2E1FA

Crystal structure of the hrdc domain of human werner syndrome protein, wrn
Total Genus 33
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
33
sequence length
94
structure length
94
Chain Sequence
QPVISAQEQETQIVLYGKLVEARQKHANKMDVPPAILATNKILVDMAKMRPTTVENVKRIDGVSEGKAAMLAPLLEVIKHFCQTNSVQTDLFSS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Crystal structure of the HRDC domain of human Werner syndrome protein, WRN
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase
molecule keywords Werner syndrome ATP-dependent helicase
total genus 33
structure length 94
sequence length 94
ec nomenclature ec 3.6.4.12: DNA helicase.
pdb deposition date 2006-10-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00570 HRDC HRDC domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.80 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 DNA polymerase; domain 1 2e1fA01
2E1FA 2CPRA 2HBKA 2RHFA 3SAGA 4OO1J 4NLBA 2KV2A 2DGZA 2HBLA 4QIWF 4CDGA 4NLCA 3SAFA 1YT3A 4CGZA 3SAHA 2E1EA 1WUDA 2HBMA 1D8BA 4QJFB 1GO3F 3CYMA 4O3MA 2RRDA 2MA1A 5C0YA 2HBJA
chains in the Genus database with same CATH superfamily
3ETLA 3H40A 8ICCA 3QUTA 1SKWA 1DOQA 5DGBA 2DUYA 3F5EA 4UATA 3RRHA 2J6SA 3K1RB 3PW5A 3T5HA 1PK3A 3F2BA 4JMUA 3NVWA 4C8OA 2RDJA 1ZRMA 2KEYA 2BGWA 4O5CA 3HRDD 2B21A 5KG2A 4JV1A 4ED3A 4BUGA 4J9SA 2CN1A 1P7DA 4UB6U 2ZXIA 4O0IA 4YCXA 4DQRA 1PUZA 5KT4A 5J8YA 2ZTEA 3WKDA 2VKQA 4Y2PA 2BCRA 1UCVA 1ZQDA 3QU2A 2A19A 2ATLA 3WU2U 3OGUA 2PFOA 3QX7A 3BQ7A 3FAHA 1WYGA 3OTQA 4F4XA 4ED0A 2A1JB 3OHBA 5CRXA 4RPZA 3H7IA 4CCHA 4KMUA 1ZD3A 3PSFA 3ISCA 5AI4A 2ZIWB 4DFPA 3ZDBA 2ZIXA 2WB1C 3ZI4A 2B0CA 8ICZA 3KHRA 1ZQEA 2WHEA 2LYBA 1OUQA 4KN7A 4ECQA 2G0AA 3V7LA 1WCNA 4PH5A 1A77A 2DKXA 4QZGA 1D8YA 4YD2A 3TQ1A 1XU4A 1X9XA 2HBKA 1ZQMA 1KFSA 8ICUA 1ECWA 4C4SA 3IP4B 4EBDA 1ZQOA 2KZMA 4NM2A 4FBTA 1X66A 4GLXA 1SWWA 3WK4A 1UT5A 1NOMA 2E8MA 2JR5A 1L7OA 2R8IA 3S6JA 4BDPA 3RJKA 3UM9A 4QZHA 1UHUA 4QZ9A 1XO1A 2ODGA 4YG2A 5KG3A 3PSPA 2KD1A 5AI0A 5GTIU 2HBLA 2YMLA 4F50A 2RQ5A 3SQIA 4P4PA 3D2SA 1UQVA 4X5VA 2WF7A 5EE9A 1WUDA 3B9JA 1JI7A 2GOLA 1L8OA 2BPCA 3ISBA 4ELVA 5KG6A 5IIOA 2IMWP 2W9MA 4CNQA 4Y2RA 3F2DA 2JH7A 2QB0A 3DV9A 1ZQJA 1K5OA 1WG8A 5HMLA 2E1FA 3MDCA 3CW2C 2W3RA 1ZJMA 5KFWA 3PZPA 2KFZA 1ZQPA 2KTQA 2K4IA 2ESEA 2AHOB 2FMPA 2WTFA 1RXVA 2IOHA 2I5HA 4K4HA 5AKYA 2B6GA 2RP5A 3QUCA 3PW2A 2YB1A 4O5KA 2ZG6A 5F9NA 3M9MB 3Q8LA 2CPRA 4MHVA 2GO7A 2RHFA 3M1YA 3PX0A 4I2FA 3WK7A 4OJPA 1X40A 3PMLA 3HW8A 3MC1A 4DQQA 9ICIA 1X6IA 3NVZA 3JPNA 3C23A 3M7DA 2Y9TA 1ZQUA 2BDUA 2KVCA 3H8WA 4NLKA 1CEZA 3A0HU 1NKBA 4B9LA 5ALOA 5EOZA 8ICPA 5IIMA 3JPRA 4WJ3B 3BS5B 4F93B 4C4TA 4I2GA 4OCZA 3GIKA 2KKVA 1L3UA 2VIXA 5DGAA 3J81j 2G08A 4QZDA 3V72A 2D8CA 9ICMA 1T7PA 3NVVA 5ALEA 8ICTA 4RPXA 3QU9A 3RJEA 3KOOA 2NRXA 4PJ0U 1ZYQA 4BX9C 1NJYA 1X9MA 4B9SA 1NJWA 4QIWC 1LB2B 2AGQA 4NLGA 2HW3A 2OM6A 3IDWA 3SAGA 2G5HB 1RM6C 1NKCA 1L5UA 8ICYA 3Q8QB 1SL2A 1CRXA 3SAHA 2F8KA 4LVSA 2PMZC 5KFHA 1XC9A 1ZQTA 2NRTA 5AKGA 1M6YA 5HHHA 4DFDA 3PSTA 1O08A 3PX6A 2HOIA 2R8HA 7ICVA 3M9NB 1DGSA 5J8YC 1ZQRA 2KHQA 5KAFU 1Q3VA 4ED7A 4UB3A 2F2AB 1PK1A 4U7CA 1SV4A 4TUSA 1T8EA 1ZQQA 2HVHA 1WWVA 2O6KA 5J0UA 1JXEA 3H4BA 4PZNA 5AM1A 5CWRA 2ZJ8A 3MDAA 3WK8A 4I2DA 3QXGA 4YXMA 3BQTA 2IOFK 3F53A 4TUPA 3MFHA 2KP7A 5J0WA 4I2CA 1J2MA 3SZ2A 2FJ6A 1FFVA 3TFRA 2HOFA 2JRZA 1QSLA 4KLUA 1DXSA 2G07A 5KT2A 2RDIA 5DB8A 1SWVA 4C80A 2FLPA 4B9MA 2H3IA 3HWTA 2Q0ZX 1DRGA 2K60A 3QZ7A 2PMZF 3WKBA 2OH2A 2PXIA 1XO0A 1K1QA 5D49A 3H0LB 3AUOA 2JEJA 2KSOA 5BOLA 2HVIA 2W9BA 3GIMA 4J9OA 1RDFA 3GV7B 5J0SA 2XY7A 1T3QA 3V6KA 7ICOA 5AK5A 4PZOA 5EE1A 5J2KA 9ICWA 1MQ3A 4UBBA 3KFUF 3TADC 2KZ3A 4KN4A 4YQWA 9ICQA 3RRGA 3NGDA 3RAXA 3QZ8A 4YD1A 2NRVA 5KTQA 2NV3A 2OHFA 4NLBA 5IIJA 2HDOA 1NK9A 4R66A 1SXDA 3THVA 3JPSA 2FLLA 4RPYA 2XC9A 1QSSA 1Z1VA 2ASLA 4JV0A 1WWUA 2Z7JA 3RH6A 4C8MA 4DL7A 3UXOA 3QU7A 5TZVA 5KFSA 2LM1A 4M9HA 4OJ5A 3KHGA 4GXKA 3WK9A 4HAIA 5KFOA 1UA1A 1ZJNA 4UB1A 1ZQZA 1TKDA 1EXNA 3N7PD 1URJA 4ECTA 3KTQA 5KL1B 5DDYA 4CF5A 5B66U 2UVUA 2NRWA 3Q8KA 2I9GA 1LVHA 2ZTDA 4O3OA 4NY8A 1VDVA 3N28A 4EYIB 1TE2A 4J9RA 4IQTA 3PV8A 2BQRA 1B4FA 1KDHA 4KLQA 2JZBA 5KG1A 1NK7A 1BGXT 2KE7A 2E8OA 4UBCA 1KL9A 4KLFA 4BWMA 5CR0A 3HP6A 2W8KA 2V9WA 2FDRA 2HHXA 2EAPA 4ACOA 4PHAA 2EDUA 2F76X 2W55A 2KIVA 1DGJA 4PPXA 4M9NA 2BQ3A 5DQIA 2VA2A 1B0XA 3C5FA 4R65A 9ICXA 4JWMA 5J2DA 2ASDA 9ICFA 9ICVA 2XO7A 4PGYA 5BOMA 5EWFA 3RR8A 5KT6A 2OEHA 1ZQNA 4P0PB 1SZHA 4J9QA 2IA6A 5T14A 3SV3A 1FO4A 2MUTA 4IR1A 4C4RA 7ICKA 4RNNA 4MEXA 2JHDA 1ED1A 5J2JA 3JPPA 5G5HA 2HHWA 4PGQA 2EZZA 1ZQAA 4UASA 2A1AA 5EWEA 2JMGA 8ICMA 2NYVA 2QARA 1COKA 3BQ2A 3ZDEA 1TK0A 4QZCA 2BCQA 4RT3A 4EBEA 1NK6A 5AHXA 5ALSA 1YZ6A 2IOFA 5J2BA 1S0MA 3GILA 4QWBA 2ZJAA 4YR2A 5ALDA 3UMBA 4I28A 2AJQA 4GC7A 4YR0A 4A8EA 3AL0B 3MGVA 2CXYA 2VA8A 5FP0A 5AIAA 5J0XA 1SL1A 5ALPA 4KLLA 5ALQA 4PHPA 1LKYA 3IRUA 2KNJA 1BPYA 5BPCA 5AKLA 2JZBB 5ALFA 2EAMA 5G5GA 2UVVA 4J9MA 3QYPA 1XSLA 2I6XA 4CDGA 7ICTA 3ZDAA 2KICA 1V9PA 3R9KA 4NLNA 5L1IA 8ICWA 3WKCA 2W8LA 1IIPA 2JEGA 4OO1J 1T3NA 4C8LA 3B0XA 2VANA 1HUOA 1KFDA 1NI3A 2EANA 3PX4A 2P6RA 9ICJA 4O3RA 4E0DA 3ZD8A 5ALLA 1BNOA 2ISOA 1F44A 3NUQA 5L1MA 1V38A 5TISU 1PVPA 3GV8B 9ICBA 4OD0A 2J6UA 3L4PA 3FDSA 8ICIA 1IXRA 4MFAA 4KMOB 5KG7A 4I2AA 4US8A 1MN8A 1HJPA 3TFSA 5KAIU 4F5OA 4DL4A 3SYZA 2KKPA 4MF2A 3D6JA 3FM9A 3RH4A 2V4RA 3CYMA 4G3IA 2P35A 4FE3A 2EH9A 4BXOA 4DWIA 3GFKB 4GXIA 2RLTA 5J0RA 1S9FA 4ECWA 7ICNA 3HPOA 5AM2A 1L6NA 1S0VA 4O3SA 3MFIA 4XUSA 1UA0A 2C2DA 2KVSA 1L3SA 1ZQXA 2MU2A 4KITB 1D9DA 3H8JA 2LI6A 3UPQA 4TQRA 4QWCA 1KTQA 3AQFA 2W7PA 4YVZA 1N5XA 2N1RA 3EYZA 1JROA 2XCPA 4NLZA 2H3FA 4DS5A 3K4GA 5J29A 4B9NA 2D3DA 2BCUA 5KFPA 2VA3A 3PR4A 2QKQA 1NK0A 5AI8A 3TACB 1XSPA 3RBDA 1ZD2P 5DQHA 4DLGA 4RQ6A 8ICOA 2YN4A 5KT7A 5L1LA 3NASA 4YR3A 2AGPA 5KFVA 4F4YA 1U45A 8ICEA 4C7YA 4KLSA 1U9LA 1RQNA 3TAQA 5ALZA 3G6YA 9ICSA 1JN3A 1T94A 1XSNA 5HMMA 2E1EA 3UXPA 2JH1A 2DPJA 2YY6A 3ZD9A 3WKAA 5KFGA 7ICLA 4UW9A 2P66A 8ICGA 3WK5A 1NZBA 8ICAA 3TANA 2C2RA 8ICRA 3T5JA 5AK6A 4NJ8A 8ICBA 2FI1A 5KFYA 4PHEA 2FLNA 2EZXA 4KLJA 4F2SA 1PZNA 3G6XA 3GDXA 3UQ0A 4FS1A 3TADA 4O5EA 3KHLA 1X6JA 5ALGA 3BS7A 2BPFA 4QNLA 4M6WB 5A0LA 1TAUA 1TFRA 3M8SA 4JV2A 5AIBA 1UT8A 5CA7A 2GLEA 5IIKA 4YN4A 2CRXA 2JEIA 3RJIA 5AKHA 4AP9A 4MF8A 4XRHA 4F91B 4B9UA 3CRXA 4QWAA 3SI8A 3O0FA 4KLGA 1NK4A 5K4LA 4XQ8A 4K4GA 3C5GA 4I29A 3OSNA 4EX6A 2M0NA 4DFKA 1CUKA 5DB9A 5C0YA 1QQ7A 2C22A 1S76D 4AYBC 1D8LA 4KLDA 4ECYA 1V85A 5DBCA 5L1KA 4M6WA 4Y2JA 2LM4A 2HOQA 3IM1A 5AK3A 4ED8A 1RPLA 1PK1B 3TKAA 2AQ0A 5KFZA 9ICTA 1JXLA 3IV6A 1Q8KA 3KBBA 3E0FA 4Y2UA 3T5KA 2LYHA 2Q4TA 5AK4A 4RQ2A 2FMQA 5AM4A 1ZD4A 9ICHA 3PVXA 1SB3C 2G09A 3EWAA 4DF8A 3GIIA 4Y2XA 1JALA 1WCLA 3RB0A 4ICAA 3AU6A 4DQPA 4NM1A 2W9AA 2NO4A 4DOBA 2LMRA 5L1JA 1JIHA 5AKJA 3RB6A 1D9FA 4RT2A 4TUQA 2R8JA 4DSKA 2HHTA 2MSNA 3RTVA 2WF8A 1C7YA 4DL2A 4C8KA 4I27A 4JB3A 7ICQA 3KHHA 4EZ9A 4RQ8A 3VCBA 4IQVA 5KFEA 5DQGA 1ZOLA 4P0QA 3CP8A 3QEBZ 3HJEA 4BJQA 3N97B 5AM3A 2E5SA 3WK6A 3KZIU 3PMNA 3L3FX 4U6PA 3QUBA 5J0QA 3KZXA 1HEKA 2K89A 3AU2A 3HILA 2DPIA 1HUZA 5AI5A 2EZYA 2K8CB 4P4MA 4YMNA 4IRKA 2LPEA 4F5NA 4QJFB 2HSZA 2XY6A 4JK1A 4EEYA 2DWQA 5KFRA 3N7RC 3NVYA 1Z19A 1S0NA 1MSWD 1NJXA 2M9NA 3ONNA 1XNSA 3EZ5A 2BR0A 2K8BB 4IQWA 4RUCA 3C1YA 4GXJA 1FFUA 5ALHA 9ICLA 2AH5A 2HMXA 1IV8A 5KFKA 4UB8U 2W43A 2L5YA 2OWOA 4Y2SA 5AKXA 5HNKA 4DOAA 7ICGA 3PR5B 1L8LA 2EQYA 2ZIUA 3LVVA 4QIWF 4Z6CA 2F44A 1PVRA 3M8RA 8ICNA 3RJHA 5AI6A 4M9LA 3RB4A 1S5LU 2QARB 2MAXA 3KD3A 1S10A 1Z00A 4UARA 4M9JA 2H3QA 3PO4A 2Y1JA 4DL5A 3JPOA 1U49A 5ALIA 4KLIA 3PO5A 3SAFA 5KT3A 4O3NA 4LZGA 2ASJA 2Y0SC 5H2FU 1NJZA 1ZQLA 3GU3A 5ALRA 3EPGA 1QTMA 1SGGA 5KFDA 4QW8A 4Z6DA 4O3MA 2KG5A 5CP2A 9ICAA 4QWDA 1RZTA 4I2JA 1L3TA 4ELUA 2XVTA 2AXTU 3RJFA 3C2LA 1ZQKA 2KZZA 2WF5A 4FZMA 5HR7A 1JX4A 5KFJA 2F1HA 1ZQBA 1RQLA 3L5KA 4P0PA 4ECZA 2E8PA 3MR6A 4IRDA 3K75D 5J2EA 4M04A 4DO9A 4I2EA 1K1SA 4NWIA 2BQUA 5AKZA 5J2GA 2K8AA 2YMMA 4Y2TA 4DFJA 3TARA 3SMVA 1MA7A 4I2BA 3IHQB 4UAZA 3QU5A 4FZLA 5AICA 5DBBA 3HKZF 8ICKA 4F92B 2MUTB 4AYBF 2XIDA 4ECVA 3GIJA 2I1QA 3ZDCA 2AGOA 1Z3EB 1NKEA 3MGHA 1T4GA 4DSIA 3M6KA 2YQEA 2JV3A 2YB4A 3MR2A 5JU5A 1PVQA 3VC8A 8ICVA 2DBYA 2F1IA 2LHTA 1SKSA 4C0ZA 2ZUCA 1TK8A 1MQ2A 3T3FA 1KFTA 3HT3A 2YMPA 3TAPA 1IM4A 8ICFA 2E3TA 3AN1A 4P2HA 2R8GA 4F8RA 4I2HA 2LBOA 1KRPA 7ICUA 3IG5A 4O3PA 4BXOB 3RBEA 2VJ4A 2MA1A 2BHNA 3I28A 4GIBA 3HKZC 2XICA 3BJYA 5EWGA 4O9MA 2YTUA 1DK2A 1X2IA 4ED1A 2Y9UA 1KW4A 2KK0A 4ECXA 3CNHA 3N4MB 5KG4A 2D6FC 5AKEA 1Z4NA 3AEVA 2WB1F 3U26A 3RAQA 3UMGA 1ZD5A 2YMQA 1N60A 1BPEA 3KKAC 4ECUA 5ALWA 2V4QA 4F5QA 2K4PA 3AM9A 3QNMA 5CHGA 3MR3A 4F5RA 4ELTA 3BQ0A 1JUDA 1VJ5A 4QZIA 4HYKA 1B22A 2OCEA 5EE3A 3LK9A 5E79U 1SV0A 3DEEA 2H3VA 4R8UB 1Q3UA 1A6SA 3MBYA 2W7OA 3C21A 3C1ZA 5CB1A 1S8OA 5KFMA 2ZTCA 1BNPA 3LWLA 3FYHA 1AQ6A 2ISPA 7ICRA 3I1YA 2RRDA 1XS9D 2H3ZA 1JRPA 4TURA 4UB2A 4UAVA 7ICIA 2AQ4A 4YFKA 4KTQA 1YT3A 3H0MB 3PNCA 2EAOA 3LDAA 1RXWA 1H38A 4DL6A 4LJXA 1GO3F 4FBUA 5KFXA 4ED2A 1ZQCA 4Q44A 1NNLA 4YMOA 4F3OA 3V6HA 1ZQGA 2KOBA 2JGAA 4Q8EA 3WKEA 2PFQA 1B43A 9ICPA 5AKIA 5ALYA 3Q8RB 3EW9A 4Z6FA 2K4HA 3AMZA 2VJ5A 5ALNA 2W9CA 3ISDA 4DEZA 4P0QB 3PW7A 4MEYA 5JTIA 1N62A 4KLTA 2OYYA 2W54A 3JPQA 3N7SC 3H4DA 1SL0A 2ES6A 4KX5A 2GH1A 4ZH4A 1LKYB 2PKEA 4F4WA 2JEFA 9ICKA 3IN5A 1SIJA 2W3SA 3AQEA 5IINA 2NO5A 5KG0A 2KN7A 4M47A 9ICNA 3RJGA 1IG6A 4QZ8A 1NZPA 5KT5A 4CF3A 4J03A 3SENA 1KN5A 2G06A 2XGPA 2AU0A 2FPLA 3NRZA 3UMCA 2UVRA 4RQMA 1A0PA 2HCFA 4DSEA 2UVWA 4UQGA 4EYHB 1ZQSA 4KLOA 1KBUA 5J2IA 4RQ4A 8ICJA 4RUAA 4RQNA 4P4OA 4NV0A 4CGZA 2ZUDA 4DS4A 7ICMA 3K1ZA 4KLEA 2WAQC 3LYSA 1X42A 2ZIUB 3KKAA 5DG7A 4LZDA 1UPHA 8ICXA 1L3VA 4J9KA 1ZRNA 9ICUA 2WF9A 7ICPA 2FPKA 3F2CA 5J2CA 4J9LA 4YXJA 4O3QA 1Z4OA 2IBKA 2ALZA 1D8BA 1CI4A 5DB6A 4GFJA 2P6UA 3G6VA 5AKKA 1AROP 4DOCA 3C2KA 3BQ1A 4DFMA 1RYSA 5J2HA 4EX7A 1ZQVA 3SEIA 9ICGA 4EENA 1L7MA 1KLNA 2DKZA 1OW5A 2YX8A 4ECRA 4NLCA 3V7KA 2Y1IA 1J2NA 1BPDA 1TV9A 2QB0B 2DF4B 2DQNB 3FC4A 2KFNA 7ICJA 3BZCA 5KFCA 4QZEA 1ZQWA 5KFIA 2ZIWA 4QW9A 3RF9A 4NL9C 1ZQFA 3ZDDA 5KFNA 2XI9A 3C29A 1QLNA 3E58A 5KL8B 7ICSA 4CE6A 5DG8A 1ZQIA 3BDPA 3H8SA 2ZUBA 3OJUA 4CRXA 1Z00B 3IG8A 4R63A 2W03A 4F2RA 4PHDA 2HHVA 1SV0C 4DF4A 2HHSA 2QLTA 5C5JA 2BKEA 3RB3A 4DQIA 2E8NA 8ICSA 3OJSA 3UXNA 2KJ5A 5F9LA 3OPXA 1RG6A 3Q8PB 3EUB2 7ICHA 1KKXA 4M0AA 4G9BA 3M9OB 2FE9A 3PSIA 1FEZA 3QU4A 3I76A 3V7JA 3BZKA 5J2AA 4MFFA 5HR6A 1QH9A 4PL2A 2NRZA 5L9XA 5J0PA 5KFQA 3MR5A 5F3XB 4F72A 3RFAA 4KX3A 5DKWA 4ZOHC 4EBCA 4OJLA 4RQ7A 3RJJA 2GWSA 1ZQYA 4OJOA 5J2FA 4OJ6A 1S0OA 3T79A 1FIQA 3PW0A 4Y2VA 5JRTA 1Y88A 5KFUA 2G5IB 5D4BA 5KFTA 4I2IA 4BWJA 9ICCA 3RR7A 2R18A 5KFBA 4GC6A 1ZQHA 2XY5A 3E2EA 1C20A 8ICHA 2FMSA 3M6ZA 5B5EU 4K4IA 2BCVA 4RQ0A 5ALMA 1Q46A 5ALKA 5KFLA 4IC9A 4RQ3A 1O03A 2LKYA 4NXZA 4QZFA 3GV5B 1LV5A 3SR6A 2HHUA 3ED5A 2ZIVB 3ALRA 4F4ZA 3C2MA 2MRLA 5KNIA 1SXEA 3TI0A 5DBAA 1N5WA 2JXJA 1ZETA 3NTUA 1U48A 4EZ6A 1OXJA 1RYUA 3NRWA 1ZXIA 1L7PA 3ICXA 1X9SA 2KMDA 4IL6U 2W9BB 5ALVA 1F0MA 2WF6A 1QCKA 4QWEA 2ZIXB 4FZNA 1NK8A 4J9PA 1V97A 2F3NA 5ALXA 2WFAA 1Z1BA 3RH5A 1BPBA 4YP3A 4F71A 2F1JA 8ICLA 2KSOB 1KSPA 4C7ZA 9ICRA 1ZQ1C 4UB5A 4EEKA 1KQQA 5HHIA 9ICEA 4DSFA 4QZBA 3T5LA 4FO6A 4USAA 4DL3A 2HBMA 3HX0A 1COOA 2C28A 7ICEA 4ECSA 3DDHA 1MC8A 3C28A 5CEHA 1DK3A 4IQUA 1BPXA 4JWNA 5J0TA 2XGQA 3QUQA 1SZPA 5D46A 2Y0SF 2DGZA 4BGDA 1N56A 4RNMA 3A0BU 1VLBA 1F5SA 4UB4A 4R64A 2C2EA 2F77X 4QZAA 4DQSA 5DG9A 5AM0A 5DLFA 1A76A 4M2YA 4UAWA 5KG5A 4IS7A 5DLGA 1S77D 2KIWA 3BS5A 3QE9Y 2IHMA 7ICFA 4RNOA 4Y2YA 4RQ5A 5KFFA 2PFNA 3H8MA 5GTHU 2IHNA 4Q8FA 2FPMA 5JUMA 4DCCA 1YZ7A 2KJ8A 2KHVA 3PW4A 1JMSA 4Q43A 4IR9A 4IRCA 1TAMA 3Q8MA 2PI4A 4TQSA 1BPZA 3B0YA 2KJ9A 2HHQA 4F4KA 4R8UA 4MFCA 4Y2QA 1HIWA 2J6TA 4F5PA 2BDPA 2PFPA 4JUZA 5J0OA 2XCAA 4M9GA 4NL9A 1BVSA 4RQ1A 1QQ6A 3UQ2A 4YMMA 4Q45A 1N2XA 5ALTA 2BPGA 3LVWA 3JPTA 3F5AA 5IIIA 4B9TA 4PGXA 4RZRA 5ALUA 5ALJA 1QSYA 3EPIA 4UAYA 1SKRA 5HP4A 1S97A 3PY8A 4J9NA 1N63A 2OXOA 3SV4A 5J0YA 1QQ5A 2W9CB 2QB1A 1TK5A 1TAQA 3D2QA 5DB7A 1J97A 3NS1A 2DL0A 1U47A 5EE0A 4DLEA 5DDMA 4B6JA 1TVAA 2LYAA 2R8KA 4KLMA 3LWMA 2WAQF 2A1JA 5AI9A 2DFLA 4DSJA 3D2NA 4FS2A 3QEAZ 2W04A 1X9WA 4PL1A 1N61A 3ORYA 2BCSA 5IILA 4Z6EA 4FFDA 2ZIVA 5KFAA 4B9VA 5AM5A 5CJ7A 3H0RB 3GQCA 3MABA 4XA5A 4CF4A 3OSPA 2BZFA 1N48A 3SD7A 3OHAA 3GZFA 3Q8SB 2ZXHA 4UAUA 2KV2A 4ED6A 2K4EA 9ICOA 3ETRA 1XWLA 2W11A 2F8LA 4US9A 4EELA 2A3VA 3V6JA 2H5XA 2PI5A 1NK5A 1U4BA 4DSLA 3MGIA 2HI0A 1L7NA 4C8NA 1KEJA 2HBJA 1RYRA 4KLHA 4RU9A 2ZJ5A 8ICQA
chains in the Genus database with same CATH topology
4PL2A 2H3FA 2KD1A 1ZQ1C 2XICA 2OM6A 3LVWA 3SAGA 3F5AA 2E5SA 2XVTA 2G5HB 3F2CA 3L3FX 2HBLA 2KOBA 3F5EA 4CDGA 3CRXA 1CRXA 4U6PA 3SQIA 2JGAA 3RFAA 3SAHA 3D2SA 3O0FA 2PMZC 3KZXA 1HEKA 2K89A 4KX3A 1WUDA 2KICA 3F2BA 2GOLA 2HBMA 4FZMA 4JMUA 5HR7A 2K8CB 4OJLA 1D8BA 3KFUF 4QJFB 4GFJA 3PSTA 4ACOA 2KEYA 3C28A 2D6FC 3F2DA 2F76X 1IIPA 2K4HA 2WB1F 4OJOA 2M0NA 2JH7A 2HOIA 3N7RC 4P0PA 2VJ5A 2OXOA 4OJ6A 1Z19A 4BUGA 5C0YA 2CN1A 1P7DA 3T79A 3ONNA 2E1FA 2ZXIA 1XNSA 2NV3A 4AYBC 4P0QB 4OO1J 2Y0SF 4NWIA 2K8BB 4NLBA 3D2QA 2DGZA 2YX8A 2G5IB 4NLCA 3PZPA 1T94A 2K8AA 2HOQA 2KHQA 1Q3VA 2E1EA 2OYYA 2JH1A 3SMVA 1MA7A 2K4IA 2VKQA 2F2AB 3N7SC 2F77X 4U7CA 2HMXA 2R18A 4FZLA 4P0PB 1SZHA 3E0FA 2DF4B 2DQNB 3HKZF 4KX5A 2GH1A 2LYAA 5T14A 1F44A 3NUQA 3M6ZA 2KIWA 4AYBF 2XIDA 2Q4TA 3IN5A 2JHDA 1ED1A 1PVPA 3AQEA 2RP5A 2WAQF 3DEEA 1NZBA 2H3VA 2YB1A 3D2NA 2ZG6A 4IC9A 2W04A 1Q3UA 2ZIUA 4PL1A 5CRXA 2CPRA 1A6SA 2LKYA 2RHFA 2JMGA 2Z7JA 2G09A 3LVVA 2W7OA 2ZIWA 3PSFA 4QIWF 3M6KA 3RF9A 1PVRA 2ZIWB 2YB4A 2ZIVA 4KMOB 4OJPA 2KJ8A 2XI9A 3C29A 2KHVA 2G06A 2ZIXA 3VC8A 1PVQA 2WB1C 2ZIVB 2KKPA 3ALRA 3M7DA 4OJ5A 4ICAA 5KL8B 2MRLA 1TAMA 3H0RB 2KVCA 2BDUA 2LHTA 3CYMA 4C0ZA 3F53A 2RRDA 4FE3A 2H3QA 2LYBA 1OUQA 4CRXA 2G0AA 2H3ZA 2KJ9A 3IG8A 2W03A 3NRWA 1A0PA 1L6NA 3N7PD 2HOFA 1URJA 3ICXA 3GZFA 4WJ3B 2HBKA 2G07A 2ZXHA 1KBUA 2KV2A 4QNLA 3SAFA 1HIWA 5KL1B 1ECWA 2K4EA 2KKVA 3IP4B 1YT3A 3H0MB 4CGZA 2VIXA 4NV0A 5A0LA 4A8EA 2KJ5A 3AL0B 2H3IA 2G08A 2Y0SC 3OPXA 2LBOA 3MGVA 3GU3A 1DRGA 3IG5A 2ZIXB 4FZNA 2F8LA 3K1ZA 2PMZF 1GO3F 3PSIA 2WAQC 2A3VA 4O3MA 2CRXA 3LYSA 2OH2A 3AQFA 3VCBA 1Z1BA 2W7PA 1XO0A 2KNJA 2VJ4A 2N1RA 3H0LB 2MA1A 4P0QA 2ZIUB 3CP8A 4BX9C 1UPHA 2HBJA 3HKZC 4QIWC 5HR6A 4BJQA 3PSPA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2E1F A;  2CPR A;  2HBK A;  2RHF A;  3SAG A;  4OO1 J;  4NLB A;  2KV2 A;  2DGZ A;  2HBL A;  4QIW F;  4CDG A;  4NLC A;  3SAF A;  1YT3 A;  4CGZ A;  3SAH A;  2E1E A;  1WUD A;  2HBM A;  1D8B A;  4QJF B;  1GO3 F;  3CYM A;  4O3M A;  2RRD A;  2MA1 A;  5C0Y A;  2HBJ A; 
#chains in the Genus database with same CATH topology
 3ETL A;  3H40 A;  8ICC A;  3QUT A;  1SKW A;  1DOQ A;  5DGB A;  2DUY A;  3F5E A;  4UAT A;  3RRH A;  2J6S A;  3K1R B;  3PW5 A;  3T5H A;  1PK3 A;  3F2B A;  4JMU A;  3NVW A;  4C8O A;  2RDJ A;  1ZRM A;  2KEY A;  2BGW A;  4O5C A;  3HRD D;  2B21 A;  5KG2 A;  4JV1 A;  4ED3 A;  4BUG A;  4J9S A;  2CN1 A;  1P7D A;  4UB6 U;  2ZXI A;  4O0I A;  4YCX A;  4DQR A;  1PUZ A;  5KT4 A;  5J8Y A;  2ZTE A;  3WKD A;  2VKQ A;  4Y2P A;  2BCR A;  1UCV A;  1ZQD A;  3QU2 A;  2A19 A;  2ATL A;  3WU2 U;  3OGU A;  2PFO A;  3QX7 A;  3BQ7 A;  3FAH A;  1WYG A;  3OTQ A;  4F4X A;  4ED0 A;  2A1J B;  3OHB A;  5CRX A;  4RPZ A;  3H7I A;  4CCH A;  4KMU A;  1ZD3 A;  3PSF A;  3ISC A;  5AI4 A;  2ZIW B;  4DFP A;  3ZDB A;  2ZIX A;  2WB1 C;  3ZI4 A;  2B0C A;  8ICZ A;  3KHR A;  1ZQE A;  2WHE A;  2LYB A;  1OUQ A;  4KN7 A;  4ECQ A;  2G0A A;  3V7L A;  1WCN A;  4PH5 A;  1A77 A;  2DKX A;  4QZG A;  1D8Y A;  4YD2 A;  3TQ1 A;  1XU4 A;  1X9X A;  2HBK A;  1ZQM A;  1KFS A;  8ICU A;  1ECW A;  4C4S A;  3IP4 B;  4EBD A;  1ZQO A;  2KZM A;  4NM2 A;  4FBT A;  1X66 A;  4GLX A;  1SWW A;  3WK4 A;  1UT5 A;  1NOM A;  2E8M A;  2JR5 A;  1L7O A;  2R8I A;  3S6J A;  4BDP A;  3RJK A;  3UM9 A;  4QZH A;  1UHU A;  4QZ9 A;  1XO1 A;  2ODG A;  4YG2 A;  5KG3 A;  3PSP A;  2KD1 A;  5AI0 A;  5GTI U;  2HBL A;  2YML A;  4F50 A;  2RQ5 A;  3SQI A;  4P4P A;  3D2S A;  1UQV A;  4X5V A;  2WF7 A;  5EE9 A;  1WUD A;  3B9J A;  1JI7 A;  2GOL A;  1L8O A;  2BPC A;  3ISB A;  4ELV A;  5KG6 A;  5IIO A;  2IMW P;  2W9M A;  4CNQ A;  4Y2R A;  3F2D A;  2JH7 A;  2QB0 A;  3DV9 A;  1ZQJ A;  1K5O A;  1WG8 A;  5HML A;  2E1F A;  3MDC A;  3CW2 C;  2W3R A;  1ZJM A;  5KFW A;  3PZP A;  2KFZ A;  1ZQP A;  2KTQ A;  2K4I A;  2ESE A;  2AHO B;  2FMP A;  2WTF A;  1RXV A;  2IOH A;  2I5H A;  4K4H A;  5AKY A;  2B6G A;  2RP5 A;  3QUC A;  3PW2 A;  2YB1 A;  4O5K A;  2ZG6 A;  5F9N A;  3M9M B;  3Q8L A;  2CPR A;  4MHV A;  2GO7 A;  2RHF A;  3M1Y A;  3PX0 A;  4I2F A;  3WK7 A;  4OJP A;  1X40 A;  3PML A;  3HW8 A;  3MC1 A;  4DQQ A;  9ICI A;  1X6I A;  3NVZ A;  3JPN A;  3C23 A;  3M7D A;  2Y9T A;  1ZQU A;  2BDU A;  2KVC A;  3H8W A;  4NLK A;  1CEZ A;  3A0H U;  1NKB A;  4B9L A;  5ALO A;  5EOZ A;  8ICP A;  5IIM A;  3JPR A;  4WJ3 B;  3BS5 B;  4F93 B;  4C4T A;  4I2G A;  4OCZ A;  3GIK A;  2KKV A;  1L3U A;  2VIX A;  5DGA A;  3J81 j;  2G08 A;  4QZD A;  3V72 A;  2D8C A;  9ICM A;  1T7P A;  3NVV A;  5ALE A;  8ICT A;  4RPX A;  3QU9 A;  3RJE A;  3KOO A;  2NRX A;  4PJ0 U;  1ZYQ A;  4BX9 C;  1NJY A;  1X9M A;  4B9S A;  1NJW A;  4QIW C;  1LB2 B;  2AGQ A;  4NLG A;  2HW3 A;  2OM6 A;  3IDW A;  3SAG A;  2G5H B;  1RM6 C;  1NKC A;  1L5U A;  8ICY A;  3Q8Q B;  1SL2 A;  1CRX A;  3SAH A;  2F8K A;  4LVS A;  2PMZ C;  5KFH A;  1XC9 A;  1ZQT A;  2NRT A;  5AKG A;  1M6Y A;  5HHH A;  4DFD A;  3PST A;  1O08 A;  3PX6 A;  2HOI A;  2R8H A;  7ICV A;  3M9N B;  1DGS A;  5J8Y C;  1ZQR A;  2KHQ A;  5KAF U;  1Q3V A;  4ED7 A;  4UB3 A;  2F2A B;  1PK1 A;  4U7C A;  1SV4 A;  4TUS A;  1T8E A;  1ZQQ A;  2HVH A;  1WWV A;  2O6K A;  5J0U A;  1JXE A;  3H4B A;  4PZN A;  5AM1 A;  5CWR A;  2ZJ8 A;  3MDA A;  3WK8 A;  4I2D A;  3QXG A;  4YXM A;  3BQT A;  2IOF K;  3F53 A;  4TUP A;  3MFH A;  2KP7 A;  5J0W A;  4I2C A;  1J2M A;  3SZ2 A;  2FJ6 A;  1FFV A;  3TFR A;  2HOF A;  2JRZ A;  1QSL A;  4KLU A;  1DXS A;  2G07 A;  5KT2 A;  2RDI A;  5DB8 A;  1SWV A;  4C80 A;  2FLP A;  4B9M A;  2H3I A;  3HWT A;  2Q0Z X;  1DRG A;  2K60 A;  3QZ7 A;  2PMZ F;  3WKB A;  2OH2 A;  2PXI A;  1XO0 A;  1K1Q A;  5D49 A;  3H0L B;  3AUO A;  2JEJ A;  2KSO A;  5BOL A;  2HVI A;  2W9B A;  3GIM A;  4J9O A;  1RDF A;  3GV7 B;  5J0S A;  2XY7 A;  1T3Q A;  3V6K A;  7ICO A;  5AK5 A;  4PZO A;  5EE1 A;  5J2K A;  9ICW A;  1MQ3 A;  4UBB A;  3KFU F;  3TAD C;  2KZ3 A;  4KN4 A;  4YQW A;  9ICQ A;  3RRG A;  3NGD A;  3RAX A;  3QZ8 A;  4YD1 A;  2NRV A;  5KTQ A;  2NV3 A;  2OHF A;  4NLB A;  5IIJ A;  2HDO A;  1NK9 A;  4R66 A;  1SXD A;  3THV A;  3JPS A;  2FLL A;  4RPY A;  2XC9 A;  1QSS A;  1Z1V A;  2ASL A;  4JV0 A;  1WWU A;  2Z7J A;  3RH6 A;  4C8M A;  4DL7 A;  3UXO A;  3QU7 A;  5TZV A;  5KFS A;  2LM1 A;  4M9H A;  4OJ5 A;  3KHG A;  4GXK A;  3WK9 A;  4HAI A;  5KFO A;  1UA1 A;  1ZJN A;  4UB1 A;  1ZQZ A;  1TKD A;  1EXN A;  3N7P D;  1URJ A;  4ECT A;  3KTQ A;  5KL1 B;  5DDY A;  4CF5 A;  5B66 U;  2UVU A;  2NRW A;  3Q8K A;  2I9G A;  1LVH A;  2ZTD A;  4O3O A;  4NY8 A;  1VDV A;  3N28 A;  4EYI B;  1TE2 A;  4J9R A;  4IQT A;  3PV8 A;  2BQR A;  1B4F A;  1KDH A;  4KLQ A;  2JZB A;  5KG1 A;  1NK7 A;  1BGX T;  2KE7 A;  2E8O A;  4UBC A;  1KL9 A;  4KLF A;  4BWM A;  5CR0 A;  3HP6 A;  2W8K A;  2V9W A;  2FDR A;  2HHX A;  2EAP A;  4ACO A;  4PHA A;  2EDU A;  2F76 X;  2W55 A;  2KIV A;  1DGJ A;  4PPX A;  4M9N A;  2BQ3 A;  5DQI A;  2VA2 A;  1B0X A;  3C5F A;  4R65 A;  9ICX A;  4JWM A;  5J2D A;  2ASD A;  9ICF A;  9ICV A;  2XO7 A;  4PGY A;  5BOM A;  5EWF A;  3RR8 A;  5KT6 A;  2OEH A;  1ZQN A;  4P0P B;  1SZH A;  4J9Q A;  2IA6 A;  5T14 A;  3SV3 A;  1FO4 A;  2MUT A;  4IR1 A;  4C4R A;  7ICK A;  4RNN A;  4MEX A;  2JHD A;  1ED1 A;  5J2J A;  3JPP A;  5G5H A;  2HHW A;  4PGQ A;  2EZZ A;  1ZQA A;  4UAS A;  2A1A A;  5EWE A;  2JMG A;  8ICM A;  2NYV A;  2QAR A;  1COK A;  3BQ2 A;  3ZDE A;  1TK0 A;  4QZC A;  2BCQ A;  4RT3 A;  4EBE A;  1NK6 A;  5AHX A;  5ALS A;  1YZ6 A;  2IOF A;  5J2B A;  1S0M A;  3GIL A;  4QWB A;  2ZJA A;  4YR2 A;  5ALD A;  3UMB A;  4I28 A;  2AJQ A;  4GC7 A;  4YR0 A;  4A8E A;  3AL0 B;  3MGV A;  2CXY A;  2VA8 A;  5FP0 A;  5AIA A;  5J0X A;  1SL1 A;  5ALP A;  4KLL A;  5ALQ A;  4PHP A;  1LKY A;  3IRU A;  2KNJ A;  1BPY A;  5BPC A;  5AKL A;  2JZB B;  5ALF A;  2EAM A;  5G5G A;  2UVV A;  4J9M A;  3QYP A;  1XSL A;  2I6X A;  4CDG A;  7ICT A;  3ZDA A;  2KIC A;  1V9P A;  3R9K A;  4NLN A;  5L1I A;  8ICW A;  3WKC A;  2W8L A;  1IIP A;  2JEG A;  4OO1 J;  1T3N A;  4C8L A;  3B0X A;  2VAN A;  1HUO A;  1KFD A;  1NI3 A;  2EAN A;  3PX4 A;  2P6R A;  9ICJ A;  4O3R A;  4E0D A;  3ZD8 A;  5ALL A;  1BNO A;  2ISO A;  1F44 A;  3NUQ A;  5L1M A;  1V38 A;  5TIS U;  1PVP A;  3GV8 B;  9ICB A;  4OD0 A;  2J6U A;  3L4P A;  3FDS A;  8ICI A;  1IXR A;  4MFA A;  4KMO B;  5KG7 A;  4I2A A;  4US8 A;  1MN8 A;  1HJP A;  3TFS A;  5KAI U;  4F5O A;  4DL4 A;  3SYZ A;  2KKP A;  4MF2 A;  3D6J A;  3FM9 A;  3RH4 A;  2V4R A;  3CYM A;  4G3I A;  2P35 A;  4FE3 A;  2EH9 A;  4BXO A;  4DWI A;  3GFK B;  4GXI A;  2RLT A;  5J0R A;  1S9F A;  4ECW A;  7ICN A;  3HPO A;  5AM2 A;  1L6N A;  1S0V A;  4O3S A;  3MFI A;  4XUS A;  1UA0 A;  2C2D A;  2KVS A;  1L3S A;  1ZQX A;  2MU2 A;  4KIT B;  1D9D A;  3H8J A;  2LI6 A;  3UPQ A;  4TQR A;  4QWC A;  1KTQ A;  3AQF A;  2W7P A;  4YVZ A;  1N5X A;  2N1R A;  3EYZ A;  1JRO A;  2XCP A;  4NLZ A;  2H3F A;  4DS5 A;  3K4G A;  5J29 A;  4B9N A;  2D3D A;  2BCU A;  5KFP A;  2VA3 A;  3PR4 A;  2QKQ A;  1NK0 A;  5AI8 A;  3TAC B;  1XSP A;  3RBD A;  1ZD2 P;  5DQH A;  4DLG A;  4RQ6 A;  8ICO A;  2YN4 A;  5KT7 A;  5L1L A;  3NAS A;  4YR3 A;  2AGP A;  5KFV A;  4F4Y A;  1U45 A;  8ICE A;  4C7Y A;  4KLS A;  1U9L A;  1RQN A;  3TAQ A;  5ALZ A;  3G6Y A;  9ICS A;  1JN3 A;  1T94 A;  1XSN A;  5HMM A;  2E1E A;  3UXP A;  2JH1 A;  2DPJ A;  2YY6 A;  3ZD9 A;  3WKA A;  5KFG A;  7ICL A;  4UW9 A;  2P66 A;  8ICG A;  3WK5 A;  1NZB A;  8ICA A;  3TAN A;  2C2R A;  8ICR A;  3T5J A;  5AK6 A;  4NJ8 A;  8ICB A;  2FI1 A;  5KFY A;  4PHE A;  2FLN A;  2EZX A;  4KLJ A;  4F2S A;  1PZN A;  3G6X A;  3GDX A;  3UQ0 A;  4FS1 A;  3TAD A;  4O5E A;  3KHL A;  1X6J A;  5ALG A;  3BS7 A;  2BPF A;  4QNL A;  4M6W B;  5A0L A;  1TAU A;  1TFR A;  3M8S A;  4JV2 A;  5AIB A;  1UT8 A;  5CA7 A;  2GLE A;  5IIK A;  4YN4 A;  2CRX A;  2JEI A;  3RJI A;  5AKH A;  4AP9 A;  4MF8 A;  4XRH A;  4F91 B;  4B9U A;  3CRX A;  4QWA A;  3SI8 A;  3O0F A;  4KLG A;  1NK4 A;  5K4L A;  4XQ8 A;  4K4G A;  3C5G A;  4I29 A;  3OSN A;  4EX6 A;  2M0N A;  4DFK A;  1CUK A;  5DB9 A;  5C0Y A;  1QQ7 A;  2C22 A;  1S76 D;  4AYB C;  1D8L A;  4KLD A;  4ECY A;  1V85 A;  5DBC A;  5L1K A;  4M6W A;  4Y2J A;  2LM4 A;  2HOQ A;  3IM1 A;  5AK3 A;  4ED8 A;  1RPL A;  1PK1 B;  3TKA A;  2AQ0 A;  5KFZ A;  9ICT A;  1JXL A;  3IV6 A;  1Q8K A;  3KBB A;  3E0F A;  4Y2U A;  3T5K A;  2LYH A;  2Q4T A;  5AK4 A;  4RQ2 A;  2FMQ A;  5AM4 A;  1ZD4 A;  9ICH A;  3PVX A;  1SB3 C;  2G09 A;  3EWA A;  4DF8 A;  3GII A;  4Y2X A;  1JAL A;  1WCL A;  3RB0 A;  4ICA A;  3AU6 A;  4DQP A;  4NM1 A;  2W9A A;  2NO4 A;  4DOB A;  2LMR A;  5L1J A;  1JIH A;  5AKJ A;  3RB6 A;  1D9F A;  4RT2 A;  4TUQ A;  2R8J A;  4DSK A;  2HHT A;  2MSN A;  3RTV A;  2WF8 A;  1C7Y A;  4DL2 A;  4C8K A;  4I27 A;  4JB3 A;  7ICQ A;  3KHH A;  4EZ9 A;  4RQ8 A;  3VCB A;  4IQV A;  5KFE A;  5DQG A;  1ZOL A;  4P0Q A;  3CP8 A;  3QEB Z;  3HJE A;  4BJQ A;  3N97 B;  5AM3 A;  2E5S A;  3WK6 A;  3KZI U;  3PMN A;  3L3F X;  4U6P A;  3QUB A;  5J0Q A;  3KZX A;  1HEK A;  2K89 A;  3AU2 A;  3HIL A;  2DPI A;  1HUZ A;  5AI5 A;  2EZY A;  2K8C B;  4P4M A;  4YMN A;  4IRK A;  2LPE A;  4F5N A;  4QJF B;  2HSZ A;  2XY6 A;  4JK1 A;  4EEY A;  2DWQ A;  5KFR A;  3N7R C;  3NVY A;  1Z19 A;  1S0N A;  1MSW D;  1NJX A;  2M9N A;  3ONN A;  1XNS A;  3EZ5 A;  2BR0 A;  2K8B B;  4IQW A;  4RUC A;  3C1Y A;  4GXJ A;  1FFU A;  5ALH A;  9ICL A;  2AH5 A;  2HMX A;  1IV8 A;  5KFK A;  4UB8 U;  2W43 A;  2L5Y A;  2OWO A;  4Y2S A;  5AKX A;  5HNK A;  4DOA A;  7ICG A;  3PR5 B;  1L8L A;  2EQY A;  2ZIU A;  3LVV A;  4QIW F;  4Z6C A;  2F44 A;  1PVR A;  3M8R A;  8ICN A;  3RJH A;  5AI6 A;  4M9L A;  3RB4 A;  1S5L U;  2QAR B;  2MAX A;  3KD3 A;  1S10 A;  1Z00 A;  4UAR A;  4M9J A;  2H3Q A;  3PO4 A;  2Y1J A;  4DL5 A;  3JPO A;  1U49 A;  5ALI A;  4KLI A;  3PO5 A;  3SAF A;  5KT3 A;  4O3N A;  4LZG A;  2ASJ A;  2Y0S C;  5H2F U;  1NJZ A;  1ZQL A;  3GU3 A;  5ALR A;  3EPG A;  1QTM A;  1SGG A;  5KFD A;  4QW8 A;  4Z6D A;  4O3M A;  2KG5 A;  5CP2 A;  9ICA A;  4QWD A;  1RZT A;  4I2J A;  1L3T A;  4ELU A;  2XVT A;  2AXT U;  3RJF A;  3C2L A;  1ZQK A;  2KZZ A;  2WF5 A;  4FZM A;  5HR7 A;  1JX4 A;  5KFJ A;  2F1H A;  1ZQB A;  1RQL A;  3L5K A;  4P0P A;  4ECZ A;  2E8P A;  3MR6 A;  4IRD A;  3K75 D;  5J2E A;  4M04 A;  4DO9 A;  4I2E A;  1K1S A;  4NWI A;  2BQU A;  5AKZ A;  5J2G A;  2K8A A;  2YMM A;  4Y2T A;  4DFJ A;  3TAR A;  3SMV A;  1MA7 A;  4I2B A;  3IHQ B;  4UAZ A;  3QU5 A;  4FZL A;  5AIC A;  5DBB A;  3HKZ F;  8ICK A;  4F92 B;  2MUT B;  4AYB F;  2XID A;  4ECV A;  3GIJ A;  2I1Q A;  3ZDC A;  2AGO A;  1Z3E B;  1NKE A;  3MGH A;  1T4G A;  4DSI A;  3M6K A;  2YQE A;  2JV3 A;  2YB4 A;  3MR2 A;  5JU5 A;  1PVQ A;  3VC8 A;  8ICV A;  2DBY A;  2F1I A;  2LHT A;  1SKS A;  4C0Z A;  2ZUC A;  1TK8 A;  1MQ2 A;  3T3F A;  1KFT A;  3HT3 A;  2YMP A;  3TAP A;  1IM4 A;  8ICF A;  2E3T A;  3AN1 A;  4P2H A;  2R8G A;  4F8R A;  4I2H A;  2LBO A;  1KRP A;  7ICU A;  3IG5 A;  4O3P A;  4BXO B;  3RBE A;  2VJ4 A;  2MA1 A;  2BHN A;  3I28 A;  4GIB A;  3HKZ C;  2XIC A;  3BJY A;  5EWG A;  4O9M A;  2YTU A;  1DK2 A;  1X2I A;  4ED1 A;  2Y9U A;  1KW4 A;  2KK0 A;  4ECX A;  3CNH A;  3N4M B;  5KG4 A;  2D6F C;  5AKE A;  1Z4N A;  3AEV A;  2WB1 F;  3U26 A;  3RAQ A;  3UMG A;  1ZD5 A;  2YMQ A;  1N60 A;  1BPE A;  3KKA C;  4ECU A;  5ALW A;  2V4Q A;  4F5Q A;  2K4P A;  3AM9 A;  3QNM A;  5CHG A;  3MR3 A;  4F5R A;  4ELT A;  3BQ0 A;  1JUD A;  1VJ5 A;  4QZI A;  4HYK A;  1B22 A;  2OCE A;  5EE3 A;  3LK9 A;  5E79 U;  1SV0 A;  3DEE A;  2H3V A;  4R8U B;  1Q3U A;  1A6S A;  3MBY A;  2W7O A;  3C21 A;  3C1Z A;  5CB1 A;  1S8O A;  5KFM A;  2ZTC A;  1BNP A;  3LWL A;  3FYH A;  1AQ6 A;  2ISP A;  7ICR A;  3I1Y A;  2RRD A;  1XS9 D;  2H3Z A;  1JRP A;  4TUR A;  4UB2 A;  4UAV A;  7ICI A;  2AQ4 A;  4YFK A;  4KTQ A;  1YT3 A;  3H0M B;  3PNC A;  2EAO A;  3LDA A;  1RXW A;  1H38 A;  4DL6 A;  4LJX A;  1GO3 F;  4FBU A;  5KFX A;  4ED2 A;  1ZQC A;  4Q44 A;  1NNL A;  4YMO A;  4F3O A;  3V6H A;  1ZQG A;  2KOB A;  2JGA A;  4Q8E A;  3WKE A;  2PFQ A;  1B43 A;  9ICP A;  5AKI A;  5ALY A;  3Q8R B;  3EW9 A;  4Z6F A;  2K4H A;  3AMZ A;  2VJ5 A;  5ALN A;  2W9C A;  3ISD A;  4DEZ A;  4P0Q B;  3PW7 A;  4MEY A;  5JTI A;  1N62 A;  4KLT A;  2OYY A;  2W54 A;  3JPQ A;  3N7S C;  3H4D A;  1SL0 A;  2ES6 A;  4KX5 A;  2GH1 A;  4ZH4 A;  1LKY B;  2PKE A;  4F4W A;  2JEF A;  9ICK A;  3IN5 A;  1SIJ A;  2W3S A;  3AQE A;  5IIN A;  2NO5 A;  5KG0 A;  2KN7 A;  4M47 A;  9ICN A;  3RJG A;  1IG6 A;  4QZ8 A;  1NZP A;  5KT5 A;  4CF3 A;  4J03 A;  3SEN A;  1KN5 A;  2G06 A;  2XGP A;  2AU0 A;  2FPL A;  3NRZ A;  3UMC A;  2UVR A;  4RQM A;  1A0P A;  2HCF A;  4DSE A;  2UVW A;  4UQG A;  4EYH B;  1ZQS A;  4KLO A;  1KBU A;  5J2I A;  4RQ4 A;  8ICJ A;  4RUA A;  4RQN A;  4P4O A;  4NV0 A;  4CGZ A;  2ZUD A;  4DS4 A;  7ICM A;  3K1Z A;  4KLE A;  2WAQ C;  3LYS A;  1X42 A;  2ZIU B;  3KKA A;  5DG7 A;  4LZD A;  1UPH A;  8ICX A;  1L3V A;  4J9K A;  1ZRN A;  9ICU A;  2WF9 A;  7ICP A;  2FPK A;  3F2C A;  5J2C A;  4J9L A;  4YXJ A;  4O3Q A;  1Z4O A;  2IBK A;  2ALZ A;  1D8B A;  1CI4 A;  5DB6 A;  4GFJ A;  2P6U A;  3G6V A;  5AKK A;  1ARO P;  4DOC A;  3C2K A;  3BQ1 A;  4DFM A;  1RYS A;  5J2H A;  4EX7 A;  1ZQV A;  3SEI A;  9ICG A;  4EEN A;  1L7M A;  1KLN A;  2DKZ A;  1OW5 A;  2YX8 A;  4ECR A;  4NLC A;  3V7K A;  2Y1I A;  1J2N A;  1BPD A;  1TV9 A;  2QB0 B;  2DF4 B;  2DQN B;  3FC4 A;  2KFN A;  7ICJ A;  3BZC A;  5KFC A;  4QZE A;  1ZQW A;  5KFI A;  2ZIW A;  4QW9 A;  3RF9 A;  4NL9 C;  1ZQF A;  3ZDD A;  5KFN A;  2XI9 A;  3C29 A;  1QLN A;  3E58 A;  5KL8 B;  7ICS A;  4CE6 A;  5DG8 A;  1ZQI A;  3BDP A;  3H8S A;  2ZUB A;  3OJU A;  4CRX A;  1Z00 B;  3IG8 A;  4R63 A;  2W03 A;  4F2R A;  4PHD A;  2HHV A;  1SV0 C;  4DF4 A;  2HHS A;  2QLT A;  5C5J A;  2BKE A;  3RB3 A;  4DQI A;  2E8N A;  8ICS A;  3OJS A;  3UXN A;  2KJ5 A;  5F9L A;  3OPX A;  1RG6 A;  3Q8P B;  3EUB 2;  7ICH A;  1KKX A;  4M0A A;  4G9B A;  3M9O B;  2FE9 A;  3PSI A;  1FEZ A;  3QU4 A;  3I76 A;  3V7J A;  3BZK A;  5J2A A;  4MFF A;  5HR6 A;  1QH9 A;  4PL2 A;  2NRZ A;  5L9X A;  5J0P A;  5KFQ A;  3MR5 A;  5F3X B;  4F72 A;  3RFA A;  4KX3 A;  5DKW A;  4ZOH C;  4EBC A;  4OJL A;  4RQ7 A;  3RJJ A;  2GWS A;  1ZQY A;  4OJO A;  5J2F A;  4OJ6 A;  1S0O A;  3T79 A;  1FIQ A;  3PW0 A;  4Y2V A;  5JRT A;  1Y88 A;  5KFU A;  2G5I B;  5D4B A;  5KFT A;  4I2I A;  4BWJ A;  9ICC A;  3RR7 A;  2R18 A;  5KFB A;  4GC6 A;  1ZQH A;  2XY5 A;  3E2E A;  1C20 A;  8ICH A;  2FMS A;  3M6Z A;  5B5E U;  4K4I A;  2BCV A;  4RQ0 A;  5ALM A;  1Q46 A;  5ALK A;  5KFL A;  4IC9 A;  4RQ3 A;  1O03 A;  2LKY A;  4NXZ A;  4QZF A;  3GV5 B;  1LV5 A;  3SR6 A;  2HHU A;  3ED5 A;  2ZIV B;  3ALR A;  4F4Z A;  3C2M A;  2MRL A;  5KNI A;  1SXE A;  3TI0 A;  5DBA A;  1N5W A;  2JXJ A;  1ZET A;  3NTU A;  1U48 A;  4EZ6 A;  1OXJ A;  1RYU A;  3NRW A;  1ZXI A;  1L7P A;  3ICX A;  1X9S A;  2KMD A;  4IL6 U;  2W9B B;  5ALV A;  1F0M A;  2WF6 A;  1QCK A;  4QWE A;  2ZIX B;  4FZN A;  1NK8 A;  4J9P A;  1V97 A;  2F3N A;  5ALX A;  2WFA A;  1Z1B A;  3RH5 A;  1BPB A;  4YP3 A;  4F71 A;  2F1J A;  8ICL A;  2KSO B;  1KSP A;  4C7Z A;  9ICR A;  1ZQ1 C;  4UB5 A;  4EEK A;  1KQQ A;  5HHI A;  9ICE A;  4DSF A;  4QZB A;  3T5L A;  4FO6 A;  4USA A;  4DL3 A;  2HBM A;  3HX0 A;  1COO A;  2C28 A;  7ICE A;  4ECS A;  3DDH A;  1MC8 A;  3C28 A;  5CEH A;  1DK3 A;  4IQU A;  1BPX A;  4JWN A;  5J0T A;  2XGQ A;  3QUQ A;  1SZP A;  5D46 A;  2Y0S F;  2DGZ A;  4BGD A;  1N56 A;  4RNM A;  3A0B U;  1VLB A;  1F5S A;  4UB4 A;  4R64 A;  2C2E A;  2F77 X;  4QZA A;  4DQS A;  5DG9 A;  5AM0 A;  5DLF A;  1A76 A;  4M2Y A;  4UAW A;  5KG5 A;  4IS7 A;  5DLG A;  1S77 D;  2KIW A;  3BS5 A;  3QE9 Y;  2IHM A;  7ICF A;  4RNO A;  4Y2Y A;  4RQ5 A;  5KFF A;  2PFN A;  3H8M A;  5GTH U;  2IHN A;  4Q8F A;  2FPM A;  5JUM A;  4DCC A;  1YZ7 A;  2KJ8 A;  2KHV A;  3PW4 A;  1JMS A;  4Q43 A;  4IR9 A;  4IRC A;  1TAM A;  3Q8M A;  2PI4 A;  4TQS A;  1BPZ A;  3B0Y A;  2KJ9 A;  2HHQ A;  4F4K A;  4R8U A;  4MFC A;  4Y2Q A;  1HIW A;  2J6T A;  4F5P A;  2BDP A;  2PFP A;  4JUZ A;  5J0O A;  2XCA A;  4M9G A;  4NL9 A;  1BVS A;  4RQ1 A;  1QQ6 A;  3UQ2 A;  4YMM A;  4Q45 A;  1N2X A;  5ALT A;  2BPG A;  3LVW A;  3JPT A;  3F5A A;  5III A;  4B9T A;  4PGX A;  4RZR A;  5ALU A;  5ALJ A;  1QSY A;  3EPI A;  4UAY A;  1SKR A;  5HP4 A;  1S97 A;  3PY8 A;  4J9N A;  1N63 A;  2OXO A;  3SV4 A;  5J0Y A;  1QQ5 A;  2W9C B;  2QB1 A;  1TK5 A;  1TAQ A;  3D2Q A;  5DB7 A;  1J97 A;  3NS1 A;  2DL0 A;  1U47 A;  5EE0 A;  4DLE A;  5DDM A;  4B6J A;  1TVA A;  2LYA A;  2R8K A;  4KLM A;  3LWM A;  2WAQ F;  2A1J A;  5AI9 A;  2DFL A;  4DSJ A;  3D2N A;  4FS2 A;  3QEA Z;  2W04 A;  1X9W A;  4PL1 A;  1N61 A;  3ORY A;  2BCS A;  5IIL A;  4Z6E A;  4FFD A;  2ZIV A;  5KFA A;  4B9V A;  5AM5 A;  5CJ7 A;  3H0R B;  3GQC A;  3MAB A;  4XA5 A;  4CF4 A;  3OSP A;  2BZF A;  1N48 A;  3SD7 A;  3OHA A;  3GZF A;  3Q8S B;  2ZXH A;  4UAU A;  2KV2 A;  4ED6 A;  2K4E A;  9ICO A;  3ETR A;  1XWL A;  2W11 A;  2F8L A;  4US9 A;  4EEL A;  2A3V A;  3V6J A;  2H5X A;  2PI5 A;  1NK5 A;  1U4B A;  4DSL A;  3MGI A;  2HI0 A;  1L7N A;  4C8N A;  1KEJ A;  2HBJ A;  1RYR A;  4KLH A;  4RU9 A;  2ZJ5 A;  8ICQ A; 
#chains in the Genus database with same CATH homology
 4PL2 A;  2H3F A;  2KD1 A;  1ZQ1 C;  2XIC A;  2OM6 A;  3LVW A;  3SAG A;  3F5A A;  2E5S A;  2XVT A;  2G5H B;  3F2C A;  3L3F X;  2HBL A;  2KOB A;  3F5E A;  4CDG A;  3CRX A;  1CRX A;  4U6P A;  3SQI A;  2JGA A;  3RFA A;  3SAH A;  3D2S A;  3O0F A;  2PMZ C;  3KZX A;  1HEK A;  2K89 A;  4KX3 A;  1WUD A;  2KIC A;  3F2B A;  2GOL A;  2HBM A;  4FZM A;  4JMU A;  5HR7 A;  2K8C B;  4OJL A;  1D8B A;  3KFU F;  4QJF B;  4GFJ A;  3PST A;  4ACO A;  2KEY A;  3C28 A;  2D6F C;  3F2D A;  2F76 X;  1IIP A;  2K4H A;  2WB1 F;  4OJO A;  2M0N A;  2JH7 A;  2HOI A;  3N7R C;  4P0P A;  2VJ5 A;  2OXO A;  4OJ6 A;  1Z19 A;  4BUG A;  5C0Y A;  2CN1 A;  1P7D A;  3T79 A;  3ONN A;  2E1F A;  2ZXI A;  1XNS A;  2NV3 A;  4AYB C;  4P0Q B;  4OO1 J;  2Y0S F;  4NWI A;  2K8B B;  4NLB A;  3D2Q A;  2DGZ A;  2YX8 A;  2G5I B;  4NLC A;  3PZP A;  1T94 A;  2K8A A;  2HOQ A;  2KHQ A;  1Q3V A;  2E1E A;  2OYY A;  2JH1 A;  3SMV A;  1MA7 A;  2K4I A;  2VKQ A;  2F2A B;  3N7S C;  2F77 X;  4U7C A;  2HMX A;  2R18 A;  4FZL A;  4P0P B;  1SZH A;  3E0F A;  2DF4 B;  2DQN B;  3HKZ F;  4KX5 A;  2GH1 A;  2LYA A;  5T14 A;  1F44 A;  3NUQ A;  3M6Z A;  2KIW A;  4AYB F;  2XID A;  2Q4T A;  3IN5 A;  2JHD A;  1ED1 A;  1PVP A;  3AQE A;  2RP5 A;  2WAQ F;  3DEE A;  1NZB A;  2H3V A;  2YB1 A;  3D2N A;  2ZG6 A;  4IC9 A;  2W04 A;  1Q3U A;  2ZIU A;  4PL1 A;  5CRX A;  2CPR A;  1A6S A;  2LKY A;  2RHF A;  2JMG A;  2Z7J A;  2G09 A;  3LVV A;  2W7O A;  2ZIW A;  3PSF A;  4QIW F;  3M6K A;  3RF9 A;  1PVR A;  2ZIW B;  2YB4 A;  2ZIV A;  4KMO B;  4OJP A;  2KJ8 A;  2XI9 A;  3C29 A;  2KHV A;  2G06 A;  2ZIX A;  3VC8 A;  1PVQ A;  2WB1 C;  2ZIV B;  2KKP A;  3ALR A;  3M7D A;  4OJ5 A;  4ICA A;  5KL8 B;  2MRL A;  1TAM A;  3H0R B;  2KVC A;  2BDU A;  2LHT A;  3CYM A;  4C0Z A;  3F53 A;  2RRD A;  4FE3 A;  2H3Q A;  2LYB A;  1OUQ A;  4CRX A;  2G0A A;  2H3Z A;  2KJ9 A;  3IG8 A;  2W03 A;  3NRW A;  1A0P A;  1L6N A;  3N7P D;  2HOF A;  1URJ A;  3ICX A;  3GZF A;  4WJ3 B;  2HBK A;  2G07 A;  2ZXH A;  1KBU A;  2KV2 A;  4QNL A;  3SAF A;  1HIW A;  5KL1 B;  1ECW A;  2K4E A;  2KKV A;  3IP4 B;  1YT3 A;  3H0M B;  4CGZ A;  2VIX A;  4NV0 A;  5A0L A;  4A8E A;  2KJ5 A;  3AL0 B;  2H3I A;  2G08 A;  2Y0S C;  3OPX A;  2LBO A;  3MGV A;  3GU3 A;  1DRG A;  3IG5 A;  2ZIX B;  4FZN A;  2F8L A;  3K1Z A;  2PMZ F;  1GO3 F;  3PSI A;  2WAQ C;  2A3V A;  4O3M A;  2CRX A;  3LYS A;  2OH2 A;  3AQF A;  3VCB A;  1Z1B A;  2W7P A;  1XO0 A;  2KNJ A;  2VJ4 A;  2N1R A;  3H0L B;  2MA1 A;  4P0Q A;  2ZIU B;  3CP8 A;  4BX9 C;  1UPH A;  2HBJ A;  3HKZ C;  4QIW C;  5HR6 A;  4BJQ A;  3PSP A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...