2OYYA

Hthp: a hexameric tyrosine-coordinated heme protein
Total Genus 30
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
30
sequence length
71
structure length
71
Chain Sequence
b'TWLPTLVTATPQEGFDLAVKLSRIAVKKTQPDAQVRDTLRAVYEKDANALIAVSAVVATHFQTIAAANDYW'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Hexameric cytochrome
publication title HTHP: A Novel Class of Hexameric, Tyrosine-coordinated Heme Proteins
pubmed doi rcsb
source organism Silicibacter pomeroyi
molecule tags Unknown function
total genus 30
structure length 71
sequence length 71
chains with identical sequence B, C, D, E, F, G, H
ec nomenclature
pdb deposition date 2007-02-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF11534 HTHP Hexameric tyrosine-coordinated heme protein (HTHP)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.500 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 DNA polymerase; domain 1 2oyyA00
2OYYA
chains in the Genus database with same CATH superfamily
2YQEA 5JU5A 4C8MA 4QZBA 4I2FA 4QZEA 4USAA 4K4HA 9ICHA 1NI3A 4KMUA 4DS4A 3T5KA 1ZQOA 3VC8A 4Y2VA 1UPHA 4RQ4A 4DF4A 5KL8B 2NRWA 4F2SA 1JN3A 7ICFA 3GU3A 4DFDA 2NRTA 1SZPA 5IIOA 5C0YA 1JALA 1ZQKA 1ZQAA 2EAPA 2BCVA 1X6IA 3ALRA 5EE9A 4DL3A 4B6JA 2W7PA 4DSKA 3RAXA 1NJXA 3RFAA 3KTQA 3ORYA 4ELUA 5CJ7A 2AQ4A 5EE0A 4MEXA 7ICEA 1SV0C 4Y2TA 2BCUA 2R8KA 3I1YA 2G06A 4YR2A 9ICOA 4ED1A 1WYGA 5J2FA 2HOFA 4O0IA 5KG4A 3U26A 3KOOA 2KIVA 3KKAA 1Q3VA 3HKZC 2JMGA 2Y9TA 3S6JA 1MC8A 4UBBA 8ICFA 1RM6C 5KT5A 2IHMA 4O3QA 4XQ8A 4C4TA 3GDXA 2GWSA 5ALDA 8ICIA 5F9NA 4CGZA 2Q0ZX 1V85A 2W54A 1ZJMA 3EPIA 2ASLA 5J0OA 3QEAZ 4RUCA 1ZQEA 3TFSA 1S0MA 4KLEA 4FE3A 4YR0A 2AQ0A 2HBLA 3N7SC 4PGXA 5HMLA 4F4WA 1ZQTA 4I2HA 1ZQSA 7ICGA 2NRVA 1NK6A 7ICMA 2RQ5A 2BZFA 8ICKA 5L1LA 9ICKA 4B9LA 4FFDA 2ZIXA 5ALLA 1TK0A 4QWAA 4KLLA 4TUPA 4DFMA 1ZRNA 4AP9A 2JH1A 5KT7A 5ALXA 5KFOA 2VJ5A 3V7JA 9ICXA 1XSPA 5DB8A 4M9JA 3LDAA 3WKDA 3DV9A 2ZJ5A 1ZQQA 5DDMA 5KAFU 4QNLA 7ICOA 2W9BA 5KNIA 4MHVA 2O6KA 5KG3A 3UPQA 2DPIA 4FZMA 5J2BA 5HMMA 1FFVA 1BPBA 8ICJA 5J0TA 1N63A 3AN1A 2QARA 3SV3A 1ZQZA 5KFKA 2KTQA 2N1RA 9ICAA 2BPFA 4J9LA 4F5QA 4J9MA 2F44A 8ICXA 1P7DA 2C22A 4BUGA 2QB0B 2H3FA 3Q8SB 2V4QA 5F9LA 1SV4A 4RZRA 1QQ5A 4EEYA 1BNOA 9ICFA 2KG5A 3SR6A 1QSYA 3Q8RB 1YT3A 4ECRA 2ES6A 3PW2A 5J0WA 8ICYA 2C28A 3GV7B 3RB6A 4KLMA 7ICHA 2BQRA 2FMPA 5DG7A 3KKAC 1HJPA 5DQGA 1A0PA 1TVAA 1VJ5A 2JZBB 4LZDA 2HW3A 4CF3A 2PI4A 4TQSA 2FMSA 3V72A 3A0HU 4YQWA 3RJKA 8ICLA 4DL7A 1LKYB 1Z00A 1JMSA 3ISCA 4R63A 3BDPA 2A3VA 1XO1A 5EOZA 4DOCA 3SEIA 1DK2A 4DL5A 3PW4A 2YMMA 1SKSA 2H3QA 4ECSA 3BZCA 3H0MB 3QUQA 3TANA 4Q44A 1S5LU 1SIJA 4I27A 4Y2PA 2E1EA 2Y0SC 3IV6A 3LVWA 2F2AB 8ICBA 4IR9A 3OSPA 1UHUA 4NXZA 5J2GA 4F4KA 8ICEA 3RR8A 4BDPA 5DQHA 3IM1A 4DOAA 5T14A 3PNCA 3OTQA 2F77X 1KN5A 4B9UA 2R8GA 3ZDDA 5ALEA 5KG1A 4I2CA 3H8JA 4JV2A 4B9MA 1X9SA 3BS7A 4MEYA 8ICWA 1QSLA 1DOQA 4UATA 1X9WA 3C2MA 3M8SA 1PVRA 5DGBA 2KV2A 3VCBA 1NJWA 2WAQF 3MBYA 1WCLA 5IIIA 3UMGA 5CR0A 1IIPA 2KSOA 5KL1B 3NRWA 5KG5A 5AKEA 8ICUA 4FS2A 4NLCA 4XRHA 5KT2A 2W9AA 1ZQXA 3MR3A 3D2QA 4O5KA 3PR4A 2CXYA 2QB1A 4B9VA 2PFNA 3L5KA 2OM6A 4ED2A 4IRKA 4Y2QA 4UAYA 1NZPA 5KFGA 5ALFA 4Y2SA 2I1QA 1D9DA 4DQPA 4RT2A 2PMZF 1T3NA 1FEZA 5ALJA 4EYIB 1IG6A 2W43A 4P4PA 3QUBA 1L6NA 5JTIA 2HI0A 5DB9A 1FFUA 1S9FA 1V38A 8ICRA 2LHTA 1A77A 8ICGA 4RPZA 1ZYQA 1S8OA 2JEGA 3D2SA 1TAQA 5KFYA 5HR6A 4GC6A 3BQ2A 4BJQA 1ZQIA 3UMBA 4F72A 1V97A 3QU9A 4UAUA 2E8OA 4RQ5A 2ODGA 5KFEA 2RDIA 3PV8A 5DGAA 3RBEA 5ALTA 5KFDA 4M9LA 4F91B 2FDRA 3THVA 1SB3C 4CF4A 3E2EA 5JRTA 3MGVA 2H5XA 4XA5A 3IDWA 1OXJA 1QLNA 3I76A 1F5SA 2KOBA 4C8NA 1UT5A 3K1ZA 3C5FA 3V7KA 4US9A 1JIHA 1FIQA 5KG0A 1RQLA 5L1KA 1PK1B 5ALQA 5J2JA 2EAOA 1RG6A 4O3RA 1SZHA 4DQRA 4F2RA 4M9GA 2KZMA 2A19A 1F0MA 5J8YA 4UAWA 3WU2U 3E58A 5KFIA 4XUSA 2KD1A 2ZUBA 3GFKB 4IRDA 1RYSA 3MABA 4EYHB 2IHNA 3ZDBA 4Q8FA 4YFKA 2AJQA 4Y2YA 1YZ6A 2WF8A 4KLUA 8ICMA 1U48A 2KKPA 3JPQA 2VA8A 3OJUA 1N5WA 4F92B 5KFXA 2LM1A 4M9HA 4BXOA 3NVWA 2LM4A 1PK3A 2K4HA 4RQMA 3TACB 4UAZA 2OWOA 4O9MA 3K1RB 3KD3A 2DKXA 2V9WA 7ICQA 2B0CA 3KFUF 1J97A 4I2DA 3KZXA 2HBJA 1NK4A 5KFTA 5AK3A 2A1JB 3H40A 2UVUA 5ALHA 3ETLA 1UA0A 5HP4A 5AM4A 4ELTA 4Y2UA 1KRPA 5D46A 1LB2B 9ICCA 3QU4A 3QX7A 3FYHA 2ZG6A 3AQEA 3H0RB 5J2HA 3PX0A 1L3UA 5AK4A 2JHDA 4I29A 2Z7JA 5KFHA 2R8HA 1RPLA 4BWJA 4C4SA 1NK8A 2OHFA 2K8AA 3CP8A 2AHOB 4DLEA 1QQ6A 2DKZA 2XY7A 1UCVA 4LVSA 2V4RA 2NRXA 3ICXA 4F4YA 1SL2A 2B21A 2ASJA 4AYBF 4QWDA 2OCEA 4KLFA 4P0PA 4ECZA 4YD2A 3NTUA 2MU2A 3LVVA 1S77D 2BR0A 2XC9A 1ZQJA 5J2KA 4ED6A 3PX6A 4EEKA 4MFCA 1L7OA 1QH9A 3N7PD 5KT3A 4KLJA 5AM2A 9ICLA 2ZJ8A 5J0QA 3NUQA 3QZ8A 2HHVA 4O3OA 1EXNA 1L3TA 4ED7A 2ZUCA 3Q8MA 4DLGA 1K1QA 2YX8A 5KFUA 4BX9C 4RPYA 5ALUA 2ZIVB 3GILA 3K4GA 3T3FA 1A76A 5AKYA 4TUSA 1NJYA 4MFAA 3OGUA 1RYUA 2Q4TA 4RUAA 4Z6EA 4CRXA 2K8BB 2BDUA 5CRXA 3Q8PB 1NK9A 4C8LA 3AEVA 2KKVA 3PZPA 1RXVA 3ZDEA 1MN8A 4KN7A 5AI6A 4Q45A 4EENA 3TKAA 3FC4A 4RT3A 2KNJA 3NASA 1U45A 2YMPA 4YXMA 1TE2A 4QIWF 1KKXA 1ZRMA 5KFZA 1OW5A 7ICPA 3L3FX 4ZH4A 2E5SA 3AU2A 4YP3A 4ED8A 2VA3A 2B6GA 3UQ0A 4RQ3A 5JUMA 4ECQA 1ZQHA 3KHHA 1CUKA 4J9NA 4O5EA 4DL6A 2HHTA 1N48A 4ELVA 1KFTA 3PR5B 4PHDA 1PZNA 2OYYA 1N56A 3C5GA 4C4RA 1HUOA 4Z6FA 2W04A 1JXEA 5ALZA 1NKCA 4GIBA 1TFRA 3OHBA 3NRZA 1KFSA 4QZGA 2KE7A 1S0VA 4RNNA 5DLFA 4GXIA 4ED0A 5KG2A 3HP6A 5HNKA 4KITB 2XY5A 4PPXA 3H4BA 2ZIUA 1NJZA 3ISBA 3CYMA 1ZQWA 2KJ9A 4YR3A 3Q8LA 4O3NA 2EQYA 3V6JA 5KFNA 3C1YA 5J0UA 3Q8QB 2NRZA 4C7YA 4DFJA 2ZTCA 5KFPA 4DS5A 2MAXA 4F4ZA 3PY8A 2MA1A 4GFJA 9ICPA 4PL1A 4MF8A 4EBDA 2ZIWA 1D8BA 5KFVA 1HEKA 3HWTA 4RQ2A 3RF9A 4OO1J 5AKLA 3RH5A 5B5EU 4B9SA 4PGYA 3TQ1A 4LZGA 1WWUA 1DRGA 2ALZA 2RRDA 4TQRA 3T5LA 1B43A 2BHNA 1PUZA 3SAHA 2KIWA 3DEEA 2FPKA 4C8KA 4R66A 3BQTA 3HRDD 2YMQA 2XCPA 1TK5A 3EZ5A 1BVSA 1NK0A 3PMLA 3R9KA 1U49A 2G5HB 2AXTU 2P6RA 4IRCA 5AI9A 4RNMA 3IG8A 2DGZA 3PO5A 8ICNA 4WJ3B 2KICA 1L3VA 4PGQA 3PVXA 4ACOA 3C2KA 5BOMA 4F5NA 9ICJA 2FPMA 1K5OA 1NKBA 3WKAA 3OSNA 1ZXIA 4QZFA 4I2GA 3QEBZ 2XIDA 4QZHA 3QUTA 5ALMA 2R8IA 3Q8KA 2E3TA 1ZQDA 2YB1A 1C20A 2KZ3A 2CN1A 1MA7A 3J81j 3SZ2A 1COOA 4ED3A 3C1ZA 2EAMA 3EUB2 2MSNA 3N4MB 4UB3A 3CRXA 4J03A 5KG7A 3RJFA 3MDAA 1N62A 2IBKA 1M6YA 2HDOA 5CP2A 1N61A 2PFOA 2W9CB 1QTMA 3NVZA 5B66U 2HHSA 2AU0A 2LKYA 2H3VA 1D8YA 2ZTEA 4J9SA 2P6UA 2I6XA 4LJXA 3ZD9A 3GV5B 2EDUA 2LI6A 4R65A 4Z6CA 2KN7A 4NY8A 1QQ7A 4M2YA 2AH5A 4GC7A 3NVVA 5EE1A 5KFRA 4OJPA 4F50A 2ZXIA 4F71A 5ALVA 5DBAA 4QZIA 2HOQA 4JB3A 4P0QB 5KFBA 2J6TA 2HBMA 3N97B 1UA1A 3RRGA 5AKIA 5IILA 3RJIA 4FZLA 4KLGA 2GOLA 3M8RA 5L1MA 3GIMA 3GQCA 1X66A 2YMLA 3F2BA 5J2CA 2BQ3A 4DCCA 4UBCA 3MGIA 2PFPA 2LMRA 4CDGA 1N5XA 4QZDA 4O3MA 3M6ZA 2FLLA 1Q8KA 3UM9A 2HVIA 3RB3A 4RQ7A 2G09A 4YCXA 1JRPA 3GIKA 2LYBA 5KFQA 3OHAA 4QZ9A 1L7NA 1RZTA 7ICUA 4J9KA 3QNMA 4QW8A 4M9NA 5EE3A 3MC1A 3BS5B 4NLNA 3IN5A 1S0OA 5KFCA 5AI0A 2UVVA 2F8LA 3AMZA 4DFPA 4UB1A 4QWCA 4DOBA 3D6JA 5J2DA 2K4PA 1HIWA 2WB1F 1DGJA 4DQSA 3CW2C 5A0LA 5CEHA 4HYKA 4DSEA 4QZAA 4DSJA 4NWIA 3EWAA 4BGDA 1BPXA 3V6KA 4KX3A 4Y2JA 3MR6A 4J9PA 5TZVA 1ZOLA 4CCHA 4PJ0U 4DFKA 1NK7A 5EWFA 2GH1A 3ZD8A 2J6UA 1N60A 5IIJA 4NJ8A 2QB0A 2K4IA 3SAFA 2F1JA 1J2MA 2NO4A 2A1AA 4X5VA 2WF5A 4UAVA 1L7PA 4AYBC 4DSLA 3SV4A 4KLDA 4RQ8A 1LVHA 4ECUA 4KLTA 2Y1JA 5ALRA 2VKQA 1X9XA 2YY6A 2JEFA 5ALIA 9ICNA 3F5AA 1OUQA 1TAMA 4U6PA 5AK6A 2QKQA 4DWIA 2PXIA 3I28A 1KDHA 4NL9A 4MFFA 4I2EA 5AKKA 2KJ8A 4YMNA 1F44A 1B4FA 4UW9A 1LKYA 1DXSA 4QZCA 4HAIA 2AGOA 2MUTB 1D9FA 5ALWA 1XSNA 5CWRA 4UASA 5AKXA 4J9OA 4DSIA 1JXLA 1Z1BA 3RTVA 1RYRA 4OJOA 2IMWP 4F93B 2RHFA 4IQWA 3PSFA 4R8UB 2L5YA 3JPTA 4NM1A 5DBBA 2Y1IA 2UVRA 2FE9A 4F5RA 1ZQRA 5DG9A 1X40A 1T4GA 2VIXA 4QIWC 4RQ1A 4IQTA 2WFAA 4UB2A 5K4LA 3G6YA 4FO6A 3H8MA 7ICKA 4EBEA 1Z4NA 2YB4A 5DB7A 2XICA 3MR5A 2D3DA 2KEYA 5FP0A 4F3OA 1DK3A 1KEJA 5ALKA 2HHUA 1XU4A 2DPJA 1T7PA 4YXJA 4YMOA 3G6XA 4MF2A 1JUDA 3RH6A 2PKEA 2ESEA 2MRLA 2HSZA 2EZYA 3F5EA 3H8WA 1ZD3A 2UVWA 3OPXA 2OXOA 5G5GA 4P4OA 3JPRA 4KLHA 4E0DA 2IOFA 1XC9A 5KT6A 4F5OA 8ICSA 3L4PA 1L7MA 5AIBA 1ECWA 4C8OA 4PHPA 3H0LB 1RQNA 5GTIU 4QW9A 5KAIU 4US8A 1DGSA 1S76D 2C2RA 2VJ4A 1AROP 4G3IA 1NK5A 3T5HA 1TK8A 2K4EA 3F2DA 1ZQCA 1T3QA 4RQNA 1BPZA 2YTUA 4JWMA 2DQNB 1B0XA 3LWLA 4TUQA 3ED5A 1QSSA 3PSPA 4NL9C 3ZI4A 3HW8A 3F53A 2W8LA 4UARA 4I2JA 1PVQA 8ICQA 3M9OB 1CRXA 2XCAA 3TAPA 4YD1A 4ECYA 4QWEA 3SYZA 1WG8A 2G07A 8ICAA 3UXOA 4P4MA 9ICMA 5J0SA 9ICEA 1VLBA 4C80A 2ZIXB 2FLPA 5G5HA 1ZQ1C 3UMCA 1XWLA 4FZNA 1SGGA 4ECWA 4FS1A 5HR7A 4DO9A 3LWMA 4OD0A 2WF7A 5AI5A 3BQ1A 2DUYA 1NNLA 1PK1A 1KBUA 9ICGA 2PFQA 3QXGA 2CRXA 5EWGA 3NS1A 2W9BB 5DLGA 1X42A 2G08A 4M6WA 4JUZA 3T79A 4JV1A 2XGPA 4OJ5A 4EX6A 1ZJNA 2JGAA 2NV3A 3H4DA 1XNSA 5KG6A 2XO7A 2I5HA 2BCRA 1ZQBA 2QARB 4F8RA 3QE9Y 4KLQA 2KVCA 3PW7A 1Z1VA 5E79U 4PHEA 5H2FU 4NV0A 5KTQA 4RQ0A 3AUOA 4UQGA 2BKEA 4A8EA 4IR1A 3QU5A 4JV0A 2W3RA 4TURA 2HHXA 3BQ0A 2XVTA 2EH9A 2OEHA 1JI7A 1ZD2P 3KHLA 2R8JA 1KSPA 2A1JA 1JROA 9ICTA 5DBCA 2KP7A 3KHGA 2AGQA 4QZ8A 2WF6A 1XSLA 3RH4A 1SWVA 4KLIA 3SQIA 3PX4A 4YMMA 3RJHA 3FDSA 2EZXA 3G6VA 4EBCA 3PW5A 1ZQNA 1Z3EB 5AI4A 4B9NA 5L1JA 3UXNA 1X2IA 1Z00B 4I2IA 3C21A 2Y9UA 5CB1A 8ICCA 3MR2A 3NVYA 3AQFA 3UXPA 2AGPA 3HX0A 1TV9A 2C2EA 4C0ZA 4Q43A 3AM9A 4O3SA 2OH2A 3UQ2A 1KQQA 4OJ6A 7ICVA 1HUZA 4ECVA 3M6KA 2ATLA 3WKCA 4FBUA 3T5JA 5ALOA 4F5PA 2WAQC 5AI8A 4NLGA 1VDVA 1L8OA 3MGHA 2W8KA 1ZQYA 2P66A 3M1YA 1ZETA 1O08A 3E0FA 1BPDA 2WB1C 3GZFA 1X9MA 1IV8A 8ICVA 7ICRA 5AKZA 2KJ5A 4DF8A 4KLSA 3QU7A 3QU2A 3PMNA 1Q46A 4IS7A 5AM5A 1SKRA 1RDFA 5J0YA 4PZNA 4PHAA 5CA7A 1TKDA 3M9NB 1A6SA 3JPOA 2PMZC 2KSOB 3ZDCA 2JRZA 3V7LA 2ZIVA 4DQQA 1IXRA 2K89A 5CHGA 5GTHU 1AQ6A 9ICSA 2BPGA 4NLKA 5F3XB 5C5JA 4U7CA 2CPRA 2RLTA 1BNPA 5J0XA 4PL2A 4C7ZA 1FO4A 4ZOHC 9ICWA 2IOHA 1BGXT 1JX4A 3HT3A 3BJYA 4EX7A 2WTFA 8ICZA 9ICBA 1S97A 3GIJA 3IHQB 5ALSA 3OJSA 1SL0A 7ICLA 3V6HA 2KHVA 3H8SA 2W7OA 2DWQA 3ETRA 2ZUDA 3O0FA 4IQVA 3ZDAA 1L8LA 2LYAA 2JV3A 3H7IA 8ICOA 4CE6A 3IRUA 2KVSA 4Z6DA 1ZQFA 4ICAA 4QWBA 3SMVA 2BGWA 1ZD5A 3KBBA 5KFMA 1TAUA 1X6JA 4EELA 1ZQUA 4RU9A 2FMQA 2M9NA 3KZIU 3PSIA 2ZTDA 1YZ7A 2XGQA 4B9TA 2KK0A 3CNHA 1KW4A 4M0AA 1RXWA 8ICTA 2NYVA 2XI9A 4UB5A 4KX5A 3MDCA 8ICPA 2RDJA 1KFDA 3K75D 1V9PA 2FPLA 3N7RC 3F2CA 3JPPA 2FLNA 9ICUA 5ALPA 3RJGA 3B0XA 3RJJA 1U4BA 5EWEA 5BPCA 3BQ7A 4UB8U 4R64A 1U47A 4KN4A 2HHWA 4KMOB 3HKZF 3EW9A 1MQ3A 1UT8A 5AM3A 1COKA 3C28A 2WHEA 7ICSA 4UB6U 5J2EA 4RQ6A 3RAQA 2KZZA 5AM1A 5KFLA 3C23A 3RR7A 2XY6A 5AICA 4Y2RA 4I28A 7ICJA 5DKWA 3RRHA 5ALNA 2K8CB 7ICNA 1MQ2A 5KFSA 1UQVA 1SL1A 4EZ9A 2DF4B 3WK9A 2G5IB 2YN4A 2VA2A 2R18A 3D2NA 1Y88A 2HBKA 3ONNA 2ZXHA 1CEZA 4BXOB 3SI8A 4PH5A 5ALGA 2W55A 3RB0A 2IA6A 3TADA 4IL6U 2D8CA 4YN4A 2ISOA 1XS9D 2JR5A 5AM0A 3IG5A 4EZ6A 2FJ6A 4IQUA 3HILA 3WK8A 5J0PA 3EYZA 2LBOA 5AKJA 4G9BA 1K1SA 4J9QA 2RP5A 3BZKA 2BCSA 4JMUA 4CNQA 3MFIA 8ICHA 1ZQVA 2D6FC 3KHRA 5L9XA 4KLOA 1Q3UA 2LPEA 3SD7A 3N28A 9ICIA 3NGDA 3QYPA 1ZQMA 5D4BA 4GXKA 5AKHA 2PI5A 2JZBA 4K4GA 5L1IA 9ICVA 7ICIA 1SXEA 3MFHA 2K60A 5HHHA 1QCKA 1B22A 2JH7A 3QUCA 2KHQA 1URJA 2W9CA 5IIKA 2VANA 4JK1A 2W3SA 4K4IA 9ICQA 2E1FA 1ZD4A 3TI0A 2KFNA 2W03A 5J2AA 1J2NA 1S0NA 4P0PB 3LYSA 2KMDA 2EZZA 2H3IA 1WUDA 1T94A 4IC9A 2BCQA 4KTQA 4OJLA 3C2LA 1ZQPA 4Q8EA 7ICTA 3AU6A 4DL4A 1XO0A 2C2DA 2EANA 1GO3F 4P0QA 3PO4A 5AK5A 1LV5A 4Y2XA 1Z19A 1ZQGA 2FI1A 1ED1A 2P35A 4J9RA 1KTQA 3IP4B 2ASDA 3FAHA 3JPNA 3WK5A 4GXJA 4YG2A 5DG8A 4DL2A 2J6SA 2BDPA 1WCNA 4I2BA 3WKEA 1O03A 9ICRA 5KFAA 1NZBA 4PZOA 4M6WB 3QZ7A 1Z4OA 2Y0SF 3HPOA 5J0RA 2E8PA 3WK7A 3RJEA 4OCZA 2QLTA 3B9JA 4NLBA 5BOLA 3LK9A 3TAQA 3RB4A 1NKEA 2I9GA 3TADC 4O5CA 3BS5A 1L5UA 2GO7A 4F4XA 2ZJAA 3RBDA 2IOFK 5AIAA 5AHXA 2E8MA 4M04A 1WWVA 2ISPA 5KT4A 4DEZA 1BPEA 1ZQLA 3EPGA 2HVHA 2NO5A 4O3PA 3FM9A 3TFRA 1SWWA 5HHIA 4UB4A 4JWNA 3HJEA 5J29A 3A0BU 3WK4A 1NOMA 3B0YA 4I2AA 2WF9A 2F8KA 2JEJA 2JXJA 2M0NA 2F1HA 1SV0A 4YVZA 1H38A 4GLXA 5DQIA 3C29A 4DQIA 4DSFA 5TISU 5DDYA 4RNOA 5DB6A 4BWMA 2BPCA 2DL0A 5ALYA 3ISDA 1S10A 4NLZA 2DBYA 2H3ZA 1U9LA 2F76X 4CF5A 5IINA 3TARA 2W9MA 4P2HA 3M9MB 3SENA 5J2IA 5IIMA 4M47A 2ZIUB 2F3NA 2LYHA 2HOIA 1D8LA 3GIIA 2DFLA 2E8NA 1CI4A 5D49A 2HHQA 3DDHA 1L3SA 2KFZA 2BQUA 4FBTA 1T8EA 3M7DA 1BPYA 2MUTA 1KLNA 2W11A 1SKWA 1N2XA 1IM4A 3WKBA 4RPXA 2ZIWB 2HCFA 3JPSA 2HMXA 1C7YA 1SXDA 2G0AA 4ECTA 5KFFA 3PW0A 5KFJA 1PVPA 4ECXA 3GV8B 4NM2A 2F1IA 5KFWA 4QJFB 4R8UA 3WK6A 3PSTA 1MSWD 3AL0B 1KL9A 5J8YC 3SAGA 5AKGA 2GLEA 2JEIA
chains in the Genus database with same CATH topology
1A0PA 2KD1A 2W04A 4A8EA 2DQNB 2OM6A 3LVVA 3PSPA 1A6SA 1Z1BA 3F53A 2XVTA 3HKZF 2PMZC 4KMOB 2ZIXA 2XIDA 2ZIVA 3VC8A 3IN5A 3C28A 2JH7A 4OJOA 2F8LA 2KHQA 2RHFA 1URJA 1UPHA 2K89A 2YB1A 2KKPA 3PSFA 1PVQA 5KL8B 2CN1A 1MA7A 1HIWA 2E1FA 1CRXA 2M0NA 3GU3A 2WB1F 2PMZF 2A3VA 2ZIUA 2W03A 3N7PD 2JH1A 5A0LA 3C29A 3CYMA 5C0YA 2K4HA 2G07A 2KJ9A 4P0PB 2VJ5A 3NUQA 2VIXA 4NWIA 1L6NA 4U7CA 2CPRA 3LYSA 4QIWC 3SQIA 3ALRA 3CRXA 2H3QA 3H0MB 2W7PA 1WUDA 2H3IA 3KFUF 1T94A 4PL2A 2YX8A 4BX9C 2K8CB 4KX3A 4IC9A 3RFAA 2ZIXB 2H3ZA 4OJLA 2DF4B 2ZIVB 2E1EA 2YB4A 2F76X 2Y0SC 3KZXA 2G5IB 2HBJA 2XICA 2LHTA 4QNLA 2KEYA 2R18A 1XO0A 1ZQ1C 3D2NA 3LVWA 2MA1A 2F2AB 2GH1A 1GO3F 2LKYA 4GFJA 2H3VA 2HBKA 3ONNA 2ZXHA 4FZNA 4P0QA 2Q4TA 4FZMA 3D2SA 2ZIUB 2KHVA 4PL1A 5HR6A 4CRXA 2K4IA 2K8BB 2BDUA 2ZIWA 3SAFA 3AQFA 4BJQA 2G06A 1ED1A 2W7OA 1Z19A 1D8BA 5HR7A 3O0FA 2HOIA 5CRXA 1HEKA 2MRLA 4C0ZA 2KKVA 3PZPA 3IP4B 5T14A 2LYAA 3F5EA 3RF9A 1KBUA 4OO1J 2OH2A 4AYBC 2HOFA 3OPXA 4OJ6A 2F77X 3M6KA 4P0PA 4ICAA 2KNJA 2OXOA 2N1RA 4OJPA 3M7DA 2CRXA 3SMVA 4QIWF 2WAQC 2ZG6A 2ZXIA 3AQEA 2VKQA 3H0RB 3IG5A 3MGVA 1DRGA 3F5AA 2JHDA 1Q3VA 3HKZC 2RRDA 2JMGA 1OUQA 1NZBA 2HOQA 1TAMA 2Z7JA 3L3FX 4U6PA 4P0QB 2G08A 2E5SA 1P7DA 4BUGA 2KOBA 2HBMA 1ECWA 2KIWA 3SAHA 3T79A 1PVRA 3DEEA 2H3FA 2Y0SF 3H0LB 3PSIA 2ZIWB 4FZLA 2KV2A 3K1ZA 2LBOA 3VCBA 4OJ5A 2GOLA 2WAQF 2HMXA 2JGAA 2NV3A 3E0FA 2G0AA 1IIPA 2K8AA 4NLBA 3CP8A 2KJ8A 2RP5A 1XNSA 3F2BA 2WB1C 4CGZA 5KL1B 3GZFA 1PVPA 2VJ4A 3NRWA 1F44A 4CDGA 2XI9A 2KVCA 1SZHA 2G5HB 4KX5A 4JMUA 4NLCA 2K4EA 4QJFB 3F2DA 4O3MA 1YT3A 3M6ZA 2KJ5A 4FE3A 2D6FC 3PSTA 3ICXA 3IG8A 2DGZA 4NV0A 1Q3UA 4WJ3B 2KICA 3AL0B 3D2QA 2G09A 2HBLA 2OYYA 3N7RC 3N7SC 3F2CA 3SAGA 4AYBF 2LYBA 4ACOA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2OYY A; 
#chains in the Genus database with same CATH topology
 2YQE A;  5JU5 A;  4C8M A;  4QZB A;  4I2F A;  4QZE A;  4USA A;  4K4H A;  9ICH A;  1NI3 A;  4KMU A;  4DS4 A;  3T5K A;  1ZQO A;  3VC8 A;  4Y2V A;  1UPH A;  4RQ4 A;  4DF4 A;  5KL8 B;  2NRW A;  4F2S A;  1JN3 A;  7ICF A;  3GU3 A;  4DFD A;  2NRT A;  1SZP A;  5IIO A;  5C0Y A;  1JAL A;  1ZQK A;  1ZQA A;  2EAP A;  2BCV A;  1X6I A;  3ALR A;  5EE9 A;  4DL3 A;  4B6J A;  2W7P A;  4DSK A;  3RAX A;  1NJX A;  3RFA A;  3KTQ A;  3ORY A;  4ELU A;  5CJ7 A;  2AQ4 A;  5EE0 A;  4MEX A;  7ICE A;  1SV0 C;  4Y2T A;  2BCU A;  2R8K A;  3I1Y A;  2G06 A;  4YR2 A;  9ICO A;  4ED1 A;  1WYG A;  5J2F A;  2HOF A;  4O0I A;  5KG4 A;  3U26 A;  3KOO A;  2KIV A;  3KKA A;  1Q3V A;  3HKZ C;  2JMG A;  2Y9T A;  3S6J A;  1MC8 A;  4UBB A;  8ICF A;  1RM6 C;  5KT5 A;  2IHM A;  4O3Q A;  4XQ8 A;  4C4T A;  3GDX A;  2GWS A;  5ALD A;  8ICI A;  5F9N A;  4CGZ A;  2Q0Z X;  1V85 A;  2W54 A;  1ZJM A;  3EPI A;  2ASL A;  5J0O A;  3QEA Z;  4RUC A;  1ZQE A;  3TFS A;  1S0M A;  4KLE A;  4FE3 A;  4YR0 A;  2AQ0 A;  2HBL A;  3N7S C;  4PGX A;  5HML A;  4F4W A;  1ZQT A;  4I2H A;  1ZQS A;  7ICG A;  2NRV A;  1NK6 A;  7ICM A;  2RQ5 A;  2BZF A;  8ICK A;  5L1L A;  9ICK A;  4B9L A;  4FFD A;  2ZIX A;  5ALL A;  1TK0 A;  4QWA A;  4KLL A;  4TUP A;  4DFM A;  1ZRN A;  4AP9 A;  2JH1 A;  5KT7 A;  5ALX A;  5KFO A;  2VJ5 A;  3V7J A;  9ICX A;  1XSP A;  5DB8 A;  4M9J A;  3LDA A;  3WKD A;  3DV9 A;  2ZJ5 A;  1ZQQ A;  5DDM A;  5KAF U;  4QNL A;  7ICO A;  2W9B A;  5KNI A;  4MHV A;  2O6K A;  5KG3 A;  3UPQ A;  2DPI A;  4FZM A;  5J2B A;  5HMM A;  1FFV A;  1BPB A;  8ICJ A;  5J0T A;  1N63 A;  3AN1 A;  2QAR A;  3SV3 A;  1ZQZ A;  5KFK A;  2KTQ A;  2N1R A;  9ICA A;  2BPF A;  4J9L A;  4F5Q A;  4J9M A;  2F44 A;  8ICX A;  1P7D A;  2C22 A;  4BUG A;  2QB0 B;  2H3F A;  3Q8S B;  2V4Q A;  5F9L A;  1SV4 A;  4RZR A;  1QQ5 A;  4EEY A;  1BNO A;  9ICF A;  2KG5 A;  3SR6 A;  1QSY A;  3Q8R B;  1YT3 A;  4ECR A;  2ES6 A;  3PW2 A;  5J0W A;  8ICY A;  2C28 A;  3GV7 B;  3RB6 A;  4KLM A;  7ICH A;  2BQR A;  2FMP A;  5DG7 A;  3KKA C;  1HJP A;  5DQG A;  1A0P A;  1TVA A;  1VJ5 A;  2JZB B;  4LZD A;  2HW3 A;  4CF3 A;  2PI4 A;  4TQS A;  2FMS A;  3V72 A;  3A0H U;  4YQW A;  3RJK A;  8ICL A;  4DL7 A;  1LKY B;  1Z00 A;  1JMS A;  3ISC A;  4R63 A;  3BDP A;  2A3V A;  1XO1 A;  5EOZ A;  4DOC A;  3SEI A;  1DK2 A;  4DL5 A;  3PW4 A;  2YMM A;  1SKS A;  2H3Q A;  4ECS A;  3BZC A;  3H0M B;  3QUQ A;  3TAN A;  4Q44 A;  1S5L U;  1SIJ A;  4I27 A;  4Y2P A;  2E1E A;  2Y0S C;  3IV6 A;  3LVW A;  2F2A B;  8ICB A;  4IR9 A;  3OSP A;  1UHU A;  4NXZ A;  5J2G A;  4F4K A;  8ICE A;  3RR8 A;  4BDP A;  5DQH A;  3IM1 A;  4DOA A;  5T14 A;  3PNC A;  3OTQ A;  2F77 X;  1KN5 A;  4B9U A;  2R8G A;  3ZDD A;  5ALE A;  5KG1 A;  4I2C A;  3H8J A;  4JV2 A;  4B9M A;  1X9S A;  3BS7 A;  4MEY A;  8ICW A;  1QSL A;  1DOQ A;  4UAT A;  1X9W A;  3C2M A;  3M8S A;  1PVR A;  5DGB A;  2KV2 A;  3VCB A;  1NJW A;  2WAQ F;  3MBY A;  1WCL A;  5III A;  3UMG A;  5CR0 A;  1IIP A;  2KSO A;  5KL1 B;  3NRW A;  5KG5 A;  5AKE A;  8ICU A;  4FS2 A;  4NLC A;  4XRH A;  5KT2 A;  2W9A A;  1ZQX A;  3MR3 A;  3D2Q A;  4O5K A;  3PR4 A;  2CXY A;  2QB1 A;  4B9V A;  2PFN A;  3L5K A;  2OM6 A;  4ED2 A;  4IRK A;  4Y2Q A;  4UAY A;  1NZP A;  5KFG A;  5ALF A;  4Y2S A;  2I1Q A;  1D9D A;  4DQP A;  4RT2 A;  2PMZ F;  1T3N A;  1FEZ A;  5ALJ A;  4EYI B;  1IG6 A;  2W43 A;  4P4P A;  3QUB A;  1L6N A;  5JTI A;  2HI0 A;  5DB9 A;  1FFU A;  1S9F A;  1V38 A;  8ICR A;  2LHT A;  1A77 A;  8ICG A;  4RPZ A;  1ZYQ A;  1S8O A;  2JEG A;  3D2S A;  1TAQ A;  5KFY A;  5HR6 A;  4GC6 A;  3BQ2 A;  4BJQ A;  1ZQI A;  3UMB A;  4F72 A;  1V97 A;  3QU9 A;  4UAU A;  2E8O A;  4RQ5 A;  2ODG A;  5KFE A;  2RDI A;  3PV8 A;  5DGA A;  3RBE A;  5ALT A;  5KFD A;  4M9L A;  4F91 B;  2FDR A;  3THV A;  1SB3 C;  4CF4 A;  3E2E A;  5JRT A;  3MGV A;  2H5X A;  4XA5 A;  3IDW A;  1OXJ A;  1QLN A;  3I76 A;  1F5S A;  2KOB A;  4C8N A;  1UT5 A;  3K1Z A;  3C5F A;  3V7K A;  4US9 A;  1JIH A;  1FIQ A;  5KG0 A;  1RQL A;  5L1K A;  1PK1 B;  5ALQ A;  5J2J A;  2EAO A;  1RG6 A;  4O3R A;  1SZH A;  4DQR A;  4F2R A;  4M9G A;  2KZM A;  2A19 A;  1F0M A;  5J8Y A;  4UAW A;  3WU2 U;  3E58 A;  5KFI A;  4XUS A;  2KD1 A;  2ZUB A;  3GFK B;  4IRD A;  1RYS A;  3MAB A;  4EYH B;  2IHN A;  3ZDB A;  4Q8F A;  4YFK A;  2AJQ A;  4Y2Y A;  1YZ6 A;  2WF8 A;  4KLU A;  8ICM A;  1U48 A;  2KKP A;  3JPQ A;  2VA8 A;  3OJU A;  1N5W A;  4F92 B;  5KFX A;  2LM1 A;  4M9H A;  4BXO A;  3NVW A;  2LM4 A;  1PK3 A;  2K4H A;  4RQM A;  3TAC B;  4UAZ A;  2OWO A;  4O9M A;  3K1R B;  3KD3 A;  2DKX A;  2V9W A;  7ICQ A;  2B0C A;  3KFU F;  1J97 A;  4I2D A;  3KZX A;  2HBJ A;  1NK4 A;  5KFT A;  5AK3 A;  2A1J B;  3H40 A;  2UVU A;  5ALH A;  3ETL A;  1UA0 A;  5HP4 A;  5AM4 A;  4ELT A;  4Y2U A;  1KRP A;  5D46 A;  1LB2 B;  9ICC A;  3QU4 A;  3QX7 A;  3FYH A;  2ZG6 A;  3AQE A;  3H0R B;  5J2H A;  3PX0 A;  1L3U A;  5AK4 A;  2JHD A;  4I29 A;  2Z7J A;  5KFH A;  2R8H A;  1RPL A;  4BWJ A;  4C4S A;  1NK8 A;  2OHF A;  2K8A A;  3CP8 A;  2AHO B;  4DLE A;  1QQ6 A;  2DKZ A;  2XY7 A;  1UCV A;  4LVS A;  2V4R A;  2NRX A;  3ICX A;  4F4Y A;  1SL2 A;  2B21 A;  2ASJ A;  4AYB F;  4QWD A;  2OCE A;  4KLF A;  4P0P A;  4ECZ A;  4YD2 A;  3NTU A;  2MU2 A;  3LVV A;  1S77 D;  2BR0 A;  2XC9 A;  1ZQJ A;  5J2K A;  4ED6 A;  3PX6 A;  4EEK A;  4MFC A;  1L7O A;  1QH9 A;  3N7P D;  5KT3 A;  4KLJ A;  5AM2 A;  9ICL A;  2ZJ8 A;  5J0Q A;  3NUQ A;  3QZ8 A;  2HHV A;  4O3O A;  1EXN A;  1L3T A;  4ED7 A;  2ZUC A;  3Q8M A;  4DLG A;  1K1Q A;  2YX8 A;  5KFU A;  4BX9 C;  4RPY A;  5ALU A;  2ZIV B;  3GIL A;  3K4G A;  3T3F A;  1A76 A;  5AKY A;  4TUS A;  1NJY A;  4MFA A;  3OGU A;  1RYU A;  2Q4T A;  4RUA A;  4Z6E A;  4CRX A;  2K8B B;  2BDU A;  5CRX A;  3Q8P B;  1NK9 A;  4C8L A;  3AEV A;  2KKV A;  3PZP A;  1RXV A;  3ZDE A;  1MN8 A;  4KN7 A;  5AI6 A;  4Q45 A;  4EEN A;  3TKA A;  3FC4 A;  4RT3 A;  2KNJ A;  3NAS A;  1U45 A;  2YMP A;  4YXM A;  1TE2 A;  4QIW F;  1KKX A;  1ZRM A;  5KFZ A;  1OW5 A;  7ICP A;  3L3F X;  4ZH4 A;  2E5S A;  3AU2 A;  4YP3 A;  4ED8 A;  2VA3 A;  2B6G A;  3UQ0 A;  4RQ3 A;  5JUM A;  4ECQ A;  1ZQH A;  3KHH A;  1CUK A;  4J9N A;  4O5E A;  4DL6 A;  2HHT A;  1N48 A;  4ELV A;  1KFT A;  3PR5 B;  4PHD A;  1PZN A;  2OYY A;  1N56 A;  3C5G A;  4C4R A;  1HUO A;  4Z6F A;  2W04 A;  1JXE A;  5ALZ A;  1NKC A;  4GIB A;  1TFR A;  3OHB A;  3NRZ A;  1KFS A;  4QZG A;  2KE7 A;  1S0V A;  4RNN A;  5DLF A;  4GXI A;  4ED0 A;  5KG2 A;  3HP6 A;  5HNK A;  4KIT B;  2XY5 A;  4PPX A;  3H4B A;  2ZIU A;  1NJZ A;  3ISB A;  3CYM A;  1ZQW A;  2KJ9 A;  4YR3 A;  3Q8L A;  4O3N A;  2EQY A;  3V6J A;  5KFN A;  3C1Y A;  5J0U A;  3Q8Q B;  2NRZ A;  4C7Y A;  4DFJ A;  2ZTC A;  5KFP A;  4DS5 A;  2MAX A;  4F4Z A;  3PY8 A;  2MA1 A;  4GFJ A;  9ICP A;  4PL1 A;  4MF8 A;  4EBD A;  2ZIW A;  1D8B A;  5KFV A;  1HEK A;  3HWT A;  4RQ2 A;  3RF9 A;  4OO1 J;  5AKL A;  3RH5 A;  5B5E U;  4B9S A;  4PGY A;  3TQ1 A;  4LZG A;  1WWU A;  1DRG A;  2ALZ A;  2RRD A;  4TQR A;  3T5L A;  1B43 A;  2BHN A;  1PUZ A;  3SAH A;  2KIW A;  3DEE A;  2FPK A;  4C8K A;  4R66 A;  3BQT A;  3HRD D;  2YMQ A;  2XCP A;  1TK5 A;  3EZ5 A;  1BVS A;  1NK0 A;  3PML A;  3R9K A;  1U49 A;  2G5H B;  2AXT U;  2P6R A;  4IRC A;  5AI9 A;  4RNM A;  3IG8 A;  2DGZ A;  3PO5 A;  8ICN A;  4WJ3 B;  2KIC A;  1L3V A;  4PGQ A;  3PVX A;  4ACO A;  3C2K A;  5BOM A;  4F5N A;  9ICJ A;  2FPM A;  1K5O A;  1NKB A;  3WKA A;  3OSN A;  1ZXI A;  4QZF A;  4I2G A;  3QEB Z;  2XID A;  4QZH A;  3QUT A;  5ALM A;  2R8I A;  3Q8K A;  2E3T A;  1ZQD A;  2YB1 A;  1C20 A;  2KZ3 A;  2CN1 A;  1MA7 A;  3J81 j;  3SZ2 A;  1COO A;  4ED3 A;  3C1Z A;  2EAM A;  3EUB 2;  2MSN A;  3N4M B;  4UB3 A;  3CRX A;  4J03 A;  5KG7 A;  3RJF A;  3MDA A;  1N62 A;  2IBK A;  1M6Y A;  2HDO A;  5CP2 A;  1N61 A;  2PFO A;  2W9C B;  1QTM A;  3NVZ A;  5B66 U;  2HHS A;  2AU0 A;  2LKY A;  2H3V A;  1D8Y A;  2ZTE A;  4J9S A;  2P6U A;  2I6X A;  4LJX A;  3ZD9 A;  3GV5 B;  2EDU A;  2LI6 A;  4R65 A;  4Z6C A;  2KN7 A;  4NY8 A;  1QQ7 A;  4M2Y A;  2AH5 A;  4GC7 A;  3NVV A;  5EE1 A;  5KFR A;  4OJP A;  4F50 A;  2ZXI A;  4F71 A;  5ALV A;  5DBA A;  4QZI A;  2HOQ A;  4JB3 A;  4P0Q B;  5KFB A;  2J6T A;  2HBM A;  3N97 B;  1UA1 A;  3RRG A;  5AKI A;  5IIL A;  3RJI A;  4FZL A;  4KLG A;  2GOL A;  3M8R A;  5L1M A;  3GIM A;  3GQC A;  1X66 A;  2YML A;  3F2B A;  5J2C A;  2BQ3 A;  4DCC A;  4UBC A;  3MGI A;  2PFP A;  2LMR A;  4CDG A;  1N5X A;  4QZD A;  4O3M A;  3M6Z A;  2FLL A;  1Q8K A;  3UM9 A;  2HVI A;  3RB3 A;  4RQ7 A;  2G09 A;  4YCX A;  1JRP A;  3GIK A;  2LYB A;  5KFQ A;  3OHA A;  4QZ9 A;  1L7N A;  1RZT A;  7ICU A;  4J9K A;  3QNM A;  4QW8 A;  4M9N A;  5EE3 A;  3MC1 A;  3BS5 B;  4NLN A;  3IN5 A;  1S0O A;  5KFC A;  5AI0 A;  2UVV A;  2F8L A;  3AMZ A;  4DFP A;  4UB1 A;  4QWC A;  4DOB A;  3D6J A;  5J2D A;  2K4P A;  1HIW A;  2WB1 F;  1DGJ A;  4DQS A;  3CW2 C;  5A0L A;  5CEH A;  4HYK A;  4DSE A;  4QZA A;  4DSJ A;  4NWI A;  3EWA A;  4BGD A;  1BPX A;  3V6K A;  4KX3 A;  4Y2J A;  3MR6 A;  4J9P A;  5TZV A;  1ZOL A;  4CCH A;  4PJ0 U;  4DFK A;  1NK7 A;  5EWF A;  2GH1 A;  3ZD8 A;  2J6U A;  1N60 A;  5IIJ A;  4NJ8 A;  2QB0 A;  2K4I A;  3SAF A;  2F1J A;  1J2M A;  2NO4 A;  2A1A A;  4X5V A;  2WF5 A;  4UAV A;  1L7P A;  4AYB C;  4DSL A;  3SV4 A;  4KLD A;  4RQ8 A;  1LVH A;  4ECU A;  4KLT A;  2Y1J A;  5ALR A;  2VKQ A;  1X9X A;  2YY6 A;  2JEF A;  5ALI A;  9ICN A;  3F5A A;  1OUQ A;  1TAM A;  4U6P A;  5AK6 A;  2QKQ A;  4DWI A;  2PXI A;  3I28 A;  1KDH A;  4NL9 A;  4MFF A;  4I2E A;  5AKK A;  2KJ8 A;  4YMN A;  1F44 A;  1B4F A;  4UW9 A;  1LKY A;  1DXS A;  4QZC A;  4HAI A;  2AGO A;  2MUT B;  1D9F A;  5ALW A;  1XSN A;  5CWR A;  4UAS A;  5AKX A;  4J9O A;  4DSI A;  1JXL A;  1Z1B A;  3RTV A;  1RYR A;  4OJO A;  2IMW P;  4F93 B;  2RHF A;  4IQW A;  3PSF A;  4R8U B;  2L5Y A;  3JPT A;  4NM1 A;  5DBB A;  2Y1I A;  2UVR A;  2FE9 A;  4F5R A;  1ZQR A;  5DG9 A;  1X40 A;  1T4G A;  2VIX A;  4QIW C;  4RQ1 A;  4IQT A;  2WFA A;  4UB2 A;  5K4L A;  3G6Y A;  4FO6 A;  3H8M A;  7ICK A;  4EBE A;  1Z4N A;  2YB4 A;  5DB7 A;  2XIC A;  3MR5 A;  2D3D A;  2KEY A;  5FP0 A;  4F3O A;  1DK3 A;  1KEJ A;  5ALK A;  2HHU A;  1XU4 A;  2DPJ A;  1T7P A;  4YXJ A;  4YMO A;  3G6X A;  4MF2 A;  1JUD A;  3RH6 A;  2PKE A;  2ESE A;  2MRL A;  2HSZ A;  2EZY A;  3F5E A;  3H8W A;  1ZD3 A;  2UVW A;  3OPX A;  2OXO A;  5G5G A;  4P4O A;  3JPR A;  4KLH A;  4E0D A;  2IOF A;  1XC9 A;  5KT6 A;  4F5O A;  8ICS A;  3L4P A;  1L7M A;  5AIB A;  1ECW A;  4C8O A;  4PHP A;  3H0L B;  1RQN A;  5GTI U;  4QW9 A;  5KAI U;  4US8 A;  1DGS A;  1S76 D;  2C2R A;  2VJ4 A;  1ARO P;  4G3I A;  1NK5 A;  3T5H A;  1TK8 A;  2K4E A;  3F2D A;  1ZQC A;  1T3Q A;  4RQN A;  1BPZ A;  2YTU A;  4JWM A;  2DQN B;  1B0X A;  3LWL A;  4TUQ A;  3ED5 A;  1QSS A;  3PSP A;  4NL9 C;  3ZI4 A;  3HW8 A;  3F53 A;  2W8L A;  4UAR A;  4I2J A;  1PVQ A;  8ICQ A;  3M9O B;  1CRX A;  2XCA A;  3TAP A;  4YD1 A;  4ECY A;  4QWE A;  3SYZ A;  1WG8 A;  2G07 A;  8ICA A;  3UXO A;  4P4M A;  9ICM A;  5J0S A;  9ICE A;  1VLB A;  4C80 A;  2ZIX B;  2FLP A;  5G5H A;  1ZQ1 C;  3UMC A;  1XWL A;  4FZN A;  1SGG A;  4ECW A;  4FS1 A;  5HR7 A;  4DO9 A;  3LWM A;  4OD0 A;  2WF7 A;  5AI5 A;  3BQ1 A;  2DUY A;  1NNL A;  1PK1 A;  1KBU A;  9ICG A;  2PFQ A;  3QXG A;  2CRX A;  5EWG A;  3NS1 A;  2W9B B;  5DLG A;  1X42 A;  2G08 A;  4M6W A;  4JUZ A;  3T79 A;  4JV1 A;  2XGP A;  4OJ5 A;  4EX6 A;  1ZJN A;  2JGA A;  2NV3 A;  3H4D A;  1XNS A;  5KG6 A;  2XO7 A;  2I5H A;  2BCR A;  1ZQB A;  2QAR B;  4F8R A;  3QE9 Y;  4KLQ A;  2KVC A;  3PW7 A;  1Z1V A;  5E79 U;  4PHE A;  5H2F U;  4NV0 A;  5KTQ A;  4RQ0 A;  3AUO A;  4UQG A;  2BKE A;  4A8E A;  4IR1 A;  3QU5 A;  4JV0 A;  2W3R A;  4TUR A;  2HHX A;  3BQ0 A;  2XVT A;  2EH9 A;  2OEH A;  1JI7 A;  1ZD2 P;  3KHL A;  2R8J A;  1KSP A;  2A1J A;  1JRO A;  9ICT A;  5DBC A;  2KP7 A;  3KHG A;  2AGQ A;  4QZ8 A;  2WF6 A;  1XSL A;  3RH4 A;  1SWV A;  4KLI A;  3SQI A;  3PX4 A;  4YMM A;  3RJH A;  3FDS A;  2EZX A;  3G6V A;  4EBC A;  3PW5 A;  1ZQN A;  1Z3E B;  5AI4 A;  4B9N A;  5L1J A;  3UXN A;  1X2I A;  1Z00 B;  4I2I A;  3C21 A;  2Y9U A;  5CB1 A;  8ICC A;  3MR2 A;  3NVY A;  3AQF A;  3UXP A;  2AGP A;  3HX0 A;  1TV9 A;  2C2E A;  4C0Z A;  4Q43 A;  3AM9 A;  4O3S A;  2OH2 A;  3UQ2 A;  1KQQ A;  4OJ6 A;  7ICV A;  1HUZ A;  4ECV A;  3M6K A;  2ATL A;  3WKC A;  4FBU A;  3T5J A;  5ALO A;  4F5P A;  2WAQ C;  5AI8 A;  4NLG A;  1VDV A;  1L8O A;  3MGH A;  2W8K A;  1ZQY A;  2P66 A;  3M1Y A;  1ZET A;  1O08 A;  3E0F A;  1BPD A;  2WB1 C;  3GZF A;  1X9M A;  1IV8 A;  8ICV A;  7ICR A;  5AKZ A;  2KJ5 A;  4DF8 A;  4KLS A;  3QU7 A;  3QU2 A;  3PMN A;  1Q46 A;  4IS7 A;  5AM5 A;  1SKR A;  1RDF A;  5J0Y A;  4PZN A;  4PHA A;  5CA7 A;  1TKD A;  3M9N B;  1A6S A;  3JPO A;  2PMZ C;  2KSO B;  3ZDC A;  2JRZ A;  3V7L A;  2ZIV A;  4DQQ A;  1IXR A;  2K89 A;  5CHG A;  5GTH U;  1AQ6 A;  9ICS A;  2BPG A;  4NLK A;  5F3X B;  5C5J A;  4U7C A;  2CPR A;  2RLT A;  1BNP A;  5J0X A;  4PL2 A;  4C7Z A;  1FO4 A;  4ZOH C;  9ICW A;  2IOH A;  1BGX T;  1JX4 A;  3HT3 A;  3BJY A;  4EX7 A;  2WTF A;  8ICZ A;  9ICB A;  1S97 A;  3GIJ A;  3IHQ B;  5ALS A;  3OJS A;  1SL0 A;  7ICL A;  3V6H A;  2KHV A;  3H8S A;  2W7O A;  2DWQ A;  3ETR A;  2ZUD A;  3O0F A;  4IQV A;  3ZDA A;  1L8L A;  2LYA A;  2JV3 A;  3H7I A;  8ICO A;  4CE6 A;  3IRU A;  2KVS A;  4Z6D A;  1ZQF A;  4ICA A;  4QWB A;  3SMV A;  2BGW A;  1ZD5 A;  3KBB A;  5KFM A;  1TAU A;  1X6J A;  4EEL A;  1ZQU A;  4RU9 A;  2FMQ A;  2M9N A;  3KZI U;  3PSI A;  2ZTD A;  1YZ7 A;  2XGQ A;  4B9T A;  2KK0 A;  3CNH A;  1KW4 A;  4M0A A;  1RXW A;  8ICT A;  2NYV A;  2XI9 A;  4UB5 A;  4KX5 A;  3MDC A;  8ICP A;  2RDJ A;  1KFD A;  3K75 D;  1V9P A;  2FPL A;  3N7R C;  3F2C A;  3JPP A;  2FLN A;  9ICU A;  5ALP A;  3RJG A;  3B0X A;  3RJJ A;  1U4B A;  5EWE A;  5BPC A;  3BQ7 A;  4UB8 U;  4R64 A;  1U47 A;  4KN4 A;  2HHW A;  4KMO B;  3HKZ F;  3EW9 A;  1MQ3 A;  1UT8 A;  5AM3 A;  1COK A;  3C28 A;  2WHE A;  7ICS A;  4UB6 U;  5J2E A;  4RQ6 A;  3RAQ A;  2KZZ A;  5AM1 A;  5KFL A;  3C23 A;  3RR7 A;  2XY6 A;  5AIC A;  4Y2R A;  4I28 A;  7ICJ A;  5DKW A;  3RRH A;  5ALN A;  2K8C B;  7ICN A;  1MQ2 A;  5KFS A;  1UQV A;  1SL1 A;  4EZ9 A;  2DF4 B;  3WK9 A;  2G5I B;  2YN4 A;  2VA2 A;  2R18 A;  3D2N A;  1Y88 A;  2HBK A;  3ONN A;  2ZXH A;  1CEZ A;  4BXO B;  3SI8 A;  4PH5 A;  5ALG A;  2W55 A;  3RB0 A;  2IA6 A;  3TAD A;  4IL6 U;  2D8C A;  4YN4 A;  2ISO A;  1XS9 D;  2JR5 A;  5AM0 A;  3IG5 A;  4EZ6 A;  2FJ6 A;  4IQU A;  3HIL A;  3WK8 A;  5J0P A;  3EYZ A;  2LBO A;  5AKJ A;  4G9B A;  1K1S A;  4J9Q A;  2RP5 A;  3BZK A;  2BCS A;  4JMU A;  4CNQ A;  3MFI A;  8ICH A;  1ZQV A;  2D6F C;  3KHR A;  5L9X A;  4KLO A;  1Q3U A;  2LPE A;  3SD7 A;  3N28 A;  9ICI A;  3NGD A;  3QYP A;  1ZQM A;  5D4B A;  4GXK A;  5AKH A;  2PI5 A;  2JZB A;  4K4G A;  5L1I A;  9ICV A;  7ICI A;  1SXE A;  3MFH A;  2K60 A;  5HHH A;  1QCK A;  1B22 A;  2JH7 A;  3QUC A;  2KHQ A;  1URJ A;  2W9C A;  5IIK A;  2VAN A;  4JK1 A;  2W3S A;  4K4I A;  9ICQ A;  2E1F A;  1ZD4 A;  3TI0 A;  2KFN A;  2W03 A;  5J2A A;  1J2N A;  1S0N A;  4P0P B;  3LYS A;  2KMD A;  2EZZ A;  2H3I A;  1WUD A;  1T94 A;  4IC9 A;  2BCQ A;  4KTQ A;  4OJL A;  3C2L A;  1ZQP A;  4Q8E A;  7ICT A;  3AU6 A;  4DL4 A;  1XO0 A;  2C2D A;  2EAN A;  1GO3 F;  4P0Q A;  3PO4 A;  5AK5 A;  1LV5 A;  4Y2X A;  1Z19 A;  1ZQG A;  2FI1 A;  1ED1 A;  2P35 A;  4J9R A;  1KTQ A;  3IP4 B;  2ASD A;  3FAH A;  3JPN A;  3WK5 A;  4GXJ A;  4YG2 A;  5DG8 A;  4DL2 A;  2J6S A;  2BDP A;  1WCN A;  4I2B A;  3WKE A;  1O03 A;  9ICR A;  5KFA A;  1NZB A;  4PZO A;  4M6W B;  3QZ7 A;  1Z4O A;  2Y0S F;  3HPO A;  5J0R A;  2E8P A;  3WK7 A;  3RJE A;  4OCZ A;  2QLT A;  3B9J A;  4NLB A;  5BOL A;  3LK9 A;  3TAQ A;  3RB4 A;  1NKE A;  2I9G A;  3TAD C;  4O5C A;  3BS5 A;  1L5U A;  2GO7 A;  4F4X A;  2ZJA A;  3RBD A;  2IOF K;  5AIA A;  5AHX A;  2E8M A;  4M04 A;  1WWV A;  2ISP A;  5KT4 A;  4DEZ A;  1BPE A;  1ZQL A;  3EPG A;  2HVH A;  2NO5 A;  4O3P A;  3FM9 A;  3TFR A;  1SWW A;  5HHI A;  4UB4 A;  4JWN A;  3HJE A;  5J29 A;  3A0B U;  3WK4 A;  1NOM A;  3B0Y A;  4I2A A;  2WF9 A;  2F8K A;  2JEJ A;  2JXJ A;  2M0N A;  2F1H A;  1SV0 A;  4YVZ A;  1H38 A;  4GLX A;  5DQI A;  3C29 A;  4DQI A;  4DSF A;  5TIS U;  5DDY A;  4RNO A;  5DB6 A;  4BWM A;  2BPC A;  2DL0 A;  5ALY A;  3ISD A;  1S10 A;  4NLZ A;  2DBY A;  2H3Z A;  1U9L A;  2F76 X;  4CF5 A;  5IIN A;  3TAR A;  2W9M A;  4P2H A;  3M9M B;  3SEN A;  5J2I A;  5IIM A;  4M47 A;  2ZIU B;  2F3N A;  2LYH A;  2HOI A;  1D8L A;  3GII A;  2DFL A;  2E8N A;  1CI4 A;  5D49 A;  2HHQ A;  3DDH A;  1L3S A;  2KFZ A;  2BQU A;  4FBT A;  1T8E A;  3M7D A;  1BPY A;  2MUT A;  1KLN A;  2W11 A;  1SKW A;  1N2X A;  1IM4 A;  3WKB A;  4RPX A;  2ZIW B;  2HCF A;  3JPS A;  2HMX A;  1C7Y A;  1SXD A;  2G0A A;  4ECT A;  5KFF A;  3PW0 A;  5KFJ A;  1PVP A;  4ECX A;  3GV8 B;  4NM2 A;  2F1I A;  5KFW A;  4QJF B;  4R8U A;  3WK6 A;  3PST A;  1MSW D;  3AL0 B;  1KL9 A;  5J8Y C;  3SAG A;  5AKG A;  2GLE A;  2JEI A; 
#chains in the Genus database with same CATH homology
 1A0P A;  2KD1 A;  2W04 A;  4A8E A;  2DQN B;  2OM6 A;  3LVV A;  3PSP A;  1A6S A;  1Z1B A;  3F53 A;  2XVT A;  3HKZ F;  2PMZ C;  4KMO B;  2ZIX A;  2XID A;  2ZIV A;  3VC8 A;  3IN5 A;  3C28 A;  2JH7 A;  4OJO A;  2F8L A;  2KHQ A;  2RHF A;  1URJ A;  1UPH A;  2K89 A;  2YB1 A;  2KKP A;  3PSF A;  1PVQ A;  5KL8 B;  2CN1 A;  1MA7 A;  1HIW A;  2E1F A;  1CRX A;  2M0N A;  3GU3 A;  2WB1 F;  2PMZ F;  2A3V A;  2ZIU A;  2W03 A;  3N7P D;  2JH1 A;  5A0L A;  3C29 A;  3CYM A;  5C0Y A;  2K4H A;  2G07 A;  2KJ9 A;  4P0P B;  2VJ5 A;  3NUQ A;  2VIX A;  4NWI A;  1L6N A;  4U7C A;  2CPR A;  3LYS A;  4QIW C;  3SQI A;  3ALR A;  3CRX A;  2H3Q A;  3H0M B;  2W7P A;  1WUD A;  2H3I A;  3KFU F;  1T94 A;  4PL2 A;  2YX8 A;  4BX9 C;  2K8C B;  4KX3 A;  4IC9 A;  3RFA A;  2ZIX B;  2H3Z A;  4OJL A;  2DF4 B;  2ZIV B;  2E1E A;  2YB4 A;  2F76 X;  2Y0S C;  3KZX A;  2G5I B;  2HBJ A;  2XIC A;  2LHT A;  4QNL A;  2KEY A;  2R18 A;  1XO0 A;  1ZQ1 C;  3D2N A;  3LVW A;  2MA1 A;  2F2A B;  2GH1 A;  1GO3 F;  2LKY A;  4GFJ A;  2H3V A;  2HBK A;  3ONN A;  2ZXH A;  4FZN A;  4P0Q A;  2Q4T A;  4FZM A;  3D2S A;  2ZIU B;  2KHV A;  4PL1 A;  5HR6 A;  4CRX A;  2K4I A;  2K8B B;  2BDU A;  2ZIW A;  3SAF A;  3AQF A;  4BJQ A;  2G06 A;  1ED1 A;  2W7O A;  1Z19 A;  1D8B A;  5HR7 A;  3O0F A;  2HOI A;  5CRX A;  1HEK A;  2MRL A;  4C0Z A;  2KKV A;  3PZP A;  3IP4 B;  5T14 A;  2LYA A;  3F5E A;  3RF9 A;  1KBU A;  4OO1 J;  2OH2 A;  4AYB C;  2HOF A;  3OPX A;  4OJ6 A;  2F77 X;  3M6K A;  4P0P A;  4ICA A;  2KNJ A;  2OXO A;  2N1R A;  4OJP A;  3M7D A;  2CRX A;  3SMV A;  4QIW F;  2WAQ C;  2ZG6 A;  2ZXI A;  3AQE A;  2VKQ A;  3H0R B;  3IG5 A;  3MGV A;  1DRG A;  3F5A A;  2JHD A;  1Q3V A;  3HKZ C;  2RRD A;  2JMG A;  1OUQ A;  1NZB A;  2HOQ A;  1TAM A;  2Z7J A;  3L3F X;  4U6P A;  4P0Q B;  2G08 A;  2E5S A;  1P7D A;  4BUG A;  2KOB A;  2HBM A;  1ECW A;  2KIW A;  3SAH A;  3T79 A;  1PVR A;  3DEE A;  2H3F A;  2Y0S F;  3H0L B;  3PSI A;  2ZIW B;  4FZL A;  2KV2 A;  3K1Z A;  2LBO A;  3VCB A;  4OJ5 A;  2GOL A;  2WAQ F;  2HMX A;  2JGA A;  2NV3 A;  3E0F A;  2G0A A;  1IIP A;  2K8A A;  4NLB A;  3CP8 A;  2KJ8 A;  2RP5 A;  1XNS A;  3F2B A;  2WB1 C;  4CGZ A;  5KL1 B;  3GZF A;  1PVP A;  2VJ4 A;  3NRW A;  1F44 A;  4CDG A;  2XI9 A;  2KVC A;  1SZH A;  2G5H B;  4KX5 A;  4JMU A;  4NLC A;  2K4E A;  4QJF B;  3F2D A;  4O3M A;  1YT3 A;  3M6Z A;  2KJ5 A;  4FE3 A;  2D6F C;  3PST A;  3ICX A;  3IG8 A;  2DGZ A;  4NV0 A;  1Q3U A;  4WJ3 B;  2KIC A;  3AL0 B;  3D2Q A;  2G09 A;  2HBL A;  2OYY A;  3N7R C;  3N7S C;  3F2C A;  3SAG A;  4AYB F;  2LYB A;  4ACO A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...