2E1FA

Crystal structure of the hrdc domain of human werner syndrome protein, wrn
Total Genus 33
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
33
sequence length
94
structure length
94
Chain Sequence
QPVISAQEQETQIVLYGKLVEARQKHANKMDVPPAILATNKILVDMAKMRPTTVENVKRIDGVSEGKAAMLAPLLEVIKHFCQTNSVQTDLFSS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Hydrolase
molecule keywords Werner syndrome ATP-dependent helicase
publication title Crystal structure of the HRDC domain of human Werner syndrome protein, WRN
pubmed doi rcsb
source organism Homo sapiens
total genus 33
structure length 94
sequence length 94
ec nomenclature ec 3.6.4.12: DNA helicase.
pdb deposition date 2006-10-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00570 HRDC HRDC domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.80 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 DNA polymerase; domain 1 2e1fA01
3SAFA 2HBMA 4CDGA 1GO3F 3CYMA 3SAGA 4O3MA 2HBJA 2HBKA 4QIWF 2KV2A 4NLCA 2RHFA 4OO1J 2E1EA 2E1FA 2MA1A 1D8BA 1WUDA 4CGZA 1YT3A 3SAHA 5C0YA 4NLBA 2RRDA 2CPRA 2DGZA 4QJFB 2HBLA
chains in the Genus database with same CATH superfamily
4R63A 2F76X 5AM1A 2ZUCA 2YMQA 1L3VA 4RQ1A 3FDSA 3HP6A 1Z00A 1WG8A 5KFJA 2KTQA 3HKZF 4NY8A 5KFXA 5J29A 4UB4A 2OWOA 2F8KA 4EX7A 3E58A 4JV1A 3ISBA 2K8CB 4ICAA 4LZDA 3UXOA 1ZYQA 1ZQBA 2LM1A 4KLIA 3ED5A 3IHQB 5F3XB 3RH4A 1LB2B 3GDXA 4M9GA 1WUDA 1JX4A 4P0QA 3JPTA 2MU2A 1KSPA 5KFTA 2KSOA 3H0LB 3T79A 3SZ2A 2G07A 5BOLA 3FAHA 4QZCA 4J03A 2HHWA 3B9JA 4DQRA 3PMNA 2HSZA 2E5SA 3R9KA 2W9BB 2F2AB 2KG5A 3GIKA 3LVVA 4IRCA 2AHOB 1TFRA 3LK9A 2BHNA 1C20A 3TFRA 1MQ3A 3EPIA 1ECWA 1IV8A 1UCVA 2DUYA 4TQSA 2QARA 5J0TA 1VLBA 2KHQA 1K1SA 3JPPA 1SZHA 3RJJA 3K1RB 3FC4A 2VJ4A 3BQ2A 4O3QA 1JMSA 1BPZA 2FJ6A 5L1KA 3M9OB 4DS4A 1BPBA 2OH2A 5AI0A 1Z1BA 1YZ6A 2AU0A 4EZ9A 1RDFA 2LI6A 4DOCA 1PK1B 3ISCA 4J9MA 8ICQA 1S0VA 4DQSA 4XA5A 3RBDA 1N2XA 2DL0A 5ALJA 4EENA 2ODGA 3WKEA 1AQ6A 2EDUA 2B21A 4BUGA 5DQGA 8ICNA 2G5IB 2HHXA 8ICUA 5JU5A 2K8BB 4C7ZA 1JRPA 1PUZA 2W8LA 4UB5A 3GV8B 2LBOA 3MDCA 2BDPA 5EWGA 1U4BA 5AI5A 4ED6A 1ZQTA 3NASA 2HBLA 1ZQ1C 2XC9A 2AH5A 4O3SA 3AU2A 5CJ7A 1ZRNA 1O03A 8ICGA 1ZQAA 4O3RA 2RHFA 2ZIWB 1S9FA 1UA1A 1N5XA 1ZQMA 5ALZA 1ZJMA 4TUSA 5AM0A 3BJYA 1RYRA 5J2IA 2JEJA 4UB1A 4BXOB 3SV3A 3T5HA 1WCLA 3PW4A 1QH9A 1ZQKA 2ZJ5A 2Y9TA 2ATLA 4FZMA 3WKAA 4KITB 2BQUA 3RAQA 3H0MB 3WKBA 3RTVA 2FDRA 2IOFK 4BWJA 3RR7A 4QZBA 4I28A 2BCRA 3N4MB 4NM1A 3AU6A 1LV5A 2EAMA 2I9GA 9ICQA 4P4OA 4J9NA 1KRPA 2BR0A 2KV2A 1D8YA 1ZQHA 4QZAA 4IRDA 3G6XA 5ALSA 1KN5A 4RT2A 5J2JA 3IM1A 4TUQA 3KFUF 1NK5A 3M9NB 1KBUA 2J6UA 1NK7A 3QUQA 5KT4A 8ICHA 4GXKA 2JXJA 5AI9A 1SIJA 5KFAA 1Z1VA 7ICVA 4ED2A 5J0SA 4K4HA 2W04A 5KFZA 4RZRA 9ICNA 5KFYA 5L1MA 2KSOB 3PSTA 1RYSA 4KLDA 3KD3A 4QNLA 2XCAA 2FMSA 1T7PA 4ELTA 2PMZF 3PSIA 5KFKA 2KN7A 2G0AA 2V4QA 4RU9A 3ZDBA 4B9MA 9ICKA 4KMUA 2W43A 2VANA 2DFLA 1XC9A 3SD7A 1L3SA 3JPNA 1FEZA 2O6KA 2K89A 1Z4NA 1JROA 2QARB 1N61A 4NLGA 1S97A 5AIAA 2HBKA 8ICAA 3OGUA 2DPIA 5ALUA 4I2GA 5F9NA 1X40A 2E1FA 1ZQSA 4FO6A 3PR4A 4KLGA 2NO4A 4UAVA 5AKJA 1S8OA 4CGZA 2A3VA 1RM6C 2KJ8A 9ICLA 2FPLA 3I1YA 1X2IA 4EYIB 4PGYA 2JRZA 5IIOA 2VKQA 4DL5A 4MFCA 2AJQA 2P6UA 3AEVA 4TQRA 1VJ5A 3PW7A 2KIWA 4M9HA 4DFPA 1YZ7A 8ICFA 3HT3A 1QTMA 2AQ0A 1B22A 5KFCA 1BPEA 3ONNA 1UA0A 5GTIU 1Y88A 3N28A 4AYBC 2R8IA 4Y2QA 2Y0SC 4R8UB 2XGQA 5J2AA 2DQNB 5EE9A 3M8SA 3QU5A 4M6WB 4KLOA 2OEHA 3V7JA 9ICEA 5ALHA 3QEAZ 4PL1A 1HUOA 5HMLA 4F4XA 2WF9A 3UM9A 5ALMA 3LDAA 3KTQA 2Y1JA 1ZQGA 1D9DA 1HIWA 2QKQA 3N7PD 3T5JA 2IMWP 4US8A 1WWUA 4F4KA 5KG1A 4MHVA 4YMOA 2C2RA 2IHNA 2F1HA 5D4BA 2F44A 1MA7A 2YMLA 3PSPA 2R18A 5D46A 3D2NA 1FFUA 5JTIA 4UW9A 3KHRA 1SWVA 5AIBA 4DWIA 3MDAA 7ICQA 5CP2A 1QQ7A 4BX9C 4F91B 4ZOHC 4DCCA 5ALOA 2KNJA 2KHVA 3Q8MA 4RUAA 4ELVA 3F2CA 5DB8A 4RQ7A 1UT5A 1TAMA 4UBCA 4UAWA 5IIIA 1COKA 1QSYA 4F3OA 1TKDA 4RPXA 4LJXA 7ICLA 4F5QA 1NJZA 3RH5A 3OSPA 3QU2A 4QIWF 2LYAA 3QU9A 2MSNA 2FE9A 4I2HA 3RAXA 1JXLA 5KFIA 5CRXA 1NI3A 1S10A 3BQTA 2OCEA 4OJOA 4GIBA 4ECXA 3EWAA 5AI6A 4RQ0A 3AL0B 3CP8A 2KEYA 5AKLA 3OJSA 1T3NA 9ICWA 1NJXA 1PK1A 4ED0A 3AQEA 5DGBA 4DFMA 4ELUA 1VDVA 2GLEA 5J0QA 4NLZA 2QB1A 4GFJA 9ICBA 3V6JA 2R8KA 1X6JA 3GIIA 3GIJA 4I29A 5KTQA 2W54A 3MR6A 4CF3A 1N5WA 2F3NA 4DF8A 4Y2YA 4I2FA 4F71A 3IN5A 1T4GA 4DEZA 4RNMA 5DB6A 8ICSA 4DL2A 4DL6A 4PL2A 4Y2RA 4QZ8A 2DF4B 3A0BU 1J2NA 1A0PA 4K4GA 2HHVA 1UQVA 2ASJA 3SEIA 4IR1A 3PV8A 5KT3A 3WKDA 4NLKA 3F5AA 5C0YA 4DLGA 3RJIA 2W7OA 1DXSA 3SQIA 1IG6A 1ZETA 1KFDA 3NUQA 2XCPA 4OD0A 7ICIA 2BQ3A 5AK4A 4F8RA 2W03A 1A77A 4IL6U 4F5OA 1PVPA 2F8LA 5AI4A 3EZ5A 3JPQA 4B9SA 1HEKA 2HHUA 2EQYA 1T94A 5EE0A 4PZOA 2KE7A 1JXEA 3C5GA 3LWMA 3QU7A 2MUTA 5IILA 2JGAA 4CRXA 2HOFA 5ALWA 4FFDA 4M47A 4KX5A 2L5YA 3HRDD 2N1RA 2XI9A 3GV5B 2Y9UA 4I2CA 2E1EA 4EYHB 2JH7A 2PXIA 2XIDA 4O5KA 3NTUA 5ALNA 4I2JA 4YN4A 3RB3A 2LPEA 2CN1A 5KFQA 5ALRA 2K4PA 4UAZA 4OCZA 3V72A 1KEJA 5J0PA 4ECVA 4F5RA 4QZEA 5CHGA 1ZQEA 2ALZA 2JMGA 3C29A 1SKWA 2A1AA 5J0OA 2B6GA 2DBYA 5CB1A 3MR2A 1P7DA 3E0FA 1TV9A 3RJHA 2FLPA 5AKZA 3D6JA 2H3IA 2R8GA 4C4SA 2NRTA 5KG0A 3ZDEA 2NRXA 4GC7A 2XY5A 4DSJA 4ED7A 4OO1J 3QEBZ 1RQLA 3LVWA 4P0PA 3PX6A 3GIMA 2E8PA 8ICZA 5JRTA 3MR5A 4C8KA 5J2CA 2XGPA 2J6TA 1SV4A 2MRLA 4DQIA 1ZD3A 3GZFA 2WB1F 5DGAA 5J0WA 8ICBA 1F5SA 4DFDA 3SV4A 3MFIA 1MQ2A 2D3DA 2RDIA 4C80A 1N56A 2F77X 2PI5A 4KLUA 4X5VA 2JEFA 2EANA 3GFKB 1U45A 3K75D 3QUCA 5KFSA 5EOZA 5G5HA 3TKAA 3MGHA 3MGVA 4O3NA 4I2BA 4U6PA 1ZQWA 1ZRMA 2JEGA 3HKZC 2QB0A 5KFWA 4C4RA 3O0FA 3PO4A 3RB4A 3SENA 5AKGA 3AN1A 2VA3A 3TACB 1A6SA 4ECQA 3MBYA 3WKCA 1DK2A 1Z19A 3KOOA 2ZIXA 3FM9A 3H0RB 2KP7A 3SI8A 1TE2A 2KD1A 3OJUA 1RG6A 4R8UA 4RQ5A 5ALTA 1SV0A 4RQ6A 1BNPA 1D8BA 3F5EA 4M6WA 5ALKA 1IIPA 5KG7A 3HJEA 1NJYA 4OJ5A 4CNQA 4DSFA 1LVHA 2JH1A 2XVTA 3H4BA 2KKVA 4J9RA 4DL7A 2KZZA 7ICRA 4UBBA 1Q46A 1QSLA 3MC1A 4Y2PA 5KAIU 4M9LA 3G6YA 1CRXA 1RQNA 2YB1A 2HVHA 1KL9A 7ICNA 3WK5A 4DSLA 4IR9A 2HBMA 4XQ8A 1ZQIA 3RJGA 1SKRA 2C2EA 5L1LA 4AP9A 1U47A 4BWMA 4BDPA 2G5HB 4DL4A 1SGGA 3OHBA 2NRZA 3BS7A 2WAQF 1ZJNA 3OPXA 2CXYA 2BCSA 2GWSA 4QWDA 1TK5A 4M2YA 2MUTB 2DWQA 3ETLA 1KLNA 1O08A 9ICAA 4FZLA 4YVZA 3DEEA 1RYUA 4JV0A 4NL9C 1LKYA 4RQ8A 3THVA 4IQUA 3C5FA 3UXPA 4NL9A 3Q8SB 2IOFA 4QWEA 1XU4A 1BVSA 5AK6A 4UATA 5H2FU 2BDUA 4KMOB 4Y2JA 1RPLA 1Q3UA 2OYYA 4BGDA 2BCVA 3N7RC 2CPRA 3SMVA 3EUB2 2XY6A 5DBBA 3TARA 1XO1A 3DV9A 4F72A 1L8OA 5KG4A 2ISOA 3MFHA 3OHAA 1X9WA 3H40A 7ICJA 2ZIVA 4KLLA 3TI0A 2NRVA 3HILA 4RQ2A 4US9A 2WF7A 4Z6DA 5ALDA 4Z6EA 4AYBF 4J9KA 2C28A 1N48A 2RP5A 4PZNA 5A0LA 2Y0SF 3D2SA 4O0IA 4HYKA 4QZDA 5EE3A 2ZTEA 4P0PB 5KFMA 4YFKA 2FI1A 3ISDA 4MF8A 5J2FA 5KNIA 3RR8A 2P66A 2JZBB 2WF8A 2RRDA 1BNOA 3NRZA 2KFNA 4C8MA 1Z3EB 3KBBA 2K4HA 3C23A 1ZQQA 2VA8A 4UARA 1KDHA 3L5KA 1FFVA 2DPJA 3SYZA 4ECYA 3M6ZA 3ZDDA 2FMPA 3NVYA 1JN3A 3KZXA 3IRUA 4UB8U 2W55A 2K4IA 2KJ5A 5DB7A 4YR3A 1X9MA 1UT8A 4J9SA 1C7YA 5B66U 4KLFA 5KL1B 3PVXA 3LWLA 1FIQA 4QW8A 2QB0B 1U49A 2YQEA 2XICA 5J2DA 1ZOLA 2VJ5A 1F44A 1ZQOA 4QWBA 1NK8A 1CEZA 4DO9A 3WU2U 1CI4A 1ZQRA 5ALPA 1HUZA 2YTUA 3Q8KA 2ZIXB 4MEYA 5AKYA 2LKYA 4DQPA 2LYHA 1L7MA 4PHPA 4DLEA 4EBEA 8ICWA 2H5XA 5J0XA 8ICXA 2ES6A 3C2LA 1PVQA 5IIJA 3IDWA 3BQ1A 5K4LA 3M8RA 1B43A 5AKIA 2XY7A 3K4GA 3BZKA 3M7DA 2FLLA 4C4TA 2PMZC 3ZDAA 4DSKA 5KFUA 4Y2VA 3PR5B 4F5PA 4F92B 7ICPA 3PSFA 4F4YA 5DQIA 2BPFA 4KLQA 1S5LU 4GC6A 1YT3A 3RFAA 4MF2A 5AKHA 3M9MB 3EYZA 3C21A 4UAYA 4K4IA 2HW3A 3NVVA 4BJQA 4YD2A 1OUQA 4HAIA 2HBJA 5T14A 3F2BA 5DQHA 4YR0A 1XSLA 5ALVA 3CW2C 3TQ1A 4KLHA 4YP3A 4DL3A 8ICCA 4RPZA 5C5JA 4G3IA 4I2EA 2NRWA 2YY6A 1LKYB 4RT3A 3TFSA 3J81j 2HHTA 1RXVA 2H3VA 4F93B 4MEXA 3DDHA 5L9XA 2WFAA 1N63A 5KFVA 4RNOA 3IG8A 4YXMA 5KFEA 3I76A 1XNSA 2CRXA 1COOA 2FPMA 1NKEA 5KT6A 1SXDA 3UMGA 1EXNA 1U48A 2PI4A 4PGXA 1ZQNA 1SL1A 5KG6A 2KK0A 4O3OA 4EEYA 2ZIVB 5KFPA 5HNKA 2W9CA 2PFNA 7ICMA 1XSPA 4RPYA 2KICA 2KVCA 5CA7A 4O5CA 1IXRA 3RH6A 3PY8A 3PNCA 3NS1A 4Z6FA 1S0MA 2PFPA 3NVWA 4J9PA 9ICXA 4RUCA 9ICPA 2FMQA 3ZDCA 4I27A 4F4WA 1MC8A 4ZH4A 1QLNA 3AMZA 3HWTA 4ECSA 2C22A 3ICXA 1S77D 8ICOA 3T5LA 9ICRA 1X42A 2ZJAA 1ZQZA 3BQ0A 3QX7A 2QLTA 9ICUA 8ICRA 3QXGA 5KG2A 4O9MA 2R8JA 2W3RA 2EH9A 4NLNA 2Q4TA 1X9SA 3GQCA 3L4PA 1V85A 5ALFA 9ICVA 5G5GA 4B9UA 4Y2TA 4JB3A 8ICMA 2ZXIA 2ESEA 1D9FA 3OTQA 3MGIA 4JK1A 3WK4A 1WCNA 5KFFA 3Q8QB 1ZQFA 9ICGA 3BZCA 5J0RA 1TAQA 4G9BA 1WWVA 2EZYA 3GU3A 4M9NA 1BGXT 1KFSA 3A0HU 3BDPA 1L7PA 2NV3A 4F5NA 2D8CA 2EZZA 3TAPA 4NLCA 5HHHA 4QIWC 5HP4A 2EAPA 2C2DA 1JIHA 4J9LA 4RQ3A 1B0XA 8ICKA 7ICKA 5DBCA 3PZPA 2H3ZA 3WK8A 4Y2UA 4A8EA 2LMRA 4RNNA 2HOIA 4F50A 5DKWA 2ASLA 4O3MA 7ICUA 8ICEA 4DOAA 4DFKA 1V38A 4OJLA 5AI8A 5FP0A 5B5EU 5AK5A 4UB2A 2G08A 5AK3A 4GXIA 1Z4OA 2I1QA 4PPXA 2JV3A 2BCUA 1ZQUA 2KIVA 4DF4A 1S0NA 4RQNA 4XRHA 3G6VA 4Q45A 1JALA 4FBUA 2V4RA 3MR3A 4JV2A 2EAOA 4M9JA 1NZPA 4ED1A 1FO4A 2W9MA 1NKCA 2K8AA 5AKXA 4F4ZA 4OJPA 3ALRA 5KFOA 4C7YA 4O5EA 4USAA 1Q8KA 5DDMA 1DOQA 4NJ8A 4F2SA 4O3PA 3B0XA 5F9LA 4QZIA 2HVIA 2LM4A 1URJA 2M9NA 4GLXA 2JZBA 3C2MA 4CF5A 2E3TA 4CDGA 1XSNA 1QCKA 3JPSA 4Z6CA 4IS7A 5DDYA 4P2HA 1KTQA 3MABA 5J2BA 7ICOA 9ICFA 2H3QA 1TK0A 3KZIU 1KQQA 1JUDA 1N60A 4C8LA 3RF9A 5J2KA 3T5KA 2OHFA 2W9AA 1K5OA 2ZTDA 2W9CB 2E8NA 5AKKA 4CE6A 3RJKA 4Y2XA 2BGWA 3KHLA 2EZXA 9ICHA 5ALQA 1ZQXA 3SAHA 5ALYA 3M6KA 4KLTA 4IQTA 5HR7A 2YMPA 4FE3A 1NK6A 3N97B 3ZD8A 5AICA 3WK9A 5J8YC 2ZG6A 2K60A 2W8KA 2UVWA 5DG9A 3AUOA 4FZNA 1PK3A 1SV0C 5J8YA 3IV6A 2DKZA 2YB4A 2G09A 4LVSA 2MA1A 5AKEA 5DLFA 7ICTA 2AGOA 4ACOA 1V9PA 4NLBA 4JWMA 3KHGA 4YMMA 3QUTA 1AROP 4EBDA 5CWRA 4IC9A 2E8OA 4NV0A 1A76A 1M6YA 1SB3C 2BPCA 2VIXA 5E79U 4DOBA 1N62A 4EBCA 2LHTA 1OW5A 2KVSA 3H8SA 4I2AA 2ZTCA 9ICIA 9ICSA 2GH1A 2FLNA 2GO7A 3IG5A 7ICGA 1BPYA 5ALXA 4NXZA 3NGDA 4PGQA 7ICEA 2RDJA 2UVUA 4FBTA 4YG2A 3QZ8A 1UPHA 4QJFB 4CF4A 3BS5A 5ALGA 2AGPA 3L3FX 4I2IA 3D2QA 3LYSA 2WB1C 5L1IA 4M04A 4IQVA 3PX4A 1ED1A 2PFQA 1ZD2P 2ZUBA 1NK4A 2ZXHA 8ICYA 3RRHA 3K1ZA 5KFGA 4XUSA 3RJEA 3EPGA 1NNLA 1QSSA 3UPQA 5DBAA 3V6HA 3SAFA 4KLSA 1DK3A 5KFLA 1PZNA 4UB3A 4PHDA 2KZ3A 3PO5A 5AHXA 1T8EA 1U9LA 2UVVA 4YD1A 4QWCA 1SKSA 3C2KA 1ZXIA 2AGQA 1ZQYA 4J9QA 4C8NA 2PFOA 3F2DA 4Q44A 2JEIA 2P6RA 5BPCA 3QE9Y 2BQRA 4B6JA 2A1JA 2ASDA 3JPOA 4QZGA 3QYPA 1ZD4A 5KFBA 1Z00B 4KTQA 4B9TA 3UXNA 5AM5A 4C8OA 1UHUA 5TZVA 4DSIA 4P4MA 2YN4A 5KFRA 3WK6A 2BKEA 2HHSA 3M1YA 4DS5A 4C0ZA 4F2RA 3TAQA 1V97A 3RB0A 4UQGA 3H8MA 9ICMA 3JPRA 1TK8A 4QW9A 4ECWA 1SXEA 4IRKA 2ZJ8A 4P0QB 1SL0A 4MFFA 9ICJA 5J2GA 5KG3A 1J2MA 5L1JA 7ICSA 4UASA 3PMLA 3RJFA 4KX3A 4PH5A 4B9LA 5KAFU 5KL8B 1L6NA 1DGJA 5TISU 1DGSA 4B9VA 2HCFA 4JUZA 2K4EA 1T3QA 9ICTA 2KOBA 3PW2A 4EEKA 4ED8A 4IQWA 2Y1IA 3PX0A 3CRXA 2WAQC 3UQ0A 2HDOA 2ZIUA 7ICFA 8ICPA 1S0OA 5AM3A 1Q3VA 3AM9A 1ZD5A 4R65A 2W11A 3HX0A 5DLGA 4EELA 4YCXA 2I5HA 5AM4A 3N7SC 4KN4A 5J2EA 2HI0A 5IIMA 4Q43A 1ZQVA 2D6FC 3UQ2A 1L8LA 3HPOA 2NYVA 4JMUA 5KFDA 4EZ6A 2A19A 3GILA 5KT7A 4TURA 1SL2A 8ICIA 1J97A 5ALLA 4PHEA 3V6KA 4KLEA 2IBKA 1GO3F 2FPKA 5GTHU 2UVRA 4QZFA 3RBEA 1L3UA 4NWIA 1NZBA 1D8LA 2AQ4A 4RQ4A 4ED3A 1BPXA 2IOHA 1KKXA 4YMNA 3ZD9A 2V9WA 2LYBA 4KLMA 1PVRA 3EW9A 4E0DA 2KMDA 5DB9A 5IINA 4LZGA 3Q8RB 2XO7A 8ICJA 3SAGA 8ICVA 3ZI4A 3FYHA 1JI7A 1B4FA 3SR6A 4J9OA 4FS1A 2NO5A 3NVZA 1L3TA 3ORYA 3CNHA 1H38A 5HR6A 2RQ5A 2W7PA 3BS5B 1OXJA 2ZUDA 2AXTU 3QNMA 3F53A 4UAUA 4UB6U 5IIKA 4DSEA 4YXJA 3B0YA 5EWEA 4P4PA 3V7LA 1L5UA 4ECRA 1NJWA 4U7CA 4KN7A 3QU4A 5AM2A 2G06A 3IP4B 2JHDA 1RZTA 2BZFA 3C28A 4NM2A 2GOLA 3WK7A 4PJ0U 3Q8LA 8ICTA 1ZQCA 1SZPA 2P35A 5ALIA 3BQ7A 3H7IA 1TVAA 3Q8PB 5J0YA 4EX6A 7ICHA 1X66A 2W9BA 1IM4A 3H8WA 4QWAA 5D49A 2ISPA 1X9XA 3QZ7A 1F0MA 2WTFA 2B0CA 2PKEA 3QUBA 4Y2SA 1NOMA 2A1JB 1L7NA 1K1QA 1KFTA 2F1IA 1S76D 2OXOA 4OJ6A 4Q8FA 5CR0A 1XWLA 3UMCA 1HJPA 5EWFA 3VCBA 2KZMA 2BPGA 1XO0A 1NKBA 2RLTA 5J0UA 4PHAA 4B9NA 1KW4A 8ICLA 4ECUA 3NRWA 4DQQA 1NK9A 2BCQA 3RB6A 5KG5A 5DG8A 4CCHA 3KKAC 2Q0ZX 3H8JA 4MFAA 3CYMA 1ZQJA 2IA6A 4ECZA 1MSWD 2WF6A 2DKXA 3KKAA 5EE1A 3C1ZA 4FS2A 3ETRA 5DG7A 1L7OA 3TANA 3PW0A 5KFHA 4YR2A 1ZQDA 1QQ5A 2M0NA 2I6XA 3TADC 3HW8A 1WYGA 3TADA 1MN8A 2J6SA 9ICOA 2MAXA 3V7KA 1XS9D 2YX8A 1ZQLA 2R8HA 4RQMA 4ECTA 1QQ6A 2HOQA 5BOMA 5CEHA 4Q8EA 3KHHA 4JWNA 2YMMA 5HHIA 2ZIUB 5HMMA 2KFZA 1DRGA 5KT2A 1BPDA 1ZQPA 1CUKA 2DGZA 4TUPA 2HHQA 3E2EA 5KFNA 2WF5A 2JR5A 1RXWA 2F1JA 2W3SA 3AQFA 2H3FA 3T3FA 1NK0A 2HMXA 2KJ9A 3UMBA 4YQWA 2ZIWA 4R64A 2IHMA 2OM6A 3OSNA 2WHEA 4QZ9A 3GV7B 3C1YA 4KLJA 4WJ3B 1TAUA 3H4DA 4BXOA 1SWWA 3S6JA 4DFJA 2VA2A 3PW5A 4I2DA 4M0AA 2E8MA 2KKPA 4QZHA 4GXJA 3RRGA 3I28A 4R66A 2Z7JA 5J2HA 5KT5A 1X6IA 5ALEA 3U26A 9ICCA 5JUMA 3VC8A
chains in the Genus database with same CATH topology
2OH2A 2F76X 2HBMA 3NUQA 2K8AA 4IC9A 2K4HA 2Q4TA 4NV0A 2VKQA 3ALRA 4OJPA 3GZFA 4BJQA 2WB1F 3CYMA 1OUQA 3SAGA 1Z1BA 2VIXA 3M6ZA 2HBJA 4QIWF 5T14A 2LYAA 2W03A 3F2BA 1PVPA 2KV2A 2LHTA 2F8LA 2G5HB 2ZXIA 2GH1A 3HKZF 3IG5A 3KZXA 4P0QB 2KIWA 1HEKA 2WAQF 1T94A 2K4IA 3OPXA 5CRXA 2KJ5A 4KX3A 2F77X 2M0NA 1URJA 3KFUF 5HR6A 5KL8B 4OJOA 1L6NA 4FZLA 3DEEA 2JGAA 2W7PA 4CRXA 1UPHA 4QJFB 1KBUA 2HOFA 3GU3A 3ONNA 4BUGA 5KL1B 4CDGA 4KX5A 3AL0B 2K8CB 4AYBC 3CP8A 2NV3A 4ICAA 2YX8A 2G5IB 2K4EA 3L3FX 2KEYA 3D2QA 3LYSA 3MGVA 2N1RA 2K8BB 2WB1C 2XI9A 2H3VA 2Y0SC 2KOBA 3F53A 4NLCA 2HOQA 4U6PA 1ED1A 2DQNB 4QIWC 2E1EA 2BDUA 4KMOB 2W04A 3HKZC 2H3QA 2JH7A 2ZXHA 2XICA 1WUDA 2XIDA 2ZIUB 4P0QA 3IG8A 2WAQC 3K1ZA 2OYYA 2VJ5A 3AQEA 3PSTA 2G06A 3IP4B 2LBOA 1DRGA 1XNSA 2ZIUA 3O0FA 1F44A 2JHDA 3RF9A 3CRXA 4PL1A 2CN1A 3N7RC 2CPRA 3H0LB 4QNLA 2DGZA 3T79A 2CRXA 3SMVA 2G07A 4GFJA 2PMZF 4U7CA 3PZPA 3PSIA 3C28A 2HBLA 2H3ZA 1ZQ1C 1Q3VA 2G0AA 3SAFA 2GOLA 4A8EA 1A6SA 1HIWA 2HOIA 2ZIVB 3N7PD 2ZIXB 4O3MA 2LKYA 2KICA 2KVCA 2E5SA 2ZIVA 1Z19A 2ZIXA 3N7SC 2RHFA 3H0RB 3AQFA 2H3FA 2F2AB 2ZIWB 2KD1A 2HMXA 2KJ9A 2ZIWA 3LVVA 4OJLA 3IN5A 2D6FC 1D8BA 2OM6A 2G08A 2JMGA 3F5EA 3C29A 3F2DA 4JMUA 1PVQA 3SAHA 3M6KA 1IIPA 2K89A 1ECWA 4PL2A 4WJ3B 2DF4B 1P7DA 5HR7A 1MA7A 3E0FA 4FE3A 4AYBF 3PSPA 3M7DA 2R18A 4OJ5A 3D2NA 2PMZC 4FZMA 1A0PA 2JH1A 2OXOA 1GO3F 2RP5A 2Y0SF 4OJ6A 2XVTA 5A0LA 1Q3UA 3D2SA 2KHQA 2KKVA 2ZG6A 2H3IA 3H0MB 1SZHA 3ICXA 4NWIA 1NZBA 3PSFA 2HBKA 4FZNA 4BX9C 4OO1J 4P0PB 2KNJA 2KKPA 3VCBA 2YB4A 2G09A 2E1FA 3LVWA 1XO0A 4P0PA 2MA1A 2VJ4A 2KHVA 1CRXA 2LYBA 4ACOA 3F5AA 3F2CA 1YT3A 4CGZA 2YB1A 2A3VA 4NLBA 2RRDA 5C0YA 3RFAA 2Z7JA 2W7OA 2KJ8A 1TAMA 4C0ZA 2MRLA 1PVRA 3SQIA 3NRWA 3VC8A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3SAF A;  2HBM A;  4CDG A;  1GO3 F;  3CYM A;  3SAG A;  4O3M A;  2HBJ A;  2HBK A;  4QIW F;  2KV2 A;  4NLC A;  2RHF A;  4OO1 J;  2E1E A;  2E1F A;  2MA1 A;  1D8B A;  1WUD A;  4CGZ A;  1YT3 A;  3SAH A;  5C0Y A;  4NLB A;  2RRD A;  2CPR A;  2DGZ A;  4QJF B;  2HBL A; 
#chains in the Genus database with same CATH topology
 4R63 A;  2F76 X;  5AM1 A;  2ZUC A;  2YMQ A;  1L3V A;  4RQ1 A;  3FDS A;  3HP6 A;  1Z00 A;  1WG8 A;  5KFJ A;  2KTQ A;  3HKZ F;  4NY8 A;  5KFX A;  5J29 A;  4UB4 A;  2OWO A;  2F8K A;  4EX7 A;  3E58 A;  4JV1 A;  3ISB A;  2K8C B;  4ICA A;  4LZD A;  3UXO A;  1ZYQ A;  1ZQB A;  2LM1 A;  4KLI A;  3ED5 A;  3IHQ B;  5F3X B;  3RH4 A;  1LB2 B;  3GDX A;  4M9G A;  1WUD A;  1JX4 A;  4P0Q A;  3JPT A;  2MU2 A;  1KSP A;  5KFT A;  2KSO A;  3H0L B;  3T79 A;  3SZ2 A;  2G07 A;  5BOL A;  3FAH A;  4QZC A;  4J03 A;  2HHW A;  3B9J A;  4DQR A;  3PMN A;  2HSZ A;  2E5S A;  3R9K A;  2W9B B;  2F2A B;  2KG5 A;  3GIK A;  3LVV A;  4IRC A;  2AHO B;  1TFR A;  3LK9 A;  2BHN A;  1C20 A;  3TFR A;  1MQ3 A;  3EPI A;  1ECW A;  1IV8 A;  1UCV A;  2DUY A;  4TQS A;  2QAR A;  5J0T A;  1VLB A;  2KHQ A;  1K1S A;  3JPP A;  1SZH A;  3RJJ A;  3K1R B;  3FC4 A;  2VJ4 A;  3BQ2 A;  4O3Q A;  1JMS A;  1BPZ A;  2FJ6 A;  5L1K A;  3M9O B;  4DS4 A;  1BPB A;  2OH2 A;  5AI0 A;  1Z1B A;  1YZ6 A;  2AU0 A;  4EZ9 A;  1RDF A;  2LI6 A;  4DOC A;  1PK1 B;  3ISC A;  4J9M A;  8ICQ A;  1S0V A;  4DQS A;  4XA5 A;  3RBD A;  1N2X A;  2DL0 A;  5ALJ A;  4EEN A;  2ODG A;  3WKE A;  1AQ6 A;  2EDU A;  2B21 A;  4BUG A;  5DQG A;  8ICN A;  2G5I B;  2HHX A;  8ICU A;  5JU5 A;  2K8B B;  4C7Z A;  1JRP A;  1PUZ A;  2W8L A;  4UB5 A;  3GV8 B;  2LBO A;  3MDC A;  2BDP A;  5EWG A;  1U4B A;  5AI5 A;  4ED6 A;  1ZQT A;  3NAS A;  2HBL A;  1ZQ1 C;  2XC9 A;  2AH5 A;  4O3S A;  3AU2 A;  5CJ7 A;  1ZRN A;  1O03 A;  8ICG A;  1ZQA A;  4O3R A;  2RHF A;  2ZIW B;  1S9F A;  1UA1 A;  1N5X A;  1ZQM A;  5ALZ A;  1ZJM A;  4TUS A;  5AM0 A;  3BJY A;  1RYR A;  5J2I A;  2JEJ A;  4UB1 A;  4BXO B;  3SV3 A;  3T5H A;  1WCL A;  3PW4 A;  1QH9 A;  1ZQK A;  2ZJ5 A;  2Y9T A;  2ATL A;  4FZM A;  3WKA A;  4KIT B;  2BQU A;  3RAQ A;  3H0M B;  3WKB A;  3RTV A;  2FDR A;  2IOF K;  4BWJ A;  3RR7 A;  4QZB A;  4I28 A;  2BCR A;  3N4M B;  4NM1 A;  3AU6 A;  1LV5 A;  2EAM A;  2I9G A;  9ICQ A;  4P4O A;  4J9N A;  1KRP A;  2BR0 A;  2KV2 A;  1D8Y A;  1ZQH A;  4QZA A;  4IRD A;  3G6X A;  5ALS A;  1KN5 A;  4RT2 A;  5J2J A;  3IM1 A;  4TUQ A;  3KFU F;  1NK5 A;  3M9N B;  1KBU A;  2J6U A;  1NK7 A;  3QUQ A;  5KT4 A;  8ICH A;  4GXK A;  2JXJ A;  5AI9 A;  1SIJ A;  5KFA A;  1Z1V A;  7ICV A;  4ED2 A;  5J0S A;  4K4H A;  2W04 A;  5KFZ A;  4RZR A;  9ICN A;  5KFY A;  5L1M A;  2KSO B;  3PST A;  1RYS A;  4KLD A;  3KD3 A;  4QNL A;  2XCA A;  2FMS A;  1T7P A;  4ELT A;  2PMZ F;  3PSI A;  5KFK A;  2KN7 A;  2G0A A;  2V4Q A;  4RU9 A;  3ZDB A;  4B9M A;  9ICK A;  4KMU A;  2W43 A;  2VAN A;  2DFL A;  1XC9 A;  3SD7 A;  1L3S A;  3JPN A;  1FEZ A;  2O6K A;  2K89 A;  1Z4N A;  1JRO A;  2QAR B;  1N61 A;  4NLG A;  1S97 A;  5AIA A;  2HBK A;  8ICA A;  3OGU A;  2DPI A;  5ALU A;  4I2G A;  5F9N A;  1X40 A;  2E1F A;  1ZQS A;  4FO6 A;  3PR4 A;  4KLG A;  2NO4 A;  4UAV A;  5AKJ A;  1S8O A;  4CGZ A;  2A3V A;  1RM6 C;  2KJ8 A;  9ICL A;  2FPL A;  3I1Y A;  1X2I A;  4EYI B;  4PGY A;  2JRZ A;  5IIO A;  2VKQ A;  4DL5 A;  4MFC A;  2AJQ A;  2P6U A;  3AEV A;  4TQR A;  1VJ5 A;  3PW7 A;  2KIW A;  4M9H A;  4DFP A;  1YZ7 A;  8ICF A;  3HT3 A;  1QTM A;  2AQ0 A;  1B22 A;  5KFC A;  1BPE A;  3ONN A;  1UA0 A;  5GTI U;  1Y88 A;  3N28 A;  4AYB C;  2R8I A;  4Y2Q A;  2Y0S C;  4R8U B;  2XGQ A;  5J2A A;  2DQN B;  5EE9 A;  3M8S A;  3QU5 A;  4M6W B;  4KLO A;  2OEH A;  3V7J A;  9ICE A;  5ALH A;  3QEA Z;  4PL1 A;  1HUO A;  5HML A;  4F4X A;  2WF9 A;  3UM9 A;  5ALM A;  3LDA A;  3KTQ A;  2Y1J A;  1ZQG A;  1D9D A;  1HIW A;  2QKQ A;  3N7P D;  3T5J A;  2IMW P;  4US8 A;  1WWU A;  4F4K A;  5KG1 A;  4MHV A;  4YMO A;  2C2R A;  2IHN A;  2F1H A;  5D4B A;  2F44 A;  1MA7 A;  2YML A;  3PSP A;  2R18 A;  5D46 A;  3D2N A;  1FFU A;  5JTI A;  4UW9 A;  3KHR A;  1SWV A;  5AIB A;  4DWI A;  3MDA A;  7ICQ A;  5CP2 A;  1QQ7 A;  4BX9 C;  4F91 B;  4ZOH C;  4DCC A;  5ALO A;  2KNJ A;  2KHV A;  3Q8M A;  4RUA A;  4ELV A;  3F2C A;  5DB8 A;  4RQ7 A;  1UT5 A;  1TAM A;  4UBC A;  4UAW A;  5III A;  1COK A;  1QSY A;  4F3O A;  1TKD A;  4RPX A;  4LJX A;  7ICL A;  4F5Q A;  1NJZ A;  3RH5 A;  3OSP A;  3QU2 A;  4QIW F;  2LYA A;  3QU9 A;  2MSN A;  2FE9 A;  4I2H A;  3RAX A;  1JXL A;  5KFI A;  5CRX A;  1NI3 A;  1S10 A;  3BQT A;  2OCE A;  4OJO A;  4GIB A;  4ECX A;  3EWA A;  5AI6 A;  4RQ0 A;  3AL0 B;  3CP8 A;  2KEY A;  5AKL A;  3OJS A;  1T3N A;  9ICW A;  1NJX A;  1PK1 A;  4ED0 A;  3AQE A;  5DGB A;  4DFM A;  4ELU A;  1VDV A;  2GLE A;  5J0Q A;  4NLZ A;  2QB1 A;  4GFJ A;  9ICB A;  3V6J A;  2R8K A;  1X6J A;  3GII A;  3GIJ A;  4I29 A;  5KTQ A;  2W54 A;  3MR6 A;  4CF3 A;  1N5W A;  2F3N A;  4DF8 A;  4Y2Y A;  4I2F A;  4F71 A;  3IN5 A;  1T4G A;  4DEZ A;  4RNM A;  5DB6 A;  8ICS A;  4DL2 A;  4DL6 A;  4PL2 A;  4Y2R A;  4QZ8 A;  2DF4 B;  3A0B U;  1J2N A;  1A0P A;  4K4G A;  2HHV A;  1UQV A;  2ASJ A;  3SEI A;  4IR1 A;  3PV8 A;  5KT3 A;  3WKD A;  4NLK A;  3F5A A;  5C0Y A;  4DLG A;  3RJI A;  2W7O A;  1DXS A;  3SQI A;  1IG6 A;  1ZET A;  1KFD A;  3NUQ A;  2XCP A;  4OD0 A;  7ICI A;  2BQ3 A;  5AK4 A;  4F8R A;  2W03 A;  1A77 A;  4IL6 U;  4F5O A;  1PVP A;  2F8L A;  5AI4 A;  3EZ5 A;  3JPQ A;  4B9S A;  1HEK A;  2HHU A;  2EQY A;  1T94 A;  5EE0 A;  4PZO A;  2KE7 A;  1JXE A;  3C5G A;  3LWM A;  3QU7 A;  2MUT A;  5IIL A;  2JGA A;  4CRX A;  2HOF A;  5ALW A;  4FFD A;  4M47 A;  4KX5 A;  2L5Y A;  3HRD D;  2N1R A;  2XI9 A;  3GV5 B;  2Y9U A;  4I2C A;  2E1E A;  4EYH B;  2JH7 A;  2PXI A;  2XID A;  4O5K A;  3NTU A;  5ALN A;  4I2J A;  4YN4 A;  3RB3 A;  2LPE A;  2CN1 A;  5KFQ A;  5ALR A;  2K4P A;  4UAZ A;  4OCZ A;  3V72 A;  1KEJ A;  5J0P A;  4ECV A;  4F5R A;  4QZE A;  5CHG A;  1ZQE A;  2ALZ A;  2JMG A;  3C29 A;  1SKW A;  2A1A A;  5J0O A;  2B6G A;  2DBY A;  5CB1 A;  3MR2 A;  1P7D A;  3E0F A;  1TV9 A;  3RJH A;  2FLP A;  5AKZ A;  3D6J A;  2H3I A;  2R8G A;  4C4S A;  2NRT A;  5KG0 A;  3ZDE A;  2NRX A;  4GC7 A;  2XY5 A;  4DSJ A;  4ED7 A;  4OO1 J;  3QEB Z;  1RQL A;  3LVW A;  4P0P A;  3PX6 A;  3GIM A;  2E8P A;  8ICZ A;  5JRT A;  3MR5 A;  4C8K A;  5J2C A;  2XGP A;  2J6T A;  1SV4 A;  2MRL A;  4DQI A;  1ZD3 A;  3GZF A;  2WB1 F;  5DGA A;  5J0W A;  8ICB A;  1F5S A;  4DFD A;  3SV4 A;  3MFI A;  1MQ2 A;  2D3D A;  2RDI A;  4C80 A;  1N56 A;  2F77 X;  2PI5 A;  4KLU A;  4X5V A;  2JEF A;  2EAN A;  3GFK B;  1U45 A;  3K75 D;  3QUC A;  5KFS A;  5EOZ A;  5G5H A;  3TKA A;  3MGH A;  3MGV A;  4O3N A;  4I2B A;  4U6P A;  1ZQW A;  1ZRM A;  2JEG A;  3HKZ C;  2QB0 A;  5KFW A;  4C4R A;  3O0F A;  3PO4 A;  3RB4 A;  3SEN A;  5AKG A;  3AN1 A;  2VA3 A;  3TAC B;  1A6S A;  4ECQ A;  3MBY A;  3WKC A;  1DK2 A;  1Z19 A;  3KOO A;  2ZIX A;  3FM9 A;  3H0R B;  2KP7 A;  3SI8 A;  1TE2 A;  2KD1 A;  3OJU A;  1RG6 A;  4R8U A;  4RQ5 A;  5ALT A;  1SV0 A;  4RQ6 A;  1BNP A;  1D8B A;  3F5E A;  4M6W A;  5ALK A;  1IIP A;  5KG7 A;  3HJE A;  1NJY A;  4OJ5 A;  4CNQ A;  4DSF A;  1LVH A;  2JH1 A;  2XVT A;  3H4B A;  2KKV A;  4J9R A;  4DL7 A;  2KZZ A;  7ICR A;  4UBB A;  1Q46 A;  1QSL A;  3MC1 A;  4Y2P A;  5KAI U;  4M9L A;  3G6Y A;  1CRX A;  1RQN A;  2YB1 A;  2HVH A;  1KL9 A;  7ICN A;  3WK5 A;  4DSL A;  4IR9 A;  2HBM A;  4XQ8 A;  1ZQI A;  3RJG A;  1SKR A;  2C2E A;  5L1L A;  4AP9 A;  1U47 A;  4BWM A;  4BDP A;  2G5H B;  4DL4 A;  1SGG A;  3OHB A;  2NRZ A;  3BS7 A;  2WAQ F;  1ZJN A;  3OPX A;  2CXY A;  2BCS A;  2GWS A;  4QWD A;  1TK5 A;  4M2Y A;  2MUT B;  2DWQ A;  3ETL A;  1KLN A;  1O08 A;  9ICA A;  4FZL A;  4YVZ A;  3DEE A;  1RYU A;  4JV0 A;  4NL9 C;  1LKY A;  4RQ8 A;  3THV A;  4IQU A;  3C5F A;  3UXP A;  4NL9 A;  3Q8S B;  2IOF A;  4QWE A;  1XU4 A;  1BVS A;  5AK6 A;  4UAT A;  5H2F U;  2BDU A;  4KMO B;  4Y2J A;  1RPL A;  1Q3U A;  2OYY A;  4BGD A;  2BCV A;  3N7R C;  2CPR A;  3SMV A;  3EUB 2;  2XY6 A;  5DBB A;  3TAR A;  1XO1 A;  3DV9 A;  4F72 A;  1L8O A;  5KG4 A;  2ISO A;  3MFH A;  3OHA A;  1X9W A;  3H40 A;  7ICJ A;  2ZIV A;  4KLL A;  3TI0 A;  2NRV A;  3HIL A;  4RQ2 A;  4US9 A;  2WF7 A;  4Z6D A;  5ALD A;  4Z6E A;  4AYB F;  4J9K A;  2C28 A;  1N48 A;  2RP5 A;  4PZN A;  5A0L A;  2Y0S F;  3D2S A;  4O0I A;  4HYK A;  4QZD A;  5EE3 A;  2ZTE A;  4P0P B;  5KFM A;  4YFK A;  2FI1 A;  3ISD A;  4MF8 A;  5J2F A;  5KNI A;  3RR8 A;  2P66 A;  2JZB B;  2WF8 A;  2RRD A;  1BNO A;  3NRZ A;  2KFN A;  4C8M A;  1Z3E B;  3KBB A;  2K4H A;  3C23 A;  1ZQQ A;  2VA8 A;  4UAR A;  1KDH A;  3L5K A;  1FFV A;  2DPJ A;  3SYZ A;  4ECY A;  3M6Z A;  3ZDD A;  2FMP A;  3NVY A;  1JN3 A;  3KZX A;  3IRU A;  4UB8 U;  2W55 A;  2K4I A;  2KJ5 A;  5DB7 A;  4YR3 A;  1X9M A;  1UT8 A;  4J9S A;  1C7Y A;  5B66 U;  4KLF A;  5KL1 B;  3PVX A;  3LWL A;  1FIQ A;  4QW8 A;  2QB0 B;  1U49 A;  2YQE A;  2XIC A;  5J2D A;  1ZOL A;  2VJ5 A;  1F44 A;  1ZQO A;  4QWB A;  1NK8 A;  1CEZ A;  4DO9 A;  3WU2 U;  1CI4 A;  1ZQR A;  5ALP A;  1HUZ A;  2YTU A;  3Q8K A;  2ZIX B;  4MEY A;  5AKY A;  2LKY A;  4DQP A;  2LYH A;  1L7M A;  4PHP A;  4DLE A;  4EBE A;  8ICW A;  2H5X A;  5J0X A;  8ICX A;  2ES6 A;  3C2L A;  1PVQ A;  5IIJ A;  3IDW A;  3BQ1 A;  5K4L A;  3M8R A;  1B43 A;  5AKI A;  2XY7 A;  3K4G A;  3BZK A;  3M7D A;  2FLL A;  4C4T A;  2PMZ C;  3ZDA A;  4DSK A;  5KFU A;  4Y2V A;  3PR5 B;  4F5P A;  4F92 B;  7ICP A;  3PSF A;  4F4Y A;  5DQI A;  2BPF A;  4KLQ A;  1S5L U;  4GC6 A;  1YT3 A;  3RFA A;  4MF2 A;  5AKH A;  3M9M B;  3EYZ A;  3C21 A;  4UAY A;  4K4I A;  2HW3 A;  3NVV A;  4BJQ A;  4YD2 A;  1OUQ A;  4HAI A;  2HBJ A;  5T14 A;  3F2B A;  5DQH A;  4YR0 A;  1XSL A;  5ALV A;  3CW2 C;  3TQ1 A;  4KLH A;  4YP3 A;  4DL3 A;  8ICC A;  4RPZ A;  5C5J A;  4G3I A;  4I2E A;  2NRW A;  2YY6 A;  1LKY B;  4RT3 A;  3TFS A;  3J81 j;  2HHT A;  1RXV A;  2H3V A;  4F93 B;  4MEX A;  3DDH A;  5L9X A;  2WFA A;  1N63 A;  5KFV A;  4RNO A;  3IG8 A;  4YXM A;  5KFE A;  3I76 A;  1XNS A;  2CRX A;  1COO A;  2FPM A;  1NKE A;  5KT6 A;  1SXD A;  3UMG A;  1EXN A;  1U48 A;  2PI4 A;  4PGX A;  1ZQN A;  1SL1 A;  5KG6 A;  2KK0 A;  4O3O A;  4EEY A;  2ZIV B;  5KFP A;  5HNK A;  2W9C A;  2PFN A;  7ICM A;  1XSP A;  4RPY A;  2KIC A;  2KVC A;  5CA7 A;  4O5C A;  1IXR A;  3RH6 A;  3PY8 A;  3PNC A;  3NS1 A;  4Z6F A;  1S0M A;  2PFP A;  3NVW A;  4J9P A;  9ICX A;  4RUC A;  9ICP A;  2FMQ A;  3ZDC A;  4I27 A;  4F4W A;  1MC8 A;  4ZH4 A;  1QLN A;  3AMZ A;  3HWT A;  4ECS A;  2C22 A;  3ICX A;  1S77 D;  8ICO A;  3T5L A;  9ICR A;  1X42 A;  2ZJA A;  1ZQZ A;  3BQ0 A;  3QX7 A;  2QLT A;  9ICU A;  8ICR A;  3QXG A;  5KG2 A;  4O9M A;  2R8J A;  2W3R A;  2EH9 A;  4NLN A;  2Q4T A;  1X9S A;  3GQC A;  3L4P A;  1V85 A;  5ALF A;  9ICV A;  5G5G A;  4B9U A;  4Y2T A;  4JB3 A;  8ICM A;  2ZXI A;  2ESE A;  1D9F A;  3OTQ A;  3MGI A;  4JK1 A;  3WK4 A;  1WCN A;  5KFF A;  3Q8Q B;  1ZQF A;  9ICG A;  3BZC A;  5J0R A;  1TAQ A;  4G9B A;  1WWV A;  2EZY A;  3GU3 A;  4M9N A;  1BGX T;  1KFS A;  3A0H U;  3BDP A;  1L7P A;  2NV3 A;  4F5N A;  2D8C A;  2EZZ A;  3TAP A;  4NLC A;  5HHH A;  4QIW C;  5HP4 A;  2EAP A;  2C2D A;  1JIH A;  4J9L A;  4RQ3 A;  1B0X A;  8ICK A;  7ICK A;  5DBC A;  3PZP A;  2H3Z A;  3WK8 A;  4Y2U A;  4A8E A;  2LMR A;  4RNN A;  2HOI A;  4F50 A;  5DKW A;  2ASL A;  4O3M A;  7ICU A;  8ICE A;  4DOA A;  4DFK A;  1V38 A;  4OJL A;  5AI8 A;  5FP0 A;  5B5E U;  5AK5 A;  4UB2 A;  2G08 A;  5AK3 A;  4GXI A;  1Z4O A;  2I1Q A;  4PPX A;  2JV3 A;  2BCU A;  1ZQU A;  2KIV A;  4DF4 A;  1S0N A;  4RQN A;  4XRH A;  3G6V A;  4Q45 A;  1JAL A;  4FBU A;  2V4R A;  3MR3 A;  4JV2 A;  2EAO A;  4M9J A;  1NZP A;  4ED1 A;  1FO4 A;  2W9M A;  1NKC A;  2K8A A;  5AKX A;  4F4Z A;  4OJP A;  3ALR A;  5KFO A;  4C7Y A;  4O5E A;  4USA A;  1Q8K A;  5DDM A;  1DOQ A;  4NJ8 A;  4F2S A;  4O3P A;  3B0X A;  5F9L A;  4QZI A;  2HVI A;  2LM4 A;  1URJ A;  2M9N A;  4GLX A;  2JZB A;  3C2M A;  4CF5 A;  2E3T A;  4CDG A;  1XSN A;  1QCK A;  3JPS A;  4Z6C A;  4IS7 A;  5DDY A;  4P2H A;  1KTQ A;  3MAB A;  5J2B A;  7ICO A;  9ICF A;  2H3Q A;  1TK0 A;  3KZI U;  1KQQ A;  1JUD A;  1N60 A;  4C8L A;  3RF9 A;  5J2K A;  3T5K A;  2OHF A;  2W9A A;  1K5O A;  2ZTD A;  2W9C B;  2E8N A;  5AKK A;  4CE6 A;  3RJK A;  4Y2X A;  2BGW A;  3KHL A;  2EZX A;  9ICH A;  5ALQ A;  1ZQX A;  3SAH A;  5ALY A;  3M6K A;  4KLT A;  4IQT A;  5HR7 A;  2YMP A;  4FE3 A;  1NK6 A;  3N97 B;  3ZD8 A;  5AIC A;  3WK9 A;  5J8Y C;  2ZG6 A;  2K60 A;  2W8K A;  2UVW A;  5DG9 A;  3AUO A;  4FZN A;  1PK3 A;  1SV0 C;  5J8Y A;  3IV6 A;  2DKZ A;  2YB4 A;  2G09 A;  4LVS A;  2MA1 A;  5AKE A;  5DLF A;  7ICT A;  2AGO A;  4ACO A;  1V9P A;  4NLB A;  4JWM A;  3KHG A;  4YMM A;  3QUT A;  1ARO P;  4EBD A;  5CWR A;  4IC9 A;  2E8O A;  4NV0 A;  1A76 A;  1M6Y A;  1SB3 C;  2BPC A;  2VIX A;  5E79 U;  4DOB A;  1N62 A;  4EBC A;  2LHT A;  1OW5 A;  2KVS A;  3H8S A;  4I2A A;  2ZTC A;  9ICI A;  9ICS A;  2GH1 A;  2FLN A;  2GO7 A;  3IG5 A;  7ICG A;  1BPY A;  5ALX A;  4NXZ A;  3NGD A;  4PGQ A;  7ICE A;  2RDJ A;  2UVU A;  4FBT A;  4YG2 A;  3QZ8 A;  1UPH A;  4QJF B;  4CF4 A;  3BS5 A;  5ALG A;  2AGP A;  3L3F X;  4I2I A;  3D2Q A;  3LYS A;  2WB1 C;  5L1I A;  4M04 A;  4IQV A;  3PX4 A;  1ED1 A;  2PFQ A;  1ZD2 P;  2ZUB A;  1NK4 A;  2ZXH A;  8ICY A;  3RRH A;  3K1Z A;  5KFG A;  4XUS A;  3RJE A;  3EPG A;  1NNL A;  1QSS A;  3UPQ A;  5DBA A;  3V6H A;  3SAF A;  4KLS A;  1DK3 A;  5KFL A;  1PZN A;  4UB3 A;  4PHD A;  2KZ3 A;  3PO5 A;  5AHX A;  1T8E A;  1U9L A;  2UVV A;  4YD1 A;  4QWC A;  1SKS A;  3C2K A;  1ZXI A;  2AGQ A;  1ZQY A;  4J9Q A;  4C8N A;  2PFO A;  3F2D A;  4Q44 A;  2JEI A;  2P6R A;  5BPC A;  3QE9 Y;  2BQR A;  4B6J A;  2A1J A;  2ASD A;  3JPO A;  4QZG A;  3QYP A;  1ZD4 A;  5KFB A;  1Z00 B;  4KTQ A;  4B9T A;  3UXN A;  5AM5 A;  4C8O A;  1UHU A;  5TZV A;  4DSI A;  4P4M A;  2YN4 A;  5KFR A;  3WK6 A;  2BKE A;  2HHS A;  3M1Y A;  4DS5 A;  4C0Z A;  4F2R A;  3TAQ A;  1V97 A;  3RB0 A;  4UQG A;  3H8M A;  9ICM A;  3JPR A;  1TK8 A;  4QW9 A;  4ECW A;  1SXE A;  4IRK A;  2ZJ8 A;  4P0Q B;  1SL0 A;  4MFF A;  9ICJ A;  5J2G A;  5KG3 A;  1J2M A;  5L1J A;  7ICS A;  4UAS A;  3PML A;  3RJF A;  4KX3 A;  4PH5 A;  4B9L A;  5KAF U;  5KL8 B;  1L6N A;  1DGJ A;  5TIS U;  1DGS A;  4B9V A;  2HCF A;  4JUZ A;  2K4E A;  1T3Q A;  9ICT A;  2KOB A;  3PW2 A;  4EEK A;  4ED8 A;  4IQW A;  2Y1I A;  3PX0 A;  3CRX A;  2WAQ C;  3UQ0 A;  2HDO A;  2ZIU A;  7ICF A;  8ICP A;  1S0O A;  5AM3 A;  1Q3V A;  3AM9 A;  1ZD5 A;  4R65 A;  2W11 A;  3HX0 A;  5DLG A;  4EEL A;  4YCX A;  2I5H A;  5AM4 A;  3N7S C;  4KN4 A;  5J2E A;  2HI0 A;  5IIM A;  4Q43 A;  1ZQV A;  2D6F C;  3UQ2 A;  1L8L A;  3HPO A;  2NYV A;  4JMU A;  5KFD A;  4EZ6 A;  2A19 A;  3GIL A;  5KT7 A;  4TUR A;  1SL2 A;  8ICI A;  1J97 A;  5ALL A;  4PHE A;  3V6K A;  4KLE A;  2IBK A;  1GO3 F;  2FPK A;  5GTH U;  2UVR A;  4QZF A;  3RBE A;  1L3U A;  4NWI A;  1NZB A;  1D8L A;  2AQ4 A;  4RQ4 A;  4ED3 A;  1BPX A;  2IOH A;  1KKX A;  4YMN A;  3ZD9 A;  2V9W A;  2LYB A;  4KLM A;  1PVR A;  3EW9 A;  4E0D A;  2KMD A;  5DB9 A;  5IIN A;  4LZG A;  3Q8R B;  2XO7 A;  8ICJ A;  3SAG A;  8ICV A;  3ZI4 A;  3FYH A;  1JI7 A;  1B4F A;  3SR6 A;  4J9O A;  4FS1 A;  2NO5 A;  3NVZ A;  1L3T A;  3ORY A;  3CNH A;  1H38 A;  5HR6 A;  2RQ5 A;  2W7P A;  3BS5 B;  1OXJ A;  2ZUD A;  2AXT U;  3QNM A;  3F53 A;  4UAU A;  4UB6 U;  5IIK A;  4DSE A;  4YXJ A;  3B0Y A;  5EWE A;  4P4P A;  3V7L A;  1L5U A;  4ECR A;  1NJW A;  4U7C A;  4KN7 A;  3QU4 A;  5AM2 A;  2G06 A;  3IP4 B;  2JHD A;  1RZT A;  2BZF A;  3C28 A;  4NM2 A;  2GOL A;  3WK7 A;  4PJ0 U;  3Q8L A;  8ICT A;  1ZQC A;  1SZP A;  2P35 A;  5ALI A;  3BQ7 A;  3H7I A;  1TVA A;  3Q8P B;  5J0Y A;  4EX6 A;  7ICH A;  1X66 A;  2W9B A;  1IM4 A;  3H8W A;  4QWA A;  5D49 A;  2ISP A;  1X9X A;  3QZ7 A;  1F0M A;  2WTF A;  2B0C A;  2PKE A;  3QUB A;  4Y2S A;  1NOM A;  2A1J B;  1L7N A;  1K1Q A;  1KFT A;  2F1I A;  1S76 D;  2OXO A;  4OJ6 A;  4Q8F A;  5CR0 A;  1XWL A;  3UMC A;  1HJP A;  5EWF A;  3VCB A;  2KZM A;  2BPG A;  1XO0 A;  1NKB A;  2RLT A;  5J0U A;  4PHA A;  4B9N A;  1KW4 A;  8ICL A;  4ECU A;  3NRW A;  4DQQ A;  1NK9 A;  2BCQ A;  3RB6 A;  5KG5 A;  5DG8 A;  4CCH A;  3KKA C;  2Q0Z X;  3H8J A;  4MFA A;  3CYM A;  1ZQJ A;  2IA6 A;  4ECZ A;  1MSW D;  2WF6 A;  2DKX A;  3KKA A;  5EE1 A;  3C1Z A;  4FS2 A;  3ETR A;  5DG7 A;  1L7O A;  3TAN A;  3PW0 A;  5KFH A;  4YR2 A;  1ZQD A;  1QQ5 A;  2M0N A;  2I6X A;  3TAD C;  3HW8 A;  1WYG A;  3TAD A;  1MN8 A;  2J6S A;  9ICO A;  2MAX A;  3V7K A;  1XS9 D;  2YX8 A;  1ZQL A;  2R8H A;  4RQM A;  4ECT A;  1QQ6 A;  2HOQ A;  5BOM A;  5CEH A;  4Q8E A;  3KHH A;  4JWN A;  2YMM A;  5HHI A;  2ZIU B;  5HMM A;  2KFZ A;  1DRG A;  5KT2 A;  1BPD A;  1ZQP A;  1CUK A;  2DGZ A;  4TUP A;  2HHQ A;  3E2E A;  5KFN A;  2WF5 A;  2JR5 A;  1RXW A;  2F1J A;  2W3S A;  3AQF A;  2H3F A;  3T3F A;  1NK0 A;  2HMX A;  2KJ9 A;  3UMB A;  4YQW A;  2ZIW A;  4R64 A;  2IHM A;  2OM6 A;  3OSN A;  2WHE A;  4QZ9 A;  3GV7 B;  3C1Y A;  4KLJ A;  4WJ3 B;  1TAU A;  3H4D A;  4BXO A;  1SWW A;  3S6J A;  4DFJ A;  2VA2 A;  3PW5 A;  4I2D A;  4M0A A;  2E8M A;  2KKP A;  4QZH A;  4GXJ A;  3RRG A;  3I28 A;  4R66 A;  2Z7J A;  5J2H A;  5KT5 A;  1X6I A;  5ALE A;  3U26 A;  9ICC A;  5JUM A;  3VC8 A; 
#chains in the Genus database with same CATH homology
 2OH2 A;  2F76 X;  2HBM A;  3NUQ A;  2K8A A;  4IC9 A;  2K4H A;  2Q4T A;  4NV0 A;  2VKQ A;  3ALR A;  4OJP A;  3GZF A;  4BJQ A;  2WB1 F;  3CYM A;  1OUQ A;  3SAG A;  1Z1B A;  2VIX A;  3M6Z A;  2HBJ A;  4QIW F;  5T14 A;  2LYA A;  2W03 A;  3F2B A;  1PVP A;  2KV2 A;  2LHT A;  2F8L A;  2G5H B;  2ZXI A;  2GH1 A;  3HKZ F;  3IG5 A;  3KZX A;  4P0Q B;  2KIW A;  1HEK A;  2WAQ F;  1T94 A;  2K4I A;  3OPX A;  5CRX A;  2KJ5 A;  4KX3 A;  2F77 X;  2M0N A;  1URJ A;  3KFU F;  5HR6 A;  5KL8 B;  4OJO A;  1L6N A;  4FZL A;  3DEE A;  2JGA A;  2W7P A;  4CRX A;  1UPH A;  4QJF B;  1KBU A;  2HOF A;  3GU3 A;  3ONN A;  4BUG A;  5KL1 B;  4CDG A;  4KX5 A;  3AL0 B;  2K8C B;  4AYB C;  3CP8 A;  2NV3 A;  4ICA A;  2YX8 A;  2G5I B;  2K4E A;  3L3F X;  2KEY A;  3D2Q A;  3LYS A;  3MGV A;  2N1R A;  2K8B B;  2WB1 C;  2XI9 A;  2H3V A;  2Y0S C;  2KOB A;  3F53 A;  4NLC A;  2HOQ A;  4U6P A;  1ED1 A;  2DQN B;  4QIW C;  2E1E A;  2BDU A;  4KMO B;  2W04 A;  3HKZ C;  2H3Q A;  2JH7 A;  2ZXH A;  2XIC A;  1WUD A;  2XID A;  2ZIU B;  4P0Q A;  3IG8 A;  2WAQ C;  3K1Z A;  2OYY A;  2VJ5 A;  3AQE A;  3PST A;  2G06 A;  3IP4 B;  2LBO A;  1DRG A;  1XNS A;  2ZIU A;  3O0F A;  1F44 A;  2JHD A;  3RF9 A;  3CRX A;  4PL1 A;  2CN1 A;  3N7R C;  2CPR A;  3H0L B;  4QNL A;  2DGZ A;  3T79 A;  2CRX A;  3SMV A;  2G07 A;  4GFJ A;  2PMZ F;  4U7C A;  3PZP A;  3PSI A;  3C28 A;  2HBL A;  2H3Z A;  1ZQ1 C;  1Q3V A;  2G0A A;  3SAF A;  2GOL A;  4A8E A;  1A6S A;  1HIW A;  2HOI A;  2ZIV B;  3N7P D;  2ZIX B;  4O3M A;  2LKY A;  2KIC A;  2KVC A;  2E5S A;  2ZIV A;  1Z19 A;  2ZIX A;  3N7S C;  2RHF A;  3H0R B;  3AQF A;  2H3F A;  2F2A B;  2ZIW B;  2KD1 A;  2HMX A;  2KJ9 A;  2ZIW A;  3LVV A;  4OJL A;  3IN5 A;  2D6F C;  1D8B A;  2OM6 A;  2G08 A;  2JMG A;  3F5E A;  3C29 A;  3F2D A;  4JMU A;  1PVQ A;  3SAH A;  3M6K A;  1IIP A;  2K89 A;  1ECW A;  4PL2 A;  4WJ3 B;  2DF4 B;  1P7D A;  5HR7 A;  1MA7 A;  3E0F A;  4FE3 A;  4AYB F;  3PSP A;  3M7D A;  2R18 A;  4OJ5 A;  3D2N A;  2PMZ C;  4FZM A;  1A0P A;  2JH1 A;  2OXO A;  1GO3 F;  2RP5 A;  2Y0S F;  4OJ6 A;  2XVT A;  5A0L A;  1Q3U A;  3D2S A;  2KHQ A;  2KKV A;  2ZG6 A;  2H3I A;  3H0M B;  1SZH A;  3ICX A;  4NWI A;  1NZB A;  3PSF A;  2HBK A;  4FZN A;  4BX9 C;  4OO1 J;  4P0P B;  2KNJ A;  2KKP A;  3VCB A;  2YB4 A;  2G09 A;  2E1F A;  3LVW A;  1XO0 A;  4P0P A;  2MA1 A;  2VJ4 A;  2KHV A;  1CRX A;  2LYB A;  4ACO A;  3F5A A;  3F2C A;  1YT3 A;  4CGZ A;  2YB1 A;  2A3V A;  4NLB A;  2RRD A;  5C0Y A;  3RFA A;  2Z7J A;  2W7O A;  2KJ8 A;  1TAM A;  4C0Z A;  2MRL A;  1PVR A;  3SQI A;  3NRW A;  3VC8 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...