2OYYA

Hthp: a hexameric tyrosine-coordinated heme protein
Total Genus 30
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
30
sequence length
71
structure length
71
Chain Sequence
TWLPTLVTATPQEGFDLAVKLSRIAVKKTQPDAQVRDTLRAVYEKDANALIAVSAVVATHFQTIAAANDYW
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title HTHP: A Novel Class of Hexameric, Tyrosine-coordinated Heme Proteins
pubmed doi rcsb
molecule keywords Hexameric cytochrome
source organism Silicibacter pomeroyi
molecule tags Unknown function
total genus 30
structure length 71
sequence length 71
chains with identical sequence B, C, D, E, F, G, H
ec nomenclature
pdb deposition date 2007-02-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF11534 HTHP Hexameric tyrosine-coordinated heme protein (HTHP)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.500 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 DNA polymerase; domain 1 2oyyA00
2OYYA
chains in the Genus database with same CATH superfamily
2RHFA 2KNJA 4ECRA 4WJ3B 4FS1A 1B43A 3G6VA 1NKCA 4KLEA 3AU2A 5D46A 4EX7A 5DGAA 1DGJA 4F3OA 4DL5A 3H8SA 1KSPA 2YMLA 3RBEA 3HJEA 3MBYA 1KKXA 2AGPA 4DSJA 5IIKA 2RDJA 2XGQA 4O3OA 4PZOA 2QB0A 1S5LU 1X40A 2F1HA 5AI0A 1DK3A 2DWQA 4OJ5A 3SAHA 1NK4A 1XSPA 2L5YA 4DFJA 3OHAA 5JTIA 1MQ3A 1ZQLA 4F5RA 3IG8A 4UB1A 5AM4A 4MHVA 1Z19A 1ZD2P 3ZDEA 2GO7A 2E5SA 4BX9C 4JMUA 4EYHB 4BWMA 2R18A 2EZYA 4M2YA 4DL6A 1KTQA 3H7IA 2QARB 1DRGA 9ICLA 4YR2A 3TADC 5IILA 1RG6A 4RQNA 2OCEA 4YG2A 4YQWA 3G6YA 4IQWA 1NI3A 5ALMA 5BOLA 1Z3EB 4C80A 3L4PA 3QNMA 2WAQC 4ECZA 4M6WB 4IC9A 1OUQA 4R8UB 3OGUA 4F91B 1WCLA 1Q8KA 2EH9A 5DDMA 5KG2A 4Y2QA 1F5SA 3RJHA 7ICFA 1TAMA 2E8PA 3UXNA 2NYVA 5AM0A 1D8LA 2KVSA 3GV5B 3C2MA 5J0PA 4RNMA 3M9NB 5KFQA 1ZRMA 5KFJA 1X9WA 1J2MA 2ASLA 2D6FC 3KOOA 3ALRA 2HMXA 3QEBZ 1Z1BA 3WK5A 2VANA 3M7DA 2BGWA 3SYZA 1ZQEA 4JV2A 3PX0A 3V6KA 3WK6A 1BPEA 3CP8A 5AIAA 2H3ZA 4UB5A 1PZNA 2XICA 3HILA 4PHPA 5L1JA 1RM6C 4J9PA 1X6IA 2FMPA 4PHAA 5AKZA 1VDVA 1QCKA 2ZJ5A 4RQMA 4NY8A 5DB9A 4EENA 2FMQA 3PSIA 8ICCA 4KITB 4I2FA 3AN1A 2KJ5A 1ZQBA 3RJKA 4DFMA 1Z4OA 1L7PA 2F8LA 5KFEA 4QZHA 4M47A 7ICKA 1ZQKA 3M8SA 4QZIA 1OXJA 4R66A 4K4HA 4OO1J 5J0SA 4RNNA 4I2CA 1ZQJA 5ALOA 3JPPA 1UA1A 3JPRA 2ZXHA 2DPIA 3PR4A 4ECWA 5AICA 1X9SA 1YZ6A 3SAGA 2Y9TA 1L5UA 2Q4TA 2BDUA 4ACOA 3NVYA 5G5HA 1DOQA 3TAQA 2W55A 1C7YA 4EELA 1L8OA 3KTQA 9ICWA 5EWFA 5KFUA 4DQPA 4IR1A 2ZUBA 1U4BA 4QWEA 2PFNA 4YD2A 4U6PA 3AMZA 4KLQA 4M9HA 4UAWA 2M9NA 1WUDA 1NKEA 3SAFA 3H0LB 4J9SA 3RB3A 5DLFA 8ICAA 2FLLA 5J2AA 2F76X 3V6JA 1A76A 2KEYA 1SGGA 3QXGA 5HNKA 5EWGA 5IINA 5ALDA 8ICOA 3NVZA 7ICSA 1ZQGA 8ICLA 1PVQA 2HHXA 4B6JA 4CE6A 8ICNA 3PO4A 4F4WA 5KFCA 4DF4A 1RYSA 3H8JA 2VA8A 4PH5A 5ALUA 5AKLA 3Q8KA 8ICKA 2JXJA 9ICIA 4P4PA 5AI8A 2H3FA 4DOCA 4YP3A 1JROA 2W8LA 3LVVA 1C20A 2W9CA 1JX4A 3N7PD 3TACB 4RNOA 2DUYA 5KG7A 4JK1A 4IRDA 4DSIA 4LJXA 4KN4A 3C29A 2HVHA 4I27A 5KG5A 3QYPA 3SMVA 3K1ZA 2FI1A 4BXOA 2CPRA 3Q8SB 4EX6A 1DK2A 5KNIA 2E3TA 2OM6A 2YMQA 1D9DA 2KJ9A 2HI0A 2JR5A 4B9UA 4QZFA 1DXSA 4ECVA 1N48A 4OJOA 2LPEA 4EYIB 2QKQA 4KLJA 3IDWA 2KSOB 2GLEA 2WF9A 3WKBA 1GO3F 7ICJA 1BGXT 3JPSA 3C5GA 4PL1A 2FPKA 2BHNA 4BDPA 5KFPA 5KFIA 5J2IA 3PVXA 3R9KA 5DBAA 4DFDA 4DSLA 5EOZA 1QTMA 1JI7A 4NLKA 3ICXA 2R8KA 4DSKA 1UT8A 2Q0ZX 4YVZA 4F4XA 1SZHA 4KLGA 3UPQA 4DSFA 5ALGA 4M0AA 3RJIA 4OCZA 3Q8MA 1Z00B 2EDUA 2BCSA 2ALZA 2ATLA 1WCNA 2HCFA 1KL9A 2XY6A 4CF5A 5KT6A 2BPFA 9ICFA 2JEIA 1L7OA 1NK6A 3A0BU 2HW3A 1T3NA 2MU2A 2OWOA 4Y2TA 4BJQA 4ECXA 1V9PA 2JV3A 8ICGA 5AKKA 2FJ6A 1ZQQA 1SZPA 4QWCA 2ISPA 9ICEA 2W9BB 4F71A 2HHVA 1ZQNA 3M9OB 2AU0A 5ALNA 2AXTU 4DL3A 9ICGA 1RDFA 4PJ0U 4B9MA 2F3NA 3C1ZA 3IHQB 3TANA 1XO0A 3RB0A 1DGSA 4Z6DA 3K75D 1SWWA 4KMOB 4DL4A 1LKYB 3RRGA 4RT2A 3N97B 2HHSA 5EE0A 3WKAA 2HHQA 1PK3A 4DFPA 4EEKA 5D4BA 2HBLA 4UAZA 1NK0A 3ONNA 3KZXA 1Z00A 1AQ6A 2EZXA 5KFBA 4IRKA 1UPHA 2JZBA 4DOAA 3FYHA 8ICFA 4XA5A 3N28A 4I2BA 4BGDA 4IS7A 4O3RA 3RJJA 3M8RA 4QZDA 2BCUA 1ZQWA 3BJYA 3I1YA 3C5FA 2PMZF 5L9XA 4PZNA 4UBBA 4ED1A 5J0XA 2V9WA 4J9NA 5BPCA 3V72A 3MGIA 1NK5A 2UVVA 1PVRA 2W9BA 7ICUA 5ALFA 3LWLA 1MC8A 1WYGA 3MR3A 2EAMA 2DKZA 4GFJA 3H8MA 3QU7A 4C8OA 1U48A 3NVWA 1JRPA 3QU2A 3LYSA 2WF8A 2ZTDA 2AGOA 4NL9C 2XCAA 4FS2A 5AI4A 2KN7A 3UXPA 5KFSA 5L1MA 4NJ8A 3MGVA 3EUB2 3ISDA 3KHHA 4YXJA 2Y0SC 3OTQA 2BPGA 3E2EA 4I2GA 3F2DA 3PW4A 1XC9A 1ZQDA 2VKQA 4C8MA 2KHVA 4CF3A 2QB0B 3PMLA 4R65A 3C2LA 2E8OA 5ALXA 5ALKA 1SL1A 3RJEA 2IOFA 4DS4A 1BPBA 1JN3A 5DGBA 4YD1A 1X9XA 3PW0A 2IA6A 1O03A 4QWDA 1T4GA 3S6JA 2W54A 4B9TA 3GV8B 5J2EA 2K4EA 4E0DA 3RB4A 2JHDA 3M6KA 4UB2A 3NRWA 3PW2A 1KFTA 1ZQHA 8ICZA 3RB6A 3Q8QB 3QUTA 2E8NA 3BS7A 3ETRA 5KFMA 5JU5A 4G9BA 3IG5A 4RUCA 2IOFK 3OJUA 4PHDA 5AK3A 2ZTEA 4I2DA 3HP6A 7ICNA 3JPNA 2KZZA 4UBCA 2IHNA 3RH6A 2F44A 1ZQUA 3PW5A 9ICJA 2XGPA 1SV0C 1S0VA 4JWNA 4UQGA 1RXVA 2GH1A 9ICHA 5DB8A 5KG3A 1ZQRA 1BNPA 2KZMA 1XU4A 3C28A 3TFRA 2JH7A 3TAPA 3ZD9A 1OW5A 1FEZA 4YMMA 3WK9A 2MUTA 2YB4A 1V38A 5KG4A 1SKWA 3QZ7A 4NV0A 1ZQ1C 3IRUA 4A8EA 3PY8A 3U26A 2XC9A 2W3RA 2R8IA 3UQ0A 2RLTA 1X2IA 4QZ8A 3RTVA 1SL0A 1L7NA 1EXNA 1L3SA 4RQ4A 3LWMA 3PR5B 5G5GA 2NRVA 2VIXA 3DDHA 5J0TA 4R64A 4I29A 5J2FA 3IN5A 1L3UA 2W11A 3BQTA 4NWIA 5J0OA 2KIWA 4J9MA 2Y1IA 4GXJA 1T7PA 2NO4A 3NUQA 4ECYA 5IIOA 1SV4A 2K4PA 2F8KA 3ZDAA 1KBUA 2LYBA 4US8A 2ZUCA 2W04A 4MF2A 2H3QA 3MR5A 1ZYQA 2Z7JA 4RQ6A 3WKCA 3UXOA 2EAPA 2P6UA 2ZUDA 1NZPA 4C4TA 2BR0A 9ICUA 2WF6A 4YN4A 5J0UA 3T79A 1BPXA 2I9GA 5IIIA 5J2BA 5C0YA 4NL9A 4IRCA 5AM2A 1PUZA 5GTHU 3V6HA 5EWEA 5HR6A 1ZQPA 3MR2A 2NV3A 2W3SA 3V7JA 1U47A 7ICHA 4ED7A 5KFZA 5DG9A 7ICVA 2HSZA 3E0FA 2HBJA 4DOBA 3H4BA 2NRWA 4GLXA 2KTQA 8ICRA 4F2RA 3GFKB 1SXDA 4C8NA 5B5EU 2OH2A 3OSNA 1ZQFA 2W43A 2YB1A 2XVTA 5IIJA 1D9FA 3GV7B 7ICTA 2H3VA 1U45A 2JGAA 1X42A 2NO5A 5ALPA 3EZ5A 4B9LA 4RU9A 5HR7A 1P7DA 3AU6A 4J9RA 3NTUA 1YT3A 4JUZA 2D8CA 1HJPA 4ED6A 2UVRA 4QZGA 1CRXA 7ICPA 3M1YA 3MR6A 4J9LA 3KHGA 3HPOA 4Y2PA 3NRZA 4DEZA 4ELVA 2BZFA 4GXKA 3RH4A 2HBMA 2MA1A 2KFZA 1WWVA 3AL0B 3RBDA 2FLPA 1Z4NA 2W9CB 3A0HU 3GIMA 1T3QA 3CW2C 2IMWP 4RQ2A 4KLSA 4F5PA 7ICLA 1ZQYA 3EW9A 4EEYA 2WFAA 4Q45A 9ICSA 3RFAA 2MRLA 2B6GA 4BXOB 3JPQA 1KQQA 3QU9A 8ICEA 2WF5A 2H5XA 4HAIA 1ZQZA 1MN8A 2XCPA 4Y2YA 1XS9D 2FMSA 4C0ZA 3C1YA 4GXIA 2HHWA 1B0XA 2I5HA 3RRHA 1X66A 2DFLA 4Q8FA 2G0AA 3LDAA 1YZ7A 4RPZA 5KT5A 2AQ4A 5KAFU 2AHOB 1T8EA 3TADA 2R8JA 2JEJA 1TAQA 3IM1A 5CB1A 7ICQA 3QE9Y 1ZRNA 3SV4A 4FBTA 4KLUA 2C2DA 1TFRA 2ZJAA 2V4RA 3QU4A 4P0PA 3B9JA 2DQNB 3TKAA 1NJXA 4I2HA 3ED5A 4F4KA 4JB3A 4EBDA 4B9NA 3MABA 7ICEA 5J2CA 2DL0A 2C2EA 1D8BA 1QSSA 2KMDA 3RJFA 1L3VA 3KHRA 2KG5A 3RR7A 3KZIU 2YMMA 5ALHA 4DQRA 2VA3A 1A77A 1J2NA 4DLGA 2NRXA 3RH5A 4DO9A 4RT3A 3AEVA 4FBUA 4UASA 3C2KA 1X9MA 1H38A 3H8WA 3VCBA 3O0FA 3CNHA 2IBKA 4CCHA 4PGXA 2YY6A 1N63A 4DL2A 2CN1A 4US9A 3EPIA 1SWVA 4IQVA 5DB6A 5JUMA 1SKRA 2N1RA 1KW4A 2WAQF 3WK8A 4OJPA 5B66U 4MFFA 4F92B 1IXRA 1ZD3A 4ED3A 1XWLA 2C2RA 5CA7A 2ISOA 1KEJA 1JXEA 5ALYA 1KN5A 4J03A 3OJSA 1KFSA 5J0QA 2ZG6A 4UB3A 1ZD5A 5J2DA 2R8HA 5EE9A 5DQGA 2XY7A 2K8CB 5KT2A 4ECSA 1S0NA 4F8RA 1QH9A 2JZBB 2GOLA 4M9LA 4U7CA 7ICGA 4IQTA 3HRDD 5AI5A 1TV9A 3VC8A 2K8BB 2YX8A 2VA2A 1PK1B 4AP9A 8ICTA 4DL7A 4UARA 2V4QA 3L3FX 5KFRA 4CF4A 1HUOA 3MGHA 5HHHA 2ZIUA 5AKIA 2PFOA 2WF7A 2DPJA 5DLGA 4TQRA 3SV3A 3QUCA 4O5CA 3UMGA 5DG7A 1HUZA 3CRXA 2AQ0A 3F2BA 3BS5B 4KLMA 2NRTA 2YTUA 5ALQA 4Z6FA 1RYRA 1T94A 4DQSA 4TUPA 3UMBA 2P35A 3AQFA 3DEEA 2ZIXA 5KT4A 1ZQAA 2C28A 2DGZA 4RQ0A 4NLZA 2LM1A 9ICBA 4J9OA 2DBYA 3I28A 3LVWA 4NLNA 5CR0A 1MSWD 4Y2RA 8ICVA 1B22A 1MQ2A 4MF8A 2ASDA 3AM9A 3HX0A 2JEFA 1K1SA 1N5XA 1NKBA 4LZDA 3UQ2A 1IIPA 1TK0A 3WU2U 2XI9A 4CDGA 2BKEA 5E79U 2HVIA 2OHFA 1U49A 1FFVA 3ZI4A 2ZIWB 2W03A 1PK1A 2IOHA 1WG8A 4K4IA 8ICMA 4QZCA 3ISBA 4UATA 4TUSA 2R8GA 2BCRA 4AYBC 4RQ5A 3T3FA 4I2JA 2K89A 2HOIA 4QZ9A 4KTQA 4B9SA 1ED1A 3PX4A 4LZGA 2G06A 8ICBA 4O3NA 4P0QA 5CWRA 1S0OA 4O3QA 5KFWA 3BS5A 2EANA 5DKWA 4ECQA 5C5JA 1L3TA 2PXIA 5J0WA 2P6RA 5CJ7A 4MEXA 2WB1C 4NXZA 7ICIA 4UAVA 2FE9A 1LB2B 1AROP 3KD3A 1PVPA 3T5KA 4IR9A 1TK5A 1N60A 2AGQA 2I6XA 3Q8RB 5KG6A 3NGDA 3HKZC 2F1IA 5HMMA 2B21A 4ICAA 4XRHA 1UT5A 5F9LA 4O3SA 1S8OA 9ICNA 4DCCA 4K4GA 2MUTB 4QZEA 4M04A 4RPYA 4NLGA 3OPXA 2C22A 2G09A 1O08A 3B0XA 1CEZA 1SL2A 2HOQA 3HT3A 5AM5A 4NM2A 5KT7A 5KG1A 2ZIWA 2KOBA 1D8YA 2A1JB 8ICSA 1COOA 3MC1A 1JXLA 3TI0A 2GWSA 3WK4A 3GIIA 5CHGA 5F3XB 4ECUA 4KLFA 1NK7A 4YR3A 1JALA 4F4YA 4KX5A 4FFDA 9ICKA 1ZQSA 4B9VA 4QW9A 3PX6A 3H0MB 1J97A 1ZXIA 5ALLA 2W7PA 4MFAA 1RQNA 1K1QA 1ZJMA 2E8MA 4Y2VA 5AKYA 2QLTA 1F44A 1Z1VA 2ZJ8A 7ICMA 1XO1A 5KAIU 2LYAA 1ZQTA 1KDHA 4F5NA 4FZLA 4I2EA 4DWIA 3WKEA 1VLBA 5J0YA 5DQHA 3N4MB 3PSFA 2F77X 5KFVA 1L6NA 4P2HA 1HEKA 3FAHA 4BWJA 4EZ6A 4YR0A 3BQ0A 1FO4A 1TK8A 4PL2A 3GDXA 3H0RB 4QW8A 4ED0A 2BCVA 2AJQA 4F72A 1A0PA 4TUQA 2KKVA 1ZQIA 4EBCA 2PKEA 1QQ6A 8ICXA 4DF8A 3D2QA 2I1QA 3MDAA 1S10A 5J2JA 4KLIA 8ICHA 3I76A 9ICPA 2A1JA 3FM9A 4YCXA 4PGYA 4F93B 3RJGA 4Q43A 3T5JA 3ZDBA 4RQ3A 1Y88A 4EBEA 2E1EA 5TISU 4GC6A 5AKJA 2ZIVA 3SEIA 2KVCA 4O9MA 3KBBA 1LVHA 4O5KA 5D49A 5J8YC 2O6KA 2FLNA 3SQIA 5DBBA 1FIQA 3ZDDA 2K60A 4J9KA 1KLNA 3GILA 4DS5A 3EYZA 2M0NA 4I2IA 2F2AB 3SI8A 3TQ1A 4MEYA 1N56A 1FFUA 5EE3A 3MDCA 4XUSA 1ZETA 5KG0A 4CNQA 3E58A 2WTFA 3FC4A 2P66A 2ASJA 3WKDA 3ZD8A 5KFFA 3TARA 3BQ2A 4GC7A 3QUBA 2BQ3A 4JWMA 4Y2SA 5ALWA 2KKPA 3RAXA 2BCQA 4ZH4A 1BPDA 1WWUA 5J2GA 2LKYA 3AUOA 4OD0A 3WK7A 5L1LA 2IHMA 2J6UA 2KD1A 3J81j 3BQ1A 3T5LA 4IL6U 3KHLA 4YMNA 3KFUF 2LM4A 1JIHA 4AYBF 3HW8A 4GIBA 1JMSA 3K4GA 4Z6CA 4UB6U 1RZTA 1S77D 2ZTCA 5CEHA 4KLHA 5ALIA 2XO7A 4LVSA 1KFDA 5KFGA 3H4DA 4BUGA 2B0CA 1S0MA 3M6ZA 5KFKA 2WB1F 2F1JA 2CRXA 5AM1A 1IV8A 5JRTA 3FDSA 4CGZA 1L7MA 2OYYA 8ICJA 2PI4A 2QARA 5KFDA 8ICIA 3ETLA 1SV0A 2ODGA 1BVSA 1NZBA 3HKZF 8ICUA 2KP7A 4P0PB 2Y0SF 4QJFB 4EZ9A 4KLTA 5ALVA 5ALSA 2W7OA 3Q8LA 3D2NA 4M6WA 4F5QA 9ICVA 5FP0A 5AKHA 4R8UA 5ALEA 1Q3VA 1ZQMA 5KT3A 4NLBA 2OXOA 1ECWA 5KFAA 3ZDCA 3IP4B 2LBOA 2LHTA 2JH1A 1A6SA 2KK0A 2XY5A 2YN4A 2JRZA 4JV0A 3GQCA 4QWBA 1S76D 1ZOLA 3AQEA 9ICTA 1QQ5A 2Y1JA 4ELUA 5L1KA 4G3IA 2PMZC 3SENA 2BPCA 2LMRA 1N62A 4USAA 3PW7A 4DFKA 4M9GA 9ICOA 2HDOA 4RPXA 4C8KA 4Q8EA 3OHBA 2HOFA 2A3VA 4Y2JA 1UHUA 5AK5A 3GZFA 5J8YA 1COKA 1SIJA 4TQSA 4KMUA 1S9FA 3MFIA 1UA0A 5AK4A 4FO6A 8ICYA 1K5OA 3QEAZ 5ALTA 1SB3C 5J29A 4I28A 4JV1A 5DDYA 4UAYA 2KFNA 3SD7A 5KFTA 3M9MB 7ICRA 2MAXA 1BPYA 2PFQA 3F5EA 2HHTA 4O5EA 4YFKA 3CYMA 3IV6A 2J6TA 1IG6A 5IIMA 2KIVA 2ZIUB 2VJ4A 1HIWA 4UAUA 1RPLA 2FDRA 9ICRA 3PSPA 1XSLA 2A1AA 1QSYA 1KRPA 3KKAC 5AM3A 2EQYA 4QWAA 3ISCA 2W8KA 4OJ6A 3NASA 5KFNA 5J2KA 5KL1B 5ALJA 4KN7A 1M6YA 5K4LA 1JUDA 2ZIXB 4DLEA 1BPZA 4QNLA 5CRXA 2K4IA 5KFYA 1NJYA 5AI6A 3PZPA 2YMPA 2QB1A 3V7LA 3EWAA 4QIWC 3T5HA 5DBCA 2KICA 4UW9A 8ICWA 3C21A 4Z6EA 2ESEA 4J9QA 2UVWA 3BZCA 2BDPA 4ED8A 3NVVA 2WHEA 4Q44A 5F9NA 4KLDA 4DQQA 4KX3A 1MA7A 5KL8B 5CP2A 3OSPA 1B4FA 4KLLA 1L8LA 4RZRA 4PHEA 4F4ZA 9ICXA 1TAUA 1XNSA 1XSNA 3Q8PB 2VJ5A 3B0YA 2CXYA 3F2CA 2HBKA 3TFSA 3THVA 5KFLA 5AI9A 2FPMA 3QUQA 1CUKA 1QLNA 9ICCA 1X6JA 4FZMA 4I2AA 2EAOA 4P0QB 5HHIA 5AHXA 5ALRA 5J0RA 3G6XA 1V85A 5KFOA 2G5HB 3GIKA 5AIBA 3RAQA 1NK8A 5DB7A 2HHUA 4NLCA 2K4HA 2KV2A 3DV9A 2G5IB 4Y2XA 2PI5A 2G08A 1UCVA 1ZQCA 3PNCA 4ECTA 1UQVA 3GU3A 4F50A 2W9AA 4CRXA 4C7ZA 4TURA 4O3MA 1N5WA 2LYHA 2KSOA 2EZZA 3MFHA 1ZQXA 4YMOA 5DG8A 5HP4A 4M9NA 2JMGA 4FE3A 3RF9A 9ICMA 1CI4A 5L1IA 4C4RA 2KHQA 4PGQA 3RR8A 5J2HA 1N2XA 1QQ7A 3L5KA 5AKGA 3C23A 3NS1A 5T14A 1U9LA 2JEGA 9ICQA 2G07A 2PFPA 3N7RC 5GTIU 4P4OA 1V97A 4Y2UA 5ALZA 3QU5A 4R63A 2KE7A 5AKXA 1S97A 4PPXA 3BQ7A 3QX7A 5AK6A 4MFCA 1TVAA 5KFXA 2UVUA 8ICQA 5DQIA 4IQUA 2DF4B 4ELTA 3K1RB 4DSEA 3KKAA 1RXWA 5HMLA 2ZXIA 4HYKA 4O0IA 2H3IA 3HWTA 5KFHA 3F5AA 7ICOA 5A0LA 3PMNA 1LV5A 3LK9A 3GIJA 1BNOA 3UMCA 3H40A 4QZBA 4DQIA 1RQLA 4F2SA 1NK9A 4QZAA 2AH5A 1NJWA 5EE1A 4UB8U 1ZJNA 3BDPA 3D2SA 2E1FA 2ES6A 2FPLA 4C8LA 1SKSA 1Q46A 4X5VA 1LKYA 1URJA 4O3PA 4C7YA 2RDIA 9ICAA 1VJ5A 4RQ8A 2BQUA 3SR6A 3BZKA 3N7SC 2KZ3A 1NJZA 4YXMA 3PV8A 3JPOA 3QZ8A 4UB4A 2RQ5A 4RUAA 3PSTA 4XQ8A 2XIDA 2ZIVB 5TZVA 3V7KA 3UM9A 4M9JA 5KTQA 2NRZA 1F0MA 3SZ2A 4RQ1A 2RRDA 2OEHA 4OJLA 2KJ8A 3ORYA 4ZOHC 2J6SA 2DKXA 4P4MA 2RP5A 1RYUA 1TE2A 2BQRA 4C4SA 8ICPA 1Q3UA 2W9MA 1SXEA 1ZD4A 2YQEA 2Y9UA 3F53A 1NOMA 4NM1A 1TKDA 4RQ7A 2K8AA 1ZQVA 2A19A 1QSLA 1IM4A 1ZQOA 4QIWF 3EPGA 2LI6A 4ED2A 1N61A 4FZNA 5H2FU 5BOMA 1NNLA 2MSNA 5AKEA 3D6JA 3PO5A 4KLOA 4F5OA 3JPTA 2D3DA
chains in the Genus database with same CATH topology
3F5EA 2RHFA 4U6PA 2JHDA 3M6KA 2DGZA 2KNJA 4PL1A 1UPHA 2CRXA 4WJ3B 3NRWA 2E1EA 3F5AA 5A0LA 3OPXA 4CGZA 2G09A 1WUDA 2D6FC 2OYYA 3CYMA 4FZMA 2ZIVA 4P0QB 3SAFA 3H0LB 3LVWA 2KVCA 2HOQA 3ALRA 2HMXA 3T79A 3ICXA 1Z1BA 3VCBA 2PMZF 3M7DA 2ZIWA 3IG5A 3O0FA 2KOBA 2ZIUB 2G5HB 5C0YA 1SZHA 2F76X 3RFAA 2MRLA 2KEYA 2VJ4A 1NZBA 3HKZF 4P0PB 2Y0SF 4QJFB 2CN1A 3RF9A 5HR6A 1IIPA 3SQIA 3D2SA 1HIWA 2E1FA 2W7OA 4NLCA 2K4HA 2XI9A 1PVQA 2KV2A 4CDGA 2G5IB 2N1RA 2WAQF 2NV3A 3D2NA 3PSPA 3CP8A 4OJPA 2H3ZA 4KX5A 2G08A 1Q3VA 2XICA 4OJ5A 3SAHA 2GH1A 2M0NA 1PVRA 3GU3A 4NLBA 2F2AB 4C0ZA 2OXOA 4OJ6A 1URJA 1ECWA 2ZIWB 3H0MB 2W03A 2ZG6A 4CRXA 2W7PA 3IG8A 3E0FA 5KL1B 3C28A 2HBJA 2JH7A 4O3MA 2H3FA 3PSIA 4BJQA 3IP4B 4GFJA 2LBOA 2LHTA 2K8CB 2JH1A 2G0AA 3N7SC 1A6SA 2KJ5A 2ZIXB 4AYBC 1F44A 1Z19A 3LVVA 4QNLA 5CRXA 2OH2A 2K4IA 3LYSA 2E5SA 4BX9C 2K89A 2GOLA 2HOIA 2F8LA 4U7CA 3PSTA 3AQEA 3N7PD 3VC8A 3PZPA 2YB1A 2YB4A 2JMGA 4FE3A 2LYAA 1ED1A 2XIDA 2KKPA 2XVTA 2K8BB 2ZIVB 4JMUA 1ZQ1C 2R18A 4FZLA 4NV0A 4QIWC 2YX8A 2KHQA 2H3VA 3KZXA 4A8EA 1DRGA 2G06A 2KICA 2JGAA 2PMZC 4P0QA 3MGVA 3C29A 2RRDA 2LKYA 4OJLA 2KJ8A 4OO1J 3L3FX 3PSFA 2F77X 2Y0SC 3SMVA 5HR7A 2KD1A 2ZIUA 1P7DA 1L6NA 3K1ZA 2RP5A 1HEKA 2CPRA 5T14A 3F2DA 4P0PA 2VKQA 2G07A 1XO0A 2KHVA 2WAQC 2WB1C 1YT3A 2ZXHA 3N7RC 2VIXA 3KFUF 4AYBF 2OM6A 2DQNB 4IC9A 4PL2A 1OUQA 1Q3UA 2A3VA 2HOFA 3F53A 2KJ9A 3H0RB 4KMOB 3GZFA 3SAGA 3IN5A 4KX3A 4NWIA 3CRXA 2KIWA 1PVPA 5KL8B 1MA7A 1CRXA 1A0PA 2K8AA 2KKVA 2Q4TA 2BDUA 3NUQA 4OJOA 3F2BA 4QIWF 4ACOA 1TAMA 4FZNA 3D2QA 1XNSA 2HBMA 1D8BA 1KBUA 2MA1A 2DF4B 2LYBA 3HKZC 1T94A 2W04A 2VJ5A 4BUGA 3AL0B 2H3QA 2HBLA 3F2CA 2HBKA 4ICAA 2Z7JA 3M6ZA 2ZXIA 1GO3F 3AQFA 3DEEA 2ZIXA 3ONNA 2WB1F 2K4EA 2H3IA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2OYY A; 
#chains in the Genus database with same CATH topology
 2RHF A;  2KNJ A;  4ECR A;  4WJ3 B;  4FS1 A;  1B43 A;  3G6V A;  1NKC A;  4KLE A;  3AU2 A;  5D46 A;  4EX7 A;  5DGA A;  1DGJ A;  4F3O A;  4DL5 A;  3H8S A;  1KSP A;  2YML A;  3RBE A;  3HJE A;  3MBY A;  1KKX A;  2AGP A;  4DSJ A;  5IIK A;  2RDJ A;  2XGQ A;  4O3O A;  4PZO A;  2QB0 A;  1S5L U;  1X40 A;  2F1H A;  5AI0 A;  1DK3 A;  2DWQ A;  4OJ5 A;  3SAH A;  1NK4 A;  1XSP A;  2L5Y A;  4DFJ A;  3OHA A;  5JTI A;  1MQ3 A;  1ZQL A;  4F5R A;  3IG8 A;  4UB1 A;  5AM4 A;  4MHV A;  1Z19 A;  1ZD2 P;  3ZDE A;  2GO7 A;  2E5S A;  4BX9 C;  4JMU A;  4EYH B;  4BWM A;  2R18 A;  2EZY A;  4M2Y A;  4DL6 A;  1KTQ A;  3H7I A;  2QAR B;  1DRG A;  9ICL A;  4YR2 A;  3TAD C;  5IIL A;  1RG6 A;  4RQN A;  2OCE A;  4YG2 A;  4YQW A;  3G6Y A;  4IQW A;  1NI3 A;  5ALM A;  5BOL A;  1Z3E B;  4C80 A;  3L4P A;  3QNM A;  2WAQ C;  4ECZ A;  4M6W B;  4IC9 A;  1OUQ A;  4R8U B;  3OGU A;  4F91 B;  1WCL A;  1Q8K A;  2EH9 A;  5DDM A;  5KG2 A;  4Y2Q A;  1F5S A;  3RJH A;  7ICF A;  1TAM A;  2E8P A;  3UXN A;  2NYV A;  5AM0 A;  1D8L A;  2KVS A;  3GV5 B;  3C2M A;  5J0P A;  4RNM A;  3M9N B;  5KFQ A;  1ZRM A;  5KFJ A;  1X9W A;  1J2M A;  2ASL A;  2D6F C;  3KOO A;  3ALR A;  2HMX A;  3QEB Z;  1Z1B A;  3WK5 A;  2VAN A;  3M7D A;  2BGW A;  3SYZ A;  1ZQE A;  4JV2 A;  3PX0 A;  3V6K A;  3WK6 A;  1BPE A;  3CP8 A;  5AIA A;  2H3Z A;  4UB5 A;  1PZN A;  2XIC A;  3HIL A;  4PHP A;  5L1J A;  1RM6 C;  4J9P A;  1X6I A;  2FMP A;  4PHA A;  5AKZ A;  1VDV A;  1QCK A;  2ZJ5 A;  4RQM A;  4NY8 A;  5DB9 A;  4EEN A;  2FMQ A;  3PSI A;  8ICC A;  4KIT B;  4I2F A;  3AN1 A;  2KJ5 A;  1ZQB A;  3RJK A;  4DFM A;  1Z4O A;  1L7P A;  2F8L A;  5KFE A;  4QZH A;  4M47 A;  7ICK A;  1ZQK A;  3M8S A;  4QZI A;  1OXJ A;  4R66 A;  4K4H A;  4OO1 J;  5J0S A;  4RNN A;  4I2C A;  1ZQJ A;  5ALO A;  3JPP A;  1UA1 A;  3JPR A;  2ZXH A;  2DPI A;  3PR4 A;  4ECW A;  5AIC A;  1X9S A;  1YZ6 A;  3SAG A;  2Y9T A;  1L5U A;  2Q4T A;  2BDU A;  4ACO A;  3NVY A;  5G5H A;  1DOQ A;  3TAQ A;  2W55 A;  1C7Y A;  4EEL A;  1L8O A;  3KTQ A;  9ICW A;  5EWF A;  5KFU A;  4DQP A;  4IR1 A;  2ZUB A;  1U4B A;  4QWE A;  2PFN A;  4YD2 A;  4U6P A;  3AMZ A;  4KLQ A;  4M9H A;  4UAW A;  2M9N A;  1WUD A;  1NKE A;  3SAF A;  3H0L B;  4J9S A;  3RB3 A;  5DLF A;  8ICA A;  2FLL A;  5J2A A;  2F76 X;  3V6J A;  1A76 A;  2KEY A;  1SGG A;  3QXG A;  5HNK A;  5EWG A;  5IIN A;  5ALD A;  8ICO A;  3NVZ A;  7ICS A;  1ZQG A;  8ICL A;  1PVQ A;  2HHX A;  4B6J A;  4CE6 A;  8ICN A;  3PO4 A;  4F4W A;  5KFC A;  4DF4 A;  1RYS A;  3H8J A;  2VA8 A;  4PH5 A;  5ALU A;  5AKL A;  3Q8K A;  8ICK A;  2JXJ A;  9ICI A;  4P4P A;  5AI8 A;  2H3F A;  4DOC A;  4YP3 A;  1JRO A;  2W8L A;  3LVV A;  1C20 A;  2W9C A;  1JX4 A;  3N7P D;  3TAC B;  4RNO A;  2DUY A;  5KG7 A;  4JK1 A;  4IRD A;  4DSI A;  4LJX A;  4KN4 A;  3C29 A;  2HVH A;  4I27 A;  5KG5 A;  3QYP A;  3SMV A;  3K1Z A;  2FI1 A;  4BXO A;  2CPR A;  3Q8S B;  4EX6 A;  1DK2 A;  5KNI A;  2E3T A;  2OM6 A;  2YMQ A;  1D9D A;  2KJ9 A;  2HI0 A;  2JR5 A;  4B9U A;  4QZF A;  1DXS A;  4ECV A;  1N48 A;  4OJO A;  2LPE A;  4EYI B;  2QKQ A;  4KLJ A;  3IDW A;  2KSO B;  2GLE A;  2WF9 A;  3WKB A;  1GO3 F;  7ICJ A;  1BGX T;  3JPS A;  3C5G A;  4PL1 A;  2FPK A;  2BHN A;  4BDP A;  5KFP A;  5KFI A;  5J2I A;  3PVX A;  3R9K A;  5DBA A;  4DFD A;  4DSL A;  5EOZ A;  1QTM A;  1JI7 A;  4NLK A;  3ICX A;  2R8K A;  4DSK A;  1UT8 A;  2Q0Z X;  4YVZ A;  4F4X A;  1SZH A;  4KLG A;  3UPQ A;  4DSF A;  5ALG A;  4M0A A;  3RJI A;  4OCZ A;  3Q8M A;  1Z00 B;  2EDU A;  2BCS A;  2ALZ A;  2ATL A;  1WCN A;  2HCF A;  1KL9 A;  2XY6 A;  4CF5 A;  5KT6 A;  2BPF A;  9ICF A;  2JEI A;  1L7O A;  1NK6 A;  3A0B U;  2HW3 A;  1T3N A;  2MU2 A;  2OWO A;  4Y2T A;  4BJQ A;  4ECX A;  1V9P A;  2JV3 A;  8ICG A;  5AKK A;  2FJ6 A;  1ZQQ A;  1SZP A;  4QWC A;  2ISP A;  9ICE A;  2W9B B;  4F71 A;  2HHV A;  1ZQN A;  3M9O B;  2AU0 A;  5ALN A;  2AXT U;  4DL3 A;  9ICG A;  1RDF A;  4PJ0 U;  4B9M A;  2F3N A;  3C1Z A;  3IHQ B;  3TAN A;  1XO0 A;  3RB0 A;  1DGS A;  4Z6D A;  3K75 D;  1SWW A;  4KMO B;  4DL4 A;  1LKY B;  3RRG A;  4RT2 A;  3N97 B;  2HHS A;  5EE0 A;  3WKA A;  2HHQ A;  1PK3 A;  4DFP A;  4EEK A;  5D4B A;  2HBL A;  4UAZ A;  1NK0 A;  3ONN A;  3KZX A;  1Z00 A;  1AQ6 A;  2EZX A;  5KFB A;  4IRK A;  1UPH A;  2JZB A;  4DOA A;  3FYH A;  8ICF A;  4XA5 A;  3N28 A;  4I2B A;  4BGD A;  4IS7 A;  4O3R A;  3RJJ A;  3M8R A;  4QZD A;  2BCU A;  1ZQW A;  3BJY A;  3I1Y A;  3C5F A;  2PMZ F;  5L9X A;  4PZN A;  4UBB A;  4ED1 A;  5J0X A;  2V9W A;  4J9N A;  5BPC A;  3V72 A;  3MGI A;  1NK5 A;  2UVV A;  1PVR A;  2W9B A;  7ICU A;  5ALF A;  3LWL A;  1MC8 A;  1WYG A;  3MR3 A;  2EAM A;  2DKZ A;  4GFJ A;  3H8M A;  3QU7 A;  4C8O A;  1U48 A;  3NVW A;  1JRP A;  3QU2 A;  3LYS A;  2WF8 A;  2ZTD A;  2AGO A;  4NL9 C;  2XCA A;  4FS2 A;  5AI4 A;  2KN7 A;  3UXP A;  5KFS A;  5L1M A;  4NJ8 A;  3MGV A;  3EUB 2;  3ISD A;  3KHH A;  4YXJ A;  2Y0S C;  3OTQ A;  2BPG A;  3E2E A;  4I2G A;  3F2D A;  3PW4 A;  1XC9 A;  1ZQD A;  2VKQ A;  4C8M A;  2KHV A;  4CF3 A;  2QB0 B;  3PML A;  4R65 A;  3C2L A;  2E8O A;  5ALX A;  5ALK A;  1SL1 A;  3RJE A;  2IOF A;  4DS4 A;  1BPB A;  1JN3 A;  5DGB A;  4YD1 A;  1X9X A;  3PW0 A;  2IA6 A;  1O03 A;  4QWD A;  1T4G A;  3S6J A;  2W54 A;  4B9T A;  3GV8 B;  5J2E A;  2K4E A;  4E0D A;  3RB4 A;  2JHD A;  3M6K A;  4UB2 A;  3NRW A;  3PW2 A;  1KFT A;  1ZQH A;  8ICZ A;  3RB6 A;  3Q8Q B;  3QUT A;  2E8N A;  3BS7 A;  3ETR A;  5KFM A;  5JU5 A;  4G9B A;  3IG5 A;  4RUC A;  2IOF K;  3OJU A;  4PHD A;  5AK3 A;  2ZTE A;  4I2D A;  3HP6 A;  7ICN A;  3JPN A;  2KZZ A;  4UBC A;  2IHN A;  3RH6 A;  2F44 A;  1ZQU A;  3PW5 A;  9ICJ A;  2XGP A;  1SV0 C;  1S0V A;  4JWN A;  4UQG A;  1RXV A;  2GH1 A;  9ICH A;  5DB8 A;  5KG3 A;  1ZQR A;  1BNP A;  2KZM A;  1XU4 A;  3C28 A;  3TFR A;  2JH7 A;  3TAP A;  3ZD9 A;  1OW5 A;  1FEZ A;  4YMM A;  3WK9 A;  2MUT A;  2YB4 A;  1V38 A;  5KG4 A;  1SKW A;  3QZ7 A;  4NV0 A;  1ZQ1 C;  3IRU A;  4A8E A;  3PY8 A;  3U26 A;  2XC9 A;  2W3R A;  2R8I A;  3UQ0 A;  2RLT A;  1X2I A;  4QZ8 A;  3RTV A;  1SL0 A;  1L7N A;  1EXN A;  1L3S A;  4RQ4 A;  3LWM A;  3PR5 B;  5G5G A;  2NRV A;  2VIX A;  3DDH A;  5J0T A;  4R64 A;  4I29 A;  5J2F A;  3IN5 A;  1L3U A;  2W11 A;  3BQT A;  4NWI A;  5J0O A;  2KIW A;  4J9M A;  2Y1I A;  4GXJ A;  1T7P A;  2NO4 A;  3NUQ A;  4ECY A;  5IIO A;  1SV4 A;  2K4P A;  2F8K A;  3ZDA A;  1KBU A;  2LYB A;  4US8 A;  2ZUC A;  2W04 A;  4MF2 A;  2H3Q A;  3MR5 A;  1ZYQ A;  2Z7J A;  4RQ6 A;  3WKC A;  3UXO A;  2EAP A;  2P6U A;  2ZUD A;  1NZP A;  4C4T A;  2BR0 A;  9ICU A;  2WF6 A;  4YN4 A;  5J0U A;  3T79 A;  1BPX A;  2I9G A;  5III A;  5J2B A;  5C0Y A;  4NL9 A;  4IRC A;  5AM2 A;  1PUZ A;  5GTH U;  3V6H A;  5EWE A;  5HR6 A;  1ZQP A;  3MR2 A;  2NV3 A;  2W3S A;  3V7J A;  1U47 A;  7ICH A;  4ED7 A;  5KFZ A;  5DG9 A;  7ICV A;  2HSZ A;  3E0F A;  2HBJ A;  4DOB A;  3H4B A;  2NRW A;  4GLX A;  2KTQ A;  8ICR A;  4F2R A;  3GFK B;  1SXD A;  4C8N A;  5B5E U;  2OH2 A;  3OSN A;  1ZQF A;  2W43 A;  2YB1 A;  2XVT A;  5IIJ A;  1D9F A;  3GV7 B;  7ICT A;  2H3V A;  1U45 A;  2JGA A;  1X42 A;  2NO5 A;  5ALP A;  3EZ5 A;  4B9L A;  4RU9 A;  5HR7 A;  1P7D A;  3AU6 A;  4J9R A;  3NTU A;  1YT3 A;  4JUZ A;  2D8C A;  1HJP A;  4ED6 A;  2UVR A;  4QZG A;  1CRX A;  7ICP A;  3M1Y A;  3MR6 A;  4J9L A;  3KHG A;  3HPO A;  4Y2P A;  3NRZ A;  4DEZ A;  4ELV A;  2BZF A;  4GXK A;  3RH4 A;  2HBM A;  2MA1 A;  2KFZ A;  1WWV A;  3AL0 B;  3RBD A;  2FLP A;  1Z4N A;  2W9C B;  3A0H U;  3GIM A;  1T3Q A;  3CW2 C;  2IMW P;  4RQ2 A;  4KLS A;  4F5P A;  7ICL A;  1ZQY A;  3EW9 A;  4EEY A;  2WFA A;  4Q45 A;  9ICS A;  3RFA A;  2MRL A;  2B6G A;  4BXO B;  3JPQ A;  1KQQ A;  3QU9 A;  8ICE A;  2WF5 A;  2H5X A;  4HAI A;  1ZQZ A;  1MN8 A;  2XCP A;  4Y2Y A;  1XS9 D;  2FMS A;  4C0Z A;  3C1Y A;  4GXI A;  2HHW A;  1B0X A;  2I5H A;  3RRH A;  1X66 A;  2DFL A;  4Q8F A;  2G0A A;  3LDA A;  1YZ7 A;  4RPZ A;  5KT5 A;  2AQ4 A;  5KAF U;  2AHO B;  1T8E A;  3TAD A;  2R8J A;  2JEJ A;  1TAQ A;  3IM1 A;  5CB1 A;  7ICQ A;  3QE9 Y;  1ZRN A;  3SV4 A;  4FBT A;  4KLU A;  2C2D A;  1TFR A;  2ZJA A;  2V4R A;  3QU4 A;  4P0P A;  3B9J A;  2DQN B;  3TKA A;  1NJX A;  4I2H A;  3ED5 A;  4F4K A;  4JB3 A;  4EBD A;  4B9N A;  3MAB A;  7ICE A;  5J2C A;  2DL0 A;  2C2E A;  1D8B A;  1QSS A;  2KMD A;  3RJF A;  1L3V A;  3KHR A;  2KG5 A;  3RR7 A;  3KZI U;  2YMM A;  5ALH A;  4DQR A;  2VA3 A;  1A77 A;  1J2N A;  4DLG A;  2NRX A;  3RH5 A;  4DO9 A;  4RT3 A;  3AEV A;  4FBU A;  4UAS A;  3C2K A;  1X9M A;  1H38 A;  3H8W A;  3VCB A;  3O0F A;  3CNH A;  2IBK A;  4CCH A;  4PGX A;  2YY6 A;  1N63 A;  4DL2 A;  2CN1 A;  4US9 A;  3EPI A;  1SWV A;  4IQV A;  5DB6 A;  5JUM A;  1SKR A;  2N1R A;  1KW4 A;  2WAQ F;  3WK8 A;  4OJP A;  5B66 U;  4MFF A;  4F92 B;  1IXR A;  1ZD3 A;  4ED3 A;  1XWL A;  2C2R A;  5CA7 A;  2ISO A;  1KEJ A;  1JXE A;  5ALY A;  1KN5 A;  4J03 A;  3OJS A;  1KFS A;  5J0Q A;  2ZG6 A;  4UB3 A;  1ZD5 A;  5J2D A;  2R8H A;  5EE9 A;  5DQG A;  2XY7 A;  2K8C B;  5KT2 A;  4ECS A;  1S0N A;  4F8R A;  1QH9 A;  2JZB B;  2GOL A;  4M9L A;  4U7C A;  7ICG A;  4IQT A;  3HRD D;  5AI5 A;  1TV9 A;  3VC8 A;  2K8B B;  2YX8 A;  2VA2 A;  1PK1 B;  4AP9 A;  8ICT A;  4DL7 A;  4UAR A;  2V4Q A;  3L3F X;  5KFR A;  4CF4 A;  1HUO A;  3MGH A;  5HHH A;  2ZIU A;  5AKI A;  2PFO A;  2WF7 A;  2DPJ A;  5DLG A;  4TQR A;  3SV3 A;  3QUC A;  4O5C A;  3UMG A;  5DG7 A;  1HUZ A;  3CRX A;  2AQ0 A;  3F2B A;  3BS5 B;  4KLM A;  2NRT A;  2YTU A;  5ALQ A;  4Z6F A;  1RYR A;  1T94 A;  4DQS A;  4TUP A;  3UMB A;  2P35 A;  3AQF A;  3DEE A;  2ZIX A;  5KT4 A;  1ZQA A;  2C28 A;  2DGZ A;  4RQ0 A;  4NLZ A;  2LM1 A;  9ICB A;  4J9O A;  2DBY A;  3I28 A;  3LVW A;  4NLN A;  5CR0 A;  1MSW D;  4Y2R A;  8ICV A;  1B22 A;  1MQ2 A;  4MF8 A;  2ASD A;  3AM9 A;  3HX0 A;  2JEF A;  1K1S A;  1N5X A;  1NKB A;  4LZD A;  3UQ2 A;  1IIP A;  1TK0 A;  3WU2 U;  2XI9 A;  4CDG A;  2BKE A;  5E79 U;  2HVI A;  2OHF A;  1U49 A;  1FFV A;  3ZI4 A;  2ZIW B;  2W03 A;  1PK1 A;  2IOH A;  1WG8 A;  4K4I A;  8ICM A;  4QZC A;  3ISB A;  4UAT A;  4TUS A;  2R8G A;  2BCR A;  4AYB C;  4RQ5 A;  3T3F A;  4I2J A;  2K89 A;  2HOI A;  4QZ9 A;  4KTQ A;  4B9S A;  1ED1 A;  3PX4 A;  4LZG A;  2G06 A;  8ICB A;  4O3N A;  4P0Q A;  5CWR A;  1S0O A;  4O3Q A;  5KFW A;  3BS5 A;  2EAN A;  5DKW A;  4ECQ A;  5C5J A;  1L3T A;  2PXI A;  5J0W A;  2P6R A;  5CJ7 A;  4MEX A;  2WB1 C;  4NXZ A;  7ICI A;  4UAV A;  2FE9 A;  1LB2 B;  1ARO P;  3KD3 A;  1PVP A;  3T5K A;  4IR9 A;  1TK5 A;  1N60 A;  2AGQ A;  2I6X A;  3Q8R B;  5KG6 A;  3NGD A;  3HKZ C;  2F1I A;  5HMM A;  2B21 A;  4ICA A;  4XRH A;  1UT5 A;  5F9L A;  4O3S A;  1S8O A;  9ICN A;  4DCC A;  4K4G A;  2MUT B;  4QZE A;  4M04 A;  4RPY A;  4NLG A;  3OPX A;  2C22 A;  2G09 A;  1O08 A;  3B0X A;  1CEZ A;  1SL2 A;  2HOQ A;  3HT3 A;  5AM5 A;  4NM2 A;  5KT7 A;  5KG1 A;  2ZIW A;  2KOB A;  1D8Y A;  2A1J B;  8ICS A;  1COO A;  3MC1 A;  1JXL A;  3TI0 A;  2GWS A;  3WK4 A;  3GII A;  5CHG A;  5F3X B;  4ECU A;  4KLF A;  1NK7 A;  4YR3 A;  1JAL A;  4F4Y A;  4KX5 A;  4FFD A;  9ICK A;  1ZQS A;  4B9V A;  4QW9 A;  3PX6 A;  3H0M B;  1J97 A;  1ZXI A;  5ALL A;  2W7P A;  4MFA A;  1RQN A;  1K1Q A;  1ZJM A;  2E8M A;  4Y2V A;  5AKY A;  2QLT A;  1F44 A;  1Z1V A;  2ZJ8 A;  7ICM A;  1XO1 A;  5KAI U;  2LYA A;  1ZQT A;  1KDH A;  4F5N A;  4FZL A;  4I2E A;  4DWI A;  3WKE A;  1VLB A;  5J0Y A;  5DQH A;  3N4M B;  3PSF A;  2F77 X;  5KFV A;  1L6N A;  4P2H A;  1HEK A;  3FAH A;  4BWJ A;  4EZ6 A;  4YR0 A;  3BQ0 A;  1FO4 A;  1TK8 A;  4PL2 A;  3GDX A;  3H0R B;  4QW8 A;  4ED0 A;  2BCV A;  2AJQ A;  4F72 A;  1A0P A;  4TUQ A;  2KKV A;  1ZQI A;  4EBC A;  2PKE A;  1QQ6 A;  8ICX A;  4DF8 A;  3D2Q A;  2I1Q A;  3MDA A;  1S10 A;  5J2J A;  4KLI A;  8ICH A;  3I76 A;  9ICP A;  2A1J A;  3FM9 A;  4YCX A;  4PGY A;  4F93 B;  3RJG A;  4Q43 A;  3T5J A;  3ZDB A;  4RQ3 A;  1Y88 A;  4EBE A;  2E1E A;  5TIS U;  4GC6 A;  5AKJ A;  2ZIV A;  3SEI A;  2KVC A;  4O9M A;  3KBB A;  1LVH A;  4O5K A;  5D49 A;  5J8Y C;  2O6K A;  2FLN A;  3SQI A;  5DBB A;  1FIQ A;  3ZDD A;  2K60 A;  4J9K A;  1KLN A;  3GIL A;  4DS5 A;  3EYZ A;  2M0N A;  4I2I A;  2F2A B;  3SI8 A;  3TQ1 A;  4MEY A;  1N56 A;  1FFU A;  5EE3 A;  3MDC A;  4XUS A;  1ZET A;  5KG0 A;  4CNQ A;  3E58 A;  2WTF A;  3FC4 A;  2P66 A;  2ASJ A;  3WKD A;  3ZD8 A;  5KFF A;  3TAR A;  3BQ2 A;  4GC7 A;  3QUB A;  2BQ3 A;  4JWM A;  4Y2S A;  5ALW A;  2KKP A;  3RAX A;  2BCQ A;  4ZH4 A;  1BPD A;  1WWU A;  5J2G A;  2LKY A;  3AUO A;  4OD0 A;  3WK7 A;  5L1L A;  2IHM A;  2J6U A;  2KD1 A;  3J81 j;  3BQ1 A;  3T5L A;  4IL6 U;  3KHL A;  4YMN A;  3KFU F;  2LM4 A;  1JIH A;  4AYB F;  3HW8 A;  4GIB A;  1JMS A;  3K4G A;  4Z6C A;  4UB6 U;  1RZT A;  1S77 D;  2ZTC A;  5CEH A;  4KLH A;  5ALI A;  2XO7 A;  4LVS A;  1KFD A;  5KFG A;  3H4D A;  4BUG A;  2B0C A;  1S0M A;  3M6Z A;  5KFK A;  2WB1 F;  2F1J A;  2CRX A;  5AM1 A;  1IV8 A;  5JRT A;  3FDS A;  4CGZ A;  1L7M A;  2OYY A;  8ICJ A;  2PI4 A;  2QAR A;  5KFD A;  8ICI A;  3ETL A;  1SV0 A;  2ODG A;  1BVS A;  1NZB A;  3HKZ F;  8ICU A;  2KP7 A;  4P0P B;  2Y0S F;  4QJF B;  4EZ9 A;  4KLT A;  5ALV A;  5ALS A;  2W7O A;  3Q8L A;  3D2N A;  4M6W A;  4F5Q A;  9ICV A;  5FP0 A;  5AKH A;  4R8U A;  5ALE A;  1Q3V A;  1ZQM A;  5KT3 A;  4NLB A;  2OXO A;  1ECW A;  5KFA A;  3ZDC A;  3IP4 B;  2LBO A;  2LHT A;  2JH1 A;  1A6S A;  2KK0 A;  2XY5 A;  2YN4 A;  2JRZ A;  4JV0 A;  3GQC A;  4QWB A;  1S76 D;  1ZOL A;  3AQE A;  9ICT A;  1QQ5 A;  2Y1J A;  4ELU A;  5L1K A;  4G3I A;  2PMZ C;  3SEN A;  2BPC A;  2LMR A;  1N62 A;  4USA A;  3PW7 A;  4DFK A;  4M9G A;  9ICO A;  2HDO A;  4RPX A;  4C8K A;  4Q8E A;  3OHB A;  2HOF A;  2A3V A;  4Y2J A;  1UHU A;  5AK5 A;  3GZF A;  5J8Y A;  1COK A;  1SIJ A;  4TQS A;  4KMU A;  1S9F A;  3MFI A;  1UA0 A;  5AK4 A;  4FO6 A;  8ICY A;  1K5O A;  3QEA Z;  5ALT A;  1SB3 C;  5J29 A;  4I28 A;  4JV1 A;  5DDY A;  4UAY A;  2KFN A;  3SD7 A;  5KFT A;  3M9M B;  7ICR A;  2MAX A;  1BPY A;  2PFQ A;  3F5E A;  2HHT A;  4O5E A;  4YFK A;  3CYM A;  3IV6 A;  2J6T A;  1IG6 A;  5IIM A;  2KIV A;  2ZIU B;  2VJ4 A;  1HIW A;  4UAU A;  1RPL A;  2FDR A;  9ICR A;  3PSP A;  1XSL A;  2A1A A;  1QSY A;  1KRP A;  3KKA C;  5AM3 A;  2EQY A;  4QWA A;  3ISC A;  2W8K A;  4OJ6 A;  3NAS A;  5KFN A;  5J2K A;  5KL1 B;  5ALJ A;  4KN7 A;  1M6Y A;  5K4L A;  1JUD A;  2ZIX B;  4DLE A;  1BPZ A;  4QNL A;  5CRX A;  2K4I A;  5KFY A;  1NJY A;  5AI6 A;  3PZP A;  2YMP A;  2QB1 A;  3V7L A;  3EWA A;  4QIW C;  3T5H A;  5DBC A;  2KIC A;  4UW9 A;  8ICW A;  3C21 A;  4Z6E A;  2ESE A;  4J9Q A;  2UVW A;  3BZC A;  2BDP A;  4ED8 A;  3NVV A;  2WHE A;  4Q44 A;  5F9N A;  4KLD A;  4DQQ A;  4KX3 A;  1MA7 A;  5KL8 B;  5CP2 A;  3OSP A;  1B4F A;  4KLL A;  1L8L A;  4RZR A;  4PHE A;  4F4Z A;  9ICX A;  1TAU A;  1XNS A;  1XSN A;  3Q8P B;  2VJ5 A;  3B0Y A;  2CXY A;  3F2C A;  2HBK A;  3TFS A;  3THV A;  5KFL A;  5AI9 A;  2FPM A;  3QUQ A;  1CUK A;  1QLN A;  9ICC A;  1X6J A;  4FZM A;  4I2A A;  2EAO A;  4P0Q B;  5HHI A;  5AHX A;  5ALR A;  5J0R A;  3G6X A;  1V85 A;  5KFO A;  2G5H B;  3GIK A;  5AIB A;  3RAQ A;  1NK8 A;  5DB7 A;  2HHU A;  4NLC A;  2K4H A;  2KV2 A;  3DV9 A;  2G5I B;  4Y2X A;  2PI5 A;  2G08 A;  1UCV A;  1ZQC A;  3PNC A;  4ECT A;  1UQV A;  3GU3 A;  4F50 A;  2W9A A;  4CRX A;  4C7Z A;  4TUR A;  4O3M A;  1N5W A;  2LYH A;  2KSO A;  2EZZ A;  3MFH A;  1ZQX A;  4YMO A;  5DG8 A;  5HP4 A;  4M9N A;  2JMG A;  4FE3 A;  3RF9 A;  9ICM A;  1CI4 A;  5L1I A;  4C4R A;  2KHQ A;  4PGQ A;  3RR8 A;  5J2H A;  1N2X A;  1QQ7 A;  3L5K A;  5AKG A;  3C23 A;  3NS1 A;  5T14 A;  1U9L A;  2JEG A;  9ICQ A;  2G07 A;  2PFP A;  3N7R C;  5GTI U;  4P4O A;  1V97 A;  4Y2U A;  5ALZ A;  3QU5 A;  4R63 A;  2KE7 A;  5AKX A;  1S97 A;  4PPX A;  3BQ7 A;  3QX7 A;  5AK6 A;  4MFC A;  1TVA A;  5KFX A;  2UVU A;  8ICQ A;  5DQI A;  4IQU A;  2DF4 B;  4ELT A;  3K1R B;  4DSE A;  3KKA A;  1RXW A;  5HML A;  2ZXI A;  4HYK A;  4O0I A;  2H3I A;  3HWT A;  5KFH A;  3F5A A;  7ICO A;  5A0L A;  3PMN A;  1LV5 A;  3LK9 A;  3GIJ A;  1BNO A;  3UMC A;  3H40 A;  4QZB A;  4DQI A;  1RQL A;  4F2S A;  1NK9 A;  4QZA A;  2AH5 A;  1NJW A;  5EE1 A;  4UB8 U;  1ZJN A;  3BDP A;  3D2S A;  2E1F A;  2ES6 A;  2FPL A;  4C8L A;  1SKS A;  1Q46 A;  4X5V A;  1LKY A;  1URJ A;  4O3P A;  4C7Y A;  2RDI A;  9ICA A;  1VJ5 A;  4RQ8 A;  2BQU A;  3SR6 A;  3BZK A;  3N7S C;  2KZ3 A;  1NJZ A;  4YXM A;  3PV8 A;  3JPO A;  3QZ8 A;  4UB4 A;  2RQ5 A;  4RUA A;  3PST A;  4XQ8 A;  2XID A;  2ZIV B;  5TZV A;  3V7K A;  3UM9 A;  4M9J A;  5KTQ A;  2NRZ A;  1F0M A;  3SZ2 A;  4RQ1 A;  2RRD A;  2OEH A;  4OJL A;  2KJ8 A;  3ORY A;  4ZOH C;  2J6S A;  2DKX A;  4P4M A;  2RP5 A;  1RYU A;  1TE2 A;  2BQR A;  4C4S A;  8ICP A;  1Q3U A;  2W9M A;  1SXE A;  1ZD4 A;  2YQE A;  2Y9U A;  3F53 A;  1NOM A;  4NM1 A;  1TKD A;  4RQ7 A;  2K8A A;  1ZQV A;  2A19 A;  1QSL A;  1IM4 A;  1ZQO A;  4QIW F;  3EPG A;  2LI6 A;  4ED2 A;  1N61 A;  4FZN A;  5H2F U;  5BOM A;  1NNL A;  2MSN A;  5AKE A;  3D6J A;  3PO5 A;  4KLO A;  4F5O A;  3JPT A;  2D3D A; 
#chains in the Genus database with same CATH homology
 3F5E A;  2RHF A;  4U6P A;  2JHD A;  3M6K A;  2DGZ A;  2KNJ A;  4PL1 A;  1UPH A;  2CRX A;  4WJ3 B;  3NRW A;  2E1E A;  3F5A A;  5A0L A;  3OPX A;  4CGZ A;  2G09 A;  1WUD A;  2D6F C;  2OYY A;  3CYM A;  4FZM A;  2ZIV A;  4P0Q B;  3SAF A;  3H0L B;  3LVW A;  2KVC A;  2HOQ A;  3ALR A;  2HMX A;  3T79 A;  3ICX A;  1Z1B A;  3VCB A;  2PMZ F;  3M7D A;  2ZIW A;  3IG5 A;  3O0F A;  2KOB A;  2ZIU B;  2G5H B;  5C0Y A;  1SZH A;  2F76 X;  3RFA A;  2MRL A;  2KEY A;  2VJ4 A;  1NZB A;  3HKZ F;  4P0P B;  2Y0S F;  4QJF B;  2CN1 A;  3RF9 A;  5HR6 A;  1IIP A;  3SQI A;  3D2S A;  1HIW A;  2E1F A;  2W7O A;  4NLC A;  2K4H A;  2XI9 A;  1PVQ A;  2KV2 A;  4CDG A;  2G5I B;  2N1R A;  2WAQ F;  2NV3 A;  3D2N A;  3PSP A;  3CP8 A;  4OJP A;  2H3Z A;  4KX5 A;  2G08 A;  1Q3V A;  2XIC A;  4OJ5 A;  3SAH A;  2GH1 A;  2M0N A;  1PVR A;  3GU3 A;  4NLB A;  2F2A B;  4C0Z A;  2OXO A;  4OJ6 A;  1URJ A;  1ECW A;  2ZIW B;  3H0M B;  2W03 A;  2ZG6 A;  4CRX A;  2W7P A;  3IG8 A;  3E0F A;  5KL1 B;  3C28 A;  2HBJ A;  2JH7 A;  4O3M A;  2H3F A;  3PSI A;  4BJQ A;  3IP4 B;  4GFJ A;  2LBO A;  2LHT A;  2K8C B;  2JH1 A;  2G0A A;  3N7S C;  1A6S A;  2KJ5 A;  2ZIX B;  4AYB C;  1F44 A;  1Z19 A;  3LVV A;  4QNL A;  5CRX A;  2OH2 A;  2K4I A;  3LYS A;  2E5S A;  4BX9 C;  2K89 A;  2GOL A;  2HOI A;  2F8L A;  4U7C A;  3PST A;  3AQE A;  3N7P D;  3VC8 A;  3PZP A;  2YB1 A;  2YB4 A;  2JMG A;  4FE3 A;  2LYA A;  1ED1 A;  2XID A;  2KKP A;  2XVT A;  2K8B B;  2ZIV B;  4JMU A;  1ZQ1 C;  2R18 A;  4FZL A;  4NV0 A;  4QIW C;  2YX8 A;  2KHQ A;  2H3V A;  3KZX A;  4A8E A;  1DRG A;  2G06 A;  2KIC A;  2JGA A;  2PMZ C;  4P0Q A;  3MGV A;  3C29 A;  2RRD A;  2LKY A;  4OJL A;  2KJ8 A;  4OO1 J;  3L3F X;  3PSF A;  2F77 X;  2Y0S C;  3SMV A;  5HR7 A;  2KD1 A;  2ZIU A;  1P7D A;  1L6N A;  3K1Z A;  2RP5 A;  1HEK A;  2CPR A;  5T14 A;  3F2D A;  4P0P A;  2VKQ A;  2G07 A;  1XO0 A;  2KHV A;  2WAQ C;  2WB1 C;  1YT3 A;  2ZXH A;  3N7R C;  2VIX A;  3KFU F;  4AYB F;  2OM6 A;  2DQN B;  4IC9 A;  4PL2 A;  1OUQ A;  1Q3U A;  2A3V A;  2HOF A;  3F53 A;  2KJ9 A;  3H0R B;  4KMO B;  3GZF A;  3SAG A;  3IN5 A;  4KX3 A;  4NWI A;  3CRX A;  2KIW A;  1PVP A;  5KL8 B;  1MA7 A;  1CRX A;  1A0P A;  2K8A A;  2KKV A;  2Q4T A;  2BDU A;  3NUQ A;  4OJO A;  3F2B A;  4QIW F;  4ACO A;  1TAM A;  4FZN A;  3D2Q A;  1XNS A;  2HBM A;  1D8B A;  1KBU A;  2MA1 A;  2DF4 B;  2LYB A;  3HKZ C;  1T94 A;  2W04 A;  2VJ5 A;  4BUG A;  3AL0 B;  2H3Q A;  2HBL A;  3F2C A;  2HBK A;  4ICA A;  2Z7J A;  3M6Z A;  2ZXI A;  1GO3 F;  3AQF A;  3DEE A;  2ZIX A;  3ONN A;  2WB1 F;  2K4E A;  2H3I A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...