5J8YA

Crystal structure of the scm-sam and sfmbt-sam heterodimer
Total Genus 25
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
25
sequence length
78
structure length
78
Chain Sequence
DSMPIDWTIEEVIQYIESNDNSLAVHGDLFRKHEIDGKALLLLNSEMMMKYMGLKEGPAEKICNLVNKVNGRRNNLAL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Polycomb protein Scm
publication title Molecular basis of PRC1 targeting to Polycomb response elements by PhoRC.
pubmed doi rcsb
source organism Drosophila melanogaster
molecule tags Nuclear protein
total genus 25
structure length 78
sequence length 78
chains with identical sequence B
ec nomenclature
pdb deposition date 2016-04-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00536 SAM_1 SAM domain (Sterile alpha motif)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.50 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 Transcription Factor, Ets-1 5j8yA00
3TADA 2LPEA 1B4FA 2E8PA 5KNIA 1PK3A 2DKXA 2F8KA 2E8MA 1DXSA 1PK1B 2F44A 1WWUA 1SXDA 2QARA 4MHVA 1JI7A 5JU5A 2K4PA 2KSOA 2LMRA 3TACB 5JTIA 4RQNA 2K60A 3BS5B 2QKQA 2QB0A 2GLEA 2YTUA 2KE7A 2QARB 1WWVA 2KSOB 1UQVA 3HILA 4IS7A 1COKA 5L1MA 1KW4A 2D3DA 2B6GA 2QB0B 3TADC 1SGGA 3H8MA 2EAMA 3KKAA 4NL9A 2E8NA 1Z1VA 1X66A 2Y9TA 2DL0A 5J8YA 2EAOA 3BQ7A 1V38A 4PZOA 1V85A 2FE9A 1SV0A 1RG6A 2DKZA 1UCVA 2KIVA 2EAPA 5F3XB 2EANA 2F3NA 2KMDA 3SEIA 1SXEA 1OW5A 2KG5A 1OXJA 1LKYA 3IDWA 3KKAC 4NL9C 2D8CA 3SENA 3K1RB 4NJ8A 2ESEA 2Y9UA 3BS5A 5J8YC 2L5YA 1LKYB 1SV4A 1SV0C 1X9XA 4PZNA 2ES6A 1F0MA 2E8OA 3BS7A 1PK1A 1X40A 4RQMA 1B0XA 5JRTA 2QB1A 2JV3A
chains in the Genus database with same CATH superfamily
4DQPA 2LPEA 2IHNA 4ECXA 3QXGA 3AU2A 5KNIA 1Z00B 5AKKA 1S8OA 4MFFA 1QSLA 2DKXA 4O3RA 1LV5A 3F5AA 1ZQAA 4JV0A 1CEZA 3IM1A 1ZQHA 1DGSA 4NV0A 2LMRA 2R8IA 3PNCA 2ASDA 1UT5A 3CRXA 1BPEA 4M2YA 2JRZA 2WF7A 5DB8A 2AU0A 1ZQTA 1UT8A 4FBTA 4XRHA 2EH9A 4ECRA 4IS7A 1ZQPA 3GILA 2YMMA 1UA1A 4QWCA 3IG8A 4I2FA 4AYBF 3NVWA 2KZMA 2EZZA 1F5SA 2FPKA 3T3FA 1KQQA 3RBEA 4UAZA 2ISPA 4GXJA 1QTMA 1ZQOA 2YQEA 4O3NA 5C5JA 2WF9A 8ICGA 4QIWF 4ELTA 4F5NA 1QCKA 5HHIA 1EXNA 1V85A 3C21A 1T4GA 2W43A 1UCVA 3RR8A 3Q8LA 5AI4A 2HBMA 4RQ8A 2EANA 2NRTA 1D8BA 2IOFK 1ZQKA 3K75D 4MF2A 4UATA 3HX0A 1N48A 8ICAA 3KHRA 2OHFA 4U7CA 3C5FA 5CJ7A 1MQ3A 3GFKB 5IIKA 2JZBB 4NLNA 1ED1A 2LM4A 1L8LA 2K89A 4GLXA 1ZD2P 3MABA 2NYVA 5ALQA 1Z00A 5KT3A 4C8LA 4KMUA 5L1LA 5KFBA 2A1JB 4K4GA 2Q0ZX 2CRXA 1X40A 4NWIA 4DCCA 4PH5A 3T5KA 3RJGA 1XSLA 2ISOA 2GOLA 3L3FX 3ETLA 7ICTA 2G09A 4EENA 3QEAZ 4ECWA 4PL2A 3OSNA 1ZQYA 4KTQA 2DFLA 2AJQA 3BQ1A 3WK8A 1J2NA 5KG7A 1ZD5A 5JTIA 3Q8KA 5ALTA 4J9RA 4KN7A 3PSTA 1RPLA 5ALIA 2WFAA 1NKCA 3H0MB 1QSYA 4YR0A 4WJ3B 4O3OA 3GV8B 2NRXA 1JUDA 4EEYA 1Z4NA 3RAXA 3KD3A 5J2GA 3SZ2A 2JMGA 5DG9A 3SD7A 4UBBA 1RXVA 4F5PA 1JROA 3RB6A 3THVA 3WK6A 3RJJA 9ICPA 1HEKA 5J2FA 3O0FA 4F72A 3JPPA 2BPGA 4NLZA 1XS9D 1SV0A 4TUPA 1NZPA 3UM9A 1TAUA 4KLSA 1Y88A 2EDUA 3J81j 2JZBA 3V6JA 9ICLA 5J29A 4KLTA 1NJWA 3JPRA 2FMSA 5J2KA 5KTQA 4DL6A 4KLQA 7ICRA 2A1JA 2EQYA 5J0YA 5ALEA 3C2LA 4MFAA 1LKYB 2F1HA 4KLHA 3F2DA 7ICJA 3AUOA 3H8JA 1LB2B 4YXMA 2MUTA 4PZNA 3NVVA 3C5GA 1MSWD 4RQMA 2F76X 7ICSA 4BWJA 3DEEA 1BGXT 3QZ7A 2RDIA 2XI9A 2ZIWB 1ZQEA 4FS2A 4ECVA 3N7SC 5KG3A 4PGXA 2JHDA 2AQ4A 4UB2A 3PR4A 3Q8SB 3RJHA 3N28A 4QZ8A 5KT4A 3TACB 4OJPA 3E0FA 1VJ5A 3KBBA 2KE7A 1NJZA 1JMSA 3TFSA 2EZYA 5KL8B 4E0DA 1PVQA 3SAGA 2E3TA 2ZJ8A 4KN4A 2IA6A 2ODGA 4UASA 1TKDA 5ALYA 1SGGA 5HHHA 3MR6A 3H8MA 1KFTA 5KFIA 5ALRA 4CNQA 4RPZA 3OTQA 5J0TA 5J2JA 4Q8EA 5IINA 2V4RA 2WB1C 2BCVA 5J8YA 2XIDA 3PW7A 5KFEA 1DRGA 7ICEA 1BPDA 5J0UA 1SKSA 8ICPA 1RYUA 4DSKA 4IRCA 3OHAA 5DGBA 2AH5A 4YQWA 1D8LA 1LKYA 5KFHA 2ZUCA 4QZBA 1U47A 2VIXA 3SENA 4NJ8A 3M8SA 1F44A 1JX4A 5EE9A 2O6KA 4RQ4A 5ALJA 1HUOA 5AKXA 2ZIWA 4QW8A 5KFNA 3RB3A 4NLGA 1SV0C 8ICVA 3V7LA 4NLCA 5ALXA 4F2RA 4FBUA 4RUCA 3PX4A 3Q8MA 4OJLA 3M6KA 2PMZF 2G07A 3PW5A 2P6UA 1PK1B 2W9BB 3AN1A 3RJEA 8ICXA 4QWDA 3MGHA 2XC9A 1C7YA 5T14A 4RQNA 1N62A 2OCEA 3BS5B 3QE9Y 2J6UA 1ZQJA 5J0RA 1KDHA 2QARB 2BHNA 2ZG6A 4JB3A 4KMOB 9ICKA 1COKA 2M0NA 4GXIA 4CGZA 4GC7A 4I2HA 1WYGA 4GXKA 5AI5A 3V6KA 1NI3A 4F2SA 4Y2VA 4DQIA 4OO1J 3LVWA 4I2BA 4DO9A 1DK3A 3M6ZA 4F5QA 2C28A 2FE9A 1T8EA 2I1QA 5DG8A 3OHBA 5J2AA 1XU4A 3SMVA 2PI5A 7ICNA 3L4PA 2ZTDA 5KAFU 2W8KA 4DQRA 5DG7A 5AI6A 8ICKA 5KFUA 4PJ0U 4AYBC 3KOOA 5KT7A 2XICA 2PFQA 5J8YC 7ICFA 5GTIU 3TANA 2G5IB 4DL7A 4QIWC 2NO4A 2R8GA 2KZZA 1COOA 3WK5A 5ALNA 3RH4A 1NJXA 4J9LA 3ZDAA 1PK1A 2W9BA 2AGQA 5JRTA 1WCLA 4KLFA 2WF8A 3GU3A 3NGDA 1FO4A 3OJUA 4JK1A 3WK4A 2F8KA 4DLGA 4F92B 1O08A 3RH6A 2W7OA 4KX5A 5C0YA 1WWUA 2A1AA 2QARA 2YMQA 1KEJA 3V7JA 5JUMA 1N61A 5CR0A 5CB1A 3H4DA 4B9NA 2QKQA 3C2MA 5CRXA 3M1YA 5AM3A 4K4HA 1N63A 1WUDA 3T5HA 1S0OA 4O3SA 3C28A 1L6NA 2ZUBA 2XCAA 2OXOA 2WB1F 3K1ZA 3C2KA 3HILA 4QZDA 1KW4A 2NRWA 5DQHA 4LZGA 5KFAA 5HR7A 3I1YA 3BZCA 1NKBA 4F4YA 4UB6U 4DS4A 3ZI4A 3D2SA 3PV8A 2W3RA 2JEJA 3D2NA 7ICHA 2FLNA 2IOFA 4IRDA 1RG6A 8ICJA 3UQ2A 3B0YA 4YXJA 2WTFA 3K4GA 2HBLA 4U6PA 3HW8A 2B21A 3B0XA 3CYMA 2KD1A 2JH1A 4X5VA 5GTHU 4JWNA 5KT6A 4P4PA 4ECSA 1M6YA 4RQ1A 5KFDA 7ICLA 1QQ7A 3GIMA 4MF8A 4Y2PA 4DS5A 5AKEA 1Q46A 2BZFA 4YR3A 4O5CA 3HJEA 2KN7A 3E58A 2FPMA 3LVVA 4UBCA 1JN3A 5DLFA 4UAWA 4IQVA 4F50A 2N1RA 4IQUA 4RT2A 5KG4A 1TK8A 3U26A 4BGDA 4PHPA 2WF6A 4YN4A 2AXTU 4ED1A 4F4KA 2HBJA 2F1JA 5ALOA 3ZDCA 2YTUA 5AI0A 2HHUA 4PHDA 5KL1B 1WWVA 1IG6A 2LYAA 1KL9A 5AM1A 2H3VA 2D3DA 1FFVA 5KFLA 5J0WA 4UW9A 5CEHA 4O5EA 9ICOA 4ELVA 1KLNA 1V38A 2I5HA 3HPOA 8ICZA 4EX7A 3QU5A 5KFRA 1JIHA 1MN8A 3NVZA 5ALKA 3SQIA 1ZJMA 5J2BA 4PHAA 5DDMA 5AK3A 2W11A 1BNOA 1TE2A 4R66A 2KMDA 3F5EA 1CUKA 5KFPA 2K8BB 3RH5A 1ZQXA 7ICPA 3DDHA 3V6HA 4YFKA 4XA5A 2FJ6A 2OYYA 2ASLA 4EBEA 4KITB 5TISU 1UA0A 2K8AA 3KHHA 3M8RA 4I2CA 2CN1A 2ZJAA 3SR6A 2MU2A 3EYZA 3SV3A 2H3IA 4ECTA 2YX8A 4P0PB 1U4BA 5DKWA 4DFKA 4I2AA 4RUAA 1IM4A 5KFWA 3QYPA 4KX3A 2RHFA 4M0AA 2ZIXB 2E8MA 1K1QA 5KAIU 2RDJA 1RQNA 1WCNA 1NOMA 4RQ6A 3RB4A 4LVSA 4P0QB 1L7NA 1ZJNA 1ZD3A 5ALZA 1QQ5A 1SWWA 1X2IA 5G5GA 4PPXA 4M04A 4I2JA 3PO4A 8ICMA 2M9NA 4YD1A 5J2IA 3C1ZA 2A3VA 4RNOA 4I2GA 3G6XA 2MUTB 2H3ZA 7ICOA 1DK2A 5KG5A 4KLLA 2C2RA 4Y2YA 4DOCA 4QZAA 3RBDA 7ICVA 1Z1VA 1Z4OA 1ZD4A 5AK4A 2G08A 2PMZC 1QQ6A 4Y2RA 2BPFA 1HUZA 4DOAA 1XNSA 3MC1A 8ICYA 2W3SA 4YCXA 1ZQRA 4KLDA 1N5XA 8ICCA 3C29A 2ALZA 3MDAA 2G5HB 3KHLA 2E1EA 2NRVA 5AK6A 2R8HA 2J6TA 4J9MA 3ONNA 3MR2A 4UAVA 2EZXA 4Q45A 3H8WA 1SWVA 5L1KA 4OCZA 5ALVA 4ED3A 3WKDA 4O5KA 5KT5A 4YMMA 1TAQA 2NV3A 4NLBA 3M9OB 3C1YA 3HT3A 5J2CA 1RXWA 4ECUA 4DSEA 4P0PA 1ZOLA 5CA7A 2KVCA 4OD0A 3ZD9A 4DWIA 1X9XA 5HNKA 2ZIXA 2ES6A 3T79A 9ICXA 3BS7A 1NNLA 3EWAA 2W55A 3PMNA 2G0AA 5ALPA 3LWLA 4OJOA 4GC6A 5IIJA 4P0QA 2BCUA 1S9FA 3KZIU 8ICNA 4C8MA 1RZTA 1KN5A 2YN4A 1XSPA 4M9HA 8ICRA 1ZQGA 4ELUA 2AGPA 5KFTA 2KZ3A 2WAQF 4UB8U 3IRUA 2LI6A 3KTQA 2MAXA 1S77D 8ICHA 4C8KA 5AM4A 1T94A 2K4IA 1ZYQA 5HP4A 4C8OA 2FLPA 3BJYA 4KLIA 1T7PA 3ORYA 1UQVA 4IC9A 1BVSA 1RQLA 4I2DA 3OSPA 2QB0B 4QWBA 4C7YA 3MDCA 1YT3A 5HMLA 4B9TA 4YMNA 1CI4A 1NK6A 1RDFA 3ISCA 3GIKA 2KV2A 3SAHA 1Q8KA 4EELA 5ALFA 3ED5A 3QU9A 2W7PA 3ZDDA 4Q44A 5AKLA 1ZQCA 3LWMA 4J9SA 2AQ0A 1S0VA 2W9CB 3UXOA 1B43A 1P7DA 3SAFA 3NS1A 4TUSA 3FC4A 3MBYA 4B9LA 2HHSA 3V72A 4RU9A 3NRZA 2IMWP 3AEVA 4J9NA 3JPTA 4QWAA 1IXRA 4F5OA 5ALWA 2XY5A 4M9JA 4J9PA 3QZ8A 2OH2A 4DL5A 4MFCA 4NLKA 1Z19A 4IQTA 2JV3A 1U49A 3KZXA 9ICJA 3CNHA 4Z6CA 2E8PA 1ZQQA 3V7KA 1PK3A 3FYHA 4UAUA 1SL1A 2FMPA 2B0CA 3Q8PB 4O0IA 3UMCA 5KFCA 5L9XA 3H40A 1SB3C 1HIWA 3LDAA 2QB0A 4QNLA 2BR0A 4QJFB 4LZDA 4TQRA 2RRDA 1J97A 1ZETA 1L7MA 4ED0A 7ICKA 4FE3A 4ECQA 2QLTA 2KEYA 3EPIA 2Y1JA 4F4XA 9ICMA 3RF9A 1RYRA 5KFYA 4Y2QA 3ZDEA 1SIJA 2ZJ5A 3JPNA 9ICGA 1FFUA 4F8RA 4J9KA 3I76A 4DL2A 5AKIA 2W9CA 4JMUA 3CW2C 3N97B 1Z3EB 2KKPA 1KKXA 1V97A 1L7PA 1NK7A 5DB7A 2HMXA 2PFOA 3RRGA 1RM6C 2AGOA 2I9GA 3H8SA 1BPBA 1SL0A 4DSFA 4KLGA 3LK9A 2K8CB 4RNNA 2HW3A 1SKWA 1OXJA 2H5XA 4FO6A 1AQ6A 2H3FA 2KICA 1ZQIA 3QU2A 9ICFA 5AM5A 1X6JA 2UVRA 5DGAA 3H0RB 1NJYA 3OJSA 1NK8A 9ICNA 3NVYA 4JV2A 5J2DA 2W9MA 4GFJA 4OJ5A 2KK0A 3H4BA 2KHQA 2W9AA 4US9A 4TURA 3AMZA 3BDPA 2ZIVB 2HHQA 4DOBA 4ED7A 1URJA 5KFMA 2VKQA 5BPCA 3WU2U 5F9LA 7ICIA 4CF4A 2K60A 5DQGA 5DB9A 4B6JA 4DQSA 4P4MA 1S0NA 2BQ3A 2XY6A 5KFXA 2KHVA 3TAQA 5KG0A 3C23A 2IOHA 5J0OA 3GV7B 1N5WA 5KFKA 2KP7A 3KKAA 2HHVA 4RQ3A 4ICAA 4F4WA 5KFQA 4CDGA 9ICRA 2ZXHA 4FZNA 4TUQA 3T5JA 2C2DA 3HKZC 5ALGA 1L3TA 4PL1A 5AKZA 5AK5A 4M6WB 3JPOA 3GDXA 3SV4A 3HWTA 3IV6A 1PVPA 1V9PA 4C0ZA 4YVZA 5K4LA 4B9SA 3AU6A 7ICMA 4P2HA 2G06A 4DQQA 4J9OA 3BQ2A 3QUBA 1OW5A 3AQFA 2HOQA 4R64A 2Z7JA 4EX6A 3PW0A 2ESEA 1ZRNA 1QH9A 2KTQA 1OUQA 3E2EA 4DFMA 4PGQA 1AROP 3RB0A 1TVAA 8ICBA 3WKAA 2FMQA 1PZNA 5ALHA 5AKJA 4Y2UA 3QX7A 5AM0A 1ZQBA 2ZIVA 5D4BA 7ICQA 2Q4TA 4EZ6A 3JPQA 1ZQ1C 2E1FA 4O3QA 4BXOB 3WK7A 2BCRA 3TQ1A 3WKBA 5EE0A 3RFAA 4MHVA 5HR6A 2KFNA 1TK0A 1Q3UA 1X42A 3FM9A 5IILA 2BDPA 3TAPA 5AKHA 3F53A 3PX0A 3Q8QB 1BPZA 4RQ5A 4QZGA 3UMGA 3AL0B 2UVVA 4LJXA 4M6WA 3QEBZ 3IN5A 1U48A 5EE3A 4G3IA 2ZIUB 3BQTA 1NK4A 1SKRA 1XSNA 9ICWA 4YP3A 4I2IA 3A0HU 4EZ9A 2F2AB 5KFOA 3L5KA 4EBCA 4Q8FA 4PHEA 1C20A 2Y0SF 3EZ5A 4ECZA 1SZPA 2ASJA 1Z1BA 1IV8A 2XCPA 2OEHA 2WAQC 1S0MA 4DSJA 2ATLA 3N4MB 3MGVA 2BGWA 4J9QA 4HAIA 4P4OA 4QZFA 1ZQZA 3KKAC 2GWSA 5KFSA 2PI4A 1L5UA 2D8CA 1ZQDA 3MFIA 3EW9A 4F91B 4F3OA 1K5OA 2GO7A 3A0BU 4F71A 2JEGA 2L5YA 2KJ5A 3WKCA 1JXLA 2LYBA 1GO3F 4BXOA 2KVSA 2HHTA 2PFPA 2E8OA 5ALDA 4BJQA 4ED8A 5KFZA 2QB1A 1A77A 2R18A 3GZFA 2NRZA 1ZQFA 1N60A 4QWEA 2DBYA 4Y2JA 1B4FA 2C2EA 3M9MB 4Z6DA 3D2QA 1DXSA 2HOIA 4FS1A 4XQ8A 4RPXA 1O03A 1A6SA 1JI7A 4KLEA 2PXIA 1TFRA 4UQGA 2D6FC 4MEXA 2ZIUA 4JV1A 5G5HA 3S6JA 4QW9A 4UB3A 2XGPA 3N7RC 3PX6A 3HKZF 1KRPA 4QZIA 3QNMA 4QZ9A 1L3UA 5J0XA 4C4RA 4KLMA 5D46A 5AICA 3UQ0A 1X9MA 3RRHA 1NKEA 1X66A 2DL0A 8ICWA 1SZHA 3GIIA 8ICUA 3PW4A 3BQ7A 4PZOA 3NASA 3D6JA 3ISBA 2OWOA 2UVUA 3G6YA 2VA3A 3QU4A 1NK5A 5EWGA 2P6RA 2AHOB 4BWMA 3EUB2 1ZRMA 4G9BA 3EPGA 9ICQA 2K4EA 4XUSA 1MA7A 4A8EA 9ICHA 4DL3A 1IIPA 3H0LB 4IQWA 1QSSA 2CPRA 5E79U 3OPXA 4R65A 4Y2TA 1WG8A 4EYIB 5EE1A 5KFVA 2BQRA 5B5EU 5KFGA 2H3QA 4BDPA 8ICQA 3HRDD 3Q8RB 3TADA 3KHGA 2DF4B 1KTQA 3RJIA 4J03A 5J2EA 4R63A 4DSLA 2LKYA 4EEKA 4DL4A 2DQNB 3HP6A 4RQ7A 2PKEA 5JU5A 4CCHA 1BPXA 3UXPA 2KKVA 3OGUA 9ICAA 2Y1IA 5CP2A 2BKEA 1ZQWA 5DBBA 2GLEA 4C4TA 1XC9A 5ALSA 4DFJA 3ALRA 2ZXIA 2J6SA 1MC8A 3RR7A 5AM2A 3WK9A 3SYZA 4Z6EA 2LM1A 1XO1A 2YY6A 3T5LA 2EAMA 2E8NA 3M9NB 5CWRA 4UAYA 2R8KA 3NRWA 1J2MA 2ZUDA 2BPCA 2HBKA 4C4SA 4B9MA 3I28A 2HHXA 2HVIA 2C22A 1K1SA 5IIIA 4DF8A 1ZQSA 2EAPA 5J0SA 3SEIA 1SXEA 3ICXA 3DV9A 2KOBA 1NK0A 2FDRA 2KFZA 2YB1A 5IIOA 2VJ5A 1U9LA 4KLUA 2FLLA 1JXEA 2CXYA 3H7IA 2XY7A 2Y9UA 2MA1A 3PVXA 2BCQA 9ICIA 5KG6A 4FZMA 1S76D 4IL6U 3VCBA 4Q43A 2YMLA 4UB4A 1KSPA 3MR3A 3RTVA 9ICEA 2FPLA 9ICBA 2DGZA 4NM2A 2KIWA 4RPYA 5J2HA 5ALMA 9ICVA 3BQ0A 1SXDA 5AKYA 8ICIA 2W03A 2W04A 2K4PA 5EWFA 4NXZA 2I6XA 5J0PA 2XO7A 3UMBA 3MR5A 3PY8A 4YG2A 3QUCA 8ICTA 1N2XA 1D8YA 2LHTA 5KFJA 2VA2A 5AI9A 5L1MA 4CE6A 4YD2A 2HHWA 3IP4B 1QLNA 2B6GA 3TADC 3RAQA 2IBKA 5AKGA 1VLBA 4IRKA 2BCSA 1U45A 5AIAA 2JR5A 3VC8A 2A19A 4I29A 3ZDBA 1X9SA 3ZD8A 1DOQA 3PMLA 2VA8A 2XGQA 4CF3A 1NK9A 3LYSA 4Y2SA 4QZHA 3NTUA 3AQEA 2BDUA 5F3XB 2KJ8A 4KLOA 1S5LU 1ZQVA 2MSNA 2VJ4A 2DPJA 1DGJA 8ICLA 8ICSA 2KG5A 4JWMA 1L3SA 4O3PA 5EOZA 1ZQLA 4ECYA 2XVTA 1KBUA 4M47A 4R8UB 3ISDA 4C80A 4KLJA 2ZTCA 4FFDA 4IR1A 2Y0SC 5EWEA 2F8LA 4UARA 2GH1A 1KFDA 1ZQMA 1A0PA 4US8A 4M9GA 4QZCA 1B0XA 2ZTEA 9ICCA 8ICEA 1MQ2A 4RQ0A 3PSIA 2HVHA 3SI8A 4HYKA 1L8OA 1S97A 2DUYA 2RQ5A 1CRXA 9ICTA 4I2EA 3B9JA 4USAA 5ALLA 2F44A 5KG2A 1ECWA 4UB5A 4K4IA 2MRLA 3GV5B 3RJKA 2JXJA 3F2CA 2JH7A 5KT2A 3QU7A 2WF5A 5DDYA 4O3MA 4AP9A 3MGIA 2UVWA 2RLTA 4Y2XA 3QUQA 4MEYA 2KSOB 1T3QA 4IR9A 3PSPA 4CRXA 3N7PD 1LVHA 4YR2A 5FP0A 3FDSA 3QUTA 4NL9A 2JEFA 2V9WA 4RQ2A 1PUZA 4F93B 2KNJA 2Y9TA 4F4ZA 3CP8A 3UPQA 4ZH4A 2EAOA 2K4HA 4FZLA 4BUGA 2YMPA 2HSZA 5AHXA 3G6VA 3TARA 1TAMA 1ZQNA 1XO0A 1S10A 3RJFA 5IIMA 1SL2A 2DKZA 4YMOA 2PFNA 2KIVA 1TK5A 1D9DA 4RT3A 4ACOA 9ICUA 4UB1A 2F3NA 5H2FU 1UHUA 4R8UA 4C7ZA 5J0QA 3GQCA 2F77X 4GIBA 2RP5A 2WHEA 3IDWA 1B22A 3AM9A 3UXNA 5ALUA 4TQSA 2HDOA 3TKAA 3BS5A 4OJ6A 1X6IA 3PSFA 1JRPA 7ICGA 1RYSA 5F9NA 3JPSA 4DLEA 1ZXIA 1T3NA 1TV9A 2BQUA 4CF5A 5D49A 4ED2A 4B9UA 1HJPA 1F0MA 2HOFA 3NUQA 2YB4A 2HI0A 1BPYA 4JUZA 3BZKA 2JEIA 2V4QA 2P66A 2IHMA 2W8LA 3PW2A 3PZPA 3IG5A 4I28A 1FIQA 5BOMA 2JGAA 1H38A 2KSOA 5TZVA 1ZQUA 2LYHA 5HMMA 4ED6A 8ICOA 1Q3VA 4C8NA 1NZBA 2OM6A 3GIJA 5DQIA 2DWQA 5DBAA 5A0LA 1L3VA 4RZRA 3ETRA 5L1JA 2E5SA 5AI8A 4Z6FA 5DLGA 3F2BA 1JALA 4DFDA 2DPIA 4EBDA 4B9VA 1KFSA 1A76A 7ICUA 4M9LA 1X9WA 2HCFA 4PGYA 4QZEA 4NM1A 3KFUF 3MFHA 4BX9C 4DEZA 2LBOA 5BOLA 4O9MA 4EYHB 5B66U 5DB6A 2R8JA 3M7DA 4ZOHC 9ICSA 5CHGA 4M9NA 3TFRA 5KG1A 1XWLA 1PVRA 5DBCA 3PO5A 5KFFA 5AIBA 8ICFA 4NL9C 4NY8A 2P35A 1YZ7A 3K1RB 1UPHA 1FEZA 2NO5A 1BNPA 4DFPA 3TI0A 4DF4A 4RNMA 1VDVA 2FI1A 3FAHA 4DSIA 3IHQB 4I27A 3WKEA 3R9KA 1YZ6A 3PR5B 2KJ9A 4F5RA 1N56A 2VANA 1SV4A 1L7OA 2F1IA 5L1IA 1D9FA 2W54A
chains in the Genus database with same CATH topology
3TADA 2LPEA 1B4FA 2E8PA 5KNIA 1PK3A 2DKXA 2F8KA 2E8MA 1DXSA 1PK1B 2F44A 1WWUA 1SXDA 2QARA 4MHVA 1JI7A 5JU5A 2K4PA 2KSOA 2LMRA 3TACB 5JTIA 4RQNA 2K60A 3BS5B 2QKQA 2QB0A 2GLEA 2YTUA 2KE7A 2QARB 1WWVA 2KSOB 1UQVA 3HILA 4IS7A 1COKA 5L1MA 1KW4A 2D3DA 2B6GA 2QB0B 3TADC 1SGGA 3H8MA 2EAMA 3KKAA 4NL9A 2E8NA 1Z1VA 1X66A 2Y9TA 2DL0A 5J8YA 2EAOA 3BQ7A 1V38A 4PZOA 1V85A 2FE9A 1SV0A 1RG6A 2DKZA 1UCVA 2KIVA 2EAPA 5F3XB 2EANA 2F3NA 2KMDA 3SEIA 1SXEA 1OW5A 2KG5A 1OXJA 1LKYA 3IDWA 3KKAC 4NL9C 2D8CA 3SENA 3K1RB 4NJ8A 2ESEA 2Y9UA 3BS5A 5J8YC 2L5YA 1LKYB 1SV4A 1SV0C 1X9XA 4PZNA 2ES6A 1F0MA 2E8OA 3BS7A 1PK1A 1X40A 4RQMA 1B0XA 5JRTA 2QB1A 2JV3A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3TAD A;  2LPE A;  1B4F A;  2E8P A;  5KNI A;  1PK3 A;  2DKX A;  2F8K A;  2E8M A;  1DXS A;  1PK1 B;  2F44 A;  1WWU A;  1SXD A;  2QAR A;  4MHV A;  1JI7 A;  5JU5 A;  2K4P A;  2KSO A;  2LMR A;  3TAC B;  5JTI A;  4RQN A;  2K60 A;  3BS5 B;  2QKQ A;  2QB0 A;  2GLE A;  2YTU A;  2KE7 A;  2QAR B;  1WWV A;  2KSO B;  1UQV A;  3HIL A;  4IS7 A;  1COK A;  5L1M A;  1KW4 A;  2D3D A;  2B6G A;  2QB0 B;  3TAD C;  1SGG A;  3H8M A;  2EAM A;  3KKA A;  4NL9 A;  2E8N A;  1Z1V A;  1X66 A;  2Y9T A;  2DL0 A;  5J8Y A;  2EAO A;  3BQ7 A;  1V38 A;  4PZO A;  1V85 A;  2FE9 A;  1SV0 A;  1RG6 A;  2DKZ A;  1UCV A;  2KIV A;  2EAP A;  5F3X B;  2EAN A;  2F3N A;  2KMD A;  3SEI A;  1SXE A;  1OW5 A;  2KG5 A;  1OXJ A;  1LKY A;  3IDW A;  3KKA C;  4NL9 C;  2D8C A;  3SEN A;  3K1R B;  4NJ8 A;  2ESE A;  2Y9U A;  3BS5 A;  5J8Y C;  2L5Y A;  1LKY B;  1SV4 A;  1SV0 C;  1X9X A;  4PZN A;  2ES6 A;  1F0M A;  2E8O A;  3BS7 A;  1PK1 A;  1X40 A;  4RQM A;  1B0X A;  5JRT A;  2QB1 A;  2JV3 A; 
#chains in the Genus database with same CATH topology
 4DQP A;  2LPE A;  2IHN A;  4ECX A;  3QXG A;  3AU2 A;  5KNI A;  1Z00 B;  5AKK A;  1S8O A;  4MFF A;  1QSL A;  2DKX A;  4O3R A;  1LV5 A;  3F5A A;  1ZQA A;  4JV0 A;  1CEZ A;  3IM1 A;  1ZQH A;  1DGS A;  4NV0 A;  2LMR A;  2R8I A;  3PNC A;  2ASD A;  1UT5 A;  3CRX A;  1BPE A;  4M2Y A;  2JRZ A;  2WF7 A;  5DB8 A;  2AU0 A;  1ZQT A;  1UT8 A;  4FBT A;  4XRH A;  2EH9 A;  4ECR A;  4IS7 A;  1ZQP A;  3GIL A;  2YMM A;  1UA1 A;  4QWC A;  3IG8 A;  4I2F A;  4AYB F;  3NVW A;  2KZM A;  2EZZ A;  1F5S A;  2FPK A;  3T3F A;  1KQQ A;  3RBE A;  4UAZ A;  2ISP A;  4GXJ A;  1QTM A;  1ZQO A;  2YQE A;  4O3N A;  5C5J A;  2WF9 A;  8ICG A;  4QIW F;  4ELT A;  4F5N A;  1QCK A;  5HHI A;  1EXN A;  1V85 A;  3C21 A;  1T4G A;  2W43 A;  1UCV A;  3RR8 A;  3Q8L A;  5AI4 A;  2HBM A;  4RQ8 A;  2EAN A;  2NRT A;  1D8B A;  2IOF K;  1ZQK A;  3K75 D;  4MF2 A;  4UAT A;  3HX0 A;  1N48 A;  8ICA A;  3KHR A;  2OHF A;  4U7C A;  3C5F A;  5CJ7 A;  1MQ3 A;  3GFK B;  5IIK A;  2JZB B;  4NLN A;  1ED1 A;  2LM4 A;  1L8L A;  2K89 A;  4GLX A;  1ZD2 P;  3MAB A;  2NYV A;  5ALQ A;  1Z00 A;  5KT3 A;  4C8L A;  4KMU A;  5L1L A;  5KFB A;  2A1J B;  4K4G A;  2Q0Z X;  2CRX A;  1X40 A;  4NWI A;  4DCC A;  4PH5 A;  3T5K A;  3RJG A;  1XSL A;  2ISO A;  2GOL A;  3L3F X;  3ETL A;  7ICT A;  2G09 A;  4EEN A;  3QEA Z;  4ECW A;  4PL2 A;  3OSN A;  1ZQY A;  4KTQ A;  2DFL A;  2AJQ A;  3BQ1 A;  3WK8 A;  1J2N A;  5KG7 A;  1ZD5 A;  5JTI A;  3Q8K A;  5ALT A;  4J9R A;  4KN7 A;  3PST A;  1RPL A;  5ALI A;  2WFA A;  1NKC A;  3H0M B;  1QSY A;  4YR0 A;  4WJ3 B;  4O3O A;  3GV8 B;  2NRX A;  1JUD A;  4EEY A;  1Z4N A;  3RAX A;  3KD3 A;  5J2G A;  3SZ2 A;  2JMG A;  5DG9 A;  3SD7 A;  4UBB A;  1RXV A;  4F5P A;  1JRO A;  3RB6 A;  3THV A;  3WK6 A;  3RJJ A;  9ICP A;  1HEK A;  5J2F A;  3O0F A;  4F72 A;  3JPP A;  2BPG A;  4NLZ A;  1XS9 D;  1SV0 A;  4TUP A;  1NZP A;  3UM9 A;  1TAU A;  4KLS A;  1Y88 A;  2EDU A;  3J81 j;  2JZB A;  3V6J A;  9ICL A;  5J29 A;  4KLT A;  1NJW A;  3JPR A;  2FMS A;  5J2K A;  5KTQ A;  4DL6 A;  4KLQ A;  7ICR A;  2A1J A;  2EQY A;  5J0Y A;  5ALE A;  3C2L A;  4MFA A;  1LKY B;  2F1H A;  4KLH A;  3F2D A;  7ICJ A;  3AUO A;  3H8J A;  1LB2 B;  4YXM A;  2MUT A;  4PZN A;  3NVV A;  3C5G A;  1MSW D;  4RQM A;  2F76 X;  7ICS A;  4BWJ A;  3DEE A;  1BGX T;  3QZ7 A;  2RDI A;  2XI9 A;  2ZIW B;  1ZQE A;  4FS2 A;  4ECV A;  3N7S C;  5KG3 A;  4PGX A;  2JHD A;  2AQ4 A;  4UB2 A;  3PR4 A;  3Q8S B;  3RJH A;  3N28 A;  4QZ8 A;  5KT4 A;  3TAC B;  4OJP A;  3E0F A;  1VJ5 A;  3KBB A;  2KE7 A;  1NJZ A;  1JMS A;  3TFS A;  2EZY A;  5KL8 B;  4E0D A;  1PVQ A;  3SAG A;  2E3T A;  2ZJ8 A;  4KN4 A;  2IA6 A;  2ODG A;  4UAS A;  1TKD A;  5ALY A;  1SGG A;  5HHH A;  3MR6 A;  3H8M A;  1KFT A;  5KFI A;  5ALR A;  4CNQ A;  4RPZ A;  3OTQ A;  5J0T A;  5J2J A;  4Q8E A;  5IIN A;  2V4R A;  2WB1 C;  2BCV A;  5J8Y A;  2XID A;  3PW7 A;  5KFE A;  1DRG A;  7ICE A;  1BPD A;  5J0U A;  1SKS A;  8ICP A;  1RYU A;  4DSK A;  4IRC A;  3OHA A;  5DGB A;  2AH5 A;  4YQW A;  1D8L A;  1LKY A;  5KFH A;  2ZUC A;  4QZB A;  1U47 A;  2VIX A;  3SEN A;  4NJ8 A;  3M8S A;  1F44 A;  1JX4 A;  5EE9 A;  2O6K A;  4RQ4 A;  5ALJ A;  1HUO A;  5AKX A;  2ZIW A;  4QW8 A;  5KFN A;  3RB3 A;  4NLG A;  1SV0 C;  8ICV A;  3V7L A;  4NLC A;  5ALX A;  4F2R A;  4FBU A;  4RUC A;  3PX4 A;  3Q8M A;  4OJL A;  3M6K A;  2PMZ F;  2G07 A;  3PW5 A;  2P6U A;  1PK1 B;  2W9B B;  3AN1 A;  3RJE A;  8ICX A;  4QWD A;  3MGH A;  2XC9 A;  1C7Y A;  5T14 A;  4RQN A;  1N62 A;  2OCE A;  3BS5 B;  3QE9 Y;  2J6U A;  1ZQJ A;  5J0R A;  1KDH A;  2QAR B;  2BHN A;  2ZG6 A;  4JB3 A;  4KMO B;  9ICK A;  1COK A;  2M0N A;  4GXI A;  4CGZ A;  4GC7 A;  4I2H A;  1WYG A;  4GXK A;  5AI5 A;  3V6K A;  1NI3 A;  4F2S A;  4Y2V A;  4DQI A;  4OO1 J;  3LVW A;  4I2B A;  4DO9 A;  1DK3 A;  3M6Z A;  4F5Q A;  2C28 A;  2FE9 A;  1T8E A;  2I1Q A;  5DG8 A;  3OHB A;  5J2A A;  1XU4 A;  3SMV A;  2PI5 A;  7ICN A;  3L4P A;  2ZTD A;  5KAF U;  2W8K A;  4DQR A;  5DG7 A;  5AI6 A;  8ICK A;  5KFU A;  4PJ0 U;  4AYB C;  3KOO A;  5KT7 A;  2XIC A;  2PFQ A;  5J8Y C;  7ICF A;  5GTI U;  3TAN A;  2G5I B;  4DL7 A;  4QIW C;  2NO4 A;  2R8G A;  2KZZ A;  1COO A;  3WK5 A;  5ALN A;  3RH4 A;  1NJX A;  4J9L A;  3ZDA A;  1PK1 A;  2W9B A;  2AGQ A;  5JRT A;  1WCL A;  4KLF A;  2WF8 A;  3GU3 A;  3NGD A;  1FO4 A;  3OJU A;  4JK1 A;  3WK4 A;  2F8K A;  4DLG A;  4F92 B;  1O08 A;  3RH6 A;  2W7O A;  4KX5 A;  5C0Y A;  1WWU A;  2A1A A;  2QAR A;  2YMQ A;  1KEJ A;  3V7J A;  5JUM A;  1N61 A;  5CR0 A;  5CB1 A;  3H4D A;  4B9N A;  2QKQ A;  3C2M A;  5CRX A;  3M1Y A;  5AM3 A;  4K4H A;  1N63 A;  1WUD A;  3T5H A;  1S0O A;  4O3S A;  3C28 A;  1L6N A;  2ZUB A;  2XCA A;  2OXO A;  2WB1 F;  3K1Z A;  3C2K A;  3HIL A;  4QZD A;  1KW4 A;  2NRW A;  5DQH A;  4LZG A;  5KFA A;  5HR7 A;  3I1Y A;  3BZC A;  1NKB A;  4F4Y A;  4UB6 U;  4DS4 A;  3ZI4 A;  3D2S A;  3PV8 A;  2W3R A;  2JEJ A;  3D2N A;  7ICH A;  2FLN A;  2IOF A;  4IRD A;  1RG6 A;  8ICJ A;  3UQ2 A;  3B0Y A;  4YXJ A;  2WTF A;  3K4G A;  2HBL A;  4U6P A;  3HW8 A;  2B21 A;  3B0X A;  3CYM A;  2KD1 A;  2JH1 A;  4X5V A;  5GTH U;  4JWN A;  5KT6 A;  4P4P A;  4ECS A;  1M6Y A;  4RQ1 A;  5KFD A;  7ICL A;  1QQ7 A;  3GIM A;  4MF8 A;  4Y2P A;  4DS5 A;  5AKE A;  1Q46 A;  2BZF A;  4YR3 A;  4O5C A;  3HJE A;  2KN7 A;  3E58 A;  2FPM A;  3LVV A;  4UBC A;  1JN3 A;  5DLF A;  4UAW A;  4IQV A;  4F50 A;  2N1R A;  4IQU A;  4RT2 A;  5KG4 A;  1TK8 A;  3U26 A;  4BGD A;  4PHP A;  2WF6 A;  4YN4 A;  2AXT U;  4ED1 A;  4F4K A;  2HBJ A;  2F1J A;  5ALO A;  3ZDC A;  2YTU A;  5AI0 A;  2HHU A;  4PHD A;  5KL1 B;  1WWV A;  1IG6 A;  2LYA A;  1KL9 A;  5AM1 A;  2H3V A;  2D3D A;  1FFV A;  5KFL A;  5J0W A;  4UW9 A;  5CEH A;  4O5E A;  9ICO A;  4ELV A;  1KLN A;  1V38 A;  2I5H A;  3HPO A;  8ICZ A;  4EX7 A;  3QU5 A;  5KFR A;  1JIH A;  1MN8 A;  3NVZ A;  5ALK A;  3SQI A;  1ZJM A;  5J2B A;  4PHA A;  5DDM A;  5AK3 A;  2W11 A;  1BNO A;  1TE2 A;  4R66 A;  2KMD A;  3F5E A;  1CUK A;  5KFP A;  2K8B B;  3RH5 A;  1ZQX A;  7ICP A;  3DDH A;  3V6H A;  4YFK A;  4XA5 A;  2FJ6 A;  2OYY A;  2ASL A;  4EBE A;  4KIT B;  5TIS U;  1UA0 A;  2K8A A;  3KHH A;  3M8R A;  4I2C A;  2CN1 A;  2ZJA A;  3SR6 A;  2MU2 A;  3EYZ A;  3SV3 A;  2H3I A;  4ECT A;  2YX8 A;  4P0P B;  1U4B A;  5DKW A;  4DFK A;  4I2A A;  4RUA A;  1IM4 A;  5KFW A;  3QYP A;  4KX3 A;  2RHF A;  4M0A A;  2ZIX B;  2E8M A;  1K1Q A;  5KAI U;  2RDJ A;  1RQN A;  1WCN A;  1NOM A;  4RQ6 A;  3RB4 A;  4LVS A;  4P0Q B;  1L7N A;  1ZJN A;  1ZD3 A;  5ALZ A;  1QQ5 A;  1SWW A;  1X2I A;  5G5G A;  4PPX A;  4M04 A;  4I2J A;  3PO4 A;  8ICM A;  2M9N A;  4YD1 A;  5J2I A;  3C1Z A;  2A3V A;  4RNO A;  4I2G A;  3G6X A;  2MUT B;  2H3Z A;  7ICO A;  1DK2 A;  5KG5 A;  4KLL A;  2C2R A;  4Y2Y A;  4DOC A;  4QZA A;  3RBD A;  7ICV A;  1Z1V A;  1Z4O A;  1ZD4 A;  5AK4 A;  2G08 A;  2PMZ C;  1QQ6 A;  4Y2R A;  2BPF A;  1HUZ A;  4DOA A;  1XNS A;  3MC1 A;  8ICY A;  2W3S A;  4YCX A;  1ZQR A;  4KLD A;  1N5X A;  8ICC A;  3C29 A;  2ALZ A;  3MDA A;  2G5H B;  3KHL A;  2E1E A;  2NRV A;  5AK6 A;  2R8H A;  2J6T A;  4J9M A;  3ONN A;  3MR2 A;  4UAV A;  2EZX A;  4Q45 A;  3H8W A;  1SWV A;  5L1K A;  4OCZ A;  5ALV A;  4ED3 A;  3WKD A;  4O5K A;  5KT5 A;  4YMM A;  1TAQ A;  2NV3 A;  4NLB A;  3M9O B;  3C1Y A;  3HT3 A;  5J2C A;  1RXW A;  4ECU A;  4DSE A;  4P0P A;  1ZOL A;  5CA7 A;  2KVC A;  4OD0 A;  3ZD9 A;  4DWI A;  1X9X A;  5HNK A;  2ZIX A;  2ES6 A;  3T79 A;  9ICX A;  3BS7 A;  1NNL A;  3EWA A;  2W55 A;  3PMN A;  2G0A A;  5ALP A;  3LWL A;  4OJO A;  4GC6 A;  5IIJ A;  4P0Q A;  2BCU A;  1S9F A;  3KZI U;  8ICN A;  4C8M A;  1RZT A;  1KN5 A;  2YN4 A;  1XSP A;  4M9H A;  8ICR A;  1ZQG A;  4ELU A;  2AGP A;  5KFT A;  2KZ3 A;  2WAQ F;  4UB8 U;  3IRU A;  2LI6 A;  3KTQ A;  2MAX A;  1S77 D;  8ICH A;  4C8K A;  5AM4 A;  1T94 A;  2K4I A;  1ZYQ A;  5HP4 A;  4C8O A;  2FLP A;  3BJY A;  4KLI A;  1T7P A;  3ORY A;  1UQV A;  4IC9 A;  1BVS A;  1RQL A;  4I2D A;  3OSP A;  2QB0 B;  4QWB A;  4C7Y A;  3MDC A;  1YT3 A;  5HML A;  4B9T A;  4YMN A;  1CI4 A;  1NK6 A;  1RDF A;  3ISC A;  3GIK A;  2KV2 A;  3SAH A;  1Q8K A;  4EEL A;  5ALF A;  3ED5 A;  3QU9 A;  2W7P A;  3ZDD A;  4Q44 A;  5AKL A;  1ZQC A;  3LWM A;  4J9S A;  2AQ0 A;  1S0V A;  2W9C B;  3UXO A;  1B43 A;  1P7D A;  3SAF A;  3NS1 A;  4TUS A;  3FC4 A;  3MBY A;  4B9L A;  2HHS A;  3V72 A;  4RU9 A;  3NRZ A;  2IMW P;  3AEV A;  4J9N A;  3JPT A;  4QWA A;  1IXR A;  4F5O A;  5ALW A;  2XY5 A;  4M9J A;  4J9P A;  3QZ8 A;  2OH2 A;  4DL5 A;  4MFC A;  4NLK A;  1Z19 A;  4IQT A;  2JV3 A;  1U49 A;  3KZX A;  9ICJ A;  3CNH A;  4Z6C A;  2E8P A;  1ZQQ A;  3V7K A;  1PK3 A;  3FYH A;  4UAU A;  1SL1 A;  2FMP A;  2B0C A;  3Q8P B;  4O0I A;  3UMC A;  5KFC A;  5L9X A;  3H40 A;  1SB3 C;  1HIW A;  3LDA A;  2QB0 A;  4QNL A;  2BR0 A;  4QJF B;  4LZD A;  4TQR A;  2RRD A;  1J97 A;  1ZET A;  1L7M A;  4ED0 A;  7ICK A;  4FE3 A;  4ECQ A;  2QLT A;  2KEY A;  3EPI A;  2Y1J A;  4F4X A;  9ICM A;  3RF9 A;  1RYR A;  5KFY A;  4Y2Q A;  3ZDE A;  1SIJ A;  2ZJ5 A;  3JPN A;  9ICG A;  1FFU A;  4F8R A;  4J9K A;  3I76 A;  4DL2 A;  5AKI A;  2W9C A;  4JMU A;  3CW2 C;  3N97 B;  1Z3E B;  2KKP A;  1KKX A;  1V97 A;  1L7P A;  1NK7 A;  5DB7 A;  2HMX A;  2PFO A;  3RRG A;  1RM6 C;  2AGO A;  2I9G A;  3H8S A;  1BPB A;  1SL0 A;  4DSF A;  4KLG A;  3LK9 A;  2K8C B;  4RNN A;  2HW3 A;  1SKW A;  1OXJ A;  2H5X A;  4FO6 A;  1AQ6 A;  2H3F A;  2KIC A;  1ZQI A;  3QU2 A;  9ICF A;  5AM5 A;  1X6J A;  2UVR A;  5DGA A;  3H0R B;  1NJY A;  3OJS A;  1NK8 A;  9ICN A;  3NVY A;  4JV2 A;  5J2D A;  2W9M A;  4GFJ A;  4OJ5 A;  2KK0 A;  3H4B A;  2KHQ A;  2W9A A;  4US9 A;  4TUR A;  3AMZ A;  3BDP A;  2ZIV B;  2HHQ A;  4DOB A;  4ED7 A;  1URJ A;  5KFM A;  2VKQ A;  5BPC A;  3WU2 U;  5F9L A;  7ICI A;  4CF4 A;  2K60 A;  5DQG A;  5DB9 A;  4B6J A;  4DQS A;  4P4M A;  1S0N A;  2BQ3 A;  2XY6 A;  5KFX A;  2KHV A;  3TAQ A;  5KG0 A;  3C23 A;  2IOH A;  5J0O A;  3GV7 B;  1N5W A;  5KFK A;  2KP7 A;  3KKA A;  2HHV A;  4RQ3 A;  4ICA A;  4F4W A;  5KFQ A;  4CDG A;  9ICR A;  2ZXH A;  4FZN A;  4TUQ A;  3T5J A;  2C2D A;  3HKZ C;  5ALG A;  1L3T A;  4PL1 A;  5AKZ A;  5AK5 A;  4M6W B;  3JPO A;  3GDX A;  3SV4 A;  3HWT A;  3IV6 A;  1PVP A;  1V9P A;  4C0Z A;  4YVZ A;  5K4L A;  4B9S A;  3AU6 A;  7ICM A;  4P2H A;  2G06 A;  4DQQ A;  4J9O A;  3BQ2 A;  3QUB A;  1OW5 A;  3AQF A;  2HOQ A;  4R64 A;  2Z7J A;  4EX6 A;  3PW0 A;  2ESE A;  1ZRN A;  1QH9 A;  2KTQ A;  1OUQ A;  3E2E A;  4DFM A;  4PGQ A;  1ARO P;  3RB0 A;  1TVA A;  8ICB A;  3WKA A;  2FMQ A;  1PZN A;  5ALH A;  5AKJ A;  4Y2U A;  3QX7 A;  5AM0 A;  1ZQB A;  2ZIV A;  5D4B A;  7ICQ A;  2Q4T A;  4EZ6 A;  3JPQ A;  1ZQ1 C;  2E1F A;  4O3Q A;  4BXO B;  3WK7 A;  2BCR A;  3TQ1 A;  3WKB A;  5EE0 A;  3RFA A;  4MHV A;  5HR6 A;  2KFN A;  1TK0 A;  1Q3U A;  1X42 A;  3FM9 A;  5IIL A;  2BDP A;  3TAP A;  5AKH A;  3F53 A;  3PX0 A;  3Q8Q B;  1BPZ A;  4RQ5 A;  4QZG A;  3UMG A;  3AL0 B;  2UVV A;  4LJX A;  4M6W A;  3QEB Z;  3IN5 A;  1U48 A;  5EE3 A;  4G3I A;  2ZIU B;  3BQT A;  1NK4 A;  1SKR A;  1XSN A;  9ICW A;  4YP3 A;  4I2I A;  3A0H U;  4EZ9 A;  2F2A B;  5KFO A;  3L5K A;  4EBC A;  4Q8F A;  4PHE A;  1C20 A;  2Y0S F;  3EZ5 A;  4ECZ A;  1SZP A;  2ASJ A;  1Z1B A;  1IV8 A;  2XCP A;  2OEH A;  2WAQ C;  1S0M A;  4DSJ A;  2ATL A;  3N4M B;  3MGV A;  2BGW A;  4J9Q A;  4HAI A;  4P4O A;  4QZF A;  1ZQZ A;  3KKA C;  2GWS A;  5KFS A;  2PI4 A;  1L5U A;  2D8C A;  1ZQD A;  3MFI A;  3EW9 A;  4F91 B;  4F3O A;  1K5O A;  2GO7 A;  3A0B U;  4F71 A;  2JEG A;  2L5Y A;  2KJ5 A;  3WKC A;  1JXL A;  2LYB A;  1GO3 F;  4BXO A;  2KVS A;  2HHT A;  2PFP A;  2E8O A;  5ALD A;  4BJQ A;  4ED8 A;  5KFZ A;  2QB1 A;  1A77 A;  2R18 A;  3GZF A;  2NRZ A;  1ZQF A;  1N60 A;  4QWE A;  2DBY A;  4Y2J A;  1B4F A;  2C2E A;  3M9M B;  4Z6D A;  3D2Q A;  1DXS A;  2HOI A;  4FS1 A;  4XQ8 A;  4RPX A;  1O03 A;  1A6S A;  1JI7 A;  4KLE A;  2PXI A;  1TFR A;  4UQG A;  2D6F C;  4MEX A;  2ZIU A;  4JV1 A;  5G5H A;  3S6J A;  4QW9 A;  4UB3 A;  2XGP A;  3N7R C;  3PX6 A;  3HKZ F;  1KRP A;  4QZI A;  3QNM A;  4QZ9 A;  1L3U A;  5J0X A;  4C4R A;  4KLM A;  5D46 A;  5AIC A;  3UQ0 A;  1X9M A;  3RRH A;  1NKE A;  1X66 A;  2DL0 A;  8ICW A;  1SZH A;  3GII A;  8ICU A;  3PW4 A;  3BQ7 A;  4PZO A;  3NAS A;  3D6J A;  3ISB A;  2OWO A;  2UVU A;  3G6Y A;  2VA3 A;  3QU4 A;  1NK5 A;  5EWG A;  2P6R A;  2AHO B;  4BWM A;  3EUB 2;  1ZRM A;  4G9B A;  3EPG A;  9ICQ A;  2K4E A;  4XUS A;  1MA7 A;  4A8E A;  9ICH A;  4DL3 A;  1IIP A;  3H0L B;  4IQW A;  1QSS A;  2CPR A;  5E79 U;  3OPX A;  4R65 A;  4Y2T A;  1WG8 A;  4EYI B;  5EE1 A;  5KFV A;  2BQR A;  5B5E U;  5KFG A;  2H3Q A;  4BDP A;  8ICQ A;  3HRD D;  3Q8R B;  3TAD A;  3KHG A;  2DF4 B;  1KTQ A;  3RJI A;  4J03 A;  5J2E A;  4R63 A;  4DSL A;  2LKY A;  4EEK A;  4DL4 A;  2DQN B;  3HP6 A;  4RQ7 A;  2PKE A;  5JU5 A;  4CCH A;  1BPX A;  3UXP A;  2KKV A;  3OGU A;  9ICA A;  2Y1I A;  5CP2 A;  2BKE A;  1ZQW A;  5DBB A;  2GLE A;  4C4T A;  1XC9 A;  5ALS A;  4DFJ A;  3ALR A;  2ZXI A;  2J6S A;  1MC8 A;  3RR7 A;  5AM2 A;  3WK9 A;  3SYZ A;  4Z6E A;  2LM1 A;  1XO1 A;  2YY6 A;  3T5L A;  2EAM A;  2E8N A;  3M9N B;  5CWR A;  4UAY A;  2R8K A;  3NRW A;  1J2M A;  2ZUD A;  2BPC A;  2HBK A;  4C4S A;  4B9M A;  3I28 A;  2HHX A;  2HVI A;  2C22 A;  1K1S A;  5III A;  4DF8 A;  1ZQS A;  2EAP A;  5J0S A;  3SEI A;  1SXE A;  3ICX A;  3DV9 A;  2KOB A;  1NK0 A;  2FDR A;  2KFZ A;  2YB1 A;  5IIO A;  2VJ5 A;  1U9L A;  4KLU A;  2FLL A;  1JXE A;  2CXY A;  3H7I A;  2XY7 A;  2Y9U A;  2MA1 A;  3PVX A;  2BCQ A;  9ICI A;  5KG6 A;  4FZM A;  1S76 D;  4IL6 U;  3VCB A;  4Q43 A;  2YML A;  4UB4 A;  1KSP A;  3MR3 A;  3RTV A;  9ICE A;  2FPL A;  9ICB A;  2DGZ A;  4NM2 A;  2KIW A;  4RPY A;  5J2H A;  5ALM A;  9ICV A;  3BQ0 A;  1SXD A;  5AKY A;  8ICI A;  2W03 A;  2W04 A;  2K4P A;  5EWF A;  4NXZ A;  2I6X A;  5J0P A;  2XO7 A;  3UMB A;  3MR5 A;  3PY8 A;  4YG2 A;  3QUC A;  8ICT A;  1N2X A;  1D8Y A;  2LHT A;  5KFJ A;  2VA2 A;  5AI9 A;  5L1M A;  4CE6 A;  4YD2 A;  2HHW A;  3IP4 B;  1QLN A;  2B6G A;  3TAD C;  3RAQ A;  2IBK A;  5AKG A;  1VLB A;  4IRK A;  2BCS A;  1U45 A;  5AIA A;  2JR5 A;  3VC8 A;  2A19 A;  4I29 A;  3ZDB A;  1X9S A;  3ZD8 A;  1DOQ A;  3PML A;  2VA8 A;  2XGQ A;  4CF3 A;  1NK9 A;  3LYS A;  4Y2S A;  4QZH A;  3NTU A;  3AQE A;  2BDU A;  5F3X B;  2KJ8 A;  4KLO A;  1S5L U;  1ZQV A;  2MSN A;  2VJ4 A;  2DPJ A;  1DGJ A;  8ICL A;  8ICS A;  2KG5 A;  4JWM A;  1L3S A;  4O3P A;  5EOZ A;  1ZQL A;  4ECY A;  2XVT A;  1KBU A;  4M47 A;  4R8U B;  3ISD A;  4C80 A;  4KLJ A;  2ZTC A;  4FFD A;  4IR1 A;  2Y0S C;  5EWE A;  2F8L A;  4UAR A;  2GH1 A;  1KFD A;  1ZQM A;  1A0P A;  4US8 A;  4M9G A;  4QZC A;  1B0X A;  2ZTE A;  9ICC A;  8ICE A;  1MQ2 A;  4RQ0 A;  3PSI A;  2HVH A;  3SI8 A;  4HYK A;  1L8O A;  1S97 A;  2DUY A;  2RQ5 A;  1CRX A;  9ICT A;  4I2E A;  3B9J A;  4USA A;  5ALL A;  2F44 A;  5KG2 A;  1ECW A;  4UB5 A;  4K4I A;  2MRL A;  3GV5 B;  3RJK A;  2JXJ A;  3F2C A;  2JH7 A;  5KT2 A;  3QU7 A;  2WF5 A;  5DDY A;  4O3M A;  4AP9 A;  3MGI A;  2UVW A;  2RLT A;  4Y2X A;  3QUQ A;  4MEY A;  2KSO B;  1T3Q A;  4IR9 A;  3PSP A;  4CRX A;  3N7P D;  1LVH A;  4YR2 A;  5FP0 A;  3FDS A;  3QUT A;  4NL9 A;  2JEF A;  2V9W A;  4RQ2 A;  1PUZ A;  4F93 B;  2KNJ A;  2Y9T A;  4F4Z A;  3CP8 A;  3UPQ A;  4ZH4 A;  2EAO A;  2K4H A;  4FZL A;  4BUG A;  2YMP A;  2HSZ A;  5AHX A;  3G6V A;  3TAR A;  1TAM A;  1ZQN A;  1XO0 A;  1S10 A;  3RJF A;  5IIM A;  1SL2 A;  2DKZ A;  4YMO A;  2PFN A;  2KIV A;  1TK5 A;  1D9D A;  4RT3 A;  4ACO A;  9ICU A;  4UB1 A;  2F3N A;  5H2F U;  1UHU A;  4R8U A;  4C7Z A;  5J0Q A;  3GQC A;  2F77 X;  4GIB A;  2RP5 A;  2WHE A;  3IDW A;  1B22 A;  3AM9 A;  3UXN A;  5ALU A;  4TQS A;  2HDO A;  3TKA A;  3BS5 A;  4OJ6 A;  1X6I A;  3PSF A;  1JRP A;  7ICG A;  1RYS A;  5F9N A;  3JPS A;  4DLE A;  1ZXI A;  1T3N A;  1TV9 A;  2BQU A;  4CF5 A;  5D49 A;  4ED2 A;  4B9U A;  1HJP A;  1F0M A;  2HOF A;  3NUQ A;  2YB4 A;  2HI0 A;  1BPY A;  4JUZ A;  3BZK A;  2JEI A;  2V4Q A;  2P66 A;  2IHM A;  2W8L A;  3PW2 A;  3PZP A;  3IG5 A;  4I28 A;  1FIQ A;  5BOM A;  2JGA A;  1H38 A;  2KSO A;  5TZV A;  1ZQU A;  2LYH A;  5HMM A;  4ED6 A;  8ICO A;  1Q3V A;  4C8N A;  1NZB A;  2OM6 A;  3GIJ A;  5DQI A;  2DWQ A;  5DBA A;  5A0L A;  1L3V A;  4RZR A;  3ETR A;  5L1J A;  2E5S A;  5AI8 A;  4Z6F A;  5DLG A;  3F2B A;  1JAL A;  4DFD A;  2DPI A;  4EBD A;  4B9V A;  1KFS A;  1A76 A;  7ICU A;  4M9L A;  1X9W A;  2HCF A;  4PGY A;  4QZE A;  4NM1 A;  3KFU F;  3MFH A;  4BX9 C;  4DEZ A;  2LBO A;  5BOL A;  4O9M A;  4EYH B;  5B66 U;  5DB6 A;  2R8J A;  3M7D A;  4ZOH C;  9ICS A;  5CHG A;  4M9N A;  3TFR A;  5KG1 A;  1XWL A;  1PVR A;  5DBC A;  3PO5 A;  5KFF A;  5AIB A;  8ICF A;  4NL9 C;  4NY8 A;  2P35 A;  1YZ7 A;  3K1R B;  1UPH A;  1FEZ A;  2NO5 A;  1BNP A;  4DFP A;  3TI0 A;  4DF4 A;  4RNM A;  1VDV A;  2FI1 A;  3FAH A;  4DSI A;  3IHQ B;  4I27 A;  3WKE A;  3R9K A;  1YZ6 A;  3PR5 B;  2KJ9 A;  4F5R A;  1N56 A;  2VAN A;  1SV4 A;  1L7O A;  2F1I A;  5L1I A;  1D9F A;  2W54 A; 
#chains in the Genus database with same CATH homology
 3TAD A;  2LPE A;  1B4F A;  2E8P A;  5KNI A;  1PK3 A;  2DKX A;  2F8K A;  2E8M A;  1DXS A;  1PK1 B;  2F44 A;  1WWU A;  1SXD A;  2QAR A;  4MHV A;  1JI7 A;  5JU5 A;  2K4P A;  2KSO A;  2LMR A;  3TAC B;  5JTI A;  4RQN A;  2K60 A;  3BS5 B;  2QKQ A;  2QB0 A;  2GLE A;  2YTU A;  2KE7 A;  2QAR B;  1WWV A;  2KSO B;  1UQV A;  3HIL A;  4IS7 A;  1COK A;  5L1M A;  1KW4 A;  2D3D A;  2B6G A;  2QB0 B;  3TAD C;  1SGG A;  3H8M A;  2EAM A;  3KKA A;  4NL9 A;  2E8N A;  1Z1V A;  1X66 A;  2Y9T A;  2DL0 A;  5J8Y A;  2EAO A;  3BQ7 A;  1V38 A;  4PZO A;  1V85 A;  2FE9 A;  1SV0 A;  1RG6 A;  2DKZ A;  1UCV A;  2KIV A;  2EAP A;  5F3X B;  2EAN A;  2F3N A;  2KMD A;  3SEI A;  1SXE A;  1OW5 A;  2KG5 A;  1OXJ A;  1LKY A;  3IDW A;  3KKA C;  4NL9 C;  2D8C A;  3SEN A;  3K1R B;  4NJ8 A;  2ESE A;  2Y9U A;  3BS5 A;  5J8Y C;  2L5Y A;  1LKY B;  1SV4 A;  1SV0 C;  1X9X A;  4PZN A;  2ES6 A;  1F0M A;  2E8O A;  3BS7 A;  1PK1 A;  1X40 A;  4RQM A;  1B0X A;  5JRT A;  2QB1 A;  2JV3 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...