5J8YA

Crystal structure of the scm-sam and sfmbt-sam heterodimer
Total Genus 25
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
25
sequence length
78
structure length
78
Chain Sequence
DSMPIDWTIEEVIQYIESNDNSLAVHGDLFRKHEIDGKALLLLNSEMMMKYMGLKEGPAEKICNLVNKVNGRRNNLAL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Nuclear protein
molecule keywords Polycomb protein Scm
publication title Molecular basis of PRC1 targeting to Polycomb response elements by PhoRC.
pubmed doi rcsb
source organism Drosophila melanogaster
total genus 25
structure length 78
sequence length 78
chains with identical sequence B
ec nomenclature
pdb deposition date 2016-04-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00536 SAM_1 SAM domain (Sterile alpha motif)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.50 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 Transcription Factor, Ets-1 5j8yA00
2K4PA 1V38A 1RG6A 5J8YC 5L1MA 1B4FA 2EAPA 2FE9A 1SV0A 2L5YA 2K60A 1WWUA 2D8CA 5KNIA 1OW5A 1SXDA 3BS7A 3HILA 2QB0B 3H8MA 3KKAC 1V85A 1KW4A 1F0MA 1Z1VA 2F8KA 3TACB 5F3XB 2KSOA 2Y9UA 2LPEA 1LKYB 2DKXA 2LMRA 4RQMA 2EAMA 2JV3A 2EAOA 1PK3A 5JU5A 1X66A 4RQNA 2Y9TA 1SGGA 2E8PA 1PK1A 2QKQA 1X40A 1WWVA 1OXJA 4NL9A 2F44A 3BS5A 3IDWA 4PZOA 2QARA 2GLEA 2E8MA 2E8NA 1SV4A 1UQVA 3TADA 1B0XA 1JI7A 2ES6A 1DXSA 2QB1A 5J8YA 3SENA 1COKA 5JRTA 2DL0A 2YTUA 2KSOB 1SXEA 2QB0A 1SV0C 1X9XA 3BQ7A 3K1RB 3SEIA 2E8OA 2EANA 1UCVA 4IS7A 2F3NA 3KKAA 1LKYA 4NL9C 2D3DA 1PK1B 2KG5A 2DKZA 2ESEA 4NJ8A 3BS5B 2KIVA 2KE7A 2QARB 2B6GA 4PZNA 5JTIA 3TADC 2KMDA 4MHVA
chains in the Genus database with same CATH superfamily
4KLGA 1F5SA 2LYHA 1Z4OA 5AM1A 3EPIA 1X9MA 1IM4A 4IRCA 3QZ8A 4FBTA 2H3QA 1X6IA 4DS4A 5ALKA 2JRZA 2W43A 5HR7A 2W11A 4F3OA 3SMVA 5C0YA 3K4GA 5HHHA 3U26A 1KKXA 4FFDA 3VC8A 2RLTA 5KFNA 7ICMA 8ICXA 4R63A 4UB6U 2PFPA 3DEEA 5TZVA 1ZD5A 2Y0SC 1TE2A 9ICBA 2G5IB 5KFWA 1N60A 1JN3A 1U48A 4C4TA 4PH5A 2BPGA 4IR9A 3GFKB 1RYRA 2OCEA 5KG5A 3AM9A 9ICRA 2CPRA 3K1ZA 4OJ6A 1FEZA 5KFDA 4YMMA 2DF4B 2QB1A 5DGBA 2YTUA 4OJPA 4FZNA 4C80A 4RPYA 4RUAA 1RZTA 4RNOA 3WU2U 5ALJA 4M9GA 2ATLA 2M9NA 5KT4A 1S76D 2RRDA 1RYSA 4UAUA 1PK1B 2KG5A 5J2GA 2DUYA 3PO5A 2F1JA 3OTQA 3F2CA 3UPQA 5FP0A 4P0PB 5AKLA 1U4BA 1S9FA 4M2YA 3SD7A 2PFQA 5KG0A 4XQ8A 5L1MA 5KFGA 4MEXA 1M6YA 2IOFA 5KFOA 7ICPA 1ZQSA 5TISU 2AGQA 4YG2A 1ZQAA 2HBLA 2BGWA 2VA8A 4ECYA 5J2EA 3N28A 3OJSA 4NXZA 4DQRA 3AN1A 3G6VA 4EYHB 3AQEA 1TAQA 2J6TA 1NJZA 5GTHU 4NWIA 4F5OA 9ICPA 3QUBA 2W7PA 1A77A 2FMSA 1IG6A 7ICNA 1KFSA 5KFYA 3S6JA 2KVSA 1U49A 4QNLA 5IIJA 2E8PA 1PK1A 4F50A 5KG3A 3LYSA 1TVAA 3LK9A 1OUQA 4P0PA 4GC6A 4ECRA 2WF6A 5J0QA 5ALOA 2H3IA 2KZZA 1L6NA 2ZIXB 4ED6A 8ICFA 2JMGA 4FBUA 1JIHA 2JR5A 4PHDA 2BPCA 2ES6A 3PNCA 5ALQA 2HBMA 3WKDA 1DGSA 1QQ6A 3GIJA 3DV9A 1S10A 9ICLA 1SV0C 4ELTA 1T7PA 1B43A 5ALYA 2OM6A 4CF5A 4PGQA 1UCVA 2VIXA 3QXGA 2F3NA 4QIWF 1NK5A 3RB3A 3H4DA 5DB7A 4YQWA 3RJHA 2W7OA 3UQ0A 5KFMA 2G0AA 1KDHA 2HBJA 1YZ7A 3WK6A 1SKWA 2BHNA 2KKVA 3JPQA 3BZKA 3K75D 3PW0A 2B6GA 4O5KA 3KD3A 5JTIA 1N63A 1IXRA 2JGAA 4BWMA 2I1QA 1T94A 2IHMA 2UVWA 1HEKA 4Q44A 4QIWC 5AI8A 5DG9A 2AGPA 3C28A 2ZIXA 3BQTA 1ZQPA 1ZYQA 4UBBA 3AMZA 5KTQA 4B9LA 2XO7A 2WF9A 4OD0A 2QB0B 2P6RA 3KKAC 4DF4A 3ZDAA 1Q8KA 1FO4A 4FZMA 1ZETA 1DOQA 5ALNA 4RQ8A 2K4HA 7ICGA 4QZFA 1TK5A 4ECWA 3RR7A 1QSSA 1S0MA 2XI9A 2CXYA 2PXIA 5T14A 4C8NA 4WJ3B 2AJQA 2F44A 4I2JA 2ZJ8A 3NVZA 1ZD2P 2HBKA 4ECUA 2KTQA 5G5GA 2K8CB 3NVWA 4GXJA 5KFIA 3LWLA 3ED5A 1KN5A 2R8HA 7ICUA 1DXSA 2KHVA 5KG6A 4KTQA 3SENA 2RDIA 3Q8MA 2BKEA 2JH7A 1D8YA 2DL0A 4UAVA 1KLNA 2QB0A 1MSWD 1ZQJA 3MDCA 4YCXA 3HP6A 3PX0A 3MR6A 1RPLA 4NL9C 3PSPA 3UMCA 5ALVA 4CF3A 4Q43A 4OJOA 2CRXA 2PKEA 2AHOB 1GO3F 4NJ8A 4IC9A 5J2CA 9ICMA 1WCNA 4F4ZA 2F2AB 2HHVA 3AU2A 3ZI4A 2AXTU 3G6XA 2W03A 9ICUA 2BCVA 1SV0A 3CW2C 4I29A 2K60A 5KFSA 3N97B 1O08A 4J9OA 4GC7A 1WG8A 2JZBB 4F92B 4Q8EA 1ZQ1C 4KLUA 4UAWA 3KHHA 5J0SA 1BGXT 4NM1A 3H0MB 4B9UA 4NLNA 5CHGA 3LWMA 4GXKA 2LPEA 3QX7A 1BNPA 4F93B 2W9CB 3TARA 1RXWA 2ASLA 5KFUA 1X66A 4QZCA 5J2IA 3JPSA 9ICWA 1BNOA 9ICCA 1ZQWA 4BJQA 5KT3A 4MEYA 4RQ6A 3PX6A 1NK8A 4MF2A 2WHEA 1S0OA 4QZIA 1ZQLA 5ALTA 1ZQRA 3RB6A 5KL1B 3DDHA 2FLLA 1Z3EB 2HMXA 1NKBA 4TUSA 2F1IA 4DSLA 4DL2A 4DQPA 3RJKA 2KSOB 2JZBA 5EE3A 2H3FA 2KIWA 1LVHA 3Q8QB 4O3SA 4ECZA 3C29A 4JB3A 2LYBA 5AI9A 3PVXA 2KK0A 4O3QA 2W9CA 1KRPA 9ICOA 4EELA 1Q3VA 4DLEA 8ICGA 5IIIA 4NLBA 1D9FA 3PW5A 3CP8A 1N5WA 2K8BB 3WK8A 2O6KA 5KFAA 4YXJA 3C5GA 3T5JA 5HR6A 5J2FA 4F71A 1NK0A 1S5LU 1RXVA 5CRXA 4DLGA 4KN7A 2WF8A 4Y2UA 4NY8A 5EOZA 5EWGA 1HUZA 4CCHA 4B9NA 1ZQCA 4MF8A 4LZDA 2KSOA 5IIMA 4G3IA 4PHPA 4F8RA 1D8LA 3JPPA 1TK8A 5AM4A 1PK3A 4F2SA 5J2HA 4AP9A 1NZBA 3ZDDA 4KLQA 2W3RA 4DL5A 9ICVA 1ZQYA 5HP4A 4KX3A 1XU4A 1VLBA 3KTQA 2ZIWB 3IDWA 5L9XA 2FDRA 4B9SA 5J2AA 2YMMA 1L8LA 5J0YA 4PJ0U 4M6WB 4Y2QA 2BQRA 4EBCA 1JALA 1B0XA 2HVIA 2ZIUB 5J29A 4JWNA 7ICIA 4ZOHC 3D2SA 1C20A 3IP4B 3EUB2 5AM2A 5AKGA 1BVSA 2MSNA 1SXEA 5KG2A 2YQEA 1WCLA 5J0UA 3ETRA 5F9NA 3V6JA 4YD2A 8ICTA 4Y2VA 5KFHA 9ICSA 4FE3A 3GZFA 1SZHA 1L3SA 4XA5A 4EX6A 5HHIA 3RJEA 3MGVA 7ICHA 3CNHA 3RB4A 4NLKA 1P7DA 2VANA 2KFZA 3SV3A 2KMDA 3UXPA 3EZ5A 3M6ZA 2C22A 2K8AA 3TFRA 4CRXA 5EE9A 2PMZC 3MGIA 2FE9A 4IQUA 5ALDA 1FFUA 2G06A 4JMUA 1Z1BA 4P4PA 2Y1JA 4M6WA 7ICKA 5EE1A 2NO4A 2FMPA 1C7YA 1MC8A 2NRXA 2ZIUA 3HILA 3PW4A 4IRKA 3KHRA 1ZJMA 3HWTA 3Q8LA 2EH9A 1ZQOA 3A0HU 5CJ7A 4Y2YA 3BDPA 5AICA 1RYUA 2R8KA 4FO6A 5ALSA 1D9DA 2EAMA 3FDSA 4PPXA 4F4XA 2BQ3A 1S0VA 4G9BA 4P2HA 4P4OA 3RB0A 4DS5A 1ZQVA 2VJ5A 2Y9TA 2Y0SF 2HHQA 5KFVA 5CA7A 3LVWA 1F44A 4KLTA 1S97A 5B5EU 4JV2A 3R9KA 1N62A 4KMOB 1U47A 2GLEA 4MFCA 3F5EA 1BPYA 1COOA 4BGDA 4OCZA 2W9BB 2OWOA 3TAQA 3AL0B 3MR3A 9ICIA 5KAFU 8ICSA 4YP3A 3H4BA 5J8YA 3C5FA 3I28A 5BOLA 3V7JA 1COKA 1L3UA 1ZQNA 3FM9A 2F76X 2V9WA 1XSPA 8ICIA 2HSZA 4BDPA 1DK2A 9ICQA 3QUTA 5J2JA 8ICAA 5AKZA 3KBBA 2D3DA 4JK1A 3T79A 2DKZA 3JPRA 4F5RA 4DEZA 5DKWA 5EWFA 5DBCA 4MHVA 5L1KA 4M9HA 4LZGA 5J2DA 4QWCA 2M0NA 3AQFA 1L8OA 3V6HA 3E2EA 1NZPA 2W9BA 2J6UA 4LVSA 1JROA 4C7ZA 1XSNA 5AK4A 4BXOB 3NASA 4EEKA 5DB6A 2XY6A 3J81j 2KKPA 3L4PA 2W54A 2ODGA 2HCFA 3QZ7A 5CWRA 7ICOA 1NNLA 2MAXA 1V9PA 5E79U 3PO4A 2QKQA 1ZQKA 4OJLA 1JXEA 3E58A 4KITB 1BPXA 4PZOA 4PHEA 2F8LA 1ZRNA 3WK5A 3A0BU 4F5PA 1QQ5A 3TADA 5KT5A 1JI7A 4U7CA 1ZQQA 4NLCA 4QZAA 3AU6A 3V6KA 5ALRA 5ALEA 4BXOA 3OHAA 4RQ3A 4DQQA 2VA2A 4GLXA 5CB1A 3RH4A 4F4WA 4ECTA 7ICSA 4M9LA 2WB1C 3I1YA 4UASA 5KT7A 4PGYA 2MUTB 4FS2A 3ETLA 3JPNA 3BS5B 4XUSA 9ICHA 4QJFB 1TK0A 3RAQA 2EDUA 3SV4A 4C4RA 3PY8A 2BDUA 2K4PA 4UAYA 3KZXA 4DL6A 1RG6A 2H3ZA 1ZQBA 4KLHA 1QSYA 2BCSA 3SAHA 5DLGA 3WKAA 2E3TA 4MFFA 3I76A 3HKZC 4EEYA 3RR8A 2D8CA 3GQCA 1OW5A 1A0PA 4CNQA 4R8UB 1QCKA 4J03A 3PR4A 2UVVA 2Y9UA 4KX5A 2ZTCA 2DKXA 4NLZA 2LMRA 4JUZA 5KFKA 4UB2A 3D2QA 4HYKA 3PW2A 3TFSA 3ZD8A 2XIDA 2YB4A 1ZQDA 4RPZA 9ICAA 4OO1J 4IQTA 3WKBA 2MUTA 5C5JA 1BPZA 3QEBZ 1VDVA 5D46A 3BS5A 3M9NB 1RQLA 2MU2A 4YR0A 4C8MA 3ZDEA 4J9SA 3GILA 4ED8A 1CI4A 2XY5A 8ICPA 2ZTDA 4UARA 5AI6A 2MRLA 4J9MA 5AKYA 3Q8KA 1QTMA 2FLPA 4QZ9A 3BQ2A 4DSEA 3GIMA 3QU7A 3QYPA 2YMPA 3KFUF 4O9MA 4O5EA 2JEIA 5DQIA 5KAIU 3WK9A 2KJ9A 1JUDA 4R8UA 3ORYA 1D8BA 1ECWA 5DG7A 1K1QA 1Z00B 4HAIA 4MFAA 4DQIA 2A19A 3RJGA 7ICFA 8ICBA 2J6SA 4RQ0A 4RQ1A 8ICWA 4RUCA 4UATA 2C28A 2KOBA 1ZQTA 3H7IA 3F2DA 2ZUBA 3RTVA 4EX7A 4I2IA 2EZZA 1CUKA 3C2LA 3PR5B 1L7MA 1KQQA 5IIOA 2NV3A 4XRHA 4UBCA 3RJIA 4USAA 4Y2SA 1SXDA 1N5XA 1TAMA 4CDGA 1X6JA 3UMBA 1UA1A 2Y1IA 3GU3A 5J0OA 1IV8A 2LM1A 3M8SA 3GIKA 4K4IA 4PGXA 4KLIA 4TQRA 1NJXA 4I2HA 2FJ6A 4FS1A 5ALUA 1Z00A 4UB4A 1ZQIA 5G5HA 4QW8A 4IQWA 4ECVA 2BDPA 2I6XA 3UXNA 2EQYA 5D49A 2KEYA 3QNMA 2XCPA 1V97A 5DG8A 5DBBA 3PMNA 4I2AA 2G07A 4C8OA 2WF5A 4DSJA 5JUMA 2P66A 5AI5A 3C2MA 5DB9A 3H40A 2DQNB 2W9MA 4ED1A 3NGDA 3JPTA 4DOCA 4KN4A 1NK9A 4ED3A 2NRWA 2OEHA 5KG4A 3H0LB 3KZIU 4TQSA 2W8KA 1BPDA 3ICXA 3KKAA 4GIBA 5EE0A 3IV6A 1RDFA 5KFFA 1XO0A 2IHNA 4Z6FA 2WAQF 3H8JA 2RP5A 4QZEA 3PV8A 3IRUA 2VKQA 1L3TA 4J9QA 5DQGA 3C1ZA 2AQ0A 1U45A 4I27A 3UXOA 1X42A 3UMGA 5AKXA 2KJ5A 1MA7A 1V38A 2VJ4A 4DFMA 2LHTA 8ICQA 4ICAA 2WAQC 2FI1A 1KTQA 1WWUA 1N2XA 2HOQA 1JX4A 3RH5A 3SAFA 3BS7A 1A6SA 1ZQXA 2NRVA 3BQ1A 3H8MA 1KBUA 1F0MA 1Z1VA 2F8KA 3TACB 4RU9A 1DGJA 2CN1A 3LVVA 1B22A 1ZJNA 5AKIA 4ECXA 1SZPA 2JEFA 3EW9A 3N4MB 3V7LA 2K89A 5ALLA 4O0IA 8ICEA 3D6JA 9ICFA 1WWVA 4NL9A 1KFDA 2E5SA 2DWQA 1T3QA 1ZD3A 4R66A 4GFJA 4PL2A 3RBEA 2EZYA 4RQ7A 5D4BA 3Q8RB 1DK3A 4EYIB 3RH6A 3C23A 2XCAA 4RQ2A 1PVRA 3UM9A 3QE9Y 1ZQMA 4IL6U 4Z6DA 3NRWA 4Y2XA 5ALZA 2I5HA 4K4GA 5KFPA 8ICVA 4UQGA 3CRXA 1WYGA 4Q45A 3RJJA 3ALRA 2I9GA 5KFBA 3ZDCA 1T8EA 2ZJ5A 7ICEA 2JEJA 2HI0A 4PZNA 1PZNA 3BQ0A 4TUPA 2MA1A 4QW9A 4QZBA 5KG7A 1L7PA 2PMZF 9ICGA 3F53A 1KFTA 7ICVA 1MQ2A 2L5YA 3PMLA 7ICQA 1PVPA 4P0QB 4Z6CA 1KW4A 5ALIA 3L5KA 4M0AA 2ZIWA 3RF9A 4DCCA 3CYMA 3RRHA 4DFPA 1FIQA 2JV3A 4UB5A 2DFLA 2Q0ZX 5DQHA 3E0FA 4YMOA 1KEJA 4DOAA 3NTUA 1SGGA 3PSTA 5ALPA 2UVRA 3MC1A 2C2RA 4DL4A 1S0NA 1OXJA 5HMLA 2PI5A 5J0WA 3JPOA 5KG1A 2LYAA 4IR1A 1ZOLA 1Z4NA 5KFXA 2E8MA 3RAXA 4QWEA 4LJXA 4DFDA 2E1FA 4IRDA 5K4LA 4C7YA 2GOLA 1SV4A 5DGAA 3QU4A 2A1AA 2WFAA 5A0LA 1YZ6A 5AIBA 4UB3A 2HOIA 3KOOA 5KL8B 4I2CA 2W04A 2HVHA 2LBOA 5ALMA 2ISOA 4P0QA 2KHQA 2AQ4A 1Q46A 4ECSA 2BQUA 3SYZA 5J0PA 3SEIA 1QQ7A 2WF7A 5AM3A 4GXIA 3OPXA 3PW7A 8ICCA 3HW8A 1ZRMA 5AM0A 3TQ1A 2NYVA 2ZIVB 4EBDA 2H5XA 2ESEA 1JXLA 4DFKA 3MBYA 9ICXA 2KFNA 1L5UA 4O3RA 2QARB 4B6JA 4DSIA 5BOMA 3C1YA 2IA6A 4F5QA 1K1SA 3EYZA 1RQNA 1WUDA 1HJPA 3SR6A 1L3VA 2WTFA 1UT8A 1QLNA 3O0FA 2ZUCA 1MQ3A 2HHWA 2DPJA 4NM2A 2RDJA 2KV2A 4KLFA 2YB1A 4CGZA 4J9LA 3F2BA 2OYYA 3ZD9A 4Y2PA 2B0CA 1J97A 4KLDA 2W55A 1PUZA 3MDAA 4RQ5A 2KZMA 2PFNA 4QZDA 1S77D 3BJYA 2OH2A 3MR2A 3ONNA 1L7NA 4ED0A 2C2DA 4KLMA 3GV7B 5DDYA 2ZIVA 4Q8FA 2JHDA 1SKRA 4JV1A 1LB2B 2QARA 4ELVA 5KFCA 4EBEA 1FFVA 3NS1A 1CRXA 2QLTA 5L1LA 4Y2RA 2OXOA 4RZRA 1ZQEA 4M04A 2YMQA 4EZ6A 8ICNA 4KMUA 3B9JA 4AYBF 4KLEA 3SZ2A 2ASJA 2IOHA 4Y2JA 2R8JA 3IG5A 5CR0A 3AUOA 1XC9A 8ICUA 2EZXA 5KFRA 1XWLA 4M9JA 2YY6A 4KLOA 3K1RB 5AK5A 2E8OA 3MFIA 1J2MA 1EXNA 2KZ3A 3GV8B 4EZ9A 3THVA 2BPFA 4M9NA 4US9A 2WB1F 4AYBC 5AKHA 3PZPA 2IBKA 2G08A 1NK6A 1N61A 5AKKA 1ZQFA 5L1JA 4BWJA 2Z7JA 2KNJA 2HHUA 2NRTA 4UAZA 1KL9A 4A8EA 2LM4A 9ICTA 1NK4A 2V4QA 2C2EA 3RJFA 4I2DA 2KVCA 2BCRA 3HKZF 2PI4A 4F5NA 4DOBA 3SI8A 3HRDD 5KFTA 4RT3A 4DQSA 4O3PA 3F5AA 3NRZA 1CEZA 1URJA 8ICMA 3OGUA 2FPKA 3M7DA 4YVZA 2EAOA 1X2IA 5J2BA 4DF8A 1MN8A 3HT3A 1SKSA 4RQNA 2BZFA 8ICZA 2XICA 4UW9A 2PFOA 3M1YA 4JWMA 2W8LA 4PHAA 2XC9A 3Q8PB 2DPIA 1S8OA 2UVUA 5ALWA 4ED2A 1X9SA 2FMQA 3H0RB 1O03A 1TFRA 5AK3A 5KFEA 1N48A 2XGQA 1NOMA 2JXJA 4YMNA 2HHXA 2JH1A 3IN5A 2V4RA 1BPBA 2G5HB 4I2GA 2ZG6A 3T3FA 1NJYA 4KLLA 4C4SA 2A3VA 3IHQB 4I2FA 3C21A 1X9XA 3BQ7A 4US8A 4ED7A 8ICKA 4F4KA 4IQVA 3HX0A 1KSPA 3TKAA 1JRPA 5J0RA 2FPLA 3L3FX 4J9RA 1Y88A 5AK6A 4EENA 3FAHA 5IINA 2XVTA 3WKCA 3M6KA 4F2RA 2R8IA 2BCQA 3N7SC 3GIIA 3HPOA 2EAPA 5KFLA 3SAGA 3OJUA 4FZLA 4C0ZA 1QH9A 2ZTEA 1Z19A 1XNSA 5DLFA 2YMLA 3RRGA 1DRGA 1V85A 4O5CA 2ALZA 2A1JB 5AHXA 4RNMA 1U9LA 1X9WA 5DBAA 1SL0A 2B21A 2BCUA 5F3XB 4QZHA 4BUGA 3TANA 3QU5A 1ZQHA 4B9VA 4YD1A 4ZH4A 2GO7A 3MABA 3TI0A 4K4HA 3MFHA 1ZD4A 4QWAA 5CP2A 4J9PA 2XY7A 4ECQA 3D2NA 3SQIA 3FC4A 2YX8A 2NRZA 1IIPA 5KFZA 2R18A 1X40A 5AKJA 1AQ6A 1XO1A 3PSIA 2K4EA 1UPHA 1ZQUA 4O3NA 4RPXA 5BPCA 4F72A 4M47A 1NKCA 7ICLA 2ZJAA 3N7RC 4QZ8A 2E8NA 2HW3A 1UQVA 5J0XA 1SL2A 7ICRA 3M8RA 2H3VA 2ZUDA 3MGHA 3IG8A 3M9MB 4TUQA 3HJEA 4U6PA 1LV5A 2KICA 2A1JA 2IMWP 4TURA 3GDXA 4KLSA 2EANA 4QWBA 3IM1A 1SIJA 4JV0A 4RQ4A 1PVQA 1A76A 3ISDA 4DWIA 3EWAA 5KFQA 1L7OA 1YT3A 2KIVA 2KE7A 2XGPA 2DBYA 3WKEA 2F1HA 5J2KA 9ICEA 3WK7A 4UB8U 4OJ5A 1H38A 4DL7A 8ICYA 1AROP 4DSFA 3ZDBA 3ISCA 3QUQA 4CF4A 3KHLA 3T5LA 5ALHA 5AKEA 5KNIA 3V7KA 2RHFA 5L1IA 4B9MA 2E1EA 2GWSA 4O3OA 5IIKA 2DGZA 1LKYB 3T5KA 4RQMA 3RFAA 3QU9A 1XSLA 9ICJA 1SWWA 5AM5A 5CEHA 5JU5A 3UQ2A 2FLNA 7ICTA 2N1RA 4UB1A 4Z6EA 3Q8SB 4J9NA 8ICHA 4E0DA 3QU2A 2P35A 3ISBA 3AEVA 4RNNA 5DB8A 3C2KA 2LI6A 4C8KA 5AIAA 5ALGA 4BX9C 3MR5A 3GV5B 3TAPA 2IOFK 5AI4A 3T5HA 3H8WA 4KLJA 4DFJA 1TKDA 3NUQA 1VJ5A 4DL3A 5EWEA 4O3MA 1UT5A 4YFKA 1SB3C 3WK4A 3RBDA 4ELUA 1Q3UA 5JRTA 8ICLA 2ZXIA 5IILA 1SL1A 8ICJA 3NVYA 2G09A 4B9TA 2HHSA 4YN4A 3QUCA 1K5OA 1UHUA 4IS7A 2HOFA 1LKYA 2YN4A 1HUOA 1NJWA 2R8GA 4DO9A 3KHGA 2NO5A 2OHFA 2HDOA 3G6YA 1XS9D 2VA3A 2KN7A 1T3NA 4YXMA 5DDMA 5J8YC 2P6UA 1B4FA 2ZXHA 4Y2TA 3NVVA 4QWDA 2AU0A 1N56A 8ICOA 1T4GA 2KJ8A 3H8SA 2HHTA 4CE6A 1JMSA 3PX4A 1NKEA 2ASDA 2K4IA 1QSLA 4I28A 5ALFA 4F91B 1J2NA 4NV0A 4YR3A 3QEAZ 1ZQGA 2Q4TA 1RM6C 9ICNA 4NLGA 3B0XA 2AH5A 2FPMA 4RT2A 5ALXA 3OSNA 4I2BA 9ICKA 4PL1A 2F77X 1TAUA 2ISPA 3EPGA 2RQ5A 2JEGA 3OHBA 5KT6A 2W3SA 5F9LA 4J9KA 2LKYA 4I2EA 5KFJA 3N7PD 2AGOA 3V72A 2KP7A 4C8LA 1NI3A 4P4MA 3LDAA 1ZQZA 2GH1A 3B0YA 5B66U 4QZGA 3PSFA 1TV9A 1NK7A 4F4YA 4R65A 5AI0A 8ICRA 2W9AA 4YR2A 1ZXIA 5H2FU 7ICJA 5GTIU 1BPEA 5HNKA 5J0TA 3BZCA 5HMMA 4ACOA 1SWVA 4DSKA 2KD1A 2BR0A 1HIWA 3M9OB 3VCBA 4R64A 1UA0A 2D6FC 4X5VA 3FYHA 3OSPA 5KT2A 3TADC 1ED1A
chains in the Genus database with same CATH topology
2K4PA 1V38A 1RG6A 5J8YC 5L1MA 1B4FA 2EAPA 2FE9A 1SV0A 2L5YA 2K60A 1WWUA 2D8CA 5KNIA 1OW5A 1SXDA 3BS7A 3HILA 2QB0B 3H8MA 3KKAC 1V85A 1KW4A 1F0MA 1Z1VA 2F8KA 3TACB 5F3XB 2KSOA 2Y9UA 2LPEA 1LKYB 2DKXA 2LMRA 4RQMA 2EAMA 2JV3A 2EAOA 1PK3A 5JU5A 1X66A 4RQNA 2Y9TA 1SGGA 2E8PA 1PK1A 2QKQA 1X40A 1WWVA 1OXJA 4NL9A 2F44A 3BS5A 3IDWA 4PZOA 2QARA 2GLEA 2E8MA 2E8NA 1SV4A 1UQVA 3TADA 1B0XA 1JI7A 2ES6A 1DXSA 2QB1A 5J8YA 3SENA 1COKA 5JRTA 2DL0A 2YTUA 2KSOB 1SXEA 2QB0A 1SV0C 1X9XA 3BQ7A 3K1RB 3SEIA 2E8OA 2EANA 1UCVA 4IS7A 2F3NA 3KKAA 1LKYA 4NL9C 2D3DA 1PK1B 2KG5A 2DKZA 2ESEA 4NJ8A 3BS5B 2KIVA 2KE7A 2QARB 2B6GA 4PZNA 5JTIA 3TADC 2KMDA 4MHVA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2K4P A;  1V38 A;  1RG6 A;  5J8Y C;  5L1M A;  1B4F A;  2EAP A;  2FE9 A;  1SV0 A;  2L5Y A;  2K60 A;  1WWU A;  2D8C A;  5KNI A;  1OW5 A;  1SXD A;  3BS7 A;  3HIL A;  2QB0 B;  3H8M A;  3KKA C;  1V85 A;  1KW4 A;  1F0M A;  1Z1V A;  2F8K A;  3TAC B;  5F3X B;  2KSO A;  2Y9U A;  2LPE A;  1LKY B;  2DKX A;  2LMR A;  4RQM A;  2EAM A;  2JV3 A;  2EAO A;  1PK3 A;  5JU5 A;  1X66 A;  4RQN A;  2Y9T A;  1SGG A;  2E8P A;  1PK1 A;  2QKQ A;  1X40 A;  1WWV A;  1OXJ A;  4NL9 A;  2F44 A;  3BS5 A;  3IDW A;  4PZO A;  2QAR A;  2GLE A;  2E8M A;  2E8N A;  1SV4 A;  1UQV A;  3TAD A;  1B0X A;  1JI7 A;  2ES6 A;  1DXS A;  2QB1 A;  5J8Y A;  3SEN A;  1COK A;  5JRT A;  2DL0 A;  2YTU A;  2KSO B;  1SXE A;  2QB0 A;  1SV0 C;  1X9X A;  3BQ7 A;  3K1R B;  3SEI A;  2E8O A;  2EAN A;  1UCV A;  4IS7 A;  2F3N A;  3KKA A;  1LKY A;  4NL9 C;  2D3D A;  1PK1 B;  2KG5 A;  2DKZ A;  2ESE A;  4NJ8 A;  3BS5 B;  2KIV A;  2KE7 A;  2QAR B;  2B6G A;  4PZN A;  5JTI A;  3TAD C;  2KMD A;  4MHV A; 
#chains in the Genus database with same CATH topology
 4KLG A;  1F5S A;  2LYH A;  1Z4O A;  5AM1 A;  3EPI A;  1X9M A;  1IM4 A;  4IRC A;  3QZ8 A;  4FBT A;  2H3Q A;  1X6I A;  4DS4 A;  5ALK A;  2JRZ A;  2W43 A;  5HR7 A;  2W11 A;  4F3O A;  3SMV A;  5C0Y A;  3K4G A;  5HHH A;  3U26 A;  1KKX A;  4FFD A;  3VC8 A;  2RLT A;  5KFN A;  7ICM A;  8ICX A;  4R63 A;  4UB6 U;  2PFP A;  3DEE A;  5TZV A;  1ZD5 A;  2Y0S C;  1TE2 A;  9ICB A;  2G5I B;  5KFW A;  1N60 A;  1JN3 A;  1U48 A;  4C4T A;  4PH5 A;  2BPG A;  4IR9 A;  3GFK B;  1RYR A;  2OCE A;  5KG5 A;  3AM9 A;  9ICR A;  2CPR A;  3K1Z A;  4OJ6 A;  1FEZ A;  5KFD A;  4YMM A;  2DF4 B;  2QB1 A;  5DGB A;  2YTU A;  4OJP A;  4FZN A;  4C80 A;  4RPY A;  4RUA A;  1RZT A;  4RNO A;  3WU2 U;  5ALJ A;  4M9G A;  2ATL A;  2M9N A;  5KT4 A;  1S76 D;  2RRD A;  1RYS A;  4UAU A;  1PK1 B;  2KG5 A;  5J2G A;  2DUY A;  3PO5 A;  2F1J A;  3OTQ A;  3F2C A;  3UPQ A;  5FP0 A;  4P0P B;  5AKL A;  1U4B A;  1S9F A;  4M2Y A;  3SD7 A;  2PFQ A;  5KG0 A;  4XQ8 A;  5L1M A;  5KFG A;  4MEX A;  1M6Y A;  2IOF A;  5KFO A;  7ICP A;  1ZQS A;  5TIS U;  2AGQ A;  4YG2 A;  1ZQA A;  2HBL A;  2BGW A;  2VA8 A;  4ECY A;  5J2E A;  3N28 A;  3OJS A;  4NXZ A;  4DQR A;  3AN1 A;  3G6V A;  4EYH B;  3AQE A;  1TAQ A;  2J6T A;  1NJZ A;  5GTH U;  4NWI A;  4F5O A;  9ICP A;  3QUB A;  2W7P A;  1A77 A;  2FMS A;  1IG6 A;  7ICN A;  1KFS A;  5KFY A;  3S6J A;  2KVS A;  1U49 A;  4QNL A;  5IIJ A;  2E8P A;  1PK1 A;  4F50 A;  5KG3 A;  3LYS A;  1TVA A;  3LK9 A;  1OUQ A;  4P0P A;  4GC6 A;  4ECR A;  2WF6 A;  5J0Q A;  5ALO A;  2H3I A;  2KZZ A;  1L6N A;  2ZIX B;  4ED6 A;  8ICF A;  2JMG A;  4FBU A;  1JIH A;  2JR5 A;  4PHD A;  2BPC A;  2ES6 A;  3PNC A;  5ALQ A;  2HBM A;  3WKD A;  1DGS A;  1QQ6 A;  3GIJ A;  3DV9 A;  1S10 A;  9ICL A;  1SV0 C;  4ELT A;  1T7P A;  1B43 A;  5ALY A;  2OM6 A;  4CF5 A;  4PGQ A;  1UCV A;  2VIX A;  3QXG A;  2F3N A;  4QIW F;  1NK5 A;  3RB3 A;  3H4D A;  5DB7 A;  4YQW A;  3RJH A;  2W7O A;  3UQ0 A;  5KFM A;  2G0A A;  1KDH A;  2HBJ A;  1YZ7 A;  3WK6 A;  1SKW A;  2BHN A;  2KKV A;  3JPQ A;  3BZK A;  3K75 D;  3PW0 A;  2B6G A;  4O5K A;  3KD3 A;  5JTI A;  1N63 A;  1IXR A;  2JGA A;  4BWM A;  2I1Q A;  1T94 A;  2IHM A;  2UVW A;  1HEK A;  4Q44 A;  4QIW C;  5AI8 A;  5DG9 A;  2AGP A;  3C28 A;  2ZIX A;  3BQT A;  1ZQP A;  1ZYQ A;  4UBB A;  3AMZ A;  5KTQ A;  4B9L A;  2XO7 A;  2WF9 A;  4OD0 A;  2QB0 B;  2P6R A;  3KKA C;  4DF4 A;  3ZDA A;  1Q8K A;  1FO4 A;  4FZM A;  1ZET A;  1DOQ A;  5ALN A;  4RQ8 A;  2K4H A;  7ICG A;  4QZF A;  1TK5 A;  4ECW A;  3RR7 A;  1QSS A;  1S0M A;  2XI9 A;  2CXY A;  2PXI A;  5T14 A;  4C8N A;  4WJ3 B;  2AJQ A;  2F44 A;  4I2J A;  2ZJ8 A;  3NVZ A;  1ZD2 P;  2HBK A;  4ECU A;  2KTQ A;  5G5G A;  2K8C B;  3NVW A;  4GXJ A;  5KFI A;  3LWL A;  3ED5 A;  1KN5 A;  2R8H A;  7ICU A;  1DXS A;  2KHV A;  5KG6 A;  4KTQ A;  3SEN A;  2RDI A;  3Q8M A;  2BKE A;  2JH7 A;  1D8Y A;  2DL0 A;  4UAV A;  1KLN A;  2QB0 A;  1MSW D;  1ZQJ A;  3MDC A;  4YCX A;  3HP6 A;  3PX0 A;  3MR6 A;  1RPL A;  4NL9 C;  3PSP A;  3UMC A;  5ALV A;  4CF3 A;  4Q43 A;  4OJO A;  2CRX A;  2PKE A;  2AHO B;  1GO3 F;  4NJ8 A;  4IC9 A;  5J2C A;  9ICM A;  1WCN A;  4F4Z A;  2F2A B;  2HHV A;  3AU2 A;  3ZI4 A;  2AXT U;  3G6X A;  2W03 A;  9ICU A;  2BCV A;  1SV0 A;  3CW2 C;  4I29 A;  2K60 A;  5KFS A;  3N97 B;  1O08 A;  4J9O A;  4GC7 A;  1WG8 A;  2JZB B;  4F92 B;  4Q8E A;  1ZQ1 C;  4KLU A;  4UAW A;  3KHH A;  5J0S A;  1BGX T;  4NM1 A;  3H0M B;  4B9U A;  4NLN A;  5CHG A;  3LWM A;  4GXK A;  2LPE A;  3QX7 A;  1BNP A;  4F93 B;  2W9C B;  3TAR A;  1RXW A;  2ASL A;  5KFU A;  1X66 A;  4QZC A;  5J2I A;  3JPS A;  9ICW A;  1BNO A;  9ICC A;  1ZQW A;  4BJQ A;  5KT3 A;  4MEY A;  4RQ6 A;  3PX6 A;  1NK8 A;  4MF2 A;  2WHE A;  1S0O A;  4QZI A;  1ZQL A;  5ALT A;  1ZQR A;  3RB6 A;  5KL1 B;  3DDH A;  2FLL A;  1Z3E B;  2HMX A;  1NKB A;  4TUS A;  2F1I A;  4DSL A;  4DL2 A;  4DQP A;  3RJK A;  2KSO B;  2JZB A;  5EE3 A;  2H3F A;  2KIW A;  1LVH A;  3Q8Q B;  4O3S A;  4ECZ A;  3C29 A;  4JB3 A;  2LYB A;  5AI9 A;  3PVX A;  2KK0 A;  4O3Q A;  2W9C A;  1KRP A;  9ICO A;  4EEL A;  1Q3V A;  4DLE A;  8ICG A;  5III A;  4NLB A;  1D9F A;  3PW5 A;  3CP8 A;  1N5W A;  2K8B B;  3WK8 A;  2O6K A;  5KFA A;  4YXJ A;  3C5G A;  3T5J A;  5HR6 A;  5J2F A;  4F71 A;  1NK0 A;  1S5L U;  1RXV A;  5CRX A;  4DLG A;  4KN7 A;  2WF8 A;  4Y2U A;  4NY8 A;  5EOZ A;  5EWG A;  1HUZ A;  4CCH A;  4B9N A;  1ZQC A;  4MF8 A;  4LZD A;  2KSO A;  5IIM A;  4G3I A;  4PHP A;  4F8R A;  1D8L A;  3JPP A;  1TK8 A;  5AM4 A;  1PK3 A;  4F2S A;  5J2H A;  4AP9 A;  1NZB A;  3ZDD A;  4KLQ A;  2W3R A;  4DL5 A;  9ICV A;  1ZQY A;  5HP4 A;  4KX3 A;  1XU4 A;  1VLB A;  3KTQ A;  2ZIW B;  3IDW A;  5L9X A;  2FDR A;  4B9S A;  5J2A A;  2YMM A;  1L8L A;  5J0Y A;  4PJ0 U;  4M6W B;  4Y2Q A;  2BQR A;  4EBC A;  1JAL A;  1B0X A;  2HVI A;  2ZIU B;  5J29 A;  4JWN A;  7ICI A;  4ZOH C;  3D2S A;  1C20 A;  3IP4 B;  3EUB 2;  5AM2 A;  5AKG A;  1BVS A;  2MSN A;  1SXE A;  5KG2 A;  2YQE A;  1WCL A;  5J0U A;  3ETR A;  5F9N A;  3V6J A;  4YD2 A;  8ICT A;  4Y2V A;  5KFH A;  9ICS A;  4FE3 A;  3GZF A;  1SZH A;  1L3S A;  4XA5 A;  4EX6 A;  5HHI A;  3RJE A;  3MGV A;  7ICH A;  3CNH A;  3RB4 A;  4NLK A;  1P7D A;  2VAN A;  2KFZ A;  3SV3 A;  2KMD A;  3UXP A;  3EZ5 A;  3M6Z A;  2C22 A;  2K8A A;  3TFR A;  4CRX A;  5EE9 A;  2PMZ C;  3MGI A;  2FE9 A;  4IQU A;  5ALD A;  1FFU A;  2G06 A;  4JMU A;  1Z1B A;  4P4P A;  2Y1J A;  4M6W A;  7ICK A;  5EE1 A;  2NO4 A;  2FMP A;  1C7Y A;  1MC8 A;  2NRX A;  2ZIU A;  3HIL A;  3PW4 A;  4IRK A;  3KHR A;  1ZJM A;  3HWT A;  3Q8L A;  2EH9 A;  1ZQO A;  3A0H U;  5CJ7 A;  4Y2Y A;  3BDP A;  5AIC A;  1RYU A;  2R8K A;  4FO6 A;  5ALS A;  1D9D A;  2EAM A;  3FDS A;  4PPX A;  4F4X A;  2BQ3 A;  1S0V A;  4G9B A;  4P2H A;  4P4O A;  3RB0 A;  4DS5 A;  1ZQV A;  2VJ5 A;  2Y9T A;  2Y0S F;  2HHQ A;  5KFV A;  5CA7 A;  3LVW A;  1F44 A;  4KLT A;  1S97 A;  5B5E U;  4JV2 A;  3R9K A;  1N62 A;  4KMO B;  1U47 A;  2GLE A;  4MFC A;  3F5E A;  1BPY A;  1COO A;  4BGD A;  4OCZ A;  2W9B B;  2OWO A;  3TAQ A;  3AL0 B;  3MR3 A;  9ICI A;  5KAF U;  8ICS A;  4YP3 A;  3H4B A;  5J8Y A;  3C5F A;  3I28 A;  5BOL A;  3V7J A;  1COK A;  1L3U A;  1ZQN A;  3FM9 A;  2F76 X;  2V9W A;  1XSP A;  8ICI A;  2HSZ A;  4BDP A;  1DK2 A;  9ICQ A;  3QUT A;  5J2J A;  8ICA A;  5AKZ A;  3KBB A;  2D3D A;  4JK1 A;  3T79 A;  2DKZ A;  3JPR A;  4F5R A;  4DEZ A;  5DKW A;  5EWF A;  5DBC A;  4MHV A;  5L1K A;  4M9H A;  4LZG A;  5J2D A;  4QWC A;  2M0N A;  3AQF A;  1L8O A;  3V6H A;  3E2E A;  1NZP A;  2W9B A;  2J6U A;  4LVS A;  1JRO A;  4C7Z A;  1XSN A;  5AK4 A;  4BXO B;  3NAS A;  4EEK A;  5DB6 A;  2XY6 A;  3J81 j;  2KKP A;  3L4P A;  2W54 A;  2ODG A;  2HCF A;  3QZ7 A;  5CWR A;  7ICO A;  1NNL A;  2MAX A;  1V9P A;  5E79 U;  3PO4 A;  2QKQ A;  1ZQK A;  4OJL A;  1JXE A;  3E58 A;  4KIT B;  1BPX A;  4PZO A;  4PHE A;  2F8L A;  1ZRN A;  3WK5 A;  3A0B U;  4F5P A;  1QQ5 A;  3TAD A;  5KT5 A;  1JI7 A;  4U7C A;  1ZQQ A;  4NLC A;  4QZA A;  3AU6 A;  3V6K A;  5ALR A;  5ALE A;  4BXO A;  3OHA A;  4RQ3 A;  4DQQ A;  2VA2 A;  4GLX A;  5CB1 A;  3RH4 A;  4F4W A;  4ECT A;  7ICS A;  4M9L A;  2WB1 C;  3I1Y A;  4UAS A;  5KT7 A;  4PGY A;  2MUT B;  4FS2 A;  3ETL A;  3JPN A;  3BS5 B;  4XUS A;  9ICH A;  4QJF B;  1TK0 A;  3RAQ A;  2EDU A;  3SV4 A;  4C4R A;  3PY8 A;  2BDU A;  2K4P A;  4UAY A;  3KZX A;  4DL6 A;  1RG6 A;  2H3Z A;  1ZQB A;  4KLH A;  1QSY A;  2BCS A;  3SAH A;  5DLG A;  3WKA A;  2E3T A;  4MFF A;  3I76 A;  3HKZ C;  4EEY A;  3RR8 A;  2D8C A;  3GQC A;  1OW5 A;  1A0P A;  4CNQ A;  4R8U B;  1QCK A;  4J03 A;  3PR4 A;  2UVV A;  2Y9U A;  4KX5 A;  2ZTC A;  2DKX A;  4NLZ A;  2LMR A;  4JUZ A;  5KFK A;  4UB2 A;  3D2Q A;  4HYK A;  3PW2 A;  3TFS A;  3ZD8 A;  2XID A;  2YB4 A;  1ZQD A;  4RPZ A;  9ICA A;  4OO1 J;  4IQT A;  3WKB A;  2MUT A;  5C5J A;  1BPZ A;  3QEB Z;  1VDV A;  5D46 A;  3BS5 A;  3M9N B;  1RQL A;  2MU2 A;  4YR0 A;  4C8M A;  3ZDE A;  4J9S A;  3GIL A;  4ED8 A;  1CI4 A;  2XY5 A;  8ICP A;  2ZTD A;  4UAR A;  5AI6 A;  2MRL A;  4J9M A;  5AKY A;  3Q8K A;  1QTM A;  2FLP A;  4QZ9 A;  3BQ2 A;  4DSE A;  3GIM A;  3QU7 A;  3QYP A;  2YMP A;  3KFU F;  4O9M A;  4O5E A;  2JEI A;  5DQI A;  5KAI U;  3WK9 A;  2KJ9 A;  1JUD A;  4R8U A;  3ORY A;  1D8B A;  1ECW A;  5DG7 A;  1K1Q A;  1Z00 B;  4HAI A;  4MFA A;  4DQI A;  2A19 A;  3RJG A;  7ICF A;  8ICB A;  2J6S A;  4RQ0 A;  4RQ1 A;  8ICW A;  4RUC A;  4UAT A;  2C28 A;  2KOB A;  1ZQT A;  3H7I A;  3F2D A;  2ZUB A;  3RTV A;  4EX7 A;  4I2I A;  2EZZ A;  1CUK A;  3C2L A;  3PR5 B;  1L7M A;  1KQQ A;  5IIO A;  2NV3 A;  4XRH A;  4UBC A;  3RJI A;  4USA A;  4Y2S A;  1SXD A;  1N5X A;  1TAM A;  4CDG A;  1X6J A;  3UMB A;  1UA1 A;  2Y1I A;  3GU3 A;  5J0O A;  1IV8 A;  2LM1 A;  3M8S A;  3GIK A;  4K4I A;  4PGX A;  4KLI A;  4TQR A;  1NJX A;  4I2H A;  2FJ6 A;  4FS1 A;  5ALU A;  1Z00 A;  4UB4 A;  1ZQI A;  5G5H A;  4QW8 A;  4IQW A;  4ECV A;  2BDP A;  2I6X A;  3UXN A;  2EQY A;  5D49 A;  2KEY A;  3QNM A;  2XCP A;  1V97 A;  5DG8 A;  5DBB A;  3PMN A;  4I2A A;  2G07 A;  4C8O A;  2WF5 A;  4DSJ A;  5JUM A;  2P66 A;  5AI5 A;  3C2M A;  5DB9 A;  3H40 A;  2DQN B;  2W9M A;  4ED1 A;  3NGD A;  3JPT A;  4DOC A;  4KN4 A;  1NK9 A;  4ED3 A;  2NRW A;  2OEH A;  5KG4 A;  3H0L B;  3KZI U;  4TQS A;  2W8K A;  1BPD A;  3ICX A;  3KKA A;  4GIB A;  5EE0 A;  3IV6 A;  1RDF A;  5KFF A;  1XO0 A;  2IHN A;  4Z6F A;  2WAQ F;  3H8J A;  2RP5 A;  4QZE A;  3PV8 A;  3IRU A;  2VKQ A;  1L3T A;  4J9Q A;  5DQG A;  3C1Z A;  2AQ0 A;  1U45 A;  4I27 A;  3UXO A;  1X42 A;  3UMG A;  5AKX A;  2KJ5 A;  1MA7 A;  1V38 A;  2VJ4 A;  4DFM A;  2LHT A;  8ICQ A;  4ICA A;  2WAQ C;  2FI1 A;  1KTQ A;  1WWU A;  1N2X A;  2HOQ A;  1JX4 A;  3RH5 A;  3SAF A;  3BS7 A;  1A6S A;  1ZQX A;  2NRV A;  3BQ1 A;  3H8M A;  1KBU A;  1F0M A;  1Z1V A;  2F8K A;  3TAC B;  4RU9 A;  1DGJ A;  2CN1 A;  3LVV A;  1B22 A;  1ZJN A;  5AKI A;  4ECX A;  1SZP A;  2JEF A;  3EW9 A;  3N4M B;  3V7L A;  2K89 A;  5ALL A;  4O0I A;  8ICE A;  3D6J A;  9ICF A;  1WWV A;  4NL9 A;  1KFD A;  2E5S A;  2DWQ A;  1T3Q A;  1ZD3 A;  4R66 A;  4GFJ A;  4PL2 A;  3RBE A;  2EZY A;  4RQ7 A;  5D4B A;  3Q8R B;  1DK3 A;  4EYI B;  3RH6 A;  3C23 A;  2XCA A;  4RQ2 A;  1PVR A;  3UM9 A;  3QE9 Y;  1ZQM A;  4IL6 U;  4Z6D A;  3NRW A;  4Y2X A;  5ALZ A;  2I5H A;  4K4G A;  5KFP A;  8ICV A;  4UQG A;  3CRX A;  1WYG A;  4Q45 A;  3RJJ A;  3ALR A;  2I9G A;  5KFB A;  3ZDC A;  1T8E A;  2ZJ5 A;  7ICE A;  2JEJ A;  2HI0 A;  4PZN A;  1PZN A;  3BQ0 A;  4TUP A;  2MA1 A;  4QW9 A;  4QZB A;  5KG7 A;  1L7P A;  2PMZ F;  9ICG A;  3F53 A;  1KFT A;  7ICV A;  1MQ2 A;  2L5Y A;  3PML A;  7ICQ A;  1PVP A;  4P0Q B;  4Z6C A;  1KW4 A;  5ALI A;  3L5K A;  4M0A A;  2ZIW A;  3RF9 A;  4DCC A;  3CYM A;  3RRH A;  4DFP A;  1FIQ A;  2JV3 A;  4UB5 A;  2DFL A;  2Q0Z X;  5DQH A;  3E0F A;  4YMO A;  1KEJ A;  4DOA A;  3NTU A;  1SGG A;  3PST A;  5ALP A;  2UVR A;  3MC1 A;  2C2R A;  4DL4 A;  1S0N A;  1OXJ A;  5HML A;  2PI5 A;  5J0W A;  3JPO A;  5KG1 A;  2LYA A;  4IR1 A;  1ZOL A;  1Z4N A;  5KFX A;  2E8M A;  3RAX A;  4QWE A;  4LJX A;  4DFD A;  2E1F A;  4IRD A;  5K4L A;  4C7Y A;  2GOL A;  1SV4 A;  5DGA A;  3QU4 A;  2A1A A;  2WFA A;  5A0L A;  1YZ6 A;  5AIB A;  4UB3 A;  2HOI A;  3KOO A;  5KL8 B;  4I2C A;  2W04 A;  2HVH A;  2LBO A;  5ALM A;  2ISO A;  4P0Q A;  2KHQ A;  2AQ4 A;  1Q46 A;  4ECS A;  2BQU A;  3SYZ A;  5J0P A;  3SEI A;  1QQ7 A;  2WF7 A;  5AM3 A;  4GXI A;  3OPX A;  3PW7 A;  8ICC A;  3HW8 A;  1ZRM A;  5AM0 A;  3TQ1 A;  2NYV A;  2ZIV B;  4EBD A;  2H5X A;  2ESE A;  1JXL A;  4DFK A;  3MBY A;  9ICX A;  2KFN A;  1L5U A;  4O3R A;  2QAR B;  4B6J A;  4DSI A;  5BOM A;  3C1Y A;  2IA6 A;  4F5Q A;  1K1S A;  3EYZ A;  1RQN A;  1WUD A;  1HJP A;  3SR6 A;  1L3V A;  2WTF A;  1UT8 A;  1QLN A;  3O0F A;  2ZUC A;  1MQ3 A;  2HHW A;  2DPJ A;  4NM2 A;  2RDJ A;  2KV2 A;  4KLF A;  2YB1 A;  4CGZ A;  4J9L A;  3F2B A;  2OYY A;  3ZD9 A;  4Y2P A;  2B0C A;  1J97 A;  4KLD A;  2W55 A;  1PUZ A;  3MDA A;  4RQ5 A;  2KZM A;  2PFN A;  4QZD A;  1S77 D;  3BJY A;  2OH2 A;  3MR2 A;  3ONN A;  1L7N A;  4ED0 A;  2C2D A;  4KLM A;  3GV7 B;  5DDY A;  2ZIV A;  4Q8F A;  2JHD A;  1SKR A;  4JV1 A;  1LB2 B;  2QAR A;  4ELV A;  5KFC A;  4EBE A;  1FFV A;  3NS1 A;  1CRX A;  2QLT A;  5L1L A;  4Y2R A;  2OXO A;  4RZR A;  1ZQE A;  4M04 A;  2YMQ A;  4EZ6 A;  8ICN A;  4KMU A;  3B9J A;  4AYB F;  4KLE A;  3SZ2 A;  2ASJ A;  2IOH A;  4Y2J A;  2R8J A;  3IG5 A;  5CR0 A;  3AUO A;  1XC9 A;  8ICU A;  2EZX A;  5KFR A;  1XWL A;  4M9J A;  2YY6 A;  4KLO A;  3K1R B;  5AK5 A;  2E8O A;  3MFI A;  1J2M A;  1EXN A;  2KZ3 A;  3GV8 B;  4EZ9 A;  3THV A;  2BPF A;  4M9N A;  4US9 A;  2WB1 F;  4AYB C;  5AKH A;  3PZP A;  2IBK A;  2G08 A;  1NK6 A;  1N61 A;  5AKK A;  1ZQF A;  5L1J A;  4BWJ A;  2Z7J A;  2KNJ A;  2HHU A;  2NRT A;  4UAZ A;  1KL9 A;  4A8E A;  2LM4 A;  9ICT A;  1NK4 A;  2V4Q A;  2C2E A;  3RJF A;  4I2D A;  2KVC A;  2BCR A;  3HKZ F;  2PI4 A;  4F5N A;  4DOB A;  3SI8 A;  3HRD D;  5KFT A;  4RT3 A;  4DQS A;  4O3P A;  3F5A A;  3NRZ A;  1CEZ A;  1URJ A;  8ICM A;  3OGU A;  2FPK A;  3M7D A;  4YVZ A;  2EAO A;  1X2I A;  5J2B A;  4DF8 A;  1MN8 A;  3HT3 A;  1SKS A;  4RQN A;  2BZF A;  8ICZ A;  2XIC A;  4UW9 A;  2PFO A;  3M1Y A;  4JWM A;  2W8L A;  4PHA A;  2XC9 A;  3Q8P B;  2DPI A;  1S8O A;  2UVU A;  5ALW A;  4ED2 A;  1X9S A;  2FMQ A;  3H0R B;  1O03 A;  1TFR A;  5AK3 A;  5KFE A;  1N48 A;  2XGQ A;  1NOM A;  2JXJ A;  4YMN A;  2HHX A;  2JH1 A;  3IN5 A;  2V4R A;  1BPB A;  2G5H B;  4I2G A;  2ZG6 A;  3T3F A;  1NJY A;  4KLL A;  4C4S A;  2A3V A;  3IHQ B;  4I2F A;  3C21 A;  1X9X A;  3BQ7 A;  4US8 A;  4ED7 A;  8ICK A;  4F4K A;  4IQV A;  3HX0 A;  1KSP A;  3TKA A;  1JRP A;  5J0R A;  2FPL A;  3L3F X;  4J9R A;  1Y88 A;  5AK6 A;  4EEN A;  3FAH A;  5IIN A;  2XVT A;  3WKC A;  3M6K A;  4F2R A;  2R8I A;  2BCQ A;  3N7S C;  3GII A;  3HPO A;  2EAP A;  5KFL A;  3SAG A;  3OJU A;  4FZL A;  4C0Z A;  1QH9 A;  2ZTE A;  1Z19 A;  1XNS A;  5DLF A;  2YML A;  3RRG A;  1DRG A;  1V85 A;  4O5C A;  2ALZ A;  2A1J B;  5AHX A;  4RNM A;  1U9L A;  1X9W A;  5DBA A;  1SL0 A;  2B21 A;  2BCU A;  5F3X B;  4QZH A;  4BUG A;  3TAN A;  3QU5 A;  1ZQH A;  4B9V A;  4YD1 A;  4ZH4 A;  2GO7 A;  3MAB A;  3TI0 A;  4K4H A;  3MFH A;  1ZD4 A;  4QWA A;  5CP2 A;  4J9P A;  2XY7 A;  4ECQ A;  3D2N A;  3SQI A;  3FC4 A;  2YX8 A;  2NRZ A;  1IIP A;  5KFZ A;  2R18 A;  1X40 A;  5AKJ A;  1AQ6 A;  1XO1 A;  3PSI A;  2K4E A;  1UPH A;  1ZQU A;  4O3N A;  4RPX A;  5BPC A;  4F72 A;  4M47 A;  1NKC A;  7ICL A;  2ZJA A;  3N7R C;  4QZ8 A;  2E8N A;  2HW3 A;  1UQV A;  5J0X A;  1SL2 A;  7ICR A;  3M8R A;  2H3V A;  2ZUD A;  3MGH A;  3IG8 A;  3M9M B;  4TUQ A;  3HJE A;  4U6P A;  1LV5 A;  2KIC A;  2A1J A;  2IMW P;  4TUR A;  3GDX A;  4KLS A;  2EAN A;  4QWB A;  3IM1 A;  1SIJ A;  4JV0 A;  4RQ4 A;  1PVQ A;  1A76 A;  3ISD A;  4DWI A;  3EWA A;  5KFQ A;  1L7O A;  1YT3 A;  2KIV A;  2KE7 A;  2XGP A;  2DBY A;  3WKE A;  2F1H A;  5J2K A;  9ICE A;  3WK7 A;  4UB8 U;  4OJ5 A;  1H38 A;  4DL7 A;  8ICY A;  1ARO P;  4DSF A;  3ZDB A;  3ISC A;  3QUQ A;  4CF4 A;  3KHL A;  3T5L A;  5ALH A;  5AKE A;  5KNI A;  3V7K A;  2RHF A;  5L1I A;  4B9M A;  2E1E A;  2GWS A;  4O3O A;  5IIK A;  2DGZ A;  1LKY B;  3T5K A;  4RQM A;  3RFA A;  3QU9 A;  1XSL A;  9ICJ A;  1SWW A;  5AM5 A;  5CEH A;  5JU5 A;  3UQ2 A;  2FLN A;  7ICT A;  2N1R A;  4UB1 A;  4Z6E A;  3Q8S B;  4J9N A;  8ICH A;  4E0D A;  3QU2 A;  2P35 A;  3ISB A;  3AEV A;  4RNN A;  5DB8 A;  3C2K A;  2LI6 A;  4C8K A;  5AIA A;  5ALG A;  4BX9 C;  3MR5 A;  3GV5 B;  3TAP A;  2IOF K;  5AI4 A;  3T5H A;  3H8W A;  4KLJ A;  4DFJ A;  1TKD A;  3NUQ A;  1VJ5 A;  4DL3 A;  5EWE A;  4O3M A;  1UT5 A;  4YFK A;  1SB3 C;  3WK4 A;  3RBD A;  4ELU A;  1Q3U A;  5JRT A;  8ICL A;  2ZXI A;  5IIL A;  1SL1 A;  8ICJ A;  3NVY A;  2G09 A;  4B9T A;  2HHS A;  4YN4 A;  3QUC A;  1K5O A;  1UHU A;  4IS7 A;  2HOF A;  1LKY A;  2YN4 A;  1HUO A;  1NJW A;  2R8G A;  4DO9 A;  3KHG A;  2NO5 A;  2OHF A;  2HDO A;  3G6Y A;  1XS9 D;  2VA3 A;  2KN7 A;  1T3N A;  4YXM A;  5DDM A;  5J8Y C;  2P6U A;  1B4F A;  2ZXH A;  4Y2T A;  3NVV A;  4QWD A;  2AU0 A;  1N56 A;  8ICO A;  1T4G A;  2KJ8 A;  3H8S A;  2HHT A;  4CE6 A;  1JMS A;  3PX4 A;  1NKE A;  2ASD A;  2K4I A;  1QSL A;  4I28 A;  5ALF A;  4F91 B;  1J2N A;  4NV0 A;  4YR3 A;  3QEA Z;  1ZQG A;  2Q4T A;  1RM6 C;  9ICN A;  4NLG A;  3B0X A;  2AH5 A;  2FPM A;  4RT2 A;  5ALX A;  3OSN A;  4I2B A;  9ICK A;  4PL1 A;  2F77 X;  1TAU A;  2ISP A;  3EPG A;  2RQ5 A;  2JEG A;  3OHB A;  5KT6 A;  2W3S A;  5F9L A;  4J9K A;  2LKY A;  4I2E A;  5KFJ A;  3N7P D;  2AGO A;  3V72 A;  2KP7 A;  4C8L A;  1NI3 A;  4P4M A;  3LDA A;  1ZQZ A;  2GH1 A;  3B0Y A;  5B66 U;  4QZG A;  3PSF A;  1TV9 A;  1NK7 A;  4F4Y A;  4R65 A;  5AI0 A;  8ICR A;  2W9A A;  4YR2 A;  1ZXI A;  5H2F U;  7ICJ A;  5GTI U;  1BPE A;  5HNK A;  5J0T A;  3BZC A;  5HMM A;  4ACO A;  1SWV A;  4DSK A;  2KD1 A;  2BR0 A;  1HIW A;  3M9O B;  3VCB A;  4R64 A;  1UA0 A;  2D6F C;  4X5V A;  3FYH A;  3OSP A;  5KT2 A;  3TAD C;  1ED1 A; 
#chains in the Genus database with same CATH homology
 2K4P A;  1V38 A;  1RG6 A;  5J8Y C;  5L1M A;  1B4F A;  2EAP A;  2FE9 A;  1SV0 A;  2L5Y A;  2K60 A;  1WWU A;  2D8C A;  5KNI A;  1OW5 A;  1SXD A;  3BS7 A;  3HIL A;  2QB0 B;  3H8M A;  3KKA C;  1V85 A;  1KW4 A;  1F0M A;  1Z1V A;  2F8K A;  3TAC B;  5F3X B;  2KSO A;  2Y9U A;  2LPE A;  1LKY B;  2DKX A;  2LMR A;  4RQM A;  2EAM A;  2JV3 A;  2EAO A;  1PK3 A;  5JU5 A;  1X66 A;  4RQN A;  2Y9T A;  1SGG A;  2E8P A;  1PK1 A;  2QKQ A;  1X40 A;  1WWV A;  1OXJ A;  4NL9 A;  2F44 A;  3BS5 A;  3IDW A;  4PZO A;  2QAR A;  2GLE A;  2E8M A;  2E8N A;  1SV4 A;  1UQV A;  3TAD A;  1B0X A;  1JI7 A;  2ES6 A;  1DXS A;  2QB1 A;  5J8Y A;  3SEN A;  1COK A;  5JRT A;  2DL0 A;  2YTU A;  2KSO B;  1SXE A;  2QB0 A;  1SV0 C;  1X9X A;  3BQ7 A;  3K1R B;  3SEI A;  2E8O A;  2EAN A;  1UCV A;  4IS7 A;  2F3N A;  3KKA A;  1LKY A;  4NL9 C;  2D3D A;  1PK1 B;  2KG5 A;  2DKZ A;  2ESE A;  4NJ8 A;  3BS5 B;  2KIV A;  2KE7 A;  2QAR B;  2B6G A;  4PZN A;  5JTI A;  3TAD C;  2KMD A;  4MHV A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...