5J8YA

Crystal structure of the scm-sam and sfmbt-sam heterodimer
Total Genus 25
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
25
sequence length
78
structure length
78
Chain Sequence
DSMPIDWTIEEVIQYIESNDNSLAVHGDLFRKHEIDGKALLLLNSEMMMKYMGLKEGPAEKICNLVNKVNGRRNNLAL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Polycomb protein Scm
publication title Molecular basis of PRC1 targeting to Polycomb response elements by PhoRC.
pubmed doi rcsb
source organism Drosophila melanogaster
molecule tags Nuclear protein
total genus 25
structure length 78
sequence length 78
chains with identical sequence B
ec nomenclature
pdb deposition date 2016-04-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00536 SAM_1 SAM domain (Sterile alpha motif)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.50 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 Transcription Factor, Ets-1 5j8yA00
1Z1VA 1OXJA 1SXEA 5L1MA 1SXDA 2E8MA 2L5YA 2F3NA 3KKAA 3TADA 2GLEA 2Y9TA 2QB1A 5F3XB 1V85A 5JRTA 2DL0A 2K4PA 2EAMA 1KW4A 3SEIA 2ES6A 4IS7A 2QB0A 4RQNA 1PK1B 5J8YA 4MHVA 1DXSA 3BQ7A 2KE7A 3BS5A 1PK3A 1WWVA 1JI7A 1RG6A 3H8MA 2F8KA 2EAPA 3IDWA 1X9XA 2DKXA 2F44A 3K1RB 5KNIA 4PZNA 4RQMA 5JTIA 1COKA 2QB0B 1B4FA 5JU5A 4NL9A 3HILA 2KMDA 1B0XA 3TACB 1SV0A 3SENA 1LKYA 2KSOB 2EANA 1OW5A 3BS5B 2KG5A 2K60A 2E8PA 2D8CA 2E8NA 2QKQA 3KKAC 4PZOA 1V38A 1UQVA 2FE9A 2B6GA 1PK1A 5J8YC 3BS7A 2QARA 1X40A 2Y9UA 2LMRA 4NJ8A 2ESEA 2LPEA 1WWUA 3TADC 1F0MA 2EAOA 1SV4A 1SGGA 1UCVA 2KIVA 4NL9C 2DKZA 2JV3A 1SV0C 2D3DA 2E8OA 2QARB 2KSOA 2YTUA 1X66A 1LKYB
chains in the Genus database with same CATH superfamily
4BX9C 5HMLA 3Q8RB 5L1MA 5KFEA 4PHPA 1RQLA 2I1QA 4RQ4A 5L1KA 1DK3A 2KJ9A 7ICFA 4KLDA 4P4OA 2EAMA 2JH7A 2F2AB 5AM4A 4IS7A 3OPXA 4O3SA 4RU9A 1ZOLA 5KFSA 5EWFA 2V4QA 3RR7A 3N7RC 1ZD3A 4TQRA 4NLBA 5ALRA 2VJ4A 2ZUBA 4P0PA 5G5HA 3C5FA 3QU2A 1BPYA 2DKXA 5KNIA 1Z00B 2M0NA 5J0UA 9ICIA 4XQ8A 3V7LA 2KMDA 1YT3A 3IG8A 2ASLA 4TUQA 4KLQA 1KKXA 4UBCA 3F5EA 4G9BA 5KFWA 3H7IA 3JPTA 1ZQXA 4Y2UA 5AIAA 4QWBA 1HJPA 4EX6A 1L7NA 1ECWA 3GV5B 1U49A 2A1JA 2KZ3A 4UB8U 3V6HA 4US8A 4J9RA 1OUQA 3B0XA 3MABA 3UXPA 2BR0A 3C28A 3IHQB 1QH9A 1ZQRA 1CEZA 4ED7A 2R8GA 4A8EA 3H8WA 2KV2A 3M8SA 3GIIA 5KFGA 4P0PB 3UXOA 2W9MA 3V72A 4IRDA 1V97A 3N7PD 4KLIA 2UVWA 3UMBA 5KFVA 1ZQNA 4Z6EA 4QZCA 3H8SA 4RNNA 4U6PA 2XIDA 2WFAA 3OJUA 5KFHA 4XRHA 1N56A 5H2FU 3KKAA 3MFIA 5DQGA 2DL0A 3AU6A 4I2AA 1BPXA 4B6JA 4RQ0A 2A1JB 3MFHA 5AI9A 2C2RA 2DWQA 1S8OA 3NVWA 5GTHU 3N97B 2I6XA 4JV1A 4DFPA 5ALDA 1PZNA 3UPQA 1XSNA 4NLZA 1QQ6A 4YCXA 1F5SA 4R64A 4OCZA 3ISDA 4C7YA 4ECWA 1RQNA 1ZQLA 8ICYA 2IOHA 2FMSA 2HBJA 5JTIA 1UHUA 2AGOA 4I2CA 3KTQA 4EBCA 1ZQFA 4Z6CA 2RRDA 4BXOB 4I2DA 4GXJA 4EBDA 4UB1A 4M47A 3FAHA 4Q43A 4J9PA 1MQ3A 2I9GA 1UT5A 3RJHA 4F50A 4I2GA 2XGPA 1V38A 5DQHA 9ICXA 4F2RA 1TAMA 3SAHA 3PO4A 2YB4A 2W9BA 4YR3A 4ECQA 2PKEA 1PK1A 3RBDA 4B9NA 3G6YA 3RRHA 5B66U 2IMWP 5KFAA 5HHIA 3SZ2A 3QZ7A 1N5WA 3ED5A 1A76A 2KOBA 4EELA 5HNKA 5CHGA 2WF7A 4G3IA 4PGXA 3OHAA 3VCBA 4O3RA 1Q3UA 1IV8A 3NS1A 5DBAA 5J0SA 4QW9A 1X66A 1K1QA 3N7SC 1JRPA 5L1LA 4RUAA 3GFKB 4CGZA 4DLEA 3WK7A 3K1ZA 2W8KA 1KTQA 5KFJA 5AK6A 5IIKA 4DSKA 1CRXA 5KG3A 4OJOA 4UB6U 2ASDA 3PR5B 1H38A 3PZPA 1PK1B 4JV0A 4F71A 1MQ2A 3ZDDA 2GOLA 5KFDA 3HP6A 5KFTA 3BS5A 2A3VA 4B9MA 3EYZA 1Q46A 2BDPA 7ICHA 2DBYA 2EAPA 4O3NA 1QSSA 3Q8LA 3AEVA 3RJFA 2OXOA 1X42A 4RUCA 1PVQA 4FE3A 1ZQHA 1DGJA 5ALWA 5DG8A 2ODGA 1RYRA 1L8LA 3SV3A 4CF4A 2JEIA 4Q44A 1XU4A 3AUOA 4DF4A 5AI0A 1S0OA 4F2SA 2LBOA 2PMZC 4PZOA 1RDFA 8ICAA 3M6KA 1PVPA 2K8AA 2MRLA 2LI6A 1KRPA 1T8EA 2DF4B 9ICLA 1O03A 1O08A 2ZIUA 4LVSA 2ZJ8A 8ICCA 2KK0A 3AM9A 5KL8B 4QZ9A 3IN5A 3QU5A 4JWNA 1SV4A 5AIBA 2PFOA 2LYAA 1KLNA 2VKQA 3KHRA 1NJWA 3O0FA 3HWTA 1JXLA 4C8KA 2G5IB 5AM3A 7ICRA 2E8MA 7ICVA 1ZXIA 1TVAA 1V85A 2ZIXA 2PI5A 1ZJMA 5J2JA 1ZQPA 2IOFK 5J0OA 4ELVA 2C2DA 9ICPA 5AHXA 4IL6U 2WAQF 1QQ7A 5CEHA 2IBKA 4NM1A 2JH1A 2Y0SC 2ZIUB 1MC8A 5EE1A 2JEFA 5AICA 1FEZA 3ZD8A 3GQCA 4USAA 4B9LA 3PMLA 3WKAA 3ISCA 1GO3F 2XVTA 1XS9D 1MSWD 1X9SA 2GO7A 5KG5A 3BQ0A 3LVVA 4M2YA 2QB0B 2HHSA 3RR8A 2YMMA 3CRXA 1KL9A 2C28A 5HP4A 5EE3A 2E8NA 5ALFA 2OH2A 2HHUA 3HT3A 2ZG6A 1UQVA 2ZIXB 3CW2C 9ICVA 2F1JA 5DB8A 4FBTA 2W7OA 5AI6A 4DWIA 4DQQA 4M9JA 4YD2A 1A0PA 2V4RA 1T4GA 1SZHA 2LMRA 1QTMA 3LYSA 2AJQA 1ZQUA 1L7MA 3OJSA 3MBYA 3MC1A 2KHVA 3H40A 3WKBA 4F5PA 4NL9C 4F91B 4OJ5A 3RJEA 2QARB 1FIQA 2KHQA 2MUTB 5KFXA 1S9FA 3JPSA 1NJXA 2JEJA 4TURA 4KX3A 2BCVA 5TISU 4Y2TA 2QB1A 2DPJA 2K4PA 1BVSA 4QJFB 1D8BA 4KLFA 4UB3A 4ECRA 1KQQA 3ZDCA 3RF9A 5CRXA 2ALZA 2BDUA 3V7JA 3L4PA 2LYBA 1X2IA 3H8JA 4YG2A 2WB1F 1XO1A 4Y2YA 2LYHA 2LM4A 4O0IA 4UQGA 1JIHA 2NRWA 2VIXA 2YQEA 3IDWA 4UW9A 4AP9A 3HKZF 1XWLA 4PGQA 1UA1A 1M6YA 2KVSA 3C5GA 1B0XA 3G6XA 1LKYA 3H0MB 4EENA 2KICA 1OW5A 3PVXA 2K89A 1ZQWA 5ALJA 4IQVA 3PSPA 1Z19A 9ICSA 2KKPA 7ICPA 3CNHA 3WKEA 1JALA 5AKGA 5J0WA 4DSFA 7ICTA 3ETLA 2UVRA 2OWOA 3CYMA 5KG2A 5EE9A 3E58A 1S77D 4CF3A 4Q8EA 4ED1A 5KFOA 3RAXA 4FZLA 3SD7A 4IR1A 3EZ5A 2KP7A 1X9MA 1U47A 4Q45A 3G6VA 1C7YA 2ZUDA 2KTQA 3SAFA 1KFDA 2YMLA 5KFLA 1CUKA 4C80A 3QUCA 3LVWA 3ZDEA 3Q8KA 5KT3A 1P7DA 1LKYB 4UB5A 2UVVA 3A0BU 4XUSA 7ICQA 4ECSA 2GLEA 3RH5A 1L7OA 1QSYA 3E2EA 3QXGA 1CI4A 4BGDA 5D46A 5ALIA 2FDRA 4NLNA 2E5SA 8ICFA 3THVA 4I29A 2R8KA 3SYZA 4QIWC 2KFZA 5AM0A 4F92B 2K8BB 2MA1A 3D2QA 4GC6A 3F2DA 3GIKA 3FYHA 4JB3A 4R66A 4M9GA 3DEEA 2H3QA 5KFKA 3RRGA 5DG7A 5DDYA 1UPHA 9ICWA 3I28A 4KITB 1RYSA 2ZXHA 3ZDAA 4YP3A 4FS1A 4OJ6A 4EYHB 2R8IA 2OHFA 4K4HA 4YR0A 4RPZA 2FE9A 4QWDA 3HX0A 2VA8A 5J0TA 1PUZA 3WK8A 2W9AA 2K8CB 2XI9A 4FBUA 4M6WB 4J03A 3D2NA 3OHBA 3KFUF 1ZD5A 4UAZA 2E3TA 3ORYA 4NJ8A 1ZQIA 4M9LA 1WWUA 5AK5A 4IQUA 4B9VA 5HR6A 5ALNA 1NJYA 4GIBA 3UQ2A 1N2XA 1B22A 3QEBZ 4I27A 2YB1A 5ALSA 4ECZA 2D3DA 4UBBA 3RB6A 5KAFU 3RB4A 5KFUA 3RAQA 1QCKA 1T94A 1TK8A 1X6JA 1SXDA 2HOQA 1S97A 2FLPA 2BCQA 4ED0A 4DQIA 5KG1A 4F5NA 2ZJAA 5KFFA 2YX8A 4DF8A 3LWLA 3J81j 5ALYA 2AQ4A 2ES6A 4ZH4A 2JR5A 3MGHA 2VANA 5FP0A 4BXOA 4EEKA 5K4LA 1J97A 8ICBA 1DXSA 1JXEA 4ECVA 2F8KA 4PHEA 1ZQYA 2YMPA 2FPKA 4JK1A 4RT2A 3EPGA 2HHWA 5J2HA 9ICHA 3RJJA 8ICQA 3ALRA 3QU7A 4ECYA 8ICIA 4P0QA 3TAQA 4NV0A 2XICA 5KFRA 2FI1A 4F4WA 5KFPA 2EANA 4Y2JA 1SWWA 2ISPA 1SWVA 1NKEA 8ICRA 4GXIA 2CXYA 8ICVA 3JPOA 3SAGA 1B43A 3AU2A 3BS7A 4GLXA 5AK3A 4F4XA 1NOMA 1NI3A 1L3UA 3PW7A 5KAIU 2Y9UA 2H3FA 3B9JA 2NO5A 5CA7A 9ICUA 5E79U 2XCAA 2ZJ5A 3NASA 3KD3A 1TAQA 4LJXA 1HIWA 1S0NA 4C0ZA 3WK6A 4C8OA 5J2EA 5F9LA 4NLGA 2HHVA 2JHDA 4RNOA 1SGGA 4FO6A 1K1SA 5AKEA 1SV0C 4CDGA 2BPGA 1X6IA 4P0QB 1COOA 4RQ5A 1SXEA 1YZ7A 5KT6A 3KHHA 5ALQA 5KFIA 5BOMA 5JRTA 4P4PA 5HR7A 4F4KA 5AK4A 3SEIA 5KFZA 3LDAA 4RQ7A 2R8JA 3H4DA 8ICNA 3T5LA 4UAUA 1HEKA 2W54A 2NRTA 4DSEA 2EZZA 3TANA 3ICXA 5L9XA 1EXNA 5EE0A 3UXNA 4R65A 2H3VA 1FFUA 5J0QA 2AGPA 5ALGA 4KLMA 4UATA 5HMMA 2XY5A 2RLTA 5J29A 1NNLA 1QSLA 4KN7A 2OM6A 3RH6A 4F93B 2NRXA 2CPRA 4EEYA 1RYUA 5J2GA 2LM1A 5DDMA 3C2KA 2JGAA 4ICAA 4QNLA 3M9OB 3CP8A 2G06A 3KOOA 2J6TA 2H5XA 4I28A 5J8YC 1ZQDA 3UMGA 3PSIA 4AYBC 2LPEA 3V6JA 4I2IA 1ZQGA 3SMVA 4K4IA 1TV9A 1URJA 4QZHA 2ZIWB 3GV7B 3NTUA 2HHTA 2JZBB 8ICGA 2EQYA 2W11A 5J0PA 5J2AA 3SR6A 3WK5A 3Q8MA 1D8YA 4DS4A 2BGWA 4FZMA 4KLJA 3TAPA 5AKZA 1KW4A 2QB0A 5AKLA 3GIMA 3MR3A 3HW8A 2WAQC 5CB1A 5DB9A 4O3MA 1Q3VA 4ELTA 4RPXA 5IIJA 3ONNA 3UMCA 3JPNA 3K75D 9ICNA 1N62A 2NYVA 1T7PA 1L3SA 2PMZF 1XC9A 2KD1A 1ZQSA 1ZQQA 9ICEA 4RQMA 2AH5A 4OJLA 2P6RA 2W3SA 3TI0A 4F8RA 3PNCA 5JU5A 2HVHA 4OO1J 7ICOA 2PFPA 4DFKA 2XO7A 4DL2A 3GU3A 2XC9A 7ICEA 9ICRA 4M9HA 4JMUA 2XCPA 2E8PA 3RBEA 2W9CB 3EW9A 2EH9A 4DFMA 1BPBA 1UA0A 1Z4NA 2MSNA 3EPIA 4OJPA 8ICUA 1TAUA 2A1AA 1NK0A 4DL6A 3F5AA 1WCLA 2QARA 2B0CA 2MUTA 1N5XA 2Q0ZX 1N60A 1JROA 3L3FX 2DGZA 4TUSA 1X9WA 4C8MA 1HUOA 4DO9A 5L1JA 4YFKA 1ZQZA 2CN1A 1L7PA 2IOFA 4ED6A 4PL1A 4QZ8A 4E0DA 1UCVA 2KIVA 3AMZA 3QEAZ 2DKZA 4DSLA 4DFDA 1NJZA 4Y2VA 4RZRA 4DS5A 4Z6DA 2WF9A 2XY6A 2Y0SF 4C7ZA 4YD1A 2F3NA 3GDXA 4YXMA 4ECUA 1ZQEA 2KKVA 2ZIVA 3GV8B 2HBKA 4I2FA 1ZQCA 4RQNA 2HDOA 4MHVA 4TUPA 8ICMA 3PW2A 1L3TA 7ICGA 5ALPA 1SKRA 3BQ7A 3OSNA 3DDHA 2VJ5A 1WWVA 3OTQA 1XSPA 5AI5A 3E0FA 9ICJA 2ZTDA 1ZD2P 4RPYA 4PZNA 1DGSA 2JEGA 4GC7A 1ZQVA 3IG5A 2A19A 5DGAA 2ISOA 2Z7JA 1XNSA 1RZTA 3QNMA 3T5HA 5ALOA 2YN4A 1SL1A 2BCUA 4J9KA 5IINA 4TQSA 5BOLA 2B6GA 2W55A 9ICOA 4K4GA 3C23A 2ZIVB 1L8OA 3RJGA 3PV8A 1S10A 2FJ6A 1X40A 4F5OA 8ICLA 2KEYA 3RB3A 1SB3C 3WKDA 3T5JA 2EAOA 2H3IA 3IM1A 3JPRA 1MA7A 4BUGA 9ICMA 4KTQA 7ICSA 2IHMA 3C2MA 2EDUA 5CWRA 2W7PA 1ZQJA 3PR4A 2G5HB 1Z1VA 1OXJA 9ICBA 2K4HA 5AKIA 4RQ2A 2JRZA 4R8UB 4ED8A 1N48A 2K4IA 1WYGA 3MDAA 3WK9A 4ECTA 3AQFA 3OGUA 2R8HA 3M6ZA 3K4GA 3DV9A 4RQ8A 1D9DA 5D4BA 5GTIU 2XY7A 1BNPA 1SZPA 2BCSA 1ZQ1C 3PSFA 4UAVA 3NVZA 3AL0B 1VJ5A 4QW8A 2VA3A 1AQ6A 1BNOA 3I1YA 3MR5A 3LK9A 5ALHA 3PY8A 4GFJA 2V9WA 5KFMA 3PX6A 4YMNA 1Z1BA 4XA5A 3PO5A 2KNJA 4KN4A 4QZEA 2B21A 5F9NA 1AROP 1F44A 4NL9A 3HILA 3TACB 4M6WA 5KFBA 4DQPA 1ZRMA 4RQ6A 4F4YA 1NKCA 4BWMA 3RJKA 4O9MA 2FMQA 3KKAC 4QZIA 5KG0A 5EOZA 1TKDA 5ALVA 4YN4A 3BZCA 3QZ8A 4LZGA 3SI8A 5EWGA 3TFSA 3M9NB 4MF2A 4KLGA 2FLNA 2PI4A 3F53A 5AI8A 4PPXA 4BJQA 5J0XA 3ZI4A 1ZQOA 5AM2A 1NK7A 4IQTA 3PW0A 4QZBA 4US9A 1S5LU 3NUQA 4J9NA 2JV3A 4M9NA 5DBCA 2DQNB 4EZ9A 1U48A 2KZMA 2KSOA 2YTUA 3BQ2A 1LB2B 1VDVA 4QIWF 2N1RA 3M8RA 8ICHA 4RT3A 3M1YA 5IILA 1NK9A 5J2BA 1RXVA 2F1HA 4B9UA 8ICOA 3NRZA 2NRZA 4F4ZA 5AM1A 1NK4A 5J2IA 4KX5A 4C4TA 1KFTA 3IP4B 1S0MA 1KSPA 5JUMA 3HPOA 4DOCA 5AI4A 4Y2XA 3MDCA 5KT2A 1NK5A 5IIIA 2RP5A 1NZBA 1ZRNA 2BPFA 2HBMA 3L5KA 3TQ1A 4R63A 5DQIA 1S76D 3TARA 2F44A 3KZXA 1COKA 4Y2RA 1B4FA 4JWMA 4J9LA 3RFAA 4F5RA 1KEJA 3BQ1A 3C29A 2HOIA 2RQ5A 3Q8SB 3EWAA 2KSOB 3C21A 3OSPA 4C8LA 3PW5A 4M04A 2E1FA 9ICAA 9ICGA 3GZFA 5ALXA 1N63A 9ICQA 2JMGA 4MF8A 4KLUA 3MGVA 1BPEA 2LHTA 1TFRA 5AM5A 4CCHA 4KLOA 3H4BA 1U9LA 4J9MA 5J0RA 2MAXA 2ESEA 3NVVA 4DOAA 7ICUA 3QYPA 4UARA 5DG9A 2NRVA 3TFRA 1KN5A 3PX0A 4O5CA 1KBUA 1DRGA 4MEYA 5DB6A 5AKKA 4EBEA 1V9PA 1IXRA 1S0VA 2ZTCA 4DQRA 4J9SA 3Q8PB 2HSZA 2HBLA 1Z3EB 2ZTEA 5T14A 4NM2A 3KHLA 1FO4A 7ICKA 3NGDA 2HMXA 4ZOHC 1ZD4A 5J2CA 1LVHA 3QU9A 3HRDD 1RM6C 2LKYA 4NXZA 3KHGA 2W03A 2HVIA 7ICNA 2CRXA 2F77X 2OCEA 4CNQA 4KLEA 2G0AA 2F1IA 5KTQA 4IR9A 4FS2A 2PFQA 4P2HA 5KG7A 2NV3A 8ICJA 4YXJA 3FDSA 1FFVA 5DB7A 3PW4A 2KE7A 2BQRA 4EYIB 2G09A 3MR6A 1RG6A 3LWMA 3M7DA 3PX4A 8ICPA 4IC9A 2E1EA 3ETRA 4ECXA 4YMOA 3BQTA 1HUZA 5J2KA 4DSJA 3TKAA 2O6KA 1U45A 2WF6A 4P4MA 5KT7A 1MN8A 4UB2A 3N4MB 5ALMA 1JN3A 2G07A 5KFYA 2WF8A 1K5OA 2D8CA 4O5EA 4PHDA 2HOFA 4ELUA 1A6SA 5B5EU 2Q4TA 5J0YA 2ATLA 2M9NA 2UVUA 4DOBA 2ZIWA 4O3PA 4ED2A 2DPIA 1YZ6A 4DSIA 5DLFA 5C0YA 4DEZA 2JZBA 1ZQTA 1NKBA 5KFCA 4GXKA 3TADC 8ICZA 7ICIA 3RB0A 3QX7A 5TZVA 2R18A 1WG8A 2W04A 2W9BB 1ZQKA 2BQUA 4RQ1A 1QQ5A 4MEXA 1NK8A 1DK2A 4I2BA 8ICWA 1C20A 4F5QA 1SKWA 2W8LA 4PL2A 1ZETA 1J2NA 4O3QA 5A0LA 5DBBA 1RPLA 2J6SA 4KMUA 2L5YA 4FZNA 2DFLA 8ICEA 4DL4A 1T3QA 3NVYA 1L5UA 3IV6A 3S6JA 4KLTA 8ICXA 2K4EA 2KVCA 2BCRA 1KFSA 1JUDA 4UAYA 4DFJA 3H0RB 2AU0A 1ZJNA 4NWIA 5ALUA 3C1YA 5BPCA 2I5HA 4U7CA 2KJ5A 4ACOA 1BPZA 5ALKA 2BPCA 1XSLA 1NK6A 4QZFA 1DOQA 2W9CA 2C22A 5IIOA 4QWAA 1LV5A 2AXTU 3F2BA 4J9QA 4PH5A 1BGXT 3KBBA 4QZDA 4CRXA 3K1RB 3BZKA 4ED3A 3AQEA 4YVZA 1A77A 1SV0A 4NY8A 4AYBF 3EUB2 4O5KA 1N61A 1WCNA 2BQ3A 3BS5B 9ICTA 4CF5A 2K60A 2P66A 1TE2A 4B9SA 4KLSA 1NZPA 5G5GA 2W3RA 2RDIA 3H0LB 1ZQAA 5AKHA 1TK5A 1J2MA 2BKEA 4QWCA 1VLBA 2FPLA 3T79A 4IRCA 5C5JA 3MR2A 2F8LA 1SKSA 3IRUA 4F3OA 4I2HA 1RXWA 4M0AA 4DCCA 4B9TA 4Y2PA 1QLNA 4YMMA 1XO0A 1PVRA 3KZIU 2OYYA 3WK4A 9ICKA 3RJIA 2OEHA 1SL2A 5KT5A 4BWJA 4KLLA 2KFNA 2YY6A 2E8OA 5KFNA 5AKYA 7ICJA 2AHOB 2PXIA 5KL1B 1SIJA 3HJEA 4PGYA 4EX7A 3RH4A 3TADA 3C1ZA 1D8LA 3QE9Y 5F3XB 1U4BA 4C8NA 1JMSA 4I2JA 3M9MB 3A0HU 4IQWA 1ZQBA 4IRKA 5J8YA 4UB4A 4DL7A 2FPMA 2WHEA 5IIMA 1T3NA 5J2FA 2W43A 3T5KA 5ALTA 3BJYA 1JI7A 8ICSA 3H8MA 1ED1A 2DUYA 2YMQA 4QZAA 1Q8KA 1IM4A 1D9FA 2PFNA 5L1IA 2JXJA 4RNMA 4DQSA 3WU2U 3I76A 2MU2A 2RHFA 2EZYA 1ZYQA 4DL5A 3V6KA 3VC8A 2WB1C 5CP2A 2EZXA 4EZ6A 5DKWA 5ALZA 2HW3A 2FMPA 2QKQA 4DL3A 3HKZC 2ZUCA 4WJ3B 3WKCA 8ICTA 4HAIA 2J6UA 2Y1IA 2ASJA 5AKJA 4UAWA 4PJ0U 4YR2A 4QZGA 3FC4A 3QU4A 3V7KA 4O3OA 4CE6A 2GWSA 4JUZA 2KIWA 2XGQA 2FLLA 2IHNA 2C2EA 1KDHA 3SV4A 4MFAA 1BPDA 4FFDA 5CR0A 3BDPA 4R8UA 2F76X 3NRWA 4KMOB 3D6JA 2BHNA 2D6FC 2VA2A 4Q8FA 5KT4A 1L6NA 4MFCA 5J2DA 5KG6A 1JX4A 4BDPA 1L3VA 3SQIA 2RDJA 4NLCA 4LZDA 4RQ3A 2WTFA 5ALEA 3U26A 3JPQA 2KJ8A 2HI0A 2ZXIA 4X5VA 4C4SA 4Z6FA 4I2EA 2Y9TA 4NLKA 3QUQA 4C4RA 3PSTA 2NO4A 3T3FA 4MFFA 4KLHA 3ZDBA 1IG6A 1WUDA 2QLTA 4Y2SA 8ICKA 4J9OA 5HHHA 2HHXA 5AKXA 1PK3A 2IA6A 2H3ZA 4UASA 3B0YA 5CJ7A 1X9XA 3GIJA 3JPPA 3N28A 5KFQA 3D2SA 4JV2A 1TK0A 2AQ0A 3C2LA 2GH1A 1Z4OA 9ICFA 3SENA 1UT8A 3ISBA 2P35A 1ZQMA 3QUTA 3RTVA 2KG5A 4YQWA 5DLGA 5D49A 2AGQA 5EWEA 4DLGA 1Y88A 4OD0A 3AN1A 4Y2QA 5KG4A 3FM9A 5DGBA 3F2CA 2KZZA 3QUBA 7ICLA 3PMNA 3GILA 4F72A 4PHAA 2HHQA 1F0MA 2Y1JA 2BZFA 5ALLA 2KN7A 1Z00A 1SL0A 7ICMA 3Q8QB 3UM9A 4HYKA 9ICCA 2P6UA 2HCFA 3ZD9A 1IIPA 2G08A 4QWEA 3MGIA 2WF5A 3R9KA 3UQ0A
chains in the Genus database with same CATH topology
1Z1VA 1OXJA 1SXEA 5L1MA 1SXDA 2E8MA 2L5YA 2F3NA 3KKAA 3TADA 2GLEA 2Y9TA 2QB1A 5F3XB 1V85A 5JRTA 2DL0A 2K4PA 2EAMA 1KW4A 3SEIA 2ES6A 4IS7A 2QB0A 4RQNA 1PK1B 5J8YA 4MHVA 1DXSA 3BQ7A 2KE7A 3BS5A 1PK3A 1WWVA 1JI7A 1RG6A 3H8MA 2F8KA 2EAPA 3IDWA 1X9XA 2DKXA 2F44A 3K1RB 5KNIA 4PZNA 4RQMA 5JTIA 1COKA 2QB0B 1B4FA 5JU5A 4NL9A 3HILA 2KMDA 1B0XA 3TACB 1SV0A 3SENA 1LKYA 2KSOB 2EANA 1OW5A 3BS5B 2KG5A 2K60A 2E8PA 2D8CA 2E8NA 2QKQA 3KKAC 4PZOA 1V38A 1UQVA 2FE9A 2B6GA 1PK1A 5J8YC 3BS7A 2QARA 1X40A 2Y9UA 2LMRA 4NJ8A 2ESEA 2LPEA 1WWUA 3TADC 1F0MA 2EAOA 1SV4A 1SGGA 1UCVA 2KIVA 4NL9C 2DKZA 2JV3A 1SV0C 2D3DA 2E8OA 2QARB 2KSOA 2YTUA 1X66A 1LKYB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1Z1V A;  1OXJ A;  1SXE A;  5L1M A;  1SXD A;  2E8M A;  2L5Y A;  2F3N A;  3KKA A;  3TAD A;  2GLE A;  2Y9T A;  2QB1 A;  5F3X B;  1V85 A;  5JRT A;  2DL0 A;  2K4P A;  2EAM A;  1KW4 A;  3SEI A;  2ES6 A;  4IS7 A;  2QB0 A;  4RQN A;  1PK1 B;  5J8Y A;  4MHV A;  1DXS A;  3BQ7 A;  2KE7 A;  3BS5 A;  1PK3 A;  1WWV A;  1JI7 A;  1RG6 A;  3H8M A;  2F8K A;  2EAP A;  3IDW A;  1X9X A;  2DKX A;  2F44 A;  3K1R B;  5KNI A;  4PZN A;  4RQM A;  5JTI A;  1COK A;  2QB0 B;  1B4F A;  5JU5 A;  4NL9 A;  3HIL A;  2KMD A;  1B0X A;  3TAC B;  1SV0 A;  3SEN A;  1LKY A;  2KSO B;  2EAN A;  1OW5 A;  3BS5 B;  2KG5 A;  2K60 A;  2E8P A;  2D8C A;  2E8N A;  2QKQ A;  3KKA C;  4PZO A;  1V38 A;  1UQV A;  2FE9 A;  2B6G A;  1PK1 A;  5J8Y C;  3BS7 A;  2QAR A;  1X40 A;  2Y9U A;  2LMR A;  4NJ8 A;  2ESE A;  2LPE A;  1WWU A;  3TAD C;  1F0M A;  2EAO A;  1SV4 A;  1SGG A;  1UCV A;  2KIV A;  4NL9 C;  2DKZ A;  2JV3 A;  1SV0 C;  2D3D A;  2E8O A;  2QAR B;  2KSO A;  2YTU A;  1X66 A;  1LKY B; 
#chains in the Genus database with same CATH topology
 4BX9 C;  5HML A;  3Q8R B;  5L1M A;  5KFE A;  4PHP A;  1RQL A;  2I1Q A;  4RQ4 A;  5L1K A;  1DK3 A;  2KJ9 A;  7ICF A;  4KLD A;  4P4O A;  2EAM A;  2JH7 A;  2F2A B;  5AM4 A;  4IS7 A;  3OPX A;  4O3S A;  4RU9 A;  1ZOL A;  5KFS A;  5EWF A;  2V4Q A;  3RR7 A;  3N7R C;  1ZD3 A;  4TQR A;  4NLB A;  5ALR A;  2VJ4 A;  2ZUB A;  4P0P A;  5G5H A;  3C5F A;  3QU2 A;  1BPY A;  2DKX A;  5KNI A;  1Z00 B;  2M0N A;  5J0U A;  9ICI A;  4XQ8 A;  3V7L A;  2KMD A;  1YT3 A;  3IG8 A;  2ASL A;  4TUQ A;  4KLQ A;  1KKX A;  4UBC A;  3F5E A;  4G9B A;  5KFW A;  3H7I A;  3JPT A;  1ZQX A;  4Y2U A;  5AIA A;  4QWB A;  1HJP A;  4EX6 A;  1L7N A;  1ECW A;  3GV5 B;  1U49 A;  2A1J A;  2KZ3 A;  4UB8 U;  3V6H A;  4US8 A;  4J9R A;  1OUQ A;  3B0X A;  3MAB A;  3UXP A;  2BR0 A;  3C28 A;  3IHQ B;  1QH9 A;  1ZQR A;  1CEZ A;  4ED7 A;  2R8G A;  4A8E A;  3H8W A;  2KV2 A;  3M8S A;  3GII A;  5KFG A;  4P0P B;  3UXO A;  2W9M A;  3V72 A;  4IRD A;  1V97 A;  3N7P D;  4KLI A;  2UVW A;  3UMB A;  5KFV A;  1ZQN A;  4Z6E A;  4QZC A;  3H8S A;  4RNN A;  4U6P A;  2XID A;  2WFA A;  3OJU A;  5KFH A;  4XRH A;  1N56 A;  5H2F U;  3KKA A;  3MFI A;  5DQG A;  2DL0 A;  3AU6 A;  4I2A A;  1BPX A;  4B6J A;  4RQ0 A;  2A1J B;  3MFH A;  5AI9 A;  2C2R A;  2DWQ A;  1S8O A;  3NVW A;  5GTH U;  3N97 B;  2I6X A;  4JV1 A;  4DFP A;  5ALD A;  1PZN A;  3UPQ A;  1XSN A;  4NLZ A;  1QQ6 A;  4YCX A;  1F5S A;  4R64 A;  4OCZ A;  3ISD A;  4C7Y A;  4ECW A;  1RQN A;  1ZQL A;  8ICY A;  2IOH A;  2FMS A;  2HBJ A;  5JTI A;  1UHU A;  2AGO A;  4I2C A;  3KTQ A;  4EBC A;  1ZQF A;  4Z6C A;  2RRD A;  4BXO B;  4I2D A;  4GXJ A;  4EBD A;  4UB1 A;  4M47 A;  3FAH A;  4Q43 A;  4J9P A;  1MQ3 A;  2I9G A;  1UT5 A;  3RJH A;  4F50 A;  4I2G A;  2XGP A;  1V38 A;  5DQH A;  9ICX A;  4F2R A;  1TAM A;  3SAH A;  3PO4 A;  2YB4 A;  2W9B A;  4YR3 A;  4ECQ A;  2PKE A;  1PK1 A;  3RBD A;  4B9N A;  3G6Y A;  3RRH A;  5B66 U;  2IMW P;  5KFA A;  5HHI A;  3SZ2 A;  3QZ7 A;  1N5W A;  3ED5 A;  1A76 A;  2KOB A;  4EEL A;  5HNK A;  5CHG A;  2WF7 A;  4G3I A;  4PGX A;  3OHA A;  3VCB A;  4O3R A;  1Q3U A;  1IV8 A;  3NS1 A;  5DBA A;  5J0S A;  4QW9 A;  1X66 A;  1K1Q A;  3N7S C;  1JRP A;  5L1L A;  4RUA A;  3GFK B;  4CGZ A;  4DLE A;  3WK7 A;  3K1Z A;  2W8K A;  1KTQ A;  5KFJ A;  5AK6 A;  5IIK A;  4DSK A;  1CRX A;  5KG3 A;  4OJO A;  4UB6 U;  2ASD A;  3PR5 B;  1H38 A;  3PZP A;  1PK1 B;  4JV0 A;  4F71 A;  1MQ2 A;  3ZDD A;  2GOL A;  5KFD A;  3HP6 A;  5KFT A;  3BS5 A;  2A3V A;  4B9M A;  3EYZ A;  1Q46 A;  2BDP A;  7ICH A;  2DBY A;  2EAP A;  4O3N A;  1QSS A;  3Q8L A;  3AEV A;  3RJF A;  2OXO A;  1X42 A;  4RUC A;  1PVQ A;  4FE3 A;  1ZQH A;  1DGJ A;  5ALW A;  5DG8 A;  2ODG A;  1RYR A;  1L8L A;  3SV3 A;  4CF4 A;  2JEI A;  4Q44 A;  1XU4 A;  3AUO A;  4DF4 A;  5AI0 A;  1S0O A;  4F2S A;  2LBO A;  2PMZ C;  4PZO A;  1RDF A;  8ICA A;  3M6K A;  1PVP A;  2K8A A;  2MRL A;  2LI6 A;  1KRP A;  1T8E A;  2DF4 B;  9ICL A;  1O03 A;  1O08 A;  2ZIU A;  4LVS A;  2ZJ8 A;  8ICC A;  2KK0 A;  3AM9 A;  5KL8 B;  4QZ9 A;  3IN5 A;  3QU5 A;  4JWN A;  1SV4 A;  5AIB A;  2PFO A;  2LYA A;  1KLN A;  2VKQ A;  3KHR A;  1NJW A;  3O0F A;  3HWT A;  1JXL A;  4C8K A;  2G5I B;  5AM3 A;  7ICR A;  2E8M A;  7ICV A;  1ZXI A;  1TVA A;  1V85 A;  2ZIX A;  2PI5 A;  1ZJM A;  5J2J A;  1ZQP A;  2IOF K;  5J0O A;  4ELV A;  2C2D A;  9ICP A;  5AHX A;  4IL6 U;  2WAQ F;  1QQ7 A;  5CEH A;  2IBK A;  4NM1 A;  2JH1 A;  2Y0S C;  2ZIU B;  1MC8 A;  5EE1 A;  2JEF A;  5AIC A;  1FEZ A;  3ZD8 A;  3GQC A;  4USA A;  4B9L A;  3PML A;  3WKA A;  3ISC A;  1GO3 F;  2XVT A;  1XS9 D;  1MSW D;  1X9S A;  2GO7 A;  5KG5 A;  3BQ0 A;  3LVV A;  4M2Y A;  2QB0 B;  2HHS A;  3RR8 A;  2YMM A;  3CRX A;  1KL9 A;  2C28 A;  5HP4 A;  5EE3 A;  2E8N A;  5ALF A;  2OH2 A;  2HHU A;  3HT3 A;  2ZG6 A;  1UQV A;  2ZIX B;  3CW2 C;  9ICV A;  2F1J A;  5DB8 A;  4FBT A;  2W7O A;  5AI6 A;  4DWI A;  4DQQ A;  4M9J A;  4YD2 A;  1A0P A;  2V4R A;  1T4G A;  1SZH A;  2LMR A;  1QTM A;  3LYS A;  2AJQ A;  1ZQU A;  1L7M A;  3OJS A;  3MBY A;  3MC1 A;  2KHV A;  3H40 A;  3WKB A;  4F5P A;  4NL9 C;  4F91 B;  4OJ5 A;  3RJE A;  2QAR B;  1FIQ A;  2KHQ A;  2MUT B;  5KFX A;  1S9F A;  3JPS A;  1NJX A;  2JEJ A;  4TUR A;  4KX3 A;  2BCV A;  5TIS U;  4Y2T A;  2QB1 A;  2DPJ A;  2K4P A;  1BVS A;  4QJF B;  1D8B A;  4KLF A;  4UB3 A;  4ECR A;  1KQQ A;  3ZDC A;  3RF9 A;  5CRX A;  2ALZ A;  2BDU A;  3V7J A;  3L4P A;  2LYB A;  1X2I A;  3H8J A;  4YG2 A;  2WB1 F;  1XO1 A;  4Y2Y A;  2LYH A;  2LM4 A;  4O0I A;  4UQG A;  1JIH A;  2NRW A;  2VIX A;  2YQE A;  3IDW A;  4UW9 A;  4AP9 A;  3HKZ F;  1XWL A;  4PGQ A;  1UA1 A;  1M6Y A;  2KVS A;  3C5G A;  1B0X A;  3G6X A;  1LKY A;  3H0M B;  4EEN A;  2KIC A;  1OW5 A;  3PVX A;  2K89 A;  1ZQW A;  5ALJ A;  4IQV A;  3PSP A;  1Z19 A;  9ICS A;  2KKP A;  7ICP A;  3CNH A;  3WKE A;  1JAL A;  5AKG A;  5J0W A;  4DSF A;  7ICT A;  3ETL A;  2UVR A;  2OWO A;  3CYM A;  5KG2 A;  5EE9 A;  3E58 A;  1S77 D;  4CF3 A;  4Q8E A;  4ED1 A;  5KFO A;  3RAX A;  4FZL A;  3SD7 A;  4IR1 A;  3EZ5 A;  2KP7 A;  1X9M A;  1U47 A;  4Q45 A;  3G6V A;  1C7Y A;  2ZUD A;  2KTQ A;  3SAF A;  1KFD A;  2YML A;  5KFL A;  1CUK A;  4C80 A;  3QUC A;  3LVW A;  3ZDE A;  3Q8K A;  5KT3 A;  1P7D A;  1LKY B;  4UB5 A;  2UVV A;  3A0B U;  4XUS A;  7ICQ A;  4ECS A;  2GLE A;  3RH5 A;  1L7O A;  1QSY A;  3E2E A;  3QXG A;  1CI4 A;  4BGD A;  5D46 A;  5ALI A;  2FDR A;  4NLN A;  2E5S A;  8ICF A;  3THV A;  4I29 A;  2R8K A;  3SYZ A;  4QIW C;  2KFZ A;  5AM0 A;  4F92 B;  2K8B B;  2MA1 A;  3D2Q A;  4GC6 A;  3F2D A;  3GIK A;  3FYH A;  4JB3 A;  4R66 A;  4M9G A;  3DEE A;  2H3Q A;  5KFK A;  3RRG A;  5DG7 A;  5DDY A;  1UPH A;  9ICW A;  3I28 A;  4KIT B;  1RYS A;  2ZXH A;  3ZDA A;  4YP3 A;  4FS1 A;  4OJ6 A;  4EYH B;  2R8I A;  2OHF A;  4K4H A;  4YR0 A;  4RPZ A;  2FE9 A;  4QWD A;  3HX0 A;  2VA8 A;  5J0T A;  1PUZ A;  3WK8 A;  2W9A A;  2K8C B;  2XI9 A;  4FBU A;  4M6W B;  4J03 A;  3D2N A;  3OHB A;  3KFU F;  1ZD5 A;  4UAZ A;  2E3T A;  3ORY A;  4NJ8 A;  1ZQI A;  4M9L A;  1WWU A;  5AK5 A;  4IQU A;  4B9V A;  5HR6 A;  5ALN A;  1NJY A;  4GIB A;  3UQ2 A;  1N2X A;  1B22 A;  3QEB Z;  4I27 A;  2YB1 A;  5ALS A;  4ECZ A;  2D3D A;  4UBB A;  3RB6 A;  5KAF U;  3RB4 A;  5KFU A;  3RAQ A;  1QCK A;  1T94 A;  1TK8 A;  1X6J A;  1SXD A;  2HOQ A;  1S97 A;  2FLP A;  2BCQ A;  4ED0 A;  4DQI A;  5KG1 A;  4F5N A;  2ZJA A;  5KFF A;  2YX8 A;  4DF8 A;  3LWL A;  3J81 j;  5ALY A;  2AQ4 A;  2ES6 A;  4ZH4 A;  2JR5 A;  3MGH A;  2VAN A;  5FP0 A;  4BXO A;  4EEK A;  5K4L A;  1J97 A;  8ICB A;  1DXS A;  1JXE A;  4ECV A;  2F8K A;  4PHE A;  1ZQY A;  2YMP A;  2FPK A;  4JK1 A;  4RT2 A;  3EPG A;  2HHW A;  5J2H A;  9ICH A;  3RJJ A;  8ICQ A;  3ALR A;  3QU7 A;  4ECY A;  8ICI A;  4P0Q A;  3TAQ A;  4NV0 A;  2XIC A;  5KFR A;  2FI1 A;  4F4W A;  5KFP A;  2EAN A;  4Y2J A;  1SWW A;  2ISP A;  1SWV A;  1NKE A;  8ICR A;  4GXI A;  2CXY A;  8ICV A;  3JPO A;  3SAG A;  1B43 A;  3AU2 A;  3BS7 A;  4GLX A;  5AK3 A;  4F4X A;  1NOM A;  1NI3 A;  1L3U A;  3PW7 A;  5KAI U;  2Y9U A;  2H3F A;  3B9J A;  2NO5 A;  5CA7 A;  9ICU A;  5E79 U;  2XCA A;  2ZJ5 A;  3NAS A;  3KD3 A;  1TAQ A;  4LJX A;  1HIW A;  1S0N A;  4C0Z A;  3WK6 A;  4C8O A;  5J2E A;  5F9L A;  4NLG A;  2HHV A;  2JHD A;  4RNO A;  1SGG A;  4FO6 A;  1K1S A;  5AKE A;  1SV0 C;  4CDG A;  2BPG A;  1X6I A;  4P0Q B;  1COO A;  4RQ5 A;  1SXE A;  1YZ7 A;  5KT6 A;  3KHH A;  5ALQ A;  5KFI A;  5BOM A;  5JRT A;  4P4P A;  5HR7 A;  4F4K A;  5AK4 A;  3SEI A;  5KFZ A;  3LDA A;  4RQ7 A;  2R8J A;  3H4D A;  8ICN A;  3T5L A;  4UAU A;  1HEK A;  2W54 A;  2NRT A;  4DSE A;  2EZZ A;  3TAN A;  3ICX A;  5L9X A;  1EXN A;  5EE0 A;  3UXN A;  4R65 A;  2H3V A;  1FFU A;  5J0Q A;  2AGP A;  5ALG A;  4KLM A;  4UAT A;  5HMM A;  2XY5 A;  2RLT A;  5J29 A;  1NNL A;  1QSL A;  4KN7 A;  2OM6 A;  3RH6 A;  4F93 B;  2NRX A;  2CPR A;  4EEY A;  1RYU A;  5J2G A;  2LM1 A;  5DDM A;  3C2K A;  2JGA A;  4ICA A;  4QNL A;  3M9O B;  3CP8 A;  2G06 A;  3KOO A;  2J6T A;  2H5X A;  4I28 A;  5J8Y C;  1ZQD A;  3UMG A;  3PSI A;  4AYB C;  2LPE A;  3V6J A;  4I2I A;  1ZQG A;  3SMV A;  4K4I A;  1TV9 A;  1URJ A;  4QZH A;  2ZIW B;  3GV7 B;  3NTU A;  2HHT A;  2JZB B;  8ICG A;  2EQY A;  2W11 A;  5J0P A;  5J2A A;  3SR6 A;  3WK5 A;  3Q8M A;  1D8Y A;  4DS4 A;  2BGW A;  4FZM A;  4KLJ A;  3TAP A;  5AKZ A;  1KW4 A;  2QB0 A;  5AKL A;  3GIM A;  3MR3 A;  3HW8 A;  2WAQ C;  5CB1 A;  5DB9 A;  4O3M A;  1Q3V A;  4ELT A;  4RPX A;  5IIJ A;  3ONN A;  3UMC A;  3JPN A;  3K75 D;  9ICN A;  1N62 A;  2NYV A;  1T7P A;  1L3S A;  2PMZ F;  1XC9 A;  2KD1 A;  1ZQS A;  1ZQQ A;  9ICE A;  4RQM A;  2AH5 A;  4OJL A;  2P6R A;  2W3S A;  3TI0 A;  4F8R A;  3PNC A;  5JU5 A;  2HVH A;  4OO1 J;  7ICO A;  2PFP A;  4DFK A;  2XO7 A;  4DL2 A;  3GU3 A;  2XC9 A;  7ICE A;  9ICR A;  4M9H A;  4JMU A;  2XCP A;  2E8P A;  3RBE A;  2W9C B;  3EW9 A;  2EH9 A;  4DFM A;  1BPB A;  1UA0 A;  1Z4N A;  2MSN A;  3EPI A;  4OJP A;  8ICU A;  1TAU A;  2A1A A;  1NK0 A;  4DL6 A;  3F5A A;  1WCL A;  2QAR A;  2B0C A;  2MUT A;  1N5X A;  2Q0Z X;  1N60 A;  1JRO A;  3L3F X;  2DGZ A;  4TUS A;  1X9W A;  4C8M A;  1HUO A;  4DO9 A;  5L1J A;  4YFK A;  1ZQZ A;  2CN1 A;  1L7P A;  2IOF A;  4ED6 A;  4PL1 A;  4QZ8 A;  4E0D A;  1UCV A;  2KIV A;  3AMZ A;  3QEA Z;  2DKZ A;  4DSL A;  4DFD A;  1NJZ A;  4Y2V A;  4RZR A;  4DS5 A;  4Z6D A;  2WF9 A;  2XY6 A;  2Y0S F;  4C7Z A;  4YD1 A;  2F3N A;  3GDX A;  4YXM A;  4ECU A;  1ZQE A;  2KKV A;  2ZIV A;  3GV8 B;  2HBK A;  4I2F A;  1ZQC A;  4RQN A;  2HDO A;  4MHV A;  4TUP A;  8ICM A;  3PW2 A;  1L3T A;  7ICG A;  5ALP A;  1SKR A;  3BQ7 A;  3OSN A;  3DDH A;  2VJ5 A;  1WWV A;  3OTQ A;  1XSP A;  5AI5 A;  3E0F A;  9ICJ A;  2ZTD A;  1ZD2 P;  4RPY A;  4PZN A;  1DGS A;  2JEG A;  4GC7 A;  1ZQV A;  3IG5 A;  2A19 A;  5DGA A;  2ISO A;  2Z7J A;  1XNS A;  1RZT A;  3QNM A;  3T5H A;  5ALO A;  2YN4 A;  1SL1 A;  2BCU A;  4J9K A;  5IIN A;  4TQS A;  5BOL A;  2B6G A;  2W55 A;  9ICO A;  4K4G A;  3C23 A;  2ZIV B;  1L8O A;  3RJG A;  3PV8 A;  1S10 A;  2FJ6 A;  1X40 A;  4F5O A;  8ICL A;  2KEY A;  3RB3 A;  1SB3 C;  3WKD A;  3T5J A;  2EAO A;  2H3I A;  3IM1 A;  3JPR A;  1MA7 A;  4BUG A;  9ICM A;  4KTQ A;  7ICS A;  2IHM A;  3C2M A;  2EDU A;  5CWR A;  2W7P A;  1ZQJ A;  3PR4 A;  2G5H B;  1Z1V A;  1OXJ A;  9ICB A;  2K4H A;  5AKI A;  4RQ2 A;  2JRZ A;  4R8U B;  4ED8 A;  1N48 A;  2K4I A;  1WYG A;  3MDA A;  3WK9 A;  4ECT A;  3AQF A;  3OGU A;  2R8H A;  3M6Z A;  3K4G A;  3DV9 A;  4RQ8 A;  1D9D A;  5D4B A;  5GTI U;  2XY7 A;  1BNP A;  1SZP A;  2BCS A;  1ZQ1 C;  3PSF A;  4UAV A;  3NVZ A;  3AL0 B;  1VJ5 A;  4QW8 A;  2VA3 A;  1AQ6 A;  1BNO A;  3I1Y A;  3MR5 A;  3LK9 A;  5ALH A;  3PY8 A;  4GFJ A;  2V9W A;  5KFM A;  3PX6 A;  4YMN A;  1Z1B A;  4XA5 A;  3PO5 A;  2KNJ A;  4KN4 A;  4QZE A;  2B21 A;  5F9N A;  1ARO P;  1F44 A;  4NL9 A;  3HIL A;  3TAC B;  4M6W A;  5KFB A;  4DQP A;  1ZRM A;  4RQ6 A;  4F4Y A;  1NKC A;  4BWM A;  3RJK A;  4O9M A;  2FMQ A;  3KKA C;  4QZI A;  5KG0 A;  5EOZ A;  1TKD A;  5ALV A;  4YN4 A;  3BZC A;  3QZ8 A;  4LZG A;  3SI8 A;  5EWG A;  3TFS A;  3M9N B;  4MF2 A;  4KLG A;  2FLN A;  2PI4 A;  3F53 A;  5AI8 A;  4PPX A;  4BJQ A;  5J0X A;  3ZI4 A;  1ZQO A;  5AM2 A;  1NK7 A;  4IQT A;  3PW0 A;  4QZB A;  4US9 A;  1S5L U;  3NUQ A;  4J9N A;  2JV3 A;  4M9N A;  5DBC A;  2DQN B;  4EZ9 A;  1U48 A;  2KZM A;  2KSO A;  2YTU A;  3BQ2 A;  1LB2 B;  1VDV A;  4QIW F;  2N1R A;  3M8R A;  8ICH A;  4RT3 A;  3M1Y A;  5IIL A;  1NK9 A;  5J2B A;  1RXV A;  2F1H A;  4B9U A;  8ICO A;  3NRZ A;  2NRZ A;  4F4Z A;  5AM1 A;  1NK4 A;  5J2I A;  4KX5 A;  4C4T A;  1KFT A;  3IP4 B;  1S0M A;  1KSP A;  5JUM A;  3HPO A;  4DOC A;  5AI4 A;  4Y2X A;  3MDC A;  5KT2 A;  1NK5 A;  5III A;  2RP5 A;  1NZB A;  1ZRN A;  2BPF A;  2HBM A;  3L5K A;  3TQ1 A;  4R63 A;  5DQI A;  1S76 D;  3TAR A;  2F44 A;  3KZX A;  1COK A;  4Y2R A;  1B4F A;  4JWM A;  4J9L A;  3RFA A;  4F5R A;  1KEJ A;  3BQ1 A;  3C29 A;  2HOI A;  2RQ5 A;  3Q8S B;  3EWA A;  2KSO B;  3C21 A;  3OSP A;  4C8L A;  3PW5 A;  4M04 A;  2E1F A;  9ICA A;  9ICG A;  3GZF A;  5ALX A;  1N63 A;  9ICQ A;  2JMG A;  4MF8 A;  4KLU A;  3MGV A;  1BPE A;  2LHT A;  1TFR A;  5AM5 A;  4CCH A;  4KLO A;  3H4B A;  1U9L A;  4J9M A;  5J0R A;  2MAX A;  2ESE A;  3NVV A;  4DOA A;  7ICU A;  3QYP A;  4UAR A;  5DG9 A;  2NRV A;  3TFR A;  1KN5 A;  3PX0 A;  4O5C A;  1KBU A;  1DRG A;  4MEY A;  5DB6 A;  5AKK A;  4EBE A;  1V9P A;  1IXR A;  1S0V A;  2ZTC A;  4DQR A;  4J9S A;  3Q8P B;  2HSZ A;  2HBL A;  1Z3E B;  2ZTE A;  5T14 A;  4NM2 A;  3KHL A;  1FO4 A;  7ICK A;  3NGD A;  2HMX A;  4ZOH C;  1ZD4 A;  5J2C A;  1LVH A;  3QU9 A;  3HRD D;  1RM6 C;  2LKY A;  4NXZ A;  3KHG A;  2W03 A;  2HVI A;  7ICN A;  2CRX A;  2F77 X;  2OCE A;  4CNQ A;  4KLE A;  2G0A A;  2F1I A;  5KTQ A;  4IR9 A;  4FS2 A;  2PFQ A;  4P2H A;  5KG7 A;  2NV3 A;  8ICJ A;  4YXJ A;  3FDS A;  1FFV A;  5DB7 A;  3PW4 A;  2KE7 A;  2BQR A;  4EYI B;  2G09 A;  3MR6 A;  1RG6 A;  3LWM A;  3M7D A;  3PX4 A;  8ICP A;  4IC9 A;  2E1E A;  3ETR A;  4ECX A;  4YMO A;  3BQT A;  1HUZ A;  5J2K A;  4DSJ A;  3TKA A;  2O6K A;  1U45 A;  2WF6 A;  4P4M A;  5KT7 A;  1MN8 A;  4UB2 A;  3N4M B;  5ALM A;  1JN3 A;  2G07 A;  5KFY A;  2WF8 A;  1K5O A;  2D8C A;  4O5E A;  4PHD A;  2HOF A;  4ELU A;  1A6S A;  5B5E U;  2Q4T A;  5J0Y A;  2ATL A;  2M9N A;  2UVU A;  4DOB A;  2ZIW A;  4O3P A;  4ED2 A;  2DPI A;  1YZ6 A;  4DSI A;  5DLF A;  5C0Y A;  4DEZ A;  2JZB A;  1ZQT A;  1NKB A;  5KFC A;  4GXK A;  3TAD C;  8ICZ A;  7ICI A;  3RB0 A;  3QX7 A;  5TZV A;  2R18 A;  1WG8 A;  2W04 A;  2W9B B;  1ZQK A;  2BQU A;  4RQ1 A;  1QQ5 A;  4MEX A;  1NK8 A;  1DK2 A;  4I2B A;  8ICW A;  1C20 A;  4F5Q A;  1SKW A;  2W8L A;  4PL2 A;  1ZET A;  1J2N A;  4O3Q A;  5A0L A;  5DBB A;  1RPL A;  2J6S A;  4KMU A;  2L5Y A;  4FZN A;  2DFL A;  8ICE A;  4DL4 A;  1T3Q A;  3NVY A;  1L5U A;  3IV6 A;  3S6J A;  4KLT A;  8ICX A;  2K4E A;  2KVC A;  2BCR A;  1KFS A;  1JUD A;  4UAY A;  4DFJ A;  3H0R B;  2AU0 A;  1ZJN A;  4NWI A;  5ALU A;  3C1Y A;  5BPC A;  2I5H A;  4U7C A;  2KJ5 A;  4ACO A;  1BPZ A;  5ALK A;  2BPC A;  1XSL A;  1NK6 A;  4QZF A;  1DOQ A;  2W9C A;  2C22 A;  5IIO A;  4QWA A;  1LV5 A;  2AXT U;  3F2B A;  4J9Q A;  4PH5 A;  1BGX T;  3KBB A;  4QZD A;  4CRX A;  3K1R B;  3BZK A;  4ED3 A;  3AQE A;  4YVZ A;  1A77 A;  1SV0 A;  4NY8 A;  4AYB F;  3EUB 2;  4O5K A;  1N61 A;  1WCN A;  2BQ3 A;  3BS5 B;  9ICT A;  4CF5 A;  2K60 A;  2P66 A;  1TE2 A;  4B9S A;  4KLS A;  1NZP A;  5G5G A;  2W3R A;  2RDI A;  3H0L B;  1ZQA A;  5AKH A;  1TK5 A;  1J2M A;  2BKE A;  4QWC A;  1VLB A;  2FPL A;  3T79 A;  4IRC A;  5C5J A;  3MR2 A;  2F8L A;  1SKS A;  3IRU A;  4F3O A;  4I2H A;  1RXW A;  4M0A A;  4DCC A;  4B9T A;  4Y2P A;  1QLN A;  4YMM A;  1XO0 A;  1PVR A;  3KZI U;  2OYY A;  3WK4 A;  9ICK A;  3RJI A;  2OEH A;  1SL2 A;  5KT5 A;  4BWJ A;  4KLL A;  2KFN A;  2YY6 A;  2E8O A;  5KFN A;  5AKY A;  7ICJ A;  2AHO B;  2PXI A;  5KL1 B;  1SIJ A;  3HJE A;  4PGY A;  4EX7 A;  3RH4 A;  3TAD A;  3C1Z A;  1D8L A;  3QE9 Y;  5F3X B;  1U4B A;  4C8N A;  1JMS A;  4I2J A;  3M9M B;  3A0H U;  4IQW A;  1ZQB A;  4IRK A;  5J8Y A;  4UB4 A;  4DL7 A;  2FPM A;  2WHE A;  5IIM A;  1T3N A;  5J2F A;  2W43 A;  3T5K A;  5ALT A;  3BJY A;  1JI7 A;  8ICS A;  3H8M A;  1ED1 A;  2DUY A;  2YMQ A;  4QZA A;  1Q8K A;  1IM4 A;  1D9F A;  2PFN A;  5L1I A;  2JXJ A;  4RNM A;  4DQS A;  3WU2 U;  3I76 A;  2MU2 A;  2RHF A;  2EZY A;  1ZYQ A;  4DL5 A;  3V6K A;  3VC8 A;  2WB1 C;  5CP2 A;  2EZX A;  4EZ6 A;  5DKW A;  5ALZ A;  2HW3 A;  2FMP A;  2QKQ A;  4DL3 A;  3HKZ C;  2ZUC A;  4WJ3 B;  3WKC A;  8ICT A;  4HAI A;  2J6U A;  2Y1I A;  2ASJ A;  5AKJ A;  4UAW A;  4PJ0 U;  4YR2 A;  4QZG A;  3FC4 A;  3QU4 A;  3V7K A;  4O3O A;  4CE6 A;  2GWS A;  4JUZ A;  2KIW A;  2XGQ A;  2FLL A;  2IHN A;  2C2E A;  1KDH A;  3SV4 A;  4MFA A;  1BPD A;  4FFD A;  5CR0 A;  3BDP A;  4R8U A;  2F76 X;  3NRW A;  4KMO B;  3D6J A;  2BHN A;  2D6F C;  2VA2 A;  4Q8F A;  5KT4 A;  1L6N A;  4MFC A;  5J2D A;  5KG6 A;  1JX4 A;  4BDP A;  1L3V A;  3SQI A;  2RDJ A;  4NLC A;  4LZD A;  4RQ3 A;  2WTF A;  5ALE A;  3U26 A;  3JPQ A;  2KJ8 A;  2HI0 A;  2ZXI A;  4X5V A;  4C4S A;  4Z6F A;  4I2E A;  2Y9T A;  4NLK A;  3QUQ A;  4C4R A;  3PST A;  2NO4 A;  3T3F A;  4MFF A;  4KLH A;  3ZDB A;  1IG6 A;  1WUD A;  2QLT A;  4Y2S A;  8ICK A;  4J9O A;  5HHH A;  2HHX A;  5AKX A;  1PK3 A;  2IA6 A;  2H3Z A;  4UAS A;  3B0Y A;  5CJ7 A;  1X9X A;  3GIJ A;  3JPP A;  3N28 A;  5KFQ A;  3D2S A;  4JV2 A;  1TK0 A;  2AQ0 A;  3C2L A;  2GH1 A;  1Z4O A;  9ICF A;  3SEN A;  1UT8 A;  3ISB A;  2P35 A;  1ZQM A;  3QUT A;  3RTV A;  2KG5 A;  4YQW A;  5DLG A;  5D49 A;  2AGQ A;  5EWE A;  4DLG A;  1Y88 A;  4OD0 A;  3AN1 A;  4Y2Q A;  5KG4 A;  3FM9 A;  5DGB A;  3F2C A;  2KZZ A;  3QUB A;  7ICL A;  3PMN A;  3GIL A;  4F72 A;  4PHA A;  2HHQ A;  1F0M A;  2Y1J A;  2BZF A;  5ALL A;  2KN7 A;  1Z00 A;  1SL0 A;  7ICM A;  3Q8Q B;  3UM9 A;  4HYK A;  9ICC A;  2P6U A;  2HCF A;  3ZD9 A;  1IIP A;  2G08 A;  4QWE A;  3MGI A;  2WF5 A;  3R9K A;  3UQ0 A; 
#chains in the Genus database with same CATH homology
 1Z1V A;  1OXJ A;  1SXE A;  5L1M A;  1SXD A;  2E8M A;  2L5Y A;  2F3N A;  3KKA A;  3TAD A;  2GLE A;  2Y9T A;  2QB1 A;  5F3X B;  1V85 A;  5JRT A;  2DL0 A;  2K4P A;  2EAM A;  1KW4 A;  3SEI A;  2ES6 A;  4IS7 A;  2QB0 A;  4RQN A;  1PK1 B;  5J8Y A;  4MHV A;  1DXS A;  3BQ7 A;  2KE7 A;  3BS5 A;  1PK3 A;  1WWV A;  1JI7 A;  1RG6 A;  3H8M A;  2F8K A;  2EAP A;  3IDW A;  1X9X A;  2DKX A;  2F44 A;  3K1R B;  5KNI A;  4PZN A;  4RQM A;  5JTI A;  1COK A;  2QB0 B;  1B4F A;  5JU5 A;  4NL9 A;  3HIL A;  2KMD A;  1B0X A;  3TAC B;  1SV0 A;  3SEN A;  1LKY A;  2KSO B;  2EAN A;  1OW5 A;  3BS5 B;  2KG5 A;  2K60 A;  2E8P A;  2D8C A;  2E8N A;  2QKQ A;  3KKA C;  4PZO A;  1V38 A;  1UQV A;  2FE9 A;  2B6G A;  1PK1 A;  5J8Y C;  3BS7 A;  2QAR A;  1X40 A;  2Y9U A;  2LMR A;  4NJ8 A;  2ESE A;  2LPE A;  1WWU A;  3TAD C;  1F0M A;  2EAO A;  1SV4 A;  1SGG A;  1UCV A;  2KIV A;  4NL9 C;  2DKZ A;  2JV3 A;  1SV0 C;  2D3D A;  2E8O A;  2QAR B;  2KSO A;  2YTU A;  1X66 A;  1LKY B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...