VZEA 1U6JA 3KELA 4LWZA 3RF9A 4PGHA 1X7DA 4YIKA 3BEDA 2Y3AA 1QHHB 1X19A 4FNOA 3NH9A 4CWAA 4U7CA 3I8OA 1SXJD 3LUDA 2XYVA 1P1KA 3UJDA 1Z07A 5L95A 3DO6A 5BN4A 4IIXA 3ZDQA 3CCFA 3TRHA 3D4OA 3V48A 2J53A 4K6GA 2IHKA 3NBKA 3C45A 1QC5A 2WWXA 2PS3A 5MPOA 2Q7DA 2PDAA 4RGOS 1FSZA 2DE0X 2V6JA 2CL7X 2BI8A 2GDJA 3VZCA 3IEVA 1XRQA 4LRQA 3C5FA 2I2FA 3SVZA 2O6LA 5JAHA 3ROKA 1WL8A 3Q10A 1U5BA 3I53A 3BXGA 4KB5A 3W1SA 2K6QA 4D9EA 3GRAA 2JIDA 1ULTA 3SSOA 3TQIA 4OBWA 2YUTA 4XM2A 1G5IA 3LWZA 1E58A 1JB1A 4RDXA 4NWIA 2D0OB 4XJXA 4XR9A 4EZ9A 1YDEA 4AKTA 4Q01A 4K7WA 2NWQA 3QIAA 3PV1A 1Z1VA 3DS8A 1F52A 2EERA 5BUZA 2V74B 3EDQA 1T0YA 2V97A 1FTYA 3MTIA 1ONPA 3O1HB 1U0EA 4DR1B 4N3AA 1BE0A 5SYAA 4BWFB 1G5RA 4DSNA 3V62A 3C3PA 3WL5A 4BXOA 2NVUB 2XWJI 4J90A 2FR1A 1N2CB 2HDNB 4WSOA 1OAOC 1H6CA 3ROTA 2JFXA 5K01A 1V6CA 4BJ6A 3TX2A 4MRSA 4LZLA 3BHNA 3LY9A 4WK6A 3LK7A 3DP7A 2F6RA 2PBZA 4US9A 3AM9A 5AK4A 4YFVA 2W37A 5CXUA 4D0RA 5ITZA 1XVAA 4K4GA 5CNIA 2YS6A 5BRAA 4ITUA 1BXRB 5CB8A 4TUSA 3G2PA 2WILA 4BNDA 3T6KA 1EXNA 4JMUA 2H1RA 4F3TA 2QPLA 4QZ9A 2UU7A 2FCMA 3FFAA 4AF6A 2QROA 4LWOA 3RC2A 5ILGA 3L6RA 3DO5A 1LS1A 1GPKA 4KX6B 5JS6A 3PSHA 2FKNA 1LX6A 3W1VA 3ZK7A 1Z3EB 3H7PA 1JG7A 2A9FA 3DFMA 1W8DA 1ZK2A 4FJZA 3A2KA 1GG8A 4JROA 1UMDA 4Y2JA 4KE8A 2PSEA 4CLOB 1ML4A 4I5FA 2GNPA 4I3GA 5G40A 4UU0A 1RQXA 3QVMA 1YRYE 2E1RA 4IG9A 3D6UA 4M76B 4YAUA 3TN7A 2BC9A 4CKWA 4XEHA 1L5QA 2EG5A 1G59A 4GBJA 5BR7A 3EW7A 3GIKA 1ULSA 2ZUEA 4K1LA 2XB9A 2XKJE 5JQGF 3PKZA 4KWHA 2CC2A 3KTDA 4KI0A 2NPTB 1A5AB 3I5XA 2KFZA 3TLMA 4OHUA 3QIVA 3T7CA 1WO8A 1D2EA 3EPGA 4NTZA 3ZGLA 1TC2A 3DZGA 5EIWA 5KYYA 4CKBA 3T4PA 5KNCH 2XI9A 1TQ2A 3T1VA 4P08A 5ALNA 1TGVA 1HC7A 2FCQA 4DN6A 1RWSA 4XYEA 4R1NA 1J49A 4PTYA 4CT0A 1FB5A 2JKYA 3QYPA 4QBGB 4LXQA 4Y67A 5HS4A 1MVOA 3WGLA 3T4UA 1VL6A 2LYAA 4EZJA 3I39X 3MMSA 3L8CA 4OEHA 3ME5A 1G8MA 3BMNA 4F3NA 3K1TA 2C4KA 4MJSB 1SG6A 4YRCA 1FYVA 4V3BA 1DC3A 4Z3KA 1SBQA 2F7SA 2D1YA 1M67A 5TSDA 5CBPA 4TRJA 1XN1A 3L8ZA 1LKYA 1KYIA 4LDPA 3Q9SA 4WGFA 1TO2E 3GLIE 3A05A 1KRXA 5DDMA 2BM9A 3VU0A 1HR0B 3WA7A 5F1OA 2OWEA 2M9NA 3B0AA 4P1ZA 4L9SA 1C76A 5L1JA 3C98A 1J4AA 3QSGA 2QRVB 3RRHA 4JA2A 4OLAA 3DA8A 5H2FU 5M04A 5DK6A 4MGEA 3AF1A 1L6NA 1T8WA 3FTQA 2BCSA 2IJGX 4G5RA 1YCDA 1JXLA 3EE6A 4XWGA 3UHOA 5HDBB 1U8AA 4KYTA 5LWHA 3W5VB 3V00A 1F4LA 2HF8A 4A2CA 3HG7A 1S4MA 3RANA 4CIBA 2R68A 1PSWA 3JU3A 4NAMA 2FJUA 3ITNA 5DBEX 3O2SB 3NJ4A 2W11A 4DAEA 1AB6A 2QSYA 5DT9A 4BWMA 3FDJA 1UBQA 2HN9A 3S8EA 4X57B 3BY4B 2H51A 5L51A 4LI3X 5LJIA 1Y89A 1W0JA 3A2MA 1ENZA 4J16C 3DOUA 3ZE7A 1F8YA 4XSHA 4WZAB 3KQQA 1NRJB 5IASA 2IHVA 1UHUA 2XRMA 1Q57A 5H70A 2AKEA 1J8MF 5D4BA 3B36A 4TQ9A 2IDYA 1PUTA 1RFGE 2FK8A 3GC6A 1ZKDA 3FYUC 4RKYA 2OO5A 4BCDA 3RBDA 1HDXA 1Z4MA 4BKTA 1IATA 2HCBA 4XM0A 3UJAA 2J4FA 1RXSA 2QDFA 2HLDA 4FBGA 2PSJA 1SVUA 3WNQA 5DNEA 3N59A 4QU0A 4C2BA 5LMCA 2P79A 4D81A 4A20A 1U4BA 4C05A 4QLOA 1JG1A 2QNBA 3AIOA 1QIMA 5B1DA 3SZ2A 3J81j 3FGPA 4BUZA 2WXGA 3IIJA 4YV2A 4F4IA 4DWFA 2IYOA 5K4GA 4IFBA 1ZN2A 3U19A 1MHHE 1LVUA 1MC5A 4PC1A 2CPRA 1P1IA 4Z5XA 5ALZA 3KFXA 1PFYA 1M0TA 1JX4A 3ODGA 3RT9A 2E49A 3W5CA 4C7OB 1MNQA 1KS9A 3AQFA 4LOHA 1ZXBA 4BNMA 3LG2A 2GHIA 1F2DA 5KHQA 3GZNA 4E94A 2CXTA 4DS5A 1R8XA 2JZOA 2E18A 2Z6UA 1D0VA 4ISCA 4KCGA 5K4AA 4CMJA 3VZRA 4KMOB 4QPJC 1THTA 2GAOA 4QUAA 3V6HA 1FYXA 2AI3A 3E4CA 4KVZA 2I4IA 1N57A 3NLLA 2BGGA 1RDFA 5LZ7A 2ZRKA 4XSVA 3KKEA 1V5WA 5I45A 4NENA 1C9DB 1W49A 1I14A 4URKA 1Z0SA 2A3NA 5EGNA 5A9RA 4DNXA 4EG8A 5DSZA 1XWLA 5HIJA 4O02B 4LG1A 1J07A 3TIIA 3OX1A 2K1FA 2OXFA 4GEGA 5LB2A 1YB2A 3CX6A 1MFWA 2Z1NA 2QPTA 4FINA 2OV6A 4Z9AA 4YRTA 4YRKA 5CEJA 1L7XA 1PNTA 4BQRA 4DLWA 1FFYA 2IF0A 3D1VA 2BKRB 1VPWA 2I1WA 4DNOA 3AHEA 2G4CA 1Y3FE 3APFA 2BUCA 2YN4A 4TYNA 4EKGA 3M6MD 2N9PC 3S7ZA 1CJSA 4A10A 2RJNA 1R6TA 2P9BA 4MGIR 3ML9A 4PYZA 3WLNA 4A4DA 2VJPA 1KY5A 2H89B 5EZYB 3IODA 3HCPA 3GZTB 5F9FA 5K7SA 2A1JB 1QPGA 3M81A 4ALKA 3AIKA 4J6IA 4XWWA 1B8UA 1JJ7A 4EEYA 4IINA 4UEOA 4AJJA 5KEIA 4TUYB 1D5MC 3MCWA 2IGBA 3Q0IA 4U7JA 4GS5A 4ECSA 3B1LX 4PLCA 3PGMA 3DOJA 3PGJA 3FPLA 3HCBA 2PGNA 4X71A 3CUKA 4FGJA 4QUJA 8ICUA 3COSA 1H6BA 4FONA 4IQUA 4KFCA 3SQMA 2UZ3A 5EUCA 4KC0A 3UJ7A 4KE9A 1XUOA 4H35A 1FXWA 4MMZB 1CEEA 3PG5A 2XEXA 5CPFA 3IB6A 3HILA 4WJ3B 5DO9A 3GT4A 3GJ8A 4CL0A 3ACCA 3A4IA 1XT9B 3IR7A 1KE1A 3RYFA 5DWDA 3PIDA 4PBRA 2XAAA 5JAMA 2H2HA 5KYXA 4CYEA 1QXSA 2Z6VA 4LE2A 1YUBA 2FLNA 1UP7A 4G1FA 3GEEA 2JAPA 1HF3A 5T4EA 1JEEA 5IDXA 1E1LA 1J2NA 4QL3A 4YXJA 1EFVA 3C3EA 1OBOA 3NHAA 1UH5A 2DJ5A 2X1VA 3WL4A 4A82A 1PWXA 5CCDA 3IN5A 3FGZA 2RG1A 2X6RA 4ECYA 3QU5A 1MAAA 1XTSA 3T5LA 5B66U 2C95A 3O82A 2G77B 3T06B 1YSCA 1MW8X 2QQGA 4IWXA 4FLHA 1GUFA 2PYZA 5DQHA 4Y1RA 4HDOA 3DJFA 1NW9B 1NNLA 1UELA 1LPMA 3RVSA 4WECA 2OJWA 2Z2ZA 2CLKB 1L7DA 3ZKWA 4LJYA 1FEHA 1MOZA 4E32A 3TNYA 3D6JA 1QH8B 1K3TA 1PV1A 5J2TA 4BWJA 1A8UA 4NLBA 4KO3S 5CU7A 5KT5A 1D2NA 3F0TA 2B8EA 1Q6YA 3RRMA 1MP0A 3R9KA 1JA9A 2H88B 1IEQA 1MABA 4TGLA 1JA0A 2ABWA 4V0NA 3PPWA 1V1MB 3THVA 2D8MA 5EIFA 4AULA 2VK2A 1U98A 1CF9A 6GPBA 3TQQA 3OM1A 3Q7TA 3ENVA 2VATA 5G4KA 1QGUB 4J7XA 2VJAA 2O20A 2AFHA 2WJJA 4R16A 3TLGA 5D7NA 4GLOA 4XARA 4YPFA 3RNGC 1YE8A 5FLYA 5BOVA 1GZ5A 2HJ9A 4XKJA 3PC4A 3WGGA 4AUNA 2O8FB 2WKPA 5FBRB 2ZBQA 3WLRA 3LYAA 2K25A 3DUFA 2ZSKA 1PN3A 3PUXA 5H8YE 3GP5A 4XUGB 5JOQA 1HEZE 4UE2A 5G1OA 5A4AA 5IVKA 1NTRA 4GGMX 3C74A 1E3MA 3M62B 4H3SA 5FQOA 1K7YA 2WWTA 2WWFA 1X86B 4F6RB 2O2YA 1V9SA 5F5LA 4YQYA 1NOJA 3KHUA 2XLBA 4BUJA 3MSXA 1WQ3A 2O7NA 1PQ4A 4MW4A 2LPMA 2D54A 4F96A 4HRAA 4D98A 1KSPA 1TUIA 5CDYA 2AOUB 3FVTA 4ALIA 5CG1A 4P4NA 1JE0A 2ZM5A 3QKIA 1JMVA 2M0AA 4J9VA 3SX0A 5FD8A 2CUKA 2OTCA 2YMQA 2KJ6A 3QOXA 3UGQA 3WLAA 2Y9PB 3RD2A 3MWDA 4M0PA 2QBYB 5ALWA 4MDYA 3RAJA 3NY5A 4CU5A 3QBEA 3V9AA 1WDMA 2WWVD 4MS3A 3GGCA 3HFJA 4UCWA 3C3XA