2OYYA

Hthp: a hexameric tyrosine-coordinated heme protein
Total Genus 30
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
30
sequence length
71
structure length
71
Chain Sequence
TWLPTLVTATPQEGFDLAVKLSRIAVKKTQPDAQVRDTLRAVYEKDANALIAVSAVVATHFQTIAAANDYW
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Hexameric cytochrome
publication title HTHP: A Novel Class of Hexameric, Tyrosine-coordinated Heme Proteins
pubmed doi rcsb
source organism Silicibacter pomeroyi
molecule tags Unknown function
total genus 30
structure length 71
sequence length 71
chains with identical sequence B, C, D, E, F, G, H
ec nomenclature
pdb deposition date 2007-02-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF11534 HTHP Hexameric tyrosine-coordinated heme protein (HTHP)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.500 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 DNA polymerase; domain 1 2oyyA00
2OYYA
chains in the Genus database with same CATH superfamily
1F5SA 5AKEA 4PL1A 5AK4A 2WF5A 3JPSA 1JN3A 2AQ0A 1JROA 2P6UA 4J9SA 4IRKA 2ZUDA 8ICXA 1D8BA 1ZQQA 1VLBA 3RJHA 5EE1A 4KMUA 3SAHA 2ASDA 5KFWA 1IXRA 2WTFA 1PVRA 3BS7A 5KG7A 4RQ3A 1JIHA 1BNPA 2OEHA 5AIBA 2KN7A 2JXJA 1PVPA 4FE3A 3FAHA 4F93B 5ALXA 4YCXA 2IOFA 1KEJA 1NK8A 4DL5A 5IIMA 3OGUA 1C7YA 4Z6DA 2XY6A 4O5EA 9ICEA 5KT5A 1ZD4A 3AL0B 3I76A 5JU5A 4RT3A 4ECYA 3OJSA 3TAPA 1Q8KA 5AKGA 3SEIA 8ICSA 7ICMA 4F50A 4JV0A 2RLTA 2W3SA 1RZTA 1RQLA 3RB3A 4PGQA 2ZJAA 4EELA 3M9MB 5AI9A 1CRXA 4R8UA 2UVUA 1JXEA 1QTMA 2OHFA 3QUQA 1OXJA 3RB6A 2UVVA 3FM9A 4J9PA 3H0RB 1CUKA 3F5EA 4QZGA 2ISOA 7ICIA 3M9OB 1VDVA 4UB4A 2HOFA 2AJQA 5B66U 4R64A 4C4SA 3AU6A 1D9FA 3PMNA 4RQ0A 3H4BA 4OO1J 8ICUA 4OJOA 2BCVA 3BQ7A 5DDYA 2I1QA 3JPQA 3T5KA 2AGQA 4IR1A 1ZQYA 3MDCA 1UT5A 5JUMA 5KFXA 2GH1A 4GXJA 1RXWA 5JRTA 4DL7A 3PVXA 3N97B 5J0YA 2KIVA 5AM2A 3OJUA 1U47A 3V7LA 1ZQJA 3ZDCA 2ZIVB 4QJFB 2YY6A 4O3NA 2KP7A 4TUSA 1FEZA 2F2AB 5HNKA 2K4PA 3TARA 3NTUA 4J03A 1P7DA 5L1IA 2VA2A 4KITB 4I2AA 1T3QA 3LWMA 2QB0B 3LDAA 1J2MA 1XO0A 5A0LA 3BZCA 3G6VA 3WKCA 2F44A 2R8IA 2BR0A 2IOFK 5KFNA 2KSOB 2DL0A 4RQ1A 3NRZA 5ALDA 3HX0A 2HMXA 2WHEA 4B9SA 2WF9A 3M9NB 5EE0A 2HHSA 3BQ0A 3ZDBA 2IHMA 2ALZA 3PMLA 5KG4A 2JH7A 3LK9A 2HHQA 4YR0A 1URJA 3RJJA 5J2EA 5TZVA 4JV1A 2WB1C 4F5RA 3SI8A 3WK6A 3BQTA 4DS5A 2VJ5A 3BDPA 4C80A 1NI3A 3ISDA 1ECWA 2K89A 1DGJA 3N7RC 4KLIA 2ZG6A 9ICLA 5DG7A 3T5HA 2AQ4A 2KFNA 5AI8A 3D2QA 3AQEA 4JB3A 2DUYA 2FE9A 3ETRA 3OHAA 2Y1JA 3RBDA 3RJKA 2OH2A 4TQSA 2A1JA 2G0AA 1XO1A 4RU9A 3C21A 3L5KA 2KJ5A 7ICNA 3V6HA 2M9NA 3QNMA 1JUDA 4F8RA 5AKXA 1U49A 4U7CA 5AKJA 2KJ9A 4PL2A 1L3VA 2R8JA 4M04A 4J9NA 3M6ZA 5CR0A 2RP5A 2ZJ5A 9ICHA 4QZIA 4O3OA 1NKBA 2D3DA 1B0XA 3CW2C 2FMQA 3D2SA 1Z19A 2W9BB 2DGZA 3RH4A 4UASA 3HRDD 5GTIU 2LM4A 5J2JA 2FLNA 3H8MA 4R8UB 2G5HB 2F1JA 4USAA 4RPXA 4F4YA 2NRZA 2EDUA 2YMPA 5KG1A 1S0OA 4ICAA 4QZ8A 5KFMA 5J0XA 2YB1A 1X9SA 2ESEA 1PUZA 4I2BA 1LVHA 1KFSA 4UB6U 3WK7A 4FO6A 4KLOA 3IP4B 5KFIA 4DQPA 3RJGA 4QZDA 2R8KA 5KTQA 3M7DA 2RRDA 3IG5A 4QWEA 4ED0A 2ATLA 1MC8A 3C2MA 1JALA 5KG2A 4DFKA 2K4HA 3UMGA 1KW4A 4DQRA 3UMCA 3H0LB 4G3IA 1QH9A 1L7NA 3SAGA 2W7PA 1NKCA 7ICLA 4PJ0U 4PZNA 3Q8LA 5J0OA 3G6YA 3WK9A 2PMZF 4QZAA 1KQQA 1FO4A 5KFPA 1IIPA 4EBEA 1MN8A 2K8AA 4GLXA 1JXLA 3CRXA 1QSYA 2JEIA 9ICQA 2HHWA 8ICZA 9ICTA 2KJ8A 3WK5A 2Y1IA 1NZPA 3R9KA 1SL1A 8ICTA 4RQ2A 1SGGA 3D6JA 1ZQMA 4NV0A 4CNQA 3TFSA 1A0PA 3GU3A 1C20A 2EAOA 3MGHA 5ALTA 4F4ZA 2OCEA 2KKVA 5J0UA 2DPIA 2GO7A 5BPCA 1KSPA 4RPYA 7ICGA 1JRPA 4KN7A 1F0MA 5IILA 3PW5A 8ICMA 5AK6A 5KG0A 2I9GA 3PSTA 3KHRA 4Q45A 4KTQA 1SV4A 1YZ6A 2XY7A 1AQ6A 3MFHA 7ICUA 1L8LA 4NJ8A 3TKAA 4ECQA 1BVSA 2KNJA 2W43A 2AHOB 2H5XA 4AYBC 1KLNA 2BGWA 2HHUA 1O08A 8ICYA 2KIWA 2MSNA 1T4GA 4F71A 4EX7A 5J2FA 2ZXIA 1RM6C 4DOBA 1S97A 1PK1B 1XS9D 5F9NA 3IV6A 4RPZA 3C5FA 4J9OA 2VIXA 4F5NA 1ZQGA 1ZQVA 5D46A 5AI0A 2HOQA 5CB1A 4EBCA 4IQUA 4RUCA 1OW5A 2E5SA 5J0WA 3QU2A 4KLSA 4EEYA 5AI5A 1SXEA 5C0YA 4EENA 2AGPA 1DK2A 5KFKA 3VC8A 1ZRNA 3LVVA 4I2JA 4F91B 1YZ7A 1XNSA 3PR5B 7ICKA 2AH5A 2Y0SC 4QZFA 1KRPA 5DQGA 4TQRA 1HUZA 2BCUA 5G5HA 1SKRA 5EWEA 1S5LU 4P4PA 5L9XA 4CCHA 4BWJA 2LI6A 3PX4A 8ICLA 3H7IA 2ZIVA 3ISCA 4QZHA 1SZPA 3Q8SB 3C1YA 3RB0A 2XIDA 1ZQCA 4ECXA 2B0CA 4KLFA 4UB1A 5BOLA 3RH6A 7ICEA 1UQVA 2E8OA 2W03A 4O3MA 3RBEA 3JPPA 1YT3A 1DOQA 3KZIU 1S0VA 2P66A 1X9WA 5KFJA 3PO5A 4C4RA 4YMOA 2HBKA 5E79U 5ALQA 3K1RB 5HHHA 1V38A 1IG6A 5AKIA 5EOZA 1LB2B 2ZTEA 2MAXA 9ICCA 3HKZF 2Q4TA 4KLGA 1WUDA 3TANA 2CN1A 4ED2A 4P0QA 5DGAA 4JMUA 4Y2JA 1NK0A 3IM1A 3L3FX 5CJ7A 2BQUA 5IIOA 2HDOA 3IG8A 1RQNA 1X42A 2LYAA 3H8WA 1Z00A 3J81j 2VA3A 4DL4A 1UCVA 2FDRA 2XGPA 1HEKA 2LHTA 7ICQA 4Q44A 1KKXA 4M9GA 5IIKA 1O03A 3PZPA 3QU5A 2R8HA 2ZXHA 2XO7A 3NVVA 3QU9A 4F92B 3I1YA 3EUB2 4J9KA 3QE9Y 1PZNA 1H38A 3GIIA 3ZD8A 4PH5A 3EPIA 4I2FA 1L8OA 2VKQA 2KG5A 1XSLA 8ICNA 4PHPA 3V7JA 2WAQC 3SAFA 1NJWA 4XQ8A 4RNNA 2NRWA 5EWFA 4M9NA 2F8LA 2NV3A 2HBJA 4UAWA 2BPFA 9ICVA 1F44A 3C2KA 7ICJA 1TAMA 1PK3A 2HVHA 4DLEA 3RAXA 4IRCA 8ICGA 3QX7A 5DB6A 5AM5A 1T94A 5JTIA 4F5QA 2ZUCA 3MDAA 1Q3VA 4DQQA 2HI0A 5ALMA 4HYKA 1NK9A 1RG6A 4Q8EA 3NVYA 3QXGA 2W9BA 3AEVA 4YXJA 1Z4OA 1ZQOA 4YP3A 2F1IA 4Z6CA 4MF2A 1ZQXA 4LZDA 3HPOA 2BPCA 5AM0A 2JH1A 3NGDA 3Q8RB 1PVQA 2BKEA 3QEBZ 2RDIA 4DSEA 8ICFA 2H3IA 4HAIA 2G5IB 2L5YA 3HP6A 2K4IA 1L5UA 2WFAA 1MSWD 4I2CA 7ICTA 4RQNA 5KFSA 5CRXA 3OTQA 2C2EA 2LKYA 1N62A 5ALFA 1N61A 2EQYA 4QIWC 5DG9A 9ICOA 1KL9A 5KT4A 4G9BA 4PHEA 2J6UA 3PV8A 5CA7A 1EXNA 2YTUA 3RR8A 1TV9A 3F5AA 4NLCA 4IQVA 3KHGA 2XC9A 1ZQRA 2KZMA 1U4BA 4YD2A 2ZUBA 3KKAC 4QZBA 3RRHA 1BPBA 4A8EA 4BJQA 2B21A 3JPRA 5DLFA 3FC4A 3A0BU 2W8LA 4DWIA 5AM4A 9ICUA 4BGDA 4OJLA 2ZTCA 3MR6A 1L3UA 4DFDA 4ELUA 1ZQLA 4YQWA 2MUTB 1XSNA 2W04A 4UW9A 4C7ZA 2XY5A 3DEEA 4R66A 4J9RA 4QW9A 1ZETA 2Q0ZX 8ICHA 2NRTA 4DQIA 5HP4A 4P0PB 2PFOA 1ZQWA 3OPXA 1V9PA 2F76X 4BXOB 1BNOA 1S9FA 3M8RA 3V72A 4EYIB 3Q8MA 1DGSA 1U48A 3PX6A 9ICBA 3H40A 4P0QB 2KVSA 2AGOA 1ZQFA 2HHXA 3WK8A 3MR2A 4QWCA 4ECWA 1ZQAA 2KV2A 2K8BB 4Y2PA 4BDPA 4FZNA 9ICXA 1TAQA 1Z00B 4OJPA 2FMPA 3WU2U 1JI7A 3RH5A 1QQ7A 5EWGA 2DWQA 2XVTA 1QSSA 3JPTA 4C7YA 4K4IA 4CRXA 1PK1A 4YR2A 3B0YA 3MR5A 3BQ1A 5HMMA 3SZ2A 5KFVA 4XRHA 4B9MA 4NL9C 1RPLA 4ECZA 2Z7JA 3EZ5A 4DFJA 1X6IA 1ZQBA 3GDXA 4M6WB 4RQ7A 2ASJA 2ASLA 1UA1A 3V7KA 8ICRA 3Q8PB 2RHFA 1VJ5A 4J9QA 1TK0A 2WB1F 4O3RA 4QZEA 2G07A 4GXKA 1MQ3A 2QARA 3UXNA 5ALSA 3PR4A 2WF6A 3PSFA 5AI6A 3F2CA 3IRUA 4I29A 4RQMA 5IIJA 4ED7A 5AM3A 5D49A 2KICA 1X66A 3LVWA 4F4XA 5G5GA 1SXDA 1UHUA 2HBLA 4ZH4A 2D6FC 5ALEA 3SYZA 7ICVA 8ICIA 2PFPA 2FPLA 1QLNA 5J0RA 5KAFU 2KZZA 1ZQ1C 4PGYA 5KFUA 3RJIA 1S76D 1Q3UA 3N28A 4DFMA 7ICRA 2FLPA 1UT8A 1Z1BA 4CF5A 3IN5A 3GV5B 2LM1A 5L1KA 4NLNA 3T5JA 3GIMA 1BGXT 5EE9A 3E0FA 5KG5A 5KT2A 5GTHU 3BS5B 3GV7B 4Y2RA 4Y2UA 4O3SA 3AQFA 3NVWA 2KKPA 3FDSA 4MFCA 2W9CA 2GLEA 2UVWA 4PPXA 4GIBA 2JR5A 1N60A 4B9NA 4YR3A 1Z4NA 4DOCA 4PZOA 4KMOB 3IDWA 1RYSA 4M2YA 4RQ8A 2IMWP 3EWAA 3QUBA 3TAQA 1SV0C 2NO4A 2BQRA 1TAUA 3RF9A 1A76A 3KFUF 4ELVA 2JHDA 4DSKA 4O0IA 2FI1A 4RNOA 3T3FA 4DSFA 3EW9A 3ORYA 1NZBA 4YVZA 1NJZA 3Q8QB 3A0HU 1T7PA 2IA6A 4C0ZA 2JGAA 1ZD3A 3MBYA 4OJ6A 1DRGA 4KLDA 2QB1A 1CEZA 2FJ6A 3N4MB 3SMVA 4RQ4A 4Y2VA 2LMRA 4GFJA 4DEZA 2WF8A 3L4PA 4DL6A 1QQ5A 1WYGA 5J2IA 3E58A 3NRWA 2OM6A 3SENA 1NK7A 2KVCA 4FZLA 9ICFA 3KKAA 3C5GA 4EX6A 3AUOA 1RDFA 2H3QA 3GFKB 5J2HA 1TKDA 2ZIUA 3WKBA 1ZQHA 1N2XA 5DBBA 4ECTA 4ELTA 3BQ2A 4I27A 2E8NA 5KFTA 1NJXA 4KLMA 4RQ6A 3UMBA 4F3OA 5KL1B 2XICA 2V9WA 1BPEA 2YX8A 5CWRA 4QWDA 1S10A 2ZJ8A 2A1AA 5ALPA 8ICQA 1SWVA 2C22A 1NOMA 3JPOA 3CNHA 4WJ3B 5AKZA 5KFHA 2KMDA 4KLEA 3GIJA 3F2DA 3RB4A 1S0MA 1KN5A 4ACOA 3K4GA 1XSPA 3NUQA 1SWWA 1RXVA 4M9HA 2V4RA 1Z1VA 4YN4A 1NJYA 3NVZA 4AYBF 2DBYA 2F77X 2PKEA 1J97A 4KLUA 2M0NA 4FBTA 2QARB 2FLLA 4DLGA 3QUCA 1BPXA 2W7OA 1XU4A 3OSNA 5ALVA 3PY8A 1WCNA 4UB3A 2YMLA 9ICPA 4M9LA 2Y9TA 3V6JA 2AU0A 3SV3A 1T8EA 1BPZA 3V6KA 4O5KA 2PI4A 5DLGA 3RRGA 4ED8A 1L3TA 2HOIA 4DSJA 3RTVA 2BCQA 2PFNA 3EPGA 4DCCA 2HHVA 3TADC 3KHLA 2CRXA 3U26A 2MUTA 3TFRA 3HKZC 5AK3A 4MFFA 2Y0SF 4US9A 5IIIA 5DDMA 3M1YA 4Y2XA 1B22A 1XC9A 1LV5A 3UQ0A 1NK4A 4XA5A 4C8OA 1L7PA 4NWIA 4MF8A 2C2RA 4P0PA 5HMLA 4BXOA 8ICJA 3QZ7A 2H3ZA 2ZIXB 3GV8B 4IC9A 2RQ5A 1FFUA 5AKKA 1ZQDA 1N48A 4UQGA 2BDUA 1T3NA 4KLJA 4DSIA 1N5XA 5KFOA 4UARA 5L1LA 8ICPA 5CP2A 4NLGA 3DV9A 5L1JA 2ISPA 5D4BA 2W9CB 4MEXA 2KHVA 1ZQPA 2HBMA 4IR9A 9ICMA 4GC7A 3TQ1A 4UAVA 2C28A 4I2GA 4QZCA 2XI9A 1SIJA 4ED3A 1N63A 3NS1A 2W55A 2GWSA 4FZMA 2W9AA 3AM9A 3OHBA 3UXOA 1ZQNA 1M6YA 4KN4A 3PW0A 2NRXA 8ICKA 8ICAA 3C1ZA 1Z3EB 2DKZA 4UAUA 2W8KA 4YMMA 5J8YC 4DS4A 4Q8FA 4NY8A 1IM4A 3UM9A 1ZQZA 2BCRA 4OJ5A 3N7SC 2C2DA 1HJPA 3C28A 4M6WA 5KFDA 5HHIA 2JZBA 2EAMA 3ZI4A 5ALNA 2UVRA 2YQEA 4DFPA 4EEKA 1KFTA 3MFIA 1LKYB 4P4MA 3QU4A 3K75D 3WK4A 4FBUA 1SV0A 4LJXA 3GQCA 3KZXA 2KK0A 1FIQA 1COOA 3F2BA 1HIWA 3GIKA 2W3RA 2ZIUB 4XUSA 2ES6A 4YFKA 1L7OA 4F4WA 4K4GA 2EZXA 4NLKA 4B9VA 5FP0A 2KTQA 2KE7A 1TK8A 2H3VA 4EZ6A 3UPQA 3KD3A 5DBCA 2P35A 2JEGA 3UQ2A 4F5PA 3O0FA 4GC6A 1TVAA 2LPEA 4NLZA 2WAQF 4OCZA 5J2KA 2J6SA 3ED5A 2IBKA 1KFDA 4BUGA 5DQHA 9ICRA 1ZQIA 5ALWA 4B9TA 4KX3A 4JWMA 2DFLA 4ED1A 2DKXA 1GO3F 4LVSA 5KFBA 2A19A 3BS5A 1B4FA 2O6KA 2G06A 3AU2A 1D9DA 3ZD9A 5IINA 1SB3C 9ICKA 4UB8U 3OSPA 7ICHA 1D8YA 1X9MA 1A77A 3FYHA 4Q43A 2BHNA 4GXIA 4BX9C 4F2SA 3PX0A 3ZDEA 1FFVA 5DB7A 1X2IA 2MRLA 3K1ZA 5KG6A 4ECUA 3H8SA 1ZQSA 4IL6U 4J9LA 1JMSA 3C29A 3HJEA 2A3VA 4O5CA 1COKA 5J2DA 5AKHA 5L1MA 1U9LA 2KHQA 5ALRA 2BCSA 4BWMA 3ONNA 5F3XB 3KHHA 4AP9A 7ICFA 5ALHA 2NYVA 1XWLA 4C8KA 4QIWF 4RZRA 2BPGA 1ZJNA 2JEFA 4JK1A 4DF4A 2DPJA 4B9LA 3I28A 5KAIU 3DDHA 5KFRA 3T79A 1SKWA 2LYBA 8ICVA 5B5EU 2FMSA 5ALUA 3QZ8A 5J0TA 2D8CA 5EE3A 2JRZA 2KOBA 2LBOA 4C8NA 9ICJA 3JPNA 5AICA 1RYUA 2EZYA 4KLLA 2PI5A 3WKAA 4NXZA 3TADA 3AN1A 7ICSA 3HWTA 3SD7A 1N5WA 1HUOA 2V4QA 4C4TA 5AI4A 4U6PA 1OUQA 1S0NA 4DL2A 3CYMA 4QW8A 4TURA 8ICWA 5ALYA 2JMGA 3H0MB 4UB2A 1SL0A 1WWVA 5DQIA 3PNCA 5J2GA 4I2HA 3H4DA 4QWAA 1L7MA 5TISU 3LWLA 4EYHB 4NLBA 2XGQA 4B6JA 1RYRA 3PSPA 4DL3A 2J6TA 4DOAA 2KD1A 3SV4A 4RQ5A 4RT2A 5ALOA 4I2IA 1L3SA 2W54A 2JZBB 5DBAA 3RFAA 5KFEA 2F1HA 4UAZA 2EANA 3THVA 2WF7A 3IHQB 2R18A 4YXMA 2QLTA 3SQIA 4PGXA 4F2RA 2GOLA 4CF4A 1X9XA 1CI4A 4US8A 2PXIA 2G09A 4DO9A 5J2AA 2JV3A 3AMZA 2YB4A 2NO5A 1X6JA 2HHTA 5C5JA 3ALRA 1UPHA 5KFQA 5KFYA 4CE6A 4Z6EA 1SZHA 3B0XA 5J8YA 3HW8A 4FS2A 1V85A 8ICOA 5J29A 1ZQEA 2JEJA 2BQ3A 4TUPA 2HVIA 5HR6A 3S6JA 4UB5A 4IRDA 3BZKA 4I2DA 1N56A 5AK5A 2F3NA 3PW2A 3EYZA 4P2HA 3H8JA 4CDGA 4QWBA 2OXOA 1ZYQA 1X40A 1ZQTA 4F72A 2EH9A 9ICWA 1ZD2P 2ZIWA 3ISBA 4C8MA 4QZ9A 4EZ9A 4ED6A 2EZZA 3QYPA 4OD0A 1BPDA 1ZD5A 3M8SA 1MQ2A 2DQNB 4PHAA 4R65A 2ZIXA 2E1EA 3MGIA 1ZJMA 3GZFA 4TUQA 4JUZA 2VJ4A 4C8LA 1SKSA 4IS7A 2I6XA 4NM2A 2PMZC 1BPYA 2E8PA 2OYYA 2G08A 4O3PA 3SR6A 5KFLA 2BZFA 1DK3A 4R63A 1L6NA 5KT6A 2HW3A 1WCLA 5AM1A 3GILA 9ICNA 4M47A 1K1SA 3MGVA 1A6SA 4DF8A 5DB9A 4UAYA 9ICAA 1K5OA 3CP8A 3KBBA 5ALJA 2K8CB 4UBBA 1TFRA 2YMQA 5ALLA 3TACB 3QU7A 1UA0A 1ZQKA 4MHVA 2YMMA 2XCAA 1ZOLA 2CPRA 4IQWA 4ZOHC 5ALGA 3MR3A 3PW4A 2CXYA 4B9UA 2MU2A 3ZDDA 1DXSA 5AHXA 2ZTDA 1WG8A 2YN4A 5HR7A 1AROP 4O3QA 3NASA 3M6KA 4E0DA 5DG8A 1LKYA 1TK5A 1V97A 2BDPA 3KOOA 7ICOA 2Y9UA 3WKEA 1TE2A 1K1QA 5J2CA 3RJFA 4K4HA 1SL2A 4KLHA 2XCPA 2VA8A 3ICXA 1QQ6A 1NNLA 5DGBA 2MA1A 4KX5A 1WWUA 1QCKA 4Z6FA 1S77D 2E1FA 4YMNA 4QNLA 4Y2SA 5ALZA 4KLQA 4MFAA 4YG2A 5J0QA 3WKDA 1Y88A 2PFQA 5DB8A 5KT7A 5CEHA 1KBUA 3HILA 3TI0A 5CHGA 8ICEA 4Y2QA 5KT3A 9ICGA 4MEYA 3D2NA 4UATA 5ALKA 2EAPA 5KFGA 1NK5A 5DKWA 7ICPA 5BOMA 3PO4A 5K4LA 1D8LA 3Q8KA 3C2LA 3PSIA 4KLTA 2FPKA 2NRVA 4PHDA 1ZRMA 2KZ3A 5AIAA 4FFDA 2W11A 3F53A 2W9MA 4UBCA 3QEAZ 4FS1A 5J2BA 4RUAA 3MC1A 2OWOA 3ZDAA 2KEYA 3PW7A 2IOHA 2HSZA 3BJYA 5T14A 3B9JA 3E2EA 3RJEA 3RAQA 4LZGA 2A1JB 1B43A 4JV2A 1J2NA 1MA7A 4DSLA 1KTQA 4NL9A 4I2EA 4ECSA 5KFZA 4F5OA 3KTQA 5J0PA 4Y2TA 5KNIA 1ZXIA 1QSLA 4M0AA 9ICSA 4P4OA 2ODGA 2AXTU 1KDHA 3ETLA 1JX4A 2QKQA 2ZIWB 2R8GA 3G6XA 2DF4B 4JWNA 3QUTA 2I5HA 4IQTA 3UXPA 1NK6A 2B6GA 8ICCA 4NM1A 3MABA 2KFZA 4CGZA 8ICBA 5KG3A 1U45A 2VANA 1NKEA 2QB0A 2F8KA 5KFAA 1ED1A 4RNMA 4ECRA 3HT3A 4ECVA 2HCFA 5ALIA 5KL8B 2N1RA 1Q46A 5AKLA 2LYHA 4YD1A 3C23A 2FPMA 2KSOA 3VCBA 9ICIA 2H3FA 4O9MA 5KFFA 3T5LA 2IHNA 5AKYA 4I28A 4M9JA 1ZQUA 3LYSA 5KFCA 5J0SA 2P6RA 5F9LA 1S8OA 5H2FU 4CF3A 2K4EA 3RR7A 2RDJA 4Y2YA 4DQSA 4F4KA 1IV8A 2E8MA 2K60A 4EBDA 3N7PD 4J9MA 4X5VA 2E3TA
chains in the Genus database with same CATH topology
1UPHA 2K89A 1SZHA 4PL1A 3L3FX 3N7RC 2K4HA 3M6KA 2ZG6A 2GH1A 1Z1BA 2H3VA 3IN5A 2H3IA 5KL1B 2KV2A 3H0LB 2XICA 2K8BB 3IG8A 2VIXA 4NWIA 5HR6A 4P0PA 3T79A 2G5IB 2LYBA 2LYAA 3AQEA 2HOQA 3D2QA 4FZNA 2YX8A 1D8BA 3E0FA 3SAGA 2W7PA 4OJPA 3SAHA 2E5SA 2H3ZA 2K4IA 2ZIXB 4CDGA 3O0FA 4IC9A 1HEKA 2OH2A 2KOBA 2OXOA 2LBOA 2G0AA 2WAQF 2BDUA 2LHTA 1PVRA 2PMZF 5CRXA 5C0YA 3ICXA 2LKYA 1IIPA 2ZIVB 3AQFA 2XVTA 2K8AA 2MA1A 4KX5A 2KJ5A 2KKPA 4QJFB 3VC8A 2ZIWB 2ZIWA 3LVVA 2E1FA 4BUGA 3PZPA 4QNLA 3CRXA 4CRXA 4WJ3B 1XNSA 2KHVA 2DF4B 4QIWC 1PVPA 2Y0SC 2HBMA 4FE3A 2F2AB 2KJ8A 2ZXHA 4KX3A 3F2DA 4KMOB 2DQNB 4U7CA 4ACOA 2Z7JA 1GO3F 2XI9A 4NV0A 4U6PA 1MA7A 2ZIXA 2KJ9A 2E1EA 3F5AA 4PL2A 4NLCA 1OUQA 5HR7A 3NUQA 1P7DA 1A0PA 3GZFA 3CYMA 3M6ZA 4CGZA 3GU3A 2VJ4A 1KBUA 2RP5A 4FZMA 2VKQA 3AL0B 4AYBF 2RHFA 2G06A 2JMGA 3RF9A 2KKVA 2ZIVA 3KFUF 2F77X 2WAQC 3H0MB 2PMZC 2JHDA 4A8EA 4BJQA 3SAFA 1ED1A 2OYYA 2G08A 1XO0A 5A0LA 1NZBA 3D2SA 2WB1F 3D2NA 1Z19A 2XIDA 2M0NA 2F8LA 2G07A 2NV3A 2HBJA 2DGZA 1L6NA 4C0ZA 2JGAA 4OJLA 5KL8B 3PSTA 2N1RA 1F44A 2W03A 1TAMA 4NLBA 2W7OA 1CRXA 4O3MA 3PSPA 4OJ6A 4BX9C 2G5HB 2KD1A 3PSIA 3PSFA 1DRGA 3F2CA 4OJ5A 3N7SC 1YT3A 3VCBA 2H3FA 3MGVA 2W04A 1A6SA 3C28A 2HMXA 3DEEA 4ICAA 3SMVA 1T94A 2MRLA 3CP8A 3RFAA 3K1ZA 2K8CB 3F53A 2KNJA 2KICA 3LVWA 3LYSA 1Q3VA 2HBKA 3H0RB 2Y0SF 2YB1A 4GFJA 3F5EA 4AYBC 3C29A 2A3VA 2R18A 2HBLA 4P0PB 2D6FC 3OPXA 2JH7A 2F76X 2KEYA 2CPRA 2KIWA 1URJA 3SQIA 5T14A 2K4EA 3KZXA 2OM6A 3NRWA 2KHQA 2HOFA 2KVCA 2WB1C 3ALRA 3HKZF 3IP4B 4FZLA 2HOIA 2Q4TA 2GOLA 3ONNA 1ZQ1C 1WUDA 2H3QA 2ZXIA 3F2BA 1HIWA 2CRXA 4OO1J 3M7DA 2RRDA 2G09A 2VJ5A 3HKZC 4OJOA 2JH1A 2CN1A 2ZIUB 2YB4A 2ZIUA 3IG5A 3N7PD 4P0QA 1Q3UA 4P0QB 1PVQA 4QIWF 4JMUA 1ECWA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2OYY A; 
#chains in the Genus database with same CATH topology
 1F5S A;  5AKE A;  4PL1 A;  5AK4 A;  2WF5 A;  3JPS A;  1JN3 A;  2AQ0 A;  1JRO A;  2P6U A;  4J9S A;  4IRK A;  2ZUD A;  8ICX A;  1D8B A;  1ZQQ A;  1VLB A;  3RJH A;  5EE1 A;  4KMU A;  3SAH A;  2ASD A;  5KFW A;  1IXR A;  2WTF A;  1PVR A;  3BS7 A;  5KG7 A;  4RQ3 A;  1JIH A;  1BNP A;  2OEH A;  5AIB A;  2KN7 A;  2JXJ A;  1PVP A;  4FE3 A;  3FAH A;  4F93 B;  5ALX A;  4YCX A;  2IOF A;  1KEJ A;  1NK8 A;  4DL5 A;  5IIM A;  3OGU A;  1C7Y A;  4Z6D A;  2XY6 A;  4O5E A;  9ICE A;  5KT5 A;  1ZD4 A;  3AL0 B;  3I76 A;  5JU5 A;  4RT3 A;  4ECY A;  3OJS A;  3TAP A;  1Q8K A;  5AKG A;  3SEI A;  8ICS A;  7ICM A;  4F50 A;  4JV0 A;  2RLT A;  2W3S A;  1RZT A;  1RQL A;  3RB3 A;  4PGQ A;  2ZJA A;  4EEL A;  3M9M B;  5AI9 A;  1CRX A;  4R8U A;  2UVU A;  1JXE A;  1QTM A;  2OHF A;  3QUQ A;  1OXJ A;  3RB6 A;  2UVV A;  3FM9 A;  4J9P A;  3H0R B;  1CUK A;  3F5E A;  4QZG A;  2ISO A;  7ICI A;  3M9O B;  1VDV A;  4UB4 A;  2HOF A;  2AJQ A;  5B66 U;  4R64 A;  4C4S A;  3AU6 A;  1D9F A;  3PMN A;  4RQ0 A;  3H4B A;  4OO1 J;  8ICU A;  4OJO A;  2BCV A;  3BQ7 A;  5DDY A;  2I1Q A;  3JPQ A;  3T5K A;  2AGQ A;  4IR1 A;  1ZQY A;  3MDC A;  1UT5 A;  5JUM A;  5KFX A;  2GH1 A;  4GXJ A;  1RXW A;  5JRT A;  4DL7 A;  3PVX A;  3N97 B;  5J0Y A;  2KIV A;  5AM2 A;  3OJU A;  1U47 A;  3V7L A;  1ZQJ A;  3ZDC A;  2ZIV B;  4QJF B;  2YY6 A;  4O3N A;  2KP7 A;  4TUS A;  1FEZ A;  2F2A B;  5HNK A;  2K4P A;  3TAR A;  3NTU A;  4J03 A;  1P7D A;  5L1I A;  2VA2 A;  4KIT B;  4I2A A;  1T3Q A;  3LWM A;  2QB0 B;  3LDA A;  1J2M A;  1XO0 A;  5A0L A;  3BZC A;  3G6V A;  3WKC A;  2F44 A;  2R8I A;  2BR0 A;  2IOF K;  5KFN A;  2KSO B;  2DL0 A;  4RQ1 A;  3NRZ A;  5ALD A;  3HX0 A;  2HMX A;  2WHE A;  4B9S A;  2WF9 A;  3M9N B;  5EE0 A;  2HHS A;  3BQ0 A;  3ZDB A;  2IHM A;  2ALZ A;  3PML A;  5KG4 A;  2JH7 A;  3LK9 A;  2HHQ A;  4YR0 A;  1URJ A;  3RJJ A;  5J2E A;  5TZV A;  4JV1 A;  2WB1 C;  4F5R A;  3SI8 A;  3WK6 A;  3BQT A;  4DS5 A;  2VJ5 A;  3BDP A;  4C80 A;  1NI3 A;  3ISD A;  1ECW A;  2K89 A;  1DGJ A;  3N7R C;  4KLI A;  2ZG6 A;  9ICL A;  5DG7 A;  3T5H A;  2AQ4 A;  2KFN A;  5AI8 A;  3D2Q A;  3AQE A;  4JB3 A;  2DUY A;  2FE9 A;  3ETR A;  3OHA A;  2Y1J A;  3RBD A;  3RJK A;  2OH2 A;  4TQS A;  2A1J A;  2G0A A;  1XO1 A;  4RU9 A;  3C21 A;  3L5K A;  2KJ5 A;  7ICN A;  3V6H A;  2M9N A;  3QNM A;  1JUD A;  4F8R A;  5AKX A;  1U49 A;  4U7C A;  5AKJ A;  2KJ9 A;  4PL2 A;  1L3V A;  2R8J A;  4M04 A;  4J9N A;  3M6Z A;  5CR0 A;  2RP5 A;  2ZJ5 A;  9ICH A;  4QZI A;  4O3O A;  1NKB A;  2D3D A;  1B0X A;  3CW2 C;  2FMQ A;  3D2S A;  1Z19 A;  2W9B B;  2DGZ A;  3RH4 A;  4UAS A;  3HRD D;  5GTI U;  2LM4 A;  5J2J A;  2FLN A;  3H8M A;  4R8U B;  2G5H B;  2F1J A;  4USA A;  4RPX A;  4F4Y A;  2NRZ A;  2EDU A;  2YMP A;  5KG1 A;  1S0O A;  4ICA A;  4QZ8 A;  5KFM A;  5J0X A;  2YB1 A;  1X9S A;  2ESE A;  1PUZ A;  4I2B A;  1LVH A;  1KFS A;  4UB6 U;  3WK7 A;  4FO6 A;  4KLO A;  3IP4 B;  5KFI A;  4DQP A;  3RJG A;  4QZD A;  2R8K A;  5KTQ A;  3M7D A;  2RRD A;  3IG5 A;  4QWE A;  4ED0 A;  2ATL A;  1MC8 A;  3C2M A;  1JAL A;  5KG2 A;  4DFK A;  2K4H A;  3UMG A;  1KW4 A;  4DQR A;  3UMC A;  3H0L B;  4G3I A;  1QH9 A;  1L7N A;  3SAG A;  2W7P A;  1NKC A;  7ICL A;  4PJ0 U;  4PZN A;  3Q8L A;  5J0O A;  3G6Y A;  3WK9 A;  2PMZ F;  4QZA A;  1KQQ A;  1FO4 A;  5KFP A;  1IIP A;  4EBE A;  1MN8 A;  2K8A A;  4GLX A;  1JXL A;  3CRX A;  1QSY A;  2JEI A;  9ICQ A;  2HHW A;  8ICZ A;  9ICT A;  2KJ8 A;  3WK5 A;  2Y1I A;  1NZP A;  3R9K A;  1SL1 A;  8ICT A;  4RQ2 A;  1SGG A;  3D6J A;  1ZQM A;  4NV0 A;  4CNQ A;  3TFS A;  1A0P A;  3GU3 A;  1C20 A;  2EAO A;  3MGH A;  5ALT A;  4F4Z A;  2OCE A;  2KKV A;  5J0U A;  2DPI A;  2GO7 A;  5BPC A;  1KSP A;  4RPY A;  7ICG A;  1JRP A;  4KN7 A;  1F0M A;  5IIL A;  3PW5 A;  8ICM A;  5AK6 A;  5KG0 A;  2I9G A;  3PST A;  3KHR A;  4Q45 A;  4KTQ A;  1SV4 A;  1YZ6 A;  2XY7 A;  1AQ6 A;  3MFH A;  7ICU A;  1L8L A;  4NJ8 A;  3TKA A;  4ECQ A;  1BVS A;  2KNJ A;  2W43 A;  2AHO B;  2H5X A;  4AYB C;  1KLN A;  2BGW A;  2HHU A;  1O08 A;  8ICY A;  2KIW A;  2MSN A;  1T4G A;  4F71 A;  4EX7 A;  5J2F A;  2ZXI A;  1RM6 C;  4DOB A;  1S97 A;  1PK1 B;  1XS9 D;  5F9N A;  3IV6 A;  4RPZ A;  3C5F A;  4J9O A;  2VIX A;  4F5N A;  1ZQG A;  1ZQV A;  5D46 A;  5AI0 A;  2HOQ A;  5CB1 A;  4EBC A;  4IQU A;  4RUC A;  1OW5 A;  2E5S A;  5J0W A;  3QU2 A;  4KLS A;  4EEY A;  5AI5 A;  1SXE A;  5C0Y A;  4EEN A;  2AGP A;  1DK2 A;  5KFK A;  3VC8 A;  1ZRN A;  3LVV A;  4I2J A;  4F91 B;  1YZ7 A;  1XNS A;  3PR5 B;  7ICK A;  2AH5 A;  2Y0S C;  4QZF A;  1KRP A;  5DQG A;  4TQR A;  1HUZ A;  2BCU A;  5G5H A;  1SKR A;  5EWE A;  1S5L U;  4P4P A;  5L9X A;  4CCH A;  4BWJ A;  2LI6 A;  3PX4 A;  8ICL A;  3H7I A;  2ZIV A;  3ISC A;  4QZH A;  1SZP A;  3Q8S B;  3C1Y A;  3RB0 A;  2XID A;  1ZQC A;  4ECX A;  2B0C A;  4KLF A;  4UB1 A;  5BOL A;  3RH6 A;  7ICE A;  1UQV A;  2E8O A;  2W03 A;  4O3M A;  3RBE A;  3JPP A;  1YT3 A;  1DOQ A;  3KZI U;  1S0V A;  2P66 A;  1X9W A;  5KFJ A;  3PO5 A;  4C4R A;  4YMO A;  2HBK A;  5E79 U;  5ALQ A;  3K1R B;  5HHH A;  1V38 A;  1IG6 A;  5AKI A;  5EOZ A;  1LB2 B;  2ZTE A;  2MAX A;  9ICC A;  3HKZ F;  2Q4T A;  4KLG A;  1WUD A;  3TAN A;  2CN1 A;  4ED2 A;  4P0Q A;  5DGA A;  4JMU A;  4Y2J A;  1NK0 A;  3IM1 A;  3L3F X;  5CJ7 A;  2BQU A;  5IIO A;  2HDO A;  3IG8 A;  1RQN A;  1X42 A;  2LYA A;  3H8W A;  1Z00 A;  3J81 j;  2VA3 A;  4DL4 A;  1UCV A;  2FDR A;  2XGP A;  1HEK A;  2LHT A;  7ICQ A;  4Q44 A;  1KKX A;  4M9G A;  5IIK A;  1O03 A;  3PZP A;  3QU5 A;  2R8H A;  2ZXH A;  2XO7 A;  3NVV A;  3QU9 A;  4F92 B;  3I1Y A;  3EUB 2;  4J9K A;  3QE9 Y;  1PZN A;  1H38 A;  3GII A;  3ZD8 A;  4PH5 A;  3EPI A;  4I2F A;  1L8O A;  2VKQ A;  2KG5 A;  1XSL A;  8ICN A;  4PHP A;  3V7J A;  2WAQ C;  3SAF A;  1NJW A;  4XQ8 A;  4RNN A;  2NRW A;  5EWF A;  4M9N A;  2F8L A;  2NV3 A;  2HBJ A;  4UAW A;  2BPF A;  9ICV A;  1F44 A;  3C2K A;  7ICJ A;  1TAM A;  1PK3 A;  2HVH A;  4DLE A;  3RAX A;  4IRC A;  8ICG A;  3QX7 A;  5DB6 A;  5AM5 A;  1T94 A;  5JTI A;  4F5Q A;  2ZUC A;  3MDA A;  1Q3V A;  4DQQ A;  2HI0 A;  5ALM A;  4HYK A;  1NK9 A;  1RG6 A;  4Q8E A;  3NVY A;  3QXG A;  2W9B A;  3AEV A;  4YXJ A;  1Z4O A;  1ZQO A;  4YP3 A;  2F1I A;  4Z6C A;  4MF2 A;  1ZQX A;  4LZD A;  3HPO A;  2BPC A;  5AM0 A;  2JH1 A;  3NGD A;  3Q8R B;  1PVQ A;  2BKE A;  3QEB Z;  2RDI A;  4DSE A;  8ICF A;  2H3I A;  4HAI A;  2G5I B;  2L5Y A;  3HP6 A;  2K4I A;  1L5U A;  2WFA A;  1MSW D;  4I2C A;  7ICT A;  4RQN A;  5KFS A;  5CRX A;  3OTQ A;  2C2E A;  2LKY A;  1N62 A;  5ALF A;  1N61 A;  2EQY A;  4QIW C;  5DG9 A;  9ICO A;  1KL9 A;  5KT4 A;  4G9B A;  4PHE A;  2J6U A;  3PV8 A;  5CA7 A;  1EXN A;  2YTU A;  3RR8 A;  1TV9 A;  3F5A A;  4NLC A;  4IQV A;  3KHG A;  2XC9 A;  1ZQR A;  2KZM A;  1U4B A;  4YD2 A;  2ZUB A;  3KKA C;  4QZB A;  3RRH A;  1BPB A;  4A8E A;  4BJQ A;  2B21 A;  3JPR A;  5DLF A;  3FC4 A;  3A0B U;  2W8L A;  4DWI A;  5AM4 A;  9ICU A;  4BGD A;  4OJL A;  2ZTC A;  3MR6 A;  1L3U A;  4DFD A;  4ELU A;  1ZQL A;  4YQW A;  2MUT B;  1XSN A;  2W04 A;  4UW9 A;  4C7Z A;  2XY5 A;  3DEE A;  4R66 A;  4J9R A;  4QW9 A;  1ZET A;  2Q0Z X;  8ICH A;  2NRT A;  4DQI A;  5HP4 A;  4P0P B;  2PFO A;  1ZQW A;  3OPX A;  1V9P A;  2F76 X;  4BXO B;  1BNO A;  1S9F A;  3M8R A;  3V72 A;  4EYI B;  3Q8M A;  1DGS A;  1U48 A;  3PX6 A;  9ICB A;  3H40 A;  4P0Q B;  2KVS A;  2AGO A;  1ZQF A;  2HHX A;  3WK8 A;  3MR2 A;  4QWC A;  4ECW A;  1ZQA A;  2KV2 A;  2K8B B;  4Y2P A;  4BDP A;  4FZN A;  9ICX A;  1TAQ A;  1Z00 B;  4OJP A;  2FMP A;  3WU2 U;  1JI7 A;  3RH5 A;  1QQ7 A;  5EWG A;  2DWQ A;  2XVT A;  1QSS A;  3JPT A;  4C7Y A;  4K4I A;  4CRX A;  1PK1 A;  4YR2 A;  3B0Y A;  3MR5 A;  3BQ1 A;  5HMM A;  3SZ2 A;  5KFV A;  4XRH A;  4B9M A;  4NL9 C;  1RPL A;  4ECZ A;  2Z7J A;  3EZ5 A;  4DFJ A;  1X6I A;  1ZQB A;  3GDX A;  4M6W B;  4RQ7 A;  2ASJ A;  2ASL A;  1UA1 A;  3V7K A;  8ICR A;  3Q8P B;  2RHF A;  1VJ5 A;  4J9Q A;  1TK0 A;  2WB1 F;  4O3R A;  4QZE A;  2G07 A;  4GXK A;  1MQ3 A;  2QAR A;  3UXN A;  5ALS A;  3PR4 A;  2WF6 A;  3PSF A;  5AI6 A;  3F2C A;  3IRU A;  4I29 A;  4RQM A;  5IIJ A;  4ED7 A;  5AM3 A;  5D49 A;  2KIC A;  1X66 A;  3LVW A;  4F4X A;  5G5G A;  1SXD A;  1UHU A;  2HBL A;  4ZH4 A;  2D6F C;  5ALE A;  3SYZ A;  7ICV A;  8ICI A;  2PFP A;  2FPL A;  1QLN A;  5J0R A;  5KAF U;  2KZZ A;  1ZQ1 C;  4PGY A;  5KFU A;  3RJI A;  1S76 D;  1Q3U A;  3N28 A;  4DFM A;  7ICR A;  2FLP A;  1UT8 A;  1Z1B A;  4CF5 A;  3IN5 A;  3GV5 B;  2LM1 A;  5L1K A;  4NLN A;  3T5J A;  3GIM A;  1BGX T;  5EE9 A;  3E0F A;  5KG5 A;  5KT2 A;  5GTH U;  3BS5 B;  3GV7 B;  4Y2R A;  4Y2U A;  4O3S A;  3AQF A;  3NVW A;  2KKP A;  3FDS A;  4MFC A;  2W9C A;  2GLE A;  2UVW A;  4PPX A;  4GIB A;  2JR5 A;  1N60 A;  4B9N A;  4YR3 A;  1Z4N A;  4DOC A;  4PZO A;  4KMO B;  3IDW A;  1RYS A;  4M2Y A;  4RQ8 A;  2IMW P;  3EWA A;  3QUB A;  3TAQ A;  1SV0 C;  2NO4 A;  2BQR A;  1TAU A;  3RF9 A;  1A76 A;  3KFU F;  4ELV A;  2JHD A;  4DSK A;  4O0I A;  2FI1 A;  4RNO A;  3T3F A;  4DSF A;  3EW9 A;  3ORY A;  1NZB A;  4YVZ A;  1NJZ A;  3Q8Q B;  3A0H U;  1T7P A;  2IA6 A;  4C0Z A;  2JGA A;  1ZD3 A;  3MBY A;  4OJ6 A;  1DRG A;  4KLD A;  2QB1 A;  1CEZ A;  2FJ6 A;  3N4M B;  3SMV A;  4RQ4 A;  4Y2V A;  2LMR A;  4GFJ A;  4DEZ A;  2WF8 A;  3L4P A;  4DL6 A;  1QQ5 A;  1WYG A;  5J2I A;  3E58 A;  3NRW A;  2OM6 A;  3SEN A;  1NK7 A;  2KVC A;  4FZL A;  9ICF A;  3KKA A;  3C5G A;  4EX6 A;  3AUO A;  1RDF A;  2H3Q A;  3GFK B;  5J2H A;  1TKD A;  2ZIU A;  3WKB A;  1ZQH A;  1N2X A;  5DBB A;  4ECT A;  4ELT A;  3BQ2 A;  4I27 A;  2E8N A;  5KFT A;  1NJX A;  4KLM A;  4RQ6 A;  3UMB A;  4F3O A;  5KL1 B;  2XIC A;  2V9W A;  1BPE A;  2YX8 A;  5CWR A;  4QWD A;  1S10 A;  2ZJ8 A;  2A1A A;  5ALP A;  8ICQ A;  1SWV A;  2C22 A;  1NOM A;  3JPO A;  3CNH A;  4WJ3 B;  5AKZ A;  5KFH A;  2KMD A;  4KLE A;  3GIJ A;  3F2D A;  3RB4 A;  1S0M A;  1KN5 A;  4ACO A;  3K4G A;  1XSP A;  3NUQ A;  1SWW A;  1RXV A;  4M9H A;  2V4R A;  1Z1V A;  4YN4 A;  1NJY A;  3NVZ A;  4AYB F;  2DBY A;  2F77 X;  2PKE A;  1J97 A;  4KLU A;  2M0N A;  4FBT A;  2QAR B;  2FLL A;  4DLG A;  3QUC A;  1BPX A;  2W7O A;  1XU4 A;  3OSN A;  5ALV A;  3PY8 A;  1WCN A;  4UB3 A;  2YML A;  9ICP A;  4M9L A;  2Y9T A;  3V6J A;  2AU0 A;  3SV3 A;  1T8E A;  1BPZ A;  3V6K A;  4O5K A;  2PI4 A;  5DLG A;  3RRG A;  4ED8 A;  1L3T A;  2HOI A;  4DSJ A;  3RTV A;  2BCQ A;  2PFN A;  3EPG A;  4DCC A;  2HHV A;  3TAD C;  3KHL A;  2CRX A;  3U26 A;  2MUT A;  3TFR A;  3HKZ C;  5AK3 A;  4MFF A;  2Y0S F;  4US9 A;  5III A;  5DDM A;  3M1Y A;  4Y2X A;  1B22 A;  1XC9 A;  1LV5 A;  3UQ0 A;  1NK4 A;  4XA5 A;  4C8O A;  1L7P A;  4NWI A;  4MF8 A;  2C2R A;  4P0P A;  5HML A;  4BXO A;  8ICJ A;  3QZ7 A;  2H3Z A;  2ZIX B;  3GV8 B;  4IC9 A;  2RQ5 A;  1FFU A;  5AKK A;  1ZQD A;  1N48 A;  4UQG A;  2BDU A;  1T3N A;  4KLJ A;  4DSI A;  1N5X A;  5KFO A;  4UAR A;  5L1L A;  8ICP A;  5CP2 A;  4NLG A;  3DV9 A;  5L1J A;  2ISP A;  5D4B A;  2W9C B;  4MEX A;  2KHV A;  1ZQP A;  2HBM A;  4IR9 A;  9ICM A;  4GC7 A;  3TQ1 A;  4UAV A;  2C28 A;  4I2G A;  4QZC A;  2XI9 A;  1SIJ A;  4ED3 A;  1N63 A;  3NS1 A;  2W55 A;  2GWS A;  4FZM A;  2W9A A;  3AM9 A;  3OHB A;  3UXO A;  1ZQN A;  1M6Y A;  4KN4 A;  3PW0 A;  2NRX A;  8ICK A;  8ICA A;  3C1Z A;  1Z3E B;  2DKZ A;  4UAU A;  2W8K A;  4YMM A;  5J8Y C;  4DS4 A;  4Q8F A;  4NY8 A;  1IM4 A;  3UM9 A;  1ZQZ A;  2BCR A;  4OJ5 A;  3N7S C;  2C2D A;  1HJP A;  3C28 A;  4M6W A;  5KFD A;  5HHI A;  2JZB A;  2EAM A;  3ZI4 A;  5ALN A;  2UVR A;  2YQE A;  4DFP A;  4EEK A;  1KFT A;  3MFI A;  1LKY B;  4P4M A;  3QU4 A;  3K75 D;  3WK4 A;  4FBU A;  1SV0 A;  4LJX A;  3GQC A;  3KZX A;  2KK0 A;  1FIQ A;  1COO A;  3F2B A;  1HIW A;  3GIK A;  2W3R A;  2ZIU B;  4XUS A;  2ES6 A;  4YFK A;  1L7O A;  4F4W A;  4K4G A;  2EZX A;  4NLK A;  4B9V A;  5FP0 A;  2KTQ A;  2KE7 A;  1TK8 A;  2H3V A;  4EZ6 A;  3UPQ A;  3KD3 A;  5DBC A;  2P35 A;  2JEG A;  3UQ2 A;  4F5P A;  3O0F A;  4GC6 A;  1TVA A;  2LPE A;  4NLZ A;  2WAQ F;  4OCZ A;  5J2K A;  2J6S A;  3ED5 A;  2IBK A;  1KFD A;  4BUG A;  5DQH A;  9ICR A;  1ZQI A;  5ALW A;  4B9T A;  4KX3 A;  4JWM A;  2DFL A;  4ED1 A;  2DKX A;  1GO3 F;  4LVS A;  5KFB A;  2A19 A;  3BS5 A;  1B4F A;  2O6K A;  2G06 A;  3AU2 A;  1D9D A;  3ZD9 A;  5IIN A;  1SB3 C;  9ICK A;  4UB8 U;  3OSP A;  7ICH A;  1D8Y A;  1X9M A;  1A77 A;  3FYH A;  4Q43 A;  2BHN A;  4GXI A;  4BX9 C;  4F2S A;  3PX0 A;  3ZDE A;  1FFV A;  5DB7 A;  1X2I A;  2MRL A;  3K1Z A;  5KG6 A;  4ECU A;  3H8S A;  1ZQS A;  4IL6 U;  4J9L A;  1JMS A;  3C29 A;  3HJE A;  2A3V A;  4O5C A;  1COK A;  5J2D A;  5AKH A;  5L1M A;  1U9L A;  2KHQ A;  5ALR A;  2BCS A;  4BWM A;  3ONN A;  5F3X B;  3KHH A;  4AP9 A;  7ICF A;  5ALH A;  2NYV A;  1XWL A;  4C8K A;  4QIW F;  4RZR A;  2BPG A;  1ZJN A;  2JEF A;  4JK1 A;  4DF4 A;  2DPJ A;  4B9L A;  3I28 A;  5KAI U;  3DDH A;  5KFR A;  3T79 A;  1SKW A;  2LYB A;  8ICV A;  5B5E U;  2FMS A;  5ALU A;  3QZ8 A;  5J0T A;  2D8C A;  5EE3 A;  2JRZ A;  2KOB A;  2LBO A;  4C8N A;  9ICJ A;  3JPN A;  5AIC A;  1RYU A;  2EZY A;  4KLL A;  2PI5 A;  3WKA A;  4NXZ A;  3TAD A;  3AN1 A;  7ICS A;  3HWT A;  3SD7 A;  1N5W A;  1HUO A;  2V4Q A;  4C4T A;  5AI4 A;  4U6P A;  1OUQ A;  1S0N A;  4DL2 A;  3CYM A;  4QW8 A;  4TUR A;  8ICW A;  5ALY A;  2JMG A;  3H0M B;  4UB2 A;  1SL0 A;  1WWV A;  5DQI A;  3PNC A;  5J2G A;  4I2H A;  3H4D A;  4QWA A;  1L7M A;  5TIS U;  3LWL A;  4EYH B;  4NLB A;  2XGQ A;  4B6J A;  1RYR A;  3PSP A;  4DL3 A;  2J6T A;  4DOA A;  2KD1 A;  3SV4 A;  4RQ5 A;  4RT2 A;  5ALO A;  4I2I A;  1L3S A;  2W54 A;  2JZB B;  5DBA A;  3RFA A;  5KFE A;  2F1H A;  4UAZ A;  2EAN A;  3THV A;  2WF7 A;  3IHQ B;  2R18 A;  4YXM A;  2QLT A;  3SQI A;  4PGX A;  4F2R A;  2GOL A;  4CF4 A;  1X9X A;  1CI4 A;  4US8 A;  2PXI A;  2G09 A;  4DO9 A;  5J2A A;  2JV3 A;  3AMZ A;  2YB4 A;  2NO5 A;  1X6J A;  2HHT A;  5C5J A;  3ALR A;  1UPH A;  5KFQ A;  5KFY A;  4CE6 A;  4Z6E A;  1SZH A;  3B0X A;  5J8Y A;  3HW8 A;  4FS2 A;  1V85 A;  8ICO A;  5J29 A;  1ZQE A;  2JEJ A;  2BQ3 A;  4TUP A;  2HVI A;  5HR6 A;  3S6J A;  4UB5 A;  4IRD A;  3BZK A;  4I2D A;  1N56 A;  5AK5 A;  2F3N A;  3PW2 A;  3EYZ A;  4P2H A;  3H8J A;  4CDG A;  4QWB A;  2OXO A;  1ZYQ A;  1X40 A;  1ZQT A;  4F72 A;  2EH9 A;  9ICW A;  1ZD2 P;  2ZIW A;  3ISB A;  4C8M A;  4QZ9 A;  4EZ9 A;  4ED6 A;  2EZZ A;  3QYP A;  4OD0 A;  1BPD A;  1ZD5 A;  3M8S A;  1MQ2 A;  2DQN B;  4PHA A;  4R65 A;  2ZIX A;  2E1E A;  3MGI A;  1ZJM A;  3GZF A;  4TUQ A;  4JUZ A;  2VJ4 A;  4C8L A;  1SKS A;  4IS7 A;  2I6X A;  4NM2 A;  2PMZ C;  1BPY A;  2E8P A;  2OYY A;  2G08 A;  4O3P A;  3SR6 A;  5KFL A;  2BZF A;  1DK3 A;  4R63 A;  1L6N A;  5KT6 A;  2HW3 A;  1WCL A;  5AM1 A;  3GIL A;  9ICN A;  4M47 A;  1K1S A;  3MGV A;  1A6S A;  4DF8 A;  5DB9 A;  4UAY A;  9ICA A;  1K5O A;  3CP8 A;  3KBB A;  5ALJ A;  2K8C B;  4UBB A;  1TFR A;  2YMQ A;  5ALL A;  3TAC B;  3QU7 A;  1UA0 A;  1ZQK A;  4MHV A;  2YMM A;  2XCA A;  1ZOL A;  2CPR A;  4IQW A;  4ZOH C;  5ALG A;  3MR3 A;  3PW4 A;  2CXY A;  4B9U A;  2MU2 A;  3ZDD A;  1DXS A;  5AHX A;  2ZTD A;  1WG8 A;  2YN4 A;  5HR7 A;  1ARO P;  4O3Q A;  3NAS A;  3M6K A;  4E0D A;  5DG8 A;  1LKY A;  1TK5 A;  1V97 A;  2BDP A;  3KOO A;  7ICO A;  2Y9U A;  3WKE A;  1TE2 A;  1K1Q A;  5J2C A;  3RJF A;  4K4H A;  1SL2 A;  4KLH A;  2XCP A;  2VA8 A;  3ICX A;  1QQ6 A;  1NNL A;  5DGB A;  2MA1 A;  4KX5 A;  1WWU A;  1QCK A;  4Z6F A;  1S77 D;  2E1F A;  4YMN A;  4QNL A;  4Y2S A;  5ALZ A;  4KLQ A;  4MFA A;  4YG2 A;  5J0Q A;  3WKD A;  1Y88 A;  2PFQ A;  5DB8 A;  5KT7 A;  5CEH A;  1KBU A;  3HIL A;  3TI0 A;  5CHG A;  8ICE A;  4Y2Q A;  5KT3 A;  9ICG A;  4MEY A;  3D2N A;  4UAT A;  5ALK A;  2EAP A;  5KFG A;  1NK5 A;  5DKW A;  7ICP A;  5BOM A;  3PO4 A;  5K4L A;  1D8L A;  3Q8K A;  3C2L A;  3PSI A;  4KLT A;  2FPK A;  2NRV A;  4PHD A;  1ZRM A;  2KZ3 A;  5AIA A;  4FFD A;  2W11 A;  3F53 A;  2W9M A;  4UBC A;  3QEA Z;  4FS1 A;  5J2B A;  4RUA A;  3MC1 A;  2OWO A;  3ZDA A;  2KEY A;  3PW7 A;  2IOH A;  2HSZ A;  3BJY A;  5T14 A;  3B9J A;  3E2E A;  3RJE A;  3RAQ A;  4LZG A;  2A1J B;  1B43 A;  4JV2 A;  1J2N A;  1MA7 A;  4DSL A;  1KTQ A;  4NL9 A;  4I2E A;  4ECS A;  5KFZ A;  4F5O A;  3KTQ A;  5J0P A;  4Y2T A;  5KNI A;  1ZXI A;  1QSL A;  4M0A A;  9ICS A;  4P4O A;  2ODG A;  2AXT U;  1KDH A;  3ETL A;  1JX4 A;  2QKQ A;  2ZIW B;  2R8G A;  3G6X A;  2DF4 B;  4JWN A;  3QUT A;  2I5H A;  4IQT A;  3UXP A;  1NK6 A;  2B6G A;  8ICC A;  4NM1 A;  3MAB A;  2KFZ A;  4CGZ A;  8ICB A;  5KG3 A;  1U45 A;  2VAN A;  1NKE A;  2QB0 A;  2F8K A;  5KFA A;  1ED1 A;  4RNM A;  4ECR A;  3HT3 A;  4ECV A;  2HCF A;  5ALI A;  5KL8 B;  2N1R A;  1Q46 A;  5AKL A;  2LYH A;  4YD1 A;  3C23 A;  2FPM A;  2KSO A;  3VCB A;  9ICI A;  2H3F A;  4O9M A;  5KFF A;  3T5L A;  2IHN A;  5AKY A;  4I28 A;  4M9J A;  1ZQU A;  3LYS A;  5KFC A;  5J0S A;  2P6R A;  5F9L A;  1S8O A;  5H2F U;  4CF3 A;  2K4E A;  3RR7 A;  2RDJ A;  4Y2Y A;  4DQS A;  4F4K A;  1IV8 A;  2E8M A;  2K60 A;  4EBD A;  3N7P D;  4J9M A;  4X5V A;  2E3T A; 
#chains in the Genus database with same CATH homology
 1UPH A;  2K89 A;  1SZH A;  4PL1 A;  3L3F X;  3N7R C;  2K4H A;  3M6K A;  2ZG6 A;  2GH1 A;  1Z1B A;  2H3V A;  3IN5 A;  2H3I A;  5KL1 B;  2KV2 A;  3H0L B;  2XIC A;  2K8B B;  3IG8 A;  2VIX A;  4NWI A;  5HR6 A;  4P0P A;  3T79 A;  2G5I B;  2LYB A;  2LYA A;  3AQE A;  2HOQ A;  3D2Q A;  4FZN A;  2YX8 A;  1D8B A;  3E0F A;  3SAG A;  2W7P A;  4OJP A;  3SAH A;  2E5S A;  2H3Z A;  2K4I A;  2ZIX B;  4CDG A;  3O0F A;  4IC9 A;  1HEK A;  2OH2 A;  2KOB A;  2OXO A;  2LBO A;  2G0A A;  2WAQ F;  2BDU A;  2LHT A;  1PVR A;  2PMZ F;  5CRX A;  5C0Y A;  3ICX A;  2LKY A;  1IIP A;  2ZIV B;  3AQF A;  2XVT A;  2K8A A;  2MA1 A;  4KX5 A;  2KJ5 A;  2KKP A;  4QJF B;  3VC8 A;  2ZIW B;  2ZIW A;  3LVV A;  2E1F A;  4BUG A;  3PZP A;  4QNL A;  3CRX A;  4CRX A;  4WJ3 B;  1XNS A;  2KHV A;  2DF4 B;  4QIW C;  1PVP A;  2Y0S C;  2HBM A;  4FE3 A;  2F2A B;  2KJ8 A;  2ZXH A;  4KX3 A;  3F2D A;  4KMO B;  2DQN B;  4U7C A;  4ACO A;  2Z7J A;  1GO3 F;  2XI9 A;  4NV0 A;  4U6P A;  1MA7 A;  2ZIX A;  2KJ9 A;  2E1E A;  3F5A A;  4PL2 A;  4NLC A;  1OUQ A;  5HR7 A;  3NUQ A;  1P7D A;  1A0P A;  3GZF A;  3CYM A;  3M6Z A;  4CGZ A;  3GU3 A;  2VJ4 A;  1KBU A;  2RP5 A;  4FZM A;  2VKQ A;  3AL0 B;  4AYB F;  2RHF A;  2G06 A;  2JMG A;  3RF9 A;  2KKV A;  2ZIV A;  3KFU F;  2F77 X;  2WAQ C;  3H0M B;  2PMZ C;  2JHD A;  4A8E A;  4BJQ A;  3SAF A;  1ED1 A;  2OYY A;  2G08 A;  1XO0 A;  5A0L A;  1NZB A;  3D2S A;  2WB1 F;  3D2N A;  1Z19 A;  2XID A;  2M0N A;  2F8L A;  2G07 A;  2NV3 A;  2HBJ A;  2DGZ A;  1L6N A;  4C0Z A;  2JGA A;  4OJL A;  5KL8 B;  3PST A;  2N1R A;  1F44 A;  2W03 A;  1TAM A;  4NLB A;  2W7O A;  1CRX A;  4O3M A;  3PSP A;  4OJ6 A;  4BX9 C;  2G5H B;  2KD1 A;  3PSI A;  3PSF A;  1DRG A;  3F2C A;  4OJ5 A;  3N7S C;  1YT3 A;  3VCB A;  2H3F A;  3MGV A;  2W04 A;  1A6S A;  3C28 A;  2HMX A;  3DEE A;  4ICA A;  3SMV A;  1T94 A;  2MRL A;  3CP8 A;  3RFA A;  3K1Z A;  2K8C B;  3F53 A;  2KNJ A;  2KIC A;  3LVW A;  3LYS A;  1Q3V A;  2HBK A;  3H0R B;  2Y0S F;  2YB1 A;  4GFJ A;  3F5E A;  4AYB C;  3C29 A;  2A3V A;  2R18 A;  2HBL A;  4P0P B;  2D6F C;  3OPX A;  2JH7 A;  2F76 X;  2KEY A;  2CPR A;  2KIW A;  1URJ A;  3SQI A;  5T14 A;  2K4E A;  3KZX A;  2OM6 A;  3NRW A;  2KHQ A;  2HOF A;  2KVC A;  2WB1 C;  3ALR A;  3HKZ F;  3IP4 B;  4FZL A;  2HOI A;  2Q4T A;  2GOL A;  3ONN A;  1ZQ1 C;  1WUD A;  2H3Q A;  2ZXI A;  3F2B A;  1HIW A;  2CRX A;  4OO1 J;  3M7D A;  2RRD A;  2G09 A;  2VJ5 A;  3HKZ C;  4OJO A;  2JH1 A;  2CN1 A;  2ZIU B;  2YB4 A;  2ZIU A;  3IG5 A;  3N7P D;  4P0Q A;  1Q3U A;  4P0Q B;  1PVQ A;  4QIW F;  4JMU A;  1ECW A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...