2E1FA

Crystal structure of the hrdc domain of human werner syndrome protein, wrn
Total Genus 33
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
33
sequence length
94
structure length
94
Chain Sequence
QPVISAQEQETQIVLYGKLVEARQKHANKMDVPPAILATNKILVDMAKMRPTTVENVKRIDGVSEGKAAMLAPLLEVIKHFCQTNSVQTDLFSS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Crystal structure of the HRDC domain of human Werner syndrome protein, WRN
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase
molecule keywords Werner syndrome ATP-dependent helicase
total genus 33
structure length 94
sequence length 94
ec nomenclature ec 3.6.4.12: DNA helicase.
pdb deposition date 2006-10-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00570 HRDC HRDC domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.80 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 DNA polymerase; domain 1 2e1fA01
2E1EA 2HBMA 3CYMA 4OO1J 2E1FA 2HBJA 2RRDA 2CPRA 2MA1A 3SAGA 2RHFA 4O3MA 2DGZA 4CGZA 4CDGA 4QIWF 1D8BA 4NLBA 5C0YA 2KV2A 4QJFB 1GO3F 1YT3A 4NLCA 3SAHA 2HBLA 1WUDA 2HBKA 3SAFA
chains in the Genus database with same CATH superfamily
8ICVA 5BOMA 2IOFK 4DQIA 1PK3A 3GIMA 2YB4A 3AU2A 3KKAA 4ECRA 2EZXA 2KG5A 2FPMA 5KFVA 3HRDD 3C2LA 2BCSA 4F72A 2MSNA 1KFDA 2XC9A 4GC7A 4DL7A 2CRXA 5DB7A 4FFDA 1D8LA 4DQSA 1Z1BA 3UXOA 4OCZA 5J2GA 2G06A 1LB2B 3ED5A 3QUCA 5CRXA 3CW2C 1SWVA 3J81j 5HNKA 1B22A 3O0FA 3GDXA 2P66A 4P4OA 2IOHA 3D6JA 4QZHA 1ZQRA 3H0RB 2ES6A 1KFTA 2JHDA 3PSFA 5L1IA 5AM2A 2ZIUB 3RR8A 3RJKA 4P0PA 5EOZA 4R64A 4C0ZA 4PZOA 4JB3A 4Y2XA 5CR0A 1PVPA 1SIJA 2F8LA 4DL6A 9ICFA 2H5XA 4Q43A 3RB6A 5AKZA 1BGXT 5D49A 3LDAA 2FMQA 1Z00B 4KLIA 3RAXA 4GC6A 4F8RA 4FBUA 4RQ3A 2J6SA 1MN8A 3TADA 2C2EA 5KT4A 4QZEA 2ZXHA 9ICUA 8ICTA 3QXGA 1KKXA 3SENA 1IIPA 1MA7A 1ZYQA 3SAHA 4J9LA 4DSEA 2HMXA 4UB2A 4Z6FA 3QZ7A 4YMOA 2XCAA 2LM1A 3M9MB 1A76A 2VA3A 5KFSA 3MR5A 1X6JA 3N97B 1V38A 3M8RA 2Y0SC 3PW4A 1OUQA 4RNOA 2FMSA 4CGZA 3TANA 1J2MA 3UMBA 2JEIA 4CF3A 2XICA 3N7SC 7ICKA 1SXDA 4LZGA 1ZQNA 2ZJ8A 3D2QA 3ZDAA 4J9RA 1RM6C 1UT8A 1S0OA 1HUZA 5BPCA 4YD2A 2WF8A 2NO5A 5ALWA 3E58A 3UQ0A 4NLZA 9ICQA 2HVIA 3EPIA 3BQ2A 4KN7A 3SYZA 3PZPA 3T5JA 1DXSA 3BDPA 4RQMA 1BPZA 2E8OA 4M9GA 2F2AB 1Z1VA 4J9KA 9ICWA 2B0CA 4GFJA 4IRKA 5AM0A 8ICOA 1JUDA 1URJA 4PPXA 1ZQKA 4UB5A 1RXWA 3OSPA 2ZJAA 5L1JA 4EYIB 3PX4A 2W9CB 5IILA 3HWTA 4B9SA 1F5SA 3LK9A 3UM9A 4FE3A 1D8YA 2BHNA 1V97A 3KZXA 2XO7A 3SD7A 2OWOA 4XA5A 3V7LA 4ZH4A 2GWSA 4DOCA 2K89A 3CNHA 1DRGA 1ZQUA 4DFJA 4RU9A 4K4IA 1TAQA 5ALXA 8ICWA 7ICOA 2GO7A 4NLBA 3AN1A 1T7PA 2KTQA 1A0PA 4IQTA 2MUTB 3MABA 5ALFA 3HJEA 2VA8A 2HSZA 2LYAA 3QUBA 3NASA 1JX4A 4US9A 2GLEA 2BCRA 4C4SA 3H0LB 2XVTA 4F4XA 5KFFA 1N61A 4DL2A 2KSOB 1UCVA 2K4EA 2BQUA 4E0DA 3EYZA 1XSNA 2XIDA 1UPHA 5ALSA 1VJ5A 9ICNA 2KKVA 4M9HA 2NRZA 9ICVA 4BGDA 1HUOA 4GIBA 2B6GA 4XUSA 4Y2YA 4ECWA 4R8UB 4IRDA 2A3VA 1X9MA 5IIJA 1NKEA 3MR2A 1DK3A 4JV1A 4NLCA 5AI8A 2E8PA 1L3TA 2D8CA 4EBDA 3N4MB 1RYSA 2JEJA 3GIJA 3OHBA 1MQ3A 3BQ7A 4PHEA 1SV0C 2G09A 2RRDA 1KW4A 1KN5A 2HDOA 1WWVA 1MC8A 3GIKA 2Z7JA 3Q8RB 1COKA 2H3QA 4UB1A 2HHTA 2JV3A 2RP5A 4IQUA 2G0AA 3RJIA 4QZAA 4J9PA 2KSOA 3RRGA 2AH5A 4Y2QA 4NLGA 4YQWA 1BPXA 2XCPA 1X42A 1ZRNA 3SEIA 1PK1B 4CF4A 2YMQA 1L6NA 4F5QA 4P4PA 3WK7A 3T5KA 4RUAA 2DPJA 4CNQA 3VCBA 4J9SA 3V72A 1QH9A 2RQ5A 4RNMA 2QLTA 2O6KA 3SMVA 2EQYA 4O3QA 4FS1A 2LMRA 4DWIA 3M8SA 2WB1C 3SAFA 4I2BA 4ELTA 2WB1F 9ICJA 1ZQFA 3DV9A 5A0LA 5KFYA 3JPOA 4YR0A 1RYRA 4US8A 3Q8LA 4QZBA 4PHPA 3K4GA 5J0UA 1EXNA 4ECZA 3G6YA 4WJ3B 2MRLA 2VJ5A 2KN7A 3IV6A 3WK4A 2HHUA 1S10A 4Y2VA 3TAQA 1QSLA 4OJ6A 1NK6A 2IHNA 2BCUA 1S77D 2KJ8A 5HR6A 3QUQA 4EENA 5J2CA 2YB1A 4I2CA 1ZD4A 3LYSA 4KLHA 4RQ2A 4M2YA 4YR3A 3NVVA 2HOFA 3QU4A 4CRXA 5ALHA 5AI9A 2DPIA 2P35A 1ZJNA 4O3MA 5DLGA 2JR5A 5KT5A 1ZOLA 2BKEA 3NS1A 5TISU 3WK5A 2PFQA 5J0QA 4BX9C 2KIWA 2Q0ZX 1ZQXA 4R63A 1TE2A 3PW0A 2WAQC 1B4FA 1C20A 4KLSA 3EPGA 2KZ3A 5KT6A 4QWDA 2W7OA 5EE0A 2KOBA 7ICVA 2A1JA 3PSTA 4I2FA 5AK4A 2WFAA 2FMPA 1PUZA 1ZQBA 8ICMA 8ICGA 1NK7A 2W03A 2UVRA 2LI6A 4KN4A 1S8OA 3M6KA 5J0RA 1NKCA 2CPRA 2AQ4A 1TK8A 2K60A 4JUZA 2R8GA 2W11A 1P7DA 4PGQA 2AU0A 2YMLA 2KV2A 2KZZA 5KL8B 3WKEA 2W8LA 3QE9Y 1T3NA 2XGPA 1ZQGA 5KG3A 1SWWA 2NRVA 5J0OA 3ZDDA 4FZNA 4ED1A 2ZIWB 1SL1A 4Q8FA 3BS7A 2V4RA 2FPKA 5KFGA 5EE3A 2V4QA 2XY6A 2KJ5A 4KITB 3RJHA 2AJQA 5JRTA 8ICQA 3M9NB 3E2EA 4I2JA 1LKYB 2RDJA 4ELUA 1ZQYA 4QNLA 5D46A 4UBCA 4FS2A 4ECVA 2E8MA 2KJ9A 3BS5B 2JH1A 5DBBA 2F1HA 3RFAA 5EWEA 1Q3VA 4Q8EA 3I1YA 3AU6A 4NM1A 5DLFA 1M6YA 5AI5A 3THVA 4FBTA 1RQLA 3RB0A 4P4MA 1ZRMA 4GXJA 4RQ5A 2XGQA 5KFRA 2ZIXB 2ISOA 3WU2U 5ALOA 4CE6A 2FJ6A 2Q4TA 2ZUDA 4DFDA 3F5AA 2W55A 1QCKA 4U6PA 5KG6A 2JH7A 3VC8A 4RT3A 3ONNA 2R8JA 3DDHA 4MHVA 3OPXA 7ICUA 2EZZA 2A1AA 1NJYA 1PVQA 2A1JB 1RZTA 4Y2PA 2NO4A 4C8OA 2K8BB 3EUB2 2KVSA 5KG0A 2LM4A 3QYPA 5HHHA 5AKYA 3QNMA 7ICLA 5AICA 2ZG6A 4I2GA 7ICGA 4UB6U 4F3OA 3PSIA 4DSFA 2KMDA 2NV3A 5JUMA 2FPLA 3CYMA 5IIIA 4I28A 3H8SA 2BPFA 5F9NA 4I2EA 4J9QA 4ECSA 4KTQA 8ICNA 5AKKA 2CXYA 4J9MA 1Q8KA 4UAYA 2YQEA 3MBYA 1UQVA 1N56A 4YFKA 2K4HA 2QARB 2W8KA 1SGGA 4EYHB 1AROP 5KFLA 1S0MA 1WWUA 1ZD3A 1N2XA 3GIIA 1RXVA 3C2MA 5AI0A 1MQ2A 4MF2A 2JXJA 5AK5A 3PSPA 3JPRA 4YR2A 1LV5A 2EDUA 2DBYA 1Z19A 2OYYA 1LKYA 3FDSA 1NJWA 8ICYA 2BGWA 5ALEA 5CB1A 3HPOA 1MSWD 1DK2A 4UATA 2HHXA 2WF6A 2ZUBA 3KBBA 1BNOA 4AYBC 4Q45A 4AYBF 4C7ZA 2P6RA 1HEKA 5AKHA 5ALNA 2M9NA 2KICA 1ZQAA 1N48A 3WKDA 3ZDEA 1N60A 5J2JA 1PZNA 8ICEA 2AGOA 1U4BA 3AUOA 1U9LA 4C7YA 2IA6A 5KT3A 5J2AA 1X9XA 1ZQEA 4ACOA 3TARA 8ICXA 3UPQA 3ALRA 4GXIA 1KLNA 5DBAA 4ECTA 3TADC 4EZ9A 2J6TA 5KFJA 4LZDA 3PO5A 2D3DA 2PFNA 3IHQB 5FP0A 2WF9A 2NRWA 2PI5A 5KFHA 1NNLA 4F92B 4LVSA 1UA0A 4DEZA 1ZQTA 3Q8SB 5AM5A 1JIHA 4PJ0U 5L1LA 5ALPA 1BPBA 4P0QA 2MU2A 4ED8A 5CEHA 1D9FA 2DFLA 4UB8U 5EWFA 2DWQA 1TVAA 4BXOA 5DGBA 3EW9A 4IQVA 5J8YA 1ZQWA 1U49A 2KHVA 2DKXA 2ODGA 4MF8A 3PX0A 1QTMA 4ECUA 5J0WA 5J8YC 3C23A 5AI6A 1JROA 2H3VA 2LYBA 3HP6A 1XO1A 4RQ7A 3U26A 3H7IA 1QSYA 2JZBA 9ICTA 3JPPA 4DFMA 2L5YA 5K4LA 1JI7A 2I6XA 2KP7A 4DFKA 3MR3A 1IM4A 2YY6A 5DDYA 3D2SA 5J2IA 2NRXA 9ICAA 4QZDA 4R65A 4RPZA 3KHRA 2RDIA 4DSJA 2W3SA 4KLTA 3OSNA 1COOA 4DF8A 2ZIUA 1ED1A 3L5KA 4I2IA 3GV7B 5TZVA 1TAMA 2AGPA 1CI4A 1ZD5A 1NK9A 1XSPA 2F76X 1ZQVA 4IL6U 2BDPA 4UQGA 5DG7A 5E79U 4JK1A 5DG9A 4UB3A 5KG1A 4O3RA 3CP8A 5KFZA 3C2KA 4ED3A 5D4BA 5JU5A 1WUDA 5J2HA 3GZFA 3OGUA 3PW2A 3A0HU 1BPEA 4PL1A 2WTFA 1U47A 2PMZF 5KFBA 4EX6A 3B9JA 3NRWA 3V6JA 1FEZA 3FC4A 4TUPA 2UVWA 1U45A 9ICKA 2HOIA 1HIWA 4YD1A 3PMNA 1IXRA 5H2FU 1WYGA 3MGVA 5HMLA 5ALMA 5HHIA 4Y2SA 2VIXA 4BXOB 4B9VA 2W9MA 4QWCA 1KEJA 4YXJA 3KHHA 2MAXA 2OEHA 4P2HA 4P0PB 1PVRA 1XS9D 1SL2A 3I28A 3M9OB 2QB0A 2ZIVA 4MFAA 1GO3F 2OHFA 2KEYA 2HHQA 2R8HA 2N1RA 5ALJA 1XO0A 5IIKA 2VKQA 5EWGA 4UAVA 5DB9A 1FFUA 4KLMA 5IIMA 1FIQA 2KHQA 4TUSA 2CN1A 5AM4A 4DQRA 8ICPA 1TAUA 2ISPA 7ICJA 2UVVA 2ALZA 2M0NA 5J0SA 1Z4OA 4C8MA 1QSSA 1L7NA 5KFNA 8ICKA 4PL2A 8ICUA 4JMUA 4DSKA 1KDHA 2C28A 4RQ0A 2DQNB 1SL0A 4JV0A 4MFFA 1D8BA 4Z6EA 4ECQA 5IIOA 1NKBA 2WF7A 1ZQIA 4R8UA 3IDWA 5KG2A 5ALTA 3PV8A 5L1KA 4PHAA 1K1SA 4RQ6A 2ZIWA 4ED2A 3A0BU 5KFCA 5ALRA 4Z6DA 3GU3A 1DGSA 4M9NA 1WCLA 5DG8A 4DF4A 1KL9A 4NXZA 2PXIA 4M04A 2ZIXA 4DOAA 5KFAA 3JPTA 2YMMA 8ICBA 2ZTDA 3UMGA 4EX7A 4DL3A 2MUTA 2C22A 4FZLA 5ALZA 2HHSA 1NOMA 3Q8KA 3MDCA 4DOBA 1YZ6A 3RBDA 7ICSA 2ATLA 4EBCA 3V7KA 5G5GA 3N28A 2DF4B 4TQSA 1ECWA 3RH6A 2HBKA 3MGIA 8ICAA 3NUQA 4IC9A 5KFPA 3ISCA 1L3VA 2W04A 3WKAA 2HHVA 4F4KA 2KD1A 1RQNA 3R9KA 4RPXA 4RQ4A 4ED6A 7ICNA 1V9PA 3ISDA 2PI4A 1CEZA 2H3IA 5EE1A 2BCVA 2RLTA 2QARA 3PR5B 4KLUA 1IG6A 3QZ8A 2ASDA 4KLQA 4YXMA 2LKYA 5KG4A 2J6UA 3IP4B 4YCXA 1DOQA 1WCNA 4ECYA 7ICTA 4DL4A 4J03A 3UXNA 4O5KA 3T5HA 1KTQA 3KZIU 1N5XA 4GLXA 4F93B 3KD3A 2HVHA 2R8IA 3RAQA 4QW8A 2IMWP 5KT2A 3KTQA 2F8KA 2QB0B 2YN4A 5AKEA 1XNSA 2HW3A 1Z00A 3JPSA 9ICMA 2W43A 2Y0SF 3RH5A 2H3FA 2KFNA 4KLFA 1S76D 3SZ2A 1N5WA 3FAHA 1RG6A 4OJOA 4DQPA 2F77X 5J0PA 3V7JA 5AKIA 4NL9A 2I5HA 4G9BA 3B0XA 3H8WA 3PY8A 4KLDA 1L8LA 1QQ6A 1ZQLA 3JPNA 4Y2UA 8ICFA 2KVCA 2R18A 3K1ZA 2FE9A 5AKXA 3Q8QB 3L4PA 1VLBA 3HX0A 1J97A 3C5GA 4O5EA 1X66A 1NK8A 3GQCA 4C8LA 3C28A 4PZNA 5KFWA 4X5VA 3QU9A 3F2CA 4F5OA 4NLKA 3M6ZA 4F5PA 4MEYA 3RJJA 4Q44A 1RPLA 2WF5A 1BNPA 3WKCA 3C1YA 4GXKA 1TV9A 3EZ5A 5AM3A 9ICBA 5KFOA 1UHUA 4QWAA 4QZCA 7ICPA 2I1QA 1T4GA 4OO1J 2ZJ5A 5ALGA 4R66A 3TI0A 1TK0A 3KOOA 4DLEA 4FO6A 1SZHA 2JZBB 1NZPA 4CCHA 2YX8A 9ICXA 3IM1A 3ZD8A 4KLOA 4F50A 3F53A 1IV8A 3AMZA 2KFZA 4ED7A 3ISBA 1S0VA 2IBKA 3B0YA 8ICHA 5AM1A 5F3XB 7ICEA 4NLNA 4F2RA 2XI9A 3L3FX 1JN3A 4QZ8A 2HI0A 5J2FA 1JMSA 2PFOA 3C29A 5CHGA 2C2DA 1QQ7A 5J29A 3UXPA 3RB4A 1SZPA 2F44A 2ASJA 2JGAA 4TURA 9ICHA 3KFUF 4M6WA 2PMZC 3G6VA 4M6WB 2ESEA 9ICRA 5EE9A 1T3QA 5KFEA 3PVXA 1Z3EB 3QUTA 3QEAZ 2W9CA 2BDUA 4PH5A 5KAIU 5DBCA 4UARA 4A8EA 4DS5A 1DGJA 7ICRA 4F5RA 1SV4A 4O3SA 1ZD2P 4B9TA 1S97A 4F4YA 2ZTEA 1X9SA 2A19A 4NWIA 5B66U 2W7PA 2WHEA 1HJPA 7ICMA 5CA7A 2KZMA 4DO9A 3CRXA 5AKLA 1X40A 3AEVA 1L7OA 2ZIVB 1YZ7A 4XQ8A 4UAWA 4O3OA 4B9NA 4FZMA 5ALIA 2R8KA 5G5HA 8ICCA 4O5CA 2HBMA 3NTUA 4P0QB 5CWRA 1SKSA 1ZQZA 5DQHA 3MFIA 2KE7A 3H40A 3KKAC 4EEKA 3ZI4A 2ASLA 3D2NA 1TK5A 2G07A 3K75D 4QZIA 4OJ5A 3PW5A 1CUKA 5GTHU 4HAIA 3SV4A 2PKEA 3KHGA 5HR7A 1KRPA 4OJLA 3UMCA 1Y88A 1O03A 4NJ8A 4PHDA 3BQ1A 1F44A 2HOQA 3V6KA 3SI8A 3F5EA 2G08A 2Y9UA 4USAA 5KFDA 5F9LA 1JRPA 4ELVA 2VA2A 3SAGA 4C4RA 1XSLA 3OHAA 2OM6A 3RJGA 1OXJA 5ALVA 5J2EA 2G5HB 2FI1A 5DKWA 5JTIA 9ICCA 4O3NA 2W9BA 4DQQA 2K4IA 2Y9TA 4C4TA 2BQ3A 2I9GA 5T14A 3TFSA 1C7YA 3AQEA 1SXEA 3F2DA 2QB1A 2AXTU 4I2AA 3BQ0A 2W9BB 5KG5A 3UQ2A 1QLNA 2KNJA 4KX3A 9ICEA 1A6SA 4B9MA 1ZQQA 4IR1A 4F4ZA 3PR4A 8ICIA 5KFMA 3LWMA 1ZETA 1KSPA 3NVZA 4J9NA 1XC9A 4BDPA 2JMGA 1UA1A 1F0MA 4KLEA 4DSIA 7ICQA 1BPYA 4KLLA 5J2BA 3GV5B 1XWLA 2KIVA 4QJFB 2F1JA 2PFPA 5ALLA 3S6JA 2FLLA 4DL5A 1ZQCA 4UAUA 4C80A 1X2IA 4I2DA 4KMUA 4YP3A 4G3IA 4B9LA 5HMMA 1U48A 2GOLA 2GH1A 5DQGA 1FO4A 2EAPA 5ALDA 2KKPA 3ZD9A 4C8KA 3OTQA 2ZXIA 3RB3A 3BS5A 1NK0A 5C5JA 2DKZA 3GV8B 4ICAA 2F3NA 1WG8A 4KMOB 4CF5A 4F71A 1ZXIA 4F91B 2V9WA 4M9JA 2DUYA 2OH2A 9ICIA 5KAFU 3WKBA 1X6IA 3QX7A 4F5NA 1Q46A 1N63A 4C8NA 1RYUA 3T79A 3IN5A 1BPDA 3RJEA 3AL0B 1T94A 2NRTA 4PGXA 1YT3A 4DFPA 4QWBA 1XU4A 1VDVA 1L3UA 4RQ1A 1S5LU 1J2NA 4B6JA 3G6XA 2EH9A 4JWMA 4RZRA 3H8JA 2E3TA 1ZJMA 4QZFA 4YN4A 3LVWA 4MFCA 2ZTCA 3FYHA 1BVSA 3AM9A 2C2RA 3AQFA 2AHOB 3SV3A 1TFRA 3HKZC 3E0FA 4UB4A 1NK4A 2UVUA 8ICLA 5GTIU 8ICJA 5AIBA 5J0XA 3ETLA 1TKDA 4RT2A 2RHFA 3NGDA 2EAMA 1N62A 1O08A 1K1QA 5HP4A 3H0MB 1FFVA 5ALYA 4LJXA 4K4HA 5KFIA 1X9WA 1L8OA 2BCQA 1UT5A 2K8CB 4O3PA 4TQRA 3K1RB 3SR6A 4JWNA 2JEFA 3T5LA 4QIWF 9ICOA 3M1YA 4BWJA 3BZKA 3N7RC 1QQ5A 2YTUA 4EEYA 2IHMA 4MEXA 1JXLA 2VANA 1L7PA 5DQIA 2K4PA 2G5IB 9ICLA 5DB6A 3QEBZ 8ICSA 7ICIA 2EAOA 3LVVA 3DEEA 1ZQ1C 5J0YA 5AI4A 3RRHA 4DCCA 5ALQA 1V85A 2BZFA 4F4WA 3C21A 4YMMA 2BPGA 4UAZA 1SV0A 3WK9A 2DL0A 2IOFA 2YMPA 7ICFA 5B5EU 2KK0A 3NRZA 1PK1A 3MDAA 1LVHA 4IQWA 1NI3A 8ICRA 2LHTA 3OJSA 5DB8A 1D9DA 3WK8A 4UASA 4UBBA 3ETRA 1ZQJA 4DSLA 5KL1B 3TQ1A 5BOLA 1S0NA 3TACB 3ZDBA 3TKAA 1ZQPA 5IINA 3BJYA 3KHLA 2P6UA 2JRZA 1Q3UA 4IRCA 2OCEA 2BQRA 3H4DA 2JEGA 4J9OA 2FDRA 3GFKB 1KBUA 1NZBA 3IG8A 3V6HA 3BQTA 5CP2A 4QIWC 3PO4A 3JPQA 3RJFA 4YMNA 3HT3A 2XY7A 1AQ6A 4UW9A 5J2DA 4KLGA 3BZCA 2LPEA 4DLGA 3N7PD 4NL9C 2LYHA 3NVYA 2E5SA 5KFUA 3OJUA 1Z4NA 4PGYA 2QKQA 1H38A 5AIAA 1SKWA 4KX5A 4BWMA 3T3FA 4AP9A 5C0YA 4NY8A 9ICGA 2W3RA 2E1EA 4EZ6A 3PX6A 2K8AA 3H8MA 4RQ8A 5L9XA 5DDMA 5KFTA 2HCFA 4K4GA 3EWAA 4TUQA 9ICSA 3HW8A 2HHWA 2B21A 5CJ7A 3RF9A 3IRUA 1OW5A 5KFQA 4CDGA 5J0TA 5AHXA 3ZDCA 4QWEA 3ICXA 2AQ0A 3C1ZA 2ZUCA 5KG7A 1B0XA 2W54A 3Q8MA 1A77A 5KFKA 2LBOA 2E1FA 3SQIA 4Z6CA 2EZYA 1S9FA 5KFXA 2E8NA 3TFRA 4RPYA 4JV2A 1T8EA 1ZQOA 3RBEA 4ED0A 7ICHA 4F2SA 4IS7A 5J2KA 4Y2RA 5ALUA 4M47A 4RUCA 2HBJA 8ICZA 2Y1IA 4U7CA 4YG2A 4Y2JA 1L5UA 9ICPA 2EANA 2FLPA 4KLJA 4BJQA 2VJ4A 1ZQHA 3HILA 1K5OA 1NK5A 3F2BA 2BR0A 2D6FC 3HKZF 3MC1A 3ORYA 5AKJA 4ECXA 4ZOHC 3LWLA 4XRHA 1NJXA 1L3SA 3QU7A 2BPCA 5ALKA 4NV0A 3QU2A 4QZGA 5KT7A 4I29A 4EELA 3M7DA 2AGQA 3RR7A 4DS4A 2FLNA 3RTVA 4QZ9A 1KQQA 2DGZA 3MFHA 3H4BA 3NVWA 2NYVA 5L1MA 3PW7A 4YVZA 5KNIA 1ZQMA 2H3ZA 1CRXA 4M9LA 2W9AA 4OD0A 5DGAA 3RH4A 4I27A 5AK3A 4NM2A 1JXEA 4RNNA 1SKRA 3PMLA 3C5FA 4QW9A 3IG5A 3QU5A 1KFSA 2WAQF 5KTQA 4B9UA 4Y2TA 4O9MA 3TAPA 4RQNA 1L7MA 2XY5A 3MR6A 4M0AA 1RDFA 1SB3C 2OXOA 3PNCA 1JALA 5AKGA 3MGHA 4IR9A 4OJPA 4EBEA 2Y1JA 1NJZA 1ZQDA 3WK6A 2F1IA 4HYKA 3GILA 2MA1A 1ZQSA 3FM9A 4I2HA 5AK6A 3Q8PB 1B43A 4BUGA 4O0IA 3I76A 2HBLA
chains in the Genus database with same CATH topology
2WB1F 2NV3A 2HBMA 3GZFA 3F53A 5A0LA 4P0QB 4PL1A 3CYMA 1XNSA 1KBUA 2K8CB 2PMZF 5KL8B 4P0QA 2LYAA 1NZBA 2HBJA 3IG8A 1OUQA 4U7CA 4QIWC 2Y0SC 4WJ3B 2MRLA 2YB4A 2GOLA 2ZIWA 3D2NA 2G07A 2GH1A 2VJ5A 2Y0SF 2XVTA 3H0LB 3NRWA 4OJ5A 2KKPA 2VJ4A 2ZIWB 4BJQA 2H3FA 2ZXIA 2XI9A 3GU3A 3L3FX 4OJOA 4CGZA 2K4EA 4QIWF 2F77X 2HOIA 2CRXA 2XIDA 1HIWA 1UPHA 4ICAA 4KMOB 4OJ6A 3N7RC 3F2BA 2ZIXA 2XICA 2KJ5A 3N7SC 3N7PD 3MGVA 2KKVA 3HKZF 2KJ8A 1Z1BA 2D6FC 5HR6A 4OJLA 2KHVA 2G06A 2OH2A 3D2QA 2K4HA 2YB1A 3C29A 2VIXA 1F44A 2HOQA 3LYSA 5CRXA 2E5SA 4FZLA 3F5EA 4NV0A 2G08A 2HOFA 3O0FA 2KVCA 2R18A 4QNLA 3K1ZA 3M7DA 4CRXA 2G5IB 2A3VA 2JGAA 2KJ9A 3SAGA 2JH1A 4P0PB 2H3VA 1PVRA 2LYBA 3H0RB 4O3MA 2DGZA 3T79A 3IN5A 3KFUF 3RFAA 2JHDA 3AL0B 3PSPA 2ZIVA 3PSFA 1T94A 2PMZC 4KX5A 3PZPA 3LVVA 1Q3VA 3DEEA 1ZQ1C 2DF4B 1Z19A 2OM6A 2OYYA 1ECWA 3C28A 5C0YA 5HR7A 1GO3F 1YT3A 2H3ZA 2ZIUB 2G5HB 4NLCA 4BX9C 1CRXA 2KEYA 2HBKA 4P0PA 2KIWA 4C0ZA 2F2AB 2E1EA 2K8AA 3F2CA 2N1RA 3NUQA 2K4IA 2BDUA 4AYBC 3M6ZA 1XO0A 2VKQA 1PVPA 2ZIXB 2WAQC 3IG5A 2F8LA 4GFJA 4IC9A 1HEKA 2G09A 2RRDA 2WAQF 4AYBF 3SAFA 2W04A 5T14A 3D2SA 3AQEA 1URJA 2Q4TA 3F2DA 2KICA 2Z7JA 2W7OA 2KOBA 2KHQA 3RF9A 3F5AA 2H3QA 2CN1A 4A8EA 2KD1A 4U6PA 3PSTA 2RP5A 2JH7A 3LVWA 4FZNA 3VC8A 2G0AA 1WUDA 4CDGA 3ONNA 3ICXA 2H3IA 2KNJA 4KX3A 2M0NA 4FE3A 1A6SA 2OXOA 2LHTA 3AQFA 3OPXA 2ZIUA 3HKZC 1ED1A 3KZXA 2W03A 4OJPA 3E0FA 1L6NA 4NWIA 1PVQA 2W7PA 4ACOA 2LKYA 4OO1J 2LBOA 1TAMA 2E1FA 3M6KA 4PL2A 3ALRA 3SQIA 2K8BB 4JMUA 2CPRA 2F76X 2K89A 3CRXA 5KL1B 2DQNB 1DRGA 3IP4B 3VCBA 2JMGA 2MA1A 2RHFA 2ZIVB 2ZXHA 4FZMA 1P7DA 1D8BA 3H0MB 2ZG6A 3CP8A 4BUGA 1SZHA 1IIPA 4NLBA 3SMVA 1Q3UA 2KV2A 4QJFB 1MA7A 2YX8A 3SAHA 3PSIA 2HBLA 2HMXA 2WB1C 1A0PA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2E1E A;  2HBM A;  3CYM A;  4OO1 J;  2E1F A;  2HBJ A;  2RRD A;  2CPR A;  2MA1 A;  3SAG A;  2RHF A;  4O3M A;  2DGZ A;  4CGZ A;  4CDG A;  4QIW F;  1D8B A;  4NLB A;  5C0Y A;  2KV2 A;  4QJF B;  1GO3 F;  1YT3 A;  4NLC A;  3SAH A;  2HBL A;  1WUD A;  2HBK A;  3SAF A; 
#chains in the Genus database with same CATH topology
 8ICV A;  5BOM A;  2IOF K;  4DQI A;  1PK3 A;  3GIM A;  2YB4 A;  3AU2 A;  3KKA A;  4ECR A;  2EZX A;  2KG5 A;  2FPM A;  5KFV A;  3HRD D;  3C2L A;  2BCS A;  4F72 A;  2MSN A;  1KFD A;  2XC9 A;  4GC7 A;  4DL7 A;  2CRX A;  5DB7 A;  4FFD A;  1D8L A;  4DQS A;  1Z1B A;  3UXO A;  4OCZ A;  5J2G A;  2G06 A;  1LB2 B;  3ED5 A;  3QUC A;  5CRX A;  3CW2 C;  1SWV A;  3J81 j;  5HNK A;  1B22 A;  3O0F A;  3GDX A;  2P66 A;  4P4O A;  2IOH A;  3D6J A;  4QZH A;  1ZQR A;  3H0R B;  2ES6 A;  1KFT A;  2JHD A;  3PSF A;  5L1I A;  5AM2 A;  2ZIU B;  3RR8 A;  3RJK A;  4P0P A;  5EOZ A;  4R64 A;  4C0Z A;  4PZO A;  4JB3 A;  4Y2X A;  5CR0 A;  1PVP A;  1SIJ A;  2F8L A;  4DL6 A;  9ICF A;  2H5X A;  4Q43 A;  3RB6 A;  5AKZ A;  1BGX T;  5D49 A;  3LDA A;  2FMQ A;  1Z00 B;  4KLI A;  3RAX A;  4GC6 A;  4F8R A;  4FBU A;  4RQ3 A;  2J6S A;  1MN8 A;  3TAD A;  2C2E A;  5KT4 A;  4QZE A;  2ZXH A;  9ICU A;  8ICT A;  3QXG A;  1KKX A;  3SEN A;  1IIP A;  1MA7 A;  1ZYQ A;  3SAH A;  4J9L A;  4DSE A;  2HMX A;  4UB2 A;  4Z6F A;  3QZ7 A;  4YMO A;  2XCA A;  2LM1 A;  3M9M B;  1A76 A;  2VA3 A;  5KFS A;  3MR5 A;  1X6J A;  3N97 B;  1V38 A;  3M8R A;  2Y0S C;  3PW4 A;  1OUQ A;  4RNO A;  2FMS A;  4CGZ A;  3TAN A;  1J2M A;  3UMB A;  2JEI A;  4CF3 A;  2XIC A;  3N7S C;  7ICK A;  1SXD A;  4LZG A;  1ZQN A;  2ZJ8 A;  3D2Q A;  3ZDA A;  4J9R A;  1RM6 C;  1UT8 A;  1S0O A;  1HUZ A;  5BPC A;  4YD2 A;  2WF8 A;  2NO5 A;  5ALW A;  3E58 A;  3UQ0 A;  4NLZ A;  9ICQ A;  2HVI A;  3EPI A;  3BQ2 A;  4KN7 A;  3SYZ A;  3PZP A;  3T5J A;  1DXS A;  3BDP A;  4RQM A;  1BPZ A;  2E8O A;  4M9G A;  2F2A B;  1Z1V A;  4J9K A;  9ICW A;  2B0C A;  4GFJ A;  4IRK A;  5AM0 A;  8ICO A;  1JUD A;  1URJ A;  4PPX A;  1ZQK A;  4UB5 A;  1RXW A;  3OSP A;  2ZJA A;  5L1J A;  4EYI B;  3PX4 A;  2W9C B;  5IIL A;  3HWT A;  4B9S A;  1F5S A;  3LK9 A;  3UM9 A;  4FE3 A;  1D8Y A;  2BHN A;  1V97 A;  3KZX A;  2XO7 A;  3SD7 A;  2OWO A;  4XA5 A;  3V7L A;  4ZH4 A;  2GWS A;  4DOC A;  2K89 A;  3CNH A;  1DRG A;  1ZQU A;  4DFJ A;  4RU9 A;  4K4I A;  1TAQ A;  5ALX A;  8ICW A;  7ICO A;  2GO7 A;  4NLB A;  3AN1 A;  1T7P A;  2KTQ A;  1A0P A;  4IQT A;  2MUT B;  3MAB A;  5ALF A;  3HJE A;  2VA8 A;  2HSZ A;  2LYA A;  3QUB A;  3NAS A;  1JX4 A;  4US9 A;  2GLE A;  2BCR A;  4C4S A;  3H0L B;  2XVT A;  4F4X A;  5KFF A;  1N61 A;  4DL2 A;  2KSO B;  1UCV A;  2K4E A;  2BQU A;  4E0D A;  3EYZ A;  1XSN A;  2XID A;  1UPH A;  5ALS A;  1VJ5 A;  9ICN A;  2KKV A;  4M9H A;  2NRZ A;  9ICV A;  4BGD A;  1HUO A;  4GIB A;  2B6G A;  4XUS A;  4Y2Y A;  4ECW A;  4R8U B;  4IRD A;  2A3V A;  1X9M A;  5IIJ A;  1NKE A;  3MR2 A;  1DK3 A;  4JV1 A;  4NLC A;  5AI8 A;  2E8P A;  1L3T A;  2D8C A;  4EBD A;  3N4M B;  1RYS A;  2JEJ A;  3GIJ A;  3OHB A;  1MQ3 A;  3BQ7 A;  4PHE A;  1SV0 C;  2G09 A;  2RRD A;  1KW4 A;  1KN5 A;  2HDO A;  1WWV A;  1MC8 A;  3GIK A;  2Z7J A;  3Q8R B;  1COK A;  2H3Q A;  4UB1 A;  2HHT A;  2JV3 A;  2RP5 A;  4IQU A;  2G0A A;  3RJI A;  4QZA A;  4J9P A;  2KSO A;  3RRG A;  2AH5 A;  4Y2Q A;  4NLG A;  4YQW A;  1BPX A;  2XCP A;  1X42 A;  1ZRN A;  3SEI A;  1PK1 B;  4CF4 A;  2YMQ A;  1L6N A;  4F5Q A;  4P4P A;  3WK7 A;  3T5K A;  4RUA A;  2DPJ A;  4CNQ A;  3VCB A;  4J9S A;  3V72 A;  1QH9 A;  2RQ5 A;  4RNM A;  2QLT A;  2O6K A;  3SMV A;  2EQY A;  4O3Q A;  4FS1 A;  2LMR A;  4DWI A;  3M8S A;  2WB1 C;  3SAF A;  4I2B A;  4ELT A;  2WB1 F;  9ICJ A;  1ZQF A;  3DV9 A;  5A0L A;  5KFY A;  3JPO A;  4YR0 A;  1RYR A;  4US8 A;  3Q8L A;  4QZB A;  4PHP A;  3K4G A;  5J0U A;  1EXN A;  4ECZ A;  3G6Y A;  4WJ3 B;  2MRL A;  2VJ5 A;  2KN7 A;  3IV6 A;  3WK4 A;  2HHU A;  1S10 A;  4Y2V A;  3TAQ A;  1QSL A;  4OJ6 A;  1NK6 A;  2IHN A;  2BCU A;  1S77 D;  2KJ8 A;  5HR6 A;  3QUQ A;  4EEN A;  5J2C A;  2YB1 A;  4I2C A;  1ZD4 A;  3LYS A;  4KLH A;  4RQ2 A;  4M2Y A;  4YR3 A;  3NVV A;  2HOF A;  3QU4 A;  4CRX A;  5ALH A;  5AI9 A;  2DPI A;  2P35 A;  1ZJN A;  4O3M A;  5DLG A;  2JR5 A;  5KT5 A;  1ZOL A;  2BKE A;  3NS1 A;  5TIS U;  3WK5 A;  2PFQ A;  5J0Q A;  4BX9 C;  2KIW A;  2Q0Z X;  1ZQX A;  4R63 A;  1TE2 A;  3PW0 A;  2WAQ C;  1B4F A;  1C20 A;  4KLS A;  3EPG A;  2KZ3 A;  5KT6 A;  4QWD A;  2W7O A;  5EE0 A;  2KOB A;  7ICV A;  2A1J A;  3PST A;  4I2F A;  5AK4 A;  2WFA A;  2FMP A;  1PUZ A;  1ZQB A;  8ICM A;  8ICG A;  1NK7 A;  2W03 A;  2UVR A;  2LI6 A;  4KN4 A;  1S8O A;  3M6K A;  5J0R A;  1NKC A;  2CPR A;  2AQ4 A;  1TK8 A;  2K60 A;  4JUZ A;  2R8G A;  2W11 A;  1P7D A;  4PGQ A;  2AU0 A;  2YML A;  2KV2 A;  2KZZ A;  5KL8 B;  3WKE A;  2W8L A;  3QE9 Y;  1T3N A;  2XGP A;  1ZQG A;  5KG3 A;  1SWW A;  2NRV A;  5J0O A;  3ZDD A;  4FZN A;  4ED1 A;  2ZIW B;  1SL1 A;  4Q8F A;  3BS7 A;  2V4R A;  2FPK A;  5KFG A;  5EE3 A;  2V4Q A;  2XY6 A;  2KJ5 A;  4KIT B;  3RJH A;  2AJQ A;  5JRT A;  8ICQ A;  3M9N B;  3E2E A;  4I2J A;  1LKY B;  2RDJ A;  4ELU A;  1ZQY A;  4QNL A;  5D46 A;  4UBC A;  4FS2 A;  4ECV A;  2E8M A;  2KJ9 A;  3BS5 B;  2JH1 A;  5DBB A;  2F1H A;  3RFA A;  5EWE A;  1Q3V A;  4Q8E A;  3I1Y A;  3AU6 A;  4NM1 A;  5DLF A;  1M6Y A;  5AI5 A;  3THV A;  4FBT A;  1RQL A;  3RB0 A;  4P4M A;  1ZRM A;  4GXJ A;  4RQ5 A;  2XGQ A;  5KFR A;  2ZIX B;  2ISO A;  3WU2 U;  5ALO A;  4CE6 A;  2FJ6 A;  2Q4T A;  2ZUD A;  4DFD A;  3F5A A;  2W55 A;  1QCK A;  4U6P A;  5KG6 A;  2JH7 A;  3VC8 A;  4RT3 A;  3ONN A;  2R8J A;  3DDH A;  4MHV A;  3OPX A;  7ICU A;  2EZZ A;  2A1A A;  1NJY A;  1PVQ A;  2A1J B;  1RZT A;  4Y2P A;  2NO4 A;  4C8O A;  2K8B B;  3EUB 2;  2KVS A;  5KG0 A;  2LM4 A;  3QYP A;  5HHH A;  5AKY A;  3QNM A;  7ICL A;  5AIC A;  2ZG6 A;  4I2G A;  7ICG A;  4UB6 U;  4F3O A;  3PSI A;  4DSF A;  2KMD A;  2NV3 A;  5JUM A;  2FPL A;  3CYM A;  5III A;  4I28 A;  3H8S A;  2BPF A;  5F9N A;  4I2E A;  4J9Q A;  4ECS A;  4KTQ A;  8ICN A;  5AKK A;  2CXY A;  4J9M A;  1Q8K A;  4UAY A;  2YQE A;  3MBY A;  1UQV A;  1N56 A;  4YFK A;  2K4H A;  2QAR B;  2W8K A;  1SGG A;  4EYH B;  1ARO P;  5KFL A;  1S0M A;  1WWU A;  1ZD3 A;  1N2X A;  3GII A;  1RXV A;  3C2M A;  5AI0 A;  1MQ2 A;  4MF2 A;  2JXJ A;  5AK5 A;  3PSP A;  3JPR A;  4YR2 A;  1LV5 A;  2EDU A;  2DBY A;  1Z19 A;  2OYY A;  1LKY A;  3FDS A;  1NJW A;  8ICY A;  2BGW A;  5ALE A;  5CB1 A;  3HPO A;  1MSW D;  1DK2 A;  4UAT A;  2HHX A;  2WF6 A;  2ZUB A;  3KBB A;  1BNO A;  4AYB C;  4Q45 A;  4AYB F;  4C7Z A;  2P6R A;  1HEK A;  5AKH A;  5ALN A;  2M9N A;  2KIC A;  1ZQA A;  1N48 A;  3WKD A;  3ZDE A;  1N60 A;  5J2J A;  1PZN A;  8ICE A;  2AGO A;  1U4B A;  3AUO A;  1U9L A;  4C7Y A;  2IA6 A;  5KT3 A;  5J2A A;  1X9X A;  1ZQE A;  4ACO A;  3TAR A;  8ICX A;  3UPQ A;  3ALR A;  4GXI A;  1KLN A;  5DBA A;  4ECT A;  3TAD C;  4EZ9 A;  2J6T A;  5KFJ A;  4LZD A;  3PO5 A;  2D3D A;  2PFN A;  3IHQ B;  5FP0 A;  2WF9 A;  2NRW A;  2PI5 A;  5KFH A;  1NNL A;  4F92 B;  4LVS A;  1UA0 A;  4DEZ A;  1ZQT A;  3Q8S B;  5AM5 A;  1JIH A;  4PJ0 U;  5L1L A;  5ALP A;  1BPB A;  4P0Q A;  2MU2 A;  4ED8 A;  5CEH A;  1D9F A;  2DFL A;  4UB8 U;  5EWF A;  2DWQ A;  1TVA A;  4BXO A;  5DGB A;  3EW9 A;  4IQV A;  5J8Y A;  1ZQW A;  1U49 A;  2KHV A;  2DKX A;  2ODG A;  4MF8 A;  3PX0 A;  1QTM A;  4ECU A;  5J0W A;  5J8Y C;  3C23 A;  5AI6 A;  1JRO A;  2H3V A;  2LYB A;  3HP6 A;  1XO1 A;  4RQ7 A;  3U26 A;  3H7I A;  1QSY A;  2JZB A;  9ICT A;  3JPP A;  4DFM A;  2L5Y A;  5K4L A;  1JI7 A;  2I6X A;  2KP7 A;  4DFK A;  3MR3 A;  1IM4 A;  2YY6 A;  5DDY A;  3D2S A;  5J2I A;  2NRX A;  9ICA A;  4QZD A;  4R65 A;  4RPZ A;  3KHR A;  2RDI A;  4DSJ A;  2W3S A;  4KLT A;  3OSN A;  1COO A;  4DF8 A;  2ZIU A;  1ED1 A;  3L5K A;  4I2I A;  3GV7 B;  5TZV A;  1TAM A;  2AGP A;  1CI4 A;  1ZD5 A;  1NK9 A;  1XSP A;  2F76 X;  1ZQV A;  4IL6 U;  2BDP A;  4UQG A;  5DG7 A;  5E79 U;  4JK1 A;  5DG9 A;  4UB3 A;  5KG1 A;  4O3R A;  3CP8 A;  5KFZ A;  3C2K A;  4ED3 A;  5D4B A;  5JU5 A;  1WUD A;  5J2H A;  3GZF A;  3OGU A;  3PW2 A;  3A0H U;  1BPE A;  4PL1 A;  2WTF A;  1U47 A;  2PMZ F;  5KFB A;  4EX6 A;  3B9J A;  3NRW A;  3V6J A;  1FEZ A;  3FC4 A;  4TUP A;  2UVW A;  1U45 A;  9ICK A;  2HOI A;  1HIW A;  4YD1 A;  3PMN A;  1IXR A;  5H2F U;  1WYG A;  3MGV A;  5HML A;  5ALM A;  5HHI A;  4Y2S A;  2VIX A;  4BXO B;  4B9V A;  2W9M A;  4QWC A;  1KEJ A;  4YXJ A;  3KHH A;  2MAX A;  2OEH A;  4P2H A;  4P0P B;  1PVR A;  1XS9 D;  1SL2 A;  3I28 A;  3M9O B;  2QB0 A;  2ZIV A;  4MFA A;  1GO3 F;  2OHF A;  2KEY A;  2HHQ A;  2R8H A;  2N1R A;  5ALJ A;  1XO0 A;  5IIK A;  2VKQ A;  5EWG A;  4UAV A;  5DB9 A;  1FFU A;  4KLM A;  5IIM A;  1FIQ A;  2KHQ A;  4TUS A;  2CN1 A;  5AM4 A;  4DQR A;  8ICP A;  1TAU A;  2ISP A;  7ICJ A;  2UVV A;  2ALZ A;  2M0N A;  5J0S A;  1Z4O A;  4C8M A;  1QSS A;  1L7N A;  5KFN A;  8ICK A;  4PL2 A;  8ICU A;  4JMU A;  4DSK A;  1KDH A;  2C28 A;  4RQ0 A;  2DQN B;  1SL0 A;  4JV0 A;  4MFF A;  1D8B A;  4Z6E A;  4ECQ A;  5IIO A;  1NKB A;  2WF7 A;  1ZQI A;  4R8U A;  3IDW A;  5KG2 A;  5ALT A;  3PV8 A;  5L1K A;  4PHA A;  1K1S A;  4RQ6 A;  2ZIW A;  4ED2 A;  3A0B U;  5KFC A;  5ALR A;  4Z6D A;  3GU3 A;  1DGS A;  4M9N A;  1WCL A;  5DG8 A;  4DF4 A;  1KL9 A;  4NXZ A;  2PXI A;  4M04 A;  2ZIX A;  4DOA A;  5KFA A;  3JPT A;  2YMM A;  8ICB A;  2ZTD A;  3UMG A;  4EX7 A;  4DL3 A;  2MUT A;  2C22 A;  4FZL A;  5ALZ A;  2HHS A;  1NOM A;  3Q8K A;  3MDC A;  4DOB A;  1YZ6 A;  3RBD A;  7ICS A;  2ATL A;  4EBC A;  3V7K A;  5G5G A;  3N28 A;  2DF4 B;  4TQS A;  1ECW A;  3RH6 A;  2HBK A;  3MGI A;  8ICA A;  3NUQ A;  4IC9 A;  5KFP A;  3ISC A;  1L3V A;  2W04 A;  3WKA A;  2HHV A;  4F4K A;  2KD1 A;  1RQN A;  3R9K A;  4RPX A;  4RQ4 A;  4ED6 A;  7ICN A;  1V9P A;  3ISD A;  2PI4 A;  1CEZ A;  2H3I A;  5EE1 A;  2BCV A;  2RLT A;  2QAR A;  3PR5 B;  4KLU A;  1IG6 A;  3QZ8 A;  2ASD A;  4KLQ A;  4YXM A;  2LKY A;  5KG4 A;  2J6U A;  3IP4 B;  4YCX A;  1DOQ A;  1WCN A;  4ECY A;  7ICT A;  4DL4 A;  4J03 A;  3UXN A;  4O5K A;  3T5H A;  1KTQ A;  3KZI U;  1N5X A;  4GLX A;  4F93 B;  3KD3 A;  2HVH A;  2R8I A;  3RAQ A;  4QW8 A;  2IMW P;  5KT2 A;  3KTQ A;  2F8K A;  2QB0 B;  2YN4 A;  5AKE A;  1XNS A;  2HW3 A;  1Z00 A;  3JPS A;  9ICM A;  2W43 A;  2Y0S F;  3RH5 A;  2H3F A;  2KFN A;  4KLF A;  1S76 D;  3SZ2 A;  1N5W A;  3FAH A;  1RG6 A;  4OJO A;  4DQP A;  2F77 X;  5J0P A;  3V7J A;  5AKI A;  4NL9 A;  2I5H A;  4G9B A;  3B0X A;  3H8W A;  3PY8 A;  4KLD A;  1L8L A;  1QQ6 A;  1ZQL A;  3JPN A;  4Y2U A;  8ICF A;  2KVC A;  2R18 A;  3K1Z A;  2FE9 A;  5AKX A;  3Q8Q B;  3L4P A;  1VLB A;  3HX0 A;  1J97 A;  3C5G A;  4O5E A;  1X66 A;  1NK8 A;  3GQC A;  4C8L A;  3C28 A;  4PZN A;  5KFW A;  4X5V A;  3QU9 A;  3F2C A;  4F5O A;  4NLK A;  3M6Z A;  4F5P A;  4MEY A;  3RJJ A;  4Q44 A;  1RPL A;  2WF5 A;  1BNP A;  3WKC A;  3C1Y A;  4GXK A;  1TV9 A;  3EZ5 A;  5AM3 A;  9ICB A;  5KFO A;  1UHU A;  4QWA A;  4QZC A;  7ICP A;  2I1Q A;  1T4G A;  4OO1 J;  2ZJ5 A;  5ALG A;  4R66 A;  3TI0 A;  1TK0 A;  3KOO A;  4DLE A;  4FO6 A;  1SZH A;  2JZB B;  1NZP A;  4CCH A;  2YX8 A;  9ICX A;  3IM1 A;  3ZD8 A;  4KLO A;  4F50 A;  3F53 A;  1IV8 A;  3AMZ A;  2KFZ A;  4ED7 A;  3ISB A;  1S0V A;  2IBK A;  3B0Y A;  8ICH A;  5AM1 A;  5F3X B;  7ICE A;  4NLN A;  4F2R A;  2XI9 A;  3L3F X;  1JN3 A;  4QZ8 A;  2HI0 A;  5J2F A;  1JMS A;  2PFO A;  3C29 A;  5CHG A;  2C2D A;  1QQ7 A;  5J29 A;  3UXP A;  3RB4 A;  1SZP A;  2F44 A;  2ASJ A;  2JGA A;  4TUR A;  9ICH A;  3KFU F;  4M6W A;  2PMZ C;  3G6V A;  4M6W B;  2ESE A;  9ICR A;  5EE9 A;  1T3Q A;  5KFE A;  3PVX A;  1Z3E B;  3QUT A;  3QEA Z;  2W9C A;  2BDU A;  4PH5 A;  5KAI U;  5DBC A;  4UAR A;  4A8E A;  4DS5 A;  1DGJ A;  7ICR A;  4F5R A;  1SV4 A;  4O3S A;  1ZD2 P;  4B9T A;  1S97 A;  4F4Y A;  2ZTE A;  1X9S A;  2A19 A;  4NWI A;  5B66 U;  2W7P A;  2WHE A;  1HJP A;  7ICM A;  5CA7 A;  2KZM A;  4DO9 A;  3CRX A;  5AKL A;  1X40 A;  3AEV A;  1L7O A;  2ZIV B;  1YZ7 A;  4XQ8 A;  4UAW A;  4O3O A;  4B9N A;  4FZM A;  5ALI A;  2R8K A;  5G5H A;  8ICC A;  4O5C A;  2HBM A;  3NTU A;  4P0Q B;  5CWR A;  1SKS A;  1ZQZ A;  5DQH A;  3MFI A;  2KE7 A;  3H40 A;  3KKA C;  4EEK A;  3ZI4 A;  2ASL A;  3D2N A;  1TK5 A;  2G07 A;  3K75 D;  4QZI A;  4OJ5 A;  3PW5 A;  1CUK A;  5GTH U;  4HAI A;  3SV4 A;  2PKE A;  3KHG A;  5HR7 A;  1KRP A;  4OJL A;  3UMC A;  1Y88 A;  1O03 A;  4NJ8 A;  4PHD A;  3BQ1 A;  1F44 A;  2HOQ A;  3V6K A;  3SI8 A;  3F5E A;  2G08 A;  2Y9U A;  4USA A;  5KFD A;  5F9L A;  1JRP A;  4ELV A;  2VA2 A;  3SAG A;  4C4R A;  1XSL A;  3OHA A;  2OM6 A;  3RJG A;  1OXJ A;  5ALV A;  5J2E A;  2G5H B;  2FI1 A;  5DKW A;  5JTI A;  9ICC A;  4O3N A;  2W9B A;  4DQQ A;  2K4I A;  2Y9T A;  4C4T A;  2BQ3 A;  2I9G A;  5T14 A;  3TFS A;  1C7Y A;  3AQE A;  1SXE A;  3F2D A;  2QB1 A;  2AXT U;  4I2A A;  3BQ0 A;  2W9B B;  5KG5 A;  3UQ2 A;  1QLN A;  2KNJ A;  4KX3 A;  9ICE A;  1A6S A;  4B9M A;  1ZQQ A;  4IR1 A;  4F4Z A;  3PR4 A;  8ICI A;  5KFM A;  3LWM A;  1ZET A;  1KSP A;  3NVZ A;  4J9N A;  1XC9 A;  4BDP A;  2JMG A;  1UA1 A;  1F0M A;  4KLE A;  4DSI A;  7ICQ A;  1BPY A;  4KLL A;  5J2B A;  3GV5 B;  1XWL A;  2KIV A;  4QJF B;  2F1J A;  2PFP A;  5ALL A;  3S6J A;  2FLL A;  4DL5 A;  1ZQC A;  4UAU A;  4C80 A;  1X2I A;  4I2D A;  4KMU A;  4YP3 A;  4G3I A;  4B9L A;  5HMM A;  1U48 A;  2GOL A;  2GH1 A;  5DQG A;  1FO4 A;  2EAP A;  5ALD A;  2KKP A;  3ZD9 A;  4C8K A;  3OTQ A;  2ZXI A;  3RB3 A;  3BS5 A;  1NK0 A;  5C5J A;  2DKZ A;  3GV8 B;  4ICA A;  2F3N A;  1WG8 A;  4KMO B;  4CF5 A;  4F71 A;  1ZXI A;  4F91 B;  2V9W A;  4M9J A;  2DUY A;  2OH2 A;  9ICI A;  5KAF U;  3WKB A;  1X6I A;  3QX7 A;  4F5N A;  1Q46 A;  1N63 A;  4C8N A;  1RYU A;  3T79 A;  3IN5 A;  1BPD A;  3RJE A;  3AL0 B;  1T94 A;  2NRT A;  4PGX A;  1YT3 A;  4DFP A;  4QWB A;  1XU4 A;  1VDV A;  1L3U A;  4RQ1 A;  1S5L U;  1J2N A;  4B6J A;  3G6X A;  2EH9 A;  4JWM A;  4RZR A;  3H8J A;  2E3T A;  1ZJM A;  4QZF A;  4YN4 A;  3LVW A;  4MFC A;  2ZTC A;  3FYH A;  1BVS A;  3AM9 A;  2C2R A;  3AQF A;  2AHO B;  3SV3 A;  1TFR A;  3HKZ C;  3E0F A;  4UB4 A;  1NK4 A;  2UVU A;  8ICL A;  5GTI U;  8ICJ A;  5AIB A;  5J0X A;  3ETL A;  1TKD A;  4RT2 A;  2RHF A;  3NGD A;  2EAM A;  1N62 A;  1O08 A;  1K1Q A;  5HP4 A;  3H0M B;  1FFV A;  5ALY A;  4LJX A;  4K4H A;  5KFI A;  1X9W A;  1L8O A;  2BCQ A;  1UT5 A;  2K8C B;  4O3P A;  4TQR A;  3K1R B;  3SR6 A;  4JWN A;  2JEF A;  3T5L A;  4QIW F;  9ICO A;  3M1Y A;  4BWJ A;  3BZK A;  3N7R C;  1QQ5 A;  2YTU A;  4EEY A;  2IHM A;  4MEX A;  1JXL A;  2VAN A;  1L7P A;  5DQI A;  2K4P A;  2G5I B;  9ICL A;  5DB6 A;  3QEB Z;  8ICS A;  7ICI A;  2EAO A;  3LVV A;  3DEE A;  1ZQ1 C;  5J0Y A;  5AI4 A;  3RRH A;  4DCC A;  5ALQ A;  1V85 A;  2BZF A;  4F4W A;  3C21 A;  4YMM A;  2BPG A;  4UAZ A;  1SV0 A;  3WK9 A;  2DL0 A;  2IOF A;  2YMP A;  7ICF A;  5B5E U;  2KK0 A;  3NRZ A;  1PK1 A;  3MDA A;  1LVH A;  4IQW A;  1NI3 A;  8ICR A;  2LHT A;  3OJS A;  5DB8 A;  1D9D A;  3WK8 A;  4UAS A;  4UBB A;  3ETR A;  1ZQJ A;  4DSL A;  5KL1 B;  3TQ1 A;  5BOL A;  1S0N A;  3TAC B;  3ZDB A;  3TKA A;  1ZQP A;  5IIN A;  3BJY A;  3KHL A;  2P6U A;  2JRZ A;  1Q3U A;  4IRC A;  2OCE A;  2BQR A;  3H4D A;  2JEG A;  4J9O A;  2FDR A;  3GFK B;  1KBU A;  1NZB A;  3IG8 A;  3V6H A;  3BQT A;  5CP2 A;  4QIW C;  3PO4 A;  3JPQ A;  3RJF A;  4YMN A;  3HT3 A;  2XY7 A;  1AQ6 A;  4UW9 A;  5J2D A;  4KLG A;  3BZC A;  2LPE A;  4DLG A;  3N7P D;  4NL9 C;  2LYH A;  3NVY A;  2E5S A;  5KFU A;  3OJU A;  1Z4N A;  4PGY A;  2QKQ A;  1H38 A;  5AIA A;  1SKW A;  4KX5 A;  4BWM A;  3T3F A;  4AP9 A;  5C0Y A;  4NY8 A;  9ICG A;  2W3R A;  2E1E A;  4EZ6 A;  3PX6 A;  2K8A A;  3H8M A;  4RQ8 A;  5L9X A;  5DDM A;  5KFT A;  2HCF A;  4K4G A;  3EWA A;  4TUQ A;  9ICS A;  3HW8 A;  2HHW A;  2B21 A;  5CJ7 A;  3RF9 A;  3IRU A;  1OW5 A;  5KFQ A;  4CDG A;  5J0T A;  5AHX A;  3ZDC A;  4QWE A;  3ICX A;  2AQ0 A;  3C1Z A;  2ZUC A;  5KG7 A;  1B0X A;  2W54 A;  3Q8M A;  1A77 A;  5KFK A;  2LBO A;  2E1F A;  3SQI A;  4Z6C A;  2EZY A;  1S9F A;  5KFX A;  2E8N A;  3TFR A;  4RPY A;  4JV2 A;  1T8E A;  1ZQO A;  3RBE A;  4ED0 A;  7ICH A;  4F2S A;  4IS7 A;  5J2K A;  4Y2R A;  5ALU A;  4M47 A;  4RUC A;  2HBJ A;  8ICZ A;  2Y1I A;  4U7C A;  4YG2 A;  4Y2J A;  1L5U A;  9ICP A;  2EAN A;  2FLP A;  4KLJ A;  4BJQ A;  2VJ4 A;  1ZQH A;  3HIL A;  1K5O A;  1NK5 A;  3F2B A;  2BR0 A;  2D6F C;  3HKZ F;  3MC1 A;  3ORY A;  5AKJ A;  4ECX A;  4ZOH C;  3LWL A;  4XRH A;  1NJX A;  1L3S A;  3QU7 A;  2BPC A;  5ALK A;  4NV0 A;  3QU2 A;  4QZG A;  5KT7 A;  4I29 A;  4EEL A;  3M7D A;  2AGQ A;  3RR7 A;  4DS4 A;  2FLN A;  3RTV A;  4QZ9 A;  1KQQ A;  2DGZ A;  3MFH A;  3H4B A;  3NVW A;  2NYV A;  5L1M A;  3PW7 A;  4YVZ A;  5KNI A;  1ZQM A;  2H3Z A;  1CRX A;  4M9L A;  2W9A A;  4OD0 A;  5DGA A;  3RH4 A;  4I27 A;  5AK3 A;  4NM2 A;  1JXE A;  4RNN A;  1SKR A;  3PML A;  3C5F A;  4QW9 A;  3IG5 A;  3QU5 A;  1KFS A;  2WAQ F;  5KTQ A;  4B9U A;  4Y2T A;  4O9M A;  3TAP A;  4RQN A;  1L7M A;  2XY5 A;  3MR6 A;  4M0A A;  1RDF A;  1SB3 C;  2OXO A;  3PNC A;  1JAL A;  5AKG A;  3MGH A;  4IR9 A;  4OJP A;  4EBE A;  2Y1J A;  1NJZ A;  1ZQD A;  3WK6 A;  2F1I A;  4HYK A;  3GIL A;  2MA1 A;  1ZQS A;  3FM9 A;  4I2H A;  5AK6 A;  3Q8P B;  1B43 A;  4BUG A;  4O0I A;  3I76 A;  2HBL A; 
#chains in the Genus database with same CATH homology
 2WB1 F;  2NV3 A;  2HBM A;  3GZF A;  3F53 A;  5A0L A;  4P0Q B;  4PL1 A;  3CYM A;  1XNS A;  1KBU A;  2K8C B;  2PMZ F;  5KL8 B;  4P0Q A;  2LYA A;  1NZB A;  2HBJ A;  3IG8 A;  1OUQ A;  4U7C A;  4QIW C;  2Y0S C;  4WJ3 B;  2MRL A;  2YB4 A;  2GOL A;  2ZIW A;  3D2N A;  2G07 A;  2GH1 A;  2VJ5 A;  2Y0S F;  2XVT A;  3H0L B;  3NRW A;  4OJ5 A;  2KKP A;  2VJ4 A;  2ZIW B;  4BJQ A;  2H3F A;  2ZXI A;  2XI9 A;  3GU3 A;  3L3F X;  4OJO A;  4CGZ A;  2K4E A;  4QIW F;  2F77 X;  2HOI A;  2CRX A;  2XID A;  1HIW A;  1UPH A;  4ICA A;  4KMO B;  4OJ6 A;  3N7R C;  3F2B A;  2ZIX A;  2XIC A;  2KJ5 A;  3N7S C;  3N7P D;  3MGV A;  2KKV A;  3HKZ F;  2KJ8 A;  1Z1B A;  2D6F C;  5HR6 A;  4OJL A;  2KHV A;  2G06 A;  2OH2 A;  3D2Q A;  2K4H A;  2YB1 A;  3C29 A;  2VIX A;  1F44 A;  2HOQ A;  3LYS A;  5CRX A;  2E5S A;  4FZL A;  3F5E A;  4NV0 A;  2G08 A;  2HOF A;  3O0F A;  2KVC A;  2R18 A;  4QNL A;  3K1Z A;  3M7D A;  4CRX A;  2G5I B;  2A3V A;  2JGA A;  2KJ9 A;  3SAG A;  2JH1 A;  4P0P B;  2H3V A;  1PVR A;  2LYB A;  3H0R B;  4O3M A;  2DGZ A;  3T79 A;  3IN5 A;  3KFU F;  3RFA A;  2JHD A;  3AL0 B;  3PSP A;  2ZIV A;  3PSF A;  1T94 A;  2PMZ C;  4KX5 A;  3PZP A;  3LVV A;  1Q3V A;  3DEE A;  1ZQ1 C;  2DF4 B;  1Z19 A;  2OM6 A;  2OYY A;  1ECW A;  3C28 A;  5C0Y A;  5HR7 A;  1GO3 F;  1YT3 A;  2H3Z A;  2ZIU B;  2G5H B;  4NLC A;  4BX9 C;  1CRX A;  2KEY A;  2HBK A;  4P0P A;  2KIW A;  4C0Z A;  2F2A B;  2E1E A;  2K8A A;  3F2C A;  2N1R A;  3NUQ A;  2K4I A;  2BDU A;  4AYB C;  3M6Z A;  1XO0 A;  2VKQ A;  1PVP A;  2ZIX B;  2WAQ C;  3IG5 A;  2F8L A;  4GFJ A;  4IC9 A;  1HEK A;  2G09 A;  2RRD A;  2WAQ F;  4AYB F;  3SAF A;  2W04 A;  5T14 A;  3D2S A;  3AQE A;  1URJ A;  2Q4T A;  3F2D A;  2KIC A;  2Z7J A;  2W7O A;  2KOB A;  2KHQ A;  3RF9 A;  3F5A A;  2H3Q A;  2CN1 A;  4A8E A;  2KD1 A;  4U6P A;  3PST A;  2RP5 A;  2JH7 A;  3LVW A;  4FZN A;  3VC8 A;  2G0A A;  1WUD A;  4CDG A;  3ONN A;  3ICX A;  2H3I A;  2KNJ A;  4KX3 A;  2M0N A;  4FE3 A;  1A6S A;  2OXO A;  2LHT A;  3AQF A;  3OPX A;  2ZIU A;  3HKZ C;  1ED1 A;  3KZX A;  2W03 A;  4OJP A;  3E0F A;  1L6N A;  4NWI A;  1PVQ A;  2W7P A;  4ACO A;  2LKY A;  4OO1 J;  2LBO A;  1TAM A;  2E1F A;  3M6K A;  4PL2 A;  3ALR A;  3SQI A;  2K8B B;  4JMU A;  2CPR A;  2F76 X;  2K89 A;  3CRX A;  5KL1 B;  2DQN B;  1DRG A;  3IP4 B;  3VCB A;  2JMG A;  2MA1 A;  2RHF A;  2ZIV B;  2ZXH A;  4FZM A;  1P7D A;  1D8B A;  3H0M B;  2ZG6 A;  3CP8 A;  4BUG A;  1SZH A;  1IIP A;  4NLB A;  3SMV A;  1Q3U A;  2KV2 A;  4QJF B;  1MA7 A;  2YX8 A;  3SAH A;  3PSI A;  2HBL A;  2HMX A;  2WB1 C;  1A0P A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...