2E1FA

Crystal structure of the hrdc domain of human werner syndrome protein, wrn
Total Genus 33
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
33
sequence length
94
structure length
94
Chain Sequence
b'QPVISAQEQETQIVLYGKLVEARQKHANKMDVPPAILATNKILVDMAKMRPTTVENVKRIDGVSEGKAAMLAPLLEVIKHFCQTNSVQTDLFSS'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Werner syndrome ATP-dependent helicase
publication title Crystal structure of the HRDC domain of human Werner syndrome protein, WRN
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase
total genus 33
structure length 94
sequence length 94
ec nomenclature ec 3.6.4.12: DNA helicase.
pdb deposition date 2006-10-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00570 HRDC HRDC domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.80 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 DNA polymerase; domain 1 2e1fA01
4QIWF 2HBKA 3CYMA 4QJFB 1WUDA 2E1FA 2RHFA 3SAFA 5C0YA 4O3MA 2CPRA 4NLBA 1YT3A 2HBJA 1GO3F 3SAGA 1D8BA 2E1EA 2MA1A 4CGZA 2HBMA 4CDGA 2HBLA 4NLCA 2RRDA 2DGZA 2KV2A 4OO1J 3SAHA
chains in the Genus database with same CATH superfamily
2PI4A 3NUQA 3I76A 1ZQJA 3DEEA 2KKPA 3THVA 4RQ7A 4F2SA 3ONNA 2KVCA 4JUZA 4UAWA 4DL6A 4KMUA 4QZFA 4O3NA 3MGVA 1PVRA 1XU4A 3KHRA 4YD1A 1AQ6A 2ISOA 2BQUA 4GFJA 2DUYA 2H3VA 1BGXT 5KFMA 4J9MA 2NRWA 2F8KA 4JV2A 5DQIA 2DL0A 2N1RA 3AEVA 3MR5A 4C4SA 2YTUA 1D9FA 4UB2A 5C0YA 5KG0A 2C22A 1QSLA 4NL9C 4I29A 1X9SA 4O0IA 2WF8A 1S77D 1T3QA 3BZKA 4NY8A 2DPIA 4NM1A 5J0PA 5AI6A 2ZUCA 2OWOA 3GIKA 4CF3A 4RZRA 1U9LA 5DB7A 5BPCA 5T14A 4EEYA 4OO1J 5J2GA 4MF2A 2YMMA 5J2FA 8ICUA 5B66U 3QU4A 3RFAA 4ECQA 1COKA 1QCKA 2YB1A 1UQVA 1C7YA 4KLUA 5J0UA 4F4YA 3QEBZ 2HHQA 4M2YA 1XSPA 2XVTA 2Y1JA 1B43A 4KITB 4IQVA 3TI0A 1ZRMA 3GDXA 2G07A 3KHGA 5ALEA 2HDOA 1T4GA 1URJA 4CF4A 2KJ9A 1QSSA 3EYZA 4RPYA 4I2AA 4O3QA 4DSEA 1V97A 4BXOB 2I9GA 2F77X 2YMQA 5AKYA 4OJ5A 4ED8A 1COOA 3PO4A 1D8BA 1ZQZA 5ALVA 3MC1A 4BJQA 4X5VA 4M6WA 4Y2XA 4YMNA 4LZGA 4I2BA 1NK9A 3TARA 2RHFA 1FFVA 4KLDA 1S5LU 2H3QA 1SL2A 3QEAZ 8ICWA 2E1EA 3IRUA 8ICXA 2IBKA 3QUTA 3A0HU 2G08A 2NYVA 5B5EU 9ICTA 4RNMA 4AYBC 4FZLA 2BCVA 2VA8A 4J9KA 2XICA 5IIJA 2G5HB 1UPHA 3O0FA 3SZ2A 2FE9A 4UAUA 4Q8EA 3D2SA 4R64A 4RU9A 4BXOA 3Q8KA 2K4PA 1K1QA 1ZQHA 2HW3A 4O3RA 4F92B 7ICLA 4KLOA 5ALTA 4ECTA 1MQ3A 5KG3A 1ZD4A 1S8OA 3GU3A 4FBUA 5AKJA 3AM9A 5KL1B 3B0YA 2FI1A 5L1IA 5G5HA 3V6HA 2EQYA 2J6UA 3C2LA 3C5GA 3UQ2A 4F93B 9ICAA 3UMBA 2KFZA 3VCBA 4YR0A 4KLEA 1Z00B 2UVWA 1NKBA 2HHSA 1DK3A 1OXJA 3C1YA 1FFUA 4Y2QA 3LDAA 1LVHA 1SB3C 3BQ0A 7ICIA 2YX8A 2EZZA 3IM1A 3OPXA 3N7SC 4ED7A 4DQIA 5AKXA 9ICGA 7ICTA 1X6JA 4Y2VA 3NRZA 4I2DA 4QWCA 1S0MA 5KT5A 3IP4B 2FMSA 4BWMA 2I5HA 3RJFA 2LI6A 5CP2A 2DFLA 3AUOA 9ICHA 1CI4A 2NRTA 3HWTA 1T3NA 5ALOA 2KFNA 2DKZA 2RLTA 5AKZA 3AU6A 9ICEA 7ICVA 1DRGA 1JRPA 4UB8U 1CEZA 4QNLA 3ICXA 2LHTA 3H8MA 3T5KA 5D4BA 3BZCA 1RYUA 1MSWD 5E79U 1TKDA 1JXLA 4Z6DA 5IINA 3LWLA 4IQWA 5KT2A 4ZH4A 2A3VA 1ZQBA 4ECXA 4QZ9A 2R8HA 4ELUA 4LZDA 3NASA 3RB4A 3SENA 2Y0SF 2AHOB 4RPXA 1S0NA 1ZQXA 1X9WA 2VA2A 5GTIU 2R18A 4I28A 1BPZA 5KFIA 2MU2A 2QARB 2H3FA 4NLCA 3SMVA 3I1YA 1PVPA 2KTQA 4PGXA 3FM9A 1ZD5A 4RNOA 3IG8A 5AIAA 3PY8A 4OJOA 3K1RB 3PX4A 2GH1A 1ZOLA 1TVAA 3Q8QB 4PZNA 2WAQC 1NJWA 5EE9A 4PL2A 2KJ8A 5KFHA 4DFKA 1V9PA 2XO7A 1ZQPA 2MSNA 9ICRA 1V85A 2IHMA 2WB1F 2QB0B 1Z3EB 2LYAA 2QKQA 2JEGA 3OSPA 3CRXA 4RQ1A 8ICQA 4DOBA 4DWIA 2W03A 5KFZA 1UA1A 1OUQA 3C21A 4DS5A 3OJSA 5AHXA 1S10A 1WCLA 3ZI4A 4DFDA 1RXWA 2NRVA 4EEKA 9ICIA 4E0DA 4RQ8A 2FMQA 1SV4A 1Y88A 2ALZA 2QARA 5DG9A 3RH5A 1U4BA 2VJ4A 2W9BA 4F2RA 4KN4A 2ZTDA 4I27A 1IXRA 3HRDD 2GO7A 3HP6A 5DDMA 3PX0A 3OJUA 4R8UA 4ECUA 4YR2A 4TUSA 2FLLA 3LVWA 2ZIXB 3H0RB 8ICPA 1MC8A 2JH7A 5IIKA 3U26A 4YXMA 4JWMA 3EZ5A 4TQSA 4IR9A 3NTUA 2WF9A 2E8OA 5HMLA 1JALA 2JGAA 1SXDA 2GLEA 3N97B 4ICAA 3GIIA 3PW4A 5H2FU 3WKCA 1L8OA 2O6KA 1XNSA 4DLEA 3MFIA 1ZQAA 5KFSA 4F71A 9ICCA 4ECVA 4UASA 5BOMA 4Y2UA 2V4RA 8ICGA 2LM1A 3OHAA 7ICUA 4FE3A 5L1KA 3G6VA 2H5XA 9ICUA 1B22A 3WK8A 4KLTA 2FJ6A 4OD0A 1OW5A 3FYHA 4UBBA 3BS7A 5DGBA 5ALDA 1HUOA 4I2CA 2PXIA 5AK5A 1WWUA 4QZBA 2ZTEA 3D6JA 3KHHA 4PJ0U 4A8EA 1O08A 2JXJA 2Q0ZX 4QWDA 4U7CA 4Y2YA 3QU9A 3WK7A 1DK2A 3PVXA 2J6SA 1J2NA 4UB3A 1BPBA 3RBDA 4EENA 5J2HA 7ICRA 4DOCA 2LMRA 1LB2B 2ZUBA 2AQ4A 5KAFU 3FDSA 4PHDA 3L5KA 5J2CA 5KFNA 2E3TA 2HBLA 5HP4A 5AM3A 4QZAA 4QWBA 3RR8A 2A1JB 1TK5A 4RPZA 5KG6A 3PSIA 3F5EA 4UAYA 4J9LA 1EXNA 3UXNA 4DSKA 4ELVA 3UXOA 4IQUA 1BVSA 5KFBA 1ZQKA 7ICOA 3TACB 2KE7A 1N61A 4FBTA 1ED1A 1SV0C 3H40A 1J97A 3GIJA 4RT2A 2Q4TA 3HT3A 2XCPA 3UM9A 4GLXA 4AYBF 4BX9C 1N60A 4IR1A 3MBYA 4EYHB 3ZDAA 4NWIA 3KD3A 4QZCA 4G9BA 1ZQDA 2WFAA 4P0QA 4O3PA 5KG1A 3CW2C 2BCQA 7ICNA 3JPRA 4RUAA 1KL9A 5ALNA 4Q44A 2RDJA 1KRPA 4TURA 2HHUA 3NVWA 5ALPA 5AKIA 4OJPA 2KEYA 4F5NA 1L7NA 3M1YA 2A1JA 3QU2A 3GZFA 3EPIA 1ZQNA 4DQPA 5J0YA 2HHTA 2MA1A 1BNPA 5HHIA 4ED6A 2K4HA 3QUBA 1ZQYA 2C2RA 3ISDA 1U48A 3ORYA 3SAFA 3KTQA 4JWNA 1ZD2P 5CHGA 2BPGA 2M0NA 3RJEA 4EBDA 4PGQA 1ZXIA 5J8YC 4P4OA 4GXKA 2KZMA 4UB5A 2KN7A 4ACOA 2QLTA 4JMUA 4R63A 2OXOA 3RRGA 2PFOA 2W8KA 5DB6A 3RJGA 5J0WA 5BOLA 4DOAA 2PMZC 3FC4A 4J9NA 4DF8A 1Z1BA 9ICSA 2JZBA 4KMOB 4OJ6A 1J2MA 2FLPA 3IG5A 3HPOA 5L1LA 4M6WB 5AKLA 2XY7A 4QJFB 2FPKA 2ZG6A 1H38A 2BCRA 2IMWP 3HKZF 3PV8A 3M8SA 5JTIA 5GTHU 2JMGA 2JEIA 4Q45A 4RT3A 4YXJA 3M9MB 5J0RA 5J2EA 1IM4A 3Q8PB 3LK9A 2E1FA 1WCNA 2AH5A 5EE3A 2F8LA 3M6KA 3MFHA 4Z6EA 4LVSA 4DQQA 2PKEA 8ICLA 2A19A 3TQ1A 4Q43A 2BPFA 4F5PA 3BJYA 3PW0A 5KFRA 8ICFA 4M04A 3LVVA 2A1AA 4KLIA 2CRXA 3SR6A 7ICFA 4XUSA 4J9QA 2I1QA 3M6ZA 1SKRA 4ECYA 2E5SA 3HX0A 2LPEA 3MGHA 1SL1A 3ALRA 2W11A 1SKWA 5HR7A 1A76A 3PW7A 2HVHA 3JPSA 4BWJA 5KT3A 4GXJA 1JIHA 5KFQA 3BS5A 2WAQF 4M9GA 5KFGA 2PFNA 2K8CB 3IN5A 2D3DA 4KTQA 1N48A 4R66A 1RQNA 3MR3A 1ZQGA 2DPJA 5ALQA 4EX7A 9ICQA 5IIOA 3EUB2 3WK9A 1X6IA 2C2DA 1NJXA 2CPRA 4Z6FA 2V4QA 1L7MA 2F1JA 3CNHA 2HHXA 4KN7A 2NRXA 3E0FA 1FEZA 5ALUA 4PHEA 2BQRA 2YMPA 3T5HA 2BHNA 4NV0A 2VKQA 4IRKA 5EE1A 3SEIA 1ZQIA 3RJIA 5EWEA 1T8EA 4UW9A 4XA5A 4EYIB 4NLBA 4ZOHC 2BGWA 1N2XA 1BPYA 3PO5A 4CDGA 8ICOA 4I2JA 2DGZA 1QQ6A 3VC8A 5CA7A 2C28A 2F76X 1NZPA 5ALWA 4F8RA 3Q8LA 1X42A 1X9MA 5AI4A 4I2EA 3JPPA 2W9CA 8ICAA 1Z19A 2H3ZA 4RUCA 2B6GA 1N5WA 1LKYB 2LYBA 1L5UA 5A0LA 3R9KA 3Q8SB 4KLMA 4B6JA 4DF4A 2W8LA 1L3UA 1NI3A 1MA7A 4USAA 3I28A 5EWFA 8ICCA 4QIWF 1NNLA 5ALMA 1NKEA 3BQTA 5ALHA 4IQTA 1N62A 4P4MA 3NVYA 3H4BA 4DQRA 1Q3VA 4I2GA 5KFOA 1CRXA 1ZQRA 3RB0A 2W54A 4YCXA 8ICZA 1ZQCA 4ECRA 3IHQB 1BPEA 3C5FA 4IS7A 5KFYA 2RRDA 1QLNA 2MRLA 4DSIA 5DQGA 3H0MB 3LWMA 4K4HA 4QZGA 3OHBA 4C80A 3MABA 2IHNA 1L6NA 3G6XA 1SL0A 3BDPA 4KLHA 1LKYA 3RJJA 3KZXA 4J9SA 2KD1A 3IV6A 2DKXA 5ALIA 5KT6A 4B9MA 3GQCA 2XGPA 3UPQA 2VA3A 5DB9A 1JXEA 1Z4NA 8ICSA 1JI7A 2OYYA 1YT3A 1F44A 4KLJA 4BGDA 3RRHA 4NXZA 3ETRA 5JRTA 2K60A 5J2IA 1D8YA 5J29A 2R8KA 2B0CA 3KZIU 4MF8A 5KFXA 3SD7A 1S0OA 1F0MA 2XY5A 2W9BB 2YY6A 3WKAA 1VLBA 3H8SA 4CF5A 1ZQMA 4R8UB 1UA0A 1KBUA 2F1HA 2XY6A 2P6RA 1NK0A 3UMGA 4O5CA 2KIVA 4CE6A 5KFKA 2Z7JA 2WF5A 2XC9A 5HHHA 1XS9D 2QB1A 2HOIA 3MGIA 4C8KA 3WK4A 4WJ3B 2ATLA 3ZDCA 3C2MA 1IIPA 4EBCA 2WTFA 1DGSA 2F3NA 4QZEA 2IOFA 4O3MA 3QE9Y 1O03A 8ICKA 1GO3F 4DL2A 3CP8A 3V7JA 2ZXIA 4C8LA 3RH4A 3RB6A 3T79A 5J2JA 1KTQA 8ICEA 5F9LA 1TAQA 5J0TA 1NKCA 5HR6A 4P4PA 4MEXA 3ZD9A 2KMDA 2NRZA 5CR0A 2DBYA 4DSJA 1PK1B 2FLNA 1ZETA 2KOBA 4MFFA 5AK4A 5KTQA 1L3SA 2F2AB 5DBBA 4GC6A 5KT7A 4YQWA 1NK6A 5KFJA 4F50A 2R8IA 1PUZA 1P7DA 3UMCA 3BQ7A 2EDUA 2AGOA 4M9JA 1Z4OA 3HJEA 5J0QA 5AI8A 8ICNA 5CB1A 7ICPA 3RJHA 3ZDBA 2ES6A 2WF7A 2K89A 3M9OB 4NLNA 4O3OA 5J2KA 2BR0A 5ALYA 3NVVA 3PZPA 4Q8FA 2BDUA 8ICBA 2PI5A 2WF6A 5ALFA 5KFTA 4R65A 1U49A 3GV8B 4BUGA 2KSOB 4UATA 2PMZF 1MQ2A 2C2EA 2BCUA 2F1IA 2R8GA 2W7OA 4QW8A 1PK1A 3V72A 5HMMA 4US8A 4PGYA 2FPLA 5AI0A 2JV3A 3NS1A 7ICSA 3RF9A 1L7OA 9ICLA 5ALJA 2HHWA 8ICIA 1NK8A 3ZDDA 1S76D 2AXTU 3RR7A 2ODGA 1KFSA 4RQ5A 3SAGA 3C29A 4DL3A 3MDAA 1BPXA 1ZJNA 3RBEA 2P6UA 4DCCA 4QWEA 4FZNA 3TANA 4RQ4A 3NVZA 3HW8A 2DQNB 2EAMA 4GIBA 2KK0A 2RP5A 3WK5A 4EBEA 4PH5A 1SIJA 4ELTA 1RZTA 2Y9UA 4P0QB 5J0XA 2KSOA 4YFKA 5AM2A 3D2NA 4ED2A 1ZQLA 4KLQA 5HNKA 5KT4A 1KKXA 3SYZA 3QYPA 4YD2A 4DQSA 5KL8B 4I2HA 5KAIU 5ALLA 3SV4A 2XI9A 3QXGA 8ICTA 3OGUA 4ED0A 1HEKA 5AM4A 5IILA 2HBMA 3BQ1A 2YMLA 3JPNA 2XGQA 3M7DA 7ICJA 3HILA 1KN5A 4ECWA 2FPMA 2OHFA 1X40A 4KX3A 1IV8A 2ZJAA 3S6JA 1UT5A 5DG8A 3B0XA 1ZQTA 4KLFA 3WKEA 2DF4B 1JN3A 1M6YA 2WB1C 5D49A 2KZZA 4JK1A 5AM1A 1S9FA 3V6JA 4FZMA 5EOZA 1HIWA 1SWVA 2JZBB 4NLGA 1RPLA 2AGPA 5AKGA 1S97A 4YG2A 5AKEA 3TFRA 3ISBA 3A0BU 2HSZA 2W9MA 5DQHA 3OSNA 1JX4A 2E8PA 5F3XB 3ETLA 1DOQA 9ICVA 3E2EA 2KP7A 1L7PA 2Y1IA 1NZBA 5AKKA 4PHAA 1QSYA 3CYMA 2JRZA 4C0ZA 5J2AA 2WHEA 1XWLA 4QZ8A 1ZQVA 7ICMA 3WK6A 7ICKA 4M9LA 2AJQA 5ALSA 1Z1VA 4UB4A 2UVRA 1QH9A 2R8JA 4EX6A 4PZOA 4NJ8A 5KFAA 4O3SA 3IDWA 1WG8A 2KICA 4FS2A 1RXVA 1VJ5A 3PSFA 4DL4A 2IOFK 3H4DA 1JUDA 5KNIA 3TAPA 5KFWA 4XRHA 4JV1A 5KFDA 3PR4A 2W04A 3NGDA 3BS5B 4DFJA 2M9NA 3WKBA 4NLKA 1ZRNA 1C20A 2GOLA 5AM0A 2P66A 3MDCA 1UHUA 5KFVA 4DEZA 4Y2SA 5FP0A 8ICMA 1JMSA 4C8NA 2JHDA 3JPTA 2V9WA 5DG7A 2KHVA 3K75D 1CUKA 5DBCA 1TAUA 2G0AA 2NV3A 3AQFA 5DDYA 4RQ2A 3Q8MA 5G5GA 5DB8A 1ZYQA 4AP9A 1XSLA 4UQGA 1HJPA 4J03A 3DDHA 1SZHA 3AQEA 2LKYA 1WYGA 4MHVA 3TADA 3RB3A 2HVIA 4C8MA 4QZDA 3J81j 4IRCA 3KHLA 4O5KA 2UVUA 2B21A 4UAZA 4DS4A 4M47A 3KFUF 2E8MA 8ICJA 1ZQEA 5DGAA 2GWSA 1VDVA 4US9A 9ICNA 4PL1A 1NJZA 2W9CB 4RQNA 1X66A 5F9NA 2KG5A 4OCZA 1X9XA 1ZJMA 4P0PB 2MUTB 9ICOA 5AKHA 1ECWA 3JPQA 4KLLA 1F5SA 3H8JA 1KSPA 2LM4A 1Q3UA 5D46A 2KIWA 4G3IA 4F5OA 3ZDEA 1XSNA 1NOMA 3K1ZA 1Q8KA 3RAXA 4IRDA 3TADC 2JEJA 3T5LA 4B9LA 2KNJA 2RDIA 4DSLA 3SQIA 4CGZA 3N28A 1SWWA 1SGGA 9ICBA 5ALZA 4DSFA 5KFCA 1RQLA 5EE0A 3C2KA 2EZXA 2AU0A 3F2CA 3NRWA 2F44A 3T5JA 5TISU 4DFMA 2IOHA 3TKAA 3ISCA 1K1SA 5CEHA 1ZQFA 4P0PA 2MUTA 3SI8A 4DO9A 3V6KA 1AROP 4DL7A 5ALRA 1SKSA 2K8BB 2W43A 4Z6CA 2CXYA 4RNNA 4I2FA 2CN1A 3UQ0A 1XO1A 1TAMA 2LYHA 4OJLA 2NO4A 3BQ2A 3KBBA 5DLGA 1RYSA 4MFCA 1A77A 2JR5A 2HHVA 1XC9A 3KOOA 5L1JA 2L5YA 2BKEA 1X2IA 4C4TA 2HBKA 2W7PA 4M9HA 1WUDA 2K8AA 3C28A 2H3IA 4EZ9A 5ALGA 4NLZA 1IG6A 3Q8RB 4O9MA 1ZQOA 4U6PA 3PW5A 3OTQA 4MEYA 2ASLA 2HOQA 2VIXA 3LYSA 3WU2U 5KG5A 3QZ8A 3AU2A 1Z00A 3K4GA 1ZQUA 3HKZC 5AI9A 4DLGA 2W3SA 3PSTA 2NO5A 4FO6A 1RYRA 1B4FA 3GIMA 2AGQA 3QNMA 9ICJA 1D8LA 5L9XA 2OEHA 4HAIA 4RQ0A 3T3FA 1BNOA 3PX6A 4QZIA 4B9UA 2P35A 2ZIWB 2HCFA 1V38A 4YR3A 3QU7A 1A6SA 4J9RA 4TUQA 2YN4A 4P2HA 5IIMA 1U45A 1PZNA 4ED3A 3UXPA 4MFAA 5J2BA 2OM6A 2XIDA 1TK0A 4CRXA 5ALXA 1K5OA 3GV5B 4Y2RA 4C7YA 3ED5A 8ICRA 4F4WA 3AN1A 2ZUDA 3EW9A 2E8NA 1S0VA 3JPOA 4BDPA 2Y9TA 5J0OA 2BPCA 4IC9A 4I2IA 1N5XA 5K4LA 2MAXA 4C4RA 4NM2A 3SAHA 3L4PA 4TUPA 3G6YA 3DV9A 2ZIVB 2G5IB 2EAOA 1DXSA 2ZIWA 1NK4A 3GFKB 2KZ3A 5KG2A 4F4XA 1U47A 2BQ3A 2OH2A 4UB1A 5CWRA 4F4ZA 1YZ7A 3GILA 4RQ6A 3F2BA 2EH9A 5DBAA 3RTVA 1B0XA 4TQRA 3D2QA 3N4MB 3PW2A 8ICYA 2IA6A 4XQ8A 2ISPA 5AK3A 2K4EA 1TE2A 5ALKA 1NJYA 4O5EA 4LJXA 1DGJA 4ED1A 4UARA 3RH6A 3AMZA 4UAVA 5CRXA 1UT8A 5TZVA 5L1MA 2ASDA 1L8LA 1KFTA 2PFQA 3ZD8A 4JB3A 4Y2PA 7ICQA 3F5AA 1SXEA 2K4IA 4EELA 4GC7A 4J9PA 4GXIA 9ICKA 2EZYA 1TV9A 4YMOA 5KFUA 5DKWA 3M9NB 3M8RA 4Y2TA 9ICFA 4HYKA 3PMLA 4M0AA 2QB0A 7ICGA 7ICEA 2ZIVA 3PSPA 2RQ5A 8ICHA 1NK7A 4UB6U 4M9NA 1ZQSA 2ZJ5A 3E58A 1KFDA 4QWAA 4FS1A 4Y2JA 1ZQWA 4C8OA 4QIWC 3C23A 1QTMA 4F72A 4ECZA 1FO4A 3PMNA 2G09A 5KFPA 3MR2A 4RQMA 5J0SA 3L3FX 5AK6A 4YP3A 1RM6C 1TK8A 2W55A 1HUZA 4K4GA 1JROA 2W9AA 2J6TA 4UBCA 2PFPA 3H0LB 1WWVA 4YN4A 5KFFA 3RJKA 4QZHA 2ASJA 5AI5A 2UVVA 2ZIXA 4DFPA 3AL0B 2JEFA 2HI0A 9ICMA 4B9SA 1PK3A 1KQQA 4PPXA 2D6FC 1L3TA 1D9DA 1ZD3A 3C1ZA 2FMPA 3QZ7A 1L3VA 2BDPA 9ICXA 3FAHA 5IIIA 2BCSA 7ICHA 1MN8A 1FIQA 2FDRA 3V7KA 5EWGA 2DWQA 2HMXA 3EPGA 1SV0A 4KLGA 2BZFA 3KKAA 2Y0SC 5DLFA 1T7PA 2KKVA 2LBOA 1ZQQA 1KW4A 3F53A 4F91B 5JUMA 4YVZA 2D8CA 2KJ5A 4JV0A 4F3OA 4KLSA 2ZTCA 1YZ6A 2HBJA 3PR5B 4CCHA 4B9NA 3QUQA 4YMMA 4PHPA 3MR6A 4K4IA 4ECSA 1QQ7A 5AICA 2I6XA 4F5QA 5CJ7A 3QUCA 2ZIUB 1A0PA 2KHQA 2VANA 1KLNA 3B9JA 2ZJ8A 3RAQA 1T94A 4DL5A 1RG6A 5KG4A 2VJ5A 5C5JA 5JU5A 3N7RC 4J9OA 8ICVA 2ZXHA 2ESEA 3N7PD 5KG7A 4KX5A 4FFDA 3QX7A 4B9TA 1RDFA 3KKAC 1KDHA 1NK5A 3QU5A 9ICPA 1KEJA 5KFLA 4F5RA 4EZ6A 5AM5A 4QW9A 1ZQ1C 2AQ0A 2G06A 2YB4A 4F4KA 3V7LA 2YQEA 3WKDA 5J2DA 1SZPA 2W3RA 3GV7B 1N63A 3F2DA 5AIBA 5J8YA 1TFRA 3H7IA 3SV3A 4IL6U 1PVQA 1LV5A 2KVSA 3H8WA 3TAQA 9ICWA 2XCAA 2EAPA 2ZIUA 3EWAA 1UCVA 4NL9A 4C7ZA 2OCEA 1BPDA 2EANA 3PNCA 3TFSA 4CNQA 5KFEA 1XO0A 4B9VA 2JH1A 1Q46A 4RQ3A 1N56A 2HOFA 2KV2A 1QQ5A
chains in the Genus database with same CATH topology
2BDUA 3VC8A 3NUQA 2F76X 2KICA 2Y0SC 2E1FA 2KKVA 2WB1F 3HKZC 2LBOA 1Q3UA 2KIWA 3IP4B 3DEEA 2LYAA 2F8LA 3PSFA 2KKPA 3F53A 3M6KA 3PSTA 3CRXA 2RHFA 3K1ZA 3ONNA 4BUGA 4OJPA 2KVCA 2W03A 2KEYA 2KJ5A 2PMZF 2H3QA 1Z19A 2H3ZA 5CRXA 4KX3A 1OUQA 3MGVA 1PVRA 4A8EA 2LYBA 2KNJA 2HBJA 3GZFA 2W7OA 2W04A 4GFJA 2E1EA 2MA1A 1KBUA 2H3VA 5A0LA 3SQIA 4CGZA 2DF4B 3F5AA 2K4IA 3LVVA 2GOLA 2K4HA 2WB1C 1DRGA 2CRXA 2G08A 2Z7JA 1MA7A 4U7CA 2ZIWB 2N1RA 3M6ZA 4QIWF 4QNLA 3ICXA 2HOIA 2LHTA 3RF9A 2ZIUB 4AYBC 2E5SA 1A0PA 4FZLA 2KHQA 4FZMA 3F2CA 4WJ3B 3NRWA 1IIPA 1HIWA 2VJ4A 1A6SA 3ALRA 2XICA 3SAFA 5C0YA 2JHDA 2ZIVA 3PSPA 1Q3VA 2G5HB 1UPHA 1CRXA 5HR7A 4O3MA 1T94A 2KHVA 2VJ5A 3O0FA 2M0NA 3N7RC 3D2SA 1GO3F 3SAGA 2G0AA 3C29A 2NV3A 4P0PA 2ZXHA 2A3VA 3AQFA 3N7PD 3CP8A 2WAQF 3LVWA 2ZIXB 4QIWC 2ZXIA 2HBLA 3H0RB 4FZNA 2RRDA 4KX5A 2MRLA 2K8CB 2JH7A 2OM6A 5T14A 3IN5A 2K8BB 4ACOA 2DQNB 4JMUA 2XIDA 3T79A 1P7DA 4OO1J 3GU3A 3H0MB 2RP5A 2G09A 2OXOA 2CN1A 4CRXA 5HR6A 1TAMA 3L3FX 2Y0SF 1SZHA 5KL1B 2PMZC 3AQEA 4OJLA 3RFAA 2LKYA 1Z1BA 1ZQ1C 2G06A 2YB4A 2YB1A 4KMOB 4P0QB 2JGAA 3PSIA 3F5EA 2CPRA 3H0LB 2R18A 2KOBA 1NZBA 1L6NA 3D2NA 4ICAA 4OJ6A 3F2DA 4IC9A 2XVTA 3KFUF 2F2AB 2G07A 3KZXA 1XNSA 3IG5A 2H3FA 4NLCA 3VCBA 1PVQA 2KD1A 3SMVA 2ZIXA 4PL1A 1ED1A 3E0FA 3SAHA 2HBKA 3CYMA 4C0ZA 4QJFB 2W7PA 1PVPA 3AL0B 1WUDA 2ZIVB 2ZG6A 2K8AA 3C28A 1URJA 2G5IB 2H3IA 2Q4TA 2D6FC 2KJ9A 4NV0A 2ZIWA 5KL8B 2VKQA 4AYBF 3HKZF 4BX9C 2ZIUA 3IG8A 2YX8A 2JMGA 2K89A 2OYYA 4P0PB 2F77X 2XI9A 4OJOA 4FE3A 4NLBA 4NWIA 4OJ5A 1YT3A 4U6PA 1F44A 1HEKA 2OH2A 1ECWA 2GH1A 4P0QA 1D8BA 3F2BA 2WAQC 3OPXA 2HOQA 3N7SC 2VIXA 3LYSA 3D2QA 2HBMA 1XO0A 4CDGA 2JH1A 4PL2A 2KJ8A 2HMXA 4BJQA 3PZPA 2DGZA 2K4EA 2HOFA 2KV2A 3M7DA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4QIW F;  2HBK A;  3CYM A;  4QJF B;  1WUD A;  2E1F A;  2RHF A;  3SAF A;  5C0Y A;  4O3M A;  2CPR A;  4NLB A;  1YT3 A;  2HBJ A;  1GO3 F;  3SAG A;  1D8B A;  2E1E A;  2MA1 A;  4CGZ A;  2HBM A;  4CDG A;  2HBL A;  4NLC A;  2RRD A;  2DGZ A;  2KV2 A;  4OO1 J;  3SAH A; 
#chains in the Genus database with same CATH topology
 2PI4 A;  3NUQ A;  3I76 A;  1ZQJ A;  3DEE A;  2KKP A;  3THV A;  4RQ7 A;  4F2S A;  3ONN A;  2KVC A;  4JUZ A;  4UAW A;  4DL6 A;  4KMU A;  4QZF A;  4O3N A;  3MGV A;  1PVR A;  1XU4 A;  3KHR A;  4YD1 A;  1AQ6 A;  2ISO A;  2BQU A;  4GFJ A;  2DUY A;  2H3V A;  1BGX T;  5KFM A;  4J9M A;  2NRW A;  2F8K A;  4JV2 A;  5DQI A;  2DL0 A;  2N1R A;  3AEV A;  3MR5 A;  4C4S A;  2YTU A;  1D9F A;  4UB2 A;  5C0Y A;  5KG0 A;  2C22 A;  1QSL A;  4NL9 C;  4I29 A;  1X9S A;  4O0I A;  2WF8 A;  1S77 D;  1T3Q A;  3BZK A;  4NY8 A;  2DPI A;  4NM1 A;  5J0P A;  5AI6 A;  2ZUC A;  2OWO A;  3GIK A;  4CF3 A;  4RZR A;  1U9L A;  5DB7 A;  5BPC A;  5T14 A;  4EEY A;  4OO1 J;  5J2G A;  4MF2 A;  2YMM A;  5J2F A;  8ICU A;  5B66 U;  3QU4 A;  3RFA A;  4ECQ A;  1COK A;  1QCK A;  2YB1 A;  1UQV A;  1C7Y A;  4KLU A;  5J0U A;  4F4Y A;  3QEB Z;  2HHQ A;  4M2Y A;  1XSP A;  2XVT A;  2Y1J A;  1B43 A;  4KIT B;  4IQV A;  3TI0 A;  1ZRM A;  3GDX A;  2G07 A;  3KHG A;  5ALE A;  2HDO A;  1T4G A;  1URJ A;  4CF4 A;  2KJ9 A;  1QSS A;  3EYZ A;  4RPY A;  4I2A A;  4O3Q A;  4DSE A;  1V97 A;  4BXO B;  2I9G A;  2F77 X;  2YMQ A;  5AKY A;  4OJ5 A;  4ED8 A;  1COO A;  3PO4 A;  1D8B A;  1ZQZ A;  5ALV A;  3MC1 A;  4BJQ A;  4X5V A;  4M6W A;  4Y2X A;  4YMN A;  4LZG A;  4I2B A;  1NK9 A;  3TAR A;  2RHF A;  1FFV A;  4KLD A;  1S5L U;  2H3Q A;  1SL2 A;  3QEA Z;  8ICW A;  2E1E A;  3IRU A;  8ICX A;  2IBK A;  3QUT A;  3A0H U;  2G08 A;  2NYV A;  5B5E U;  9ICT A;  4RNM A;  4AYB C;  4FZL A;  2BCV A;  2VA8 A;  4J9K A;  2XIC A;  5IIJ A;  2G5H B;  1UPH A;  3O0F A;  3SZ2 A;  2FE9 A;  4UAU A;  4Q8E A;  3D2S A;  4R64 A;  4RU9 A;  4BXO A;  3Q8K A;  2K4P A;  1K1Q A;  1ZQH A;  2HW3 A;  4O3R A;  4F92 B;  7ICL A;  4KLO A;  5ALT A;  4ECT A;  1MQ3 A;  5KG3 A;  1ZD4 A;  1S8O A;  3GU3 A;  4FBU A;  5AKJ A;  3AM9 A;  5KL1 B;  3B0Y A;  2FI1 A;  5L1I A;  5G5H A;  3V6H A;  2EQY A;  2J6U A;  3C2L A;  3C5G A;  3UQ2 A;  4F93 B;  9ICA A;  3UMB A;  2KFZ A;  3VCB A;  4YR0 A;  4KLE A;  1Z00 B;  2UVW A;  1NKB A;  2HHS A;  1DK3 A;  1OXJ A;  3C1Y A;  1FFU A;  4Y2Q A;  3LDA A;  1LVH A;  1SB3 C;  3BQ0 A;  7ICI A;  2YX8 A;  2EZZ A;  3IM1 A;  3OPX A;  3N7S C;  4ED7 A;  4DQI A;  5AKX A;  9ICG A;  7ICT A;  1X6J A;  4Y2V A;  3NRZ A;  4I2D A;  4QWC A;  1S0M A;  5KT5 A;  3IP4 B;  2FMS A;  4BWM A;  2I5H A;  3RJF A;  2LI6 A;  5CP2 A;  2DFL A;  3AUO A;  9ICH A;  1CI4 A;  2NRT A;  3HWT A;  1T3N A;  5ALO A;  2KFN A;  2DKZ A;  2RLT A;  5AKZ A;  3AU6 A;  9ICE A;  7ICV A;  1DRG A;  1JRP A;  4UB8 U;  1CEZ A;  4QNL A;  3ICX A;  2LHT A;  3H8M A;  3T5K A;  5D4B A;  3BZC A;  1RYU A;  1MSW D;  5E79 U;  1TKD A;  1JXL A;  4Z6D A;  5IIN A;  3LWL A;  4IQW A;  5KT2 A;  4ZH4 A;  2A3V A;  1ZQB A;  4ECX A;  4QZ9 A;  2R8H A;  4ELU A;  4LZD A;  3NAS A;  3RB4 A;  3SEN A;  2Y0S F;  2AHO B;  4RPX A;  1S0N A;  1ZQX A;  1X9W A;  2VA2 A;  5GTI U;  2R18 A;  4I28 A;  1BPZ A;  5KFI A;  2MU2 A;  2QAR B;  2H3F A;  4NLC A;  3SMV A;  3I1Y A;  1PVP A;  2KTQ A;  4PGX A;  3FM9 A;  1ZD5 A;  4RNO A;  3IG8 A;  5AIA A;  3PY8 A;  4OJO A;  3K1R B;  3PX4 A;  2GH1 A;  1ZOL A;  1TVA A;  3Q8Q B;  4PZN A;  2WAQ C;  1NJW A;  5EE9 A;  4PL2 A;  2KJ8 A;  5KFH A;  4DFK A;  1V9P A;  2XO7 A;  1ZQP A;  2MSN A;  9ICR A;  1V85 A;  2IHM A;  2WB1 F;  2QB0 B;  1Z3E B;  2LYA A;  2QKQ A;  2JEG A;  3OSP A;  3CRX A;  4RQ1 A;  8ICQ A;  4DOB A;  4DWI A;  2W03 A;  5KFZ A;  1UA1 A;  1OUQ A;  3C21 A;  4DS5 A;  3OJS A;  5AHX A;  1S10 A;  1WCL A;  3ZI4 A;  4DFD A;  1RXW A;  2NRV A;  4EEK A;  9ICI A;  4E0D A;  4RQ8 A;  2FMQ A;  1SV4 A;  1Y88 A;  2ALZ A;  2QAR A;  5DG9 A;  3RH5 A;  1U4B A;  2VJ4 A;  2W9B A;  4F2R A;  4KN4 A;  2ZTD A;  4I27 A;  1IXR A;  3HRD D;  2GO7 A;  3HP6 A;  5DDM A;  3PX0 A;  3OJU A;  4R8U A;  4ECU A;  4YR2 A;  4TUS A;  2FLL A;  3LVW A;  2ZIX B;  3H0R B;  8ICP A;  1MC8 A;  2JH7 A;  5IIK A;  3U26 A;  4YXM A;  4JWM A;  3EZ5 A;  4TQS A;  4IR9 A;  3NTU A;  2WF9 A;  2E8O A;  5HML A;  1JAL A;  2JGA A;  1SXD A;  2GLE A;  3N97 B;  4ICA A;  3GII A;  3PW4 A;  5H2F U;  3WKC A;  1L8O A;  2O6K A;  1XNS A;  4DLE A;  3MFI A;  1ZQA A;  5KFS A;  4F71 A;  9ICC A;  4ECV A;  4UAS A;  5BOM A;  4Y2U A;  2V4R A;  8ICG A;  2LM1 A;  3OHA A;  7ICU A;  4FE3 A;  5L1K A;  3G6V A;  2H5X A;  9ICU A;  1B22 A;  3WK8 A;  4KLT A;  2FJ6 A;  4OD0 A;  1OW5 A;  3FYH A;  4UBB A;  3BS7 A;  5DGB A;  5ALD A;  1HUO A;  4I2C A;  2PXI A;  5AK5 A;  1WWU A;  4QZB A;  2ZTE A;  3D6J A;  3KHH A;  4PJ0 U;  4A8E A;  1O08 A;  2JXJ A;  2Q0Z X;  4QWD A;  4U7C A;  4Y2Y A;  3QU9 A;  3WK7 A;  1DK2 A;  3PVX A;  2J6S A;  1J2N A;  4UB3 A;  1BPB A;  3RBD A;  4EEN A;  5J2H A;  7ICR A;  4DOC A;  2LMR A;  1LB2 B;  2ZUB A;  2AQ4 A;  5KAF U;  3FDS A;  4PHD A;  3L5K A;  5J2C A;  5KFN A;  2E3T A;  2HBL A;  5HP4 A;  5AM3 A;  4QZA A;  4QWB A;  3RR8 A;  2A1J B;  1TK5 A;  4RPZ A;  5KG6 A;  3PSI A;  3F5E A;  4UAY A;  4J9L A;  1EXN A;  3UXN A;  4DSK A;  4ELV A;  3UXO A;  4IQU A;  1BVS A;  5KFB A;  1ZQK A;  7ICO A;  3TAC B;  2KE7 A;  1N61 A;  4FBT A;  1ED1 A;  1SV0 C;  3H40 A;  1J97 A;  3GIJ A;  4RT2 A;  2Q4T A;  3HT3 A;  2XCP A;  3UM9 A;  4GLX A;  4AYB F;  4BX9 C;  1N60 A;  4IR1 A;  3MBY A;  4EYH B;  3ZDA A;  4NWI A;  3KD3 A;  4QZC A;  4G9B A;  1ZQD A;  2WFA A;  4P0Q A;  4O3P A;  5KG1 A;  3CW2 C;  2BCQ A;  7ICN A;  3JPR A;  4RUA A;  1KL9 A;  5ALN A;  4Q44 A;  2RDJ A;  1KRP A;  4TUR A;  2HHU A;  3NVW A;  5ALP A;  5AKI A;  4OJP A;  2KEY A;  4F5N A;  1L7N A;  3M1Y A;  2A1J A;  3QU2 A;  3GZF A;  3EPI A;  1ZQN A;  4DQP A;  5J0Y A;  2HHT A;  2MA1 A;  1BNP A;  5HHI A;  4ED6 A;  2K4H A;  3QUB A;  1ZQY A;  2C2R A;  3ISD A;  1U48 A;  3ORY A;  3SAF A;  3KTQ A;  4JWN A;  1ZD2 P;  5CHG A;  2BPG A;  2M0N A;  3RJE A;  4EBD A;  4PGQ A;  1ZXI A;  5J8Y C;  4P4O A;  4GXK A;  2KZM A;  4UB5 A;  2KN7 A;  4ACO A;  2QLT A;  4JMU A;  4R63 A;  2OXO A;  3RRG A;  2PFO A;  2W8K A;  5DB6 A;  3RJG A;  5J0W A;  5BOL A;  4DOA A;  2PMZ C;  3FC4 A;  4J9N A;  4DF8 A;  1Z1B A;  9ICS A;  2JZB A;  4KMO B;  4OJ6 A;  1J2M A;  2FLP A;  3IG5 A;  3HPO A;  5L1L A;  4M6W B;  5AKL A;  2XY7 A;  4QJF B;  2FPK A;  2ZG6 A;  1H38 A;  2BCR A;  2IMW P;  3HKZ F;  3PV8 A;  3M8S A;  5JTI A;  5GTH U;  2JMG A;  2JEI A;  4Q45 A;  4RT3 A;  4YXJ A;  3M9M B;  5J0R A;  5J2E A;  1IM4 A;  3Q8P B;  3LK9 A;  2E1F A;  1WCN A;  2AH5 A;  5EE3 A;  2F8L A;  3M6K A;  3MFH A;  4Z6E A;  4LVS A;  4DQQ A;  2PKE A;  8ICL A;  2A19 A;  3TQ1 A;  4Q43 A;  2BPF A;  4F5P A;  3BJY A;  3PW0 A;  5KFR A;  8ICF A;  4M04 A;  3LVV A;  2A1A A;  4KLI A;  2CRX A;  3SR6 A;  7ICF A;  4XUS A;  4J9Q A;  2I1Q A;  3M6Z A;  1SKR A;  4ECY A;  2E5S A;  3HX0 A;  2LPE A;  3MGH A;  1SL1 A;  3ALR A;  2W11 A;  1SKW A;  5HR7 A;  1A76 A;  3PW7 A;  2HVH A;  3JPS A;  4BWJ A;  5KT3 A;  4GXJ A;  1JIH A;  5KFQ A;  3BS5 A;  2WAQ F;  4M9G A;  5KFG A;  2PFN A;  2K8C B;  3IN5 A;  2D3D A;  4KTQ A;  1N48 A;  4R66 A;  1RQN A;  3MR3 A;  1ZQG A;  2DPJ A;  5ALQ A;  4EX7 A;  9ICQ A;  5IIO A;  3EUB 2;  3WK9 A;  1X6I A;  2C2D A;  1NJX A;  2CPR A;  4Z6F A;  2V4Q A;  1L7M A;  2F1J A;  3CNH A;  2HHX A;  4KN7 A;  2NRX A;  3E0F A;  1FEZ A;  5ALU A;  4PHE A;  2BQR A;  2YMP A;  3T5H A;  2BHN A;  4NV0 A;  2VKQ A;  4IRK A;  5EE1 A;  3SEI A;  1ZQI A;  3RJI A;  5EWE A;  1T8E A;  4UW9 A;  4XA5 A;  4EYI B;  4NLB A;  4ZOH C;  2BGW A;  1N2X A;  1BPY A;  3PO5 A;  4CDG A;  8ICO A;  4I2J A;  2DGZ A;  1QQ6 A;  3VC8 A;  5CA7 A;  2C28 A;  2F76 X;  1NZP A;  5ALW A;  4F8R A;  3Q8L A;  1X42 A;  1X9M A;  5AI4 A;  4I2E A;  3JPP A;  2W9C A;  8ICA A;  1Z19 A;  2H3Z A;  4RUC A;  2B6G A;  1N5W A;  1LKY B;  2LYB A;  1L5U A;  5A0L A;  3R9K A;  3Q8S B;  4KLM A;  4B6J A;  4DF4 A;  2W8L A;  1L3U A;  1NI3 A;  1MA7 A;  4USA A;  3I28 A;  5EWF A;  8ICC A;  4QIW F;  1NNL A;  5ALM A;  1NKE A;  3BQT A;  5ALH A;  4IQT A;  1N62 A;  4P4M A;  3NVY A;  3H4B A;  4DQR A;  1Q3V A;  4I2G A;  5KFO A;  1CRX A;  1ZQR A;  3RB0 A;  2W54 A;  4YCX A;  8ICZ A;  1ZQC A;  4ECR A;  3IHQ B;  1BPE A;  3C5F A;  4IS7 A;  5KFY A;  2RRD A;  1QLN A;  2MRL A;  4DSI A;  5DQG A;  3H0M B;  3LWM A;  4K4H A;  4QZG A;  3OHB A;  4C80 A;  3MAB A;  2IHN A;  1L6N A;  3G6X A;  1SL0 A;  3BDP A;  4KLH A;  1LKY A;  3RJJ A;  3KZX A;  4J9S A;  2KD1 A;  3IV6 A;  2DKX A;  5ALI A;  5KT6 A;  4B9M A;  3GQC A;  2XGP A;  3UPQ A;  2VA3 A;  5DB9 A;  1JXE A;  1Z4N A;  8ICS A;  1JI7 A;  2OYY A;  1YT3 A;  1F44 A;  4KLJ A;  4BGD A;  3RRH A;  4NXZ A;  3ETR A;  5JRT A;  2K60 A;  5J2I A;  1D8Y A;  5J29 A;  2R8K A;  2B0C A;  3KZI U;  4MF8 A;  5KFX A;  3SD7 A;  1S0O A;  1F0M A;  2XY5 A;  2W9B B;  2YY6 A;  3WKA A;  1VLB A;  3H8S A;  4CF5 A;  1ZQM A;  4R8U B;  1UA0 A;  1KBU A;  2F1H A;  2XY6 A;  2P6R A;  1NK0 A;  3UMG A;  4O5C A;  2KIV A;  4CE6 A;  5KFK A;  2Z7J A;  2WF5 A;  2XC9 A;  5HHH A;  1XS9 D;  2QB1 A;  2HOI A;  3MGI A;  4C8K A;  3WK4 A;  4WJ3 B;  2ATL A;  3ZDC A;  3C2M A;  1IIP A;  4EBC A;  2WTF A;  1DGS A;  2F3N A;  4QZE A;  2IOF A;  4O3M A;  3QE9 Y;  1O03 A;  8ICK A;  1GO3 F;  4DL2 A;  3CP8 A;  3V7J A;  2ZXI A;  4C8L A;  3RH4 A;  3RB6 A;  3T79 A;  5J2J A;  1KTQ A;  8ICE A;  5F9L A;  1TAQ A;  5J0T A;  1NKC A;  5HR6 A;  4P4P A;  4MEX A;  3ZD9 A;  2KMD A;  2NRZ A;  5CR0 A;  2DBY A;  4DSJ A;  1PK1 B;  2FLN A;  1ZET A;  2KOB A;  4MFF A;  5AK4 A;  5KTQ A;  1L3S A;  2F2A B;  5DBB A;  4GC6 A;  5KT7 A;  4YQW A;  1NK6 A;  5KFJ A;  4F50 A;  2R8I A;  1PUZ A;  1P7D A;  3UMC A;  3BQ7 A;  2EDU A;  2AGO A;  4M9J A;  1Z4O A;  3HJE A;  5J0Q A;  5AI8 A;  8ICN A;  5CB1 A;  7ICP A;  3RJH A;  3ZDB A;  2ES6 A;  2WF7 A;  2K89 A;  3M9O B;  4NLN A;  4O3O A;  5J2K A;  2BR0 A;  5ALY A;  3NVV A;  3PZP A;  4Q8F A;  2BDU A;  8ICB A;  2PI5 A;  2WF6 A;  5ALF A;  5KFT A;  4R65 A;  1U49 A;  3GV8 B;  4BUG A;  2KSO B;  4UAT A;  2PMZ F;  1MQ2 A;  2C2E A;  2BCU A;  2F1I A;  2R8G A;  2W7O A;  4QW8 A;  1PK1 A;  3V72 A;  5HMM A;  4US8 A;  4PGY A;  2FPL A;  5AI0 A;  2JV3 A;  3NS1 A;  7ICS A;  3RF9 A;  1L7O A;  9ICL A;  5ALJ A;  2HHW A;  8ICI A;  1NK8 A;  3ZDD A;  1S76 D;  2AXT U;  3RR7 A;  2ODG A;  1KFS A;  4RQ5 A;  3SAG A;  3C29 A;  4DL3 A;  3MDA A;  1BPX A;  1ZJN A;  3RBE A;  2P6U A;  4DCC A;  4QWE A;  4FZN A;  3TAN A;  4RQ4 A;  3NVZ A;  3HW8 A;  2DQN B;  2EAM A;  4GIB A;  2KK0 A;  2RP5 A;  3WK5 A;  4EBE A;  4PH5 A;  1SIJ A;  4ELT A;  1RZT A;  2Y9U A;  4P0Q B;  5J0X A;  2KSO A;  4YFK A;  5AM2 A;  3D2N A;  4ED2 A;  1ZQL A;  4KLQ A;  5HNK A;  5KT4 A;  1KKX A;  3SYZ A;  3QYP A;  4YD2 A;  4DQS A;  5KL8 B;  4I2H A;  5KAI U;  5ALL A;  3SV4 A;  2XI9 A;  3QXG A;  8ICT A;  3OGU A;  4ED0 A;  1HEK A;  5AM4 A;  5IIL A;  2HBM A;  3BQ1 A;  2YML A;  3JPN A;  2XGQ A;  3M7D A;  7ICJ A;  3HIL A;  1KN5 A;  4ECW A;  2FPM A;  2OHF A;  1X40 A;  4KX3 A;  1IV8 A;  2ZJA A;  3S6J A;  1UT5 A;  5DG8 A;  3B0X A;  1ZQT A;  4KLF A;  3WKE A;  2DF4 B;  1JN3 A;  1M6Y A;  2WB1 C;  5D49 A;  2KZZ A;  4JK1 A;  5AM1 A;  1S9F A;  3V6J A;  4FZM A;  5EOZ A;  1HIW A;  1SWV A;  2JZB B;  4NLG A;  1RPL A;  2AGP A;  5AKG A;  1S97 A;  4YG2 A;  5AKE A;  3TFR A;  3ISB A;  3A0B U;  2HSZ A;  2W9M A;  5DQH A;  3OSN A;  1JX4 A;  2E8P A;  5F3X B;  3ETL A;  1DOQ A;  9ICV A;  3E2E A;  2KP7 A;  1L7P A;  2Y1I A;  1NZB A;  5AKK A;  4PHA A;  1QSY A;  3CYM A;  2JRZ A;  4C0Z A;  5J2A A;  2WHE A;  1XWL A;  4QZ8 A;  1ZQV A;  7ICM A;  3WK6 A;  7ICK A;  4M9L A;  2AJQ A;  5ALS A;  1Z1V A;  4UB4 A;  2UVR A;  1QH9 A;  2R8J A;  4EX6 A;  4PZO A;  4NJ8 A;  5KFA A;  4O3S A;  3IDW A;  1WG8 A;  2KIC A;  4FS2 A;  1RXV A;  1VJ5 A;  3PSF A;  4DL4 A;  2IOF K;  3H4D A;  1JUD A;  5KNI A;  3TAP A;  5KFW A;  4XRH A;  4JV1 A;  5KFD A;  3PR4 A;  2W04 A;  3NGD A;  3BS5 B;  4DFJ A;  2M9N A;  3WKB A;  4NLK A;  1ZRN A;  1C20 A;  2GOL A;  5AM0 A;  2P66 A;  3MDC A;  1UHU A;  5KFV A;  4DEZ A;  4Y2S A;  5FP0 A;  8ICM A;  1JMS A;  4C8N A;  2JHD A;  3JPT A;  2V9W A;  5DG7 A;  2KHV A;  3K75 D;  1CUK A;  5DBC A;  1TAU A;  2G0A A;  2NV3 A;  3AQF A;  5DDY A;  4RQ2 A;  3Q8M A;  5G5G A;  5DB8 A;  1ZYQ A;  4AP9 A;  1XSL A;  4UQG A;  1HJP A;  4J03 A;  3DDH A;  1SZH A;  3AQE A;  2LKY A;  1WYG A;  4MHV A;  3TAD A;  3RB3 A;  2HVI A;  4C8M A;  4QZD A;  3J81 j;  4IRC A;  3KHL A;  4O5K A;  2UVU A;  2B21 A;  4UAZ A;  4DS4 A;  4M47 A;  3KFU F;  2E8M A;  8ICJ A;  1ZQE A;  5DGA A;  2GWS A;  1VDV A;  4US9 A;  9ICN A;  4PL1 A;  1NJZ A;  2W9C B;  4RQN A;  1X66 A;  5F9N A;  2KG5 A;  4OCZ A;  1X9X A;  1ZJM A;  4P0P B;  2MUT B;  9ICO A;  5AKH A;  1ECW A;  3JPQ A;  4KLL A;  1F5S A;  3H8J A;  1KSP A;  2LM4 A;  1Q3U A;  5D46 A;  2KIW A;  4G3I A;  4F5O A;  3ZDE A;  1XSN A;  1NOM A;  3K1Z A;  1Q8K A;  3RAX A;  4IRD A;  3TAD C;  2JEJ A;  3T5L A;  4B9L A;  2KNJ A;  2RDI A;  4DSL A;  3SQI A;  4CGZ A;  3N28 A;  1SWW A;  1SGG A;  9ICB A;  5ALZ A;  4DSF A;  5KFC A;  1RQL A;  5EE0 A;  3C2K A;  2EZX A;  2AU0 A;  3F2C A;  3NRW A;  2F44 A;  3T5J A;  5TIS U;  4DFM A;  2IOH A;  3TKA A;  3ISC A;  1K1S A;  5CEH A;  1ZQF A;  4P0P A;  2MUT A;  3SI8 A;  4DO9 A;  3V6K A;  1ARO P;  4DL7 A;  5ALR A;  1SKS A;  2K8B B;  2W43 A;  4Z6C A;  2CXY A;  4RNN A;  4I2F A;  2CN1 A;  3UQ0 A;  1XO1 A;  1TAM A;  2LYH A;  4OJL A;  2NO4 A;  3BQ2 A;  3KBB A;  5DLG A;  1RYS A;  4MFC A;  1A77 A;  2JR5 A;  2HHV A;  1XC9 A;  3KOO A;  5L1J A;  2L5Y A;  2BKE A;  1X2I A;  4C4T A;  2HBK A;  2W7P A;  4M9H A;  1WUD A;  2K8A A;  3C28 A;  2H3I A;  4EZ9 A;  5ALG A;  4NLZ A;  1IG6 A;  3Q8R B;  4O9M A;  1ZQO A;  4U6P A;  3PW5 A;  3OTQ A;  4MEY A;  2ASL A;  2HOQ A;  2VIX A;  3LYS A;  3WU2 U;  5KG5 A;  3QZ8 A;  3AU2 A;  1Z00 A;  3K4G A;  1ZQU A;  3HKZ C;  5AI9 A;  4DLG A;  2W3S A;  3PST A;  2NO5 A;  4FO6 A;  1RYR A;  1B4F A;  3GIM A;  2AGQ A;  3QNM A;  9ICJ A;  1D8L A;  5L9X A;  2OEH A;  4HAI A;  4RQ0 A;  3T3F A;  1BNO A;  3PX6 A;  4QZI A;  4B9U A;  2P35 A;  2ZIW B;  2HCF A;  1V38 A;  4YR3 A;  3QU7 A;  1A6S A;  4J9R A;  4TUQ A;  2YN4 A;  4P2H A;  5IIM A;  1U45 A;  1PZN A;  4ED3 A;  3UXP A;  4MFA A;  5J2B A;  2OM6 A;  2XID A;  1TK0 A;  4CRX A;  5ALX A;  1K5O A;  3GV5 B;  4Y2R A;  4C7Y A;  3ED5 A;  8ICR A;  4F4W A;  3AN1 A;  2ZUD A;  3EW9 A;  2E8N A;  1S0V A;  3JPO A;  4BDP A;  2Y9T A;  5J0O A;  2BPC A;  4IC9 A;  4I2I A;  1N5X A;  5K4L A;  2MAX A;  4C4R A;  4NM2 A;  3SAH A;  3L4P A;  4TUP A;  3G6Y A;  3DV9 A;  2ZIV B;  2G5I B;  2EAO A;  1DXS A;  2ZIW A;  1NK4 A;  3GFK B;  2KZ3 A;  5KG2 A;  4F4X A;  1U47 A;  2BQ3 A;  2OH2 A;  4UB1 A;  5CWR A;  4F4Z A;  1YZ7 A;  3GIL A;  4RQ6 A;  3F2B A;  2EH9 A;  5DBA A;  3RTV A;  1B0X A;  4TQR A;  3D2Q A;  3N4M B;  3PW2 A;  8ICY A;  2IA6 A;  4XQ8 A;  2ISP A;  5AK3 A;  2K4E A;  1TE2 A;  5ALK A;  1NJY A;  4O5E A;  4LJX A;  1DGJ A;  4ED1 A;  4UAR A;  3RH6 A;  3AMZ A;  4UAV A;  5CRX A;  1UT8 A;  5TZV A;  5L1M A;  2ASD A;  1L8L A;  1KFT A;  2PFQ A;  3ZD8 A;  4JB3 A;  4Y2P A;  7ICQ A;  3F5A A;  1SXE A;  2K4I A;  4EEL A;  4GC7 A;  4J9P A;  4GXI A;  9ICK A;  2EZY A;  1TV9 A;  4YMO A;  5KFU A;  5DKW A;  3M9N B;  3M8R A;  4Y2T A;  9ICF A;  4HYK A;  3PML A;  4M0A A;  2QB0 A;  7ICG A;  7ICE A;  2ZIV A;  3PSP A;  2RQ5 A;  8ICH A;  1NK7 A;  4UB6 U;  4M9N A;  1ZQS A;  2ZJ5 A;  3E58 A;  1KFD A;  4QWA A;  4FS1 A;  4Y2J A;  1ZQW A;  4C8O A;  4QIW C;  3C23 A;  1QTM A;  4F72 A;  4ECZ A;  1FO4 A;  3PMN A;  2G09 A;  5KFP A;  3MR2 A;  4RQM A;  5J0S A;  3L3F X;  5AK6 A;  4YP3 A;  1RM6 C;  1TK8 A;  2W55 A;  1HUZ A;  4K4G A;  1JRO A;  2W9A A;  2J6T A;  4UBC A;  2PFP A;  3H0L B;  1WWV A;  4YN4 A;  5KFF A;  3RJK A;  4QZH A;  2ASJ A;  5AI5 A;  2UVV A;  2ZIX A;  4DFP A;  3AL0 B;  2JEF A;  2HI0 A;  9ICM A;  4B9S A;  1PK3 A;  1KQQ A;  4PPX A;  2D6F C;  1L3T A;  1D9D A;  1ZD3 A;  3C1Z A;  2FMP A;  3QZ7 A;  1L3V A;  2BDP A;  9ICX A;  3FAH A;  5III A;  2BCS A;  7ICH A;  1MN8 A;  1FIQ A;  2FDR A;  3V7K A;  5EWG A;  2DWQ A;  2HMX A;  3EPG A;  1SV0 A;  4KLG A;  2BZF A;  3KKA A;  2Y0S C;  5DLF A;  1T7P A;  2KKV A;  2LBO A;  1ZQQ A;  1KW4 A;  3F53 A;  4F91 B;  5JUM A;  4YVZ A;  2D8C A;  2KJ5 A;  4JV0 A;  4F3O A;  4KLS A;  2ZTC A;  1YZ6 A;  2HBJ A;  3PR5 B;  4CCH A;  4B9N A;  3QUQ A;  4YMM A;  4PHP A;  3MR6 A;  4K4I A;  4ECS A;  1QQ7 A;  5AIC A;  2I6X A;  4F5Q A;  5CJ7 A;  3QUC A;  2ZIU B;  1A0P A;  2KHQ A;  2VAN A;  1KLN A;  3B9J A;  2ZJ8 A;  3RAQ A;  1T94 A;  4DL5 A;  1RG6 A;  5KG4 A;  2VJ5 A;  5C5J A;  5JU5 A;  3N7R C;  4J9O A;  8ICV A;  2ZXH A;  2ESE A;  3N7P D;  5KG7 A;  4KX5 A;  4FFD A;  3QX7 A;  4B9T A;  1RDF A;  3KKA C;  1KDH A;  1NK5 A;  3QU5 A;  9ICP A;  1KEJ A;  5KFL A;  4F5R A;  4EZ6 A;  5AM5 A;  4QW9 A;  1ZQ1 C;  2AQ0 A;  2G06 A;  2YB4 A;  4F4K A;  3V7L A;  2YQE A;  3WKD A;  5J2D A;  1SZP A;  2W3R A;  3GV7 B;  1N63 A;  3F2D A;  5AIB A;  5J8Y A;  1TFR A;  3H7I A;  3SV3 A;  4IL6 U;  1PVQ A;  1LV5 A;  2KVS A;  3H8W A;  3TAQ A;  9ICW A;  2XCA A;  2EAP A;  2ZIU A;  3EWA A;  1UCV A;  4NL9 A;  4C7Z A;  2OCE A;  1BPD A;  2EAN A;  3PNC A;  3TFS A;  4CNQ A;  5KFE A;  1XO0 A;  4B9V A;  2JH1 A;  1Q46 A;  4RQ3 A;  1N56 A;  2HOF A;  2KV2 A;  1QQ5 A; 
#chains in the Genus database with same CATH homology
 2BDU A;  3VC8 A;  3NUQ A;  2F76 X;  2KIC A;  2Y0S C;  2E1F A;  2KKV A;  2WB1 F;  3HKZ C;  2LBO A;  1Q3U A;  2KIW A;  3IP4 B;  3DEE A;  2LYA A;  2F8L A;  3PSF A;  2KKP A;  3F53 A;  3M6K A;  3PST A;  3CRX A;  2RHF A;  3K1Z A;  3ONN A;  4BUG A;  4OJP A;  2KVC A;  2W03 A;  2KEY A;  2KJ5 A;  2PMZ F;  2H3Q A;  1Z19 A;  2H3Z A;  5CRX A;  4KX3 A;  1OUQ A;  3MGV A;  1PVR A;  4A8E A;  2LYB A;  2KNJ A;  2HBJ A;  3GZF A;  2W7O A;  2W04 A;  4GFJ A;  2E1E A;  2MA1 A;  1KBU A;  2H3V A;  5A0L A;  3SQI A;  4CGZ A;  2DF4 B;  3F5A A;  2K4I A;  3LVV A;  2GOL A;  2K4H A;  2WB1 C;  1DRG A;  2CRX A;  2G08 A;  2Z7J A;  1MA7 A;  4U7C A;  2ZIW B;  2N1R A;  3M6Z A;  4QIW F;  4QNL A;  3ICX A;  2HOI A;  2LHT A;  3RF9 A;  2ZIU B;  4AYB C;  2E5S A;  1A0P A;  4FZL A;  2KHQ A;  4FZM A;  3F2C A;  4WJ3 B;  3NRW A;  1IIP A;  1HIW A;  2VJ4 A;  1A6S A;  3ALR A;  2XIC A;  3SAF A;  5C0Y A;  2JHD A;  2ZIV A;  3PSP A;  1Q3V A;  2G5H B;  1UPH A;  1CRX A;  5HR7 A;  4O3M A;  1T94 A;  2KHV A;  2VJ5 A;  3O0F A;  2M0N A;  3N7R C;  3D2S A;  1GO3 F;  3SAG A;  2G0A A;  3C29 A;  2NV3 A;  4P0P A;  2ZXH A;  2A3V A;  3AQF A;  3N7P D;  3CP8 A;  2WAQ F;  3LVW A;  2ZIX B;  4QIW C;  2ZXI A;  2HBL A;  3H0R B;  4FZN A;  2RRD A;  4KX5 A;  2MRL A;  2K8C B;  2JH7 A;  2OM6 A;  5T14 A;  3IN5 A;  2K8B B;  4ACO A;  2DQN B;  4JMU A;  2XID A;  3T79 A;  1P7D A;  4OO1 J;  3GU3 A;  3H0M B;  2RP5 A;  2G09 A;  2OXO A;  2CN1 A;  4CRX A;  5HR6 A;  1TAM A;  3L3F X;  2Y0S F;  1SZH A;  5KL1 B;  2PMZ C;  3AQE A;  4OJL A;  3RFA A;  2LKY A;  1Z1B A;  1ZQ1 C;  2G06 A;  2YB4 A;  2YB1 A;  4KMO B;  4P0Q B;  2JGA A;  3PSI A;  3F5E A;  2CPR A;  3H0L B;  2R18 A;  2KOB A;  1NZB A;  1L6N A;  3D2N A;  4ICA A;  4OJ6 A;  3F2D A;  4IC9 A;  2XVT A;  3KFU F;  2F2A B;  2G07 A;  3KZX A;  1XNS A;  3IG5 A;  2H3F A;  4NLC A;  3VCB A;  1PVQ A;  2KD1 A;  3SMV A;  2ZIX A;  4PL1 A;  1ED1 A;  3E0F A;  3SAH A;  2HBK A;  3CYM A;  4C0Z A;  4QJF B;  2W7P A;  1PVP A;  3AL0 B;  1WUD A;  2ZIV B;  2ZG6 A;  2K8A A;  3C28 A;  1URJ A;  2G5I B;  2H3I A;  2Q4T A;  2D6F C;  2KJ9 A;  4NV0 A;  2ZIW A;  5KL8 B;  2VKQ A;  4AYB F;  3HKZ F;  4BX9 C;  2ZIU A;  3IG8 A;  2YX8 A;  2JMG A;  2K89 A;  2OYY A;  4P0P B;  2F77 X;  2XI9 A;  4OJO A;  4FE3 A;  4NLB A;  4NWI A;  4OJ5 A;  1YT3 A;  4U6P A;  1F44 A;  1HEK A;  2OH2 A;  1ECW A;  2GH1 A;  4P0Q A;  1D8B A;  3F2B A;  2WAQ C;  3OPX A;  2HOQ A;  3N7S C;  2VIX A;  3LYS A;  3D2Q A;  2HBM A;  1XO0 A;  4CDG A;  2JH1 A;  4PL2 A;  2KJ8 A;  2HMX A;  4BJQ A;  3PZP A;  2DGZ A;  2K4E A;  2HOF A;  2KV2 A;  3M7D A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...