1DXSA

Crystal structure of the c-terminal sterile alpha motif (sam) domain of human p73 alpha splice variant
Total Genus 18
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
18
sequence length
57
structure length
57
Chain Sequence
SLVSFLTGLGCPNCIEYFTSQGLQSIYHLQNLTIEDLGALKIPEQYRMTIWRGLQDL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords P53-LIKE TRANSCRIPTION FACTOR
publication title Structure of the C-Terminal Sterile Alpha-Motif (Sam) Domain of Human P73 Alpha
pubmed doi rcsb
source organism Homo sapiens
molecule tags Gene regulation
total genus 18
structure length 57
sequence length 57
ec nomenclature
pdb deposition date 2000-01-15
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.50 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 Transcription Factor, Ets-1 1dxsA00
2E8PA 2QARB 4NL9A 5KNIA 1LKYB 2L5YA 1WWVA 1SXDA 1X9XA 2DKZA 3KKAA 3K1RB 2KMDA 2EAPA 3BS5A 2ES6A 4IS7A 2QB1A 4PZNA 1KW4A 1OW5A 1B0XA 2E8OA 1B4FA 2ESEA 3IDWA 5J8YC 1OXJA 2KE7A 3H8MA 5JRTA 2Y9UA 2K60A 2KSOB 4RQMA 2KG5A 1WWUA 2D8CA 4MHVA 1SV0C 2K4PA 3BQ7A 2QB0A 3TADC 2LPEA 1SXEA 1PK1A 1F0MA 1RG6A 1X40A 2EAOA 1V85A 2GLEA 2LMRA 2YTUA 2EAMA 1SV4A 2F8KA 1JI7A 2F3NA 3TACB 4NJ8A 2E8MA 3KKAC 1SV0A 5JU5A 2KIVA 2DKXA 2QARA 3BS7A 3TADA 1COKA 1LKYA 2D3DA 1DXSA 3SEIA 1UCVA 5J8YA 5JTIA 3BS5B 2Y9TA 3SENA 2DL0A 2F44A 2FE9A 2B6GA 2KSOA 4NL9C 1PK3A 2QB0B 1SGGA 5F3XB 1Z1VA 2JV3A 2QKQA 1PK1B 5L1MA 2EANA 1UQVA 1V38A 3HILA 1X66A 4RQNA 2E8NA 4PZOA
chains in the Genus database with same CATH superfamily
4FZLA 3SR6A 2PFOA 1JUDA 4TURA 4QW9A 1T4GA 1N48A 4FS1A 2NYVA 9ICVA 2HSZA 5AKKA 4IQTA 1CEZA 3RH6A 4ED2A 1X9XA 5AKIA 1KFSA 1ZYQA 2DKZA 5E79U 1BNOA 4ECTA 1T94A 2WHEA 3THVA 3SI8A 1T8EA 1SKRA 4YP3A 4C8OA 4QWAA 5EWFA 3HP6A 5DQHA 1KW4A 4QZ8A 1B4FA 4ED6A 4IQVA 3RJJA 4MF2A 3T5HA 3VCBA 4CDGA 2E5SA 2Y9UA 4F93B 2W3SA 2H5XA 5AKHA 4EELA 4EBEA 9ICBA 2ASJA 1U47A 3RJKA 3WK5A 4P4OA 1C20A 5J2BA 4P2HA 1L7NA 5KAFU 5D49A 2DPIA 3MFHA 5KG7A 3PSIA 4U7CA 2K4PA 1Z4OA 3MGIA 2OXOA 2MAXA 3C1ZA 1ZQIA 1PK1A 4FFDA 5ALPA 4RPXA 2ZXHA 3TACB 5ALIA 3LVWA 4M6WB 5KFAA 4F5QA 1ZD4A 3AQFA 1ZQLA 4ED8A 4F4ZA 2KIVA 4DS4A 3KD3A 2FMSA 5DLFA 5CP2A 4XA5A 4C4TA 4F8RA 4G3IA 3UQ0A 2ZIWA 4Y2SA 5JTIA 7ICHA 2NV3A 4DQRA 2OYYA 3HJEA 2W04A 4QZAA 1NK9A 4PJ0U 5KL1B 5L1JA 3K4GA 3LYSA 5F9LA 2JV3A 4F2SA 2HBMA 3UXOA 4YD1A 4ED0A 4QWCA 4XUSA 3GILA 5KT5A 5L1LA 4IQUA 1TFRA 2ASLA 1MC8A 4QZDA 5KG3A 3R9KA 4I2HA 3LDAA 1OUQA 2A1AA 2VIXA 5AM1A 4PHAA 3F5AA 2KMDA 5GTHU 3M9MB 2R8IA 2ES6A 3NS1A 5IIIA 4KMUA 3K1ZA 1J97A 2DFLA 2LI6A 3RJIA 5DKWA 3OHBA 4F4YA 4UBCA 1F5SA 2KE7A 3L5KA 1N60A 2E3TA 4GC6A 2FJ6A 5J2CA 1SWWA 3HKZF 1DOQA 1SZHA 3HRDD 4QWBA 5J0UA 4NM2A 1L6NA 4DEZA 3AU6A 4HAIA 4YR2A 3BQ7A 3OTQA 3PSPA 2CPRA 2IMWP 3L3FX 1ZQTA 1SXEA 1TKDA 4RQ8A 2A3VA 4M9LA 3BJYA 4I2CA 4JWMA 3CRXA 5KFCA 5DBAA 2AJQA 1L3UA 3JPTA 5AI5A 1SWVA 1ZD3A 3PMNA 3QU2A 2G09A 4RQ1A 4YR3A 5IIMA 3NVVA 2JRZA 4B6JA 2PFNA 1ZRNA 3ZDBA 3H0RB 4NL9C 4IRKA 2JHDA 1ZQZA 4AP9A 2KOBA 2AHOB 5KT4A 1TK8A 3EW9A 1HJPA 2HCFA 3N28A 2FPMA 1KQQA 5KFKA 2P6UA 2ZIVB 5DB8A 4P0PB 1K1SA 4Y2QA 4RQ2A 1XO1A 4PZOA 4DFJA 2KN7A 2Q0ZX 2XGPA 4YVZA 2ISOA 1NJWA 1WWVA 3NRZA 3JPPA 2E1FA 7ICOA 5AK4A 4UB2A 2NRZA 2XY7A 4DSFA 5HMLA 4JMUA 3OSPA 2JXJA 1SL1A 4C8KA 3F2DA 1IV8A 8ICGA 3U26A 2DGZA 2G07A 1S0OA 4US9A 2C2DA 1URJA 1ZD5A 1ZQNA 4IRCA 4KLQA 1XSPA 4RQ4A 2BDPA 2PFPA 2LYAA 5KFOA 1SB3C 4UB6U 4UW9A 2W9CA 7ICKA 4R65A 4DFPA 2EZXA 3KHLA 1SL0A 1HEKA 4QIWF 3UXPA 7ICJA 8ICUA 4ACOA 3RAQA 2FDRA 1N56A 5GTIU 1B43A 2EQYA 4Z6DA 8ICCA 3SAFA 4EYIB 7ICMA 4DS5A 2N1RA 3WK6A 4KLIA 2A1JB 5B66U 8ICLA 3FM9A 2BQUA 3FAHA 4LZDA 3PW5A 1SZPA 5AKEA 4KITB 1MSWD 8ICEA 1XSNA 1S9FA 5J8YA 3HKZC 5J2HA 1L3TA 5HNKA 8ICPA 4J9RA 4JUZA 4F2RA 2HBJA 1NJXA 3H0MB 4KLDA 3KBBA 5ALOA 4PHPA 2QKQA 1PZNA 1PK1B 3BQ0A 4NXZA 4O3OA 3BZKA 2BPFA 4DL2A 4Y2UA 3HILA 1K5OA 3QX7A 1JALA 3OHAA 5KFLA 1ZQSA 4YMMA 4KN4A 4ED3A 2RQ5A 3GDXA 4F72A 1BVSA 1MQ2A 1TAMA 2ZIWB 3I1YA 5AI4A 9ICPA 5J2IA 4UAWA 3SD7A 1D8BA 1ZQUA 2BZFA 4DSKA 1QSSA 2ATLA 4DQIA 4M04A 4RZRA 4J9NA 2BCVA 1M6YA 3OJSA 4QZEA 1ZQEA 3SV3A 2ZUBA 5B5EU 3SQIA 3M8RA 2Z7JA 3N97B 3NRWA 3IM1A 5ALMA 2IOFA 3PVXA 1XU4A 4FZNA 2ZJ8A 3BZCA 3LWMA 7ICGA 1U48A 3RB3A 1TE2A 4NWIA 3AUOA 2KEYA 2UVUA 3AL0B 2KVCA 3AM9A 4C4SA 2R8HA 4O3PA 7ICQA 2IOHA 4QZFA 4RT2A 2PI5A 1X40A 4TUSA 1MA7A 2YMQA 4ELUA 1D9DA 3B0YA 4B9NA 1SV0A 3V7LA 5KFMA 2D3DA 3C5GA 1KEJA 4F50A 5KFUA 4YG2A 5ALTA 5AI6A 8ICBA 2Y9TA 3JPSA 4UQGA 2FE9A 4C80A 1V9PA 2YY6A 4FZMA 1H38A 2P6RA 4KLGA 2YB1A 4DF8A 3WKBA 1HIWA 3EYZA 5DDMA 2O6KA 4UAUA 4R8UB 4QIWC 1RYUA 4DQPA 2Q4TA 2EANA 5KFGA 1RM6C 1ZXIA 2BQRA 4P4MA 4RQNA 3SZ2A 2W54A 1KLNA 1Q3VA 4CF3A 9ICOA 3WKAA 1WCNA 3ALRA 3IG5A 3OSNA 4GXIA 2XC9A 4KLOA 2IHMA 4DCCA 2WB1F 1CI4A 3QUQA 4CRXA 2OH2A 3V6JA 4KLFA 4PZNA 2JR5A 2BCUA 3A0HU 3JPOA 1S10A 9ICHA 5IIKA 8ICFA 5KG2A 4RNMA 5AK5A 4O3QA 2M9NA 1BPBA 3H7IA 3TI0A 1KTQA 4RQ6A 2OM6A 3QU9A 3RJHA 3TADC 1KFTA 2FPLA 4I2IA 3LVVA 1L8LA 4KMOB 1TV9A 3BQ2A 2EZYA 1DGJA 3PW0A 3PW7A 2JEJA 5AK3A 3QYPA 4GC7A 2NRXA 2W9CB 4MFFA 2XCAA 1KBUA 3ZDAA 3H8WA 1ZQ1C 2FMQA 5BPCA 9ICIA 1GO3F 4RUAA 4F5RA 5AKYA 2KSOA 4C8LA 2WF7A 2W9AA 1F44A 2HDOA 2J6TA 3H4BA 3Q8KA 4J9SA 1FIQA 3A0BU 1RYRA 2KZ3A 3SYZA 3ONNA 2E8NA 4ECXA 5KFIA 1S0MA 2WF9A 7ICNA 5AI9A 4P0QB 5J0SA 1BPDA 2YN4A 2Y1IA 5TZVA 3ETLA 3E58A 2LYHA 2J6UA 4YXJA 5H2FU 3M9OB 2EAPA 3CP8A 9ICKA 4JV2A 4HYKA 3MC1A 5DLGA 2MSNA 2IOFK 2FLNA 3B9JA 2R8JA 3ORYA 2E1EA 3I28A 5AKLA 3IDWA 3UM9A 2UVRA 4I2BA 2BCRA 4Y2YA 5JRTA 1DRGA 1V97A 1L8OA 1JROA 4I2JA 4CF5A 4GLXA 2LM4A 4RT3A 2KIWA 5JUMA 4Z6EA 9ICWA 3Q8RB 4J9QA 2DWQA 2YX8A 4J9MA 4FE3A 3RTVA 3MFIA 3PO5A 4YN4A 4KLMA 5ALDA 2WB1C 1JI7A 4BXOB 2KZZA 4UB1A 4JB3A 1AQ6A 4DFKA 4CF4A 2AQ0A 1NK6A 4DL5A 1Z4NA 5KFTA 3PW2A 1L7PA 7ICEA 2C2RA 2KHVA 2DL0A 1UHUA 4EZ9A 4RPZA 3NTUA 2P66A 1D9FA 1ZQFA 3RJFA 4MF8A 3FYHA 4UB8U 2ZIUA 2WAQC 2KKVA 4OCZA 5KL8B 3ZD9A 2ZXIA 3RR8A 4ED1A 1N5WA 1ZETA 1ZOLA 2IHNA 1QQ7A 2MUTA 4QZ9A 4OJ5A 3HPOA 2XY5A 2PI4A 2KFZA 2I6XA 1JXLA 4ECWA 3GIKA 5A0LA 4CGZA 4K4IA 1XO0A 4ECQA 4DO9A 4TQRA 4NLCA 5CRXA 2UVWA 4UAYA 4WJ3B 3QEBZ 5J8YC 5J0TA 4YCXA 3UPQA 4I2AA 4B9TA 2W11A 4M0AA 4JWNA 3MDAA 1N63A 3PX6A 5ALFA 1PVRA 5CJ7A 1U9LA 5KFHA 2VA3A 3EWAA 2D8CA 4RQ5A 4RQ7A 3RRGA 7ICVA 4Q8EA 2ODGA 5HMMA 1NNLA 4B9VA 2QB0A 2HBLA 1IM4A 1F0MA 1Z00A 1FFVA 2LMRA 3ZD8A 3CYMA 1KRPA 5KFEA 1N61A 4OJ6A 1QH9A 4E0DA 3AEVA 4NM1A 5KTQA 3D2QA 2XCPA 4DL7A 1BPZA 5CHGA 2ZJAA 1LKYA 3SEIA 1VLBA 2NO4A 4DLGA 4Y2RA 1X42A 4FO6A 5HR7A 2XIDA 3TKAA 4RQ3A 5ALKA 4B9SA 5IILA 2HHQA 3PR5B 4RUCA 8ICXA 5L1MA 4BWJA 7ICUA 1S5LU 3WKCA 2LBOA 1JMSA 3HWTA 3OGUA 1KDHA 2NO5A 2ZIXB 1ZRMA 4Y2XA 5KFNA 3M1YA 5KFYA 4ED7A 3RRHA 3BDPA 5KFZA 4DOBA 4J9OA 1NKCA 5J0YA 4F5PA 1T3NA 4C4RA 4PHEA 2KP7A 4KX5A 2OCEA 4R66A 3PZPA 1BPYA 2W9BA 2DUYA 3F53A 2BGWA 3WK7A 1YT3A 4DSLA 1L7MA 1UA0A 1ZQRA 2V9WA 3PR4A 1XWLA 1ZQAA 2AQ4A 3AMZA 1X9MA 2RRDA 4JV0A 3GV8B 8ICWA 2FMPA 2F1IA 2I1QA 4I2EA 2I5HA 2YTUA 2EAMA 3KHGA 3NVYA 2K4HA 2YQEA 4NLGA 5CEHA 2PMZC 3QU7A 9ICFA 4KLUA 5JU5A 2CRXA 2DKXA 2QARA 5G5HA 2HVIA 4B9UA 1DXSA 1RZTA 3V7KA 1HUZA 5FP0A 5CWRA 1L7OA 1ZQMA 2HI0A 4KLHA 3L4PA 4DFMA 5DG7A 1TVAA 5AHXA 4UB5A 3C2MA 2BCSA 4GXJA 4EX7A 1A77A 1Z1VA 4DOCA 2JEGA 4CCHA 3ISBA 3TARA 3DV9A 4DL4A 3FC4A 4BWMA 3QUCA 2G5IB 5BOLA 3AQEA 5BOMA 5DB6A 3C29A 1VDVA 5ALJA 1LB2B 2E8PA 5F9NA 1PVPA 2MA1A 1C7YA 1YZ7A 1Z1BA 4PH5A 2R8KA 1WYGA 8ICQA 5IIOA 5EOZA 2KJ9A 3BS5A 3C28A 1DK2A 4QW8A 9ICGA 2C22A 4UARA 1A6SA 4I29A 1JRPA 1VJ5A 1EXNA 3M7DA 2EZZA 1B22A 4LZGA 5KFSA 5ALLA 5KG4A 2K60A 4M9JA 4RQMA 1A76A 2KG5A 4Y2JA 3SMVA 2HMXA 7ICRA 3K75D 2WF8A 2FLLA 4M9GA 2KFNA 5AICA 9ICCA 4YFKA 5J2KA 2PFQA 4RNOA 3RB4A 4RNNA 2FPKA 4FS2A 3GZFA 8ICTA 1KL9A 2KTQA 4C8MA 2NRWA 1KSPA 5AIBA 4O5KA 2G06A 5ALYA 1Q3UA 4NJ8A 4P4PA 3Q8PB 2F8LA 4KLTA 5DG9A 4BGDA 3QEAZ 3QE9Y 2XGQA 4O3MA 5DQGA 2F1HA 1TAUA 1J2MA 2F44A 1RXWA 2QB0B 1SIJA 5KG1A 2LKYA 3PY8A 4ECRA 3E2EA 1WUDA 8ICJA 5EWGA 4NLNA 1UQVA 5HP4A 3SAGA 4R64A 5KT7A 4F71A 5AKXA 4NLZA 5AI0A 3HX0A 1TK5A 3NVZA 4NL9A 7ICFA 1LKYB 2Y0SF 3QNMA 1BPXA 1XNSA 3OJUA 4EENA 5IINA 3T5JA 4IS7A 2HHSA 4EBCA 5HHIA 1XC9A 1ED1A 1X9SA 1OW5A 2YMPA 5AIAA 4KLEA 3OPXA 4UAZA 1MN8A 2QLTA 3MR3A 3H8MA 5J0QA 2JH1A 5DQIA 3EUB2 4TUQA 1ZQHA 2GWSA 5J2DA 1X2IA 3NUQA 4GXKA 1J2NA 3MGHA 5AKJA 4PGQA 5J0OA 1QSLA 4FBTA 1L5UA 3ISCA 4RPYA 3C2LA 2IBKA 9ICMA 4NLBA 1Y88A 1Q8KA 2EAOA 1N62A 5C5JA 3M9NB 4Q45A 3MR2A 2W9BB 1ZD2P 2E8MA 3JPRA 1S8OA 2BR0A 4O9MA 3EPIA 4K4HA 8ICAA 3N4MB 2G0AA 3PX4A 3MR5A 3Q8LA 2B6GA 1BPEA 3HW8A 1ZQYA 5CB1A 9ICXA 2WAQF 1X6JA 1PK3A 3G6YA 3UMCA 1ZQWA 4C7ZA 3IN5A 3WK4A 2OWOA 2AXTU 3H0LB 4LJXA 2K8BB 3T5KA 3RH5A 2QARB 3KFUF 9ICNA 4BX9C 2GO7A 3H40A 2W03A 4YR0A 9ICSA 3LK9A 3RBDA 4RU9A 2H3QA 4J9KA 3K1RB 4C8NA 2KD1A 4Q8FA 2KV2A 1S0VA 2KVSA 1D8LA 1QQ6A 3ETRA 4DF4A 1JX4A 4DWIA 2KKPA 5KFJA 8ICOA 1KFDA 1OXJA 2LM1A 4O3NA 4J03A 1QLNA 2H3VA 4OJOA 2HW3A 1WWUA 4YXMA 1ZQQA 2Y0SC 4X5VA 1PVQA 3H8JA 5HHHA 1NK4A 1ZQGA 5AM3A 4QJFB 5J29A 3ICXA 1Q46A 4Q43A 3M8SA 1RG6A 4XRHA 3TFRA 2JEFA 4BUGA 2F3NA 4EYHB 4K4GA 4QZIA 4O5EA 8ICYA 3UMGA 5C0YA 1FEZA 3ISDA 3EPGA 1COKA 2JEIA 4Z6FA 3JPNA 4G9BA 2J6SA 5EE9A 9ICAA 4I2GA 5AK6A 3C2KA 2W8KA 2NRTA 3RFAA 1JIHA 5F3XB 1RYSA 4M9NA 4I27A 3KTQA 4UASA 1HUOA 4AYBF 1O08A 2FI1A 4TUPA 1N2XA 5T14A 2YMMA 4U6PA 3MABA 3PNCA 1ZQCA 2B21A 2KJ5A 2VJ4A 2A1JA 1XS9D 4ZOHC 3LWLA 3V6KA 4KTQA 4NY8A 4DSEA 3KKAA 4Q44A 5ALVA 3C5FA 4LVSA 2A19A 3V7JA 1QTMA 2HOFA 3C21A 2R8GA 3D2NA 4ECVA 2K89A 2VJ5A 5ALRA 3GV7B 1S76D 2BKEA 2PKEA 1D8YA 5K4LA 2YB4A 3O0FA 3RF9A 3KOOA 2BPGA 4BDPA 5D46A 3GQCA 3WKEA 4QZCA 1ZQDA 4IR1A 1TAQA 1ZQVA 5ALXA 4OO1J 4Y2TA 3IHQB 5J0WA 3RJEA 4O5CA 2KJ8A 2PMZF 4O0IA 4RQ0A 5AM5A 2F76X 2LPEA 2JGAA 3I76A 1LVHA 3BQTA 1U4BA 3S6JA 3N7SC 2WF5A 9ICUA 3GV5B 3PV8A 3TADA 3KZXA 4OJLA 8ICNA 1ZQXA 3CNHA 3NVWA 4C7YA 3RBEA 1SGGA 1UPHA 1Z3EB 1UT8A 2MU2A 3QUBA 4GIBA 3UQ2A 3KHHA 8ICRA 4I2DA 2F2AB 4EBDA 4KLLA 2RP5A 5EE0A 1X66A 4DL3A 3F2BA 2BHNA 5AI8A 1IIPA 3QZ7A 5KFXA 3DDHA 2W9MA 1ZQKA 1P7DA 3ZDCA 5DGBA 4EEYA 5ALEA 4YQWA 3GIJA 2W55A 2ZTDA 3QZ8A 3QXGA 2AGPA 4MEYA 2KHQA 4M9HA 1QCKA 3ZI4A 5EWEA 3JPQA 1NK0A 3T79A 1XSLA 3PO4A 1SKSA 2VKQA 2RDIA 4DL6A 3D6JA 3PSTA 4R8UA 1IXRA 4AYBC 4FBUA 4PGXA 1YZ6A 2KSOB 3GIMA 2W8LA 2VA2A 3F5EA 4ECYA 5J2EA 2HOQA 2ZG6A 1DGSA 3H4DA 1SV0C 2JZBA 3G6VA 1S77D 2DBYA 4ZH4A 3IP4B 1V85A 2GLEA 1BGXT 2WF6A 3M6ZA 2F8KA 4ECZA 5IIJA 2LHTA 5ALWA 4R63A 8ICZA 3NASA 2OHFA 3TAQA 1ZQOA 3BS7A 8ICHA 3IRUA 5J2GA 2ZUDA 2V4QA 5KAIU 3RH4A 3N7PD 4KLSA 3RB0A 4F3OA 4UB4A 4B9MA 4O3RA 1RQNA 2KNJA 4IR9A 1FFUA 2JMGA 4A8EA 1NKBA 3PMLA 2EDUA 1QSYA 1ZJNA 1NK7A 1NJYA 2ALZA 1AROP 4UATA 4PPXA 2VA8A 5TISU 5KNIA 4F5OA 2ZJ5A 4UBBA 3B0XA 3KZIU 1RXVA 3WU2U 4DQSA 4QNLA 2W43A 3VC8A 3J81j 3PW4A 4QZHA 1CRXA 3UXNA 5J2JA 9ICTA 1T7PA 2DF4B 2K8CB 5KFDA 4F5NA 4OJPA 9ICEA 2DPJA 4DFDA 1Z19A 7ICPA 5DB9A 3ZDDA 3SAHA 2E8OA 2ESEA 5ALHA 4DLEA 2G08A 3TANA 2FLPA 1K1QA 1BNPA 2BQ3A 2WFAA 2CXYA 1NK5A 2KICA 4F4WA 2ZTCA 4KX3A 4P0QA 3RR7A 2JH7A 1TK0A 2YMLA 4ELTA 1ZQJA 5J0XA 3Q8QB 2ISPA 2ZIUB 2C28A 4IC9A 2C2EA 1NKEA 3QU5A 5KT6A 3NGDA 4XQ8A 3GU3A 5AKGA 2UVVA 1ZQBA 3EZ5A 5KFWA 4US8A 2HVHA 1NZPA 9ICRA 2K8AA 4J9PA 4PL1A 4ECSA 2MUTB 4USAA 3HT3A 2MRLA 5KG5A 5ALQA 2KZMA 1DK3A 1QQ5A 4NV0A 4YMNA 2XVTA 5DB7A 2W7OA 5L9XA 4CE6A 2ZTEA 1L3VA 4B9LA 1V38A 2M0NA 4NLKA 3GIIA 3SV4A 4YD2A 1NOMA 3H8SA 2ASDA 5DBBA 3PX0A 3QU4A 2EH9A 3QUTA 4F4KA 4PGYA 1NI3A 4BXOA 2WTFA 5AM2A 5KFBA 2BPCA 3TFSA 2L5YA 2PXIA 5J0RA 4PL2A 5ALNA 1X9WA 2H3ZA 2ZUCA 2AU0A 2BCQA 2F77X 3IG8A 2OEHA 1SXDA 3IV6A 3M6KA 1ZQPA 2W7PA 2VANA 2AH5A 4UB3A 1Z00B 4QZGA 4M47A 2V4RA 1L3SA 1O03A 5AKZA 2K4EA 9ICQA 2AGOA 7ICTA 2HBKA 3WK8A 5EE1A 4BJQA 4CNQA 3RJGA 4M6WA 5L1KA 2GOLA 3AN1A 3ED5A 1IG6A 3V6HA 8ICSA 2GH1A 4PHDA 2DQNB 4EEKA 5J2FA 7ICLA 4F92B 1S97A 1RQLA 4F4XA 5KFVA 1KN5A 4ELVA 2RLTA 2H3FA 4M2YA 9ICJA 1UT5A 4MHVA 1JN3A 2K4IA 2F1JA 2RDJA 1LV5A 2G5HB 2RHFA 1JXEA 4GFJA 5DBCA 9ICLA 3G6XA 5J2AA 5ALGA 1A0PA 4KLJA 5L1IA 3Q8SB 2HHWA 2HHUA 4I2FA 3C23A 3KKAC 4QZBA 3MBYA 1S0NA 4DQQA 5CR0A 3T5LA 3T3FA 2D6FC 4IQWA 8ICVA 5KT3A 3SENA 2JZBB 1PUZA 2AGQA 4TQSA 1NJZA 5EE3A 3TQ1A 2W3RA 5ALZA 2IA6A 5ALSA 1CUKA 1RPLA 3RB6A 1NK8A 2R18A 2NRVA 1U49A 4I28A 3TAPA 3E0FA 3ZDEA 1NZBA 5HR6A 5KG6A 3Q8MA 5DGAA 5AM0A 2H3IA 3MR6A 3C1YA 3DEEA 4IL6U 7ICIA 1ECWA 3WKDA 1ZJMA 1MQ3A 1FO4A 5D4BA 4QWEA 3MDCA 4DSIA 4J9LA 3N7RC 5KFRA 4MEXA 1N5XA 4EX6A 2XI9A 8ICMA 2HHXA 2QB1A 3RAXA 4YMOA 1B0XA 7ICSA 3CW2C 2Y1JA 5ALUA 1SL2A 2CN1A 8ICKA 3FDSA 4JK1A 5J0PA 4UAVA 4ICAA 4Y2PA 5DDYA 3KHRA 5AM4A 2ZIXA 3AU2A 1WCLA 3GFKB 4IRDA 4MFCA 3V72A 2HHVA 4OD0A 5DG8A 1RDFA 3F2CA 3MGVA 4JV1A 1SV4A 4C0ZA 1U45A 3D2SA 5KT2A 2I9GA 2ZIVA 4F91B 4P0PA 1SKWA 4O3SA 2BDUA 4DSJA 2XO7A 4DOAA 5KFQA 1UCVA 4EZ6A 4QWDA 3BS5B 1WG8A 5G5GA 4MFAA 3WK9A 4Y2VA 2XY6A 1KKXA 1T3QA 2KK0A 4KN7A 3UMBA 2B0CA 2P35A 5KFPA 2XICA 1UA1A 2LYBA 1COOA 3PSFA 4ECUA 5KG0A 4Z6CA 8ICIA 2HOIA 2HHTA 5CA7A 5KFFA 1X6IA 3BQ1A
chains in the Genus database with same CATH topology
2E8PA 2QARB 4NL9A 5KNIA 1LKYB 2L5YA 1WWVA 1SXDA 1X9XA 2DKZA 3KKAA 3K1RB 2KMDA 2EAPA 3BS5A 2ES6A 4IS7A 2QB1A 4PZNA 1KW4A 1OW5A 1B0XA 2E8OA 1B4FA 2ESEA 3IDWA 5J8YC 1OXJA 2KE7A 3H8MA 5JRTA 2Y9UA 2K60A 2KSOB 4RQMA 2KG5A 1WWUA 2D8CA 4MHVA 1SV0C 2K4PA 3BQ7A 2QB0A 3TADC 2LPEA 1SXEA 1PK1A 1F0MA 1RG6A 1X40A 2EAOA 1V85A 2GLEA 2LMRA 2YTUA 2EAMA 1SV4A 2F8KA 1JI7A 2F3NA 3TACB 4NJ8A 2E8MA 3KKAC 1SV0A 5JU5A 2KIVA 2DKXA 2QARA 3BS7A 3TADA 1COKA 1LKYA 2D3DA 1DXSA 3SEIA 1UCVA 5J8YA 5JTIA 3BS5B 2Y9TA 3SENA 2DL0A 2F44A 2FE9A 2B6GA 2KSOA 4NL9C 1PK3A 2QB0B 1SGGA 5F3XB 1Z1VA 2JV3A 2QKQA 1PK1B 5L1MA 2EANA 1UQVA 1V38A 3HILA 1X66A 4RQNA 2E8NA 4PZOA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2E8P A;  2QAR B;  4NL9 A;  5KNI A;  1LKY B;  2L5Y A;  1WWV A;  1SXD A;  1X9X A;  2DKZ A;  3KKA A;  3K1R B;  2KMD A;  2EAP A;  3BS5 A;  2ES6 A;  4IS7 A;  2QB1 A;  4PZN A;  1KW4 A;  1OW5 A;  1B0X A;  2E8O A;  1B4F A;  2ESE A;  3IDW A;  5J8Y C;  1OXJ A;  2KE7 A;  3H8M A;  5JRT A;  2Y9U A;  2K60 A;  2KSO B;  4RQM A;  2KG5 A;  1WWU A;  2D8C A;  4MHV A;  1SV0 C;  2K4P A;  3BQ7 A;  2QB0 A;  3TAD C;  2LPE A;  1SXE A;  1PK1 A;  1F0M A;  1RG6 A;  1X40 A;  2EAO A;  1V85 A;  2GLE A;  2LMR A;  2YTU A;  2EAM A;  1SV4 A;  2F8K A;  1JI7 A;  2F3N A;  3TAC B;  4NJ8 A;  2E8M A;  3KKA C;  1SV0 A;  5JU5 A;  2KIV A;  2DKX A;  2QAR A;  3BS7 A;  3TAD A;  1COK A;  1LKY A;  2D3D A;  1DXS A;  3SEI A;  1UCV A;  5J8Y A;  5JTI A;  3BS5 B;  2Y9T A;  3SEN A;  2DL0 A;  2F44 A;  2FE9 A;  2B6G A;  2KSO A;  4NL9 C;  1PK3 A;  2QB0 B;  1SGG A;  5F3X B;  1Z1V A;  2JV3 A;  2QKQ A;  1PK1 B;  5L1M A;  2EAN A;  1UQV A;  1V38 A;  3HIL A;  1X66 A;  4RQN A;  2E8N A;  4PZO A; 
#chains in the Genus database with same CATH topology
 4FZL A;  3SR6 A;  2PFO A;  1JUD A;  4TUR A;  4QW9 A;  1T4G A;  1N48 A;  4FS1 A;  2NYV A;  9ICV A;  2HSZ A;  5AKK A;  4IQT A;  1CEZ A;  3RH6 A;  4ED2 A;  1X9X A;  5AKI A;  1KFS A;  1ZYQ A;  2DKZ A;  5E79 U;  1BNO A;  4ECT A;  1T94 A;  2WHE A;  3THV A;  3SI8 A;  1T8E A;  1SKR A;  4YP3 A;  4C8O A;  4QWA A;  5EWF A;  3HP6 A;  5DQH A;  1KW4 A;  4QZ8 A;  1B4F A;  4ED6 A;  4IQV A;  3RJJ A;  4MF2 A;  3T5H A;  3VCB A;  4CDG A;  2E5S A;  2Y9U A;  4F93 B;  2W3S A;  2H5X A;  5AKH A;  4EEL A;  4EBE A;  9ICB A;  2ASJ A;  1U47 A;  3RJK A;  3WK5 A;  4P4O A;  1C20 A;  5J2B A;  4P2H A;  1L7N A;  5KAF U;  5D49 A;  2DPI A;  3MFH A;  5KG7 A;  3PSI A;  4U7C A;  2K4P A;  1Z4O A;  3MGI A;  2OXO A;  2MAX A;  3C1Z A;  1ZQI A;  1PK1 A;  4FFD A;  5ALP A;  4RPX A;  2ZXH A;  3TAC B;  5ALI A;  3LVW A;  4M6W B;  5KFA A;  4F5Q A;  1ZD4 A;  3AQF A;  1ZQL A;  4ED8 A;  4F4Z A;  2KIV A;  4DS4 A;  3KD3 A;  2FMS A;  5DLF A;  5CP2 A;  4XA5 A;  4C4T A;  4F8R A;  4G3I A;  3UQ0 A;  2ZIW A;  4Y2S A;  5JTI A;  7ICH A;  2NV3 A;  4DQR A;  2OYY A;  3HJE A;  2W04 A;  4QZA A;  1NK9 A;  4PJ0 U;  5KL1 B;  5L1J A;  3K4G A;  3LYS A;  5F9L A;  2JV3 A;  4F2S A;  2HBM A;  3UXO A;  4YD1 A;  4ED0 A;  4QWC A;  4XUS A;  3GIL A;  5KT5 A;  5L1L A;  4IQU A;  1TFR A;  2ASL A;  1MC8 A;  4QZD A;  5KG3 A;  3R9K A;  4I2H A;  3LDA A;  1OUQ A;  2A1A A;  2VIX A;  5AM1 A;  4PHA A;  3F5A A;  2KMD A;  5GTH U;  3M9M B;  2R8I A;  2ES6 A;  3NS1 A;  5III A;  4KMU A;  3K1Z A;  1J97 A;  2DFL A;  2LI6 A;  3RJI A;  5DKW A;  3OHB A;  4F4Y A;  4UBC A;  1F5S A;  2KE7 A;  3L5K A;  1N60 A;  2E3T A;  4GC6 A;  2FJ6 A;  5J2C A;  1SWW A;  3HKZ F;  1DOQ A;  1SZH A;  3HRD D;  4QWB A;  5J0U A;  4NM2 A;  1L6N A;  4DEZ A;  3AU6 A;  4HAI A;  4YR2 A;  3BQ7 A;  3OTQ A;  3PSP A;  2CPR A;  2IMW P;  3L3F X;  1ZQT A;  1SXE A;  1TKD A;  4RQ8 A;  2A3V A;  4M9L A;  3BJY A;  4I2C A;  4JWM A;  3CRX A;  5KFC A;  5DBA A;  2AJQ A;  1L3U A;  3JPT A;  5AI5 A;  1SWV A;  1ZD3 A;  3PMN A;  3QU2 A;  2G09 A;  4RQ1 A;  4YR3 A;  5IIM A;  3NVV A;  2JRZ A;  4B6J A;  2PFN A;  1ZRN A;  3ZDB A;  3H0R B;  4NL9 C;  4IRK A;  2JHD A;  1ZQZ A;  4AP9 A;  2KOB A;  2AHO B;  5KT4 A;  1TK8 A;  3EW9 A;  1HJP A;  2HCF A;  3N28 A;  2FPM A;  1KQQ A;  5KFK A;  2P6U A;  2ZIV B;  5DB8 A;  4P0P B;  1K1S A;  4Y2Q A;  4RQ2 A;  1XO1 A;  4PZO A;  4DFJ A;  2KN7 A;  2Q0Z X;  2XGP A;  4YVZ A;  2ISO A;  1NJW A;  1WWV A;  3NRZ A;  3JPP A;  2E1F A;  7ICO A;  5AK4 A;  4UB2 A;  2NRZ A;  2XY7 A;  4DSF A;  5HML A;  4JMU A;  3OSP A;  2JXJ A;  1SL1 A;  4C8K A;  3F2D A;  1IV8 A;  8ICG A;  3U26 A;  2DGZ A;  2G07 A;  1S0O A;  4US9 A;  2C2D A;  1URJ A;  1ZD5 A;  1ZQN A;  4IRC A;  4KLQ A;  1XSP A;  4RQ4 A;  2BDP A;  2PFP A;  2LYA A;  5KFO A;  1SB3 C;  4UB6 U;  4UW9 A;  2W9C A;  7ICK A;  4R65 A;  4DFP A;  2EZX A;  3KHL A;  1SL0 A;  1HEK A;  4QIW F;  3UXP A;  7ICJ A;  8ICU A;  4ACO A;  3RAQ A;  2FDR A;  1N56 A;  5GTI U;  1B43 A;  2EQY A;  4Z6D A;  8ICC A;  3SAF A;  4EYI B;  7ICM A;  4DS5 A;  2N1R A;  3WK6 A;  4KLI A;  2A1J B;  5B66 U;  8ICL A;  3FM9 A;  2BQU A;  3FAH A;  4LZD A;  3PW5 A;  1SZP A;  5AKE A;  4KIT B;  1MSW D;  8ICE A;  1XSN A;  1S9F A;  5J8Y A;  3HKZ C;  5J2H A;  1L3T A;  5HNK A;  8ICP A;  4J9R A;  4JUZ A;  4F2R A;  2HBJ A;  1NJX A;  3H0M B;  4KLD A;  3KBB A;  5ALO A;  4PHP A;  2QKQ A;  1PZN A;  1PK1 B;  3BQ0 A;  4NXZ A;  4O3O A;  3BZK A;  2BPF A;  4DL2 A;  4Y2U A;  3HIL A;  1K5O A;  3QX7 A;  1JAL A;  3OHA A;  5KFL A;  1ZQS A;  4YMM A;  4KN4 A;  4ED3 A;  2RQ5 A;  3GDX A;  4F72 A;  1BVS A;  1MQ2 A;  1TAM A;  2ZIW B;  3I1Y A;  5AI4 A;  9ICP A;  5J2I A;  4UAW A;  3SD7 A;  1D8B A;  1ZQU A;  2BZF A;  4DSK A;  1QSS A;  2ATL A;  4DQI A;  4M04 A;  4RZR A;  4J9N A;  2BCV A;  1M6Y A;  3OJS A;  4QZE A;  1ZQE A;  3SV3 A;  2ZUB A;  5B5E U;  3SQI A;  3M8R A;  2Z7J A;  3N97 B;  3NRW A;  3IM1 A;  5ALM A;  2IOF A;  3PVX A;  1XU4 A;  4FZN A;  2ZJ8 A;  3BZC A;  3LWM A;  7ICG A;  1U48 A;  3RB3 A;  1TE2 A;  4NWI A;  3AUO A;  2KEY A;  2UVU A;  3AL0 B;  2KVC A;  3AM9 A;  4C4S A;  2R8H A;  4O3P A;  7ICQ A;  2IOH A;  4QZF A;  4RT2 A;  2PI5 A;  1X40 A;  4TUS A;  1MA7 A;  2YMQ A;  4ELU A;  1D9D A;  3B0Y A;  4B9N A;  1SV0 A;  3V7L A;  5KFM A;  2D3D A;  3C5G A;  1KEJ A;  4F50 A;  5KFU A;  4YG2 A;  5ALT A;  5AI6 A;  8ICB A;  2Y9T A;  3JPS A;  4UQG A;  2FE9 A;  4C80 A;  1V9P A;  2YY6 A;  4FZM A;  1H38 A;  2P6R A;  4KLG A;  2YB1 A;  4DF8 A;  3WKB A;  1HIW A;  3EYZ A;  5DDM A;  2O6K A;  4UAU A;  4R8U B;  4QIW C;  1RYU A;  4DQP A;  2Q4T A;  2EAN A;  5KFG A;  1RM6 C;  1ZXI A;  2BQR A;  4P4M A;  4RQN A;  3SZ2 A;  2W54 A;  1KLN A;  1Q3V A;  4CF3 A;  9ICO A;  3WKA A;  1WCN A;  3ALR A;  3IG5 A;  3OSN A;  4GXI A;  2XC9 A;  4KLO A;  2IHM A;  4DCC A;  2WB1 F;  1CI4 A;  3QUQ A;  4CRX A;  2OH2 A;  3V6J A;  4KLF A;  4PZN A;  2JR5 A;  2BCU A;  3A0H U;  3JPO A;  1S10 A;  9ICH A;  5IIK A;  8ICF A;  5KG2 A;  4RNM A;  5AK5 A;  4O3Q A;  2M9N A;  1BPB A;  3H7I A;  3TI0 A;  1KTQ A;  4RQ6 A;  2OM6 A;  3QU9 A;  3RJH A;  3TAD C;  1KFT A;  2FPL A;  4I2I A;  3LVV A;  1L8L A;  4KMO B;  1TV9 A;  3BQ2 A;  2EZY A;  1DGJ A;  3PW0 A;  3PW7 A;  2JEJ A;  5AK3 A;  3QYP A;  4GC7 A;  2NRX A;  2W9C B;  4MFF A;  2XCA A;  1KBU A;  3ZDA A;  3H8W A;  1ZQ1 C;  2FMQ A;  5BPC A;  9ICI A;  1GO3 F;  4RUA A;  4F5R A;  5AKY A;  2KSO A;  4C8L A;  2WF7 A;  2W9A A;  1F44 A;  2HDO A;  2J6T A;  3H4B A;  3Q8K A;  4J9S A;  1FIQ A;  3A0B U;  1RYR A;  2KZ3 A;  3SYZ A;  3ONN A;  2E8N A;  4ECX A;  5KFI A;  1S0M A;  2WF9 A;  7ICN A;  5AI9 A;  4P0Q B;  5J0S A;  1BPD A;  2YN4 A;  2Y1I A;  5TZV A;  3ETL A;  3E58 A;  2LYH A;  2J6U A;  4YXJ A;  5H2F U;  3M9O B;  2EAP A;  3CP8 A;  9ICK A;  4JV2 A;  4HYK A;  3MC1 A;  5DLG A;  2MSN A;  2IOF K;  2FLN A;  3B9J A;  2R8J A;  3ORY A;  2E1E A;  3I28 A;  5AKL A;  3IDW A;  3UM9 A;  2UVR A;  4I2B A;  2BCR A;  4Y2Y A;  5JRT A;  1DRG A;  1V97 A;  1L8O A;  1JRO A;  4I2J A;  4CF5 A;  4GLX A;  2LM4 A;  4RT3 A;  2KIW A;  5JUM A;  4Z6E A;  9ICW A;  3Q8R B;  4J9Q A;  2DWQ A;  2YX8 A;  4J9M A;  4FE3 A;  3RTV A;  3MFI A;  3PO5 A;  4YN4 A;  4KLM A;  5ALD A;  2WB1 C;  1JI7 A;  4BXO B;  2KZZ A;  4UB1 A;  4JB3 A;  1AQ6 A;  4DFK A;  4CF4 A;  2AQ0 A;  1NK6 A;  4DL5 A;  1Z4N A;  5KFT A;  3PW2 A;  1L7P A;  7ICE A;  2C2R A;  2KHV A;  2DL0 A;  1UHU A;  4EZ9 A;  4RPZ A;  3NTU A;  2P66 A;  1D9F A;  1ZQF A;  3RJF A;  4MF8 A;  3FYH A;  4UB8 U;  2ZIU A;  2WAQ C;  2KKV A;  4OCZ A;  5KL8 B;  3ZD9 A;  2ZXI A;  3RR8 A;  4ED1 A;  1N5W A;  1ZET A;  1ZOL A;  2IHN A;  1QQ7 A;  2MUT A;  4QZ9 A;  4OJ5 A;  3HPO A;  2XY5 A;  2PI4 A;  2KFZ A;  2I6X A;  1JXL A;  4ECW A;  3GIK A;  5A0L A;  4CGZ A;  4K4I A;  1XO0 A;  4ECQ A;  4DO9 A;  4TQR A;  4NLC A;  5CRX A;  2UVW A;  4UAY A;  4WJ3 B;  3QEB Z;  5J8Y C;  5J0T A;  4YCX A;  3UPQ A;  4I2A A;  4B9T A;  2W11 A;  4M0A A;  4JWN A;  3MDA A;  1N63 A;  3PX6 A;  5ALF A;  1PVR A;  5CJ7 A;  1U9L A;  5KFH A;  2VA3 A;  3EWA A;  2D8C A;  4RQ5 A;  4RQ7 A;  3RRG A;  7ICV A;  4Q8E A;  2ODG A;  5HMM A;  1NNL A;  4B9V A;  2QB0 A;  2HBL A;  1IM4 A;  1F0M A;  1Z00 A;  1FFV A;  2LMR A;  3ZD8 A;  3CYM A;  1KRP A;  5KFE A;  1N61 A;  4OJ6 A;  1QH9 A;  4E0D A;  3AEV A;  4NM1 A;  5KTQ A;  3D2Q A;  2XCP A;  4DL7 A;  1BPZ A;  5CHG A;  2ZJA A;  1LKY A;  3SEI A;  1VLB A;  2NO4 A;  4DLG A;  4Y2R A;  1X42 A;  4FO6 A;  5HR7 A;  2XID A;  3TKA A;  4RQ3 A;  5ALK A;  4B9S A;  5IIL A;  2HHQ A;  3PR5 B;  4RUC A;  8ICX A;  5L1M A;  4BWJ A;  7ICU A;  1S5L U;  3WKC A;  2LBO A;  1JMS A;  3HWT A;  3OGU A;  1KDH A;  2NO5 A;  2ZIX B;  1ZRM A;  4Y2X A;  5KFN A;  3M1Y A;  5KFY A;  4ED7 A;  3RRH A;  3BDP A;  5KFZ A;  4DOB A;  4J9O A;  1NKC A;  5J0Y A;  4F5P A;  1T3N A;  4C4R A;  4PHE A;  2KP7 A;  4KX5 A;  2OCE A;  4R66 A;  3PZP A;  1BPY A;  2W9B A;  2DUY A;  3F53 A;  2BGW A;  3WK7 A;  1YT3 A;  4DSL A;  1L7M A;  1UA0 A;  1ZQR A;  2V9W A;  3PR4 A;  1XWL A;  1ZQA A;  2AQ4 A;  3AMZ A;  1X9M A;  2RRD A;  4JV0 A;  3GV8 B;  8ICW A;  2FMP A;  2F1I A;  2I1Q A;  4I2E A;  2I5H A;  2YTU A;  2EAM A;  3KHG A;  3NVY A;  2K4H A;  2YQE A;  4NLG A;  5CEH A;  2PMZ C;  3QU7 A;  9ICF A;  4KLU A;  5JU5 A;  2CRX A;  2DKX A;  2QAR A;  5G5H A;  2HVI A;  4B9U A;  1DXS A;  1RZT A;  3V7K A;  1HUZ A;  5FP0 A;  5CWR A;  1L7O A;  1ZQM A;  2HI0 A;  4KLH A;  3L4P A;  4DFM A;  5DG7 A;  1TVA A;  5AHX A;  4UB5 A;  3C2M A;  2BCS A;  4GXJ A;  4EX7 A;  1A77 A;  1Z1V A;  4DOC A;  2JEG A;  4CCH A;  3ISB A;  3TAR A;  3DV9 A;  4DL4 A;  3FC4 A;  4BWM A;  3QUC A;  2G5I B;  5BOL A;  3AQE A;  5BOM A;  5DB6 A;  3C29 A;  1VDV A;  5ALJ A;  1LB2 B;  2E8P A;  5F9N A;  1PVP A;  2MA1 A;  1C7Y A;  1YZ7 A;  1Z1B A;  4PH5 A;  2R8K A;  1WYG A;  8ICQ A;  5IIO A;  5EOZ A;  2KJ9 A;  3BS5 A;  3C28 A;  1DK2 A;  4QW8 A;  9ICG A;  2C22 A;  4UAR A;  1A6S A;  4I29 A;  1JRP A;  1VJ5 A;  1EXN A;  3M7D A;  2EZZ A;  1B22 A;  4LZG A;  5KFS A;  5ALL A;  5KG4 A;  2K60 A;  4M9J A;  4RQM A;  1A76 A;  2KG5 A;  4Y2J A;  3SMV A;  2HMX A;  7ICR A;  3K75 D;  2WF8 A;  2FLL A;  4M9G A;  2KFN A;  5AIC A;  9ICC A;  4YFK A;  5J2K A;  2PFQ A;  4RNO A;  3RB4 A;  4RNN A;  2FPK A;  4FS2 A;  3GZF A;  8ICT A;  1KL9 A;  2KTQ A;  4C8M A;  2NRW A;  1KSP A;  5AIB A;  4O5K A;  2G06 A;  5ALY A;  1Q3U A;  4NJ8 A;  4P4P A;  3Q8P B;  2F8L A;  4KLT A;  5DG9 A;  4BGD A;  3QEA Z;  3QE9 Y;  2XGQ A;  4O3M A;  5DQG A;  2F1H A;  1TAU A;  1J2M A;  2F44 A;  1RXW A;  2QB0 B;  1SIJ A;  5KG1 A;  2LKY A;  3PY8 A;  4ECR A;  3E2E A;  1WUD A;  8ICJ A;  5EWG A;  4NLN A;  1UQV A;  5HP4 A;  3SAG A;  4R64 A;  5KT7 A;  4F71 A;  5AKX A;  4NLZ A;  5AI0 A;  3HX0 A;  1TK5 A;  3NVZ A;  4NL9 A;  7ICF A;  1LKY B;  2Y0S F;  3QNM A;  1BPX A;  1XNS A;  3OJU A;  4EEN A;  5IIN A;  3T5J A;  4IS7 A;  2HHS A;  4EBC A;  5HHI A;  1XC9 A;  1ED1 A;  1X9S A;  1OW5 A;  2YMP A;  5AIA A;  4KLE A;  3OPX A;  4UAZ A;  1MN8 A;  2QLT A;  3MR3 A;  3H8M A;  5J0Q A;  2JH1 A;  5DQI A;  3EUB 2;  4TUQ A;  1ZQH A;  2GWS A;  5J2D A;  1X2I A;  3NUQ A;  4GXK A;  1J2N A;  3MGH A;  5AKJ A;  4PGQ A;  5J0O A;  1QSL A;  4FBT A;  1L5U A;  3ISC A;  4RPY A;  3C2L A;  2IBK A;  9ICM A;  4NLB A;  1Y88 A;  1Q8K A;  2EAO A;  1N62 A;  5C5J A;  3M9N B;  4Q45 A;  3MR2 A;  2W9B B;  1ZD2 P;  2E8M A;  3JPR A;  1S8O A;  2BR0 A;  4O9M A;  3EPI A;  4K4H A;  8ICA A;  3N4M B;  2G0A A;  3PX4 A;  3MR5 A;  3Q8L A;  2B6G A;  1BPE A;  3HW8 A;  1ZQY A;  5CB1 A;  9ICX A;  2WAQ F;  1X6J A;  1PK3 A;  3G6Y A;  3UMC A;  1ZQW A;  4C7Z A;  3IN5 A;  3WK4 A;  2OWO A;  2AXT U;  3H0L B;  4LJX A;  2K8B B;  3T5K A;  3RH5 A;  2QAR B;  3KFU F;  9ICN A;  4BX9 C;  2GO7 A;  3H40 A;  2W03 A;  4YR0 A;  9ICS A;  3LK9 A;  3RBD A;  4RU9 A;  2H3Q A;  4J9K A;  3K1R B;  4C8N A;  2KD1 A;  4Q8F A;  2KV2 A;  1S0V A;  2KVS A;  1D8L A;  1QQ6 A;  3ETR A;  4DF4 A;  1JX4 A;  4DWI A;  2KKP A;  5KFJ A;  8ICO A;  1KFD A;  1OXJ A;  2LM1 A;  4O3N A;  4J03 A;  1QLN A;  2H3V A;  4OJO A;  2HW3 A;  1WWU A;  4YXM A;  1ZQQ A;  2Y0S C;  4X5V A;  1PVQ A;  3H8J A;  5HHH A;  1NK4 A;  1ZQG A;  5AM3 A;  4QJF B;  5J29 A;  3ICX A;  1Q46 A;  4Q43 A;  3M8S A;  1RG6 A;  4XRH A;  3TFR A;  2JEF A;  4BUG A;  2F3N A;  4EYH B;  4K4G A;  4QZI A;  4O5E A;  8ICY A;  3UMG A;  5C0Y A;  1FEZ A;  3ISD A;  3EPG A;  1COK A;  2JEI A;  4Z6F A;  3JPN A;  4G9B A;  2J6S A;  5EE9 A;  9ICA A;  4I2G A;  5AK6 A;  3C2K A;  2W8K A;  2NRT A;  3RFA A;  1JIH A;  5F3X B;  1RYS A;  4M9N A;  4I27 A;  3KTQ A;  4UAS A;  1HUO A;  4AYB F;  1O08 A;  2FI1 A;  4TUP A;  1N2X A;  5T14 A;  2YMM A;  4U6P A;  3MAB A;  3PNC A;  1ZQC A;  2B21 A;  2KJ5 A;  2VJ4 A;  2A1J A;  1XS9 D;  4ZOH C;  3LWL A;  3V6K A;  4KTQ A;  4NY8 A;  4DSE A;  3KKA A;  4Q44 A;  5ALV A;  3C5F A;  4LVS A;  2A19 A;  3V7J A;  1QTM A;  2HOF A;  3C21 A;  2R8G A;  3D2N A;  4ECV A;  2K89 A;  2VJ5 A;  5ALR A;  3GV7 B;  1S76 D;  2BKE A;  2PKE A;  1D8Y A;  5K4L A;  2YB4 A;  3O0F A;  3RF9 A;  3KOO A;  2BPG A;  4BDP A;  5D46 A;  3GQC A;  3WKE A;  4QZC A;  1ZQD A;  4IR1 A;  1TAQ A;  1ZQV A;  5ALX A;  4OO1 J;  4Y2T A;  3IHQ B;  5J0W A;  3RJE A;  4O5C A;  2KJ8 A;  2PMZ F;  4O0I A;  4RQ0 A;  5AM5 A;  2F76 X;  2LPE A;  2JGA A;  3I76 A;  1LVH A;  3BQT A;  1U4B A;  3S6J A;  3N7S C;  2WF5 A;  9ICU A;  3GV5 B;  3PV8 A;  3TAD A;  3KZX A;  4OJL A;  8ICN A;  1ZQX A;  3CNH A;  3NVW A;  4C7Y A;  3RBE A;  1SGG A;  1UPH A;  1Z3E B;  1UT8 A;  2MU2 A;  3QUB A;  4GIB A;  3UQ2 A;  3KHH A;  8ICR A;  4I2D A;  2F2A B;  4EBD A;  4KLL A;  2RP5 A;  5EE0 A;  1X66 A;  4DL3 A;  3F2B A;  2BHN A;  5AI8 A;  1IIP A;  3QZ7 A;  5KFX A;  3DDH A;  2W9M A;  1ZQK A;  1P7D A;  3ZDC A;  5DGB A;  4EEY A;  5ALE A;  4YQW A;  3GIJ A;  2W55 A;  2ZTD A;  3QZ8 A;  3QXG A;  2AGP A;  4MEY A;  2KHQ A;  4M9H A;  1QCK A;  3ZI4 A;  5EWE A;  3JPQ A;  1NK0 A;  3T79 A;  1XSL A;  3PO4 A;  1SKS A;  2VKQ A;  2RDI A;  4DL6 A;  3D6J A;  3PST A;  4R8U A;  1IXR A;  4AYB C;  4FBU A;  4PGX A;  1YZ6 A;  2KSO B;  3GIM A;  2W8L A;  2VA2 A;  3F5E A;  4ECY A;  5J2E A;  2HOQ A;  2ZG6 A;  1DGS A;  3H4D A;  1SV0 C;  2JZB A;  3G6V A;  1S77 D;  2DBY A;  4ZH4 A;  3IP4 B;  1V85 A;  2GLE A;  1BGX T;  2WF6 A;  3M6Z A;  2F8K A;  4ECZ A;  5IIJ A;  2LHT A;  5ALW A;  4R63 A;  8ICZ A;  3NAS A;  2OHF A;  3TAQ A;  1ZQO A;  3BS7 A;  8ICH A;  3IRU A;  5J2G A;  2ZUD A;  2V4Q A;  5KAI U;  3RH4 A;  3N7P D;  4KLS A;  3RB0 A;  4F3O A;  4UB4 A;  4B9M A;  4O3R A;  1RQN A;  2KNJ A;  4IR9 A;  1FFU A;  2JMG A;  4A8E A;  1NKB A;  3PML A;  2EDU A;  1QSY A;  1ZJN A;  1NK7 A;  1NJY A;  2ALZ A;  1ARO P;  4UAT A;  4PPX A;  2VA8 A;  5TIS U;  5KNI A;  4F5O A;  2ZJ5 A;  4UBB A;  3B0X A;  3KZI U;  1RXV A;  3WU2 U;  4DQS A;  4QNL A;  2W43 A;  3VC8 A;  3J81 j;  3PW4 A;  4QZH A;  1CRX A;  3UXN A;  5J2J A;  9ICT A;  1T7P A;  2DF4 B;  2K8C B;  5KFD A;  4F5N A;  4OJP A;  9ICE A;  2DPJ A;  4DFD A;  1Z19 A;  7ICP A;  5DB9 A;  3ZDD A;  3SAH A;  2E8O A;  2ESE A;  5ALH A;  4DLE A;  2G08 A;  3TAN A;  2FLP A;  1K1Q A;  1BNP A;  2BQ3 A;  2WFA A;  2CXY A;  1NK5 A;  2KIC A;  4F4W A;  2ZTC A;  4KX3 A;  4P0Q A;  3RR7 A;  2JH7 A;  1TK0 A;  2YML A;  4ELT A;  1ZQJ A;  5J0X A;  3Q8Q B;  2ISP A;  2ZIU B;  2C28 A;  4IC9 A;  2C2E A;  1NKE A;  3QU5 A;  5KT6 A;  3NGD A;  4XQ8 A;  3GU3 A;  5AKG A;  2UVV A;  1ZQB A;  3EZ5 A;  5KFW A;  4US8 A;  2HVH A;  1NZP A;  9ICR A;  2K8A A;  4J9P A;  4PL1 A;  4ECS A;  2MUT B;  4USA A;  3HT3 A;  2MRL A;  5KG5 A;  5ALQ A;  2KZM A;  1DK3 A;  1QQ5 A;  4NV0 A;  4YMN A;  2XVT A;  5DB7 A;  2W7O A;  5L9X A;  4CE6 A;  2ZTE A;  1L3V A;  4B9L A;  1V38 A;  2M0N A;  4NLK A;  3GII A;  3SV4 A;  4YD2 A;  1NOM A;  3H8S A;  2ASD A;  5DBB A;  3PX0 A;  3QU4 A;  2EH9 A;  3QUT A;  4F4K A;  4PGY A;  1NI3 A;  4BXO A;  2WTF A;  5AM2 A;  5KFB A;  2BPC A;  3TFS A;  2L5Y A;  2PXI A;  5J0R A;  4PL2 A;  5ALN A;  1X9W A;  2H3Z A;  2ZUC A;  2AU0 A;  2BCQ A;  2F77 X;  3IG8 A;  2OEH A;  1SXD A;  3IV6 A;  3M6K A;  1ZQP A;  2W7P A;  2VAN A;  2AH5 A;  4UB3 A;  1Z00 B;  4QZG A;  4M47 A;  2V4R A;  1L3S A;  1O03 A;  5AKZ A;  2K4E A;  9ICQ A;  2AGO A;  7ICT A;  2HBK A;  3WK8 A;  5EE1 A;  4BJQ A;  4CNQ A;  3RJG A;  4M6W A;  5L1K A;  2GOL A;  3AN1 A;  3ED5 A;  1IG6 A;  3V6H A;  8ICS A;  2GH1 A;  4PHD A;  2DQN B;  4EEK A;  5J2F A;  7ICL A;  4F92 B;  1S97 A;  1RQL A;  4F4X A;  5KFV A;  1KN5 A;  4ELV A;  2RLT A;  2H3F A;  4M2Y A;  9ICJ A;  1UT5 A;  4MHV A;  1JN3 A;  2K4I A;  2F1J A;  2RDJ A;  1LV5 A;  2G5H B;  2RHF A;  1JXE A;  4GFJ A;  5DBC A;  9ICL A;  3G6X A;  5J2A A;  5ALG A;  1A0P A;  4KLJ A;  5L1I A;  3Q8S B;  2HHW A;  2HHU A;  4I2F A;  3C23 A;  3KKA C;  4QZB A;  3MBY A;  1S0N A;  4DQQ A;  5CR0 A;  3T5L A;  3T3F A;  2D6F C;  4IQW A;  8ICV A;  5KT3 A;  3SEN A;  2JZB B;  1PUZ A;  2AGQ A;  4TQS A;  1NJZ A;  5EE3 A;  3TQ1 A;  2W3R A;  5ALZ A;  2IA6 A;  5ALS A;  1CUK A;  1RPL A;  3RB6 A;  1NK8 A;  2R18 A;  2NRV A;  1U49 A;  4I28 A;  3TAP A;  3E0F A;  3ZDE A;  1NZB A;  5HR6 A;  5KG6 A;  3Q8M A;  5DGA A;  5AM0 A;  2H3I A;  3MR6 A;  3C1Y A;  3DEE A;  4IL6 U;  7ICI A;  1ECW A;  3WKD A;  1ZJM A;  1MQ3 A;  1FO4 A;  5D4B A;  4QWE A;  3MDC A;  4DSI A;  4J9L A;  3N7R C;  5KFR A;  4MEX A;  1N5X A;  4EX6 A;  2XI9 A;  8ICM A;  2HHX A;  2QB1 A;  3RAX A;  4YMO A;  1B0X A;  7ICS A;  3CW2 C;  2Y1J A;  5ALU A;  1SL2 A;  2CN1 A;  8ICK A;  3FDS A;  4JK1 A;  5J0P A;  4UAV A;  4ICA A;  4Y2P A;  5DDY A;  3KHR A;  5AM4 A;  2ZIX A;  3AU2 A;  1WCL A;  3GFK B;  4IRD A;  4MFC A;  3V72 A;  2HHV A;  4OD0 A;  5DG8 A;  1RDF A;  3F2C A;  3MGV A;  4JV1 A;  1SV4 A;  4C0Z A;  1U45 A;  3D2S A;  5KT2 A;  2I9G A;  2ZIV A;  4F91 B;  4P0P A;  1SKW A;  4O3S A;  2BDU A;  4DSJ A;  2XO7 A;  4DOA A;  5KFQ A;  1UCV A;  4EZ6 A;  4QWD A;  3BS5 B;  1WG8 A;  5G5G A;  4MFA A;  3WK9 A;  4Y2V A;  2XY6 A;  1KKX A;  1T3Q A;  2KK0 A;  4KN7 A;  3UMB A;  2B0C A;  2P35 A;  5KFP A;  2XIC A;  1UA1 A;  2LYB A;  1COO A;  3PSF A;  4ECU A;  5KG0 A;  4Z6C A;  8ICI A;  2HOI A;  2HHT A;  5CA7 A;  5KFF A;  1X6I A;  3BQ1 A; 
#chains in the Genus database with same CATH homology
 2E8P A;  2QAR B;  4NL9 A;  5KNI A;  1LKY B;  2L5Y A;  1WWV A;  1SXD A;  1X9X A;  2DKZ A;  3KKA A;  3K1R B;  2KMD A;  2EAP A;  3BS5 A;  2ES6 A;  4IS7 A;  2QB1 A;  4PZN A;  1KW4 A;  1OW5 A;  1B0X A;  2E8O A;  1B4F A;  2ESE A;  3IDW A;  5J8Y C;  1OXJ A;  2KE7 A;  3H8M A;  5JRT A;  2Y9U A;  2K60 A;  2KSO B;  4RQM A;  2KG5 A;  1WWU A;  2D8C A;  4MHV A;  1SV0 C;  2K4P A;  3BQ7 A;  2QB0 A;  3TAD C;  2LPE A;  1SXE A;  1PK1 A;  1F0M A;  1RG6 A;  1X40 A;  2EAO A;  1V85 A;  2GLE A;  2LMR A;  2YTU A;  2EAM A;  1SV4 A;  2F8K A;  1JI7 A;  2F3N A;  3TAC B;  4NJ8 A;  2E8M A;  3KKA C;  1SV0 A;  5JU5 A;  2KIV A;  2DKX A;  2QAR A;  3BS7 A;  3TAD A;  1COK A;  1LKY A;  2D3D A;  1DXS A;  3SEI A;  1UCV A;  5J8Y A;  5JTI A;  3BS5 B;  2Y9T A;  3SEN A;  2DL0 A;  2F44 A;  2FE9 A;  2B6G A;  2KSO A;  4NL9 C;  1PK3 A;  2QB0 B;  1SGG A;  5F3X B;  1Z1V A;  2JV3 A;  2QKQ A;  1PK1 B;  5L1M A;  2EAN A;  1UQV A;  1V38 A;  3HIL A;  1X66 A;  4RQN A;  2E8N A;  4PZO A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...