2K4HA

Solution structure of the hiv-2 myristoylated matrix protein
Total Genus 32
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
32
sequence length
134
structure length
134
Chain Sequence
GARNSVLRGKKADELERIRLRPGGKKKYRLKHIVWAANKLDRFGLAESLLESKEGCQKILTVLDPMVPTGSENLKSLFNTVCVIWCIHAEEKVKDTEGAKQIVRRHLVAETGTAEKMPSTSRPTAPSSEKGGNY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Structural protein
molecule keywords HIV-2 myristoylated matrix protein
publication title Structure of the myristylated human immunodeficiency virus type 2 matrix protein and the role of phosphatidylinositol-(4,5)-bisphosphate in membrane targeting.
pubmed doi rcsb
source organism Human immunodeficiency virus type 2
total genus 32
structure length 134
sequence length 134
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2008-06-08
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.90 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 DNA polymerase; domain 1 2k4hA01
1ED1A 2H3QA 4ICAA 2GOLA 2NV3A 2H3FA 2K4HA 2H3IA 1ECWA 1UPHA 2N1RA 2H3ZA 1HEKA 2HMXA 1HIWA 1L6NA 1A6SA 2LYAA 2K4EA 4JMUA 1TAMA 2JMGA 4IC9A 2LYBA 2K4IA 2H3VA
chains in the Genus database with same CATH superfamily
4O5EA 2YMPA 5AKEA 4B9VA 4EZ6A 5J0OA 3DDHA 1AQ6A 1MSWD 4F5QA 1QSSA 3HRDD 3RBDA 9ICQA 5HP4A 4ED7A 2DPIA 2KVSA 9ICMA 1Y88A 2ZIWB 3UMCA 3H4BA 3M6KA 2KHQA 3NRZA 1SXEA 2BQ3A 5DQHA 4PL2A 5L1LA 3ISCA 4NLGA 5G5GA 8ICJA 4Y2JA 1DK3A 2XVTA 4UB8U 4BWMA 3L4PA 2HHWA 4KLMA 8ICVA 3RH4A 5L1JA 3F5AA 3TACB 4WJ3B 4EX7A 4UARA 3AL0B 1NJYA 4DSKA 9ICSA 2C22A 1Q8KA 2WF8A 3UPQA 4F5NA 1TVAA 1DK2A 2Y0SF 1ZJMA 2K4HA 3LVWA 4US8A 4CE6A 5J0WA 4KLGA 1UCVA 1HEKA 3M6ZA 4KLQA 1A6SA 4UB1A 2YX8A 4UBBA 4M9LA 3LVVA 1L3SA 8ICGA 5KFRA 1TAMA 1X6JA 4DFDA 2C2RA 4Y2TA 1U49A 2OH2A 4PJ0U 4PHAA 1BNPA 3AQFA 3AEVA 4RQ4A 3PZPA 1XC9A 1OW5A 9ICBA 4DSFA 1Z19A 3IDWA 3TFRA 4KX3A 3NASA 5J29A 3NVWA 4CCHA 3GV5B 3A0BU 1SXDA 3ISDA 2W3SA 2P66A 9ICFA 4P4PA 3H4DA 1MQ3A 4NLBA 1Z3EB 5AI5A 2HDOA 4GC6A 1UT8A 1RPLA 2Y0SC 2N1RA 4KLUA 3RJJA 3MFIA 2W8KA 3V7JA 3PR5B 2HMXA 3NUQA 5AKYA 1TK8A 4DSIA 1SB3C 4Y2XA 5KFXA 3QU9A 3E2EA 1ZD5A 1S97A 3H8MA 4MFAA 1X9MA 4DQIA 2KTQA 2K60A 4Y2YA 4IR9A 1SKRA 5GTHU 3KZXA 4O3NA 2XY5A 1K1QA 1L5UA 1CEZA 5J0RA 5AKLA 4M47A 2JEFA 4Z6FA 3M9MB 2ZIXB 2W55A 3VC8A 4KLSA 5K4LA 3PSFA 2YY6A 2QB0B 5BOMA 5A0LA 5AI8A 3RJIA 5HHIA 5EE3A 2FPKA 5L1KA 4QZBA 5KT3A 1DGSA 1L7PA 1X42A 4IQUA 1Z4OA 2KIWA 3IP4B 4UB6U 4YXMA 4IRKA 4J9SA 1N62A 3LK9A 1KSPA 2VANA 4BDPA 4PH5A 3ZDCA 1NK7A 2PI4A 4YMOA 1FO4A 4B9NA 5JUMA 2ZJ8A 2KMDA 5DLFA 5KFIA 1BGXT 4OJLA 5AI9A 3V7KA 3SENA 2K8BB 5J2FA 1NK6A 3PY8A 2KZZA 4FS1A 4DFJA 2B0CA 1KKXA 3WKAA 1D8YA 1TV9A 2H3ZA 4BX9C 3IRUA 3UMGA 5KFGA 4JV0A 4KLJA 4X5VA 3SD7A 1D8BA 1RZTA 1FEZA 3FYHA 4LZGA 3F5EA 3N7RC 4ECTA 1MQ2A 3NGDA 3SAGA 4Q44A 7ICGA 2CRXA 2CN1A 4F71A 9ICTA 2P35A 4NL9C 3RJGA 1L3TA 3ED5A 5CWRA 2YMMA 3BDPA 5DGAA 2ISOA 1JMSA 4F4WA 5J0XA 3KHLA 1DOQA 4CGZA 3Q8SB 5J8YC 4XA5A 1Z00A 3RR8A 1X2IA 3C29A 2GOLA 3PMNA 1K5OA 3D2SA 3H40A 4O0IA 3V6KA 4DFKA 3PO4A 4OJPA 1L3VA 2HVIA 4RQ1A 4NWIA 2PFQA 3PX4A 5KFEA 1JIHA 1S5LU 2ZXHA 2JXJA 1S0MA 2YMQA 2BQRA 1JXLA 1MN8A 3ZDBA 2CXYA 1UQVA 5KFFA 3OJSA 1NNLA 5KFWA 2KN7A 2A3VA 4OJ6A 1WYGA 1X9WA 2F1IA 5DB6A 4B6JA 4DEZA 2F3NA 3UM9A 2NRTA 3KZIU 3JPQA 4C8NA 5KFTA 4KX5A 1T3QA 3T3FA 2F8KA 2LYHA 3F2CA 5HR7A 4ECWA 5KT5A 4C7ZA 2KKVA 2RRDA 1YZ7A 4XRHA 4DF4A 4CRXA 1JALA 3MGHA 4OCZA 4YR0A 1PVPA 4RQ6A 2ALZA 4DL3A 1ZQJA 2ZG6A 3PW2A 3KHRA 9ICKA 2FI1A 8ICTA 4TUQA 2VA3A 2BCVA 8ICWA 4ICAA 4UB5A 4QIWF 4B9MA 3C2MA 2Y9TA 1F44A 2GWSA 3ISBA 3C28A 3PR4A 2P6RA 2DL0A 3HILA 2WB1F 1XNSA 3TQ1A 3WK9A 1NKBA 2HBMA 5ALWA 5ALSA 2D3DA 1NK4A 1JXEA 2VA8A 2BCUA 7ICTA 2J6UA 3C5GA 4TUPA 1S9FA 3PMLA 3ZDDA 2E8NA 2KSOA 4ED6A 1UT5A 2XGPA 2ZIUB 1XO1A 1SIJA 3OTQA 5ALDA 3OGUA 3T5LA 2HBJA 3QEAZ 5ALJA 4EEYA 5KT7A 2JEIA 3UQ2A 5CR0A 1QSYA 4YVZA 2I9GA 4DL6A 3MDAA 3KKAA 1QLNA 1U9LA 4F4YA 3NVVA 2K8AA 1JROA 4F72A 1H38A 3TADC 2OM6A 3EWAA 4XUSA 4RQ7A 2MA1A 2WB1C 2R18A 3H8WA 1QTMA 2Y9UA 2F8LA 4M04A 3FC4A 4Q43A 3C2KA 3SV4A 3MGVA 1MA7A 2ZXIA 3QUBA 4Q8EA 5ALHA 3RB3A 3C2LA 1L3UA 2ISPA 8ICOA 4NM1A 4UAZA 1SGGA 3TAPA 3UXPA 4P2HA 4QWCA 4DFPA 4P0PA 1ED1A 3Q8KA 1LKYB 1B43A 3ZD8A 3GILA 1NK8A 2D8CA 1WUDA 2ZIVB 3JPOA 2WFAA 2PFNA 2YMLA 2JZBB 4ECXA 4R66A 2DPJA 1MC8A 1SZHA 3FAHA 1KRPA 4NJ8A 4F2SA 4RQ3A 3GDXA 1CRXA 2DWQA 5AM2A 1GO3F 5DGBA 2HHVA 2C28A 2QARA 1ZQMA 2MU2A 5AM3A 2IHNA 2Y1JA 2WF5A 2DGZA 2J6TA 1C7YA 1SZPA 4BUGA 4K4GA 5ALKA 1ZXIA 2OWOA 2O6KA 4O3SA 4CF4A 5AKZA 4DSJA 3EUB2 2F1HA 2ZIWA 3N7PD 5G5HA 8ICXA 4UAUA 3G6VA 3PV8A 3E58A 3T5JA 9ICWA 2KVCA 2PMZF 4YD2A 4QZGA 1X6IA 3PW4A 2WAQF 4PHDA 2HCFA 4DL4A 5H2FU 2JRZA 2I1QA 2EH9A 4M2YA 4BJQA 2RDIA 2JV3A 3ORYA 3BS5B 2AQ4A 1NZPA 5DG8A 2FMPA 5EOZA 4PL1A 4FFDA 4F4XA 4UASA 4EYIB 3TAQA 1RG6A 5ALRA 4IQWA 2KE7A 3RH6A 4F93B 4DWIA 8ICUA 2IMWP 3BS7A 3QUTA 2ASDA 4Y2PA 1SL2A 3I1YA 1N48A 1RYRA 4UB2A 3RB4A 5KT4A 5HNKA 8ICMA 2AU0A 3N28A 3AN1A 2A1JB 4JUZA 1L8OA 4QZCA 3AU6A 2J6SA 3KD3A 2E8MA 4C4RA 5DG9A 3PX6A 1J2NA 1PK1B 2PMZC 4TQSA 2NRZA 5B5EU 1NJXA 2LHTA 1VJ5A 5GTIU 1ZQDA 3RR7A 4FZLA 4JWNA 1S8OA 4BXOA 1F0MA 2NV3A 4O3OA 4QZIA 4M6WB 2F76X 4ECQA 2HOIA 1V38A 4DOBA 7ICIA 4Y2QA 1O03A 3BQ2A 4MEXA 8ICFA 2EAMA 4RNNA 4FS2A 1XU4A 3NS1A 4KLTA 3ZDAA 1ZD3A 3NRWA 1KFDA 1KFTA 1RQLA 4IS7A 1UHUA 5J2GA 1D9DA 5KFAA 1IM4A 4ZH4A 5AKIA 4Q45A 5EWEA 2W3RA 1SL0A 4I2CA 2XY7A 1QH9A 5ALGA 1WG8A 1AROP 4EBDA 2E3TA 2KZMA 5AK5A 2NYVA 5JU5A 5KAIU 4RZRA 3HP6A 3D6JA 1COOA 3KFUF 1TK0A 8ICIA 5KL8B 3B0XA 2JEGA 2QB0A 3D2NA 5KFHA 7ICHA 2AJQA 4RPZA 1ZYQA 3CRXA 3RFAA 5J2KA 3F2DA 1LB2B 2HHTA 4EBCA 7ICFA 2KEYA 4QZ8A 3Q8QB 3A0HU 1BPBA 4RT2A 1ZQYA 3N97B 3SEIA 5J2IA 1ZQFA 2BQUA 5L9XA 2WHEA 5ALMA 3ZD9A 4P0QB 4BWJA 2F44A 4YQWA 4UBCA 1LV5A 2ASLA 2WF6A 5AK6A 1HUZA 3WKDA 2BZFA 4QZHA 4R65A 5J0PA 2W04A 5EE0A 1TFRA 2RQ5A 5DB8A 3KOOA 1NK9A 5AI4A 3V72A 2OYYA 3QYPA 4KLOA 5KAFU 2BHNA 2PXIA 4JK1A 1ZQXA 1V97A 1ZQTA 4OD0A 3WKCA 5ALIA 2ZUDA 2QKQA 5J2AA 3MFHA 9ICXA 2K4PA 5KL1B 1TAQA 1WCNA 5AI0A 3H0LB 3MR6A 5AKGA 2UVUA 1XO0A 2ODGA 5ALUA 1UA1A 8ICEA 3TFSA 1KL9A 2OCEA 4EENA 3RBEA 3GZFA 3RB0A 5KFKA 2AH5A 3C1YA 1WCLA 3M8SA 1JN3A 3JPRA 4ZOHC 4C7YA 2HHXA 7ICQA 4GFJA 4O5CA 4RT3A 4ECZA 5KT6A 1ZRMA 3QEBZ 3TARA 1CI4A 4US9A 1SKSA 5KFDA 5L1MA 5J2CA 4IC9A 3KHGA 1DGJA 5CP2A 3BQ0A 2DUYA 4RUAA 3HT3A 5AM0A 4F50A 9ICUA 2G07A 2IOHA 2BKEA 3IM1A 2D6FC 2Y1IA 5IIMA 2V4QA 4C4TA 3RB6A 1N61A 4KN4A 2H5XA 2NO4A 4RQNA 4IQVA 4QZEA 3CW2C 4KLFA 5ALZA 3RJHA 2ZJ5A 4UQGA 2AQ0A 4JV2A 3UMBA 1FFVA 5KFBA 2BDUA 5D49A 3PNCA 2W11A 4KLLA 3OHBA 3H7IA 3M7DA 2G5IB 4ECRA 1FIQA 4QZDA 5JRTA 1YZ6A 3ZDEA 4RNMA 1ZQZA 4PPXA 5EWFA 1U48A 4GXKA 3WK6A 3N7SC 1BPZA 2BDPA 2RLTA 1C20A 2Q0ZX 2JR5A 4I28A 3I76A 3JPTA 4KMOB 3TKAA 3OJUA 2W7PA 2W9BB 1URJA 2G5HB 5KFVA 1T4GA 4FZMA 8ICYA 1HUOA 2NO5A 5AK3A 3N4MB 4IRDA 2WF7A 5DLGA 3RH5A 4O5KA 1A76A 2JHDA 3M9NB 1V85A 4LJXA 4ECUA 1ZQQA 2E1EA 4JMUA 9ICLA 2ZTDA 2ATLA 5DDMA 5CB1A 2BCSA 4NLNA 2H3QA 4M0AA 4J9PA 1X66A 3OSPA 3SR6A 4EZ9A 5KFCA 2ZTEA 9ICGA 3PO5A 3RJKA 3QU5A 1QCKA 2ZIUA 3GV8B 3V6HA 4C80A 7ICSA 3AQEA 2ESEA 2B21A 4HAIA 1IIPA 5CRXA 2AGOA 4UB3A 4DLEA 3OPXA 2FPLA 1BPYA 1K1SA 5KG0A 2KZ3A 3K1RB 3PVXA 4DCCA 4J9KA 3RAXA 1ZD4A 2MUTB 2EAPA 5CJ7A 4NLCA 3VCBA 3GIIA 3LWMA 1JUDA 4RQMA 4QZ9A 5AK4A 4JB3A 4UAVA 2HHUA 3CNHA 5ALVA 4MHVA 1ZQEA 1RXVA 1ZQWA 4DL2A 1Q3VA 9ICVA 1ZQPA 1HIWA 2KG5A 4CDGA 4XQ8A 4EBEA 5F9NA 4NXZA 4QWEA 1NOMA 5B66U 4U7CA 1Z4NA 4JWMA 4YD1A 2IOFK 4DL5A 1JI7A 2XCPA 2G06A 4YXJA 1IV8A 1Q3UA 2KFZA 8ICKA 3IV6A 1B22A 8ICBA 1IG6A 2FLNA 4FE3A 2W9CB 1LKYA 1BPXA 1RXWA 2ZIVA 3HKZF 5TZVA 3RJEA 2JZBA 4I27A 4PGXA 2OEHA 3DV9A 5T14A 4DFMA 5KFJA 4GIBA 5ALPA 3JPNA 2R8IA 2E1FA 2MSNA 4F8RA 3QU4A 5DBCA 3L3FX 1VLBA 1VDVA 2ZUBA 2FDRA 4YMNA 3CP8A 3O0FA 4F91B 1KEJA 4QIWC 1X40A 2P6UA 1QQ5A 1ZQVA 4BGDA 3K4GA 7ICPA 3E0FA 3C5FA 3QU7A 3H8JA 3PW7A 1ZQUA 3J81j 4I2HA 4ED1A 7ICVA 4F4KA 2YQEA 3SAFA 5D46A 2KNJA 2VKQA 3PW0A 3KHHA 1N60A 4ED3A 5AICA 4FBUA 4QJFB 1ZQCA 2XGQA 4C4SA 1KTQA 5ALQA 2B6GA 3HKZC 5E79U 9ICPA 2K4EA 2W43A 4UW9A 4QZFA 4R63A 2W9MA 4DQSA 4YP3A 3BS5A 5J2HA 3Q8MA 2VJ5A 2PI5A 2EDUA 4U6PA 2FMSA 4UATA 7ICRA 1L7NA 1Z1VA 7ICEA 1NJWA 4OJOA 3MDCA 2XIDA 3SMVA 5KFNA 5BPCA 1JRPA 9ICAA 2FE9A 3SZ2A 2DKZA 1ZD2P 2A1AA 1XSPA 2LMRA 2HW3A 2A1JA 8ICSA 3QXGA 2K89A 3WKBA 4DQPA 1F5SA 1SV4A 4I2EA 2LI6A 8ICAA 2HHSA 3FM9A 9ICNA 1PK1A 2Z7JA 3KBBA 4PHEA 3RRHA 4ED8A 3WU2U 2DBYA 7ICNA 4B9SA 3IN5A 8ICRA 1U47A 1L7MA 7ICKA 2FMQA 3WK5A 2H3FA 4B9TA 4M6WA 4M9NA 3PSIA 4RQ2A 2HBKA 3S6JA 2YTUA 4PGQA 4FBTA 8ICNA 4USAA 1QQ6A 4CF3A 4KN7A 1RQNA 4NL9A 1T7PA 4RQ5A 2NRVA 4ACOA 1TE2A 2IBKA 2W9AA 2BCQA 3NTUA 1N5XA 4I2JA 4JV1A 3GIKA 3T5KA 4J9OA 5J8YA 3IG8A 2VIXA 2PFPA 3GV7B 5HMLA 2W7OA 2UVVA 4GC7A 4FZNA 1X9XA 4PZOA 4DS5A 2UVRA 2LM4A 4MFFA 2AGQA 1SWVA 4J9NA 3F53A 1NK0A 2R8JA 3WK8A 5F9LA 1SV0C 4Y2UA 4RPYA 2WAQC 4P4MA 4ED2A 1S0OA 7ICOA 8ICQA 2NRWA 4F5PA 4Y2RA 4C8MA 2L5YA 5IIKA 4LZDA 4NM2A 4ECSA 2XICA 1BNOA 4KMUA 5AM4A 3RRGA 2F1JA 9ICJA 4FO6A 2OHFA 1FFUA 1WWUA 1XWLA 2OXOA 3HJEA 2HSZA 1X9SA 4R8UB 3MR2A 3RAQA 2KJ8A 4ELUA 5DQIA 4P0QA 1YT3A 2MRLA 4CF5A 3ALRA 5IILA 2BGWA 2EAOA 1COKA 5KFYA 1S77D 1LVHA 1P7DA 2AGPA 2I6XA 3PX0A 2GO7A 2YN4A 2IA6A 1KLNA 3MC1A 1ZQHA 2M0NA 4I2IA 1NKCA 1HJPA 3HX0A 2FLPA 1ZQGA 2ZTCA 5J0SA 5IINA 5ALXA 5CHGA 5IIIA 5AKJA 2WF9A 9ICHA 2ZIXA 5KFSA 5J2EA 4O3RA 3IHQB 3RJFA 5J2JA 2JH7A 5DKWA 5AHXA 3BJYA 3UXNA 7ICJA 1D8LA 1L7OA 2DQNB 1B0XA 2XI9A 4EYHB 2M9NA 2XC9A 5AKKA 3MBYA 2WTFA 5KG5A 2VA2A 3PW5A 4M9JA 5TISU 4QWDA 2HI0A 4F5RA 4KLEA 3WKEA 9ICEA 1T8EA 1NZBA 4RQ0A 1NJZA 2KV2A 4UAYA 1PZNA 4O9MA 5AM5A 1IXRA 5ALLA 4KITB 4BXOB 4C8LA 3FDSA 1XS9D 3OHAA 3SYZA 3SI8A 3TADA 4I2AA 4QW8A 4YMMA 5IIJA 5JTIA 5KG6A 3GIJA 4ECYA 2ASJA 3LWLA 1ZQIA 9ICRA 5KFOA 4R64A 2HVHA 5DG7A 5HR6A 3KKAC 2KIVA 3RTVA 1PUZA 3GFKB 2KOBA 9ICCA 4AP9A 2KICA 2EANA 3KTQA 2QLTA 4DS4A 4IL6U 4DSEA 5DBBA 4I2FA 3SAHA 4IRCA 1NK5A 4B9LA 2H3IA 4LVSA 5AKXA 3BQTA 3MR5A 3T5HA 4TURA 3ICXA 3ONNA 3OSNA 2EZZA 2XCAA 2VJ4A 5CA7A 1M6YA 1ZQSA 2HOFA 5AM1A 1B4FA 4EELA 2W9BA 5D4BA 5KFLA 4KLDA 3M1YA 3QUQA 3QUCA 3EYZA 2W8LA 4YR3A 5J0YA 5DQGA 3PSTA 1OUQA 1PK3A 1RYSA 4PGYA 5DBAA 4DSLA 4QNLA 2FPMA 2NRXA 4HYKA 5F3XB 4MF8A 5HMMA 5DB7A 4EEKA 2XY6A 5ALFA 1EXNA 3C1ZA 4GXIA 1ZQKA 4O3QA 2HOQA 1KDHA 4KLHA 3F2BA 2FLLA 1S10A 2YB1A 7ICMA 3QE9Y 3LYSA 3SQIA 5DB9A 4PHPA 4NLZA 1ZQNA 4QWBA 2RP5A 4O3MA 1QQ7A 4A8EA 1WWVA 4RQ8A 1KBUA 1BVSA 2JEJA 2LPEA 2W03A 8ICLA 2BCRA 3TANA 4ECVA 1BPEA 3ZI4A 5AKHA 2H3VA 2MUTA 4RNOA 3L5KA 4QZAA 3RF9A 7ICUA 2EZXA 2EZYA 4DOAA 4G3IA 9ICOA 2ES6A 2YB4A 1QSLA 2R8GA 5KG2A 4J9MA 4F5OA 4CNQA 5ALEA 5ALNA 1Z1BA 1S0VA 3I28A 1J2MA 1UA0A 5EWGA 2QB1A 2G08A 4F2RA 2LYBA 2LBOA 4P4OA 5IIOA 5J0UA 3C23A 1SV0A 4MF2A 2IHMA 1BPDA 2JGAA 4ELTA 4F4ZA 3K1ZA 2BR0A 2C2DA 3UXOA 3BQ1A 5KFPA 2E8OA 3U26A 1PVQA 1U4BA 2W9CA 2R8HA 2LYAA 1ZQ1C 5KT2A 3G6XA 4AYBF 3EZ5A 4YFKA 3EPIA 5KFZA 4EX6A 1D9FA 1NI3A 3LDAA 9ICIA 3IG5A 2E5SA 4KLIA 4DOCA 2Q4TA 3R9KA 1ZQOA 4DLGA 3GIMA 1ZRNA 3AU2A 3K75D 4YCXA 3Q8LA 3WK7A 5C0YA 1T94A 2ZUCA 4Z6CA 2LM1A 2AXTU 1N63A 5HHHA 4B9UA 1OXJA 2R8KA 3V6JA 4NLKA 2GH1A 2XO7A 3ETLA 5AI6A 2C2EA 1ZQAA 2DFLA 4J03A 1V9PA 2PFOA 3Q8PB 5KFUA 2PKEA 1Z00B 2E8PA 3HPOA 2KJ5A 4AYBC 4ELVA 2KP7A 2K8CB 4UAWA 3NVZA 2DF4B 2CPRA 4DQRA 1ZQRA 5KG3A 3M8RA 3HW8A 1A77A 1ZQBA 1ZOLA 4G9BA 3MR3A 3MGIA 4QW9A 1O08A 3GQCA 3M9OB 1Q46A 1KQQA 4O3PA 1U45A 4IR1A 4Y2VA 4K4HA 3SV3A 1NKEA 4DL7A 4I2GA 1DRGA 3T79A 5FP0A 4F3OA 4OO1J 4TQRA 1XSNA 4DF8A 4E0DA 4Y2SA 5EE1A 7ICLA 3JPSA 3JPPA 3G6YA 1TK5A 5BOLA 1A0PA 1S0NA 4K4IA 2F2AB 3THVA 2A19A 4YN4A 4GXJA 3C21A 8ICCA 4RPXA 4M9HA 3HWTA 5J0TA 2JH1A 4C8OA 5AIBA 5DDYA 3B0YA 2KK0A 4MFCA 3QZ8A 4M9GA 4YR2A 3BZCA 2ZJAA 4RU9A 3H8SA 4Z6DA 2JMGA 1KW4A 4ED0A 3H0MB 1DXSA 1RYUA 3QX7A 4Q8FA 1T3NA 5AIAA 1TAUA 3V7LA 1ECWA 5KFMA 8ICHA 1CUKA 4QWAA 3WK4A 1N56A 4UB4A 1RM6C 2IOFA 4C0ZA 2BPFA 3TI0A 2F77X 2G09A 4OJ5A 3NVYA 2HHQA 8ICPA 3ETRA 2KSOB 5KFQA 5J2BA 4MEYA 3BQ7A 3MABA 3QU2A 5C5JA 4J9QA 1SWWA 4Z6EA 3D2QA 2KJ9A 3AMZA 3B9JA 5L1IA 3CYMA 4NY8A 2KFNA 3DEEA 4I2BA 4I29A 2BPCA 2HBLA 5ALYA 3BZKA 5ALTA 5KNIA 2MAXA 2RDJA 2KHVA 2KD1A 1S76D 1L8LA 3UQ0A 4TUSA 2W54A 4RUCA 2V4RA 1ZQLA 2RHFA 2V9WA 3QNMA 5KTQA 4GLXA 3AUOA 2KKPA 4R8UA 1N5WA 1ZETA 5KG4A 1PVRA 2FJ6A 4C8KA 2UVWA 4J9RA 1SL1A 3EW9A 1UPHA 4J9LA 4F92B 1N2XA 2AHOB 2I5HA 1SKWA 1KFSA 3Q8RB 5ALOA 2DKXA 1XSLA 4P0PB 2EQYA 1J97A 3H0RB 1RDFA 3QZ7A 1ZJNA 5J2DA 2K4IA 5KG7A 5EE9A 1TKDA 5KG1A 4DO9A 4YG2A 1KN5A 3AM9A 3GU3A 4I2DA 2BPGA 4NV0A 2GLEA 3PSPA 1L6NA 2QARB 4DQQA 4IQTA 8ICZA 5J0QA 5CEHA 3EPGA 1JX4A 2G0AA 2LKYA 4PZNA 4KTQA
chains in the Genus database with same CATH topology
2K8BB 5HR7A 3IN5A 2H3QA 3ALRA 3RF9A 4NLBA 3SAHA 3L3FX 3MGVA 1MA7A 2H3FA 2KKVA 2H3IA 2ZXIA 4GFJA 2Y0SC 2DF4B 2CPRA 2N1RA 2RRDA 3D2QA 2H3ZA 2KJ9A 3CP8A 3O0FA 4BX9C 4CRXA 4QIWC 2YB4A 3KFUF 2HMXA 1PVPA 3NUQA 5KL8B 1P7DA 3PSIA 3CYMA 3ICXA 1D8BA 3D2NA 2HBKA 3ONNA 1Z1BA 3DEEA 2ZIUA 3E0FA 3F5EA 2ZG6A 2ZIWB 3M6KA 2KHQA 3N7RC 3CRXA 3RFAA 2HBLA 2M0NA 2G08A 2VJ4A 2LYBA 3AQEA 4IC9A 2LBOA 3SAGA 3SAFA 3F2DA 4P0PA 2KNJA 2CRXA 1ED1A 2VKQA 4ACOA 1IIPA 2HOFA 4ICAA 2G07A 2KEYA 1WUDA 1YT3A 2ZIVB 2KHVA 2JGAA 2CN1A 2KD1A 4QIWF 2D6FC 4QJFB 5CRXA 4PL2A 1F44A 3K1ZA 3OPXA 2ZIXA 1SZHA 3IG8A 1DRGA 2PMZC 3C28A 2XVTA 4AYBC 2VIXA 3T79A 4OO1J 3KZXA 1PVQA 3HKZC 2WB1F 1XNSA 2JH7A 1CRXA 3PSTA 2LYAA 2LHTA 1GO3F 2HBMA 2K4EA 4CGZA 1ZQ1C 4P0QB 3F5AA 1OUQA 4WJ3B 2RHFA 2W7OA 4NLCA 4AYBF 3VCBA 3AL0B 4FZNA 2KKPA 2DQNB 2XI9A 4FZLA 1PVRA 1A0PA 2BDUA 2ZIXB 2F2AB 2VJ5A 3VC8A 3C29A 2DGZA 2GOLA 2Y0SF 2NV3A 4U6PA 2K4HA 3IG5A 2E5SA 4QNLA 3LVWA 3D2SA 3M7DA 3F53A 2G5IB 2Q4TA 3PSFA 1UPHA 2F76X 1NZBA 2HOIA 2W04A 5A0LA 1Q3VA 2JH1A 2ZIUB 4OJPA 1HEKA 4BUGA 4OJOA 2KV2A 3M6ZA 1HIWA 1A6SA 2XIDA 2YX8A 4NWIA 5C0YA 4CDGA 2HBJA 3N7SC 1T94A 2WAQC 2OYYA 3LVVA 3SMVA 4P0PB 4U7CA 2HOQA 1TAMA 3H0RB 2JMGA 2ZXHA 3H0MB 2ZIWA 2K4IA 2OH2A 3N7PD 3F2BA 4KMOB 3AQFA 2W7PA 2G06A 1Q3UA 1URJA 2G5HB 2KIWA 2YB1A 3IP4B 4P0QA 3PZPA 4FZMA 5KL1B 2GH1A 3GU3A 2MRLA 3LYSA 3NRWA 3SQIA 2XICA 4FE3A 1ECWA 3H0LB 2KVCA 2PMZF 2A3VA 2K89A 1Z19A 4OJ6A 4NV0A 2ZIVA 3HKZF 2K8AA 4C0ZA 2WAQF 3PSPA 1XO0A 2JHDA 2RP5A 4O3MA 1L6NA 2OM6A 2OXOA 4A8EA 5HR6A 4KX3A 2MA1A 1KBUA 2F77X 2E1EA 4BJQA 2WB1C 4JMUA 2G09A 2Z7JA 2R18A 2W03A 2KJ8A 5T14A 2G0AA 4OJ5A 3GZFA 2KOBA 2KJ5A 4KX5A 2LKYA 2KICA 4PL1A 4OJLA 2F8LA 2E1FA 2K8CB 3F2CA 2H3VA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1ED1 A;  2H3Q A;  4ICA A;  2GOL A;  2NV3 A;  2H3F A;  2K4H A;  2H3I A;  1ECW A;  1UPH A;  2N1R A;  2H3Z A;  1HEK A;  2HMX A;  1HIW A;  1L6N A;  1A6S A;  2LYA A;  2K4E A;  4JMU A;  1TAM A;  2JMG A;  4IC9 A;  2LYB A;  2K4I A;  2H3V A; 
#chains in the Genus database with same CATH topology
 4O5E A;  2YMP A;  5AKE A;  4B9V A;  4EZ6 A;  5J0O A;  3DDH A;  1AQ6 A;  1MSW D;  4F5Q A;  1QSS A;  3HRD D;  3RBD A;  9ICQ A;  5HP4 A;  4ED7 A;  2DPI A;  2KVS A;  9ICM A;  1Y88 A;  2ZIW B;  3UMC A;  3H4B A;  3M6K A;  2KHQ A;  3NRZ A;  1SXE A;  2BQ3 A;  5DQH A;  4PL2 A;  5L1L A;  3ISC A;  4NLG A;  5G5G A;  8ICJ A;  4Y2J A;  1DK3 A;  2XVT A;  4UB8 U;  4BWM A;  3L4P A;  2HHW A;  4KLM A;  8ICV A;  3RH4 A;  5L1J A;  3F5A A;  3TAC B;  4WJ3 B;  4EX7 A;  4UAR A;  3AL0 B;  1NJY A;  4DSK A;  9ICS A;  2C22 A;  1Q8K A;  2WF8 A;  3UPQ A;  4F5N A;  1TVA A;  1DK2 A;  2Y0S F;  1ZJM A;  2K4H A;  3LVW A;  4US8 A;  4CE6 A;  5J0W A;  4KLG A;  1UCV A;  1HEK A;  3M6Z A;  4KLQ A;  1A6S A;  4UB1 A;  2YX8 A;  4UBB A;  4M9L A;  3LVV A;  1L3S A;  8ICG A;  5KFR A;  1TAM A;  1X6J A;  4DFD A;  2C2R A;  4Y2T A;  1U49 A;  2OH2 A;  4PJ0 U;  4PHA A;  1BNP A;  3AQF A;  3AEV A;  4RQ4 A;  3PZP A;  1XC9 A;  1OW5 A;  9ICB A;  4DSF A;  1Z19 A;  3IDW A;  3TFR A;  4KX3 A;  3NAS A;  5J29 A;  3NVW A;  4CCH A;  3GV5 B;  3A0B U;  1SXD A;  3ISD A;  2W3S A;  2P66 A;  9ICF A;  4P4P A;  3H4D A;  1MQ3 A;  4NLB A;  1Z3E B;  5AI5 A;  2HDO A;  4GC6 A;  1UT8 A;  1RPL A;  2Y0S C;  2N1R A;  4KLU A;  3RJJ A;  3MFI A;  2W8K A;  3V7J A;  3PR5 B;  2HMX A;  3NUQ A;  5AKY A;  1TK8 A;  4DSI A;  1SB3 C;  4Y2X A;  5KFX A;  3QU9 A;  3E2E A;  1ZD5 A;  1S97 A;  3H8M A;  4MFA A;  1X9M A;  4DQI A;  2KTQ A;  2K60 A;  4Y2Y A;  4IR9 A;  1SKR A;  5GTH U;  3KZX A;  4O3N A;  2XY5 A;  1K1Q A;  1L5U A;  1CEZ A;  5J0R A;  5AKL A;  4M47 A;  2JEF A;  4Z6F A;  3M9M B;  2ZIX B;  2W55 A;  3VC8 A;  4KLS A;  5K4L A;  3PSF A;  2YY6 A;  2QB0 B;  5BOM A;  5A0L A;  5AI8 A;  3RJI A;  5HHI A;  5EE3 A;  2FPK A;  5L1K A;  4QZB A;  5KT3 A;  1DGS A;  1L7P A;  1X42 A;  4IQU A;  1Z4O A;  2KIW A;  3IP4 B;  4UB6 U;  4YXM A;  4IRK A;  4J9S A;  1N62 A;  3LK9 A;  1KSP A;  2VAN A;  4BDP A;  4PH5 A;  3ZDC A;  1NK7 A;  2PI4 A;  4YMO A;  1FO4 A;  4B9N A;  5JUM A;  2ZJ8 A;  2KMD A;  5DLF A;  5KFI A;  1BGX T;  4OJL A;  5AI9 A;  3V7K A;  3SEN A;  2K8B B;  5J2F A;  1NK6 A;  3PY8 A;  2KZZ A;  4FS1 A;  4DFJ A;  2B0C A;  1KKX A;  3WKA A;  1D8Y A;  1TV9 A;  2H3Z A;  4BX9 C;  3IRU A;  3UMG A;  5KFG A;  4JV0 A;  4KLJ A;  4X5V A;  3SD7 A;  1D8B A;  1RZT A;  1FEZ A;  3FYH A;  4LZG A;  3F5E A;  3N7R C;  4ECT A;  1MQ2 A;  3NGD A;  3SAG A;  4Q44 A;  7ICG A;  2CRX A;  2CN1 A;  4F71 A;  9ICT A;  2P35 A;  4NL9 C;  3RJG A;  1L3T A;  3ED5 A;  5CWR A;  2YMM A;  3BDP A;  5DGA A;  2ISO A;  1JMS A;  4F4W A;  5J0X A;  3KHL A;  1DOQ A;  4CGZ A;  3Q8S B;  5J8Y C;  4XA5 A;  1Z00 A;  3RR8 A;  1X2I A;  3C29 A;  2GOL A;  3PMN A;  1K5O A;  3D2S A;  3H40 A;  4O0I A;  3V6K A;  4DFK A;  3PO4 A;  4OJP A;  1L3V A;  2HVI A;  4RQ1 A;  4NWI A;  2PFQ A;  3PX4 A;  5KFE A;  1JIH A;  1S5L U;  2ZXH A;  2JXJ A;  1S0M A;  2YMQ A;  2BQR A;  1JXL A;  1MN8 A;  3ZDB A;  2CXY A;  1UQV A;  5KFF A;  3OJS A;  1NNL A;  5KFW A;  2KN7 A;  2A3V A;  4OJ6 A;  1WYG A;  1X9W A;  2F1I A;  5DB6 A;  4B6J A;  4DEZ A;  2F3N A;  3UM9 A;  2NRT A;  3KZI U;  3JPQ A;  4C8N A;  5KFT A;  4KX5 A;  1T3Q A;  3T3F A;  2F8K A;  2LYH A;  3F2C A;  5HR7 A;  4ECW A;  5KT5 A;  4C7Z A;  2KKV A;  2RRD A;  1YZ7 A;  4XRH A;  4DF4 A;  4CRX A;  1JAL A;  3MGH A;  4OCZ A;  4YR0 A;  1PVP A;  4RQ6 A;  2ALZ A;  4DL3 A;  1ZQJ A;  2ZG6 A;  3PW2 A;  3KHR A;  9ICK A;  2FI1 A;  8ICT A;  4TUQ A;  2VA3 A;  2BCV A;  8ICW A;  4ICA A;  4UB5 A;  4QIW F;  4B9M A;  3C2M A;  2Y9T A;  1F44 A;  2GWS A;  3ISB A;  3C28 A;  3PR4 A;  2P6R A;  2DL0 A;  3HIL A;  2WB1 F;  1XNS A;  3TQ1 A;  3WK9 A;  1NKB A;  2HBM A;  5ALW A;  5ALS A;  2D3D A;  1NK4 A;  1JXE A;  2VA8 A;  2BCU A;  7ICT A;  2J6U A;  3C5G A;  4TUP A;  1S9F A;  3PML A;  3ZDD A;  2E8N A;  2KSO A;  4ED6 A;  1UT5 A;  2XGP A;  2ZIU B;  1XO1 A;  1SIJ A;  3OTQ A;  5ALD A;  3OGU A;  3T5L A;  2HBJ A;  3QEA Z;  5ALJ A;  4EEY A;  5KT7 A;  2JEI A;  3UQ2 A;  5CR0 A;  1QSY A;  4YVZ A;  2I9G A;  4DL6 A;  3MDA A;  3KKA A;  1QLN A;  1U9L A;  4F4Y A;  3NVV A;  2K8A A;  1JRO A;  4F72 A;  1H38 A;  3TAD C;  2OM6 A;  3EWA A;  4XUS A;  4RQ7 A;  2MA1 A;  2WB1 C;  2R18 A;  3H8W A;  1QTM A;  2Y9U A;  2F8L A;  4M04 A;  3FC4 A;  4Q43 A;  3C2K A;  3SV4 A;  3MGV A;  1MA7 A;  2ZXI A;  3QUB A;  4Q8E A;  5ALH A;  3RB3 A;  3C2L A;  1L3U A;  2ISP A;  8ICO A;  4NM1 A;  4UAZ A;  1SGG A;  3TAP A;  3UXP A;  4P2H A;  4QWC A;  4DFP A;  4P0P A;  1ED1 A;  3Q8K A;  1LKY B;  1B43 A;  3ZD8 A;  3GIL A;  1NK8 A;  2D8C A;  1WUD A;  2ZIV B;  3JPO A;  2WFA A;  2PFN A;  2YML A;  2JZB B;  4ECX A;  4R66 A;  2DPJ A;  1MC8 A;  1SZH A;  3FAH A;  1KRP A;  4NJ8 A;  4F2S A;  4RQ3 A;  3GDX A;  1CRX A;  2DWQ A;  5AM2 A;  1GO3 F;  5DGB A;  2HHV A;  2C28 A;  2QAR A;  1ZQM A;  2MU2 A;  5AM3 A;  2IHN A;  2Y1J A;  2WF5 A;  2DGZ A;  2J6T A;  1C7Y A;  1SZP A;  4BUG A;  4K4G A;  5ALK A;  1ZXI A;  2OWO A;  2O6K A;  4O3S A;  4CF4 A;  5AKZ A;  4DSJ A;  3EUB 2;  2F1H A;  2ZIW A;  3N7P D;  5G5H A;  8ICX A;  4UAU A;  3G6V A;  3PV8 A;  3E58 A;  3T5J A;  9ICW A;  2KVC A;  2PMZ F;  4YD2 A;  4QZG A;  1X6I A;  3PW4 A;  2WAQ F;  4PHD A;  2HCF A;  4DL4 A;  5H2F U;  2JRZ A;  2I1Q A;  2EH9 A;  4M2Y A;  4BJQ A;  2RDI A;  2JV3 A;  3ORY A;  3BS5 B;  2AQ4 A;  1NZP A;  5DG8 A;  2FMP A;  5EOZ A;  4PL1 A;  4FFD A;  4F4X A;  4UAS A;  4EYI B;  3TAQ A;  1RG6 A;  5ALR A;  4IQW A;  2KE7 A;  3RH6 A;  4F93 B;  4DWI A;  8ICU A;  2IMW P;  3BS7 A;  3QUT A;  2ASD A;  4Y2P A;  1SL2 A;  3I1Y A;  1N48 A;  1RYR A;  4UB2 A;  3RB4 A;  5KT4 A;  5HNK A;  8ICM A;  2AU0 A;  3N28 A;  3AN1 A;  2A1J B;  4JUZ A;  1L8O A;  4QZC A;  3AU6 A;  2J6S A;  3KD3 A;  2E8M A;  4C4R A;  5DG9 A;  3PX6 A;  1J2N A;  1PK1 B;  2PMZ C;  4TQS A;  2NRZ A;  5B5E U;  1NJX A;  2LHT A;  1VJ5 A;  5GTI U;  1ZQD A;  3RR7 A;  4FZL A;  4JWN A;  1S8O A;  4BXO A;  1F0M A;  2NV3 A;  4O3O A;  4QZI A;  4M6W B;  2F76 X;  4ECQ A;  2HOI A;  1V38 A;  4DOB A;  7ICI A;  4Y2Q A;  1O03 A;  3BQ2 A;  4MEX A;  8ICF A;  2EAM A;  4RNN A;  4FS2 A;  1XU4 A;  3NS1 A;  4KLT A;  3ZDA A;  1ZD3 A;  3NRW A;  1KFD A;  1KFT A;  1RQL A;  4IS7 A;  1UHU A;  5J2G A;  1D9D A;  5KFA A;  1IM4 A;  4ZH4 A;  5AKI A;  4Q45 A;  5EWE A;  2W3R A;  1SL0 A;  4I2C A;  2XY7 A;  1QH9 A;  5ALG A;  1WG8 A;  1ARO P;  4EBD A;  2E3T A;  2KZM A;  5AK5 A;  2NYV A;  5JU5 A;  5KAI U;  4RZR A;  3HP6 A;  3D6J A;  1COO A;  3KFU F;  1TK0 A;  8ICI A;  5KL8 B;  3B0X A;  2JEG A;  2QB0 A;  3D2N A;  5KFH A;  7ICH A;  2AJQ A;  4RPZ A;  1ZYQ A;  3CRX A;  3RFA A;  5J2K A;  3F2D A;  1LB2 B;  2HHT A;  4EBC A;  7ICF A;  2KEY A;  4QZ8 A;  3Q8Q B;  3A0H U;  1BPB A;  4RT2 A;  1ZQY A;  3N97 B;  3SEI A;  5J2I A;  1ZQF A;  2BQU A;  5L9X A;  2WHE A;  5ALM A;  3ZD9 A;  4P0Q B;  4BWJ A;  2F44 A;  4YQW A;  4UBC A;  1LV5 A;  2ASL A;  2WF6 A;  5AK6 A;  1HUZ A;  3WKD A;  2BZF A;  4QZH A;  4R65 A;  5J0P A;  2W04 A;  5EE0 A;  1TFR A;  2RQ5 A;  5DB8 A;  3KOO A;  1NK9 A;  5AI4 A;  3V72 A;  2OYY A;  3QYP A;  4KLO A;  5KAF U;  2BHN A;  2PXI A;  4JK1 A;  1ZQX A;  1V97 A;  1ZQT A;  4OD0 A;  3WKC A;  5ALI A;  2ZUD A;  2QKQ A;  5J2A A;  3MFH A;  9ICX A;  2K4P A;  5KL1 B;  1TAQ A;  1WCN A;  5AI0 A;  3H0L B;  3MR6 A;  5AKG A;  2UVU A;  1XO0 A;  2ODG A;  5ALU A;  1UA1 A;  8ICE A;  3TFS A;  1KL9 A;  2OCE A;  4EEN A;  3RBE A;  3GZF A;  3RB0 A;  5KFK A;  2AH5 A;  3C1Y A;  1WCL A;  3M8S A;  1JN3 A;  3JPR A;  4ZOH C;  4C7Y A;  2HHX A;  7ICQ A;  4GFJ A;  4O5C A;  4RT3 A;  4ECZ A;  5KT6 A;  1ZRM A;  3QEB Z;  3TAR A;  1CI4 A;  4US9 A;  1SKS A;  5KFD A;  5L1M A;  5J2C A;  4IC9 A;  3KHG A;  1DGJ A;  5CP2 A;  3BQ0 A;  2DUY A;  4RUA A;  3HT3 A;  5AM0 A;  4F50 A;  9ICU A;  2G07 A;  2IOH A;  2BKE A;  3IM1 A;  2D6F C;  2Y1I A;  5IIM A;  2V4Q A;  4C4T A;  3RB6 A;  1N61 A;  4KN4 A;  2H5X A;  2NO4 A;  4RQN A;  4IQV A;  4QZE A;  3CW2 C;  4KLF A;  5ALZ A;  3RJH A;  2ZJ5 A;  4UQG A;  2AQ0 A;  4JV2 A;  3UMB A;  1FFV A;  5KFB A;  2BDU A;  5D49 A;  3PNC A;  2W11 A;  4KLL A;  3OHB A;  3H7I A;  3M7D A;  2G5I B;  4ECR A;  1FIQ A;  4QZD A;  5JRT A;  1YZ6 A;  3ZDE A;  4RNM A;  1ZQZ A;  4PPX A;  5EWF A;  1U48 A;  4GXK A;  3WK6 A;  3N7S C;  1BPZ A;  2BDP A;  2RLT A;  1C20 A;  2Q0Z X;  2JR5 A;  4I28 A;  3I76 A;  3JPT A;  4KMO B;  3TKA A;  3OJU A;  2W7P A;  2W9B B;  1URJ A;  2G5H B;  5KFV A;  1T4G A;  4FZM A;  8ICY A;  1HUO A;  2NO5 A;  5AK3 A;  3N4M B;  4IRD A;  2WF7 A;  5DLG A;  3RH5 A;  4O5K A;  1A76 A;  2JHD A;  3M9N B;  1V85 A;  4LJX A;  4ECU A;  1ZQQ A;  2E1E A;  4JMU A;  9ICL A;  2ZTD A;  2ATL A;  5DDM A;  5CB1 A;  2BCS A;  4NLN A;  2H3Q A;  4M0A A;  4J9P A;  1X66 A;  3OSP A;  3SR6 A;  4EZ9 A;  5KFC A;  2ZTE A;  9ICG A;  3PO5 A;  3RJK A;  3QU5 A;  1QCK A;  2ZIU A;  3GV8 B;  3V6H A;  4C80 A;  7ICS A;  3AQE A;  2ESE A;  2B21 A;  4HAI A;  1IIP A;  5CRX A;  2AGO A;  4UB3 A;  4DLE A;  3OPX A;  2FPL A;  1BPY A;  1K1S A;  5KG0 A;  2KZ3 A;  3K1R B;  3PVX A;  4DCC A;  4J9K A;  3RAX A;  1ZD4 A;  2MUT B;  2EAP A;  5CJ7 A;  4NLC A;  3VCB A;  3GII A;  3LWM A;  1JUD A;  4RQM A;  4QZ9 A;  5AK4 A;  4JB3 A;  4UAV A;  2HHU A;  3CNH A;  5ALV A;  4MHV A;  1ZQE A;  1RXV A;  1ZQW A;  4DL2 A;  1Q3V A;  9ICV A;  1ZQP A;  1HIW A;  2KG5 A;  4CDG A;  4XQ8 A;  4EBE A;  5F9N A;  4NXZ A;  4QWE A;  1NOM A;  5B66 U;  4U7C A;  1Z4N A;  4JWM A;  4YD1 A;  2IOF K;  4DL5 A;  1JI7 A;  2XCP A;  2G06 A;  4YXJ A;  1IV8 A;  1Q3U A;  2KFZ A;  8ICK A;  3IV6 A;  1B22 A;  8ICB A;  1IG6 A;  2FLN A;  4FE3 A;  2W9C B;  1LKY A;  1BPX A;  1RXW A;  2ZIV A;  3HKZ F;  5TZV A;  3RJE A;  2JZB A;  4I27 A;  4PGX A;  2OEH A;  3DV9 A;  5T14 A;  4DFM A;  5KFJ A;  4GIB A;  5ALP A;  3JPN A;  2R8I A;  2E1F A;  2MSN A;  4F8R A;  3QU4 A;  5DBC A;  3L3F X;  1VLB A;  1VDV A;  2ZUB A;  2FDR A;  4YMN A;  3CP8 A;  3O0F A;  4F91 B;  1KEJ A;  4QIW C;  1X40 A;  2P6U A;  1QQ5 A;  1ZQV A;  4BGD A;  3K4G A;  7ICP A;  3E0F A;  3C5F A;  3QU7 A;  3H8J A;  3PW7 A;  1ZQU A;  3J81 j;  4I2H A;  4ED1 A;  7ICV A;  4F4K A;  2YQE A;  3SAF A;  5D46 A;  2KNJ A;  2VKQ A;  3PW0 A;  3KHH A;  1N60 A;  4ED3 A;  5AIC A;  4FBU A;  4QJF B;  1ZQC A;  2XGQ A;  4C4S A;  1KTQ A;  5ALQ A;  2B6G A;  3HKZ C;  5E79 U;  9ICP A;  2K4E A;  2W43 A;  4UW9 A;  4QZF A;  4R63 A;  2W9M A;  4DQS A;  4YP3 A;  3BS5 A;  5J2H A;  3Q8M A;  2VJ5 A;  2PI5 A;  2EDU A;  4U6P A;  2FMS A;  4UAT A;  7ICR A;  1L7N A;  1Z1V A;  7ICE A;  1NJW A;  4OJO A;  3MDC A;  2XID A;  3SMV A;  5KFN A;  5BPC A;  1JRP A;  9ICA A;  2FE9 A;  3SZ2 A;  2DKZ A;  1ZD2 P;  2A1A A;  1XSP A;  2LMR A;  2HW3 A;  2A1J A;  8ICS A;  3QXG A;  2K89 A;  3WKB A;  4DQP A;  1F5S A;  1SV4 A;  4I2E A;  2LI6 A;  8ICA A;  2HHS A;  3FM9 A;  9ICN A;  1PK1 A;  2Z7J A;  3KBB A;  4PHE A;  3RRH A;  4ED8 A;  3WU2 U;  2DBY A;  7ICN A;  4B9S A;  3IN5 A;  8ICR A;  1U47 A;  1L7M A;  7ICK A;  2FMQ A;  3WK5 A;  2H3F A;  4B9T A;  4M6W A;  4M9N A;  3PSI A;  4RQ2 A;  2HBK A;  3S6J A;  2YTU A;  4PGQ A;  4FBT A;  8ICN A;  4USA A;  1QQ6 A;  4CF3 A;  4KN7 A;  1RQN A;  4NL9 A;  1T7P A;  4RQ5 A;  2NRV A;  4ACO A;  1TE2 A;  2IBK A;  2W9A A;  2BCQ A;  3NTU A;  1N5X A;  4I2J A;  4JV1 A;  3GIK A;  3T5K A;  4J9O A;  5J8Y A;  3IG8 A;  2VIX A;  2PFP A;  3GV7 B;  5HML A;  2W7O A;  2UVV A;  4GC7 A;  4FZN A;  1X9X A;  4PZO A;  4DS5 A;  2UVR A;  2LM4 A;  4MFF A;  2AGQ A;  1SWV A;  4J9N A;  3F53 A;  1NK0 A;  2R8J A;  3WK8 A;  5F9L A;  1SV0 C;  4Y2U A;  4RPY A;  2WAQ C;  4P4M A;  4ED2 A;  1S0O A;  7ICO A;  8ICQ A;  2NRW A;  4F5P A;  4Y2R A;  4C8M A;  2L5Y A;  5IIK A;  4LZD A;  4NM2 A;  4ECS A;  2XIC A;  1BNO A;  4KMU A;  5AM4 A;  3RRG A;  2F1J A;  9ICJ A;  4FO6 A;  2OHF A;  1FFU A;  1WWU A;  1XWL A;  2OXO A;  3HJE A;  2HSZ A;  1X9S A;  4R8U B;  3MR2 A;  3RAQ A;  2KJ8 A;  4ELU A;  5DQI A;  4P0Q A;  1YT3 A;  2MRL A;  4CF5 A;  3ALR A;  5IIL A;  2BGW A;  2EAO A;  1COK A;  5KFY A;  1S77 D;  1LVH A;  1P7D A;  2AGP A;  2I6X A;  3PX0 A;  2GO7 A;  2YN4 A;  2IA6 A;  1KLN A;  3MC1 A;  1ZQH A;  2M0N A;  4I2I A;  1NKC A;  1HJP A;  3HX0 A;  2FLP A;  1ZQG A;  2ZTC A;  5J0S A;  5IIN A;  5ALX A;  5CHG A;  5III A;  5AKJ A;  2WF9 A;  9ICH A;  2ZIX A;  5KFS A;  5J2E A;  4O3R A;  3IHQ B;  3RJF A;  5J2J A;  2JH7 A;  5DKW A;  5AHX A;  3BJY A;  3UXN A;  7ICJ A;  1D8L A;  1L7O A;  2DQN B;  1B0X A;  2XI9 A;  4EYH B;  2M9N A;  2XC9 A;  5AKK A;  3MBY A;  2WTF A;  5KG5 A;  2VA2 A;  3PW5 A;  4M9J A;  5TIS U;  4QWD A;  2HI0 A;  4F5R A;  4KLE A;  3WKE A;  9ICE A;  1T8E A;  1NZB A;  4RQ0 A;  1NJZ A;  2KV2 A;  4UAY A;  1PZN A;  4O9M A;  5AM5 A;  1IXR A;  5ALL A;  4KIT B;  4BXO B;  4C8L A;  3FDS A;  1XS9 D;  3OHA A;  3SYZ A;  3SI8 A;  3TAD A;  4I2A A;  4QW8 A;  4YMM A;  5IIJ A;  5JTI A;  5KG6 A;  3GIJ A;  4ECY A;  2ASJ A;  3LWL A;  1ZQI A;  9ICR A;  5KFO A;  4R64 A;  2HVH A;  5DG7 A;  5HR6 A;  3KKA C;  2KIV A;  3RTV A;  1PUZ A;  3GFK B;  2KOB A;  9ICC A;  4AP9 A;  2KIC A;  2EAN A;  3KTQ A;  2QLT A;  4DS4 A;  4IL6 U;  4DSE A;  5DBB A;  4I2F A;  3SAH A;  4IRC A;  1NK5 A;  4B9L A;  2H3I A;  4LVS A;  5AKX A;  3BQT A;  3MR5 A;  3T5H A;  4TUR A;  3ICX A;  3ONN A;  3OSN A;  2EZZ A;  2XCA A;  2VJ4 A;  5CA7 A;  1M6Y A;  1ZQS A;  2HOF A;  5AM1 A;  1B4F A;  4EEL A;  2W9B A;  5D4B A;  5KFL A;  4KLD A;  3M1Y A;  3QUQ A;  3QUC A;  3EYZ A;  2W8L A;  4YR3 A;  5J0Y A;  5DQG A;  3PST A;  1OUQ A;  1PK3 A;  1RYS A;  4PGY A;  5DBA A;  4DSL A;  4QNL A;  2FPM A;  2NRX A;  4HYK A;  5F3X B;  4MF8 A;  5HMM A;  5DB7 A;  4EEK A;  2XY6 A;  5ALF A;  1EXN A;  3C1Z A;  4GXI A;  1ZQK A;  4O3Q A;  2HOQ A;  1KDH A;  4KLH A;  3F2B A;  2FLL A;  1S10 A;  2YB1 A;  7ICM A;  3QE9 Y;  3LYS A;  3SQI A;  5DB9 A;  4PHP A;  4NLZ A;  1ZQN A;  4QWB A;  2RP5 A;  4O3M A;  1QQ7 A;  4A8E A;  1WWV A;  4RQ8 A;  1KBU A;  1BVS A;  2JEJ A;  2LPE A;  2W03 A;  8ICL A;  2BCR A;  3TAN A;  4ECV A;  1BPE A;  3ZI4 A;  5AKH A;  2H3V A;  2MUT A;  4RNO A;  3L5K A;  4QZA A;  3RF9 A;  7ICU A;  2EZX A;  2EZY A;  4DOA A;  4G3I A;  9ICO A;  2ES6 A;  2YB4 A;  1QSL A;  2R8G A;  5KG2 A;  4J9M A;  4F5O A;  4CNQ A;  5ALE A;  5ALN A;  1Z1B A;  1S0V A;  3I28 A;  1J2M A;  1UA0 A;  5EWG A;  2QB1 A;  2G08 A;  4F2R A;  2LYB A;  2LBO A;  4P4O A;  5IIO A;  5J0U A;  3C23 A;  1SV0 A;  4MF2 A;  2IHM A;  1BPD A;  2JGA A;  4ELT A;  4F4Z A;  3K1Z A;  2BR0 A;  2C2D A;  3UXO A;  3BQ1 A;  5KFP A;  2E8O A;  3U26 A;  1PVQ A;  1U4B A;  2W9C A;  2R8H A;  2LYA A;  1ZQ1 C;  5KT2 A;  3G6X A;  4AYB F;  3EZ5 A;  4YFK A;  3EPI A;  5KFZ A;  4EX6 A;  1D9F A;  1NI3 A;  3LDA A;  9ICI A;  3IG5 A;  2E5S A;  4KLI A;  4DOC A;  2Q4T A;  3R9K A;  1ZQO A;  4DLG A;  3GIM A;  1ZRN A;  3AU2 A;  3K75 D;  4YCX A;  3Q8L A;  3WK7 A;  5C0Y A;  1T94 A;  2ZUC A;  4Z6C A;  2LM1 A;  2AXT U;  1N63 A;  5HHH A;  4B9U A;  1OXJ A;  2R8K A;  3V6J A;  4NLK A;  2GH1 A;  2XO7 A;  3ETL A;  5AI6 A;  2C2E A;  1ZQA A;  2DFL A;  4J03 A;  1V9P A;  2PFO A;  3Q8P B;  5KFU A;  2PKE A;  1Z00 B;  2E8P A;  3HPO A;  2KJ5 A;  4AYB C;  4ELV A;  2KP7 A;  2K8C B;  4UAW A;  3NVZ A;  2DF4 B;  2CPR A;  4DQR A;  1ZQR A;  5KG3 A;  3M8R A;  3HW8 A;  1A77 A;  1ZQB A;  1ZOL A;  4G9B A;  3MR3 A;  3MGI A;  4QW9 A;  1O08 A;  3GQC A;  3M9O B;  1Q46 A;  1KQQ A;  4O3P A;  1U45 A;  4IR1 A;  4Y2V A;  4K4H A;  3SV3 A;  1NKE A;  4DL7 A;  4I2G A;  1DRG A;  3T79 A;  5FP0 A;  4F3O A;  4OO1 J;  4TQR A;  1XSN A;  4DF8 A;  4E0D A;  4Y2S A;  5EE1 A;  7ICL A;  3JPS A;  3JPP A;  3G6Y A;  1TK5 A;  5BOL A;  1A0P A;  1S0N A;  4K4I A;  2F2A B;  3THV A;  2A19 A;  4YN4 A;  4GXJ A;  3C21 A;  8ICC A;  4RPX A;  4M9H A;  3HWT A;  5J0T A;  2JH1 A;  4C8O A;  5AIB A;  5DDY A;  3B0Y A;  2KK0 A;  4MFC A;  3QZ8 A;  4M9G A;  4YR2 A;  3BZC A;  2ZJA A;  4RU9 A;  3H8S A;  4Z6D A;  2JMG A;  1KW4 A;  4ED0 A;  3H0M B;  1DXS A;  1RYU A;  3QX7 A;  4Q8F A;  1T3N A;  5AIA A;  1TAU A;  3V7L A;  1ECW A;  5KFM A;  8ICH A;  1CUK A;  4QWA A;  3WK4 A;  1N56 A;  4UB4 A;  1RM6 C;  2IOF A;  4C0Z A;  2BPF A;  3TI0 A;  2F77 X;  2G09 A;  4OJ5 A;  3NVY A;  2HHQ A;  8ICP A;  3ETR A;  2KSO B;  5KFQ A;  5J2B A;  4MEY A;  3BQ7 A;  3MAB A;  3QU2 A;  5C5J A;  4J9Q A;  1SWW A;  4Z6E A;  3D2Q A;  2KJ9 A;  3AMZ A;  3B9J A;  5L1I A;  3CYM A;  4NY8 A;  2KFN A;  3DEE A;  4I2B A;  4I29 A;  2BPC A;  2HBL A;  5ALY A;  3BZK A;  5ALT A;  5KNI A;  2MAX A;  2RDJ A;  2KHV A;  2KD1 A;  1S76 D;  1L8L A;  3UQ0 A;  4TUS A;  2W54 A;  4RUC A;  2V4R A;  1ZQL A;  2RHF A;  2V9W A;  3QNM A;  5KTQ A;  4GLX A;  3AUO A;  2KKP A;  4R8U A;  1N5W A;  1ZET A;  5KG4 A;  1PVR A;  2FJ6 A;  4C8K A;  2UVW A;  4J9R A;  1SL1 A;  3EW9 A;  1UPH A;  4J9L A;  4F92 B;  1N2X A;  2AHO B;  2I5H A;  1SKW A;  1KFS A;  3Q8R B;  5ALO A;  2DKX A;  1XSL A;  4P0P B;  2EQY A;  1J97 A;  3H0R B;  1RDF A;  3QZ7 A;  1ZJN A;  5J2D A;  2K4I A;  5KG7 A;  5EE9 A;  1TKD A;  5KG1 A;  4DO9 A;  4YG2 A;  1KN5 A;  3AM9 A;  3GU3 A;  4I2D A;  2BPG A;  4NV0 A;  2GLE A;  3PSP A;  1L6N A;  2QAR B;  4DQQ A;  4IQT A;  8ICZ A;  5J0Q A;  5CEH A;  3EPG A;  1JX4 A;  2G0A A;  2LKY A;  4PZN A;  4KTQ A; 
#chains in the Genus database with same CATH homology
 2K8B B;  5HR7 A;  3IN5 A;  2H3Q A;  3ALR A;  3RF9 A;  4NLB A;  3SAH A;  3L3F X;  3MGV A;  1MA7 A;  2H3F A;  2KKV A;  2H3I A;  2ZXI A;  4GFJ A;  2Y0S C;  2DF4 B;  2CPR A;  2N1R A;  2RRD A;  3D2Q A;  2H3Z A;  2KJ9 A;  3CP8 A;  3O0F A;  4BX9 C;  4CRX A;  4QIW C;  2YB4 A;  3KFU F;  2HMX A;  1PVP A;  3NUQ A;  5KL8 B;  1P7D A;  3PSI A;  3CYM A;  3ICX A;  1D8B A;  3D2N A;  2HBK A;  3ONN A;  1Z1B A;  3DEE A;  2ZIU A;  3E0F A;  3F5E A;  2ZG6 A;  2ZIW B;  3M6K A;  2KHQ A;  3N7R C;  3CRX A;  3RFA A;  2HBL A;  2M0N A;  2G08 A;  2VJ4 A;  2LYB A;  3AQE A;  4IC9 A;  2LBO A;  3SAG A;  3SAF A;  3F2D A;  4P0P A;  2KNJ A;  2CRX A;  1ED1 A;  2VKQ A;  4ACO A;  1IIP A;  2HOF A;  4ICA A;  2G07 A;  2KEY A;  1WUD A;  1YT3 A;  2ZIV B;  2KHV A;  2JGA A;  2CN1 A;  2KD1 A;  4QIW F;  2D6F C;  4QJF B;  5CRX A;  4PL2 A;  1F44 A;  3K1Z A;  3OPX A;  2ZIX A;  1SZH A;  3IG8 A;  1DRG A;  2PMZ C;  3C28 A;  2XVT A;  4AYB C;  2VIX A;  3T79 A;  4OO1 J;  3KZX A;  1PVQ A;  3HKZ C;  2WB1 F;  1XNS A;  2JH7 A;  1CRX A;  3PST A;  2LYA A;  2LHT A;  1GO3 F;  2HBM A;  2K4E A;  4CGZ A;  1ZQ1 C;  4P0Q B;  3F5A A;  1OUQ A;  4WJ3 B;  2RHF A;  2W7O A;  4NLC A;  4AYB F;  3VCB A;  3AL0 B;  4FZN A;  2KKP A;  2DQN B;  2XI9 A;  4FZL A;  1PVR A;  1A0P A;  2BDU A;  2ZIX B;  2F2A B;  2VJ5 A;  3VC8 A;  3C29 A;  2DGZ A;  2GOL A;  2Y0S F;  2NV3 A;  4U6P A;  2K4H A;  3IG5 A;  2E5S A;  4QNL A;  3LVW A;  3D2S A;  3M7D A;  3F53 A;  2G5I B;  2Q4T A;  3PSF A;  1UPH A;  2F76 X;  1NZB A;  2HOI A;  2W04 A;  5A0L A;  1Q3V A;  2JH1 A;  2ZIU B;  4OJP A;  1HEK A;  4BUG A;  4OJO A;  2KV2 A;  3M6Z A;  1HIW A;  1A6S A;  2XID A;  2YX8 A;  4NWI A;  5C0Y A;  4CDG A;  2HBJ A;  3N7S C;  1T94 A;  2WAQ C;  2OYY A;  3LVV A;  3SMV A;  4P0P B;  4U7C A;  2HOQ A;  1TAM A;  3H0R B;  2JMG A;  2ZXH A;  3H0M B;  2ZIW A;  2K4I A;  2OH2 A;  3N7P D;  3F2B A;  4KMO B;  3AQF A;  2W7P A;  2G06 A;  1Q3U A;  1URJ A;  2G5H B;  2KIW A;  2YB1 A;  3IP4 B;  4P0Q A;  3PZP A;  4FZM A;  5KL1 B;  2GH1 A;  3GU3 A;  2MRL A;  3LYS A;  3NRW A;  3SQI A;  2XIC A;  4FE3 A;  1ECW A;  3H0L B;  2KVC A;  2PMZ F;  2A3V A;  2K89 A;  1Z19 A;  4OJ6 A;  4NV0 A;  2ZIV A;  3HKZ F;  2K8A A;  4C0Z A;  2WAQ F;  3PSP A;  1XO0 A;  2JHD A;  2RP5 A;  4O3M A;  1L6N A;  2OM6 A;  2OXO A;  4A8E A;  5HR6 A;  4KX3 A;  2MA1 A;  1KBU A;  2F77 X;  2E1E A;  4BJQ A;  2WB1 C;  4JMU A;  2G09 A;  2Z7J A;  2R18 A;  2W03 A;  2KJ8 A;  5T14 A;  2G0A A;  4OJ5 A;  3GZF A;  2KOB A;  2KJ5 A;  4KX5 A;  2LKY A;  2KIC A;  4PL1 A;  4OJL A;  2F8L A;  2E1F A;  2K8C B;  3F2C A;  2H3V A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...