2OYYA

Hthp: a hexameric tyrosine-coordinated heme protein
Total Genus 30
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
30
sequence length
71
structure length
71
Chain Sequence
TWLPTLVTATPQEGFDLAVKLSRIAVKKTQPDAQVRDTLRAVYEKDANALIAVSAVVATHFQTIAAANDYW
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title HTHP: A Novel Class of Hexameric, Tyrosine-coordinated Heme Proteins
pubmed doi rcsb
source organism Silicibacter pomeroyi
molecule tags Unknown function
molecule keywords Hexameric cytochrome
total genus 30
structure length 71
sequence length 71
chains with identical sequence B, C, D, E, F, G, H
ec nomenclature
pdb deposition date 2007-02-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF11534 HTHP Hexameric tyrosine-coordinated heme protein (HTHP)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.500 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 DNA polymerase; domain 1 2oyyA00
2OYYA
chains in the Genus database with same CATH superfamily
3TADC 5CB1A 3NGDA 4RQ8A 1S0NA 5KFRA 2XCAA 1ZQPA 2MU2A 4F92B 4AYBF 2ZIUA 1SXEA 4KITB 1WCNA 1TVAA 3H7IA 3SAGA 4JUZA 5KG3A 1SWWA 4J9OA 1BPXA 3L4PA 5DLFA 3LK9A 4DSFA 3H4DA 4KMOB 8ICNA 8ICEA 2HDOA 3TADA 2WF8A 1F0MA 4PGQA 1D8YA 4KLJA 3EW9A 7ICUA 2FPLA 3G6YA 1QLNA 2BQ3A 3JPPA 1U45A 4QIWC 4EEYA 4DL6A 5BOLA 4C8NA 3BS7A 4JV2A 4KLGA 4KLLA 4F93B 3HKZF 3M9NB 5ALRA 1XSLA 4QWAA 4EENA 5ALYA 5J2IA 1DRGA 4BXOB 5J2FA 1N2XA 4I27A 4OD0A 5ALEA 2W7OA 3KD3A 4C7ZA 2ZTCA 4F5QA 4DOBA 2JMGA 4RT2A 3TACB 2YMPA 3O0FA 7ICJA 5JU5A 1KBUA 4IS7A 4O3OA 9ICNA 3SV3A 4Q8EA 2K4EA 1S97A 3WKBA 1NZBA 4I2CA 2VA8A 2EDUA 3H0MB 3M8RA 3F2DA 4B9UA 1ED1A 1UA1A 4DSLA 8ICVA 3MBYA 3B0YA 5CA7A 3PR5B 1T94A 5AI0A 5HMMA 5AKKA 1IIPA 2WAQC 3UXOA 2H3QA 2W3RA 4R63A 5IIOA 4KLDA 7ICVA 5D49A 5DG7A 4MFCA 2FLNA 9ICXA 2GH1A 2OHFA 2F3NA 3ISBA 1KDHA 3IG5A 5K4LA 2HHUA 2MA1A 3QEBZ 2H3FA 2CPRA 2HMXA 5CR0A 5HHHA 3SI8A 2ES6A 2FPKA 5KL1B 5KFMA 3KZIU 4ZOHC 4CF4A 2OXOA 2HOIA 5J29A 2ESEA 5G5HA 3CP8A 3NS1A 1A6SA 2BPFA 3DV9A 1SB3C 5AM2A 3N7PD 2QB0A 3RB6A 2DFLA 3RR7A 3Q8QB 2HBLA 2A1JA 1ZQEA 2KV2A 1NJXA 1KFSA 2PFOA 3IRUA 1ECWA 3BQ7A 7ICQA 4UAUA 1X66A 3EPIA 9ICVA 5C5JA 1QSSA 2HVHA 1TAMA 4F5NA 4KMUA 5DB9A 5L1IA 2LM1A 2WF6A 2D6FC 4F2SA 3E2EA 3C5FA 5KFOA 4O3QA 1SL1A 1SZHA 2BKEA 5KFLA 4O3SA 4F4WA 3H40A 4M6WB 4ELVA 2RDIA 4NWIA 1MA7A 4UBCA 5A0LA 1JALA 3M7DA 4UB1A 1TAQA 5B66U 5JTIA 3PW4A 3RB0A 1TKDA 5GTIU 1S0MA 4ECTA 2BCRA 1T4GA 2LMRA 2Y1IA 3GIIA 3M1YA 3WK6A 5ALZA 4U7CA 5AM1A 2PKEA 3OJUA 1XNSA 2XGQA 1CI4A 3MR5A 2PI4A 4M9HA 3OGUA 2KZZA 3KTQA 3QU9A 1Z00A 1ZQOA 3OHAA 3UM9A 4Y2YA 1NKBA 5IINA 4M9JA 4ECVA 5T14A 1X42A 2JR5A 5KG5A 4ECUA 5KFEA 1N61A 4DSKA 2WB1F 4B9SA 3JPQA 3RJEA 4FFDA 4FO6A 3LWMA 5KTQA 2WTFA 2BPCA 5ALSA 1C7YA 3C2MA 2W9CA 4YD1A 4DSEA 2IOFA 5ALMA 4LZGA 2YMMA 3GU3A 2C2EA 2O6KA 4KLUA 1A76A 4G9BA 3GFKB 4I2BA 4MEYA 2BZFA 1Z1VA 1U49A 3B0XA 5J0UA 2YMQA 2R8GA 4ACOA 9ICPA 4ED2A 2ZG6A 4GXJA 2MSNA 3RAQA 2KJ5A 3EPGA 4NLKA 3ICXA 2NYVA 3OTQA 1X2IA 4IR1A 3I1YA 3CRXA 1N5XA 2HCFA 3F2CA 1NJWA 5CHGA 2UVVA 1NK6A 4B9MA 3EUB2 4QZGA 3D6JA 9ICCA 5DGAA 2BCSA 4DL3A 2KVCA 3MR2A 4MEXA 3FDSA 3N4MB 8ICFA 2FLPA 1QCKA 4Z6FA 3THVA 4I2GA 2K4PA 4US9A 5EE1A 4GC7A 5J0XA 2DKXA 4LJXA 1O08A 2LBOA 5DKWA 4UAVA 5ALXA 3MFIA 3RJHA 4O3RA 1L7PA 3L5KA 1N56A 3ALRA 4ED1A 2Z7JA 3I76A 2ZTDA 2FPMA 5DBCA 2Y1JA 1JXLA 3WK4A 5KFBA 5DB8A 3QXGA 4KLMA 3KHRA 1ZQSA 3ETRA 1KL9A 1D8LA 4IQVA 5DQHA 4ED6A 2EZZA 4KLEA 5L9XA 1ZJMA 4YG2A 1BPZA 4Y2SA 4RPZA 1ZQIA 4YQWA 3UXNA 5ALVA 2HHVA 3T3FA 2ZIVB 4Q8FA 5J0OA 1X6JA 4RQ2A 4NM2A 5KFZA 2V4QA 4YD2A 2G5HB 5F9NA 5L1LA 4NXZA 4OJPA 4ECSA 2XC9A 5ALNA 3WK5A 4XUSA 2NRZA 4DS5A 1L7NA 4UB4A 8ICSA 4F3OA 3QYPA 1UHUA 1JROA 1ZQXA 5TZVA 2BDPA 1OW5A 4I2EA 3ZDEA 5AK4A 4JV0A 4I29A 5ALLA 5JUMA 2R8HA 4NL9A 4O5CA 2W3SA 5KT2A 5EE3A 5AKXA 9ICMA 7ICIA 3IHQB 4M9GA 2G09A 4RQMA 5KT4A 1B0XA 1HUZA 1XU4A 2AGPA 2H3ZA 3PMLA 2A1AA 1RXWA 2KVSA 3MFHA 2KKVA 2W43A 2PFQA 3GIKA 4Q45A 1ZQHA 3LDAA 2WB1C 1AROP 7ICKA 5ALJA 1L3SA 5HMLA 4EBDA 1TV9A 3SD7A 7ICTA 3MC1A 4CRXA 4UW9A 2G5IB 4ED7A 1V97A 4RQ5A 5KFSA 4C8LA 4QIWF 2W9BA 5KFWA 2EZYA 4J9NA 2FI1A 3TAPA 3TARA 5KFVA 2YTUA 4DOAA 5CRXA 5TISU 5J2BA 9ICIA 4Z6CA 4U6PA 2AHOB 3VCBA 5ALTA 3IM1A 2XO7A 8ICPA 2QKQA 4ECRA 9ICBA 4EEKA 4PHPA 2AQ4A 5AM3A 1D9FA 4UARA 2ZIWA 3R9KA 3AUOA 3M6ZA 2W04A 1SV0A 4UB3A 4TQRA 4CF3A 2KE7A 3AL0B 1JUDA 3A0HU 2B21A 3FM9A 2AGOA 5KAFU 4J03A 2YN4A 4Q44A 1ZQMA 3T5HA 4O9MA 3CYMA 3SYZA 2K89A 4ED0A 4P0PB 2YX8A 3NASA 4A8EA 2NRTA 3BS5A 2ZIXA 4RNMA 5EE9A 1T8EA 1CRXA 2JV3A 5E79U 3HP6A 1NJZA 4F71A 1T3QA 4FZMA 1MC8A 5IIJA 1WCLA 5KT7A 2XICA 2OH2A 4QZ9A 3QU5A 1TK5A 1Q46A 2EAOA 4ECZA 3IV6A 4XRHA 1ZQGA 2KFNA 1ZQYA 5HHIA 5KT5A 1LKYA 4C8KA 3I28A 2GO7A 3QUTA 1V9PA 1Z1BA 5J0RA 3UXPA 2KNJA 1DOQA 3NVVA 4IC9A 3OHBA 3FYHA 3ETLA 3IG8A 3WU2U 4DFJA 1ZQTA 2KFZA 3MGIA 3N97B 4G3IA 4FBUA 2KKPA 4JB3A 1PUZA 3JPTA 4O0IA 1NJYA 5HR6A 3TKAA 3HILA 3UQ2A 1ZQLA 4Z6DA 1S10A 2HOFA 5DB6A 4J9QA 4JWNA 2KSOA 5J2AA 5BPCA 4I2IA 1ZQBA 4QZ8A 2JEGA 3HX0A 4AP9A 4DF4A 2LYHA 4M9LA 4J9PA 3V7JA 3G6VA 4UB6U 3TANA 2KHQA 3KZXA 1SZPA 1NKEA 4BXOA 3QNMA 4IRCA 3PZPA 8ICHA 3HPOA 4KLQA 3G6XA 1L8LA 3K75D 2IMWP 5ALWA 1HIWA 3QU4A 2AU0A 1UT8A 5CWRA 3UMBA 3ISDA 2I1QA 8ICRA 1FFVA 1B43A 4J9RA 1RQNA 5AM0A 3ZDBA 2HHXA 2BDUA 5KT3A 2F2AB 2WFAA 1MN8A 2Q0ZX 4NLGA 3OSNA 4QZFA 5KG4A 1WWVA 2CRXA 3RTVA 1P7DA 3TFRA 3RR8A 4K4IA 1JMSA 2K4HA 5J0YA 2F8KA 1ZQZA 3BQ1A 3F5EA 5B5EU 1TAUA 5DLGA 3PW5A 2JEIA 7ICSA 3PW2A 5AK3A 5ALDA 3N28A 1ZQVA 2KIVA 2C2DA 4M04A 1XC9A 2PFPA 3UQ0A 1ZETA 4Y2UA 2NO5A 8ICTA 1KN5A 3C28A 4F5RA 5KFGA 1VDVA 3BDPA 4RQ4A 2OM6A 7ICNA 2M9NA 4FE3A 2KJ8A 1L3VA 1QH9A 4IQUA 1ZRMA 5HP4A 2DGZA 4JWMA 3NVWA 4RT3A 1L7MA 3JPRA 1J2NA 4DL7A 1QQ7A 2QB0B 4R66A 2KN7A 4KLHA 2OCEA 4KN7A 4IQTA 4YR3A 1X9MA 2ODGA 4QW9A 2W8KA 1KTQA 1KFDA 4PZNA 4NL9C 1ZJNA 2YB1A 3UPQA 2ZJ5A 3NRWA 1V38A 4HAIA 2JH7A 4CCHA 4EYHB 4NLBA 5KFKA 4CNQA 4JV1A 4P2HA 2W54A 2FMSA 4O5KA 8ICXA 4UATA 3SAFA 3PO4A 4TUPA 3AQFA 4B6JA 3KKAC 4ECXA 1RDFA 4UB8U 2G07A 1ZQJA 4JMUA 7ICEA 2A19A 4NLZA 4YMMA 2D3DA 3HWTA 1SKRA 1JN3A 2JH1A 5IIIA 1EXNA 4IQWA 2LHTA 2IHNA 1N60A 1QSYA 4BDPA 3T5JA 2VKQA 2V4RA 2DBYA 3ZD9A 2IA6A 2K4IA 9ICHA 4US8A 2Y9TA 2BQRA 1F44A 1PK1B 2E8NA 5C0YA 4O3NA 3RH6A 4ICAA 4PHAA 1XS9D 3SQIA 2KG5A 3N7RC 5AKGA 4ECYA 4DSJA 1Z3EB 3RJFA 3GIMA 5KFFA 2ZJAA 2E1EA 4PH5A 4TUSA 4MHVA 4EX7A 5L1JA 2H5XA 3MGVA 4R65A 4DS4A 5KG0A 1SGGA 2E5SA 4RPYA 3C2KA 3QE9Y 3PX0A 1ZQFA 1ZQWA 8ICZA 4PGYA 5IILA 1O03A 2HHWA 5J0WA 1ZD5A 2OWOA 9ICQA 3RB3A 2RHFA 2F76X 4IRKA 5KFHA 5EE0A 4NLNA 1N48A 2BR0A 4OCZA 2KOBA 1RXVA 1BGXT 8ICBA 1S5LU 4DWIA 4I2HA 1RG6A 3RH5A 5KFJA 5EWGA 4GLXA 3U26A 3V72A 2PMZC 5AI4A 2R8IA 1U4BA 2ASLA 1N5WA 3KHHA 1SWVA 1IG6A 2AGQA 3K1ZA 2HSZA 1PVQA 4YXMA 2LPEA 3Q8SB 4ELTA 1Z4OA 2E8OA 4TQSA 1ZQQA 3C29A 2WHEA 2K60A 8ICMA 1SKWA 3PX4A 4P0QB 4DL4A 3H0RB 1F5SA 2IOHA 5KFXA 4KX3A 3JPSA 2PFNA 2FJ6A 2L5YA 2R18A 2DKZA 3HT3A 2XY7A 4KLSA 2AH5A 1SV0C 4DO9A 1OXJA 5AKHA 2QARB 5DQGA 1JRPA 2P35A 2DUYA 4FBTA 1N63A 2WF9A 3MABA 4OJ5A 3FAHA 2RRDA 4RUCA 9ICKA 5ALHA 4DLGA 3PSFA 4K4HA 5L1KA 4HYKA 3D2NA 4DSIA 3RFAA 4R8UA 2LKYA 3L3FX 3V7KA 3TQ1A 1WUDA 2BHNA 4P4OA 3T79A 3NRZA 4DFMA 4M0AA 5DGBA 3F53A 4QW8A 3AU6A 1TK0A 1D9DA 4C8MA 5J0TA 2HHTA 3M6KA 4RQ1A 2ZJ8A 5KFAA 3CW2C 2I5HA 2QLTA 1Y88A 4B9VA 2ALZA 3BQ2A 3SAHA 4PZOA 4F4ZA 3RAXA 9ICUA 5J0PA 1COKA 4UB2A 2F8LA 4RUAA 4MF8A 5DDMA 4DF8A 4F5OA 4MFAA 2NRXA 1K1SA 3VC8A 3BZCA 2F44A 1BPYA 9ICSA 1PK3A 4QWCA 1TK8A 4Z6EA 3RBEA 2UVRA 3BJYA 2FMQA 3NUQA 2JGAA 4UBBA 3MDAA 3C2LA 3ISCA 1M6YA 1XWLA 4WJ3B 4O3PA 2J6UA 2MUTA 2N1RA 2KHVA 2W9BB 5HR7A 3PY8A 2EAMA 2G08A 3GILA 4FZNA 4QZIA 3KHLA 3OSPA 4I2AA 3C5GA 1SL0A 4DL5A 4Y2XA 7ICGA 1S9FA 2BCUA 2HBKA 1RYSA 3AQEA 3C23A 4FZLA 9ICFA 2YY6A 2KZMA 4I2JA 1S77D 1XO1A 2BPGA 1Z19A 3RBDA 1BPEA 2ZIWB 2P66A 5J2JA 3RF9A 2RDJA 3PSTA 1C20A 3M9MB 3PVXA 3RB4A 2F1IA 4ECWA 3V6JA 3LYSA 1DXSA 1ZD4A 3ZDDA 4Y2RA 1ZD3A 7ICPA 2DL0A 1DGSA 1UCVA 2E1FA 4YN4A 1YZ7A 3ZDCA 2MRLA 2ATLA 2HVIA 2AXTU 5AM4A 3H4BA 1H38A 3GIJA 8ICYA 1X9SA 1ZQ1C 4BGDA 3BS5B 2ZIXB 3RRGA 2G06A 5CEHA 3IP4B 3V6HA 1K5OA 2DPJA 4PGXA 4RQ7A 3N7SC 1V85A 4IRDA 3KOOA 2P6RA 8ICWA 5AI5A 3E0FA 2DQNB 3UMGA 5KG1A 3C21A 4F91B 1NZPA 1NK7A 1ZXIA 3RRHA 3LWLA 3AMZA 4QZEA 2ASDA 1KFTA 1LKYB 2KICA 1Q8KA 5J0SA 4P4PA 3AEVA 3D2SA 1UQVA 4CE6A 5AK6A 1MQ3A 1BPBA 3H8MA 3DDHA 2JZBB 4F72A 1CUKA 1RYUA 2JXJA 1HUOA 4UB5A 5J2GA 4BWMA 5ALKA 1DK3A 2JEJA 2W03A 1U47A 4DLEA 3UMCA 5KFQA 2KSOB 2IOFK 3LVVA 5BOMA 1S0OA 4YXJA 1X40A 5EWEA 1BPDA 3PSPA 3QU7A 1U48A 3WK7A 3JPOA 2HBJA 1JIHA 1LVHA 1L3TA 4NM1A 1RM6C 2F1JA 1FO4A 2PXIA 2KTQA 2B6GA 4J9SA 1KW4A 3QUQA 5D4BA 4F4KA 1URJA 7ICFA 1T3NA 1KKXA 3FC4A 4X5VA 3WKEA 1A77A 4DCCA 4K4GA 1SL2A 3PV8A 4ED3A 4DOCA 5AIAA 3AU2A 1IXRA 2OEHA 4PHDA 7ICMA 2WF7A 1COOA 9ICJA 2EAPA 1S76D 3BZKA 1J2MA 2XGPA 2GWSA 2HW3A 4LVSA 5J0QA 2K8CB 1FEZA 4PHEA 1S0VA 4F2RA 1NK5A 2W9AA 1ZQCA 1ZYQA 4J9MA 5KFDA 3PW0A 7ICOA 2HHSA 4EZ9A 1UT5A 3NVZA 5KFIA 3MR6A 2ZIUB 2EZXA 1QTMA 4QZAA 5KL8B 5DBAA 2P6UA 2H3IA 1ZQDA 3H8JA 3C1ZA 3SENA 2GOLA 3QUBA 3MDCA 4EBCA 1QSLA 2PI5A 3M9OB 5KFYA 3NTUA 9ICEA 4YFKA 1GO3F 1TFRA 3Q8PB 2ZUDA 4R64A 3T5LA 1FFUA 4ZH4A 5KFNA 1X6IA 1JXEA 4YCXA 1KQQA 4NV0A 3H0LB 5AI8A 4IL6U 4AYBC 1IM4A 2F77X 3QZ8A 5FP0A 8ICCA 4YR2A 2LM4A 3MR3A 2W11A 1NK8A 2KIWA 3SZ2A 2W8LA 2HI0A 2KJ9A 1DK2A 1CEZA 1S8OA 4O5EA 4LZDA 1Q3UA 5ALIA 3H8SA 3RJJA 1X9WA 7ICLA 1L6NA 2ZTEA 3AM9A 3SEIA 4YR0A 2YMLA 2BCQA 1D8BA 4GFJA 4C80A 2WAQF 4I28A 4F50A 4C4RA 4J9KA 2W7PA 3PX6A 3TFSA 1WYGA 2FE9A 3EYZA 2J6TA 2ISOA 5AKJA 3IN5A 2OYYA 4F5PA 2RQ5A 4B9TA 5EOZA 3M8SA 2Y0SF 2AQ0A 2WF5A 3PO5A 8ICJA 2VJ4A 9ICTA 3KKAA 5ALQA 4RQ3A 2MAXA 4YMNA 4RQ6A 2DWQA 3B9JA 2I9GA 4FS1A 1L5UA 2EH9A 1NNLA 3HW8A 1SV4A 2YB4A 3Q8KA 4OO1J 4QZHA 4OJOA 2NRVA 5DG9A 1MQ2A 4UAZA 2ZXHA 2I6XA 1AQ6A 1PK1A 1PVRA 8ICLA 2JEFA 1HJPA 4C7YA 4F4XA 4Q43A 4BWJA 2VIXA 4QNLA 4DEZA 1KEJA 5DBBA 4M2YA 5J8YC 3C1YA 2F1HA 4Y2PA 4DFDA 1YT3A 2UVWA 4DQPA 3KHGA 3CNHA 1N62A 1PVPA 4OJ6A 3J81j 4GC6A 1BVSA 1HEKA 3RH4A 4GXIA 9ICRA 1BNOA 4QJFB 1ZQAA 5KG7A 3KBBA 4KLFA 4USAA 2A1JB 2RP5A 2B0CA 4TURA 2YQEA 3ORYA 1X9XA 4MF2A 5EWFA 1J97A 5AKLA 3KFUF 1B4FA 4EBEA 2XVTA 4DQIA 4F4YA 3RJKA 1NKCA 8ICUA 2EQYA 2BCVA 1ZRNA 2KEYA 1PZNA 5GTHU 2VA3A 4P4MA 3RJGA 2V9WA 2RLTA 4CDGA 4M6WA 3TAQA 1BNPA 4RZRA 3BQ0A 4PJ0U 1NI3A 3WKDA 5ALGA 2R8KA 3GQCA 3Q8RB 2IBKA 3EWAA 1Q3VA 1NOMA 2XY5A 4XQ8A 1JI7A 4RQ0A 4M47A 2JHDA 1IV8A 2NO4A 4KN4A 4P0QA 3QX7A 1Z4NA 5AM5A 2UVUA 5JRTA 3A0BU 5J2HA 5AKIA 1ZQRA 5J2CA 1L8OA 4M9NA 5J8YA 3QZ7A 2VA2A 9ICGA 1Z00B 4DQQA 3OPXA 4NLCA 5ALFA 2E3TA 2XIDA 4I2DA 8ICGA 2D8CA 4BJQA 2CXYA 2K8BB 1XO0A 3SR6A 4QWEA 2QARA 3Q8LA 5F9LA 5AIBA 1NK0A 2LYAA 3QUCA 4DFKA 7ICRA 2ISPA 3BQTA 1ZOLA 5AHXA 2NV3A 5AI6A 5KFTA 1SKSA 1JX4A 3QU2A 5AICA 4QZBA 2W9CB 3SV4A 4I2FA 1UPHA 1YZ6A 2Q4TA 2R8JA 3EZ5A 5IIKA 1OUQA 4EELA 3E58A 2DPIA 2CN1A 9ICOA 5HNKA 1UA0A 3WK9A 4R8UB 4XA5A 5AKYA 4C0ZA 3ZD8A 3ZI4A 5CJ7A 4C4SA 1FIQA 5J2DA 1T7PA 3V7LA 7ICHA 2BQUA 4C8OA 4KX5A 4JK1A 3ZDAA 3HJEA 3PMNA 1MSWD 4J9LA 5ALUA 4MFFA 5IIMA 2E8PA 1LB2B 3MGHA 3GDXA 9ICLA 4NY8A 3DEEA 4ELUA 3LVWA 2AJQA 2Y9UA 5AKZA 1KLNA 2K8AA 2E8MA 4QWBA 4RNNA 2FDRA 5J2EA 1A0PA 3OJSA 2MUTB 2ZUBA 5G5GA 2G0AA 1KRPA 4GIBA 8ICQA 2C28A 2KK0A 1SXDA 3ONNA 4Y2VA 9ICWA 2FMPA 3GV8B 1RPLA 4B9LA 2JRZA 1VJ5A 2HHQA 4EZ6A 4YMOA 4Y2TA 4KTQA 4OJLA 5J2KA 4DL2A 1SIJA 2KP7A 2HBMA 2ZIVA 2FLLA 2DF4B 5D46A 3HKZC 1ZQUA 4EYIB 1QQ6A 2ASJA 5DG8A 4BUGA 4PL1A 5AK5A 4CGZA 3S6JA 4DFPA 2GLEA 3IDWA 1B22A 2PMZF 4KLIA 3GV7B 3RJIA 5H2FU 8ICOA 5DQIA 4ED8A 4NJ8A 4UASA 5CP2A 3WKCA 4TUQA 1ZD2P 3PNCA 3WKAA 5KFPA 3WK8A 4B9NA 3K4GA 1NK9A 2KD1A 4E0DA 3T5KA 5KAIU 3D2QA 4KLTA 4UQGA 2XY6A 2M0NA 4CF5A 3F5AA 1K1QA 5KFCA 3TI0A 4ECQA 3PR4A 2VANA 5ALOA 3PSIA 4RNOA 1RQLA 2QB1A 2KMDA 2VJ5A 2XI9A 2LI6A 9ICAA 2NRWA 2JZBA 1DGJA 1LV5A 2ZXIA 1L7OA 5KT6A 4C4TA 1ZQNA 5ALPA 1L3UA 1KSPA 2H3VA 4RPXA 2IHMA 8ICAA 2A3VA 3JPNA 4O3MA 2ZUCA 4KLOA 8ICIA 2LYBA 4QZDA 2W55A 3HRDD 4RU9A 5DB7A 4PL2A 4F8RA 2KZ3A 2HOQA 1WWUA 2J6SA 3PW7A 4UAYA 4YVZA 3K1RB 2C2RA 3GV5B 4BX9C 1RYRA 5AI9A 1XSPA 5F3XB 4RQNA 3Q8MA 5KG2A 4QZCA 4PPXA 2C22A 5AKEA 1ZQKA 3QEAZ 1XSNA 4P0PA 4FS2A 3AN1A 2XCPA 2W9MA 3SMVA 3H8WA 4UAWA 4QWDA 1VLBA 2Y0SC 1TE2A 1RZTA 3ED5A 4DQSA 1WG8A 5KNIA 1NK4A 3F2BA 1U9LA 8ICKA 2EANA 4IR9A 4EX6A 4YP3A 3V6KA 2BGWA 5DDYA 1QQ5A 3GZFA 5L1MA 3NVYA 5KFUA 4DQRA 4GXKA 5KG6A 4Y2QA 4Y2JA
chains in the Genus database with same CATH topology
2M0NA 3F5EA 3F5AA 2H3QA 2VJ4A 3K1ZA 2K8AA 1PVQA 3NUQA 1Q3VA 2JGAA 4CRXA 2LBOA 2JH1A 2G5IB 2KICA 4WJ3B 3PSIA 3C29A 1A0PA 3ALRA 1Z1BA 2LHTA 2N1RA 2JHDA 2G0AA 2GH1A 4AYBF 2ZIUA 2ZIUB 4U7CA 2YB4A 4QIWF 2Z7JA 2VJ5A 2VKQA 2KNJA 2XI9A 2KHVA 4P0QA 4P0QB 4OO1J 3IG5A 3H0RB 4OJOA 2K4IA 4IC9A 5KL8B 5HR7A 2ZXHA 2MA1A 2G08A 3ONNA 3SAGA 1XNSA 2H3FA 1F44A 2CPRA 4KX3A 2ZXIA 2HMXA 4FZNA 5C0YA 1PVRA 3IG8A 2H3IA 5CRXA 4KMOB 2R18A 3OPXA 4NLCA 4ICAA 2KKPA 3C28A 2H3VA 2XIDA 2GOLA 4U6PA 2VIXA 5KL1B 3SQIA 3VCBA 4QNLA 2W03A 3N7RC 2HBKA 3AQEA 4FZLA 2OM6A 4BJQA 5HR6A 5T14A 2K8BB 2A3VA 1XO0A 2OXOA 4O3MA 2HOFA 2HOIA 4FE3A 4OJLA 2LYBA 3LVVA 2LYAA 1YT3A 1GO3F 2WB1F 2KJ8A 4QIWC 1Z19A 2E1EA 2ZIWA 2ZIWB 1PVPA 4OJ6A 3RF9A 3D2SA 3CP8A 3M6ZA 2HBMA 2W04A 2ZIVB 2ZIVA 3PSTA 4PL2A 1A6SA 2DGZA 1HEKA 2HOQA 3PSPA 2DF4B 3MGVA 3AL0B 4NV0A 4OJ5A 3H0LB 2RRDA 3HKZC 2NV3A 2HBJA 4QJFB 4AYBC 2F77X 3HKZF 2E5SA 3LYSA 2KHQA 3KZXA 3N7PD 4BUGA 2G5HB 1UPHA 2Q4TA 4PL1A 4BX9C 4OJPA 1DRGA 4CGZA 1OUQA 2KIWA 3PZPA 2KJ9A 2HBLA 3PSFA 3GU3A 2RP5A 2CN1A 2KV2A 2W7OA 3CYMA 2K89A 3D2NA 2E1FA 1HIWA 1URJA 3RFAA 2LKYA 2MRLA 2JMGA 2RHFA 1ECWA 2F76X 2PMZF 2YB1A 3L3FX 3O0FA 1Q3UA 4P0PA 4ACOA 2YX8A 4C0ZA 1KBUA 4P0PB 1WUDA 3NRWA 3T79A 2ZG6A 3F53A 3KFUF 3SMVA 1TAMA 2KJ5A 1ZQ1C 2XVTA 2Y0SC 3M6KA 2JH7A 4A8EA 1L6NA 2ZIXA 2K4EA 2ZIXB 3ICXA 2KOBA 2G06A 1NZBA 4NLBA 2D6FC 2BDUA 2F2AB 3IP4B 3H0MB 4KX5A 1CRXA 1D8BA 3CRXA 3SAHA 2KEYA 4GFJA 3F2CA 3F2DA 2WAQF 3F2BA 2G09A 3N7SC 1SZHA 4FZMA 4CDGA 3SAFA 2W7PA 1ED1A 2PMZC 2CRXA 2H3ZA 3E0FA 2DQNB 4NWIA 3AQFA 1MA7A 3GZFA 2F8LA 5A0LA 2XICA 3IN5A 2KD1A 2OYYA 1P7DA 2KKVA 3DEEA 1T94A 3M7DA 2OH2A 2KVCA 2K8CB 3VC8A 3LVWA 2G07A 4JMUA 2K4HA 3D2QA 1IIPA 2WB1C 2WAQC 2Y0SF
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2OYY A; 
#chains in the Genus database with same CATH topology
 3TAD C;  5CB1 A;  3NGD A;  4RQ8 A;  1S0N A;  5KFR A;  2XCA A;  1ZQP A;  2MU2 A;  4F92 B;  4AYB F;  2ZIU A;  1SXE A;  4KIT B;  1WCN A;  1TVA A;  3H7I A;  3SAG A;  4JUZ A;  5KG3 A;  1SWW A;  4J9O A;  1BPX A;  3L4P A;  5DLF A;  3LK9 A;  4DSF A;  3H4D A;  4KMO B;  8ICN A;  8ICE A;  2HDO A;  3TAD A;  2WF8 A;  1F0M A;  4PGQ A;  1D8Y A;  4KLJ A;  3EW9 A;  7ICU A;  2FPL A;  3G6Y A;  1QLN A;  2BQ3 A;  3JPP A;  1U45 A;  4QIW C;  4EEY A;  4DL6 A;  5BOL A;  4C8N A;  3BS7 A;  4JV2 A;  4KLG A;  4KLL A;  4F93 B;  3HKZ F;  3M9N B;  5ALR A;  1XSL A;  4QWA A;  4EEN A;  5ALY A;  5J2I A;  1DRG A;  4BXO B;  5J2F A;  1N2X A;  4I27 A;  4OD0 A;  5ALE A;  2W7O A;  3KD3 A;  4C7Z A;  2ZTC A;  4F5Q A;  4DOB A;  2JMG A;  4RT2 A;  3TAC B;  2YMP A;  3O0F A;  7ICJ A;  5JU5 A;  1KBU A;  4IS7 A;  4O3O A;  9ICN A;  3SV3 A;  4Q8E A;  2K4E A;  1S97 A;  3WKB A;  1NZB A;  4I2C A;  2VA8 A;  2EDU A;  3H0M B;  3M8R A;  3F2D A;  4B9U A;  1ED1 A;  1UA1 A;  4DSL A;  8ICV A;  3MBY A;  3B0Y A;  5CA7 A;  3PR5 B;  1T94 A;  5AI0 A;  5HMM A;  5AKK A;  1IIP A;  2WAQ C;  3UXO A;  2H3Q A;  2W3R A;  4R63 A;  5IIO A;  4KLD A;  7ICV A;  5D49 A;  5DG7 A;  4MFC A;  2FLN A;  9ICX A;  2GH1 A;  2OHF A;  2F3N A;  3ISB A;  1KDH A;  3IG5 A;  5K4L A;  2HHU A;  2MA1 A;  3QEB Z;  2H3F A;  2CPR A;  2HMX A;  5CR0 A;  5HHH A;  3SI8 A;  2ES6 A;  2FPK A;  5KL1 B;  5KFM A;  3KZI U;  4ZOH C;  4CF4 A;  2OXO A;  2HOI A;  5J29 A;  2ESE A;  5G5H A;  3CP8 A;  3NS1 A;  1A6S A;  2BPF A;  3DV9 A;  1SB3 C;  5AM2 A;  3N7P D;  2QB0 A;  3RB6 A;  2DFL A;  3RR7 A;  3Q8Q B;  2HBL A;  2A1J A;  1ZQE A;  2KV2 A;  1NJX A;  1KFS A;  2PFO A;  3IRU A;  1ECW A;  3BQ7 A;  7ICQ A;  4UAU A;  1X66 A;  3EPI A;  9ICV A;  5C5J A;  1QSS A;  2HVH A;  1TAM A;  4F5N A;  4KMU A;  5DB9 A;  5L1I A;  2LM1 A;  2WF6 A;  2D6F C;  4F2S A;  3E2E A;  3C5F A;  5KFO A;  4O3Q A;  1SL1 A;  1SZH A;  2BKE A;  5KFL A;  4O3S A;  4F4W A;  3H40 A;  4M6W B;  4ELV A;  2RDI A;  4NWI A;  1MA7 A;  4UBC A;  5A0L A;  1JAL A;  3M7D A;  4UB1 A;  1TAQ A;  5B66 U;  5JTI A;  3PW4 A;  3RB0 A;  1TKD A;  5GTI U;  1S0M A;  4ECT A;  2BCR A;  1T4G A;  2LMR A;  2Y1I A;  3GII A;  3M1Y A;  3WK6 A;  5ALZ A;  4U7C A;  5AM1 A;  2PKE A;  3OJU A;  1XNS A;  2XGQ A;  1CI4 A;  3MR5 A;  2PI4 A;  4M9H A;  3OGU A;  2KZZ A;  3KTQ A;  3QU9 A;  1Z00 A;  1ZQO A;  3OHA A;  3UM9 A;  4Y2Y A;  1NKB A;  5IIN A;  4M9J A;  4ECV A;  5T14 A;  1X42 A;  2JR5 A;  5KG5 A;  4ECU A;  5KFE A;  1N61 A;  4DSK A;  2WB1 F;  4B9S A;  3JPQ A;  3RJE A;  4FFD A;  4FO6 A;  3LWM A;  5KTQ A;  2WTF A;  2BPC A;  5ALS A;  1C7Y A;  3C2M A;  2W9C A;  4YD1 A;  4DSE A;  2IOF A;  5ALM A;  4LZG A;  2YMM A;  3GU3 A;  2C2E A;  2O6K A;  4KLU A;  1A76 A;  4G9B A;  3GFK B;  4I2B A;  4MEY A;  2BZF A;  1Z1V A;  1U49 A;  3B0X A;  5J0U A;  2YMQ A;  2R8G A;  4ACO A;  9ICP A;  4ED2 A;  2ZG6 A;  4GXJ A;  2MSN A;  3RAQ A;  2KJ5 A;  3EPG A;  4NLK A;  3ICX A;  2NYV A;  3OTQ A;  1X2I A;  4IR1 A;  3I1Y A;  3CRX A;  1N5X A;  2HCF A;  3F2C A;  1NJW A;  5CHG A;  2UVV A;  1NK6 A;  4B9M A;  3EUB 2;  4QZG A;  3D6J A;  9ICC A;  5DGA A;  2BCS A;  4DL3 A;  2KVC A;  3MR2 A;  4MEX A;  3FDS A;  3N4M B;  8ICF A;  2FLP A;  1QCK A;  4Z6F A;  3THV A;  4I2G A;  2K4P A;  4US9 A;  5EE1 A;  4GC7 A;  5J0X A;  2DKX A;  4LJX A;  1O08 A;  2LBO A;  5DKW A;  4UAV A;  5ALX A;  3MFI A;  3RJH A;  4O3R A;  1L7P A;  3L5K A;  1N56 A;  3ALR A;  4ED1 A;  2Z7J A;  3I76 A;  2ZTD A;  2FPM A;  5DBC A;  2Y1J A;  1JXL A;  3WK4 A;  5KFB A;  5DB8 A;  3QXG A;  4KLM A;  3KHR A;  1ZQS A;  3ETR A;  1KL9 A;  1D8L A;  4IQV A;  5DQH A;  4ED6 A;  2EZZ A;  4KLE A;  5L9X A;  1ZJM A;  4YG2 A;  1BPZ A;  4Y2S A;  4RPZ A;  1ZQI A;  4YQW A;  3UXN A;  5ALV A;  2HHV A;  3T3F A;  2ZIV B;  4Q8F A;  5J0O A;  1X6J A;  4RQ2 A;  4NM2 A;  5KFZ A;  2V4Q A;  4YD2 A;  2G5H B;  5F9N A;  5L1L A;  4NXZ A;  4OJP A;  4ECS A;  2XC9 A;  5ALN A;  3WK5 A;  4XUS A;  2NRZ A;  4DS5 A;  1L7N A;  4UB4 A;  8ICS A;  4F3O A;  3QYP A;  1UHU A;  1JRO A;  1ZQX A;  5TZV A;  2BDP A;  1OW5 A;  4I2E A;  3ZDE A;  5AK4 A;  4JV0 A;  4I29 A;  5ALL A;  5JUM A;  2R8H A;  4NL9 A;  4O5C A;  2W3S A;  5KT2 A;  5EE3 A;  5AKX A;  9ICM A;  7ICI A;  3IHQ B;  4M9G A;  2G09 A;  4RQM A;  5KT4 A;  1B0X A;  1HUZ A;  1XU4 A;  2AGP A;  2H3Z A;  3PML A;  2A1A A;  1RXW A;  2KVS A;  3MFH A;  2KKV A;  2W43 A;  2PFQ A;  3GIK A;  4Q45 A;  1ZQH A;  3LDA A;  2WB1 C;  1ARO P;  7ICK A;  5ALJ A;  1L3S A;  5HML A;  4EBD A;  1TV9 A;  3SD7 A;  7ICT A;  3MC1 A;  4CRX A;  4UW9 A;  2G5I B;  4ED7 A;  1V97 A;  4RQ5 A;  5KFS A;  4C8L A;  4QIW F;  2W9B A;  5KFW A;  2EZY A;  4J9N A;  2FI1 A;  3TAP A;  3TAR A;  5KFV A;  2YTU A;  4DOA A;  5CRX A;  5TIS U;  5J2B A;  9ICI A;  4Z6C A;  4U6P A;  2AHO B;  3VCB A;  5ALT A;  3IM1 A;  2XO7 A;  8ICP A;  2QKQ A;  4ECR A;  9ICB A;  4EEK A;  4PHP A;  2AQ4 A;  5AM3 A;  1D9F A;  4UAR A;  2ZIW A;  3R9K A;  3AUO A;  3M6Z A;  2W04 A;  1SV0 A;  4UB3 A;  4TQR A;  4CF3 A;  2KE7 A;  3AL0 B;  1JUD A;  3A0H U;  2B21 A;  3FM9 A;  2AGO A;  5KAF U;  4J03 A;  2YN4 A;  4Q44 A;  1ZQM A;  3T5H A;  4O9M A;  3CYM A;  3SYZ A;  2K89 A;  4ED0 A;  4P0P B;  2YX8 A;  3NAS A;  4A8E A;  2NRT A;  3BS5 A;  2ZIX A;  4RNM A;  5EE9 A;  1T8E A;  1CRX A;  2JV3 A;  5E79 U;  3HP6 A;  1NJZ A;  4F71 A;  1T3Q A;  4FZM A;  1MC8 A;  5IIJ A;  1WCL A;  5KT7 A;  2XIC A;  2OH2 A;  4QZ9 A;  3QU5 A;  1TK5 A;  1Q46 A;  2EAO A;  4ECZ A;  3IV6 A;  4XRH A;  1ZQG A;  2KFN A;  1ZQY A;  5HHI A;  5KT5 A;  1LKY A;  4C8K A;  3I28 A;  2GO7 A;  3QUT A;  1V9P A;  1Z1B A;  5J0R A;  3UXP A;  2KNJ A;  1DOQ A;  3NVV A;  4IC9 A;  3OHB A;  3FYH A;  3ETL A;  3IG8 A;  3WU2 U;  4DFJ A;  1ZQT A;  2KFZ A;  3MGI A;  3N97 B;  4G3I A;  4FBU A;  2KKP A;  4JB3 A;  1PUZ A;  3JPT A;  4O0I A;  1NJY A;  5HR6 A;  3TKA A;  3HIL A;  3UQ2 A;  1ZQL A;  4Z6D A;  1S10 A;  2HOF A;  5DB6 A;  4J9Q A;  4JWN A;  2KSO A;  5J2A A;  5BPC A;  4I2I A;  1ZQB A;  4QZ8 A;  2JEG A;  3HX0 A;  4AP9 A;  4DF4 A;  2LYH A;  4M9L A;  4J9P A;  3V7J A;  3G6V A;  4UB6 U;  3TAN A;  2KHQ A;  3KZX A;  1SZP A;  1NKE A;  4BXO A;  3QNM A;  4IRC A;  3PZP A;  8ICH A;  3HPO A;  4KLQ A;  3G6X A;  1L8L A;  3K75 D;  2IMW P;  5ALW A;  1HIW A;  3QU4 A;  2AU0 A;  1UT8 A;  5CWR A;  3UMB A;  3ISD A;  2I1Q A;  8ICR A;  1FFV A;  1B43 A;  4J9R A;  1RQN A;  5AM0 A;  3ZDB A;  2HHX A;  2BDU A;  5KT3 A;  2F2A B;  2WFA A;  1MN8 A;  2Q0Z X;  4NLG A;  3OSN A;  4QZF A;  5KG4 A;  1WWV A;  2CRX A;  3RTV A;  1P7D A;  3TFR A;  3RR8 A;  4K4I A;  1JMS A;  2K4H A;  5J0Y A;  2F8K A;  1ZQZ A;  3BQ1 A;  3F5E A;  5B5E U;  1TAU A;  5DLG A;  3PW5 A;  2JEI A;  7ICS A;  3PW2 A;  5AK3 A;  5ALD A;  3N28 A;  1ZQV A;  2KIV A;  2C2D A;  4M04 A;  1XC9 A;  2PFP A;  3UQ0 A;  1ZET A;  4Y2U A;  2NO5 A;  8ICT A;  1KN5 A;  3C28 A;  4F5R A;  5KFG A;  1VDV A;  3BDP A;  4RQ4 A;  2OM6 A;  7ICN A;  2M9N A;  4FE3 A;  2KJ8 A;  1L3V A;  1QH9 A;  4IQU A;  1ZRM A;  5HP4 A;  2DGZ A;  4JWM A;  3NVW A;  4RT3 A;  1L7M A;  3JPR A;  1J2N A;  4DL7 A;  1QQ7 A;  2QB0 B;  4R66 A;  2KN7 A;  4KLH A;  2OCE A;  4KN7 A;  4IQT A;  4YR3 A;  1X9M A;  2ODG A;  4QW9 A;  2W8K A;  1KTQ A;  1KFD A;  4PZN A;  4NL9 C;  1ZJN A;  2YB1 A;  3UPQ A;  2ZJ5 A;  3NRW A;  1V38 A;  4HAI A;  2JH7 A;  4CCH A;  4EYH B;  4NLB A;  5KFK A;  4CNQ A;  4JV1 A;  4P2H A;  2W54 A;  2FMS A;  4O5K A;  8ICX A;  4UAT A;  3SAF A;  3PO4 A;  4TUP A;  3AQF A;  4B6J A;  3KKA C;  4ECX A;  1RDF A;  4UB8 U;  2G07 A;  1ZQJ A;  4JMU A;  7ICE A;  2A19 A;  4NLZ A;  4YMM A;  2D3D A;  3HWT A;  1SKR A;  1JN3 A;  2JH1 A;  5III A;  1EXN A;  4IQW A;  2LHT A;  2IHN A;  1N60 A;  1QSY A;  4BDP A;  3T5J A;  2VKQ A;  2V4R A;  2DBY A;  3ZD9 A;  2IA6 A;  2K4I A;  9ICH A;  4US8 A;  2Y9T A;  2BQR A;  1F44 A;  1PK1 B;  2E8N A;  5C0Y A;  4O3N A;  3RH6 A;  4ICA A;  4PHA A;  1XS9 D;  3SQI A;  2KG5 A;  3N7R C;  5AKG A;  4ECY A;  4DSJ A;  1Z3E B;  3RJF A;  3GIM A;  5KFF A;  2ZJA A;  2E1E A;  4PH5 A;  4TUS A;  4MHV A;  4EX7 A;  5L1J A;  2H5X A;  3MGV A;  4R65 A;  4DS4 A;  5KG0 A;  1SGG A;  2E5S A;  4RPY A;  3C2K A;  3QE9 Y;  3PX0 A;  1ZQF A;  1ZQW A;  8ICZ A;  4PGY A;  5IIL A;  1O03 A;  2HHW A;  5J0W A;  1ZD5 A;  2OWO A;  9ICQ A;  3RB3 A;  2RHF A;  2F76 X;  4IRK A;  5KFH A;  5EE0 A;  4NLN A;  1N48 A;  2BR0 A;  4OCZ A;  2KOB A;  1RXV A;  1BGX T;  8ICB A;  1S5L U;  4DWI A;  4I2H A;  1RG6 A;  3RH5 A;  5KFJ A;  5EWG A;  4GLX A;  3U26 A;  3V72 A;  2PMZ C;  5AI4 A;  2R8I A;  1U4B A;  2ASL A;  1N5W A;  3KHH A;  1SWV A;  1IG6 A;  2AGQ A;  3K1Z A;  2HSZ A;  1PVQ A;  4YXM A;  2LPE A;  3Q8S B;  4ELT A;  1Z4O A;  2E8O A;  4TQS A;  1ZQQ A;  3C29 A;  2WHE A;  2K60 A;  8ICM A;  1SKW A;  3PX4 A;  4P0Q B;  4DL4 A;  3H0R B;  1F5S A;  2IOH A;  5KFX A;  4KX3 A;  3JPS A;  2PFN A;  2FJ6 A;  2L5Y A;  2R18 A;  2DKZ A;  3HT3 A;  2XY7 A;  4KLS A;  2AH5 A;  1SV0 C;  4DO9 A;  1OXJ A;  5AKH A;  2QAR B;  5DQG A;  1JRP A;  2P35 A;  2DUY A;  4FBT A;  1N63 A;  2WF9 A;  3MAB A;  4OJ5 A;  3FAH A;  2RRD A;  4RUC A;  9ICK A;  5ALH A;  4DLG A;  3PSF A;  4K4H A;  5L1K A;  4HYK A;  3D2N A;  4DSI A;  3RFA A;  4R8U A;  2LKY A;  3L3F X;  3V7K A;  3TQ1 A;  1WUD A;  2BHN A;  4P4O A;  3T79 A;  3NRZ A;  4DFM A;  4M0A A;  5DGB A;  3F53 A;  4QW8 A;  3AU6 A;  1TK0 A;  1D9D A;  4C8M A;  5J0T A;  2HHT A;  3M6K A;  4RQ1 A;  2ZJ8 A;  5KFA A;  3CW2 C;  2I5H A;  2QLT A;  1Y88 A;  4B9V A;  2ALZ A;  3BQ2 A;  3SAH A;  4PZO A;  4F4Z A;  3RAX A;  9ICU A;  5J0P A;  1COK A;  4UB2 A;  2F8L A;  4RUA A;  4MF8 A;  5DDM A;  4DF8 A;  4F5O A;  4MFA A;  2NRX A;  1K1S A;  3VC8 A;  3BZC A;  2F44 A;  1BPY A;  9ICS A;  1PK3 A;  4QWC A;  1TK8 A;  4Z6E A;  3RBE A;  2UVR A;  3BJY A;  2FMQ A;  3NUQ A;  2JGA A;  4UBB A;  3MDA A;  3C2L A;  3ISC A;  1M6Y A;  1XWL A;  4WJ3 B;  4O3P A;  2J6U A;  2MUT A;  2N1R A;  2KHV A;  2W9B B;  5HR7 A;  3PY8 A;  2EAM A;  2G08 A;  3GIL A;  4FZN A;  4QZI A;  3KHL A;  3OSP A;  4I2A A;  3C5G A;  1SL0 A;  4DL5 A;  4Y2X A;  7ICG A;  1S9F A;  2BCU A;  2HBK A;  1RYS A;  3AQE A;  3C23 A;  4FZL A;  9ICF A;  2YY6 A;  2KZM A;  4I2J A;  1S77 D;  1XO1 A;  2BPG A;  1Z19 A;  3RBD A;  1BPE A;  2ZIW B;  2P66 A;  5J2J A;  3RF9 A;  2RDJ A;  3PST A;  1C20 A;  3M9M B;  3PVX A;  3RB4 A;  2F1I A;  4ECW A;  3V6J A;  3LYS A;  1DXS A;  1ZD4 A;  3ZDD A;  4Y2R A;  1ZD3 A;  7ICP A;  2DL0 A;  1DGS A;  1UCV A;  2E1F A;  4YN4 A;  1YZ7 A;  3ZDC A;  2MRL A;  2ATL A;  2HVI A;  2AXT U;  5AM4 A;  3H4B A;  1H38 A;  3GIJ A;  8ICY A;  1X9S A;  1ZQ1 C;  4BGD A;  3BS5 B;  2ZIX B;  3RRG A;  2G06 A;  5CEH A;  3IP4 B;  3V6H A;  1K5O A;  2DPJ A;  4PGX A;  4RQ7 A;  3N7S C;  1V85 A;  4IRD A;  3KOO A;  2P6R A;  8ICW A;  5AI5 A;  3E0F A;  2DQN B;  3UMG A;  5KG1 A;  3C21 A;  4F91 B;  1NZP A;  1NK7 A;  1ZXI A;  3RRH A;  3LWL A;  3AMZ A;  4QZE A;  2ASD A;  1KFT A;  1LKY B;  2KIC A;  1Q8K A;  5J0S A;  4P4P A;  3AEV A;  3D2S A;  1UQV A;  4CE6 A;  5AK6 A;  1MQ3 A;  1BPB A;  3H8M A;  3DDH A;  2JZB B;  4F72 A;  1CUK A;  1RYU A;  2JXJ A;  1HUO A;  4UB5 A;  5J2G A;  4BWM A;  5ALK A;  1DK3 A;  2JEJ A;  2W03 A;  1U47 A;  4DLE A;  3UMC A;  5KFQ A;  2KSO B;  2IOF K;  3LVV A;  5BOM A;  1S0O A;  4YXJ A;  1X40 A;  5EWE A;  1BPD A;  3PSP A;  3QU7 A;  1U48 A;  3WK7 A;  3JPO A;  2HBJ A;  1JIH A;  1LVH A;  1L3T A;  4NM1 A;  1RM6 C;  2F1J A;  1FO4 A;  2PXI A;  2KTQ A;  2B6G A;  4J9S A;  1KW4 A;  3QUQ A;  5D4B A;  4F4K A;  1URJ A;  7ICF A;  1T3N A;  1KKX A;  3FC4 A;  4X5V A;  3WKE A;  1A77 A;  4DCC A;  4K4G A;  1SL2 A;  3PV8 A;  4ED3 A;  4DOC A;  5AIA A;  3AU2 A;  1IXR A;  2OEH A;  4PHD A;  7ICM A;  2WF7 A;  1COO A;  9ICJ A;  2EAP A;  1S76 D;  3BZK A;  1J2M A;  2XGP A;  2GWS A;  2HW3 A;  4LVS A;  5J0Q A;  2K8C B;  1FEZ A;  4PHE A;  1S0V A;  4F2R A;  1NK5 A;  2W9A A;  1ZQC A;  1ZYQ A;  4J9M A;  5KFD A;  3PW0 A;  7ICO A;  2HHS A;  4EZ9 A;  1UT5 A;  3NVZ A;  5KFI A;  3MR6 A;  2ZIU B;  2EZX A;  1QTM A;  4QZA A;  5KL8 B;  5DBA A;  2P6U A;  2H3I A;  1ZQD A;  3H8J A;  3C1Z A;  3SEN A;  2GOL A;  3QUB A;  3MDC A;  4EBC A;  1QSL A;  2PI5 A;  3M9O B;  5KFY A;  3NTU A;  9ICE A;  4YFK A;  1GO3 F;  1TFR A;  3Q8P B;  2ZUD A;  4R64 A;  3T5L A;  1FFU A;  4ZH4 A;  5KFN A;  1X6I A;  1JXE A;  4YCX A;  1KQQ A;  4NV0 A;  3H0L B;  5AI8 A;  4IL6 U;  4AYB C;  1IM4 A;  2F77 X;  3QZ8 A;  5FP0 A;  8ICC A;  4YR2 A;  2LM4 A;  3MR3 A;  2W11 A;  1NK8 A;  2KIW A;  3SZ2 A;  2W8L A;  2HI0 A;  2KJ9 A;  1DK2 A;  1CEZ A;  1S8O A;  4O5E A;  4LZD A;  1Q3U A;  5ALI A;  3H8S A;  3RJJ A;  1X9W A;  7ICL A;  1L6N A;  2ZTE A;  3AM9 A;  3SEI A;  4YR0 A;  2YML A;  2BCQ A;  1D8B A;  4GFJ A;  4C80 A;  2WAQ F;  4I28 A;  4F50 A;  4C4R A;  4J9K A;  2W7P A;  3PX6 A;  3TFS A;  1WYG A;  2FE9 A;  3EYZ A;  2J6T A;  2ISO A;  5AKJ A;  3IN5 A;  2OYY A;  4F5P A;  2RQ5 A;  4B9T A;  5EOZ A;  3M8S A;  2Y0S F;  2AQ0 A;  2WF5 A;  3PO5 A;  8ICJ A;  2VJ4 A;  9ICT A;  3KKA A;  5ALQ A;  4RQ3 A;  2MAX A;  4YMN A;  4RQ6 A;  2DWQ A;  3B9J A;  2I9G A;  4FS1 A;  1L5U A;  2EH9 A;  1NNL A;  3HW8 A;  1SV4 A;  2YB4 A;  3Q8K A;  4OO1 J;  4QZH A;  4OJO A;  2NRV A;  5DG9 A;  1MQ2 A;  4UAZ A;  2ZXH A;  2I6X A;  1AQ6 A;  1PK1 A;  1PVR A;  8ICL A;  2JEF A;  1HJP A;  4C7Y A;  4F4X A;  4Q43 A;  4BWJ A;  2VIX A;  4QNL A;  4DEZ A;  1KEJ A;  5DBB A;  4M2Y A;  5J8Y C;  3C1Y A;  2F1H A;  4Y2P A;  4DFD A;  1YT3 A;  2UVW A;  4DQP A;  3KHG A;  3CNH A;  1N62 A;  1PVP A;  4OJ6 A;  3J81 j;  4GC6 A;  1BVS A;  1HEK A;  3RH4 A;  4GXI A;  9ICR A;  1BNO A;  4QJF B;  1ZQA A;  5KG7 A;  3KBB A;  4KLF A;  4USA A;  2A1J B;  2RP5 A;  2B0C A;  4TUR A;  2YQE A;  3ORY A;  1X9X A;  4MF2 A;  5EWF A;  1J97 A;  5AKL A;  3KFU F;  1B4F A;  4EBE A;  2XVT A;  4DQI A;  4F4Y A;  3RJK A;  1NKC A;  8ICU A;  2EQY A;  2BCV A;  1ZRN A;  2KEY A;  1PZN A;  5GTH U;  2VA3 A;  4P4M A;  3RJG A;  2V9W A;  2RLT A;  4CDG A;  4M6W A;  3TAQ A;  1BNP A;  4RZR A;  3BQ0 A;  4PJ0 U;  1NI3 A;  3WKD A;  5ALG A;  2R8K A;  3GQC A;  3Q8R B;  2IBK A;  3EWA A;  1Q3V A;  1NOM A;  2XY5 A;  4XQ8 A;  1JI7 A;  4RQ0 A;  4M47 A;  2JHD A;  1IV8 A;  2NO4 A;  4KN4 A;  4P0Q A;  3QX7 A;  1Z4N A;  5AM5 A;  2UVU A;  5JRT A;  3A0B U;  5J2H A;  5AKI A;  1ZQR A;  5J2C A;  1L8O A;  4M9N A;  5J8Y A;  3QZ7 A;  2VA2 A;  9ICG A;  1Z00 B;  4DQQ A;  3OPX A;  4NLC A;  5ALF A;  2E3T A;  2XID A;  4I2D A;  8ICG A;  2D8C A;  4BJQ A;  2CXY A;  2K8B B;  1XO0 A;  3SR6 A;  4QWE A;  2QAR A;  3Q8L A;  5F9L A;  5AIB A;  1NK0 A;  2LYA A;  3QUC A;  4DFK A;  7ICR A;  2ISP A;  3BQT A;  1ZOL A;  5AHX A;  2NV3 A;  5AI6 A;  5KFT A;  1SKS A;  1JX4 A;  3QU2 A;  5AIC A;  4QZB A;  2W9C B;  3SV4 A;  4I2F A;  1UPH A;  1YZ6 A;  2Q4T A;  2R8J A;  3EZ5 A;  5IIK A;  1OUQ A;  4EEL A;  3E58 A;  2DPI A;  2CN1 A;  9ICO A;  5HNK A;  1UA0 A;  3WK9 A;  4R8U B;  4XA5 A;  5AKY A;  4C0Z A;  3ZD8 A;  3ZI4 A;  5CJ7 A;  4C4S A;  1FIQ A;  5J2D A;  1T7P A;  3V7L A;  7ICH A;  2BQU A;  4C8O A;  4KX5 A;  4JK1 A;  3ZDA A;  3HJE A;  3PMN A;  1MSW D;  4J9L A;  5ALU A;  4MFF A;  5IIM A;  2E8P A;  1LB2 B;  3MGH A;  3GDX A;  9ICL A;  4NY8 A;  3DEE A;  4ELU A;  3LVW A;  2AJQ A;  2Y9U A;  5AKZ A;  1KLN A;  2K8A A;  2E8M A;  4QWB A;  4RNN A;  2FDR A;  5J2E A;  1A0P A;  3OJS A;  2MUT B;  2ZUB A;  5G5G A;  2G0A A;  1KRP A;  4GIB A;  8ICQ A;  2C28 A;  2KK0 A;  1SXD A;  3ONN A;  4Y2V A;  9ICW A;  2FMP A;  3GV8 B;  1RPL A;  4B9L A;  2JRZ A;  1VJ5 A;  2HHQ A;  4EZ6 A;  4YMO A;  4Y2T A;  4KTQ A;  4OJL A;  5J2K A;  4DL2 A;  1SIJ A;  2KP7 A;  2HBM A;  2ZIV A;  2FLL A;  2DF4 B;  5D46 A;  3HKZ C;  1ZQU A;  4EYI B;  1QQ6 A;  2ASJ A;  5DG8 A;  4BUG A;  4PL1 A;  5AK5 A;  4CGZ A;  3S6J A;  4DFP A;  2GLE A;  3IDW A;  1B22 A;  2PMZ F;  4KLI A;  3GV7 B;  3RJI A;  5H2F U;  8ICO A;  5DQI A;  4ED8 A;  4NJ8 A;  4UAS A;  5CP2 A;  3WKC A;  4TUQ A;  1ZD2 P;  3PNC A;  3WKA A;  5KFP A;  3WK8 A;  4B9N A;  3K4G A;  1NK9 A;  2KD1 A;  4E0D A;  3T5K A;  5KAI U;  3D2Q A;  4KLT A;  4UQG A;  2XY6 A;  2M0N A;  4CF5 A;  3F5A A;  1K1Q A;  5KFC A;  3TI0 A;  4ECQ A;  3PR4 A;  2VAN A;  5ALO A;  3PSI A;  4RNO A;  1RQL A;  2QB1 A;  2KMD A;  2VJ5 A;  2XI9 A;  2LI6 A;  9ICA A;  2NRW A;  2JZB A;  1DGJ A;  1LV5 A;  2ZXI A;  1L7O A;  5KT6 A;  4C4T A;  1ZQN A;  5ALP A;  1L3U A;  1KSP A;  2H3V A;  4RPX A;  2IHM A;  8ICA A;  2A3V A;  3JPN A;  4O3M A;  2ZUC A;  4KLO A;  8ICI A;  2LYB A;  4QZD A;  2W55 A;  3HRD D;  4RU9 A;  5DB7 A;  4PL2 A;  4F8R A;  2KZ3 A;  2HOQ A;  1WWU A;  2J6S A;  3PW7 A;  4UAY A;  4YVZ A;  3K1R B;  2C2R A;  3GV5 B;  4BX9 C;  1RYR A;  5AI9 A;  1XSP A;  5F3X B;  4RQN A;  3Q8M A;  5KG2 A;  4QZC A;  4PPX A;  2C22 A;  5AKE A;  1ZQK A;  3QEA Z;  1XSN A;  4P0P A;  4FS2 A;  3AN1 A;  2XCP A;  2W9M A;  3SMV A;  3H8W A;  4UAW A;  4QWD A;  1VLB A;  2Y0S C;  1TE2 A;  1RZT A;  3ED5 A;  4DQS A;  1WG8 A;  5KNI A;  1NK4 A;  3F2B A;  1U9L A;  8ICK A;  2EAN A;  4IR9 A;  4EX6 A;  4YP3 A;  3V6K A;  2BGW A;  5DDY A;  1QQ5 A;  3GZF A;  5L1M A;  3NVY A;  5KFU A;  4DQR A;  4GXK A;  5KG6 A;  4Y2Q A;  4Y2J A; 
#chains in the Genus database with same CATH homology
 2M0N A;  3F5E A;  3F5A A;  2H3Q A;  2VJ4 A;  3K1Z A;  2K8A A;  1PVQ A;  3NUQ A;  1Q3V A;  2JGA A;  4CRX A;  2LBO A;  2JH1 A;  2G5I B;  2KIC A;  4WJ3 B;  3PSI A;  3C29 A;  1A0P A;  3ALR A;  1Z1B A;  2LHT A;  2N1R A;  2JHD A;  2G0A A;  2GH1 A;  4AYB F;  2ZIU A;  2ZIU B;  4U7C A;  2YB4 A;  4QIW F;  2Z7J A;  2VJ5 A;  2VKQ A;  2KNJ A;  2XI9 A;  2KHV A;  4P0Q A;  4P0Q B;  4OO1 J;  3IG5 A;  3H0R B;  4OJO A;  2K4I A;  4IC9 A;  5KL8 B;  5HR7 A;  2ZXH A;  2MA1 A;  2G08 A;  3ONN A;  3SAG A;  1XNS A;  2H3F A;  1F44 A;  2CPR A;  4KX3 A;  2ZXI A;  2HMX A;  4FZN A;  5C0Y A;  1PVR A;  3IG8 A;  2H3I A;  5CRX A;  4KMO B;  2R18 A;  3OPX A;  4NLC A;  4ICA A;  2KKP A;  3C28 A;  2H3V A;  2XID A;  2GOL A;  4U6P A;  2VIX A;  5KL1 B;  3SQI A;  3VCB A;  4QNL A;  2W03 A;  3N7R C;  2HBK A;  3AQE A;  4FZL A;  2OM6 A;  4BJQ A;  5HR6 A;  5T14 A;  2K8B B;  2A3V A;  1XO0 A;  2OXO A;  4O3M A;  2HOF A;  2HOI A;  4FE3 A;  4OJL A;  2LYB A;  3LVV A;  2LYA A;  1YT3 A;  1GO3 F;  2WB1 F;  2KJ8 A;  4QIW C;  1Z19 A;  2E1E A;  2ZIW A;  2ZIW B;  1PVP A;  4OJ6 A;  3RF9 A;  3D2S A;  3CP8 A;  3M6Z A;  2HBM A;  2W04 A;  2ZIV B;  2ZIV A;  3PST A;  4PL2 A;  1A6S A;  2DGZ A;  1HEK A;  2HOQ A;  3PSP A;  2DF4 B;  3MGV A;  3AL0 B;  4NV0 A;  4OJ5 A;  3H0L B;  2RRD A;  3HKZ C;  2NV3 A;  2HBJ A;  4QJF B;  4AYB C;  2F77 X;  3HKZ F;  2E5S A;  3LYS A;  2KHQ A;  3KZX A;  3N7P D;  4BUG A;  2G5H B;  1UPH A;  2Q4T A;  4PL1 A;  4BX9 C;  4OJP A;  1DRG A;  4CGZ A;  1OUQ A;  2KIW A;  3PZP A;  2KJ9 A;  2HBL A;  3PSF A;  3GU3 A;  2RP5 A;  2CN1 A;  2KV2 A;  2W7O A;  3CYM A;  2K89 A;  3D2N A;  2E1F A;  1HIW A;  1URJ A;  3RFA A;  2LKY A;  2MRL A;  2JMG A;  2RHF A;  1ECW A;  2F76 X;  2PMZ F;  2YB1 A;  3L3F X;  3O0F A;  1Q3U A;  4P0P A;  4ACO A;  2YX8 A;  4C0Z A;  1KBU A;  4P0P B;  1WUD A;  3NRW A;  3T79 A;  2ZG6 A;  3F53 A;  3KFU F;  3SMV A;  1TAM A;  2KJ5 A;  1ZQ1 C;  2XVT A;  2Y0S C;  3M6K A;  2JH7 A;  4A8E A;  1L6N A;  2ZIX A;  2K4E A;  2ZIX B;  3ICX A;  2KOB A;  2G06 A;  1NZB A;  4NLB A;  2D6F C;  2BDU A;  2F2A B;  3IP4 B;  3H0M B;  4KX5 A;  1CRX A;  1D8B A;  3CRX A;  3SAH A;  2KEY A;  4GFJ A;  3F2C A;  3F2D A;  2WAQ F;  3F2B A;  2G09 A;  3N7S C;  1SZH A;  4FZM A;  4CDG A;  3SAF A;  2W7P A;  1ED1 A;  2PMZ C;  2CRX A;  2H3Z A;  3E0F A;  2DQN B;  4NWI A;  3AQF A;  1MA7 A;  3GZF A;  2F8L A;  5A0L A;  2XIC A;  3IN5 A;  2KD1 A;  2OYY A;  1P7D A;  2KKV A;  3DEE A;  1T94 A;  3M7D A;  2OH2 A;  2KVC A;  2K8C B;  3VC8 A;  3LVW A;  2G07 A;  4JMU A;  2K4H A;  3D2Q A;  1IIP A;  2WB1 C;  2WAQ C;  2Y0S F; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...