5EE3A

Complex structure of osychf1 with amp-pnp
Total Genus 110
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
110
sequence length
374
structure length
357
Chain Sequence
b'ERPILGRFSSHLKIGIVGLPNVGKSTFFNIVTKLSIPAENFPFCTIDPNEARVYVPDERFDWLCQLYKPKSEVSAYLEINDIALGNAFLSHIRAVDGIFHVLRAFEDKDSVDPVRDLETIGEELRLKDIEFVQNKIDDLEKSMKRSNDKQLKLEHELCEKVKAHLEDGKDVRFGDWKSADIEILNTFQLLTAKPVVYLVNMSEKDYQRKKNKFLPKIHAWVQEHGGETIIPFSCAFERLLADMPPDEAAKYCAENQIASVIPKIIKTGFAAIHLIYFFTAGPDEVKCWQIRRQTKAPQAAGTIHTDFERGFICAEVMKFDDLKELGSESAVKAAGKYRQEGKTYVVQDGDIIFFKFN'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Obg-like ATPase 1
publication title ATP binding by the P-loop NTPase OsYchF1 (an unconventional G protein) contributes to biotic but not abiotic stress responses
pubmed doi rcsb
source organism Oryza sativa subsp. japonica
molecule tags Hydrolase
total genus 110
structure length 357
sequence length 374
chains with identical sequence B
ec nomenclature ec 3.6.5.-:
pdb deposition date 2015-10-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01926 MMR_HSR1 50S ribosome-binding GTPase
A PF06071 YchF-GTPase_C Protein of unknown function (DUF933)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.300 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 TGS-like domain 5ee3A03
3.10.20.30 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 5ee3A02
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 5ee3A01
1W4CA 4YTNB 4TMTA 4IJMA 3FTQA 5FTJA 1UADA 4D25A 3S1AB 3KL4A 1I2DA 2VP0A 4TLAA 5LD2C 3NBFA 3FC4A 2C04A 1E0ZA 1JB1A 2AX5A 2CK3D 2M56B 3GLHE 4N6EB 1AS2A 4M2LA 1NN0A 1UKYA 1PV4A 3P4RB 1KSGA 1CTQA 3WRYC 1DOXA 4CF7A 1Z0KA 4OI0A 3MWLA 2KE5A 3SEAA 1WB9A 4DDUA 3TAUA 4XTRA 4ZCMA 2H89B 3BRWD 1SIJA 3AE3B 4NE2A 4BZQA 4ZPXA 4BEJA 1E9EA 3S1AA 5GVRA 3LXFA 1SHKA 3TQCA 4EDHA 2XGJA 4AURA 3AP2A 6Q21A 2AFIE 4V03A 4TMWA 5C18A 4PPNA 5EXTA 4F4CA 2ZJ8A 4KSBA 3HJNA 1FO4A 3K9GA 2F1IA 4R7ZA 3ZJYA 1OW3B 2ZI9A 2BOVA 2WWWA 4IRUB 2J9RA 1QHSA 2ZYUX 4HEJA 3Q7QA 5EXSA 1Q1BA 1XWIA 2Q5WD 3GQBA 5JI3E 2C96A 4BZXA 4RCZA 3LNCA 1ZP6A 2WBLC 1EK0A 3QKSB 3LV8A 4JVSB 1GIAA 5DI3B 2LWIA 3KQLA 5AWFC 2A2ZA 1YR8A 1AA9A 1NY6A 3LH5A 5K8UA 3VNVA 3BK7A 3AH7A 4LV5B 5EE5B 2QQ0A 3LQQA 4Q7LA 4KITB 3VRBB 4JJZA 4UNNA 4NKRA 5DHAA 2JIZD 4DUGA 3CRQA 3TSWA 1X6VA 3K09A 3AE5B 3I61A 4OHZA 1GKIA 3FE2A 1VCMA 5CYPA 4U00A 3WXMA 4IDQA 5CB6A 2A3RA 2P6UA 1N25A 3CX8A 5LB4A 5EZ5A 4D82A 3GFOA 3QKSA 1GILA 3EIEA 5DI3A 3RRMA 3P4YA 4A6XA 1JR6A 1Q22A 1GG2A 1RKBA 5BYJA 2D74A 4F92B 3HDTA 2GXUA 2W2XA 2QSYA 4Q1EA 3C41J 1G5TA 3AM9A 2EWWA 2IXGA 3BFVA 2CCKA 1G291 1G5PA 1GNRA 4ASUD 4CGZA 3R20A 1U8YA 4M21A 3G5UA 1WP9A 1CRQA 1SXJC 2HJVA 3OIWA 2WU2B 3UMRA 4YTPB 4O3MA 1RVDA 1T5IA 3PENA 2O52A 2CLDX 4XD7D 2QGNA 4A0FA 4TZ6A 4HB2A 3KZ1E 3LFUA 3QXXA 4PZLA 4BFYA 2ZRLA 3B5JA 3VR5A 3W9YA 2B7BA 4NYJQ 2DFKB 1GM5A 1GRNA 3X1WA 1NLFA 3RS5A 1VYVA 3EX7C 4PXAA 2AK3A 4IDPA 1JQJC 3BD9A 1OFFA 3KJIA 3NVAA 4PZZA 2XJ9A 1KK0A 2MSEB 4K46A 2PZGA 3MD0A 3T06B 1IJFA 3NVZA 4QHYA 3KXKA 1QF9A 3BIFA 2ZS8A 4L15A 1A5TA 4AKHA 1V97A 4M9QA 3WYGA 2BEJA 2JX5A 4Y0VA 5SZHB 4MYTA 5HZKA 2FF7A 1G3QA 4PZYA 2ORIA 4RD1A 5DE3A 2GWHA 2JA1A 4AYWA 1R5NA 2X8AA 5EE1A 3RS0A 1XDBA 2F9MA 1H8HA 3T61A 2F1RA 3OF5A 2RAPA 1G7CA 4EPTA 5HCIA 2IUUA 5G3ZA 3BS4A 5JSZB 3P63A 4C0LA 3N2IA 3WBJA 3B1XA 3ZIAA 5DIFA 5CJPA 4ACBA 1M74A 1SULA 3AVYA 2E3TA 1IBRA 1JAHA 2NIPA 5EP1A 5TV2A 2P5SA 1GOTA 5FR1A 4EKDA 3AVUA 1X8LA 1B23P 3U7HB 2JLYA 5FOXA 2FFBA 1N61A 2EYQA 3AB5A 4MKFA 3DMNA 2NPIA 5JSZA 4DCNA 1XZQA 2C5LA 2WDQB 1CBUA 2QL6A 3IIJA 4NPHA 3SQWA 4B2PA 3W6OA 2DCUA 5AUQA 3CF0A 1XD2B 2WWIA 4DHEA 1NY5A 2P3SA 2G3YA 1AS3A 4P4SB 2B8WA 2GF9A 1UDWA 1WRBA 3PO0A 2OBNA 2ZYTX 4C7ZA 1GL9B 3VR9B 2B8TA 4GI7A 1ROEA 4N0DA 1N63A 1UEIA 5C46F 1M7GA 4MRNA 1W36B 1W1WA 3KB1A 4DVGA 2CU3A 1OXVA 2JGNA 4XVUA 1E2JA 2OZEA 3OZXA 1NVID 1JQ4A 1IY1A 2R65A 4JLAA 1XD2A 4Q9JA 1R4AA 5AUOB 1N6LA 4KFUA 1Q1EA 3OAAD 4P4SA 2O5VA 3QIAA 1VMAA 5H92C 4Q9HA 4U02A 1SVLA 4HLUC 4TQAA 3SYKA 4JBYA 2IYUA 1BH2A 2DR3A 4Z54A 2OCAA 3D3QA 3RYTC 421PA 1XTKA 4V0OA 5KU1A 4CW7A 4RKEA 1M1YE 4B33A 2G0TA 4IW3B 2J0UB 5FH9A 5J4YA 3BH6A 1LW7A 4ARZB 1LV7A 4BFWA 3QPWA 2ZI6A 1RRGA 2REBA 4KX6B 4MGYR 4YXDB 1LF0A 1XMSA 3RS7A 4TSFD 5LPNA 2ZI3A 1KF6B 4C0QC 3ZGXA 1YVDA 3U6KA 2HF8A 2YOFA 3CWQA 4NYMQ 2ZUCA 5FBRB 2W6IA 4URWR 5TARA 3W5JA 4LJYA 2VSFA 2J0UA 4FWIB 2O0JA 3EARA 4DCVA 3RC8A 4M1YA 1W2GA 2PH1A 3GLFE 4M1OA 1OQRA 4ARZA 4PAQA 4OYHA 2RHDA 1Z6TA 2R6DA 3AV0B 3AKCA 4E09A 2VHQA 3PUXA 3KFXA 1QHXA 1G8YA 2FA9A 1W4RA 2EQBA 3B13B 5JCZA 2GXAA 1CJEA 4Q1DA 2GXQA 1EFRA 1ZMXA 4MRPA 4TTRA 4LC0A 3GLFB 2GJSA 4EFLA 2Q3MA 4CEHB 1QHYA 5TB5A 1YJIA 2W55A 1G9XA 3LVQE 2KJQA 2OCPA 1U99A 3VR4A 2FPKA 1ODFA 3NXSA 5J47A 5GXGB 2YVUA 2IYRA 4LDJA 2ZIAA 3E2IA 2QG6A 2XNSA 4DIDA 4DDWA 3GP8A 1L2TA 2HTME 3EAQA 1LVGA 3FFAA 1B0UA 2PVOD 1VECA 4JSTA 2WVJA 1DBSA 3FHTA 3GLFA 1CR4A 3B8HA 2JEOA 2YJTD 4CEHA 1RFLA 3IBYA 4YTMB 4Y0AA 1E1QA 1VCOA 5IK2D 4ZOHC 4MQBA 3RC3A 3CX7A 2JQRB 1GKYA 2ZRNA 3CR8A 4ITRC 1ZUHA 2BIFA 3ZS9A 1DAMA 5K8LA 5AUPB 1CJVC 1G7RA 4TL7A 1E9MA 4I1VA 4ESVA 3MCAA 3LWNA 4QL3A 2W2VA 3UWOA 1U8ZA 3LQRA 1RWSA 2RGBA 3AVPA 3KKPA 4Q66C 2WSSA 4BUJA 1TQ2A 4HAUA 4HSEA 4P33A 4DRZA 4WZ6A 2Z6VA 4IDHA 5EZ6B 4YSYB 3W5IA 1WE2A 4FINA 3RS4A 2YNMA 3U3KA 3NEYA 2WOOA 3KKNA 2KSQA 1U98A 5JJLA 5SZJA 4ZV4A 3T1TA 1ZC3A 5AJYA 2J5XA 4FCTA 1DO2A 1Z63A 1E99A 3MFYA 1AQUA 4KHZA 4RD3A 4ZHOA 3I73A 3GLGB 2H88B 1IXZA 1G8HA 3HRDD 2CXXA 3PG5A 2OLJA 2PKOA 3EPLA 1FP6A 4TL8A 4WA7A 1T3LA 2WMNB 4TT3A 2N1BA 3UG7A 5JI2E 1ZD8A 5H68A 5LDDC 3EPJA 1ZM7A 1E96A 1A2BA 1QG4A 2QMEA 3D31A 3IDQA 1T0HB 4TYQA 4YMSA 1KMHB 1E7PB 3VMFA 2IS6A 2ZXUA 4DUGD 4A9AA 1ESNA 1HYQA 2ATXA 3LB8C 1XRJA 1UBCA 1N6HA 1SVIA 3I5XA 3GLGA 1J7CA 3D7MA 1M7BA 1R7SA 1R5OA 5FPTA 3WNCA 4JZKA 2OBMA 3TRFA 1DOIA 4TL9A 3T35A 4JLMA 3AQ4A 2ONJA 3LW8A 1SVSA 3QJYA 4GT1A 2BM0A 2FGJA 2EW1A 1P2SA 3F0TA 2IYVA 1NRJB 2GILA 4OQXA 4TQ9A 3HU1A 3QG5A 1KSJA 4E5UA 1IONA 1KMHA 4XTCS 1E2PA 4CEIB 1P6XA 3A4NA 3FKQA 4GOXA 2DB3A 4LHYA 5FL7A 3CR7A 1BO6A 4BLSA 4GL2A 1IOZA 2R62A 2NO0A 4W5HA 1KNQA 4G5SA 4QBHA 1D6JA 2JLRA 2ZE8A 4LZZA 4CVNA 4M22A 4LBVA 3KKQA 1T9HA 1J8MF 4DCTA 2ZR7A 1BS1A 3KTAB 4IOJA 4LSGA 2B7CA 1V43A 3TAHA 5DN6A 4OI4A 4Q21A 4HYYA 3NBXX 2BS4B 1T4GA 4CEIA 1KOFA 2JJ1A 1G7TA 1GP2A 4R98A 5KYKA 3C8UA 3LRPA 4TYYA 3UKDA 1JQLB 2WS3B 2CLCX 2LKDA 3L8YA 1E69A 4RD6A 4BFUA 1BOFA 1QDEA 2NO6A 4YQFA 5B2ZA 3SHFA 1F48A 4Q03A 4IDNA 5HKKA 3A4MA 2JIZA 1RJ9B 3BC1A 1TPZA 1OXXK 3KTAA 1N3BA 2G6BA 3LDAA 5M04A 1HE1C 5EP2A 3EC1A 4Q4AB 4PC7A 5EUQB 3ETRA 2KBEA 4QJ4A 2NG1A 3QI2A 1FL9A 1YQTA 4TZ0A 2PCJA 3O8DA 1MO4A 1OT3A 4JIMA 4KFSA 4DSNA 3BE4A 1NBME 1G4AE 3RRYA 4KVAA 1Z22A 1EESA 3NVYA 2D2FA 1D5CA 2I1QA 1H8HD 2H8KA 1RJ9A 1T6NA 1OIVA 1CR1A 4TN1A 4W5JA 4O0MA 1GNPA 4OHWA 3ICEA 2V6IA 4KO8A 3Q8XB 1Y63A 1GSIA 2Y5CA 2AXNA 2HXSA 2J59A 4Q4AA 4FWTA 3TMKA 3B9PA 1Z6AA 1TAGA 3BB3A 3OEHD 3ZIAD 4D4MA 2O8FB 4GRAA 3NVVA 2PX0A 1KO4A 2ZREA 2ZI4A 4KLNA 3EIQA 2E1RA 1MKYA 2JDIA 5JS7A 5KSYA 1AK2A 1A2KC 4PPGA 2RH5A 2N42A 2PZEA 2WKPA 4BGDA 1R6BX 2AL7A 5HCNA 1W47A 1V8CA 2N46A 5JHGB 4XJXA 1G8GA 4CYMA 3I62A 3PUVA 3UG6A 1EX6A 1S0UA 1XD8A 1I4LD 3JVVA 1FUKA 1NBMA 2PLFA 2YYZA 3D8BA 3G82C 3NG1A 4XOIA 1NNEA 2OM2A 2O8FA 3AEDB 4GP7A 3GJ4A 3QEOA 2YC4C 1KYIA 1W2HA 2Z4SA 4B2LA 4QXAA 1TJEA 4BWYA 1VLBA 1L7VC 5IDVA 3AEGB 1KTVA 3VKHA 4ZHPA 5L3SB 1JJ7A 1G18A 3K8YA 2VSOA 1E94E 2XEXA 4RFSA 1QHHB 3EWAA 3KUCA 4JKIA 1LNZA 1MH1A 1A70A 1G41A 1KK1A 3K0CC 1XTQA 4M9ZA 4ZO4A 1LS1A 1DO0A 3RS3A 4US8A 1Q1ZA 2JJ2A 1FFHA 2AFHE 2KI5A 4B43A 2ZVQX 1XJ0A 1YZTA 3CRVA 2ZE5A 1COWA 3SHWA 1NMYA 1TF2A 3K09C 4WIAA 1Q20A 5C4GB 4WBSA 3EWSA 2HUPA 1NN3A 3R9WA 2M19A 1Q0UA 2PJZA 3ZVNA 1EFTA 1WWTA 5L3SA 2B6HA 2WPDA 2YOHA 4IVQA 4BE7B 3PEYA 1QHHA 2E87A 1G6HA 4LJ9A 1A82A 4B48A 2LKCA 2ZRAA 2JLVA 4DCSA 1OIWA 4EJSC 1ZW6A 2ZJ2A 1G4UR 2ZRIA 3C15C 2CVFA 3QE0A 5JFGA 3QKRB 2YV5A 1L4YA 2VHUA 3THYB 1ONBA 4R71A 1DOYA 4GSYA 3PVSA 4NU0A 3EA5A 3CB4A 3L82B 2V4ZA 2W6ID 1VG8A 5E4FA 4NONA 3I3SR 2WWHA 3ASYA 3AUYA 2FG5A 2D2EA 3U44B 2Q9CA 3C5HA 1HTWA 4QGGA 1ZNWA 2VL7A 4KI0A 1F6BA 1KI7A 5JRJA 2DWPA 4KODA 3SFEB 2GAAA 1VJKA 3CX6A 1TKGA 2FGKA 3QKRA 3JZAA 5EP4A 3THYA 1KI4A 1T91A 3X1ZA 4TYWA 5KDOA 1ZCAA 2WJHA 2W3SA 4ZI3A 1E2LA 1EFRD 2GEDA 3EZFA 1G64A 1JPJA 4YXWA 3SOPA 2BS3B 3ZS8A 3IHLA 3V9PA 3DZ8A 4URXR 2FPMA 2CEAA 1WBDA 2ZSDA 2P67A 1Z6GA 3OAAA 5FOUA 4V0KA 3U44A 1P9NA 1AIPA 4NCNA 4F7WA 4WVFA 3CONA 5AJWA 2JLZA 2VHCA 1HA3A 3RVBA 1FXIA 5KSOA 2D7CA 4KV9A 2G0NA 2RGEA 2BV3A 2WICA 1ZNYA 1CZPA 2BCJQ 4IEIA 2VPPA 3VR6A 1UAAA 2WJGA 2GBLC 4LWZA 4AKIA 1NL3A 1UEJA 5FI0B 3K9NA 4E22A 2VBCA 4TSFA 1TQ4A 3B2GA 1KJYA 3MJRA 2IYSA 2ZANA 5CIWA 2GA8A 2C9YA 2VIIA 2CE2X 1YZGA 2IWHA 1OYYA 2EFHB 1E0KA 3THWB 4MRSA 5F3WB 2RGNC 1P2UA 3R8FA 1RRFA 3EC2A 2VLIA 3W8NA 5GJCA 3ZZTA 3CIRB 2BMJA 1XXHE 3E1SA 2CDNA 1AZTA 3AE7B 4CEJB 3PUZA 1LB1B 1XZPA 1ZU4A 3TSZA 3DL0A 1UBEA 2GZAA 2OAP1 5FOTA 3RRNA 2NPFA 3VKGA 2Q3FA 4LI0A 4F91B 4HAXA 5FTMA 2W54A 4HATA 1XXHB 2F1HA 3C7KA 3THWA 3QG1A 1P5ZB 5BN4A 2A5YB 5CITA 1LTQA 3QXSA 1W4BA 4KBFA 2DHRA 2WIBA 4LUCA 4EPWA 4PAMA 4CEJA 2QAGB 4BLTA 2OCYC 4TT3D 4OHVA 5JWHA 1DOAA 1KMQA 1D2NA 1OF1A 1GRRA 2V54A 4JLPA 3ND8A 4LV8B 1G3UA 2WAYA 1FNNA 3M0EA 4JVMA 4XVQA 4A92A 1XPOA 1YJJA 1D8TA 4MH0R 4YMVA 2W2TA 1XXHA 2D62A 2P65A 4IVPA 2GXSA 4MYHA 3P4PB 2C99A 3UK6A 1WCV1 2GESA 1EG7A 4OK3A 4C2UA 3RABA 2NGRA 4O2LA 2NO1A 3KXIA 2QP3A 1OXUA 5IK2A 3ZYCA 4I81A 3VX4A 4DLTA 2Z43A 1T5LA 5GADl 2XITA 2QAGA 1FTNA 1QOAA 2H5EA 2C9OA 3OESA 4B6FA 1FIQA 1QVAA 5EJEA 3SFZA 4D4LA 1E2QA 1UKZA 1YR7A 1CRPA 5FL7D 4YSXB 4Q1BA 3K70D 4B3XA 3MLEA 5FTLA 3T15A 5AUNB 2IS1A 3LBIA 2HCBA 4POAA 1C9KA 3AE6B 4M1TA 3ICQB 1P73A 5C3JB 2OE2A 5FUXA 3ND9A 2Z5FA 4TLEA 1ZNZA 3HUIA 3PJRA 2FMXA 1XFAA 2ZETA 3EASA 3ADBA 3GEHA 4TLBA 2G1EA 2H16A 4IOKA 2F3TA 3SBDA 3TW4A 5DN6D 3ETLA 1M8PA 5CYOA 2ZJAA 8OHMA 3OIYA 5DI9A 3SN6A 3QY0A 2JJ1D 4EFNA 2B21A 3T34A 4F93B 2FJUA 3W3AA 1GNQA 4YMWA 4C9BA 1Z47A 3CWIA 1KK3A 1R0YA 2HLDD 3UANA 3IBGA 3NVWA 3EIHA 3TE6A 4DT1B 2J7PA 3W9CB 4LJAA 1Z5ZA 1SHZA 5HKKD 1E0AA 1DTSA 4C0KA 2A78A 2J0QA 2Z0MA 1XX6A 1DELA 4BLOA 4LX0A 3KDSE 4JSYA 4QJ3A 4IVRA 4NMMA 3O8CA 1RFKA 1C4OA 2OG2A 4NYIR 3FDIA 1KY3A 3HR8A 1GZSA 4JYCA 4OI2A 4KFRA 2VF7A 1RYJA 5C4MA 4DB2A 1P9RA 1GAQB 1DS6A 3PCRB 1KI1A 2QROA 2UZIR 3OFNA 4GMXA 5KDDA 1S3GA 1KIMA 2FFQA 2GETA 4OQNA 2J1LA 1OQQA 1QZXA 3HP1A 4MA4A 4N58A 1DAEA 2J45A 4X8MA 3HYTA 2GDJA 4QNRA 3RS2A 4E07A 1SKYB 1NVXQ 1G20E 2OBLA 1T8UA 2REOA 4KYUA 4A8JC 3TQFA 1E2KA 3P1MA 5H8WA 5JRZA 4US1R 2XZOA 3B9QA 3A37A 4DLUA 1QOGA 5GJBA 2QN6A 721PA 1N5JA 4R9UC 1AWDA 3MG9A 4PTLA 5F9FA 2JDID 2NTYC 2D3WA 3K0EA 1IM2A 3KQUA 2IYWA 3IHWA 4Q9LA 4KVGA 3AE1B 1TMKA 2CNWA 3AVOA 3TUJC 3I1FA 1XCMA 1KNXA 2BC9A 1NBMD 4PSAA 2PZFA 2R44A 4PO8A 4S2EA 4DBLC 4DDVA 5JEEA 2FE4A 3KJGA 5TXGA 1FOEB 5EXXA 2IXEA 4FIDA 4ZIRB 4YSZB 4LCBA 1D9XA 1Z06A 3CPJB 4TMXA 4PQFA 4Q4LA 3FOZA 1IY2A 4MYUA 1PLLA 2ZITA 4C2TA 1VDVA 1RIFA 1YZNA 3B9JA 2Q0HA 1UDXA 3LBHA 4C30A 1QHNA 4D2IA 4DLXA 2CVHA 1E9SA 1U2RA 2DYKA 3BORA 2QUZA 1JBKA 4A0HA 4URVR 4HB4A 2AD1A 5B57C 2Z83A 1OYWA 2JJ2D 1YRBA 4H9GA 4DKXA 1Z07A 3CNLA 2JCSA 4MGIR 1COWD 1UF9A 4ZIRA 4NZYA 3GJ7A 2RGAA 1T3HA 3OIUA 1NG1A 1U94A 4DIEA 3AVWA 1Q21A 3QVUA 3HU3A 3OEHA 4MUBA 1PUIA 3QNUA 1N2CE 4K8OA 1ZIPA 2WPDD 4HLCA 2I1VB 4IHQA 1YJ5A 4C80A 5JMTA 1G1MA 5JEDA 4RKFA 4JBXA 4AWXA 4BLQA 2UKDA 3LX8A 2QTVB 1KFYB 3TK1A 3NEJA 1E2NA 4AY2A 4OK5A 5HR5A 3P20A 1JPNA 2WJIA 3L0SA 2OXRA 4N0EA 2JASA 4BASA 4B3DA 2CE7A 1JNYA 1ZNXA 2F6RA 1K5GA 3PUYA 3RPFC 2P6RA 4M1MA 4MRRA 4NDZA 1OSNA 2HT6A 2IYYA 1SVKA 2ZRKA 2ZRGA 1GPXA 5DLQC 1N0VC 4LHVA 4LHXA 1F60A 4Q00A 3RWMB 3U5ZB 2VP2A 4N1AA 2ZRBA 2ODNA 1U0LA 3JVUA 3M1IA 4OHYA 1FPMA 5EXPA 1W0KA 3C16C 1XLPA 5DYIA 1AKEA 5CK5A 1G7SA 2WSMA 4D0GA 2V7QA 2ACZB 1OB5A 1Z3IX 3VR2A 2ZUBA 2QY9A 1DAKA 2VSXA 2J87A 3TJZA 1TTTA 5LD2B 4YXWD 2IYQA 1E4VA 1M2OB 1VYTA 5DGXA 4WZAE 1FTSA 3W34A 3TLXA 2ZR9A 4I1SA 2P6NA 4A82A 5IF9A 4CRWB 3CRMA 2DFNA 1FFUA 3IIKA 4HB3A 5JJKA 2BHRA 3AE8B 1WXQA 3PQCA 4QBFA 3FB4A 1KI6B 3X1YA 1CULC 4W9MC 1QF6A 5AJZA 1U0JA 4X8HA 1P3JA 1US8B 1XJQA 5KPJA 2AKAB 4PC2A 2QQEA 2FN4A 3AEBB 221PA 2Q9AA 2FFAA 3FYHA 2VHJA 4RD4A 2OUKA 2WIAA 5CK4A 2IA5A 3VRAB 1UWMA 2IF0A 3N2EA 3H0KA 3TGPA 2V3CC 2DBYA 1KI6A 3AF3A 2PLRA 5G53C 4QGFA 3P4QB 1RPZA 2K5PA 1RRCA 1US8A 2DFLA 5MPOA 3MWJA 3ECCA 4JL5A 5D3MB 5BW8A 1NYQA 4UXHA 2IHYA 4AIIA 5E3HA 1OLOA 5BXQC 4HUQB 4LBYA 2IWRA 3RSLA 3IPYA 3LBNA 2J41A 2EFEB 3TUIC 2HV8A 2IF2A 4P4UA 5FBQB 4GBMA 5CB8A 3BB1A 1EWQA 2ZRDA 1XTIA 3ABVB 1JR3A 1KI2A 3B1YA 3C5CA 4LYFA 4ZDJA 5KUTA 2ZSFA 4Q7MB 2W6JD 1DG1G 2CCGA 1TU4A 4L4UA 3A6PC 2WWFA 1TEVA 3HU2A 2ZJOA 1Z0IA 1JALA 1ZRHA 1E1RA 1LF5A 1W48A 2Q3HA 2R6GA 1XO3A 3KUDA 1VG1A 5D3MA 1VPLA 4G3XA 1EFCA 3FVQA 4ZCLA 3BFKA 2IYXA 1AS0A 4HUQA 2B92A 4OI1A 2IUSA 5C2TB 4GMDA 1E79D 2WZQA 2NO9A 1N6PA 2BBSA 1MV5A 4P4TA 3BERA 5E7JA 3QF4B 3NS1A 4BZPA 1RC8A 1NG9A 1DAHA 3O47A 3PR1A 2KAJA 2MMGA 2MMCA 2VP6A 4B3CA 3SI7A 3REGA 3BOSA 3W90A 4GPTA 1SXJB 3SDZA 4O2RA 1K5DA 1TU3A 1E0JA 1NSFA 3DZDA 5G5GA 2WU5B 5G40A 1P2VA 2DPXA 5EQTA 3AP1A 4LJ8A 1QT9A 4JL6A 4DLSA 5HE9A 1F3OA 2IT1A 4GZMA 1XMVA 2O8EB 4J0QA 3B1ZA 1UM8A 2KBFA 3REFA 3WMGA 1KJWA 3QF4A 3ZH9B 1ZM4A 4KAXA 1ZOYB 2QT1A 1CXZA 2GJAA 4FI3C 3VHXA 3ZZUA 2K22A 3WCQA 3BXZA 4GZLA 3GLGE 1SXJA 3E70C 4DC9A 1E4YA 1PLJA 4URUR 2CMKA 2HT1A 1TNDA 2ZRCA 1L0VB 4HDQB 4I99A 4QM7A 4HAYA 2VQSA 2MSCB 2ANBA 1Q1QA 2WWGA 1N6KA 4YDSA 2O8EA 4DLWA 2W83A 3AKYA 4N59A 3IPXA 4P32A 1N6NA 1QRAA 1VCIA 3CIOA 1ZVQA 2AN9A 4LTUA 2A30A 4MGKR 1GTVA 1NN1A 3DMDA 4LV6A 4NCHA 4B47A 1QOFA 4PAOA 3GJ8A 3AV8A 4C0BA 1VHTA 1RM6C 2XZPA 2EKIA 3DEFA 3EG5A 4P31A 4RZ3A 5P21A 2IL1A 2J7PD 3ZZ0A 4DXAA 1JAIA 2ATVA 3HYRA 4W5WA 3UATA 1E2IA 4IXNA 5A0FA 4X8OA 3K70B 3FHOA 3U7FB 4DWJA 1DAFA 3Q7PA 4OQMA 4DEXA 5AR1A 3F8TA 4FMCF 3L0PA 3DM9B 2ZU0C 3SYLA 2V55B 2W58A 3SBEA 2C95A 1N5KA 4FW9A 2AHOA 1IN5A 1J2JA 2XOKD 2QORA 4HLQB 4PSVA 3U7GA 4TMKA 5K8IA 1W0JA 2F9LA 3QKTA 5IHPA 2ERXA 2W00A 1Q3TA 1XMIA 3OFND 2IC5A 1ANKA 2RGDA 4MITA 4Z1MA 2QNRA 2VYFA 4RZUA 1I7HA 1JJVA 1KZ7B 3B78A 1SF0A 4V0MA 1W5SA 4TWZA 1KSFX 2QAJA 3CF6R 4BRWA 2J7KA 1HQYE 3ASZA 4HRSA 4QRHA 1HQCA 3NH9A 1HV8A 2C77A 4B3GA 4MGZR 3QUSA 1VHLA 3UIEA 2A7QA 5JHHB 4URZR 4D4JA 2NZJA 4UXIA 2G83A 1CS4C 2RKOA 4UNQA 1H65A 4IDOA 1G21E 2P0EA 1IXRC 3AB3A 2PJRA 1CJKC 1TQ6A 2WQYB 3KJEA 1GDDA 4Q02A 5DISB 4DZZA 4QG7A 3OE7D 1EFUA 2CNWD 4IFEA 3WNDA 1SVWA 2HLDA 4DB4A 3ZVRA 3CO5A 1SGWA 1YQ3B 4A15A 1T3QA 3FWYA 5KDLA 2QTHA 4JKYA 1SB3C 1UPTA 2FU5C 3WYAA 1P62B 2EVWX 3SJCA 1PLKA 2J3EA 1G16A 4A2WA 3SJZA 3K0AB 4I1UA 3NWJA 3L0IB 1GRQA 1Z28A 4XWKA 1XU4A 3B2FA 3NIBA 2K9XA 3ONWA 1XTSA 2ZM5A 2YHSA 4NCIA 3GLIE 1E2FA 2P2LA 4F4JA 1E9CA 3TVTA 4PQRA 1N5IA 1OFTA 3HR7A 1WF3A 5KTYA 5FL3A 2PMKA 4C4PA 1T8TA 3U3MA 4HLUA 5J4LA 2BBOA 3GLIB 1CJMA 3K0AA 1DARA 3QBTA 3WP0A 4OQLA 2FSHA 1IJEA 1OXSC 3CM0A 3FMFA 1XPUA 1XEWY 1CF4A 4D26A 2L0XA 2MJDA 1JECA 3NTUA 5GJVC 3FMPB 1D2EA 1J7KA 3SQXA 3JZMA 1KY2A 2XSZA 2ZI7A 3MMPA 4PPQA 4DLZA 3P1JA 2V1UA 4MKGA 3AVQA 4RSGA 3QSYA 2BT6A 3GLIA 4A0RA 3N5CA 3DO6A 4JLBA 4JBWA 3I5YA 2X19A 1AJEA 3NH6A 1FW6A 1FFVA 2ZQ5A 3RAPR 2GZDA 4FMDF 2O8DB 3AMZA 4LBWA 2GVZC 1Z2CA 3W6NA 3CH4B 4OK6A 2LCFA 5JWOA 3TUZC 1QHGA 4QBGB 3Q85A 2QM7A 2BCGY 4EPVA 1W0KD 1K8RA 3A36A 4RJLA 3VAAA 2V7QD 1KI9A 3VTKA 1S3SA 4AYTA 4K81B 4UKDA 5SZIA 5KO2A 4PO1A 1ZIOA 1BIFA 2HF9A 2V8OA 2EFDB 2JLSA 3MGCA 5FPKA 4G5OA 4IKEA 1E2EA 4EIWA 4QNMA 2GK7A 4U5XA 2O8DA 1OV4A 1Z2AA 2FX3A 5SZKB 1IQPA 2QPTA 3W8RA 2WWXA 5JS8A 3GJ3A 3T5GA 4FMDB 3BFXA 1YR6A 2AD5A 2VEDA 3V4RA 1TEXA 1NVVR 1XF9A 2GJ8A 4HDCA 4KCGA 3AVTA 2QPOA 2QT0A 2QTFA 1Q44A 3CPHA 2H1LA 4BFTA 1TKYA 1HH4A 2BVNA 4PHFA 1FZQA 3P4SB 1RYHA 2ODBA 3O8RA 4QC2A 3WMFA 3B1WA 3C14C 3EPHA 2C2HA 2FPLA 1P72A 3HPRA 2AK2A 3VQTA 1DGJA 4R2IA 4LJ6A 4JX1C 4CDGA 2QMHA 4IEEA 2J0VA 2RGGA 2E9SA 4Q4HB 5JCPA 2ONKA 1L4UA 1OB2A 4RCYA 4WZBE 5D3QA 1J8YF 2HDNB 3GFPA 1NENB 2GCOB 4M9XA 3BB4A 2BS2B 4I4LA 3W5VB 3SJAA 4Z51A 3TR5A 4MDFA 2ZPTX 3FMIA 2PVGC 3H2YA 4LGMA 3EW9A 4KU4A 1VG9B 4D6PA 2KB0A 1U81A 3AECB 2XXAB 1RRPA 3HPQA 1NYRA 1ELOA 1KO1A 2C78A 4WQMA 3FFBA 2F3RA 5FBLB 4GP6A 1JR3D 4ZDIA 2XTMA 2IYTA 4PANA 4Q1AA 1NLYA 3KFVA 3X1XA 3OHMA 1BYIA 4PO9A 2PMDA 4Q4HA 1ZUD2 1E1RD 2WKQA 2OSBA 3H1TA 4URYR 4MKIA 1E2MA 1PUJA 2GCOA 5G41A 1FMLA 3IQXA 3BJIC 2WJYA 4LPKA 1JW9D 4PHGA 2YC2C 2ZAMA 4G5RA 3NRZA 1NN5A 2XNDA 3KXLA 2XXAA 3SNHA 2H18A 2BKUA 2VA8A 1ZM2A 4FMBB 4TMVA 4PR0A 2CL0X 1ZD9A 3FKSA 1KDPA 3T5DA 5HZHA 4WWMA 4ZCIA 4KLZA 3U3JA 2FBWB 3CF2A 1KAGA 1P4SA 1KDTA 1NJGA 1G8FA 5H1YA 1N5WA 2PT7A 2HYIC 1CKEA 5KNBA 3ZVLA 2JAQA 2RGCA 2H17A 2G88A 5KSZA 1XCPA 2Q21A 4HUTA 4TTPA 1AGRA 4PFSA 3OIVA 3IO3A 3ADKA 3A1UA 1B9RA 1D2MA 1S9DA 3EXAA 4BEBA 4ESHA 1EWYC 2RHMA 1A4RA 3K9HA 4JWSC 1SXJD 2GZHA 1IN7A 2A5GA 2ZTSA 1F5NA 621PA 4D4KA 4ERNA 2SHKA 4C0JA 2W6JA 2ZRMA 1DADA 3AKDA 1E2HA 4EFMA 3KKOA 2PEYA 4MYCA 4P0TA 2IEYA 1P60A 4DLRA 1VIAA 3AEAB 3KB2A 1HURA 1S4QA 3DPUA 3QXHA 3PITA 4Z8YA 3VR3A 4AK9A 5AUIA 1N6OA 1E79A 1KAOA 2W0SA 2ZRJA 4TYPA 4ITKA 2AXPA 1IN4A 1YZKA 4FCVA 2IX3A 4ACAA 3I92A 1XLOA 2CL6X 3LA6A 4HDOB 1TQDA 4PC6A 4YT0B 2RCNA 1II0A 3AGPA 4RY2A 1ZJ6A 2RGXA 3CRRA 4NTZA 1IHUA 4B3FX 5DH9A 1V5WA 2V9PA 5FPSA 1X8KA 2FZLA 2VHTA 4ZDKA 3G0HA 2AWNA 1W0JD 3R7WB 2FSIA 4FN5A 4JLNA 5J5CA 2HEIA 4LPSA 4Q1CA 5BN5A 2MJEA 1NEKB 4TLDA 4MRVA 4Q01A 1II8B 4Z1MD 1WBBA 4ZI2A 1M7HA 1MRSA 2WHXA 1AZSC 2OT3B 1G5RA 3AE4B 1OIXA 4DSUA 5C1BA 4B34A 3BH0A 3IILA 2R6CA 3AP3A 3ZVMA 1W36C 1P75A 3PEVA 2F43B 3H4MA 4B3BA 4BECA 1OH6A 1N5XA 2WJVA 2ZEJA 1CJTC 3SR0A 3MWKA 3DDCA 3IKJA 3H86A 3MAAC 3RANA 2WWYA 2GHIA 5L8VA 2ERYA 3R7WA 4US0R 1VDZA 1YZQA 2A5DA 1II8A 3QOFA 4H1UA 4USAA 2UVQA 3TVDA 2QPAA 2WMOB 1A1VA 1J90A 1ETUA 2X77A 2O0HA 3EZ9A 3GLHB 4UNRA 3DKPA 2F43A 2IHBA 3BH7A 1OPXA 4Q7JB 1R5BA 3A1TA 4I1OA 5FOWA 2ZE7A 5KHOC 3LAWA 4JVLA 3THOA 1NMZA 1ZM9A 1P61B 3O8BA 2ZE6A 1XD9A 3EA0A 3NDBB 2GRJA 3CW2A 4DJTA 1E2DA 4D0NA 3DWMA 2MH7A 4AG6A 1U90A 4LHWA 2FFHA 3F3YA 3PIRA 3CH5A 3FGNA 1N5LA 2QZ4A 2GNOA 3GLHA 2XOKA 1ZCBA 3A1WA 1SKYE 4ON9A 1YU9A 1R7RA 1X1SA 3GEEA 3KQHA 2NMVA 4W7SA 2O0KA 2L52A 2ORWA 3K0CA 3B1VA 4ZKEA 4DT1A 4EJSB 3WBKA 3CZQA 3QVVA 1N62A 4RD0A 5EE3A 1WA5A 5L3RA 3AN1A 2CL7X 1XEXB 3EZ7A 4NYIQ 1Y3AA 4TLCA 2IBMA 4LK2A 2KMMA 2WP9B 3AF2A 4HB0A 1GFIA 3BAFA 4JL8A 3UMFA 4US9A 3CNNA 4RZXA 4BFXA 2DY1A 5B58C 3KX2A 4EJSA 5E7MA 3IIMA 3SYNA 3Q72A 3KWLA 1HT1E 2VO1A 2ZROA 3TKLA 5C2JB 2X1VA 1AN0A 1XB2A 1T0JB 1PDXA 2CJNA 3EUB2 1CR0A 2OXCA 1OHHD 2PT5A 2XSZD 3BIID 3ZD6A 3K0SA 3OE7A 1DE0A 1XEXA 4NYJR 1YKSA 4WXPA 5J40A 5DNYB 2ZS9A 5UKDA 1FX0B 3I72A 5B64A 2CJOA 4DLYA 3AF1A 1KO8A 2VF8A 3L4PA 1IAQA 1H8ED 1QHIA 3W5UB 1OFHA 3NHAA 5ANRB 2ZI5A 1KZGB 2H92A 2K5UA 3ZLJA 1XTRA 2EU8A 2OAQ1 1U9IA 2W0MA 2N0SB 1KI3A 2CHVA 2C8VA 4D80A 2CHGA 1L8QA 4XWAA 4MKHA 3ZQJA 4HAZA 4M1KA 4G5GA 3ZQ6A 2VH5R 1EX7A 3U4QB 1FX0A 1P2TA 1FP7A 4DDTA 2F55A 2Y8EA 2QP9X 4RD2A 1TUIA 2V6JA 3RNLA 3DKVA 3X2SA 2BEKA 2FH5B 5FFMA 1RE0A 1SZPA 1FMJA 3ZYYX 1R0XA 3PUWA 4M0LA 4NBSA 3U6BA 1NF3A 2OHFA 1G3IA 3THXB 2D4HA 3PV0A 4BLRA 4ILEA 4AKGA 3SU8A 5DO9A 4JMPA 3VU9B 2ASEA 5HPYB 1TF5A 1ZD1A 4US2R 3J81k 1KKMA 2D7DA 1OH5A 3LX5A 4TMZA 4F4IA 1TYGB 3L0OA 1N60A 3PEWA 4A6PA 3U4QA 2GJ9A 5FBWB 2NQ2C 3OEEA 2GBLA 2HXYA 3GJ0A 4F38A 2FZ4A 5AUKA 1FUUA 3NDPA 4M1SA 2VP9A 1KKLA 3SFDB 4QFMA 5CJ2A 1G3MA 1E32A 1IN6A 3VFDA 3CNOA 3K70C 2IEZA 2XX3A 2IXFA 4KFTA 1BMFA 1PJRA 1G17A 1SVOA 2ZSEA 4Q5IA 3THXA 2RGNA 3Q9LA 5J4KA 1FRDA 3AF0A 4PQYA 2CHQA 3LLMA 3VU9A 2ZRHA 4GNKA 3KQNA 2HYDA 2UZ3A 4XSGA 1E9RA 2CBZA 3NC1C 1CJUC 3SJBA 1GWNA 3A58B 5DYGA 2XTZA 3AUXA 1DPFA 1ZP0B 1QG2A 3AH8A 3QPVA 1NVWQ 4PC1A 1UFQA 3CRW1 3BGWA 4GOJA 4PSKA 1DG3A 821PA 5CM8B 3Q3JB 4M9SA 2BBTA 3K53A 2VP4A 1A7JA 1GAJA 5EUMA 4EUNA 1JEEA 1OKKA 4WOPA 2YWGA 4G5QA 3P32A 5FUWA 1OH8A 4R2HA 4DSOA 4XSHA 3I32A 5TVKA 4UNSA 3SFVA 2WDVB 2CJWB 5CLQA 1FQJA 1Z0DA 2XNDD 3VHLB 3WNBA 3B85A 1F0ZA 2ZRFA 1JR3E 4NHOA 4EAQA 2GK6A 2EFCB 2OLKA 3FAHA 1UJ2A 2Q6TA 3AGQA 4V0NA 3QEJA 4RVCA 2OFOA 2RMKA 3FKSD 4OKSA 2QI9C 1MO5A 1IXSB 1R10A 5FTNA 2GF0A 4L9WA 3CBQA 5L3VA 4NH0A 521PA 4FD2A 1IUEA 4LYJA 3ADDA 4JWUC 1Z29A 3GCGA 5FBVB 4LJ7A 2MJ3A 2TMKA 2YINC 2B76B 1F2TB 4LHZA 1PUTA 3PEUA 3R9XA 3L43A 4OJKA 2CJWA 2YWEA 3U3OA 1XBTA 4NYMR 3TW8B 3WHLA 3AVXA 5LBIA 3AF4A 3B2EA 1N6IA 2OFXA 2A9KA 1X8JA 2KWIA 3T1VA 2YOGA 5DSZA 3FHCB 4PX9A 4IXMA 4LRWA 5FOVA 3X1DA 4A36A 1KK2A 1ZM3A 1WDTA 3QBVA 4UNPA 4NP6A 4GFDA 1F2TA 4D81A 2YWHA 4B76A 4MUAA 2DWOA 1VKJA 1CLUA 1JWAD 1W5TA 3KJHA 5FOSA 4BQSA 4H1VA 3MWYW 1MO6A 2FV8A 5FUYA 2WV9A 4HAVA 2BJWA 3LW7A 3AEZA 2J46A 3B7GA 1SVMA 1VG0B 1Q12A 3EZ6A 3L2OB 2NOAA 4Q4JB 4DEYA 3FMOB 1SXJE 2A5JA 1G3RA 1TKEA 5G3YA 2ANCA 4NCJA 1NVUQ 4Z8XA 5FR2A 1KI8A 2GCNA 2ZUDA 4QBIA 4IDIA 1CEEA 1O87A 1MRNA 1NJFA 1FNMA 4JLVA 3T1OA 3M6AA 1W49A 3LXRA 1GITA 4AC9A 3Q5EA 5LB2A 4A8JB 1R2QA 3B82A 4ZKDA 4AD8A 1L6UA 1XP8A 2C98A 3PXGA 1WGKA 2BMDA 2FSFA 2ZJ5A 5CIQA 4Q18A 3DHWC 4Q4JA 4Q9IA 1OH7A 3K9LA 5AK0A 1T3SA 4B6EA 3ADCA 1PVOA 2I4IA 4IOMA 4NL4H 1PZNA 3DOFA 1YZUA 2J0SA 4LOAA 4JLDA 2BMEA 1W44A 1JXOA 3HVZA 3W6PA 1HEIA 1S9HA 4PHHA 1ZAKA 1VCNA 2JLWA 2ZYVX 2Q9BA 3LD9A 3VX3A 2F1JA 1NSTA 4A8JA 1X3SA 1ZXIA 4OJQA 4LJ4A 2ECKA 3TH5A 1DAGA 3A1SA 3LLUA 3DWGC 3IEVA 1YZLA 1E9DA 1XPRA 1P7CA 3GJ5A 1RW4A 4L16A 1GL7A 1NP6A 1FXAA 1EFHA 5F9HA 5F98A 1E6CA 5TDHA 1XNJA 2ORVA 5BYKA 4EPXA 5FPYA 1WQ1R 2JJ8A 3RRZA 1E2GA 2FNAA 4HZUB 3U2QA 3RHFA 2OEPA 3H84A 3BWDD 1OE0A 1QLBB 1Q57A 2QM8A 3CWZA 3MSXA 4KBGA 4A1FA 2BMFA 1GL6A 4V0ME 5HTKA 3P27A 2HJGA 3CPEA 4AKEA 2LEKA 2OO7A 1X86B 2AR7A 3I4LA 3NKVA 1CR2A 4LJ5A 4C3ZA 2QRNA 3DOEA 4P3YA 1PFDA 4HI0E 4Q7KA 2QP4A 4LC1A 4DSTA 2W3RA 2GCPA 5IT5A 2OFWA 1VIYA 1EGAA 2PEZA 2QE7A 1JI0A 4QGHA 1DAIA 1HT2E 3LXXA 1KRHA 4P6VF 1Z08A 2A5FA 5BN3A 4HZUA 3U60B 4C7OB 2OILA 3DM5A 3QQ5A 4E03A 4QHSA 2REXB 1S1MA 4HZIA 4CZ2A 2XB4A 4NCKA 4G0NA 4L9SA 2R2AA 1J70A 2WAXA 1NMXA 4JT2A 2F7SA 1L6VA 4JJKA 1UKVY 4JT4A 2ODEA 3AE9B 3WY9A 1SQ5A 1U8AA 4C7OA 2DFTA 3RWOA 4RFVA 4KSCA 2CK3A 5EP3A 5K8TA 3IUYA 2ZVPX 1MOZA 3NC0C 4C7YA 1I4TD 1W46A 1G19A 4B44A 5A4JA 1BKDR 4TYNA 2WOJA 5CLLA 2HCJB 4KYIB 5GVSA 4B71A 1G8PA 5DHFA 4FMCB 2ZYWX 1FRRA 1G6OA 3EZ2A 5E95A 5ELXA 4UXJA 2NZ8A 1F2UB 1KDOA 5H70A 4CT4B 2BWJA 3VKWA 2VP5A 3I8SA 4WAUA 1OFUX 4KXFB 5CDFE 2GVDC 4OL0A 4HLDA 4XH9B 1E98A 4XIGS 1O3YA 3GD7A 1R0WA 4L8GA 1J7BA 3WMEA 1W7AA 3CLVA 1Z0FA 5JJIA 5E7IA 2BBWA 1RYFA 4OHXA 2IYZA 3NHBA 2ZJBA 3QKUA 2CLSA 3SC3A 4B73A 3KQKA 3V4FA 4S35A 2XB2A 2JATA 4YMTA 1F2UA 2C9CA 4LBZA 2BJVA 3GJXC 4UJ3A 1FMAD 2V1XA 2VRWA 3TIFA 2JLUA 4MDEA 1CU1A 2ZRPA 1E9FA 2BM1A 3AEEB 1VYUA 1XLNA 3DVLA 3P4XA 5IRCD 1TUEA 4TQUS 3E5HA 4UQOA 3B6EA 1XTJA 1W4AA 1UKEA 1XMJA 2NO7A 1N6RA 2QENA 4QHTA 2WKRA 2FSGA 1X1RA 1Z83A 4RZ2A 4CIDA 3PFIA 1NIPA 1ESMA 1KGDA 1TL7C 2G77B 4LY6A 1Z0AA 5EE0A 5CDFA 4B35A 4EPRA 5B30A 4B32A 1S96A 2JLXA 2X2EA 2PX3A 3SR6A 3MJHA 2YKGA 3W3ZB 1R0ZA 3CKLA 1XLQA 4LYAA 5HE8A 2QRZA 3AKEA 2QAGC 3T12A 4CT5A 3TR0A 3EPKA 4A2QA 2EFGA 1E0SA 4TTQA 2WM9B 3OEED 5JWRA 4X8LA 3R9IA 2BKEA 2IS2A 5CM9C 4YMUA 2FEOA 1OHHA 2GEVA 2PBRA 2IS4A 2O8BB 2IK8A 1HY3A 2ZJYA 4WXRA 4ASUA 4HROA 1BMFD 2I3BA 4B74A 1NKTA 5F2EA 4PHTA 4AI6A 1TF7A 2QU8A 1E9AA 1OXTA 2QMOA 5BWMA 1J7AA 1BYUA 1H8EA 2CCJA 3A8TA 3ZD7A 2G1KA 2OESA 2GJKA 2RB4A 4BRUA 1Z6YA 4XD7A 3RSOA 3QPUA 1MR3F 2GTPA 2JLQA 4JS0A 4M53A 1VTKA 1DVRA 1XJCA 2WLBA 121PA 4GDFA 3VNUA 2QIEB 4A0GA 2O8BA 1N0UA 2XTNA 1MABB 4RFSB 1QVRA 3R8CA 3AEFB 5L3QB 4V0LA 3RLFA 2G1JA 2QBYB 1ZUIA 3VR8B 3IQWA 1WRIA 2FWRA 1JEDA 4YC7A 3GPLA 4PPFA 2ZSAA 1OJLA 1OKKD 1AQYA 4G01B 4M8NE 5AJVB 1II9A 2L83A 3KKMA 1HUQA 4IOLA 5FPHA 4IFBA 3VR1A 5GJWC 4YLGA 2ODWA 2PIAA 4XVRA 5FUVA 3A1VA 2AX4A 3T1QA 1E10A 1MABA 1P9WA 5L3QA 1GVNB 4WW0A 3AM1A 4A2PA 5TMPA 2QBYA 1XEWX 2FEMA 2AWOA 3U3RA 3WRXC 3TNFA 4QM6A 1YHNA 3P26A 3QENA 1M6NA 4BLPA 1DEKA 4BPBA 4Q48A 2O8CB 1LS6A 1NIJA 1QBKC 1YRAA 3QF7A 4EQ6B 3TSOA 4XWOA 1KHTA 2IUTA 1GKUB 2Z4RA 1EXMA 1JXMA 2ZR0A 4TL6A 3C4JA 3FPAA 1LY1A 2YWFA 3F5FA 4II7A 4EPYA 1D9ZA 1NVVQ 4L5BA 4FXPA 1MO3A 1UBFA 1AKYA 1W36D 1NI3A 1KJZA 3N70A 3U7EB 4O25A 2G9NA 3K1JA 3UXMA 1UBGA 4JLOA 3IEUA 4Q9KA 2ZJZA 3WYFA 5G5HA 1ZUNB 3UWKA 4Q19A 2O8CA 3IGFA 4A4DA 4AG5A 1KO5A 3K0FB 4EQ6A 4LYHA 3CUEF 2MSDB 3LO5A 3RDPA 1ZINA 2EWVA 2AKYA 3QXJA 2GEUA 4BFZA 3I8XA 2XJ4A 4N3NA 5KNCA 1FM0D 1JRPA 1NLZA 3AE2B 4JYBA 4QJ5A 5KOYA 1NKSA 1KSHA 4OQFA 4Q1FA 1RZ3A 1AGPA 3NBYC 5JBQA 5KPDA 1YQ4B 4YDHB 1MT0A 2QJLA 1Z6XA 1EWRA 1M34E 5KSPA 2QGZA 1CIPA 4DLVA 1U9IC 2GAOA 2GKSA 2WJJA 2P5TB 2XZLA 2YZ2A 2OV2A 3K0FA 5KNDA 4Q47A 2FDCA 1AYFA 1GUAA 1S1CA 4C0AC 4U7DA 4D0LB 2C03A 2QEQA 2R6AA 2OCBA 4QKQA 3B60A 4FCWA 1IY0A 1XCGB 4G1UC 3SZRA 2WTUA 1TX4B 5H8YE 3AVVA 2R9VA 3IO5A 1ZBDA 3GEIA 2ZU6A 1KO7A 4ABYA 1C1YA 2FOLA 4AYXA 1XEFA 1R8SA 4QOSA 1ZU5A 1E3MA 1L5PA 1I2MA 4V02A 3SE0A 3NBZC 2R6FA 1TADA 1YE8A 5FTKA 2X2FA 4DCUA 1SKQA 5J4VA 4GOKA 4C0SA 2XAUA 3MRSA 3ZDQA 1S2MA 5AJXA 4PC3A 3UPUA 3LY5A 2IW3A 1WYGA 4BFSA 4B2IA 1Q3HA 1S8FA 1Z0JA 4C0HA 2R8RA 2WDRB 1E1QD 2IYLD 4M4SA 1HE8B 2D06A 1QOBA 4UJ5A 2QMUA 5BQ5A 5J4HA 1JWBD 2ZS7A 1ZYUA 1I4DD 4ZDWA 3M4YA 5JZVA 2EYUA 1CP2A 1WMSA 1N0WA 3GJ6A 4YONB 3A4LA 1AM4D 4JLKA 2WSSD 5TY0A 3LVRE 1LFDB 1K6MA 3V00A 2PCLA 5A5GA 1E9BA 1E6EB 5EE9A 3CZPA 5FI1B 4BFVA 3L8ZA 3UMSA 5JLJA 3QXCA 2H57A 3D6TB 3SS8A 1ZC4A 1IN8A 1J99A 2QE7D 2ZSBA 3Q5DA 1KDRA 4JLJA 1Z8FA 4QGAA 5JECA 3GFTA 4FXCA 1YR9A 2DWQA 3GMTA 3MUFA 2QSZA 1OFIA 1FQKA 4JVNA 4M1WA 3U61B 2QA5A 2H7VA 2PL3A 4B75A 4KJZA 2BDTA 2VTKA 3TBKA 4OBEA 1U0HC 3WHKA 1JROA 3BBPA 3HWSA 1R8QA 4HAWA 2ZAOA 3WP1B
chains in the Genus database with same CATH superfamily
3LHIA 2WU3A 4DQXA 4TLAA 4QEZA 1PGAA 3TW0A 2LP4Y 4D8UA 3HNOA 1OLUA 3LCRA 4BQNA 3PX4A 3FPCA 2BHNA 2KE5A 2H89B 5HKOA 4BEJA 3APFA 4FS1A 4OF4A 4UDUC 4QNLA 3UUWA 2A0WA 4EL5A 3K0HA 2ZJ8A 4ZVUA 5IVPA 1YQXA 3K9GA 1ZD2P 2NACA 2J9RA 5CDGA 2FDRA 4HEJA 2C96A 3LV8A 2WB1F 3E9CA 1XVUA 3UVEA 3EVEA 5IJZA 3HZHA 2C4TA 1SIOA 3H3JA 1BEUB 3CEPB 1SZCA 4B45A 1A6SA 3MBKA 4GQBA 4LYGA 4UEWA 1SBIA 1JTFA 1BW9B 3DGFC 1NDQA 4Q1EA 4D43A 3K5WA 4M1EA 1RQPA 4GC6A 4D44A 4ZMBA 1FYFA 1MD9A 4S0XA 3BN3A 3RQIA 4X94A 4FYXA 1ORHA 4MVYA 2Q6OA 3ZV3A 4X57B 2VUSA 1ZVKA 2J9FA 3QVKA 2QTLA 2Y77A 3EUFA 2PZGA 3OWXA 1TZOA 3JQ9C 1K51A 1KYYA 1R0LA 4R31A 4RF1A 4TTJA 2PUFA 1DKPA 1V97A 1C79A 2CXNA 4YQYA 5NULA 2QR5A 3PY8A 1UZMA 5C1IA 2YCBA 4NSNA 4JOCA 4OXXA 2B5OA 1ISHA 1QIKA 3BS4A 1T8RA 2NU9A 2ZZPB 2ADOA 3CR3C 2O59A 1M83A 1P45A 5TV2A 3KOZA 1L7RA 4NJ8A 3RK0A 3EH1A 4EUEA 1B23P 4JMUA 3RYFB 1KFCB 4EMSA 2PBZA 3C7AA 3AB5A 3EG9B 2D3DA 1P7PA 3KPVA 5JE8A 2DAJA 2DCUA 3UWMA 1K1QA 1NY5A 4GR9A 3JAWB 2XVMA 5AXAA 3UTDA 8ICGA 5C46F 1IUKA 1ZQ1C 3WAKA 3AI1A 3OAAD 1FC0A 3GEGA 2ECPA 3TEFA 3RWBA 1GQSA 2HDOA 1XQXA 3MUOA 4R2MA 3F6CA 2W4QA 4ZD6A 2ZUCA 1Y7LA 2NN3C 4RKWA 3JWIA 2BFEB 2O0JA 3FVRA 1W2GA 2ZATA 4NBWA 2VTBA 1MIHA 3DBRI 4NX2A 5KB3A 2EDUA 1M1YA 4E3WA 2ZPUA 5JVDF 1Q19A 2Q3MA 1IZ0A 4CEHB 1QHYA 2Z3WA 2FPKA 3FFTA 4N3AA 4FULA 2IDMA 3RJKA 3F8SA 1L2TA 3GAAA 4LF7B 2WVJA 3DJFA 3LVVA 2WA2A 3IV7A 1NK5A 3PC3A 3CX7A 1CX9B 4GWKA 2P2YA 4I4NA 1DAMA 5EIOA 3HXOA 3ZTDA 3QU4A 1U8ZA 5IAGA 3LQRA 1RWSA 2X9NA 2I87A 1MB0A 1Z5GA 1J24A 3KHLA 3TOZA 4A3PA 1RG6A 4YSYB 3HRIA 4FINA 2X2PA 3U3KA 1B0ZA 2HIMA 1Q11A 3JRWA 2I4OA 2R11A 5BW4A 3SC2A 4D8YA 2XB8A 2WDTB 1FVOA 2O7VA 1IXZA 5H9WA 4JEMA 4ZYYA 1YSCA 1WMDA 4FLHA 2WMNB 3EYAA 3VR6H 4IQ4A 5LDDC 1WS6A 3OFSA 4LVUA 3U16A 2AI1A 3OCZA 1DBRA 4H17A 3GFSA 3A6JA 4U0JA 1FXWA 1XRSB 5FPTA 3M82A 3TRFA 2C00A 3EHVA 3X0WA 3E84A 2FFJA 8AT1A 2AUNA 1F5SA 5KMGB 3IR7A 4LHYA 3CR7A 2B4QA 2I0FA 1ZXXA 3C1UA 4YJ2A 2O2ZA 4ZU1X 4I2IA 4DCTA 3FLBA 3S2AA 1V43A 1RZRD 4PYKA 5DN6A 3GDGA 1JVNA 4GI1A 4D9GA 2JGIA 2ZUWA 4ND6A 4RPLA 1E69A 1BWRA 4UU8A 4Q03A 3WAMA 3VHTC 4RSHA 1OXXK 5M04A 4W8GA 4MSMB 1EU1A 4LKOA 3IODA 1P0FA 4KR2A 4KVAA 4PS1A 3EWNA 3NETA 1CUDA 2Y5CA 2ECOA 5AZFA 3OEHD 4EOGA 4Y18A 2C31A 1BS2A 1AK2A 2WKPA 4BLVA 3BVPA 5CM2Z 1DJMA 3MQ4A 2YC4C 1KMNA 2VTVA 1JB9A 4QXAA 1JBQA 5DXFA 8ICHA 1QG0A 1JJ7A 4Y2SA 1IG0A 3ZJ5A 3A6EA 4L0QA 3VM6A 3S2SA 5BSGA 5C8ZA 3AHHA 2EELA 3OHPA 4MQ4A 5P8WA 4IOIE 2CBXA 2YX1A 5BVHA 1ZBQA 5BO5A 1OX6A 5I7SA 3MCZA 2LKCA 2ZRAA 2HGSA 3UKJA 1OIWA 1HE4A 2CVFA 4QYXA 3IAAA 2W6ID 1FYVA 2WZCA 4JI2B 1Z74A 3T1HB 3UQAA 1UL1X 3RJTA 1L9KA 2FGKA 1X9IA 2W3SA 2A9OA 1BGWA 4OGWA 3SXJA 2I1LA 4PY2A 3VR4D 4HYTA 4V0KA 3PT5A 4IM2A 2YH2A 3I9V6 4N40A 2RGEA 2WICA 3VR6A 4K7SA 3MRXA 5FI0B 3NO4A 3MJRA 2C2DA 5DULA 3QK0A 6AT1A 2NU8A 2BBCA 3U5TA 5BN4B 3DBIA 1U9JA 3DTVA 3MC1A 1RLIA 3ODGA 4DDMA 1CYEA 2OWOA 3TSZA 2OAP1 1YK1A 4AJKA 5EFZA 2W54A 4Y2YA 2C5LC 1XXHB 4F9GA 3N0RA 4ATNA 4IL6U 5B55A 3EQ9A 1U1EA 3DT6A 1UWCA 3HCNA 2BGJA 4P16A 4KDFA 2O7NA 2C99A 5J0SA 4WJLA 1FZTA 4DG8A 3X1KA 4X92A 2B3DA 1EAYA 3UQBA 5THKA 1T5LA 4PN7A 4MCAA 2QAGA 2VPWA 3SDBA 4D4LA 5D4BA 4AZTA 3LO8A 4NMLA 1QQTA 5FTLA 2IS1A 3SZGA 4O33A 2DECA 4BL5A 3HUIA 3H1AA 2BPCA 4IOKA 2F3TA 3ETLA 2Z57A 5CYOA 3KTDA 3OIYA 3PJFA 2VRCA 3T34A 1WABA 3DQVA 4NJOA 5K0TA 1F9AA 4EG3A 2J0QA 4NNPA 4NMMA 1LDNA 4H1HA 1P9RA 1N2XA 3IP1A 4KNVA 2O2SA 5DLPA 1UELA 5AVTA 3H83A 2V9ZA 4DA4A 2E5WA 3RS2A 4TS9A 4OYLA 3DMTC 3TQFA 2PIDA 1KP2A 1D9DA 2KN5A 3CVWA 3V7KA 7ABPA 2HCTA 3JQGB 2PKRA 3GCDA 3TUJC 1ACMA 4ZEVA 2XIJA 2IXEA 2G09A 4YSZB 1PT7A 1BFUA 2DQSA 5C5EA 3ZEAA 2KN4A 4PEVA 3LBHA 4DR5B 2FQWA 4OQPA 3DVAB 4PYQA 5LQKA 4NZYA 3LSTA 3L7AA 2LVQA 4CMKA 1PUIA 3FGOA 1HFWA 4ME6A 4HNUA 3HJTA 3N0XA 3T0IA 3MHPA 4KLQA 5AI6A 2JASA 3GV7B 3NRJA 1QM5A 3SQMA 5AW9A 4LFBB 1DQZA 2B1IA 3DQQA 1IJBA 5B6IA 2ZRBA 2ODNA 3M1IA 1XLPA 2QSDA 3EVFA 2QY9A 4PLHA 5E9AA 1MJ5A 1YVEI 4KIFA 2H08A 1HFJA 4G26A 1RXVA 4KMOB 1JTEA 5JV5A 3CRMA 4FJ1A 2BHRA 3FB4A 1CULC 4BVAA 4MR9B 5AJZA 4OOEA 4WFKA 1M2OA 1ZQYA 3JS5A 2VHJA 1GQRA 2XYPA 1EX9A 1Q1OA 1I9GA 3TGPA 5A04A 2BGTA 3CEJA 3WMWA 4ENWA 4BWFB 5I9SA 2DFLA 3ECCA 3AHGA 1AV7A 4X97A 4L07A 2JH8A 4P4UA 1BJKA 5C8DA 3FPJA 2H5JA 1X1QA 5CR9A 4P4GA 1VJ5A 4YO8A 1LF5A 2Q3HA 1YN4A 2R6GA 1XO3A 5J29A 5LUBA 2UUBB 3A9SA 3TTTA 4GMDA 2PZBA 1U63A 2QTBA 2V6BA 2NV0A 4LZOA 1TKDA 2FG6C 4KIKA 3QVXA 2COEA 1YB2A 1HA5A 2HPHA 3DZDA 4MMYB 3GT7A 4Y6RA 1CEYA 4K9DA 4CMEA 4KAXA 4OCZA 1V49A 4CKEA 4F8YA 3TS1A 2HIAA 5ADHA 2C9WB 3ZW8A 2HU7A 3AW8A 5TMDA 3WGNA 2IA6A 2J3KA 3N2LA 2AN9A 1U2EA 2QVGA 4K6KA 5FLYA 1JAIA 3C19A 5BQFA 1DAFA 2BFCB 3C98A 2J9ZB 5KVQA 2H1CA 4DXFA 2QNRA 4KE9A 2Q7OE 4L75A 4MB0A 3KWFA 1KBUA 2GMWA 1CIJA 1J2RA 2ZOSA 4UCWA 3RADC 2NZJA 4F71A 2P2SA 3KW5B 3NTQA 1O96A 4OHMA 3OE7D 4IFEA 2K7FA 1I51A 2NTJA 2NYUA 4RHEA 5CU7A 1NW8A 2XWJI 5JPDA 3TVTA 1QH9A 4PS8A 3ZNNA 3GLIB 1C9DB 2B8JA 2GOWA 3OJWA 1H9AA 3U26A 4WADA 1JWMD 5H81A 1MN6A 3ZY2A 3DZJA 2P9JA 3JR7A 4IRDA 1DC3A 1IM5A 1YQEA 1T6YA 1NBEA 3UMYA 5BMVA 1AJEA 2ZQ5A 3GP3A 1WZCA 3DNFA 4I55F 3O4HA 1QHGA 2BCGY 4FD3A 4ZVOA 1ZCFA 3PREA 4O2AB 4LDZA 4I9NA 4U5XA 2E89A 4ED8A 3OWHA 4C4SA 1OGWA 2IZ1A 2XOXA 3WFIA 2Z3VA 2VI5A 4L8FA 1XF9A 3K7EA 2D1RA 5D2CA 4DQPA 2HSEA 2QTFA 1H22A 2ODBA 3B1WA 3IEIA 2FPLA 2HL6A 1X94A 4EGQA 4DIBA 1P31A 2QMHA 1MG4A 1W8DA 2RGGA 4PNZA 1T7PA 3LT4A 3HKEA 3W5VB 3SJAA 1ZSYA 4IWOA 1BWQA 2P0YA 4KU4A 1VG9B 3QAQA 4ZDIA 1RZUA 4PANA 4KFCA 2OSBA 4DCOA 4PZPA 4KQ2A 4POOA 3M63B 2O54A 3NRZA 1NN5A 3HXPA 4F4KA 1FDOA 1Z8HA 3DV0B 4WZBA 4RFLA 1N48A 2TMYA 3U3JA 3BYYB 2VLBA 1H85A 2JAQA 1KMMA 4LIPD 4NU6A 4PX5A 5CEFA 3P2EA 3OIVA 3C3BA 1A77A 4YFKA 1VZ8A 3SFTA 3CRZA 2NT4A 1LRLA 3JALB 3NONA 1YRQA 4M9RA 5KFHA 1MGPA 1CUJA 4ERNA 7ICPA 4QO7A 2JWZA 2C42A 3GVXA 3U81A 1XYGA 1P18A 1I7PA 4P4MA 1D5WA 3COVA 1Y8QB 4TPKA 1WSBA 5KFWA 2LBOA 1F12A 2JXXA 3G0HA 3R7WB 2YYYA 1UMDA 3GBSA 1PQ4A 4Q01A 2KJ6A 4Z1MD 1J42A 4BJ5A 1G5RA 1E3WB 1VE9A 4CKWA 4B34A 1W36C 1LV5A 1OV6A 5DNVA 3I9LA 4NATA 2MQJA 2G9ZA 1TAUA 1PL8A 3IHTA 3GLHB 4FMPA 3SEBA 3LFTA 2IHBA 4BO0A 5JO9A 2AN5A 2OHGA 4C6TB 5IDWA 4NDNE 2WIFA 1HZ6A 2FFHA 5AKGA 3CH5A 1CJBA 4OXRA 2QZ4A 4ND8B 2IYDB 1F4VA 4PPYA 1WULS 3TD6A 4ZKEA 4GKJB 4ZODA 1TGZB 3HCWA 3I23A 1U0OC 1ODTC 3AINA 1GEGA 3PBKA 5E7MA 1KPGA 2X1VA 1AN0A 4DJAA 2OXCA 3DDSA 2C5FA 1YO6A 2K4MA 4NYJR 3MEQA 3I72A 3AF1A 3KVYA 1ZGGA 2IH2A 4OHKA 3IBCA 1O77A 1U9IA 4IWNA 3BMCB 1KI3A 2CHVA 5CCEA 2CHGA 3R0QA 1YS7A 2PQ6A 1P2TA 1FP7A 1DIHA 1BGVA 3CUWA 5DSXA 1QDUA 3NTRA 3W5UA 1ABEA 5SYAA 4M0LA 1G3IA 5DO9A 1G8KA 3FJYA 3L0OA 4RAQA 5J0PA 3C8HA 2Y66A 3GJ0A 3ZU3A 1J20A 5CH8A 3VPHA 1PTJA 4QFMA 1E32A 2CYBA 4UZEA 1HRKA 3M9LA 4RANA 1BMFA 4IZ6A 1B42A 2VJLA 4MW4A 1QQ5A 3R1IA 4R2JA 5KAIU 1L7EA 3TMAA 4WLEA 4HWKA 4UAYA 2SKDA 4RQAA 2XRMA 3TOVA 3IR5A 4M9SA 1RXUA 3ILVA 2Z30A 4KQMA 2RKWA 5DN9A 5FUWA 4YASA 1YT3A 2Y6UA 4L72A 2P7IA 2J7QB 4YHBA 5EZQA 2PUVA 2PXCA 5GMOA 1Y6GA 3HM2A 4E7OA 1EZ4A 3GO4A 3ZCVA 4L2YA 3ZKWA 2MJ3A 4BV8A 3PEUA 3OCCA 4UPDA 1ZRNA 3Q3VA 1MNQA 5LBIA 5ELLA 4YJHB 3S5JA 5KG6A 1Q5PA 5JJCA 4O4JF 3PA6A 5DLDA 2CB0A 1G2OA 2WV9A 3WLRA 3PO4A 1GPDG 4AO7A 5FR6A 3W06A 5LQNA 4Z8XA 3U7QA 2GCNA 4DNQA 3IQGX 4XYGA 1P5RA 2N3ZA 3NS8A 3F9IA 2AR0A 3LA8A 3VUWA 1K98A 1XP8A 4EZKA 3CG4A 2H0QA 2A1TS 4F8RA 2GASA 3VX3A 2ECKA 1XMPA 4DR4B 1M2HA 2XUIA 1KEUA 3GOHA 1R0BA 2O2VA 2AYZA 3JAKB 2OEPA 1L3TA 4WFQA 1YVUA 4FJZA 4P3YA 4GX0A 4BBNC 4ELVA 4JLSA 2C5SA 2RI1A 1URJA 1GQOA 4IS7A 3AB8A 4E03A 1FP1D 4G4SP 4F3TA 5ARBA 2XHZA 1SCJA 1NMXA 4JJKA 4MGEA 5KL1B 4PGMA 3SEFA 3RJFA 4TROA 2KEYA 5EQJB 4DQUA 2CK3A 3NZSA 2DHZA 4GM0A 5HW0A 3GH1A 3ED5A 3W9UA 1B3RA 4KHPB 1LVUA 4KYIB 4F5PA 4B71A 4EUTA 5DGIA 4RV4A 2QIPA 3JQCA 2KZMA 1JF8A 3ENNA 2BWJA 3VKWA 1CUKA 4KXFB 1B43A 2CXSA 4KN6A 3GZTB 4OHXA 2IYZA 2ZJBA 1X70A 2AF4C 3PMNA 3HBNA 1WXFA 4UJ3A 4DSFA 2FE8A 1XDSA 3AR2A 1V45E 1VYUA 1U1GA 3OIDA 4XYLA 2L42A 1W4AA 3L08A 1XMJA 3I2GA 4J0IA 2OAEA 2PSDA 4BMSA 5HE8A 3T12A 3NCTA 2BI8A 3H9QA 3D3NA 3GEDA 5KTQA 1EUZA 2C9DA 5DPMA 1UJ4A 1NATA 2WUFA 4M0CA 2IK8A 5K05A 2O48X 4ID3A 4B74A 2DAPA 2IRWA 4JYPA 3TLEA 3CBGA 2HEGA 3DT9A 2I54A 1WL8A 5EZYA 3VNUA 2QIEB 2V7XA 1O4WA 2WYVA 3I8OA 1SRRA 2RJNA 4FSDA 5K5EA 2XD9A 1SIFA 3IVRA 4WK0B 3R5SA 1BQ3A 2QB0B 5FFNA 3OT1A 2FRDA 5K9ZA 5CG2A 1W96A 2YWDA 2AWOA 1F4PA 1XLTC 1DEKA 2MJLA 4OLBA 2XUGA 1XYVA 4XZ4A 2ZNVC 3MM4A 1RYMA 1ZI8A 2CDBA 4TS3A 1GUAB 4E88A 4EI9A 4HDNB 1G8MA 4N3NA 2FOXA 1YQ4B 1G5QA 5K3FA 1Z6XA 3MJSA 3QZUA 3I76A 1SXPA 2GK4A 3A3YA 3T1YB 2FDCA 1AYFA 3TDKA 2R6AA 1QFZA 3U4HA 3WK9A 3AVVA 1OPRA 4K7WA 2OD2A 4Z6FA 1C1YA 4ZOLF 4G24A 3N1XC 1H42A 2W9CA 1L5PA 1T35A 1KLNA 1FP2A 3GRYA 1WY5A 3LUJA 2VWHA 1W1IA 3R5HA 3I6QA 4B2IA 4C0WA 1UGJA 3ZV4A 1C8VB 3M4YA 4MPPA 2EYUA 3ZXIA 3HLKA 1J0GA 3QEMA 2W2MA 1E1MA 3VPDA 2VYVD 4BFVA 1JHUA 5JLJA 1XKXA 1MSWD 4QG3A 2ZSBA 4LZLA 3Q5DA 4ND2A 2AEMA 4GZ3A 1C4CA 4OBEA 3P9XA 2KXJA 1G55A 3BBPA 3HWSA 1R8QA 4IIJF 4N5DA 2E21A 3S1AB 2AG5A 2GT1A 3FC4A 4MT5A 3Q8AA 3GIWA 5JXGA 1Z0KA 2JGJA 1WB9A 2BEWB 4ETIA 3AE3B 5BUZA 4AJEA 2OQIA 1E9EA 3FOBA 2D8CA 4EDHA 2XGJA 1PT8A 4S04A 5I7UA 4NOLA 2G07A 2NUPA 5EAIA 5IBQA 3P7MA 3RJJA 1GY8A 1QIMA 2ETXA 2GJ4A 1PZFA 4QREA 4DTCA 3I61A 5DX1A 2BQ3A 4YD1A 4CM9A 1V81A 4YRTA 4YB8A 2YQZA 2QMYA 4MUHA 5I45A 3HDTA 4JJGA 3UK1A 3H1UA 4MQEA 1WBJB 2A0YA 4Z3OA 5F35A 4ASUD 1JDBC 2YLMA 3EVBA 1U8YA 5AKHA 3B70A 3L6RA 3LCMA 4EUHA 3PENA 4F4FA 1H1TA 5I9LA 2B7BA 5DCLA 5KT4A 3B6KA 2PRKA 4PZZA 4M04A 2W8LA 3TL6A 3ZCQA 2D7JA 2XTJA 3KCQA 4I6LB 1UPCA 4ZHQB 1QF9A 3W5HA 4Y0VA 3PZ7A 4P5DA 1UOPA 4A6DA 3OD1A 1ZQDA 3N2KA 5ILQA 2ASQA 3OF5A 1FYXA 2JGFA 3WIEA 4ZYZA 4DS5A 3VJMA 4QX6A 1CRWG 1E66A 1TW2A 1U28A 3WFJA 1XVIA 5TMEA 1X66A 5CBPB 3IAEA 4DRXB 2EX0A 2MSKA 3GF4A 2C5LA 1S2OA 2R1TA 2P3SA 4ZYXA 5TPZD 1ZW7A 1AQJA 1GL9B 1RMYA 4A6QA 3NM5A 3BJEA 2DLCX 1JQ4A 4CLDA 2FP4A 4JNCA 3IMKA 4P4SA 3SZ2A 2IYUA 4XWWA 3U4CA 3FCSB 1EK6A 2VDWA 4FNGA 3QQPA 2LTAA 2PX2A 4KPUB 2JKYA 4G3IA 5DLYA 1ZK0A 1LV7A 4YXDB 1LF0A 1TFUA 4DLNA 1NK7A 3DR3A 3H7AA 1YVDA 2YOFA 3Q8EA 2WYHA 4Z4IA 1R9NA 2NR2A 5L95C 4DCVA 4RTRA 4B6RA 5CJJA 4DR7B 4H77A 4PAQA 2R6DA 3AV0B 3VDNB 4UUBA 3WKBA 3ZNQA 4ZPJA 2AG1A 5CXUA 3A3KA 2ZAYA 1AXEA 3ZQUA 3DYBA 1BHQ1 5D7BA 3ZE7A 1DBSA 5AJTA 2PUGA 3GLFA 1S8OA 3WNQA 2NVUA 2DPMA 2P7HA 3JVEA 2JQRB 4ITRC 3I63C 1DHTA 4QWAA 4BAGA 2O2JA 1C9EA 3DCNA 3AVPA 4BEVA 2PGIA 5K3EA 4DK5A 3D1VA 1KIFA 2RFLA 2VJ5A 2QG4A 5LIRA 5U4XA 4EEZA 2CJPA 4DMFA 1DQSA 2SEBD 1PV1A 4RDCA 4JUCA 3LT2A 4WA7A 1Z35A 2QMEA 1JCKB 4EGAA 2PRYA 4BQPA 4A9AA 2GPYA 1UBCA 1XRNA 3EC8A 1Q0HA 1V16A 1HNZB 5AK6A 5IBPA 4OM7A 3W2TA 1P6XA 1Y8ZA 2HA2A 5FL7A 5BSTA 4GU5A 5CVJA 3AW9A 1UXJA 4HAOA 1T36B 4JY7A 1SQSA 4LSGA 3UO8B 4G0OA 4JBNA 3GP7A 3LRPA 1UDBA 1L3CA 4I2HA 1TOAA 3E82A 1KXJA 3ZNPA 3M7DA 4YT2A 2P5UA 3FX2A 3O31A 1V9CA 1SELA 3MS4A 2XGPA 4DUZB 4Y2QA 5CA1A 3HN7A 4IIVA 3U52E 3O8DA 1HDEA 2BCEA 3BE4A 1OX4B 4ENVA 4GP9A 3BXPA 1OIVA 1NP7A 4FOLA 3AR9A 1JFVA 5DXJA 4KLNA 1X39A 4R6WA 4PHCA 9ICLA 3TEYA 2I8LA 3PYXA 4GDLA 1X38A 3PUVA 3LUPA 3B3QA 2O8FA 2OM2A 2KC2A 3E9SA 2VNJA 4EWLA 1LPPA 3UBTA 1DFHA 3NW9A 3ENEA 3N9IA 3OQBA 1VSUA 4WASA 1LNZA 4QDXA 3WNZA 4M9ZA 2OD9A 3IIIA 1NW4A 1FFEA 4GI2A 3D5TA 2E85A 2E4XA 4WBSA 2HUPA 4WLVA 4BCDA 2OB1A 1TA0A 3P9RA 3ZVNA 3PRJA 2NTTA 4KWCA 4PLZA 1DBPA 2JZNA 2YOHA 5FI5A 5EQFA 2I4MA 3RC7A 4WLOA 3KDPA 5H5JA 2PGDA 2G7ZA 5FLEX 2ZJ2A 1XZAA 3AFIA 4IDEA 5C8YA 1GCUA 4YDRA 2YV5A 1DOYA 3VPAA 3L82B 2EF0A 2VQ3A 1YL6A 3OOJA 3AUYA 1Y4DE 4XUCA 2YXDA 1L7MA 1F6BA 1MQAA 2CF5A 1TJYA 1H8CA 1VJKA 3JZAA 1T91A 1NXPA 4TYWA 1EFRD 2BQUA 1G64A 3L6UA 3H1PA 1XZLA 2GZ1A 5J2HA 1AT1A 4WVFA 3UBMA 3CONA 8ICEA 3AF5A 1HA3A 3KZOA 3M9XA 1T8YA 5CLGA 3WBFA 1UAAA 2QB1A 3B2GA 1KJYA 1DDOA 2ZANA 1YZGA 3KVOA 4EHLA 3CSDA 5EGSA 3R8FA 5E6SB 3QP9A 4LJOB 2PMCA 9ICEA 2ET6A 1I0LA 5AHOA 2J9YB 3S55A 1P2DA 4W9EA 4MMXB 2OAGA 3REQB 5IBRA 5LYJB 3IE1A 1IULA 3V7NA 1QRSA 5CNKA 3JD1A 3KQPA 3UMVA 1UP7A 1DXSA 1DZ3A 1SHLA 3KKLA 2D62A 3RABA 4MUIA 5IK2A 2Z43A 4DWOA 4LDQA 3DC2A 1FTNA 2O3SA 3L7MA 2C9OA 3E2PA 3EVGA 2FEWB 2QYSA 3AR8A 4KXQA 1P0RA 4Q1BA 2VXBA 4L0DA 4M1TA 4LY9A 5IIJA 2OV4A 2FMXA 1V1PB 1ZQEA 3SBDA 2LIVA 2JJ1D 2B21A 3C2MA 5AVXA 2IGTA 1TD9A 1V26A 3PS6A 1XK7A 3DS8A 4Q1VA 3CWIA 3TE6A 2KFKA 3LUHA 5HKKD 1CDDA 3EFCA 1VZ7A 4KZ0A 1L5WA 1C4OA 3HR8A 4FGKA 3A10A 2RAUA 2V4IB 1KI1A 7AT1A 2GETA 1NVDA 4Q4CA 1YACA 2KNJA 3H17A 1DV2A 1CUYA 2FE9A 2V5UA 1SHTX 2JGLA 4FYYA 5C34B 2LBPA 5GJBA 4WGGA 3G6XA 3CCCA 3AHDA 4A2CA 4B46A 4JC4A 1Z12A 3IHWA 1ID8A 3AVOA 4H08A 4K4GA 1PZXA 4PO8A 4JAVC 4K2HA 4W9HA 1RR6A 2W37A 1V25A 5BQPA 2L0TA 1ADGA 1QPGA 2OEDA 4HGZA 2VWQA 5BYSA 1O6CA 2Q0HA 2DYKA 2NW6A 2ZBEA 4UOZA 1QX3A 2K4PA 1DB3A 3AVWA 1KF0A 2XTAA 4DV3B 1YJ5A 4IDDA 1FA9A 4AY2A 1CHDA 4NOKA 1EQAA 1N2IA 4BASA 3ENQA 4BMYA 1YDGA 1T8PA 1W9MA 1GPXA 3SYTA 3U5ZB 4G23A 1CDEA 4E3ZA 4B84A 1RWMA 1U0LA 3OU6A 1ZDMA 1G7SA 3RUEA 2WFMA 4WT7A 1PHRA 4OVVA 1WYWB 2IYQA 1E4VA 1RWXA 2M6KA 4RH1A 4CRWB 1B4FA 4DR1B 3ZCSA 3AE8B 1KFEB 4N4AA 2CHXA 3E9DA 4DMLA 3AEBB 221PA 1UWMA 2WB4A 3E22B 3R77A 1JMVA 5JUWA 1GPJA 2A3NA 1T3NA 3ISCA 4MSUA 2K5PA 2QRLA 1HYBA 3AL0C 2AI3A 1QP7A 1KZ4A 1RWVA 1SEVA 3RSLA 5A03A 5KFCA 4EEWA 5EDSA 2JHFA 3K1AA 4Q3AA 2ZJOA 2C7PA 1ZRHA 5AW1A 5D3MA 2QV0A 1BNCA 2IGBA 3R3VA 3WKDA 4HUQA 2QR2A 2PJHA 3MQ2A 4Y6OA 1V35A 4RY8A 3BERA 3QF4B 4RMHA 3E56A 2MMCA 4B9NA 5C31A 1QVZA 1TU3A 1VPDA 2DG2A 2PGOA 4GB9A 4DLSA 1YT5A 3TAXA 3SNKA 3T0GA 3BXGA 2FWJA 1K8YB 1NJ1A 3LYUA 1JL3A 4PZDA 3ZI4A 2FPIA 4IUMB 4GZLA 1DIRA 1SXJA 4H6XA 2D1FA 1FK8A 4X20A 5EGNA 5EHQA 4ND5A 4CKBA 3KLMX 4P32A 3K72B 2FN8A 1L4ZB 1NN1A 4L9RA 3B89A 4HT3B 1P7WA 5EN4A 1TS3A 4QFCA 2BFPA 1Z4NA 1G5IA 1V47A 4P31A 2GPWA 4JA2A 1K86A 3UATA 4HFRA 2QD2A 3SYLA 2XOKD 1K53A 3SLRA 3COWA 1R00A 3T6KA 3AONB 4MKXA 1CYDA 2C94A 2H2GA 2YS7A 5IJ0A 3GJYA 2WDPA 2GB1A 2GN6A 4I50B 1OFVA 4ALMA 2NXNA 1F0NA 4UDOA 2G83A 2B3TA 2AH5A 1H65A 1CJKC 1BVHA 3LUBA 2DAFA 2AHRA 4M46A 3WNDA 3LIIA 1X7HA 1W85B 4FS3A 4IDCA 4YL8A 3ZLUA 1GT6A 1MOQA 5U1PA 2XQVA 4ENSA 4A2WA 4PQEA 4EMUA 2JEFA 3GHYA 1Z28A 3MWDA 3C7TA 8ICAA 1ECBA 4H7DA 1P9DU 2Z98A 1QRDA 1OFTA 1PQUA 1HEKA 1UK9A 5FT9A 2XUJA 2BFBB 4X00A 3QMVA 3ABZA 5K09A 3RE1A 3H04A 1DARA 3CVYA 2FSHA 1TBEA 3VV2A 1KQQA 2ZUVA 4IR1A 1J7KA 1GV0A 3OT4A 1JFLA 3EBPA 3P1JA 2EKQA 4RSGA 3MK31 3QXGA 1RP7A 1WJGA 1E7WA 2BELA 4FZVA 5BR8B 2GTHA 1Z2CA 2QM7A 3QHTA 1W0KD 3HIZA 4B6OA 4M0WB 1KI9A 1H5UA 1C4XA 4AZVA 3W5DA 3RUCA 5JZ9A 1OYVA 3HWRA 4EIWA 3NI2A 1Q10A 1QYIA 1YQWA 2RBEA 1GZ5A 4K81A 5I7OA 4HDCA 2C5AA 4MQFB 4QC2A 5KFIA 1H38A 5KOJA 1DGJA 2DOKA 4NCAA 2ONKA 3GUVA 3KNZA 1JVSA 2YN2A 2G71A 5IS2A 3D0KA 2H52A 2XTMA 2Q6KA 3HKBB 3JD3A 3HK0A 1FRFS 4AQ7A 2GCOA 3EZLA 5F12A 4PHGA 3E48A 3WIBA 5ESXA 1W581 4TMVA 4PR0A 3S29A 2D54A 5TRTA 1KDPA 1KFTA 1ZQOA 2ZIWB 4KLZA 2OGUA 2FBWB 4F46A 4KQ6A 1NJGA 3RPEA 4ECSA 2R7NA 1T25A 3A9KB 5ETJA 2H17A 5DGCA 1XCPA 2FHPA 1JWAB 5JAOA 1GQFA 3BQ7A 1AY0A 5LCXA 4E33A 1Q7TA 1UBHS 1ISRA 2H1IA 3O65B 4P82A 2WD9A 3UUEA 4ZQCB 3PWSA 1P60A 1LBIA 4DLRA 3AEAB 4QRIA 4DEZA 4PLPA 4AK9A 1N6OA 3DQPA 2AXPA 1IN4A 4OXQA 4L51A 1SWWA 2PUEA 2IOQA 3IAHA 5CHFA 5KFEA 1QLHA 2Q5QA 1UIMA 3S2IA 3D2LA 9ICMA 4MJXA 1X7GA 2JFFA 3OPYI 2I3DA 5BN5A 2Z6UA 4TLDA 5TJ9A 2VZ9A 3AE4B 4CUZA 2R1ZA 3GUUA 1G1AA 3MWKA 1BRTA 4KO2S 3PPYA 1QMPA 1TK8A 5ABPA 1YI8A 3UT6A 1XR3A 3CZAA 3DE6X 4ZI7B 1U9ZA 4NC9A 3NBUA 4RUKA 4A16A 2ZE7A 4F6LA 2FK7A 5BYQA 3DWMA 1M1XB 2JEIA 4LHWA 2QR3A 3OZTA 2PXAA 2XQFA 1YB7A 1BA2A 2LM4A 4I9GA 2O19A 5F9MA 5HBGA 4W5NA 4XCQA 3H9UA 2IYOA 1RQ2A 3NUQA 1M1NA 5CH5A 3SY8A 5E3IA 3AN1A 3J81A 2K8CB 1XAJA 1OTRB 1GFIA 4JL8A 2HVIA 1NKEA 2UU7A 4CKYA 2E4VA 3PJEA 5A7HA 3IIMA 2W6PA 3Q72A 2ZROA 2AV6A 3RUIB 1TQ8A 1XB2A 4X63A 3U7ZA 2NCNA 3NKFA 4DF8A 2TMGA 5UKDA 2CJOA 2YMMA 1EM6A 2Y27A 5BT8A 1ZQZA 1O7JA 2PGAA 1YAHA 3PHCA 3DF9A 1QCDA 1XTRA 2W0MA 2GLEA 1B7GO 2I65A 3HWWA 3TOSA 1U3GA 1ZR2A 2KLGA 1QKKA 3HWX1 2F55A 5H0IA 5T4BA 5BN1A 4JK1A 1U2SA 1MX5A 4GZ5A 3PV0A 4N7BA 3P0FA 1Y5RA 5JBNA 3LMKA 4BB6A 2V4MA 3PEWA 4RA9A 2GJ9A 2HXYA 4DSZA 3PWZA 4DMRA 2L3ZA 1Z2EA