2OYYA

Hthp: a hexameric tyrosine-coordinated heme protein
Total Genus 30
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
30
sequence length
71
structure length
71
Chain Sequence
TWLPTLVTATPQEGFDLAVKLSRIAVKKTQPDAQVRDTLRAVYEKDANALIAVSAVVATHFQTIAAANDYW
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title HTHP: A Novel Class of Hexameric, Tyrosine-coordinated Heme Proteins
pubmed doi rcsb
source organism Silicibacter pomeroyi
molecule tags Unknown function
molecule keywords Hexameric cytochrome
total genus 30
structure length 71
sequence length 71
chains with identical sequence B, C, D, E, F, G, H
ec nomenclature
pdb deposition date 2007-02-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF11534 HTHP Hexameric tyrosine-coordinated heme protein (HTHP)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.500 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 DNA polymerase; domain 1 2oyyA00
2OYYA
chains in the Genus database with same CATH superfamily
3TARA 3KHLA 4MFCA 3KHRA 3THVA 1QQ7A 2B21A 4Y2YA 8ICXA 1AQ6A 3BQTA 3KKAC 5G5HA 5HMMA 4DSJA 3M6ZA 4KMUA 3BQ1A 4CF4A 4F93B 4ECSA 4OCZA 2P6RA 1KRPA 1RDFA 4QZBA 2HVHA 1S97A 2V4QA 5KFAA 2KJ5A 3AL0B 1T8EA 3GIKA 3SV3A 4ECRA 8ICLA 3BS5B 2W7PA 2OH2A 4IR9A 3D6JA 9ICCA 4Z6EA 4PHAA 5CWRA 5KFUA 4TURA 4C7ZA 4EZ9A 5AKIA 2Y1IA 2K4EA 5AM2A 3RB0A 1HUZA 3TACB 1PVPA 2ZIXA 1MA7A 3Q8LA 3H8JA 4G3IA 4IC9A 4FZLA 4Y2QA 3SENA 3N4MB 2HHVA 3NASA 2PMZF 1KSPA 4DF4A 1NJWA 5IIIA 5ALRA 5ALTA 1N56A 2A19A 5ALXA 5AI0A 3PW5A 1ZQRA 3EPGA 3H8SA 5AKKA 5AHXA 2BPGA 7ICJA 4CF3A 5DQHA 8ICOA 2XI9A 7ICEA 4R8UA 3R9KA 1N63A 5KFHA 4K4IA 1PK3A 1UCVA 5IIMA 1KQQA 5KFZA 4C4TA 1IIPA 4RQ1A 1FFUA 2M9NA 3EWAA 4QZAA 1X9SA 1KLNA 4I2HA 3GILA 1ZQLA 3GZFA 4J9MA 4ECUA 2NRZA 5J0TA 1UT8A 3H8MA 5J0RA 4YQWA 5HMLA 4NWIA 3M7DA 2WHEA 4C8MA 4BJQA 3ZD9A 3RAXA 1CRXA 4PH5A 1OW5A 3GQCA 4UB2A 4F5QA 3PW0A 3ETLA 4UBBA 8ICTA 2MAXA 2NRWA 4DSKA 4CGZA 2EZYA 4R63A 4TUQA 1PVQA 3QU7A 4F4YA 3RJGA 3HX0A 2ZG6A 1SKRA 4QZHA 2Y9TA 2HBJA 1NK8A 3SI8A 2PXIA 3WU2U 1ZJMA 4GFJA 4UASA 4ELUA 4RUAA 3M6KA 4R64A 3IN5A 1SKWA 5JTIA 5B66U 1YT3A 3GV5B 2E8NA 4NLGA 1ZQWA 2BDUA 2BKEA 1ZQEA 4Q45A 8ICZA 4MFAA 7ICFA 4J03A 4ECVA 3WK6A 5AKHA 4UQGA 3HW8A 5DQIA 7ICMA 2W9AA 1C20A 5ALDA 4Y2SA 3NS1A 2UVUA 4J9NA 3IHQB 4UB1A 5IILA 4DOBA 3JPRA 3KHHA 4AYBC 5KFWA 1PK1B 2RLTA 3VCBA 4DL4A 4MEYA 1RXWA 4F4WA 3UPQA 1L6NA 1F0MA 1JALA 2VKQA 2EANA 1K5OA 1T94A 3PSFA 4YCXA 1D8YA 2BCUA 5ALYA 2JR5A 2HI0A 4RNMA 5AK4A 4Y2VA 4MF8A 2BPFA 2G5HB 2ASLA 2IOFA 1BGXT 4BGDA 4NLNA 3RJHA 4MFFA 2A1AA 5JRTA 2K4PA 4F5NA 2JMGA 9ICNA 5ALZA 4KLDA 2D3DA 1FO4A 8ICKA 2RHFA 4C8OA 8ICWA 2F8LA 4B9TA 2F1IA 4RQ8A 9ICWA 1P7DA 2H3QA 3K1RB 3QZ8A 2LHTA 4IR1A 1LKYA 1N2XA 3G6YA 2I5HA 3TQ1A 5JUMA 2ESEA 2Y0SF 4I27A 3QX7A 5KFVA 2FMQA 4F4ZA 1A6SA 1DOQA 3ALRA 1BVSA 2AU0A 5DQGA 3PW7A 2OXOA 1QQ5A 1X40A 4RQ4A 3KBBA 2NO5A 4F4XA 2ZTDA 3L5KA 4YG2A 4O3OA 4QWCA 4YFKA 3DEEA 1U4BA 2ODGA 3SYZA 5ALQA 4DFPA 1S9FA 1YZ6A 2N1RA 3KZIU 2KJ9A 4RQ5A 1ZRMA 1XSNA 3TAPA 4NL9C 3GV7B 3C2LA 1WCNA 2VA8A 1DRGA 4RQ3A 1T3QA 8ICMA 9ICEA 4M47A 2IA6A 1NJZA 2K4HA 9ICMA 2EAMA 1JRPA 5KG5A 4EYIB 4ED2A 3RJIA 3V72A 4UAYA 3LDAA 2KD1A 2Y0SC 5KNIA 1ZJNA 5HHIA 1XSLA 3KHGA 4PL2A 3CRXA 4KTQA 5HR7A 8ICGA 3CW2C 2Q4TA 1KFTA 1JI7A 3HJEA 5KG2A 4IL6U 3RBEA 4BXOB 4U6PA 2BDPA 4TQSA 4YMOA 1HUOA 1K1QA 3NVZA 2KKPA 2MRLA 2QLTA 4IQTA 3TKAA 7ICGA 2HBKA 1N5WA 3RAQA 2K89A 2KVSA 1SGGA 4C8LA 7ICSA 4IRCA 1QCKA 3K75D 1NJYA 1L7NA 2I9GA 2YB1A 3ISDA 2HMXA 4UBCA 2ISOA 4J9KA 1ZQZA 5TISU 5CB1A 1KDHA 2LMRA 4F91B 1ZQBA 2ZIUB 2DWQA 5AKEA 3BS7A 4NLZA 3WK9A 1ZQVA 5J29A 1U49A 3ZDBA 5AKXA 1ZQKA 1AROP 2XGPA 2EH9A 4UB5A 2ZTEA 3M9NB 3MDCA 2ZJ5A 5KG3A 4OJLA 1UPHA 4UAUA 1ZQCA 2JXJA 4RQ0A 5DGAA 4O5EA 4DO9A 2W04A 4CNQA 4JMUA 3BS5A 9ICAA 3EPIA 2LM4A 4DL2A 4EBDA 7ICUA 1ZD2P 3KOOA 8ICPA 1IM4A 1X66A 4DEZA 8ICQA 1JN3A 4M9JA 5J2IA 4ED8A 4EBEA 3GU3A 4GLXA 2D6FC 4J9OA 1S10A 2ES6A 5FP0A 3EZ5A 3WK8A 1BPYA 5J0YA 3B0XA 2UVRA 1U47A 2JH1A 5ALSA 2HHUA 2LM1A 5KFTA 4NLBA 3F2BA 3H4BA 9ICHA 3WKDA 1VDVA 4OD0A 3Q8QB 3NVWA 2EZXA 3MC1A 5KL8B 4NJ8A 2DPJA 1KKXA 2ZIVA 8ICRA 1S5LU 3LWMA 4O3NA 4EX6A 5DDMA 5ALJA 1Y88A 2PI5A 8ICEA 4RQ2A 1JMSA 1IG6A 2HVIA 3JPTA 2HOIA 3NTUA 4QZIA 3AU6A 4NY8A 8ICAA 2HHXA 5DGBA 2KOBA 2E1EA 2QB0B 2MUTB 3GDXA 1ZQDA 4RZRA 2KKVA 4P4PA 4F92B 3V7KA 2JEGA 2FLPA 5J0XA 4RPZA 5AM5A 3CYMA 4RQ6A 3JPSA 3N7PD 3ZDEA 4ED0A 1ZQGA 1SXDA 1V97A 5KAFU 1HJPA 5DG9A 5HHHA 5KFDA 3RTVA 8ICIA 1ZYQA 4QW9A 3H0MB 2K8BB 3RJKA 5KT6A 3HP6A 1COKA 1ZQXA 3E2EA 5AI9A 4MHVA 4FZNA 3AEVA 1BPXA 2AGQA 3ETRA 5J0WA 4M9LA 5AK6A 2Y1JA 2R8KA 1BNPA 5ALNA 4I2GA 3Q8RB 2H3VA 3PR5B 1ZQFA 2KJ8A 1JROA 1S8OA 4RQMA 1Z1BA 3OJUA 3Q8MA 3I28A 2VJ5A 4DWIA 1DGJA 3LVVA 1ZETA 2W8KA 3EUB2 3Q8KA 9ICGA 2F76X 2B6GA 4JV1A 2OYYA 2NV3A 1LV5A 3B9JA 4RPXA 2YMPA 2JHDA 1XO0A 4UAZA 5BOMA 4EBCA 4O3QA 3QYPA 2OHFA 2J6TA 4B9NA 1PZNA 2JGAA 3G6VA 1NOMA 5HR6A 3JPNA 3AMZA 2CN1A 3C28A 1KN5A 2EQYA 2BQUA 7ICKA 3F5EA 2GWSA 8ICJA 5KFKA 4JWNA 5EE9A 4KLSA 3OTQA 5DB7A 4J9SA 4UB4A 4EEYA 1ZQHA 2PFOA 2W55A 3BDPA 4ELTA 3IDWA 2A3VA 1F5SA 4NL9A 4TUPA 3AM9A 4QZFA 2E8OA 3PW4A 4QNLA 1Z4OA 3PMNA 4M9NA 1VLBA 1BPEA 4RT2A 4PZOA 3ZDDA 4F3OA 2KZMA 3PSIA 4DF8A 5DBBA 3GIIA 2PFPA 4J9QA 5AIBA 5EWGA 1RYRA 3H8WA 2ATLA 2C2EA 4R66A 2JEFA 2P35A 4RNNA 2A1JB 5ALOA 2PKEA 5DBCA 1X9MA 1SIJA 3MDAA 5KG7A 1ZD3A 3RH5A 2JZBA 3NVYA 4ECZA 1NKCA 2BHNA 3NUQA 2W54A 1UT5A 1B0XA 5ALWA 3ZD8A 1MN8A 1DK3A 2NRVA 3V6HA 1V85A 2A1JA 4O3SA 5KT3A 4FO6A 8ICFA 4KLMA 1SWVA 2MA1A 5KT4A 1J2NA 3NRZA 5J2CA 3KKAA 3QU5A 4RNOA 4JV2A 4UB6U 3QUBA 3UMBA 1WWUA 2XVTA 2EZZA 5AM0A 3MR2A 2I1QA 5AM3A 2KHVA 2W43A 2KSOB 5ALPA 4UARA 4YMMA 2E8MA 4OJ6A 1SKSA 3RR7A 5AKJA 1KTQA 4F71A 4PGYA 1A77A 2MSNA 5J8YC 5A0LA 3D2QA 2W3SA 1ZQSA 2IHMA 3M8RA 5DLFA 1JXLA 3Q8PB 2UVWA 1ZQMA 3N97B 1D8LA 4ACOA 4DFJA 1ZQ1C 3ZDCA 4JK1A 4PGQA 4B9LA 8ICVA 2L5YA 3PX6A 1ZD4A 3N7SC 4JV0A 1X9WA 3PO4A 2XICA 5KFLA 3LK9A 2HW3A 4QJFB 2QB1A 4DFDA 1ZQPA 4ZOHC 3SAGA 2KIVA 5F9LA 3KFUF 5J2FA 3AQFA 3F2DA 5KFIA 2AXTU 2KEYA 3C5GA 3C2KA 3OSPA 4JWMA 9ICPA 1U45A 3BQ2A 5AI4A 1JUDA 3ZI4A 1L5UA 4QWBA 4YXMA 3H0LB 2J6SA 5KAIU 2RRDA 4XQ8A 4QIWF 1JX4A 1L3UA 1KBUA 2FLLA 2GOLA 1NK0A 1NJXA 1LB2B 3AUOA 5ALKA 5J2KA 2K4IA 3I76A 4DL5A 4EELA 2R8IA 5J2BA 2Z7JA 2Y9UA 4QZ9A 2W9CA 4ZH4A 2BZFA 4C8NA 2FDRA 2JZBB 4PHDA 3ZDAA 4B6JA 2V4RA 2F44A 4USAA 2KFNA 2H3FA 2W9BA 3C29A 4Y2RA 1XS9D 1L3VA 4IRDA 2QARB 4ECXA 4EEKA 4KN4A 1QSLA 4KLJA 4Y2PA 1HIWA 4ECQA 3CP8A 3C1ZA 1XWLA 2OM6A 4U7CA 1ZQTA 3EW9A 5J0OA 2ZIWA 3MABA 5AI5A 3FC4A 3OHAA 5D4BA 1Z00A 1FEZA 2AHOB 2OWOA 2HBLA 3RH6A 2K8AA 3M9MB 1FFVA 3RR8A 1K1SA 4I29A 2DL0A 1J2MA 2KICA 4DOAA 3HT3A 2XCAA 4AP9A 2HHSA 4I2BA 4KLGA 3T5LA 5KG1A 3MR3A 1KFDA 1H38A 4DQPA 4GC6A 2CRXA 5DDYA 5KFBA 3ICXA 4GXJA 2WF7A 2LYAA 4ELVA 5HNKA 2KHQA 4KN7A 1Q3UA 1DK2A 5TZVA 4R8UB 3FAHA 4UAVA 3RB4A 3GIJA 4ECTA 2RDJA 2WAQC 7ICHA 4I2CA 4QW8A 1TE2A 4RPYA 3C23A 1SZHA 1M6YA 2XC9A 3A0BU 3RF9A 1BPBA 4MF2A 5KL1B 1NK6A 1TV9A 2WAQF 2NO4A 2XO7A 1N62A 4YN4A 4P0QB 9ICUA 3MR6A 2RDIA 5AM4A 5J0QA 1O03A 2E5SA 4LZGA 4B9UA 2WF9A 3ONNA 2HDOA 3M1YA 4C0ZA 4OJ5A 5J2JA 4PZNA 2OCEA 1ZQQA 3WKCA 2F1JA 1RG6A 2F2AB 3RB3A 3BJYA 2FPKA 1RPLA 3QNMA 3HRDD 5KFOA 5DB9A 1RYSA 3MFHA 2JRZA 4P0PB 4KLUA 5DG7A 1UA0A 1TAQA 3OJSA 3DV9A 2IOHA 5AKGA 2FE9A 1GO3F 4DLGA 4I2IA 5EWFA 3A0HU 2R8HA 2ZIUA 4X5VA 1S77D 1QSYA 4BUGA 5DKWA 2FPLA 4ECWA 2GLEA 3GFKB 5KFNA 4UB3A 4BXOA 3HILA 5AKLA 2ZXIA 4DL6A 1N5XA 3H4DA 4RU9A 1ECWA 4YR0A 2R8GA 2DGZA 4DS4A 1S0VA 3T5HA 2ASDA 4NV0A 4P2HA 2K60A 2FMSA 1IXRA 4QWDA 2C2RA 3V6JA 1JIHA 3T5JA 2FJ6A 1SL1A 2DKXA 4IS7A 3QE9Y 4CE6A 3UQ2A 3L3FX 4AYBF 4FZMA 2W8LA 4KX5A 2BCQA 2BCRA 1D9DA 3RH4A 3WKEA 4PHEA 5L1IA 1L3TA 5DG8A 3L4PA 3MBYA 2JH7A 1NK9A 2UVVA 3MGHA 1QSSA 9ICQA 4NM1A 2VA2A 4FE3A 4RUCA 5KFFA 2YY6A 4YR2A 2E1FA 4G9BA 2DQNB 1RYUA 1N60A 3IM1A 1QTMA 4PPXA 4Q44A 4GXIA 5H2FU 3M8SA 3T3FA 1B43A 4O0IA 3JPOA 1F44A 4ED3A 1RQNA 4BWMA 1SL0A 4DFKA 4F5RA 2PI4A 5KG4A 5ALEA 1XSPA 4NLCA 1L7PA 3BQ7A 2HHWA 1V38A 3QXGA 3HKZF 4KLTA 2XY7A 1ZQIA 1WWVA 2LYHA 3H7IA 5CRXA 4ED6A 2XCPA 2F8KA 4J9RA 3SR6A 4TUSA 4KX3A 9ICLA 2HOQA 5GTIU 4M0AA 4M2YA 2VIXA 4LJXA 1SV0C 4C7YA 5KG6A 4Z6FA 3LVWA 3AU2A 5DB6A 2H3ZA 3D2SA 3ORYA 2KK0A 4M9GA 2AJQA 4O9MA 9ICOA 5IIOA 3UM9A 3JPPA 4FS2A 2GH1A 2PMZC 2F3NA 3TADC 4CF5A 2KZZA 4ICAA 4PL1A 3PV8A 3RBDA 1SV0A 4KMOB 4F72A 3F2CA 4US9A 1PK1A 3PVXA 3MFIA 2ZUCA 2DBYA 4I2AA 2KG5A 1L7MA 1S0OA 1QQ6A 3SQIA 2PFNA 9ICRA 5CP2A 1Z4NA 1FIQA 2XIDA 2JEIA 2C22A 3TAQA 2ZIXB 4Y2XA 4DL3A 7ICVA 2RQ5A 3MR5A 1CUKA 4I28A 5KT2A 1U48A 1RZTA 2YMLA 3UQ0A 4F5PA 5KFYA 1NK5A 5KFGA 1TKDA 3H0RB 3V7JA 3PSPA 5JU5A 1URJA 4RQNA 3SEIA 3OGUA 2BCVA 2OEHA 4O3RA 7ICOA 2AGPA 2EDUA 2LBOA 9ICFA 7ICTA 3VC8A 1B4FA 2IOFK 5D46A 5C5JA 2V9WA 4F2RA 1DGSA 3BZKA 2VA3A 3C5FA 3C1YA 4EX7A 2YB4A 3H40A 8ICCA 3DDHA 3C2MA 4OO1J 3SV4A 3K4GA 2ZXHA 1UA1A 4Y2TA 5AI6A 1L7OA 3OHBA 4DQSA 5KT5A 4QZGA 1Z19A 5KFQA 2G09A 3MGIA 1TK5A 5AI8A 1T4GA 5KFXA 4EYHB 5KFRA 5EE0A 4F50A 8ICNA 2ZJ8A 2LPEA 4KLHA 4YD2A 2R18A 2CXYA 1KL9A 3GIMA 4B9SA 1ZRNA 4QWEA 7ICIA 2NRXA 4NM2A 3D2NA 5J0SA 1KFSA 3NGDA 4F2SA 2KMDA 5AK5A 3PO5A 2DKZA 2E8PA 4J9LA 4KLFA 3IP4B 4IQWA 9ICTA 4CDGA 2KN7A 4KLIA 3TFSA 1S0NA 1X6JA 2ASJA 1OXJA 2GO7A 3BZCA 2ZJAA 4O5CA 4Z6DA 5AM1A 3QUCA 2QARA 5F3XB 3RRHA 3E58A 2KIWA 1SZPA 1TK8A 3AQEA 1WUDA 5ALHA 2HHQA 5IIKA 3PZPA 5KFMA 2AQ4A 1SWWA 5KFSA 4Z6CA 3WKAA 1NI3A 1ZOLA 1PVRA 4XUSA 4CRXA 4Q43A 3TADA 4QZCA 4UAWA 1PUZA 4UW9A 3QEBZ 1X6IA 3SD7A 5L1MA 3T5KA 1MSWD 4UATA 1BNOA 2AQ0A 1S0MA 3KZXA 2WF5A 4WJ3B 1EXNA 2W7OA 2BQRA 3IG5A 3IV6A 5IINA 4FBUA 5J2HA 4ED7A 1V9PA 2LYBA 2FI1A 1MQ3A 1RQLA 1RXVA 3ISBA 5EOZA 4K4GA 1VJ5A 4KITB 1C7YA 4QZ8A 3LWLA 1ZQJA 5ALGA 2ZUBA 3BQ0A 1QLNA 1NNLA 4BX9C 2HCFA 2XGQA 5AICA 2KNJA 1COOA 8ICSA 1CEZA 4QZEA 4KLLA 4PHPA 1XC9A 2RP5A 2IHNA 3QZ7A 2W9MA 5KFCA 5KTQA 2M0NA 4ECYA 3TI0A 3PR4A 1Q8KA 5ALFA 1NK4A 5KFJA 4DSIA 1WYGA 1SV4A 3K1ZA 2BQ3A 1ZQUA 4ED1A 1SL2A 3FM9A 4C8KA 1JXEA 4O3PA 3QEAZ 1NKBA 5J2GA 4F5OA 5EE1A 1T3NA 1A0PA 4TQRA 4IQVA 4RT3A 4DSLA 9ICIA 5ALUA 4JUZA 2LKYA 3KTQA 3PX0A 3UXNA 3TANA 1T7PA 5EWEA 1KEJA 4NLKA 4QWAA 4I2DA 2KFZA 4R65A 3QU2A 4DQQA 4YMNA 3QU9A 7ICQA 1X2IA 1LVHA 5B5EU 3HKZC 1TVAA 4LVSA 4P0QA 2IBKA 2VJ4A 1LKYB 3PNCA 1ZD5A 4O3MA 2R8JA 2H5XA 2BCSA 2NRTA 1D9FA 1S76D 5HP4A 3LYSA 3IRUA 2I6XA 1UQVA 3HPOA 9ICBA 2KZ3A 2FLNA 5J2EA 5KFPA 4BWJA 5L1KA 1X42A 2G5IB 1NK7A 3O0FA 2AH5A 5ALVA 4HYKA 3SAFA 5AIAA 4YXJA 1ZQAA 4OJPA 5F9NA 2AGOA 4KLQA 5ALLA 2NYVA 1L3SA 2KVCA 9ICKA 2C2DA 1DXSA 1QH9A 2G07A 2G08A 4DFMA 2F1HA 3SZ2A 2G06A 5CR0A 1WCLA 3WK4A 4DLEA 1ED1A 4DOCA 3NVVA 3N28A 1U9LA 1ZQYA 2EAPA 4DSFA 4OJOA 4DS5A 3RRGA 2ZIVB 1XNSA 9ICXA 2YQEA 3SMVA 5J2DA 2O6KA 3QUTA 3GV8B 2W3RA 3NRWA 4FBTA 3QUQA 8ICBA 2HOFA 4YD1A 1NZBA 3WK7A 5IIJA 2K8CB 7ICNA 1NZPA 4XA5A 4NXZA 1XO1A 5ALMA 3UMGA 3Q8SB 4Y2UA 1HEKA 4GXKA 2YMMA 4M6WA 3C21A 3V7LA 2BR0A 3UMCA 3G6XA 1N61A 5AKYA 2B0CA 2YTUA 1ZQNA 2DPIA 1TAMA 4FS1A 4LZDA 5AKZA 2YX8A 2W03A 7ICLA 4JB3A 3N7RC 4M6WB 4M9HA 4PGXA 3UXOA 3SAHA 4C80A 1SXEA 3WK5A 2WTFA 2JEJA 2P66A 4KLEA 4EENA 2PFQA 1RM6C 1TFRA 1UHUA 2DFLA 2KV2A 4B9MA 5BOLA 9ICJA 1TAUA 2QKQA 3U26A 3EYZA 4E0DA 4KLOA 4C4SA 2YMQA 3RJJA 4Q8FA 4P4MA 3ED5A 4A8EA 2J6UA 2EAOA 2CPRA 4YP3A 4BDPA 3M9OB 1BPZA 3RFAA 5K4LA 9ICSA 2JV3A 4Q8EA 5J0PA 3MGVA 8ICYA 2WB1F 1O08A 3S6JA 4RQ7A 2XY6A 5CJ7A 4DQRA 2BPCA 5L1LA 5KG0A 2E3TA 2W9CB 2HBMA 5EE3A 2WF6A 1N48A 1ZQOA 2ALZA 4I2FA 3PX4A 3WKBA 7ICRA 5KFEA 4P4OA 2IMWP 1B22A 3OSNA 2W9BB 2ZTCA 3T79A 4PJ0U 5CHGA 2MU2A 4F4KA 1TK0A 4CCHA 2XY5A 3KD3A 4US8A 3OPXA 5CA7A 1SB3C 2LI6A 4MEXA 2BGWA 5DB8A 3TFRA 5DBAA 5DLGA 3FDSA 5J2AA 2YN4A 3RJEA 4YR3A 2P6UA 2FPMA 3HWTA 3B0YA 4GIBA 4YVZA 4QIWC 2ZIWB 5KT7A 2HSZA 1KW4A 3E0FA 1J97A 2D8CA 2KSOA 4FFDA 1Z1VA 1OUQA 1Z00B 5T14A 2KTQA 2H3IA 2MUTA 2Q0ZX 4I2EA 2WF8A 1X9XA 1MQ2A 5E79U 4B9VA 2VANA 4DCCA 1NKEA 8ICHA 5ALIA 3PMLA 2FMPA 2WFAA 1ZXIA 2W11A 2KP7A 1YZ7A 4O5KA 4DL7A 2DF4B 4M04A 3F5AA 4K4HA 3ISCA 3PSTA 5CEHA 4J9PA 9ICVA 2G0AA 3FYHA 2QB0A 5AK3A 1BPDA 3J81j 2HHTA 3JPQA 3I1YA 2DUYA 4IRKA 5G5GA 4UB8U 4QZDA 7ICPA 4HAIA 1XU4A 4IQUA 1IV8A 3UXPA 3CNHA 5GTHU 5L9XA 3PW2A 3V6KA 4C4RA 1MC8A 4XRHA 1L8LA 2F77X 3PY8A 2ZUDA 1Q3VA 4F8RA 5J0UA 4DQIA 3IG8A 4DSEA 2C28A 1A76A 5BPCA 4GC7A 4EZ6A 2KE7A 3RB6A 1WG8A 4I2JA 5C0YA 1D8BA 2ISPA 5J8YA 4P0PA 1L8OA 3F53A 1CI4A 4Y2JA 5D49A 3RJFA 3AN1A 1Q46A 8ICUA 5L1JA 1Z3EB 2WB1C 3QU4A
chains in the Genus database with same CATH topology
2W04A 2KICA 4QIWC 2ZIWB 2LBOA 4NWIA 2G5HB 3HKZC 3M7DA 3E0FA 4CRXA 4JMUA 2ZXIA 4P0QA 3SAHA 3VC8A 4BJQA 2VJ4A 4KX3A 1OUQA 2HOQA 5T14A 1CRXA 3M6ZA 2H3VA 4O3MA 1ECWA 2KJ8A 3KZXA 2KV2A 2VIXA 3H0LB 4WJ3B 2CRXA 2H3IA 2JMGA 2RRDA 2KD1A 3LYSA 2Y0SC 2W7OA 1Z1BA 2DGZA 3IG5A 3ICXA 4QIWF 2RHFA 1KBUA 2LYAA 2F8LA 4CGZA 2G5IB 3O0FA 2YB4A 4PL2A 2GOLA 3NUQA 3LVWA 4NV0A 3CRXA 2VJ5A 5HR7A 2LYBA 3SAFA 2KJ5A 2Q4TA 2KHQA 2K4IA 3GU3A 3LVVA 1PVQA 2D6FC 3AL0B 1Q3UA 4OO1J 4OJPA 4A8EA 2H3ZA 2ZG6A 3D2SA 2ZXHA 2W7PA 2F76X 4U6PA 2DF4B 1P7DA 2OH2A 2H3QA 3F5AA 2Z7JA 1Z19A 2CPRA 2LHTA 4BX9C 2KKPA 2G09A 2HBJA 2MRLA 2KVCA 2MA1A 2NV3A 2KNJA 2OYYA 3PSTA 2G07A 4GFJA 2G08A 2G0AA 3RFAA 2WAQC 2JHDA 2GH1A 2JH1A 1XO0A 3M6KA 2PMZC 3L3FX 2G06A 4AYBF 3IN5A 4NLBA 2K4EA 2HBKA 3F2BA 1ED1A 1PVPA 2ZIXA 2K89A 4FZMA 1YT3A 2RP5A 4ICAA 1SZHA 4PL1A 1MA7A 2XVTA 4IC9A 4KX5A 3MGVA 5KL8B 4OJOA 2M0NA 2WB1F 2H3FA 2JGAA 2ZIVB 3RF9A 5KL1B 2ZIVA 2KHVA 2BDUA 2Y0SF 4FZLA 3C29A 1XNSA 2WAQF 4KMOB 3F2CA 3SMVA 2PMZF 2JH7A 2YB1A 2R18A 1A6SA 3ALRA 3K1ZA 4P0QB 5HR6A 2HMXA 4OJ6A 3NRWA 2HBMA 2CN1A 2HOIA 3C28A 4FE3A 2OXOA 2HOFA 2E1FA 1HIWA 2KOBA 2DQNB 5A0LA 2E1EA 3D2QA 3D2NA 2E5SA 2F77X 3SQIA 1NZBA 3F5EA 2K8CB 2KKVA 1Q3VA 2XIDA 3ONNA 1A0PA 3CP8A 4C0ZA 2ZIUB 2OM6A 2ZIXB 4OJ5A 4U7CA 3IG8A 1HEKA 1F44A 3CYMA 2XI9A 2ZIWA 4ACOA 3IP4B 2F2AB 3T79A 4CDGA 1ZQ1C 3DEEA 4AYBC 2A3VA 3N7PD 3VCBA 2LKYA 1L6NA 5C0YA 1D8BA 3OPXA 2N1RA 4NLCA 2KIWA 2VKQA 2KJ9A 4QNLA 4P0PA 4P0PB 2HBLA 3F53A 3N7SC 1T94A 2K8AA 3PSFA 3AQEA 1IIPA 2XICA 1TAMA 1WUDA 3H0MB 2K8BB 3HKZF 3PSIA 4QJFB 4OJLA 1UPHA 1GO3F 3GZFA 3H0RB 3PZPA 1DRGA 2YX8A 2W03A 3PSPA 3SAGA 1URJA 3KFUF 2WB1C 2ZIUA 3AQFA 4FZNA 3F2DA 3N7RC 2K4HA 4BUGA 5CRXA 2KEYA 1PVRA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2OYY A; 
#chains in the Genus database with same CATH topology
 3TAR A;  3KHL A;  4MFC A;  3KHR A;  3THV A;  1QQ7 A;  2B21 A;  4Y2Y A;  8ICX A;  1AQ6 A;  3BQT A;  3KKA C;  5G5H A;  5HMM A;  4DSJ A;  3M6Z A;  4KMU A;  3BQ1 A;  4CF4 A;  4F93 B;  4ECS A;  4OCZ A;  2P6R A;  1KRP A;  1RDF A;  4QZB A;  2HVH A;  1S97 A;  2V4Q A;  5KFA A;  2KJ5 A;  3AL0 B;  1T8E A;  3GIK A;  3SV3 A;  4ECR A;  8ICL A;  3BS5 B;  2W7P A;  2OH2 A;  4IR9 A;  3D6J A;  9ICC A;  4Z6E A;  4PHA A;  5CWR A;  5KFU A;  4TUR A;  4C7Z A;  4EZ9 A;  5AKI A;  2Y1I A;  2K4E A;  5AM2 A;  3RB0 A;  1HUZ A;  3TAC B;  1PVP A;  2ZIX A;  1MA7 A;  3Q8L A;  3H8J A;  4G3I A;  4IC9 A;  4FZL A;  4Y2Q A;  3SEN A;  3N4M B;  2HHV A;  3NAS A;  2PMZ F;  1KSP A;  4DF4 A;  1NJW A;  5III A;  5ALR A;  5ALT A;  1N56 A;  2A19 A;  5ALX A;  5AI0 A;  3PW5 A;  1ZQR A;  3EPG A;  3H8S A;  5AKK A;  5AHX A;  2BPG A;  7ICJ A;  4CF3 A;  5DQH A;  8ICO A;  2XI9 A;  7ICE A;  4R8U A;  3R9K A;  1N63 A;  5KFH A;  4K4I A;  1PK3 A;  1UCV A;  5IIM A;  1KQQ A;  5KFZ A;  4C4T A;  1IIP A;  4RQ1 A;  1FFU A;  2M9N A;  3EWA A;  4QZA A;  1X9S A;  1KLN A;  4I2H A;  3GIL A;  1ZQL A;  3GZF A;  4J9M A;  4ECU A;  2NRZ A;  5J0T A;  1UT8 A;  3H8M A;  5J0R A;  4YQW A;  5HML A;  4NWI A;  3M7D A;  2WHE A;  4C8M A;  4BJQ A;  3ZD9 A;  3RAX A;  1CRX A;  4PH5 A;  1OW5 A;  3GQC A;  4UB2 A;  4F5Q A;  3PW0 A;  3ETL A;  4UBB A;  8ICT A;  2MAX A;  2NRW A;  4DSK A;  4CGZ A;  2EZY A;  4R63 A;  4TUQ A;  1PVQ A;  3QU7 A;  4F4Y A;  3RJG A;  3HX0 A;  2ZG6 A;  1SKR A;  4QZH A;  2Y9T A;  2HBJ A;  1NK8 A;  3SI8 A;  2PXI A;  3WU2 U;  1ZJM A;  4GFJ A;  4UAS A;  4ELU A;  4RUA A;  3M6K A;  4R64 A;  3IN5 A;  1SKW A;  5JTI A;  5B66 U;  1YT3 A;  3GV5 B;  2E8N A;  4NLG A;  1ZQW A;  2BDU A;  2BKE A;  1ZQE A;  4Q45 A;  8ICZ A;  4MFA A;  7ICF A;  4J03 A;  4ECV A;  3WK6 A;  5AKH A;  4UQG A;  3HW8 A;  5DQI A;  7ICM A;  2W9A A;  1C20 A;  5ALD A;  4Y2S A;  3NS1 A;  2UVU A;  4J9N A;  3IHQ B;  4UB1 A;  5IIL A;  4DOB A;  3JPR A;  3KHH A;  4AYB C;  5KFW A;  1PK1 B;  2RLT A;  3VCB A;  4DL4 A;  4MEY A;  1RXW A;  4F4W A;  3UPQ A;  1L6N A;  1F0M A;  1JAL A;  2VKQ A;  2EAN A;  1K5O A;  1T94 A;  3PSF A;  4YCX A;  1D8Y A;  2BCU A;  5ALY A;  2JR5 A;  2HI0 A;  4RNM A;  5AK4 A;  4Y2V A;  4MF8 A;  2BPF A;  2G5H B;  2ASL A;  2IOF A;  1BGX T;  4BGD A;  4NLN A;  3RJH A;  4MFF A;  2A1A A;  5JRT A;  2K4P A;  4F5N A;  2JMG A;  9ICN A;  5ALZ A;  4KLD A;  2D3D A;  1FO4 A;  8ICK A;  2RHF A;  4C8O A;  8ICW A;  2F8L A;  4B9T A;  2F1I A;  4RQ8 A;  9ICW A;  1P7D A;  2H3Q A;  3K1R B;  3QZ8 A;  2LHT A;  4IR1 A;  1LKY A;  1N2X A;  3G6Y A;  2I5H A;  3TQ1 A;  5JUM A;  2ESE A;  2Y0S F;  4I27 A;  3QX7 A;  5KFV A;  2FMQ A;  4F4Z A;  1A6S A;  1DOQ A;  3ALR A;  1BVS A;  2AU0 A;  5DQG A;  3PW7 A;  2OXO A;  1QQ5 A;  1X40 A;  4RQ4 A;  3KBB A;  2NO5 A;  4F4X A;  2ZTD A;  3L5K A;  4YG2 A;  4O3O A;  4QWC A;  4YFK A;  3DEE A;  1U4B A;  2ODG A;  3SYZ A;  5ALQ A;  4DFP A;  1S9F A;  1YZ6 A;  2N1R A;  3KZI U;  2KJ9 A;  4RQ5 A;  1ZRM A;  1XSN A;  3TAP A;  4NL9 C;  3GV7 B;  3C2L A;  1WCN A;  2VA8 A;  1DRG A;  4RQ3 A;  1T3Q A;  8ICM A;  9ICE A;  4M47 A;  2IA6 A;  1NJZ A;  2K4H A;  9ICM A;  2EAM A;  1JRP A;  5KG5 A;  4EYI B;  4ED2 A;  3RJI A;  3V72 A;  4UAY A;  3LDA A;  2KD1 A;  2Y0S C;  5KNI A;  1ZJN A;  5HHI A;  1XSL A;  3KHG A;  4PL2 A;  3CRX A;  4KTQ A;  5HR7 A;  8ICG A;  3CW2 C;  2Q4T A;  1KFT A;  1JI7 A;  3HJE A;  5KG2 A;  4IL6 U;  3RBE A;  4BXO B;  4U6P A;  2BDP A;  4TQS A;  4YMO A;  1HUO A;  1K1Q A;  3NVZ A;  2KKP A;  2MRL A;  2QLT A;  4IQT A;  3TKA A;  7ICG A;  2HBK A;  1N5W A;  3RAQ A;  2K89 A;  2KVS A;  1SGG A;  4C8L A;  7ICS A;  4IRC A;  1QCK A;  3K75 D;  1NJY A;  1L7N A;  2I9G A;  2YB1 A;  3ISD A;  2HMX A;  4UBC A;  2ISO A;  4J9K A;  1ZQZ A;  5TIS U;  5CB1 A;  1KDH A;  2LMR A;  4F91 B;  1ZQB A;  2ZIU B;  2DWQ A;  5AKE A;  3BS7 A;  4NLZ A;  3WK9 A;  1ZQV A;  5J29 A;  1U49 A;  3ZDB A;  5AKX A;  1ZQK A;  1ARO P;  2XGP A;  2EH9 A;  4UB5 A;  2ZTE A;  3M9N B;  3MDC A;  2ZJ5 A;  5KG3 A;  4OJL A;  1UPH A;  4UAU A;  1ZQC A;  2JXJ A;  4RQ0 A;  5DGA A;  4O5E A;  4DO9 A;  2W04 A;  4CNQ A;  4JMU A;  3BS5 A;  9ICA A;  3EPI A;  2LM4 A;  4DL2 A;  4EBD A;  7ICU A;  1ZD2 P;  3KOO A;  8ICP A;  1IM4 A;  1X66 A;  4DEZ A;  8ICQ A;  1JN3 A;  4M9J A;  5J2I A;  4ED8 A;  4EBE A;  3GU3 A;  4GLX A;  2D6F C;  4J9O A;  1S10 A;  2ES6 A;  5FP0 A;  3EZ5 A;  3WK8 A;  1BPY A;  5J0Y A;  3B0X A;  2UVR A;  1U47 A;  2JH1 A;  5ALS A;  2HHU A;  2LM1 A;  5KFT A;  4NLB A;  3F2B A;  3H4B A;  9ICH A;  3WKD A;  1VDV A;  4OD0 A;  3Q8Q B;  3NVW A;  2EZX A;  3MC1 A;  5KL8 B;  4NJ8 A;  2DPJ A;  1KKX A;  2ZIV A;  8ICR A;  1S5L U;  3LWM A;  4O3N A;  4EX6 A;  5DDM A;  5ALJ A;  1Y88 A;  2PI5 A;  8ICE A;  4RQ2 A;  1JMS A;  1IG6 A;  2HVI A;  3JPT A;  2HOI A;  3NTU A;  4QZI A;  3AU6 A;  4NY8 A;  8ICA A;  2HHX A;  5DGB A;  2KOB A;  2E1E A;  2QB0 B;  2MUT B;  3GDX A;  1ZQD A;  4RZR A;  2KKV A;  4P4P A;  4F92 B;  3V7K A;  2JEG A;  2FLP A;  5J0X A;  4RPZ A;  5AM5 A;  3CYM A;  4RQ6 A;  3JPS A;  3N7P D;  3ZDE A;  4ED0 A;  1ZQG A;  1SXD A;  1V97 A;  5KAF U;  1HJP A;  5DG9 A;  5HHH A;  5KFD A;  3RTV A;  8ICI A;  1ZYQ A;  4QW9 A;  3H0M B;  2K8B B;  3RJK A;  5KT6 A;  3HP6 A;  1COK A;  1ZQX A;  3E2E A;  5AI9 A;  4MHV A;  4FZN A;  3AEV A;  1BPX A;  2AGQ A;  3ETR A;  5J0W A;  4M9L A;  5AK6 A;  2Y1J A;  2R8K A;  1BNP A;  5ALN A;  4I2G A;  3Q8R B;  2H3V A;  3PR5 B;  1ZQF A;  2KJ8 A;  1JRO A;  1S8O A;  4RQM A;  1Z1B A;  3OJU A;  3Q8M A;  3I28 A;  2VJ5 A;  4DWI A;  1DGJ A;  3LVV A;  1ZET A;  2W8K A;  3EUB 2;  3Q8K A;  9ICG A;  2F76 X;  2B6G A;  4JV1 A;  2OYY A;  2NV3 A;  1LV5 A;  3B9J A;  4RPX A;  2YMP A;  2JHD A;  1XO0 A;  4UAZ A;  5BOM A;  4EBC A;  4O3Q A;  3QYP A;  2OHF A;  2J6T A;  4B9N A;  1PZN A;  2JGA A;  3G6V A;  1NOM A;  5HR6 A;  3JPN A;  3AMZ A;  2CN1 A;  3C28 A;  1KN5 A;  2EQY A;  2BQU A;  7ICK A;  3F5E A;  2GWS A;  8ICJ A;  5KFK A;  4JWN A;  5EE9 A;  4KLS A;  3OTQ A;  5DB7 A;  4J9S A;  4UB4 A;  4EEY A;  1ZQH A;  2PFO A;  2W55 A;  3BDP A;  4ELT A;  3IDW A;  2A3V A;  1F5S A;  4NL9 A;  4TUP A;  3AM9 A;  4QZF A;  2E8O A;  3PW4 A;  4QNL A;  1Z4O A;  3PMN A;  4M9N A;  1VLB A;  1BPE A;  4RT2 A;  4PZO A;  3ZDD A;  4F3O A;  2KZM A;  3PSI A;  4DF8 A;  5DBB A;  3GII A;  2PFP A;  4J9Q A;  5AIB A;  5EWG A;  1RYR A;  3H8W A;  2ATL A;  2C2E A;  4R66 A;  2JEF A;  2P35 A;  4RNN A;  2A1J B;  5ALO A;  2PKE A;  5DBC A;  1X9M A;  1SIJ A;  3MDA A;  5KG7 A;  1ZD3 A;  3RH5 A;  2JZB A;  3NVY A;  4ECZ A;  1NKC A;  2BHN A;  3NUQ A;  2W54 A;  1UT5 A;  1B0X A;  5ALW A;  3ZD8 A;  1MN8 A;  1DK3 A;  2NRV A;  3V6H A;  1V85 A;  2A1J A;  4O3S A;  5KT3 A;  4FO6 A;  8ICF A;  4KLM A;  1SWV A;  2MA1 A;  5KT4 A;  1J2N A;  3NRZ A;  5J2C A;  3KKA A;  3QU5 A;  4RNO A;  4JV2 A;  4UB6 U;  3QUB A;  3UMB A;  1WWU A;  2XVT A;  2EZZ A;  5AM0 A;  3MR2 A;  2I1Q A;  5AM3 A;  2KHV A;  2W43 A;  2KSO B;  5ALP A;  4UAR A;  4YMM A;  2E8M A;  4OJ6 A;  1SKS A;  3RR7 A;  5AKJ A;  1KTQ A;  4F71 A;  4PGY A;  1A77 A;  2MSN A;  5J8Y C;  5A0L A;  3D2Q A;  2W3S A;  1ZQS A;  2IHM A;  3M8R A;  5DLF A;  1JXL A;  3Q8P B;  2UVW A;  1ZQM A;  3N97 B;  1D8L A;  4ACO A;  4DFJ A;  1ZQ1 C;  3ZDC A;  4JK1 A;  4PGQ A;  4B9L A;  8ICV A;  2L5Y A;  3PX6 A;  1ZD4 A;  3N7S C;  4JV0 A;  1X9W A;  3PO4 A;  2XIC A;  5KFL A;  3LK9 A;  2HW3 A;  4QJF B;  2QB1 A;  4DFD A;  1ZQP A;  4ZOH C;  3SAG A;  2KIV A;  5F9L A;  3KFU F;  5J2F A;  3AQF A;  3F2D A;  5KFI A;  2AXT U;  2KEY A;  3C5G A;  3C2K A;  3OSP A;  4JWM A;  9ICP A;  1U45 A;  3BQ2 A;  5AI4 A;  1JUD A;  3ZI4 A;  1L5U A;  4QWB A;  4YXM A;  3H0L B;  2J6S A;  5KAI U;  2RRD A;  4XQ8 A;  4QIW F;  1JX4 A;  1L3U A;  1KBU A;  2FLL A;  2GOL A;  1NK0 A;  1NJX A;  1LB2 B;  3AUO A;  5ALK A;  5J2K A;  2K4I A;  3I76 A;  4DL5 A;  4EEL A;  2R8I A;  5J2B A;  2Z7J A;  2Y9U A;  4QZ9 A;  2W9C A;  4ZH4 A;  2BZF A;  4C8N A;  2FDR A;  2JZB B;  4PHD A;  3ZDA A;  4B6J A;  2V4R A;  2F44 A;  4USA A;  2KFN A;  2H3F A;  2W9B A;  3C29 A;  4Y2R A;  1XS9 D;  1L3V A;  4IRD A;  2QAR B;  4ECX A;  4EEK A;  4KN4 A;  1QSL A;  4KLJ A;  4Y2P A;  1HIW A;  4ECQ A;  3CP8 A;  3C1Z A;  1XWL A;  2OM6 A;  4U7C A;  1ZQT A;  3EW9 A;  5J0O A;  2ZIW A;  3MAB A;  5AI5 A;  3FC4 A;  3OHA A;  5D4B A;  1Z00 A;  1FEZ A;  2AHO B;  2OWO A;  2HBL A;  3RH6 A;  2K8A A;  3M9M B;  1FFV A;  3RR8 A;  1K1S A;  4I29 A;  2DL0 A;  1J2M A;  2KIC A;  4DOA A;  3HT3 A;  2XCA A;  4AP9 A;  2HHS A;  4I2B A;  4KLG A;  3T5L A;  5KG1 A;  3MR3 A;  1KFD A;  1H38 A;  4DQP A;  4GC6 A;  2CRX A;  5DDY A;  5KFB A;  3ICX A;  4GXJ A;  2WF7 A;  2LYA A;  4ELV A;  5HNK A;  2KHQ A;  4KN7 A;  1Q3U A;  1DK2 A;  5TZV A;  4R8U B;  3FAH A;  4UAV A;  3RB4 A;  3GIJ A;  4ECT A;  2RDJ A;  2WAQ C;  7ICH A;  4I2C A;  4QW8 A;  1TE2 A;  4RPY A;  3C23 A;  1SZH A;  1M6Y A;  2XC9 A;  3A0B U;  3RF9 A;  1BPB A;  4MF2 A;  5KL1 B;  1NK6 A;  1TV9 A;  2WAQ F;  2NO4 A;  2XO7 A;  1N62 A;  4YN4 A;  4P0Q B;  9ICU A;  3MR6 A;  2RDI A;  5AM4 A;  5J0Q A;  1O03 A;  2E5S A;  4LZG A;  4B9U A;  2WF9 A;  3ONN A;  2HDO A;  3M1Y A;  4C0Z A;  4OJ5 A;  5J2J A;  4PZN A;  2OCE A;  1ZQQ A;  3WKC A;  2F1J A;  1RG6 A;  2F2A B;  3RB3 A;  3BJY A;  2FPK A;  1RPL A;  3QNM A;  3HRD D;  5KFO A;  5DB9 A;  1RYS A;  3MFH A;  2JRZ A;  4P0P B;  4KLU A;  5DG7 A;  1UA0 A;  1TAQ A;  3OJS A;  3DV9 A;  2IOH A;  5AKG A;  2FE9 A;  1GO3 F;  4DLG A;  4I2I A;  5EWF A;  3A0H U;  2R8H A;  2ZIU A;  4X5V A;  1S77 D;  1QSY A;  4BUG A;  5DKW A;  2FPL A;  4ECW A;  2GLE A;  3GFK B;  5KFN A;  4UB3 A;  4BXO A;  3HIL A;  5AKL A;  2ZXI A;  4DL6 A;  1N5X A;  3H4D A;  4RU9 A;  1ECW A;  4YR0 A;  2R8G A;  2DGZ A;  4DS4 A;  1S0V A;  3T5H A;  2ASD A;  4NV0 A;  4P2H A;  2K60 A;  2FMS A;  1IXR A;  4QWD A;  2C2R A;  3V6J A;  1JIH A;  3T5J A;  2FJ6 A;  1SL1 A;  2DKX A;  4IS7 A;  3QE9 Y;  4CE6 A;  3UQ2 A;  3L3F X;  4AYB F;  4FZM A;  2W8L A;  4KX5 A;  2BCQ A;  2BCR A;  1D9D A;  3RH4 A;  3WKE A;  4PHE A;  5L1I A;  1L3T A;  5DG8 A;  3L4P A;  3MBY A;  2JH7 A;  1NK9 A;  2UVV A;  3MGH A;  1QSS A;  9ICQ A;  4NM1 A;  2VA2 A;  4FE3 A;  4RUC A;  5KFF A;  2YY6 A;  4YR2 A;  2E1F A;  4G9B A;  2DQN B;  1RYU A;  1N60 A;  3IM1 A;  1QTM A;  4PPX A;  4Q44 A;  4GXI A;  5H2F U;  3M8S A;  3T3F A;  1B43 A;  4O0I A;  3JPO A;  1F44 A;  4ED3 A;  1RQN A;  4BWM A;  1SL0 A;  4DFK A;  4F5R A;  2PI4 A;  5KG4 A;  5ALE A;  1XSP A;  4NLC A;  1L7P A;  3BQ7 A;  2HHW A;  1V38 A;  3QXG A;  3HKZ F;  4KLT A;  2XY7 A;  1ZQI A;  1WWV A;  2LYH A;  3H7I A;  5CRX A;  4ED6 A;  2XCP A;  2F8K A;  4J9R A;  3SR6 A;  4TUS A;  4KX3 A;  9ICL A;  2HOQ A;  5GTI U;  4M0A A;  4M2Y A;  2VIX A;  4LJX A;  1SV0 C;  4C7Y A;  5KG6 A;  4Z6F A;  3LVW A;  3AU2 A;  5DB6 A;  2H3Z A;  3D2S A;  3ORY A;  2KK0 A;  4M9G A;  2AJQ A;  4O9M A;  9ICO A;  5IIO A;  3UM9 A;  3JPP A;  4FS2 A;  2GH1 A;  2PMZ C;  2F3N A;  3TAD C;  4CF5 A;  2KZZ A;  4ICA A;  4PL1 A;  3PV8 A;  3RBD A;  1SV0 A;  4KMO B;  4F72 A;  3F2C A;  4US9 A;  1PK1 A;  3PVX A;  3MFI A;  2ZUC A;  2DBY A;  4I2A A;  2KG5 A;  1L7M A;  1S0O A;  1QQ6 A;  3SQI A;  2PFN A;  9ICR A;  5CP2 A;  1Z4N A;  1FIQ A;  2XID A;  2JEI A;  2C22 A;  3TAQ A;  2ZIX B;  4Y2X A;  4DL3 A;  7ICV A;  2RQ5 A;  3MR5 A;  1CUK A;  4I28 A;  5KT2 A;  1U48 A;  1RZT A;  2YML A;  3UQ0 A;  4F5P A;  5KFY A;  1NK5 A;  5KFG A;  1TKD A;  3H0R B;  3V7J A;  3PSP A;  5JU5 A;  1URJ A;  4RQN A;  3SEI A;  3OGU A;  2BCV A;  2OEH A;  4O3R A;  7ICO A;  2AGP A;  2EDU A;  2LBO A;  9ICF A;  7ICT A;  3VC8 A;  1B4F A;  2IOF K;  5D46 A;  5C5J A;  2V9W A;  4F2R A;  1DGS A;  3BZK A;  2VA3 A;  3C5F A;  3C1Y A;  4EX7 A;  2YB4 A;  3H40 A;  8ICC A;  3DDH A;  3C2M A;  4OO1 J;  3SV4 A;  3K4G A;  2ZXH A;  1UA1 A;  4Y2T A;  5AI6 A;  1L7O A;  3OHB A;  4DQS A;  5KT5 A;  4QZG A;  1Z19 A;  5KFQ A;  2G09 A;  3MGI A;  1TK5 A;  5AI8 A;  1T4G A;  5KFX A;  4EYH B;  5KFR A;  5EE0 A;  4F50 A;  8ICN A;  2ZJ8 A;  2LPE A;  4KLH A;  4YD2 A;  2R18 A;  2CXY A;  1KL9 A;  3GIM A;  4B9S A;  1ZRN A;  4QWE A;  7ICI A;  2NRX A;  4NM2 A;  3D2N A;  5J0S A;  1KFS A;  3NGD A;  4F2S A;  2KMD A;  5AK5 A;  3PO5 A;  2DKZ A;  2E8P A;  4J9L A;  4KLF A;  3IP4 B;  4IQW A;  9ICT A;  4CDG A;  2KN7 A;  4KLI A;  3TFS A;  1S0N A;  1X6J A;  2ASJ A;  1OXJ A;  2GO7 A;  3BZC A;  2ZJA A;  4O5C A;  4Z6D A;  5AM1 A;  3QUC A;  2QAR A;  5F3X B;  3RRH A;  3E58 A;  2KIW A;  1SZP A;  1TK8 A;  3AQE A;  1WUD A;  5ALH A;  2HHQ A;  5IIK A;  3PZP A;  5KFM A;  2AQ4 A;  1SWW A;  5KFS A;  4Z6C A;  3WKA A;  1NI3 A;  1ZOL A;  1PVR A;  4XUS A;  4CRX A;  4Q43 A;  3TAD A;  4QZC A;  4UAW A;  1PUZ A;  4UW9 A;  3QEB Z;  1X6I A;  3SD7 A;  5L1M A;  3T5K A;  1MSW D;  4UAT A;  1BNO A;  2AQ0 A;  1S0M A;  3KZX A;  2WF5 A;  4WJ3 B;  1EXN A;  2W7O A;  2BQR A;  3IG5 A;  3IV6 A;  5IIN A;  4FBU A;  5J2H A;  4ED7 A;  1V9P A;  2LYB A;  2FI1 A;  1MQ3 A;  1RQL A;  1RXV A;  3ISB A;  5EOZ A;  4K4G A;  1VJ5 A;  4KIT B;  1C7Y A;  4QZ8 A;  3LWL A;  1ZQJ A;  5ALG A;  2ZUB A;  3BQ0 A;  1QLN A;  1NNL A;  4BX9 C;  2HCF A;  2XGQ A;  5AIC A;  2KNJ A;  1COO A;  8ICS A;  1CEZ A;  4QZE A;  4KLL A;  4PHP A;  1XC9 A;  2RP5 A;  2IHN A;  3QZ7 A;  2W9M A;  5KFC A;  5KTQ A;  2M0N A;  4ECY A;  3TI0 A;  3PR4 A;  1Q8K A;  5ALF A;  1NK4 A;  5KFJ A;  4DSI A;  1WYG A;  1SV4 A;  3K1Z A;  2BQ3 A;  1ZQU A;  4ED1 A;  1SL2 A;  3FM9 A;  4C8K A;  1JXE A;  4O3P A;  3QEA Z;  1NKB A;  5J2G A;  4F5O A;  5EE1 A;  1T3N A;  1A0P A;  4TQR A;  4IQV A;  4RT3 A;  4DSL A;  9ICI A;  5ALU A;  4JUZ A;  2LKY A;  3KTQ A;  3PX0 A;  3UXN A;  3TAN A;  1T7P A;  5EWE A;  1KEJ A;  4NLK A;  4QWA A;  4I2D A;  2KFZ A;  4R65 A;  3QU2 A;  4DQQ A;  4YMN A;  3QU9 A;  7ICQ A;  1X2I A;  1LVH A;  5B5E U;  3HKZ C;  1TVA A;  4LVS A;  4P0Q A;  2IBK A;  2VJ4 A;  1LKY B;  3PNC A;  1ZD5 A;  4O3M A;  2R8J A;  2H5X A;  2BCS A;  2NRT A;  1D9F A;  1S76 D;  5HP4 A;  3LYS A;  3IRU A;  2I6X A;  1UQV A;  3HPO A;  9ICB A;  2KZ3 A;  2FLN A;  5J2E A;  5KFP A;  4BWJ A;  5L1K A;  1X42 A;  2G5I B;  1NK7 A;  3O0F A;  2AH5 A;  5ALV A;  4HYK A;  3SAF A;  5AIA A;  4YXJ A;  1ZQA A;  4OJP A;  5F9N A;  2AGO A;  4KLQ A;  5ALL A;  2NYV A;  1L3S A;  2KVC A;  9ICK A;  2C2D A;  1DXS A;  1QH9 A;  2G07 A;  2G08 A;  4DFM A;  2F1H A;  3SZ2 A;  2G06 A;  5CR0 A;  1WCL A;  3WK4 A;  4DLE A;  1ED1 A;  4DOC A;  3NVV A;  3N28 A;  1U9L A;  1ZQY A;  2EAP A;  4DSF A;  4OJO A;  4DS5 A;  3RRG A;  2ZIV B;  1XNS A;  9ICX A;  2YQE A;  3SMV A;  5J2D A;  2O6K A;  3QUT A;  3GV8 B;  2W3R A;  3NRW A;  4FBT A;  3QUQ A;  8ICB A;  2HOF A;  4YD1 A;  1NZB A;  3WK7 A;  5IIJ A;  2K8C B;  7ICN A;  1NZP A;  4XA5 A;  4NXZ A;  1XO1 A;  5ALM A;  3UMG A;  3Q8S B;  4Y2U A;  1HEK A;  4GXK A;  2YMM A;  4M6W A;  3C21 A;  3V7L A;  2BR0 A;  3UMC A;  3G6X A;  1N61 A;  5AKY A;  2B0C A;  2YTU A;  1ZQN A;  2DPI A;  1TAM A;  4FS1 A;  4LZD A;  5AKZ A;  2YX8 A;  2W03 A;  7ICL A;  4JB3 A;  3N7R C;  4M6W B;  4M9H A;  4PGX A;  3UXO A;  3SAH A;  4C80 A;  1SXE A;  3WK5 A;  2WTF A;  2JEJ A;  2P66 A;  4KLE A;  4EEN A;  2PFQ A;  1RM6 C;  1TFR A;  1UHU A;  2DFL A;  2KV2 A;  4B9M A;  5BOL A;  9ICJ A;  1TAU A;  2QKQ A;  3U26 A;  3EYZ A;  4E0D A;  4KLO A;  4C4S A;  2YMQ A;  3RJJ A;  4Q8F A;  4P4M A;  3ED5 A;  4A8E A;  2J6U A;  2EAO A;  2CPR A;  4YP3 A;  4BDP A;  3M9O B;  1BPZ A;  3RFA A;  5K4L A;  9ICS A;  2JV3 A;  4Q8E A;  5J0P A;  3MGV A;  8ICY A;  2WB1 F;  1O08 A;  3S6J A;  4RQ7 A;  2XY6 A;  5CJ7 A;  4DQR A;  2BPC A;  5L1L A;  5KG0 A;  2E3T A;  2W9C B;  2HBM A;  5EE3 A;  2WF6 A;  1N48 A;  1ZQO A;  2ALZ A;  4I2F A;  3PX4 A;  3WKB A;  7ICR A;  5KFE A;  4P4O A;  2IMW P;  1B22 A;  3OSN A;  2W9B B;  2ZTC A;  3T79 A;  4PJ0 U;  5CHG A;  2MU2 A;  4F4K A;  1TK0 A;  4CCH A;  2XY5 A;  3KD3 A;  4US8 A;  3OPX A;  5CA7 A;  1SB3 C;  2LI6 A;  4MEX A;  2BGW A;  5DB8 A;  3TFR A;  5DBA A;  5DLG A;  3FDS A;  5J2A A;  2YN4 A;  3RJE A;  4YR3 A;  2P6U A;  2FPM A;  3HWT A;  3B0Y A;  4GIB A;  4YVZ A;  4QIW C;  2ZIW B;  5KT7 A;  2HSZ A;  1KW4 A;  3E0F A;  1J97 A;  2D8C A;  2KSO A;  4FFD A;  1Z1V A;  1OUQ A;  1Z00 B;  5T14 A;  2KTQ A;  2H3I A;  2MUT A;  2Q0Z X;  4I2E A;  2WF8 A;  1X9X A;  1MQ2 A;  5E79 U;  4B9V A;  2VAN A;  4DCC A;  1NKE A;  8ICH A;  5ALI A;  3PML A;  2FMP A;  2WFA A;  1ZXI A;  2W11 A;  2KP7 A;  1YZ7 A;  4O5K A;  4DL7 A;  2DF4 B;  4M04 A;  3F5A A;  4K4H A;  3ISC A;  3PST A;  5CEH A;  4J9P A;  9ICV A;  2G0A A;  3FYH A;  2QB0 A;  5AK3 A;  1BPD A;  3J81 j;  2HHT A;  3JPQ A;  3I1Y A;  2DUY A;  4IRK A;  5G5G A;  4UB8 U;  4QZD A;  7ICP A;  4HAI A;  1XU4 A;  4IQU A;  1IV8 A;  3UXP A;  3CNH A;  5GTH U;  5L9X A;  3PW2 A;  3V6K A;  4C4R A;  1MC8 A;  4XRH A;  1L8L A;  2F77 X;  3PY8 A;  2ZUD A;  1Q3V A;  4F8R A;  5J0U A;  4DQI A;  3IG8 A;  4DSE A;  2C28 A;  1A76 A;  5BPC A;  4GC7 A;  4EZ6 A;  2KE7 A;  3RB6 A;  1WG8 A;  4I2J A;  5C0Y A;  1D8B A;  2ISP A;  5J8Y A;  4P0P A;  1L8O A;  3F53 A;  1CI4 A;  4Y2J A;  5D49 A;  3RJF A;  3AN1 A;  1Q46 A;  8ICU A;  5L1J A;  1Z3E B;  2WB1 C;  3QU4 A; 
#chains in the Genus database with same CATH homology
 2W04 A;  2KIC A;  4QIW C;  2ZIW B;  2LBO A;  4NWI A;  2G5H B;  3HKZ C;  3M7D A;  3E0F A;  4CRX A;  4JMU A;  2ZXI A;  4P0Q A;  3SAH A;  3VC8 A;  4BJQ A;  2VJ4 A;  4KX3 A;  1OUQ A;  2HOQ A;  5T14 A;  1CRX A;  3M6Z A;  2H3V A;  4O3M A;  1ECW A;  2KJ8 A;  3KZX A;  2KV2 A;  2VIX A;  3H0L B;  4WJ3 B;  2CRX A;  2H3I A;  2JMG A;  2RRD A;  2KD1 A;  3LYS A;  2Y0S C;  2W7O A;  1Z1B A;  2DGZ A;  3IG5 A;  3ICX A;  4QIW F;  2RHF A;  1KBU A;  2LYA A;  2F8L A;  4CGZ A;  2G5I B;  3O0F A;  2YB4 A;  4PL2 A;  2GOL A;  3NUQ A;  3LVW A;  4NV0 A;  3CRX A;  2VJ5 A;  5HR7 A;  2LYB A;  3SAF A;  2KJ5 A;  2Q4T A;  2KHQ A;  2K4I A;  3GU3 A;  3LVV A;  1PVQ A;  2D6F C;  3AL0 B;  1Q3U A;  4OO1 J;  4OJP A;  4A8E A;  2H3Z A;  2ZG6 A;  3D2S A;  2ZXH A;  2W7P A;  2F76 X;  4U6P A;  2DF4 B;  1P7D A;  2OH2 A;  2H3Q A;  3F5A A;  2Z7J A;  1Z19 A;  2CPR A;  2LHT A;  4BX9 C;  2KKP A;  2G09 A;  2HBJ A;  2MRL A;  2KVC A;  2MA1 A;  2NV3 A;  2KNJ A;  2OYY A;  3PST A;  2G07 A;  4GFJ A;  2G08 A;  2G0A A;  3RFA A;  2WAQ C;  2JHD A;  2GH1 A;  2JH1 A;  1XO0 A;  3M6K A;  2PMZ C;  3L3F X;  2G06 A;  4AYB F;  3IN5 A;  4NLB A;  2K4E A;  2HBK A;  3F2B A;  1ED1 A;  1PVP A;  2ZIX A;  2K89 A;  4FZM A;  1YT3 A;  2RP5 A;  4ICA A;  1SZH A;  4PL1 A;  1MA7 A;  2XVT A;  4IC9 A;  4KX5 A;  3MGV A;  5KL8 B;  4OJO A;  2M0N A;  2WB1 F;  2H3F A;  2JGA A;  2ZIV B;  3RF9 A;  5KL1 B;  2ZIV A;  2KHV A;  2BDU A;  2Y0S F;  4FZL A;  3C29 A;  1XNS A;  2WAQ F;  4KMO B;  3F2C A;  3SMV A;  2PMZ F;  2JH7 A;  2YB1 A;  2R18 A;  1A6S A;  3ALR A;  3K1Z A;  4P0Q B;  5HR6 A;  2HMX A;  4OJ6 A;  3NRW A;  2HBM A;  2CN1 A;  2HOI A;  3C28 A;  4FE3 A;  2OXO A;  2HOF A;  2E1F A;  1HIW A;  2KOB A;  2DQN B;  5A0L A;  2E1E A;  3D2Q A;  3D2N A;  2E5S A;  2F77 X;  3SQI A;  1NZB A;  3F5E A;  2K8C B;  2KKV A;  1Q3V A;  2XID A;  3ONN A;  1A0P A;  3CP8 A;  4C0Z A;  2ZIU B;  2OM6 A;  2ZIX B;  4OJ5 A;  4U7C A;  3IG8 A;  1HEK A;  1F44 A;  3CYM A;  2XI9 A;  2ZIW A;  4ACO A;  3IP4 B;  2F2A B;  3T79 A;  4CDG A;  1ZQ1 C;  3DEE A;  4AYB C;  2A3V A;  3N7P D;  3VCB A;  2LKY A;  1L6N A;  5C0Y A;  1D8B A;  3OPX A;  2N1R A;  4NLC A;  2KIW A;  2VKQ A;  2KJ9 A;  4QNL A;  4P0P A;  4P0P B;  2HBL A;  3F53 A;  3N7S C;  1T94 A;  2K8A A;  3PSF A;  3AQE A;  1IIP A;  2XIC A;  1TAM A;  1WUD A;  3H0M B;  2K8B B;  3HKZ F;  3PSI A;  4QJF B;  4OJL A;  1UPH A;  1GO3 F;  3GZF A;  3H0R B;  3PZP A;  1DRG A;  2YX8 A;  2W03 A;  3PSP A;  3SAG A;  1URJ A;  3KFU F;  2WB1 C;  2ZIU A;  3AQF A;  4FZN A;  3F2D A;  3N7R C;  2K4H A;  4BUG A;  5CRX A;  2KEY A;  1PVR A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...