2E1FA

Crystal structure of the hrdc domain of human werner syndrome protein, wrn
Total Genus 33
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
33
sequence length
94
structure length
94
Chain Sequence
QPVISAQEQETQIVLYGKLVEARQKHANKMDVPPAILATNKILVDMAKMRPTTVENVKRIDGVSEGKAAMLAPLLEVIKHFCQTNSVQTDLFSS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Werner syndrome ATP-dependent helicase
publication title Crystal structure of the HRDC domain of human Werner syndrome protein, WRN
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase
total genus 33
structure length 94
sequence length 94
ec nomenclature ec 3.6.4.12: DNA helicase.
pdb deposition date 2006-10-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00570 HRDC HRDC domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.80 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 DNA polymerase; domain 1 2e1fA01
1GO3F 4CGZA 4NLCA 4NLBA 4OO1J 2HBJA 1D8BA 3SAFA 3SAHA 2RHFA 2HBKA 4O3MA 2E1EA 4QJFB 2HBLA 4QIWF 2DGZA 2RRDA 4CDGA 2MA1A 5C0YA 1WUDA 2E1FA 2KV2A 2HBMA 1YT3A 2CPRA 3CYMA 3SAGA
chains in the Genus database with same CATH superfamily
3N7SC 1Z19A 2G09A 1KBUA 4TQRA 4F4KA 3RRHA 3WKCA 5AKYA 4DOCA 3O0FA 1X66A 4DSJA 4M6WA 1XWLA 3IG5A 4YR3A 1SKWA 4EELA 5KTQA 1AROP 3F5AA 5IINA 3ZDDA 5KFPA 1B22A 5KFUA 4UB3A 3KHGA 2EAMA 2XVTA 2MUTB 4UASA 1RQNA 1U9LA 4XQ8A 4Q44A 4C8KA 2F1HA 2AJQA 1KW4A 4KLTA 2KOBA 4UB6U 2FLLA 3V72A 3M6ZA 4KLLA 2AQ0A 4I2BA 3KD3A 7ICKA 2PI5A 3AN1A 4FFDA 3PV8A 4I2AA 1S0NA 4R63A 2OWOA 2DWQA 2V4QA 4ICAA 1UQVA 2EANA 8ICGA 5ALVA 3F5EA 3UQ0A 3JPTA 2WHEA 1VLBA 4P4PA 4KN7A 1PVQA 5AKGA 5CA7A 4YR2A 3SAGA 4IRCA 2HMXA 2K8CB 5J2IA 2AGQA 3D2SA 5L1KA 2WF8A 5KFHA 2R8IA 4KMOB 3J81j 3RJIA 9ICOA 4QNLA 2EDUA 4UB4A 1FFVA 2HVIA 1TK0A 1SB3C 1K5OA 4QWEA 2DGZA 4I29A 3BQ7A 1B43A 3K75D 1HJPA 2NO5A 5AI5A 3HPOA 4RNMA 3D6JA 3Q8SB 4QW8A 2JMGA 4BX9C 3IV6A 5KT6A 5J0SA 1S0VA 4OO1J 2XICA 3RB4A 4KLOA 2DF4B 2R8GA 3RJKA 2BCSA 4DSFA 9ICEA 4U6PA 2ZIWA 4DL5A 4RQ7A 2AGPA 1TAMA 2E5SA 5KFGA 4FZMA 2FI1A 3AU2A 1D8BA 3UMBA 4AP9A 5HNKA 1YZ7A 4GC7A 3WU2U 1JALA 1PK1A 2ZIXB 4P0QA 4Z6CA 4MHVA 3BS5A 2KE7A 4ACOA 4JB3A 3HX0A 3WKBA 1C20A 2EAOA 2HOFA 4O0IA 1XSLA 4PHEA 1ZQSA 3B0YA 9ICNA 4QZBA 4JMUA 3QXGA 2F44A 4B9LA 5AI0A 2GOLA 1QCKA 5F9LA 4MFAA 4AYBC 3GQCA 5ALTA 4DQRA 4IR1A 4G3IA 2HCFA 4RPYA 1XSNA 4DSEA 4PHPA 4QWCA 3QU5A 1L5UA 1T8EA 4FBUA 5ALFA 7ICJA 1COKA 5J2GA 3HILA 2XY6A 3UPQA 1NJYA 2G0AA 2PFQA 4QZCA 3THVA 4O5KA 1TK5A 2ZIUA 3NVYA 3H4DA 2YTUA 4C7ZA 8ICCA 3ICXA 1NKBA 1QQ5A 3OPXA 2UVWA 5DB6A 2ZIVB 2K4IA 5ALDA 5BOMA 5EWGA 1Z1VA 2R8HA 2ESEA 2JGAA 4PGYA 1XS9D 2PXIA 2RRDA 1NK6A 3RB0A 2H3IA 5T14A 8ICLA 1DGJA 5KG5A 1XC9A 4P0PA 4C80A 4UAWA 1QH9A 2RDIA 2MSNA 4BWJA 3GIIA 2P6UA 2LPEA 2ASLA 4QZDA 3C21A 1JUDA 3Q8QB 4RNOA 4NLNA 4IRDA 1BPXA 1NZPA 5DB9A 1TV9A 2RDJA 1ZOLA 4JV1A 3H0MB 2RP5A 1K1QA 3WK8A 4RT3A 4B9VA 1QQ6A 2KIVA 4GFJA 5AKXA 1N63A 3HW8A 3ZDBA 5GTIU 2A19A 4Y2TA 4K4HA 2LHTA 1DK3A 3ZDEA 2PFOA 1X6IA 3MDCA 4ECRA 1P7DA 5J0PA 5HP4A 2Q0ZX 2YQEA 2KP7A 3QZ7A 3IN5A 4DO9A 1DXSA 7ICPA 1L8LA 1PUZA 5AKKA 1RXVA 3SD7A 3M8SA 5DBCA 1ZQCA 4EBCA 1ZYQA 1X2IA 5ALZA 1S10A 4DL6A 4I27A 3UM9A 5KFYA 3QU2A 5AK5A 4PL1A 5J2JA 8ICFA 3R9KA 2IOHA 5KFBA 2P35A 1MC8A 3PSPA 2JEJA 4J9QA 5IIMA 2W3SA 1MSWD 4KLSA 1OW5A 2YX8A 4QWDA 1T4GA 4FS2A 3D2NA 4F3OA 4PJ0U 1VDVA 3KFUF 3MGVA 4DF8A 3NVZA 4RQ1A 1L3TA 4TQSA 1L7PA 2W9CA 1XSPA 4YR0A 4CNQA 9ICAA 4KTQA 2QB0A 1ZQLA 4ECSA 3RR7A 2H3QA 4I2JA 2GLEA 4YN4A 4UW9A 4NWIA 1L7MA 4CF4A 8ICUA 1Z3EB 5J2BA 3WK4A 2YY6A 5D46A 1IIPA 4F92B 1RPLA 1V97A 2AH5A 4DQQA 2N1RA 1SWWA 1X42A 3AQFA 3IRUA 5DBBA 4DL4A 5DQGA 4WJ3B 2JH7A 4J9RA 9ICTA 4IQWA 5ALMA 1HUZA 1D9DA 5KG4A 4M0AA 4R8UB 2XY7A 4NLZA 4NV0A 4I2CA 2EZXA 2MUTA 1ZQPA 5IIKA 1B0XA 2FDRA 3GIJA 4YMOA 2DUYA 2BDUA 4O3MA 7ICMA 2YMPA 4NJ8A 8ICJA 5KFOA 4UBBA 2F77X 4ECTA 4DFMA 5KFTA 4IS7A 3PVXA 4UARA 5CHGA 3Q8KA 1U47A 4P0PB 4B9NA 2KFZA 2AGOA 4M04A 1S0MA 4EYIB 5KFZA 2C2RA 2ATLA 3OGUA 4JK1A 3PW5A 5AI4A 4M47A 1D8LA 4J9LA 2WF7A 3C5FA 2E1FA 3RH6A 4F71A 4GC6A 4F91B 3RFAA 5J8YA 1QLNA 1SWVA 3N7PD 3JPOA 1KEJA 4EZ9A 3HWTA 2K4PA 4GXJA 2HBLA 1B4FA 2D8CA 3KHHA 5FP0A 2W7OA 3M9MB 5AICA 5ALJA 1U4BA 1ZQBA 5AM4A 3M7DA 4EBDA 1FEZA 3OHAA 2ZJAA 1HUOA 3LWMA 8ICNA 3QU9A 2W55A 1ZD5A 4B6JA 1L7NA 1V85A 7ICGA 3PX4A 2WAQF 1Z1BA 4LZGA 1D8YA 3SEIA 2BGWA 5AI9A 1A77A 3MBYA 2F3NA 3H7IA 5KFAA 3RF9A 4RQ0A 5ALNA 3RJFA 2MA1A 2Y9UA 1UHUA 5AIAA 4UATA 2E8NA 1JMSA 3QUBA 5J0RA 3BZKA 3KHLA 2ZXIA 5DB7A 2YMMA 1KKXA 3PR4A 2K8AA 2WAQC 2KD1A 2ODGA 3RBEA 5KFLA 2ZIXA 5CP2A 5G5GA 2LKYA 2WF6A 4CF5A 4LVSA 1NOMA 4KLHA 3FDSA 2PFPA 4O3OA 2NYVA 2KSOB 4Y2RA 4F2RA 4GIBA 1RQLA 4PPXA 3GIKA 5CR0A 3E2EA 2W54A 3TANA 5F3XB 2UVRA 4XUSA 1NNLA 4IR9A 2KHVA 2I6XA 4A8EA 3T5KA 5GTHU 4C8LA 2AU0A 2PKEA 1N5XA 2B0CA 2KN7A 3OJUA 5CEHA 2E8OA 2Y1IA 2HOQA 2ZTCA 4NLBA 2Y0SC 1ZQRA 4B9TA 2VJ5A 4RQMA 5AM0A 3C5GA 7ICLA 2I5HA 3LDAA 2GWSA 8ICIA 1ZQYA 4DFKA 8ICBA 2OCEA 4UB2A 3AUOA 3BQTA 2W11A 3C23A 2F1IA 3IG8A 3F2CA 2ALZA 4BXOB 4CCHA 5ALGA 1N56A 2FPKA 2ZIVA 2XCAA 3BS7A 2MAXA 4DOAA 5AM1A 4US8A 4O3PA 5DGBA 5KAIU 1WCNA 2WTFA 2BR0A 1BPBA 2Y1JA 2DL0A 2ZJ5A 3NVVA 3EW9A 3LVWA 2BPFA 3ONNA 2P6RA 4J9KA 3AQEA 4PL2A 4DFDA 4DF4A 1L3SA 4I2EA 3SAFA 4EX6A 1JN3A 3L3FX 1RXWA 4QZ8A 4QZHA 1H38A 4O3QA 3V6HA 1TVAA 1JRPA 2LM4A 3Q8PB 1Z4OA 2NRVA 1SKSA 4DS4A 5E79U 3D2QA 2FJ6A 3MR6A 5KT3A 2BPGA 9ICFA 4EENA 1UA0A 8ICVA 9ICPA 1PZNA 3MDAA 3RBDA 2XO7A 2KK0A 1PVPA 1X9MA 4F4WA 3KOOA 4QIWF 3CRXA 2W04A 2OM6A 5EE0A 4YD2A 8ICXA 3PO4A 5KNIA 7ICRA 1MA7A 1SZPA 5B5EU 4YG2A 2K89A 3H8MA 1ZQEA 2W43A 4O5EA 1KL9A 1LVHA 4QW9A 2CN1A 4DEZA 4F8RA 2E8MA 5HR6A 2VA8A 3Q8LA 2J6UA 5KFNA 3ISCA 1WWUA 5DBAA 2D6FC 5ALRA 5BOLA 3HKZF 1NJZA 3AEVA 5ALWA 1A76A 4OD0A 4RQNA 2QARB 1S0OA 3JPPA 4KN4A 3RJGA 4B9UA 2WB1F 3EPGA 3NUQA 4CF3A 4RQ6A 5HR7A 3K1ZA 4IQUA 2CRXA 4F93B 4DLEA 2E8PA 3N7RC 1AQ6A 3GV8B 1NK9A 2KJ5A 2K8BB 3TADA 4YXMA 1M6YA 1TK8A 5DKWA 1Z4NA 5J2FA 5DLFA 3KKAA 4IQVA 3PO5A 3M6KA 3V6JA 1S97A 2DKXA 4YP3A 4EEKA 1X9SA 4HAIA 5DG9A 2WB1C 3TKAA 3PZPA 4IL6U 1JX4A 4C7YA 1KLNA 1QTMA 4OJLA 4QZAA 1N5WA 1TFRA 4C8MA 5KL1B 2UVVA 7ICUA 5HHHA 1RZTA 5J2AA 3AL0B 2OH2A 3ED5A 1SL2A 5CWRA 5AK6A 9ICBA 2IHMA 4R66A 2BZFA 3NRZA 1SL1A 1Q3UA 4F5PA 2KMDA 4XRHA 9ICKA 4Y2YA 4BUGA 3F53A 2BCRA 2MU2A 4I2GA 3TACB 4JV0A 5J2DA 2HOIA 4RQ3A 3TFSA 1NK5A 4MFFA 4O9MA 3A0HU 2WFAA 3QU7A 1T94A 2FMSA 7ICVA 3KHRA 2JH1A 4QZ9A 2LMRA 3DEEA 4R8UA 1CUKA 3ZDCA 3C1YA 4DLGA 3PW0A 3WK9A 2KJ8A 5KFWA 4BWMA 2WF5A 4Y2VA 3QE9Y 1RG6A 3HRDD 1NK0A 3ZD9A 1IXRA 3N97B 5KFJA 5IIIA 5J2HA 1KFTA 4O3SA 1BVSA 1NK8A 2BQ3A 1QSSA 4Q43A 3RAQA 1FIQA 4KX5A 3PNCA 4OJ5A 5ALSA 3G6YA 4F72A 2ZTEA 3QX7A 2HI0A 3V7JA 3RB6A 5ALYA 9ICIA 4J9NA 4F50A 1ZETA 2L5YA 4IQTA 3ALRA 3N28A 2QKQA 4M9NA 5KFFA 1ZJNA 1DGSA 2XI9A 2FMPA 3Q8MA 3BQ0A 4O3NA 5CB1A 4M9HA 2HHXA 4KLJA 3NS1A 8ICTA 4RQ2A 7ICSA 3ORYA 3GIMA 5J0QA 3C29A 2B21A 5AM5A 5AKEA 3L4PA 2YMLA 3SMVA 4O5CA 4Q8EA 2HHQA 4I2IA 1BGXT 5DQHA 4M9LA 4YD1A 5DG8A 4IC9A 5TISU 4IRKA 3LYSA 4QZGA 1JXLA 4RPZA 2HHTA 8ICYA 4KLDA 2H5XA 9ICVA 4J9SA 5ALEA 4K4IA 2Z7JA 4EYHB 4M9JA 2KKVA 4QZFA 4ED2A 2ZUBA 5DG7A 1N48A 2VANA 4KMUA 5EE1A 4NM1A 1XO0A 5ALOA 3DDHA 4FZNA 2R8JA 1X6JA 2W9AA 2ZUCA 5AK3A 3UXNA 5AIBA 5J0XA 2PI4A 8ICHA 3NRWA 5A0LA 2ZJ8A 4UBCA 2QB1A 5ALLA 1UA1A 2G07A 1KSPA 1UT8A 7ICIA 2KSOA 2BPCA 4DCCA 2A1JB 9ICGA 5J2KA 4F4XA 3I1YA 5JUMA 1DOQA 4DQSA 2F2AB 4UB5A 1X9WA 1ZXIA 4Y2XA 4FE3A 3RRGA 3U26A 1WUDA 1WWVA 4C8NA 2JRZA 3B9JA 4DQIA 2EQYA 1SV0A 1VJ5A 5CRXA 5JU5A 1A0PA 4YXJA 5KFKA 1KRPA 3H4BA 2KZ3A 3T79A 5AKJA 2CXYA 1S9FA 1XU4A 1LB2B 5KFIA 3GV5B 4I2HA 4B9SA 4EX7A 4BXOA 1NI3A 3EZ5A 3PSFA 2JHDA 1NZBA 1N61A 3IP4B 3EPIA 1WYGA 1NKEA 1QSYA 3PMNA 2BDPA 3TAQA 1S77D 1U45A 2IOFA 5ALHA 3QU4A 3SI8A 1RDFA 4I28A 3RAXA 1ZQOA 2HHWA 1A6SA 1ECWA 3ZD8A 1Z00B 5C0YA 1QSLA 4NL9A 1ZQAA 4ELTA 5J29A 1S5LU 5D49A 1JROA 5AI6A 1ZQHA 4F5QA 4ED1A 1SV4A 3WK5A 1UCVA 3BQ2A 3WKAA 3A0BU 3Q8RB 4JWNA 2F76X 4JV2A 4RQ5A 3HP6A 5AKIA 4PGQA 2W8KA 3ZDAA 8ICSA 1SXEA 4KLQA 2KIWA 1F44A 2ASDA 4NL9C 4UB8U 3PX0A 3GILA 5JTIA 3UMCA 2R8KA 3ETLA 3TI0A 1KDHA 3C2LA 8ICMA 3BQ1A 1OXJA 4JWMA 3OTQA 2EH9A 2W3RA 1KTQA 4CDGA 2B6GA 4ED7A 3MFHA 2HBMA 5ALXA 5C5JA 3TQ1A 1V9PA 5EWEA 2W9BA 3RTVA 4MEXA 4ED3A 2P66A 4J03A 5KG0A 5J8YC 2HSZA 1BPZA 8ICAA 5J0YA 3NGDA 4DQPA 4Z6FA 2XCPA 5L9XA 4RT2A 2GH1A 2QARA 4R65A 4P4OA 3MABA 5KG7A 5KFCA 1N60A 2BQRA 4DS5A 4QZIA 4NM2A 1ZJMA 2K60A 3WKEA 3M8RA 5ALIA 3SAHA 2OXOA 4Y2PA 5KAFU 3G6XA 2C22A 3FAHA 3IHQB 4Y2QA 4FBTA 4O3RA 9ICWA 5BPCA 2G5HB 3SV3A 4RNNA 9ICHA 4P2HA 2BKEA 3V7KA 4ECQA 3UMGA 4ED0A 5TZVA 1NKCA 3QEAZ 1T3QA 3TFRA 1IM4A 3CYMA 4DWIA 3RJHA 1Q8KA 3QUTA 5KFDA 2Y9TA 2PMZF 1BNOA 4NXZA 1XO1A 3JPQA 1C7YA 5AKHA 2IMWP 3DV9A 2YN4A 5G5HA 2ZG6A 1NK7A 4KLUA 2F1JA 4F5RA 1O08A 4EEYA 1ZRNA 1PVRA 8ICEA 2JXJA 1UT5A 4ECYA 2NV3A 3LK9A 5KFSA 1TE2A 2W9MA 1MQ3A 5H2FU 4EBEA 3OJSA 7ICQA 3CW2C 8ICRA 5DGAA 3MGIA 3RH5A 5KFRA 1J2NA 1U49A 2WF9A 3WKDA 5HMLA 5ALUA 5KG1A 3NASA 1ZQQA 5EE9A 5ALKA 1CEZA 2BHNA 2AXTU 2KZZA 2KVSA 2KFNA 5J2CA 4KITB 1ZQFA 4J9OA 4C4TA 1RM6C 4TUSA 1F0MA 3H0RB 1U48A 8ICQA 2C2EA 2ZXHA 2A1AA 3GZFA 2FLNA 4OJ6A 3ZI4A 4C0ZA 4ECVA 2XGPA 2NRZA 3PW7A 2W03A 4FZLA 4YQWA 2DPJA 2HBKA 3V6KA 2M9NA 3C2KA 2H3ZA 1RYRA 4PZNA 5CJ7A 9ICLA 4Y2JA 4BDPA 3PY8A 5L1JA 4RZRA 2EZZA 1ZQTA 2HDOA 3HT3A 4M2YA 5AK4A 3RJJA 3KZIU 4UQGA 2E1EA 1ZQVA 2JEFA 1KFDA 4ECUA 2HHVA 2DQNB 2KG5A 2W9BB 4UAZA 3H8JA 1DRGA 3T5LA 1S8OA 7ICFA 4MEYA 9ICQA 1LKYB 2RHFA 1QQ7A 4QWAA 1CRXA 2KZMA 2O6KA 3AMZA 3MR2A 4Q8FA 4QIWC 4ED6A 1RYSA 4B9MA 2ES6A 3JPNA 8ICZA 2V4RA 2F8KA 5DQIA 2HBJA 4ELVA 2XIDA 5L1MA 3H8SA 3BDPA 1FFUA 5HMMA 3C1ZA 3M9OB 1ZQIA 2JZBB 3JPRA 4NLKA 2RQ5A 3HKZC 4DL3A 5KT2A 3FC4A 2LYHA 3C2MA 3RJEA 3AM9A 4CRXA 1RYUA 3F2BA 1SXDA 3PW4A 4USAA 1NJXA 1DK2A 1X9XA 4RQ4A 1NK4A 5J0UA 1ZD4A 2A1JA 8ICOA 5KFEA 4Z6DA 5KFQA 3TADC 4AYBF 4NLGA 2VKQA 1F5SA 1D9FA 4YFKA 3KKAC 4YVZA 3TARA 4ECXA 1SGGA 2KICA 3PSTA 2ZUDA 2NRTA 3BJYA 1L3VA 3E58A 1Q3VA 3UXOA 4TUQA 4PGXA 4Z6EA 3H40A 3UXPA 1MQ2A 1SZHA 1KFSA 5IIOA 4J9MA 3JPSA 5HHIA 1O03A 1GO3F 1UPHA 2IHNA 5EE3A 3GFKB 2XY5A 5KT4A 4TUPA 3ISBA 3IM1A 4M6WB 3PSIA 4KLEA 3QZ8A 3L5KA 3LWLA 4DL2A 1HIWA 1HEKA 4RQ8A 1JI7A 4LZDA 4KLGA 3KBBA 5AM3A 1ZRMA 5J2EA 1N62A 1Z00A 4MF2A 4F5NA 5KL8B 3KTQA 2KEYA 5ALQA 2FPLA 1ZQJA 3OHBA 4RU9A 2YMQA 3BZCA 4YMNA 5D4BA 7ICNA 4HYKA 3AU6A 1ZQNA 1L8OA 1T3NA 1EXNA 3PMLA 2VA2A 1MN8A 2M0NA 4JUZA 3S6JA 1ZQUA 2R18A 3T3FA 4PHAA 5KG3A 3QYPA 3NVWA 5KFMA 9ICJA 1K1SA 1PK3A 4PHDA 1V38A 1IG6A 4RPXA 1ZQKA 2A3VA 1ZQWA 4Y2SA 3UQ2A 2HHUA 4UAVA 2OYYA 3GDXA 2F8LA 4OJOA 2ISPA 1WCLA 4KLFA 1ZQZA 3VC8A 4M9GA 4FO6A 1KN5A 3LVVA 2H3VA 5IIJA 4GXIA 7ICOA 3M9NB 1ZQ1C 3F2DA 4DL7A 2KHQA 3QUQA 2FLPA 2DKZA 2IOFK 4LJXA 1XNSA 5ALPA 2ASJA 5JRTA 3K1RB 2BCQA 2ISOA 4J9PA 3KZXA 3I76A 3N4MB 4UAUA 3QUCA 3OSNA 2JEGA 4I2FA 2DPIA 4YCXA 4BJQA 4ED8A 5J0WA 2DBYA 2JR5A 2LM1A 1S76D 2ZIWB 2KV2A 3WK7A 4ELUA 8ICWA 3SQIA 4QWBA 1BNPA 2G08A 4NLCA 3SV4A 4BGDA 4I2DA 2QLTA 4UAYA 3PR5B 3QNMA 3HJEA 1TKDA 1PK1B 1ZQXA 4P0QB 4KLMA 5F9NA 4XA5A 3BS5B 5DDMA 2HVHA 2ZTDA 3ISDA 1YT3A 4NY8A 1ZQMA 2KNJA 2LYBA 2YB1A 1IV8A 2XGQA 2V9WA 5DDYA 2LBOA 1BPYA 8ICPA 4C8OA 2HHSA 3E0FA 4MFCA 1OUQA 5J0TA 3B0XA 2CPRA 2NO4A 4X5VA 3M1YA 1ZQGA 4KX3A 3CP8A 1CI4A 3SZ2A 2JEIA 2EZYA 3T5JA 3K4GA 1JIHA 1SV0C 5AKLA 3V7LA 4YMMA 2I9GA 2FMQA 3FM9A 3NTUA 2ZIUB 4US9A 3MR3A 3G6VA 4DFPA 2G06A 2GO7A 2FPMA 4C4SA 3SYZA 9ICRA 2KKPA 3WK6A 7ICHA 4QZEA 4RUAA 3MFIA 3QEBZ 2BCVA 4ZH4A 9ICXA 4ECZA 4CGZA 3GV7B 1SKRA 9ICCA 5B66U 2AQ4A 5DLGA 4C4RA 2C28A 1TAQA 5AM2A 2D3DA 4GLXA 3SENA 2DFLA 5KG2A 2W8LA 1Q46A 3TAPA 2C2DA 2RLTA 5IILA 2G5IB 2OHFA 4TURA 5AI8A 4RUCA 3RB3A 4QJFB 5K4LA 5L1LA 1ZD2P 4F4YA 3EUB2 2IA6A 4DOBA 2K4EA 3CNHA 5L1IA 2E3TA 4PH5A 1SL0A 2VA3A 4OCZA 5J0OA 2J6TA 1URJA 2KJ9A 1ZQDA 1ZD3A 9ICUA 3I28A 1SIJA 4OJPA 5KG6A 2Q4TA 4EZ6A 2VIXA 1L6NA 2NRXA 3OSPA 3RR8A 1L7OA 1LKYA 4G9BA 8ICKA 1BPDA 5KFXA 1J97A 1ED1A 5EWFA 2UVUA 3MC1A 4DSKA 9ICMA 2HW3A 4U7CA 2FE9A 4ZOHC 4UB1A 4GXKA 3H8WA 2KVCA 3EYZA 1JXEA 4K4GA 3RH4A 1FO4A 3ETRA 3VCBA 4DFJA 5EOZA 3H0LB 2NRWA 2K4HA 2J6SA 2BCUA 2JZBA 2YB4A 5KFVA 4R64A 4E0DA 3GU3A 1KQQA 2AHOB 9ICSA 3IDWA 3SR6A 3MR5A 2JV3A 1T7PA 2OEHA 5KT5A 4PZOA 2H3FA 4Y2UA 2KTQA 3MGHA 1L3UA 5DB8A 2I1QA 5KT7A 2PFNA 1N2XA 4F5OA 3FYHA 1COOA 2VJ4A 1WG8A 4Q45A 1BPEA 2W7PA 3EWAA 2LI6A 4FS1A 4DSIA 1Y88A 7ICTA 2XC9A 4F2SA 2Y0SF 1TAUA 2W9CB 1X40A 1NJWA 4KLIA 1YZ6A 5AKZA 2QB0B 2IBKA 4MF8A 4P4MA 2EAPA 2BQUA 2PMZC 4F4ZA 4CE6A 1J2MA 3C28A 1LV5A 3T5HA 4ECWA 7ICEA 2LYAA 4DSLA 5AHXA 3PX6A 2MRLA 3PW2A
chains in the Genus database with same CATH topology
2KNJA 2R18A 2LYBA 3N7SC 4OJPA 4BX9C 3IP4B 1Z19A 4P0PB 2G09A 2Q4TA 1KBUA 4BUGA 3F53A 2ZXHA 4CRXA 3F2BA 4OO1J 2XICA 3GZFA 2YB1A 4OJ6A 4IC9A 4PL1A 4C0ZA 3LYSA 2VIXA 2OXOA 3SAHA 1L6NA 1PVPA 2W03A 3PSPA 2DF4B 3O0FA 4FZLA 2HBKA 2JGAA 2G5HB 2A3VA 2HOIA 3IG5A 2OYYA 4QIWF 4AYBF 1T94A 2LBOA 2F8LA 1ED1A 1ECWA 2H3ZA 2OM6A 2RRDA 2W04A 2YX8A 4OJOA 3CRXA 4U6PA 2VKQA 3F5AA 5C0YA 2E1FA 2H3IA 2KHVA 2Z7JA 3D2NA 2ZIWA 3E0FA 3VC8A 4A8EA 5T14A 4U7CA 1OUQA 2JH1A 2CPRA 3KFUF 3CYMA 3MGVA 2KKVA 1TAMA 2E5SA 3DEEA 3LVVA 2H3VA 4P0PA 1MA7A 4FZMA 2HOQA 2XVTA 4KX3A 2KICA 3CP8A 3PSTA 2K89A 2KVCA 4NLBA 3RFAA 2Y0SC 1D8BA 2PMZF 2VJ5A 3N7PD 3H0RB 1ZQ1C 2CN1A 3F2DA 1Q3VA 3VCBA 5HR6A 2H3QA 2KJ8A 2KHQA 2ZIUB 3H0LB 2F76X 2E1EA 2K4HA 2HBLA 2ZIXB 4NWIA 1XO0A 2D6FC 4P0QA 2W7OA 3HKZF 4FZNA 2G06A 1XNSA 2KOBA 1SZHA 4ACOA 2YB4A 3IG8A 3F2CA 3GU3A 3M7DA 2ZG6A 2KKPA 2DQNB 1IIPA 3M6ZA 3NRWA 2KIWA 5A0LA 1F44A 2WB1F 3NUQA 1PVRA 1GO3F 1UPHA 2ZIVA 3KZXA 2HOFA 3H0MB 2RP5A 2G07A 4CGZA 2H3FA 2N1RA 3K1ZA 1DRGA 5HR7A 2CRXA 2NV3A 4KX5A 4OJ5A 3N7RC 3AQFA 2WAQF 1Z1BA 2RHFA 4BJQA 4ICAA 3PSIA 2KJ5A 2K8BB 4GFJA 4JMUA 1CRXA 1A6SA 1HIWA 4WJ3B 2JH7A 1HEKA 2F2AB 2VJ4A 3F5EA 3RF9A 2LHTA 4FE3A 2GOLA 4CDGA 2MA1A 2ZIWB 1WUDA 2G5IB 2W7PA 4AYBC 2KV2A 4QIWC 3ALRA 2HBMA 1PVQA 3LVWA 5KL8B 3ONNA 3SQIA 3M6KA 4QJFB 2KEYA 3SAGA 2Y0SF 2HMXA 2XI9A 2WB1C 3PZPA 1P7DA 2G08A 2K8CB 3AQEA 2K4EA 4NLCA 4NV0A 4PL2A 3D2SA 2HBJA 2ZXIA 3SAFA 4KMOB 3L3FX 2XIDA 4OJLA 5KL1B 2G0AA 5CRXA 4QNLA 3IN5A 2PMZC 1A0PA 3AL0B 2OH2A 2BDUA 2K8AA 2WAQC 4O3MA 2KD1A 2ZIUA 4P0QB 3T79A 2ZIXA 3C28A 3C29A 2F77X 2DGZA 3ICXA 3D2QA 3SMVA 2LYAA 3OPXA 1URJA 2GH1A 2KJ9A 2LKYA 2M0NA 3HKZC 1YT3A 1Q3UA 2MRLA 3PSFA 2JMGA 2ZIVB 2JHDA 1NZBA 2K4IA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1GO3 F;  4CGZ A;  4NLC A;  4NLB A;  4OO1 J;  2HBJ A;  1D8B A;  3SAF A;  3SAH A;  2RHF A;  2HBK A;  4O3M A;  2E1E A;  4QJF B;  2HBL A;  4QIW F;  2DGZ A;  2RRD A;  4CDG A;  2MA1 A;  5C0Y A;  1WUD A;  2E1F A;  2KV2 A;  2HBM A;  1YT3 A;  2CPR A;  3CYM A;  3SAG A; 
#chains in the Genus database with same CATH topology
 3N7S C;  1Z19 A;  2G09 A;  1KBU A;  4TQR A;  4F4K A;  3RRH A;  3WKC A;  5AKY A;  4DOC A;  3O0F A;  1X66 A;  4DSJ A;  4M6W A;  1XWL A;  3IG5 A;  4YR3 A;  1SKW A;  4EEL A;  5KTQ A;  1ARO P;  3F5A A;  5IIN A;  3ZDD A;  5KFP A;  1B22 A;  5KFU A;  4UB3 A;  3KHG A;  2EAM A;  2XVT A;  2MUT B;  4UAS A;  1RQN A;  1U9L A;  4XQ8 A;  4Q44 A;  4C8K A;  2F1H A;  2AJQ A;  1KW4 A;  4KLT A;  2KOB A;  4UB6 U;  2FLL A;  3V72 A;  3M6Z A;  4KLL A;  2AQ0 A;  4I2B A;  3KD3 A;  7ICK A;  2PI5 A;  3AN1 A;  4FFD A;  3PV8 A;  4I2A A;  1S0N A;  4R63 A;  2OWO A;  2DWQ A;  2V4Q A;  4ICA A;  1UQV A;  2EAN A;  8ICG A;  5ALV A;  3F5E A;  3UQ0 A;  3JPT A;  2WHE A;  1VLB A;  4P4P A;  4KN7 A;  1PVQ A;  5AKG A;  5CA7 A;  4YR2 A;  3SAG A;  4IRC A;  2HMX A;  2K8C B;  5J2I A;  2AGQ A;  3D2S A;  5L1K A;  2WF8 A;  5KFH A;  2R8I A;  4KMO B;  3J81 j;  3RJI A;  9ICO A;  4QNL A;  2EDU A;  4UB4 A;  1FFV A;  2HVI A;  1TK0 A;  1SB3 C;  1K5O A;  4QWE A;  2DGZ A;  4I29 A;  3BQ7 A;  1B43 A;  3K75 D;  1HJP A;  2NO5 A;  5AI5 A;  3HPO A;  4RNM A;  3D6J A;  3Q8S B;  4QW8 A;  2JMG A;  4BX9 C;  3IV6 A;  5KT6 A;  5J0S A;  1S0V A;  4OO1 J;  2XIC A;  3RB4 A;  4KLO A;  2DF4 B;  2R8G A;  3RJK A;  2BCS A;  4DSF A;  9ICE A;  4U6P A;  2ZIW A;  4DL5 A;  4RQ7 A;  2AGP A;  1TAM A;  2E5S A;  5KFG A;  4FZM A;  2FI1 A;  3AU2 A;  1D8B A;  3UMB A;  4AP9 A;  5HNK A;  1YZ7 A;  4GC7 A;  3WU2 U;  1JAL A;  1PK1 A;  2ZIX B;  4P0Q A;  4Z6C A;  4MHV A;  3BS5 A;  2KE7 A;  4ACO A;  4JB3 A;  3HX0 A;  3WKB A;  1C20 A;  2EAO A;  2HOF A;  4O0I A;  1XSL A;  4PHE A;  1ZQS A;  3B0Y A;  9ICN A;  4QZB A;  4JMU A;  3QXG A;  2F44 A;  4B9L A;  5AI0 A;  2GOL A;  1QCK A;  5F9L A;  4MFA A;  4AYB C;  3GQC A;  5ALT A;  4DQR A;  4IR1 A;  4G3I A;  2HCF A;  4RPY A;  1XSN A;  4DSE A;  4PHP A;  4QWC A;  3QU5 A;  1L5U A;  1T8E A;  4FBU A;  5ALF A;  7ICJ A;  1COK A;  5J2G A;  3HIL A;  2XY6 A;  3UPQ A;  1NJY A;  2G0A A;  2PFQ A;  4QZC A;  3THV A;  4O5K A;  1TK5 A;  2ZIU A;  3NVY A;  3H4D A;  2YTU A;  4C7Z A;  8ICC A;  3ICX A;  1NKB A;  1QQ5 A;  3OPX A;  2UVW A;  5DB6 A;  2ZIV B;  2K4I A;  5ALD A;  5BOM A;  5EWG A;  1Z1V A;  2R8H A;  2ESE A;  2JGA A;  4PGY A;  1XS9 D;  2PXI A;  2RRD A;  1NK6 A;  3RB0 A;  2H3I A;  5T14 A;  8ICL A;  1DGJ A;  5KG5 A;  1XC9 A;  4P0P A;  4C80 A;  4UAW A;  1QH9 A;  2RDI A;  2MSN A;  4BWJ A;  3GII A;  2P6U A;  2LPE A;  2ASL A;  4QZD A;  3C21 A;  1JUD A;  3Q8Q B;  4RNO A;  4NLN A;  4IRD A;  1BPX A;  1NZP A;  5DB9 A;  1TV9 A;  2RDJ A;  1ZOL A;  4JV1 A;  3H0M B;  2RP5 A;  1K1Q A;  3WK8 A;  4RT3 A;  4B9V A;  1QQ6 A;  2KIV A;  4GFJ A;  5AKX A;  1N63 A;  3HW8 A;  3ZDB A;  5GTI U;  2A19 A;  4Y2T A;  4K4H A;  2LHT A;  1DK3 A;  3ZDE A;  2PFO A;  1X6I A;  3MDC A;  4ECR A;  1P7D A;  5J0P A;  5HP4 A;  2Q0Z X;  2YQE A;  2KP7 A;  3QZ7 A;  3IN5 A;  4DO9 A;  1DXS A;  7ICP A;  1L8L A;  1PUZ A;  5AKK A;  1RXV A;  3SD7 A;  3M8S A;  5DBC A;  1ZQC A;  4EBC A;  1ZYQ A;  1X2I A;  5ALZ A;  1S10 A;  4DL6 A;  4I27 A;  3UM9 A;  5KFY A;  3QU2 A;  5AK5 A;  4PL1 A;  5J2J A;  8ICF A;  3R9K A;  2IOH A;  5KFB A;  2P35 A;  1MC8 A;  3PSP A;  2JEJ A;  4J9Q A;  5IIM A;  2W3S A;  1MSW D;  4KLS A;  1OW5 A;  2YX8 A;  4QWD A;  1T4G A;  4FS2 A;  3D2N A;  4F3O A;  4PJ0 U;  1VDV A;  3KFU F;  3MGV A;  4DF8 A;  3NVZ A;  4RQ1 A;  1L3T A;  4TQS A;  1L7P A;  2W9C A;  1XSP A;  4YR0 A;  4CNQ A;  9ICA A;  4KTQ A;  2QB0 A;  1ZQL A;  4ECS A;  3RR7 A;  2H3Q A;  4I2J A;  2GLE A;  4YN4 A;  4UW9 A;  4NWI A;  1L7M A;  4CF4 A;  8ICU A;  1Z3E B;  5J2B A;  3WK4 A;  2YY6 A;  5D46 A;  1IIP A;  4F92 B;  1RPL A;  1V97 A;  2AH5 A;  4DQQ A;  2N1R A;  1SWW A;  1X42 A;  3AQF A;  3IRU A;  5DBB A;  4DL4 A;  5DQG A;  4WJ3 B;  2JH7 A;  4J9R A;  9ICT A;  4IQW A;  5ALM A;  1HUZ A;  1D9D A;  5KG4 A;  4M0A A;  4R8U B;  2XY7 A;  4NLZ A;  4NV0 A;  4I2C A;  2EZX A;  2MUT A;  1ZQP A;  5IIK A;  1B0X A;  2FDR A;  3GIJ A;  4YMO A;  2DUY A;  2BDU A;  4O3M A;  7ICM A;  2YMP A;  4NJ8 A;  8ICJ A;  5KFO A;  4UBB A;  2F77 X;  4ECT A;  4DFM A;  5KFT A;  4IS7 A;  3PVX A;  4UAR A;  5CHG A;  3Q8K A;  1U47 A;  4P0P B;  4B9N A;  2KFZ A;  2AGO A;  4M04 A;  1S0M A;  4EYI B;  5KFZ A;  2C2R A;  2ATL A;  3OGU A;  4JK1 A;  3PW5 A;  5AI4 A;  4M47 A;  1D8L A;  4J9L A;  2WF7 A;  3C5F A;  2E1F A;  3RH6 A;  4F71 A;  4GC6 A;  4F91 B;  3RFA A;  5J8Y A;  1QLN A;  1SWV A;  3N7P D;  3JPO A;  1KEJ A;  4EZ9 A;  3HWT A;  2K4P A;  4GXJ A;  2HBL A;  1B4F A;  2D8C A;  3KHH A;  5FP0 A;  2W7O A;  3M9M B;  5AIC A;  5ALJ A;  1U4B A;  1ZQB A;  5AM4 A;  3M7D A;  4EBD A;  1FEZ A;  3OHA A;  2ZJA A;  1HUO A;  3LWM A;  8ICN A;  3QU9 A;  2W55 A;  1ZD5 A;  4B6J A;  1L7N A;  1V85 A;  7ICG A;  3PX4 A;  2WAQ F;  1Z1B A;  4LZG A;  1D8Y A;  3SEI A;  2BGW A;  5AI9 A;  1A77 A;  3MBY A;  2F3N A;  3H7I A;  5KFA A;  3RF9 A;  4RQ0 A;  5ALN A;  3RJF A;  2MA1 A;  2Y9U A;  1UHU A;  5AIA A;  4UAT A;  2E8N A;  1JMS A;  3QUB A;  5J0R A;  3BZK A;  3KHL A;  2ZXI A;  5DB7 A;  2YMM A;  1KKX A;  3PR4 A;  2K8A A;  2WAQ C;  2KD1 A;  2ODG A;  3RBE A;  5KFL A;  2ZIX A;  5CP2 A;  5G5G A;  2LKY A;  2WF6 A;  4CF5 A;  4LVS A;  1NOM A;  4KLH A;  3FDS A;  2PFP A;  4O3O A;  2NYV A;  2KSO B;  4Y2R A;  4F2R A;  4GIB A;  1RQL A;  4PPX A;  3GIK A;  5CR0 A;  3E2E A;  2W54 A;  3TAN A;  5F3X B;  2UVR A;  4XUS A;  1NNL A;  4IR9 A;  2KHV A;  2I6X A;  4A8E A;  3T5K A;  5GTH U;  4C8L A;  2AU0 A;  2PKE A;  1N5X A;  2B0C A;  2KN7 A;  3OJU A;  5CEH A;  2E8O A;  2Y1I A;  2HOQ A;  2ZTC A;  4NLB A;  2Y0S C;  1ZQR A;  4B9T A;  2VJ5 A;  4RQM A;  5AM0 A;  3C5G A;  7ICL A;  2I5H A;  3LDA A;  2GWS A;  8ICI A;  1ZQY A;  4DFK A;  8ICB A;  2OCE A;  4UB2 A;  3AUO A;  3BQT A;  2W11 A;  3C23 A;  2F1I A;  3IG8 A;  3F2C A;  2ALZ A;  4BXO B;  4CCH A;  5ALG A;  1N56 A;  2FPK A;  2ZIV A;  2XCA A;  3BS7 A;  2MAX A;  4DOA A;  5AM1 A;  4US8 A;  4O3P A;  5DGB A;  5KAI U;  1WCN A;  2WTF A;  2BR0 A;  1BPB A;  2Y1J A;  2DL0 A;  2ZJ5 A;  3NVV A;  3EW9 A;  3LVW A;  2BPF A;  3ONN A;  2P6R A;  4J9K A;  3AQE A;  4PL2 A;  4DFD A;  4DF4 A;  1L3S A;  4I2E A;  3SAF A;  4EX6 A;  1JN3 A;  3L3F X;  1RXW A;  4QZ8 A;  4QZH A;  1H38 A;  4O3Q A;  3V6H A;  1TVA A;  1JRP A;  2LM4 A;  3Q8P B;  1Z4O A;  2NRV A;  1SKS A;  4DS4 A;  5E79 U;  3D2Q A;  2FJ6 A;  3MR6 A;  5KT3 A;  2BPG A;  9ICF A;  4EEN A;  1UA0 A;  8ICV A;  9ICP A;  1PZN A;  3MDA A;  3RBD A;  2XO7 A;  2KK0 A;  1PVP A;  1X9M A;  4F4W A;  3KOO A;  4QIW F;  3CRX A;  2W04 A;  2OM6 A;  5EE0 A;  4YD2 A;  8ICX A;  3PO4 A;  5KNI A;  7ICR A;  1MA7 A;  1SZP A;  5B5E U;  4YG2 A;  2K89 A;  3H8M A;  1ZQE A;  2W43 A;  4O5E A;  1KL9 A;  1LVH A;  4QW9 A;  2CN1 A;  4DEZ A;  4F8R A;  2E8M A;  5HR6 A;  2VA8 A;  3Q8L A;  2J6U A;  5KFN A;  3ISC A;  1WWU A;  5DBA A;  2D6F C;  5ALR A;  5BOL A;  3HKZ F;  1NJZ A;  3AEV A;  5ALW A;  1A76 A;  4OD0 A;  4RQN A;  2QAR B;  1S0O A;  3JPP A;  4KN4 A;  3RJG A;  4B9U A;  2WB1 F;  3EPG A;  3NUQ A;  4CF3 A;  4RQ6 A;  5HR7 A;  3K1Z A;  4IQU A;  2CRX A;  4F93 B;  4DLE A;  2E8P A;  3N7R C;  1AQ6 A;  3GV8 B;  1NK9 A;  2KJ5 A;  2K8B B;  3TAD A;  4YXM A;  1M6Y A;  1TK8 A;  5DKW A;  1Z4N A;  5J2F A;  5DLF A;  3KKA A;  4IQV A;  3PO5 A;  3M6K A;  3V6J A;  1S97 A;  2DKX A;  4YP3 A;  4EEK A;  1X9S A;  4HAI A;  5DG9 A;  2WB1 C;  3TKA A;  3PZP A;  4IL6 U;  1JX4 A;  4C7Y A;  1KLN A;  1QTM A;  4OJL A;  4QZA A;  1N5W A;  1TFR A;  4C8M A;  5KL1 B;  2UVV A;  7ICU A;  5HHH A;  1RZT A;  5J2A A;  3AL0 B;  2OH2 A;  3ED5 A;  1SL2 A;  5CWR A;  5AK6 A;  9ICB A;  2IHM A;  4R66 A;  2BZF A;  3NRZ A;  1SL1 A;  1Q3U A;  4F5P A;  2KMD A;  4XRH A;  9ICK A;  4Y2Y A;  4BUG A;  3F53 A;  2BCR A;  2MU2 A;  4I2G A;  3TAC B;  4JV0 A;  5J2D A;  2HOI A;  4RQ3 A;  3TFS A;  1NK5 A;  4MFF A;  4O9M A;  3A0H U;  2WFA A;  3QU7 A;  1T94 A;  2FMS A;  7ICV A;  3KHR A;  2JH1 A;  4QZ9 A;  2LMR A;  3DEE A;  4R8U A;  1CUK A;  3ZDC A;  3C1Y A;  4DLG A;  3PW0 A;  3WK9 A;  2KJ8 A;  5KFW A;  4BWM A;  2WF5 A;  4Y2V A;  3QE9 Y;  1RG6 A;  3HRD D;  1NK0 A;  3ZD9 A;  1IXR A;  3N97 B;  5KFJ A;  5III A;  5J2H A;  1KFT A;  4O3S A;  1BVS A;  1NK8 A;  2BQ3 A;  1QSS A;  4Q43 A;  3RAQ A;  1FIQ A;  4KX5 A;  3PNC A;  4OJ5 A;  5ALS A;  3G6Y A;  4F72 A;  2ZTE A;  3QX7 A;  2HI0 A;  3V7J A;  3RB6 A;  5ALY A;  9ICI A;  4J9N A;  4F50 A;  1ZET A;  2L5Y A;  4IQT A;  3ALR A;  3N28 A;  2QKQ A;  4M9N A;  5KFF A;  1ZJN A;  1DGS A;  2XI9 A;  2FMP A;  3Q8M A;  3BQ0 A;  4O3N A;  5CB1 A;  4M9H A;  2HHX A;  4KLJ A;  3NS1 A;  8ICT A;  4RQ2 A;  7ICS A;  3ORY A;  3GIM A;  5J0Q A;  3C29 A;  2B21 A;  5AM5 A;  5AKE A;  3L4P A;  2YML A;  3SMV A;  4O5C A;  4Q8E A;  2HHQ A;  4I2I A;  1BGX T;  5DQH A;  4M9L A;  4YD1 A;  5DG8 A;  4IC9 A;  5TIS U;  4IRK A;  3LYS A;  4QZG A;  1JXL A;  4RPZ A;  2HHT A;  8ICY A;  4KLD A;  2H5X A;  9ICV A;  4J9S A;  5ALE A;  4K4I A;  2Z7J A;  4EYH B;  4M9J A;  2KKV A;  4QZF A;  4ED2 A;  2ZUB A;  5DG7 A;  1N48 A;  2VAN A;  4KMU A;  5EE1 A;  4NM1 A;  1XO0 A;  5ALO A;  3DDH A;  4FZN A;  2R8J A;  1X6J A;  2W9A A;  2ZUC A;  5AK3 A;  3UXN A;  5AIB A;  5J0X A;  2PI4 A;  8ICH A;  3NRW A;  5A0L A;  2ZJ8 A;  4UBC A;  2QB1 A;  5ALL A;  1UA1 A;  2G07 A;  1KSP A;  1UT8 A;  7ICI A;  2KSO A;  2BPC A;  4DCC A;  2A1J B;  9ICG A;  5J2K A;  4F4X A;  3I1Y A;  5JUM A;  1DOQ A;  4DQS A;  2F2A B;  4UB5 A;  1X9W A;  1ZXI A;  4Y2X A;  4FE3 A;  3RRG A;  3U26 A;  1WUD A;  1WWV A;  4C8N A;  2JRZ A;  3B9J A;  4DQI A;  2EQY A;  1SV0 A;  1VJ5 A;  5CRX A;  5JU5 A;  1A0P A;  4YXJ A;  5KFK A;  1KRP A;  3H4B A;  2KZ3 A;  3T79 A;  5AKJ A;  2CXY A;  1S9F A;  1XU4 A;  1LB2 B;  5KFI A;  3GV5 B;  4I2H A;  4B9S A;  4EX7 A;  4BXO A;  1NI3 A;  3EZ5 A;  3PSF A;  2JHD A;  1NZB A;  1N61 A;  3IP4 B;  3EPI A;  1WYG A;  1NKE A;  1QSY A;  3PMN A;  2BDP A;  3TAQ A;  1S77 D;  1U45 A;  2IOF A;  5ALH A;  3QU4 A;  3SI8 A;  1RDF A;  4I28 A;  3RAX A;  1ZQO A;  2HHW A;  1A6S A;  1ECW A;  3ZD8 A;  1Z00 B;  5C0Y A;  1QSL A;  4NL9 A;  1ZQA A;  4ELT A;  5J29 A;  1S5L U;  5D49 A;  1JRO A;  5AI6 A;  1ZQH A;  4F5Q A;  4ED1 A;  1SV4 A;  3WK5 A;  1UCV A;  3BQ2 A;  3WKA A;  3A0B U;  3Q8R B;  4JWN A;  2F76 X;  4JV2 A;  4RQ5 A;  3HP6 A;  5AKI A;  4PGQ A;  2W8K A;  3ZDA A;  8ICS A;  1SXE A;  4KLQ A;  2KIW A;  1F44 A;  2ASD A;  4NL9 C;  4UB8 U;  3PX0 A;  3GIL A;  5JTI A;  3UMC A;  2R8K A;  3ETL A;  3TI0 A;  1KDH A;  3C2L A;  8ICM A;  3BQ1 A;  1OXJ A;  4JWM A;  3OTQ A;  2EH9 A;  2W3R A;  1KTQ A;  4CDG A;  2B6G A;  4ED7 A;  3MFH A;  2HBM A;  5ALX A;  5C5J A;  3TQ1 A;  1V9P A;  5EWE A;  2W9B A;  3RTV A;  4MEX A;  4ED3 A;  2P66 A;  4J03 A;  5KG0 A;  5J8Y C;  2HSZ A;  1BPZ A;  8ICA A;  5J0Y A;  3NGD A;  4DQP A;  4Z6F A;  2XCP A;  5L9X A;  4RT2 A;  2GH1 A;  2QAR A;  4R65 A;  4P4O A;  3MAB A;  5KG7 A;  5KFC A;  1N60 A;  2BQR A;  4DS5 A;  4QZI A;  4NM2 A;  1ZJM A;  2K60 A;  3WKE A;  3M8R A;  5ALI A;  3SAH A;  2OXO A;  4Y2P A;  5KAF U;  3G6X A;  2C22 A;  3FAH A;  3IHQ B;  4Y2Q A;  4FBT A;  4O3R A;  9ICW A;  5BPC A;  2G5H B;  3SV3 A;  4RNN A;  9ICH A;  4P2H A;  2BKE A;  3V7K A;  4ECQ A;  3UMG A;  4ED0 A;  5TZV A;  1NKC A;  3QEA Z;  1T3Q A;  3TFR A;  1IM4 A;  3CYM A;  4DWI A;  3RJH A;  1Q8K A;  3QUT A;  5KFD A;  2Y9T A;  2PMZ F;  1BNO A;  4NXZ A;  1XO1 A;  3JPQ A;  1C7Y A;  5AKH A;  2IMW P;  3DV9 A;  2YN4 A;  5G5H A;  2ZG6 A;  1NK7 A;  4KLU A;  2F1J A;  4F5R A;  1O08 A;  4EEY A;  1ZRN A;  1PVR A;  8ICE A;  2JXJ A;  1UT5 A;  4ECY A;  2NV3 A;  3LK9 A;  5KFS A;  1TE2 A;  2W9M A;  1MQ3 A;  5H2F U;  4EBE A;  3OJS A;  7ICQ A;  3CW2 C;  8ICR A;  5DGA A;  3MGI A;  3RH5 A;  5KFR A;  1J2N A;  1U49 A;  2WF9 A;  3WKD A;  5HML A;  5ALU A;  5KG1 A;  3NAS A;  1ZQQ A;  5EE9 A;  5ALK A;  1CEZ A;  2BHN A;  2AXT U;  2KZZ A;  2KVS A;  2KFN A;  5J2C A;  4KIT B;  1ZQF A;  4J9O A;  4C4T A;  1RM6 C;  4TUS A;  1F0M A;  3H0R B;  1U48 A;  8ICQ A;  2C2E A;  2ZXH A;  2A1A A;  3GZF A;  2FLN A;  4OJ6 A;  3ZI4 A;  4C0Z A;  4ECV A;  2XGP A;  2NRZ A;  3PW7 A;  2W03 A;  4FZL A;  4YQW A;  2DPJ A;  2HBK A;  3V6K A;  2M9N A;  3C2K A;  2H3Z A;  1RYR A;  4PZN A;  5CJ7 A;  9ICL A;  4Y2J A;  4BDP A;  3PY8 A;  5L1J A;  4RZR A;  2EZZ A;  1ZQT A;  2HDO A;  3HT3 A;  4M2Y A;  5AK4 A;  3RJJ A;  3KZI U;  4UQG A;  2E1E A;  1ZQV A;  2JEF A;  1KFD A;  4ECU A;  2HHV A;  2DQN B;  2KG5 A;  2W9B B;  4UAZ A;  3H8J A;  1DRG A;  3T5L A;  1S8O A;  7ICF A;  4MEY A;  9ICQ A;  1LKY B;  2RHF A;  1QQ7 A;  4QWA A;  1CRX A;  2KZM A;  2O6K A;  3AMZ A;  3MR2 A;  4Q8F A;  4QIW C;  4ED6 A;  1RYS A;  4B9M A;  2ES6 A;  3JPN A;  8ICZ A;  2V4R A;  2F8K A;  5DQI A;  2HBJ A;  4ELV A;  2XID A;  5L1M A;  3H8S A;  3BDP A;  1FFU A;  5HMM A;  3C1Z A;  3M9O B;  1ZQI A;  2JZB B;  3JPR A;  4NLK A;  2RQ5 A;  3HKZ C;  4DL3 A;  5KT2 A;  3FC4 A;  2LYH A;  3C2M A;  3RJE A;  3AM9 A;  4CRX A;  1RYU A;  3F2B A;  1SXD A;  3PW4 A;  4USA A;  1NJX A;  1DK2 A;  1X9X A;  4RQ4 A;  1NK4 A;  5J0U A;  1ZD4 A;  2A1J A;  8ICO A;  5KFE A;  4Z6D A;  5KFQ A;  3TAD C;  4AYB F;  4NLG A;  2VKQ A;  1F5S A;  1D9F A;  4YFK A;  3KKA C;  4YVZ A;  3TAR A;  4ECX A;  1SGG A;  2KIC A;  3PST A;  2ZUD A;  2NRT A;  3BJY A;  1L3V A;  3E58 A;  1Q3V A;  3UXO A;  4TUQ A;  4PGX A;  4Z6E A;  3H40 A;  3UXP A;  1MQ2 A;  1SZH A;  1KFS A;  5IIO A;  4J9M A;  3JPS A;  5HHI A;  1O03 A;  1GO3 F;  1UPH A;  2IHN A;  5EE3 A;  3GFK B;  2XY5 A;  5KT4 A;  4TUP A;  3ISB A;  3IM1 A;  4M6W B;  3PSI A;  4KLE A;  3QZ8 A;  3L5K A;  3LWL A;  4DL2 A;  1HIW A;  1HEK A;  4RQ8 A;  1JI7 A;  4LZD A;  4KLG A;  3KBB A;  5AM3 A;  1ZRM A;  5J2E A;  1N62 A;  1Z00 A;  4MF2 A;  4F5N A;  5KL8 B;  3KTQ A;  2KEY A;  5ALQ A;  2FPL A;  1ZQJ A;  3OHB A;  4RU9 A;  2YMQ A;  3BZC A;  4YMN A;  5D4B A;  7ICN A;  4HYK A;  3AU6 A;  1ZQN A;  1L8O A;  1T3N A;  1EXN A;  3PML A;  2VA2 A;  1MN8 A;  2M0N A;  4JUZ A;  3S6J A;  1ZQU A;  2R18 A;  3T3F A;  4PHA A;  5KG3 A;  3QYP A;  3NVW A;  5KFM A;  9ICJ A;  1K1S A;  1PK3 A;  4PHD A;  1V38 A;  1IG6 A;  4RPX A;  1ZQK A;  2A3V A;  1ZQW A;  4Y2S A;  3UQ2 A;  2HHU A;  4UAV A;  2OYY A;  3GDX A;  2F8L A;  4OJO A;  2ISP A;  1WCL A;  4KLF A;  1ZQZ A;  3VC8 A;  4M9G A;  4FO6 A;  1KN5 A;  3LVV A;  2H3V A;  5IIJ A;  4GXI A;  7ICO A;  3M9N B;  1ZQ1 C;  3F2D A;  4DL7 A;  2KHQ A;  3QUQ A;  2FLP A;  2DKZ A;  2IOF K;  4LJX A;  1XNS A;  5ALP A;  2ASJ A;  5JRT A;  3K1R B;  2BCQ A;  2ISO A;  4J9P A;  3KZX A;  3I76 A;  3N4M B;  4UAU A;  3QUC A;  3OSN A;  2JEG A;  4I2F A;  2DPI A;  4YCX A;  4BJQ A;  4ED8 A;  5J0W A;  2DBY A;  2JR5 A;  2LM1 A;  1S76 D;  2ZIW B;  2KV2 A;  3WK7 A;  4ELU A;  8ICW A;  3SQI A;  4QWB A;  1BNP A;  2G08 A;  4NLC A;  3SV4 A;  4BGD A;  4I2D A;  2QLT A;  4UAY A;  3PR5 B;  3QNM A;  3HJE A;  1TKD A;  1PK1 B;  1ZQX A;  4P0Q B;  4KLM A;  5F9N A;  4XA5 A;  3BS5 B;  5DDM A;  2HVH A;  2ZTD A;  3ISD A;  1YT3 A;  4NY8 A;  1ZQM A;  2KNJ A;  2LYB A;  2YB1 A;  1IV8 A;  2XGQ A;  2V9W A;  5DDY A;  2LBO A;  1BPY A;  8ICP A;  4C8O A;  2HHS A;  3E0F A;  4MFC A;  1OUQ A;  5J0T A;  3B0X A;  2CPR A;  2NO4 A;  4X5V A;  3M1Y A;  1ZQG A;  4KX3 A;  3CP8 A;  1CI4 A;  3SZ2 A;  2JEI A;  2EZY A;  3T5J A;  3K4G A;  1JIH A;  1SV0 C;  5AKL A;  3V7L A;  4YMM A;  2I9G A;  2FMQ A;  3FM9 A;  3NTU A;  2ZIU B;  4US9 A;  3MR3 A;  3G6V A;  4DFP A;  2G06 A;  2GO7 A;  2FPM A;  4C4S A;  3SYZ A;  9ICR A;  2KKP A;  3WK6 A;  7ICH A;  4QZE A;  4RUA A;  3MFI A;  3QEB Z;  2BCV A;  4ZH4 A;  9ICX A;  4ECZ A;  4CGZ A;  3GV7 B;  1SKR A;  9ICC A;  5B66 U;  2AQ4 A;  5DLG A;  4C4R A;  2C28 A;  1TAQ A;  5AM2 A;  2D3D A;  4GLX A;  3SEN A;  2DFL A;  5KG2 A;  2W8L A;  1Q46 A;  3TAP A;  2C2D A;  2RLT A;  5IIL A;  2G5I B;  2OHF A;  4TUR A;  5AI8 A;  4RUC A;  3RB3 A;  4QJF B;  5K4L A;  5L1L A;  1ZD2 P;  4F4Y A;  3EUB 2;  2IA6 A;  4DOB A;  2K4E A;  3CNH A;  5L1I A;  2E3T A;  4PH5 A;  1SL0 A;  2VA3 A;  4OCZ A;  5J0O A;  2J6T A;  1URJ A;  2KJ9 A;  1ZQD A;  1ZD3 A;  9ICU A;  3I28 A;  1SIJ A;  4OJP A;  5KG6 A;  2Q4T A;  4EZ6 A;  2VIX A;  1L6N A;  2NRX A;  3OSP A;  3RR8 A;  1L7O A;  1LKY A;  4G9B A;  8ICK A;  1BPD A;  5KFX A;  1J97 A;  1ED1 A;  5EWF A;  2UVU A;  3MC1 A;  4DSK A;  9ICM A;  2HW3 A;  4U7C A;  2FE9 A;  4ZOH C;  4UB1 A;  4GXK A;  3H8W A;  2KVC A;  3EYZ A;  1JXE A;  4K4G A;  3RH4 A;  1FO4 A;  3ETR A;  3VCB A;  4DFJ A;  5EOZ A;  3H0L B;  2NRW A;  2K4H A;  2J6S A;  2BCU A;  2JZB A;  2YB4 A;  5KFV A;  4R64 A;  4E0D A;  3GU3 A;  1KQQ A;  2AHO B;  9ICS A;  3IDW A;  3SR6 A;  3MR5 A;  2JV3 A;  1T7P A;  2OEH A;  5KT5 A;  4PZO A;  2H3F A;  4Y2U A;  2KTQ A;  3MGH A;  1L3U A;  5DB8 A;  2I1Q A;  5KT7 A;  2PFN A;  1N2X A;  4F5O A;  3FYH A;  1COO A;  2VJ4 A;  1WG8 A;  4Q45 A;  1BPE A;  2W7P A;  3EWA A;  2LI6 A;  4FS1 A;  4DSI A;  1Y88 A;  7ICT A;  2XC9 A;  4F2S A;  2Y0S F;  1TAU A;  2W9C B;  1X40 A;  1NJW A;  4KLI A;  1YZ6 A;  5AKZ A;  2QB0 B;  2IBK A;  4MF8 A;  4P4M A;  2EAP A;  2BQU A;  2PMZ C;  4F4Z A;  4CE6 A;  1J2M A;  3C28 A;  1LV5 A;  3T5H A;  4ECW A;  7ICE A;  2LYA A;  4DSL A;  5AHX A;  3PX6 A;  2MRL A;  3PW2 A; 
#chains in the Genus database with same CATH homology
 2KNJ A;  2R18 A;  2LYB A;  3N7S C;  4OJP A;  4BX9 C;  3IP4 B;  1Z19 A;  4P0P B;  2G09 A;  2Q4T A;  1KBU A;  4BUG A;  3F53 A;  2ZXH A;  4CRX A;  3F2B A;  4OO1 J;  2XIC A;  3GZF A;  2YB1 A;  4OJ6 A;  4IC9 A;  4PL1 A;  4C0Z A;  3LYS A;  2VIX A;  2OXO A;  3SAH A;  1L6N A;  1PVP A;  2W03 A;  3PSP A;  2DF4 B;  3O0F A;  4FZL A;  2HBK A;  2JGA A;  2G5H B;  2A3V A;  2HOI A;  3IG5 A;  2OYY A;  4QIW F;  4AYB F;  1T94 A;  2LBO A;  2F8L A;  1ED1 A;  1ECW A;  2H3Z A;  2OM6 A;  2RRD A;  2W04 A;  2YX8 A;  4OJO A;  3CRX A;  4U6P A;  2VKQ A;  3F5A A;  5C0Y A;  2E1F A;  2H3I A;  2KHV A;  2Z7J A;  3D2N A;  2ZIW A;  3E0F A;  3VC8 A;  4A8E A;  5T14 A;  4U7C A;  1OUQ A;  2JH1 A;  2CPR A;  3KFU F;  3CYM A;  3MGV A;  2KKV A;  1TAM A;  2E5S A;  3DEE A;  3LVV A;  2H3V A;  4P0P A;  1MA7 A;  4FZM A;  2HOQ A;  2XVT A;  4KX3 A;  2KIC A;  3CP8 A;  3PST A;  2K89 A;  2KVC A;  4NLB A;  3RFA A;  2Y0S C;  1D8B A;  2PMZ F;  2VJ5 A;  3N7P D;  3H0R B;  1ZQ1 C;  2CN1 A;  3F2D A;  1Q3V A;  3VCB A;  5HR6 A;  2H3Q A;  2KJ8 A;  2KHQ A;  2ZIU B;  3H0L B;  2F76 X;  2E1E A;  2K4H A;  2HBL A;  2ZIX B;  4NWI A;  1XO0 A;  2D6F C;  4P0Q A;  2W7O A;  3HKZ F;  4FZN A;  2G06 A;  1XNS A;  2KOB A;  1SZH A;  4ACO A;  2YB4 A;  3IG8 A;  3F2C A;  3GU3 A;  3M7D A;  2ZG6 A;  2KKP A;  2DQN B;  1IIP A;  3M6Z A;  3NRW A;  2KIW A;  5A0L A;  1F44 A;  2WB1 F;  3NUQ A;  1PVR A;  1GO3 F;  1UPH A;  2ZIV A;  3KZX A;  2HOF A;  3H0M B;  2RP5 A;  2G07 A;  4CGZ A;  2H3F A;  2N1R A;  3K1Z A;  1DRG A;  5HR7 A;  2CRX A;  2NV3 A;  4KX5 A;  4OJ5 A;  3N7R C;  3AQF A;  2WAQ F;  1Z1B A;  2RHF A;  4BJQ A;  4ICA A;  3PSI A;  2KJ5 A;  2K8B B;  4GFJ A;  4JMU A;  1CRX A;  1A6S A;  1HIW A;  4WJ3 B;  2JH7 A;  1HEK A;  2F2A B;  2VJ4 A;  3F5E A;  3RF9 A;  2LHT A;  4FE3 A;  2GOL A;  4CDG A;  2MA1 A;  2ZIW B;  1WUD A;  2G5I B;  2W7P A;  4AYB C;  2KV2 A;  4QIW C;  3ALR A;  2HBM A;  1PVQ A;  3LVW A;  5KL8 B;  3ONN A;  3SQI A;  3M6K A;  4QJF B;  2KEY A;  3SAG A;  2Y0S F;  2HMX A;  2XI9 A;  2WB1 C;  3PZP A;  1P7D A;  2G08 A;  2K8C B;  3AQE A;  2K4E A;  4NLC A;  4NV0 A;  4PL2 A;  3D2S A;  2HBJ A;  2ZXI A;  3SAF A;  4KMO B;  3L3F X;  2XID A;  4OJL A;  5KL1 B;  2G0A A;  5CRX A;  4QNL A;  3IN5 A;  2PMZ C;  1A0P A;  3AL0 B;  2OH2 A;  2BDU A;  2K8A A;  2WAQ C;  4O3M A;  2KD1 A;  2ZIU A;  4P0Q B;  3T79 A;  2ZIX A;  3C28 A;  3C29 A;  2F77 X;  2DGZ A;  3ICX A;  3D2Q A;  3SMV A;  2LYA A;  3OPX A;  1URJ A;  2GH1 A;  2KJ9 A;  2LKY A;  2M0N A;  3HKZ C;  1YT3 A;  1Q3U A;  2MRL A;  3PSF A;  2JMG A;  2ZIV B;  2JHD A;  1NZB A;  2K4I A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...