1DXSA

Crystal structure of the c-terminal sterile alpha motif (sam) domain of human p73 alpha splice variant
Total Genus 18
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
18
sequence length
57
structure length
57
Chain Sequence
SLVSFLTGLGCPNCIEYFTSQGLQSIYHLQNLTIEDLGALKIPEQYRMTIWRGLQDL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Gene regulation
molecule keywords P53-LIKE TRANSCRIPTION FACTOR
publication title Structure of the C-Terminal Sterile Alpha-Motif (Sam) Domain of Human P73 Alpha
pubmed doi rcsb
source organism Homo sapiens
total genus 18
structure length 57
sequence length 57
ec nomenclature
pdb deposition date 2000-01-15
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.50 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 Transcription Factor, Ets-1 1dxsA00
2LPEA 4PZOA 1SGGA 3BS5B 5JU5A 2F3NA 5J8YA 4MHVA 1F0MA 2KSOA 2EANA 1WWUA 3BS7A 1SV0A 2Y9TA 1DXSA 1RG6A 2KE7A 2L5YA 2QKQA 3IDWA 2QB0A 1PK1B 3BS5A 2EAMA 2EAPA 5KNIA 2D3DA 2GLEA 2JV3A 1B4FA 1OW5A 5L1MA 1COKA 2DKZA 3KKAC 2E8MA 2E8NA 1PK1A 3TADC 2KG5A 3SEIA 2YTUA 4NL9A 5JTIA 1X66A 4NJ8A 2QARB 1X40A 5F3XB 1LKYB 1UQVA 2D8CA 2F44A 2QB1A 2E8OA 2F8KA 1WWVA 3HILA 3TACB 1OXJA 3KKAA 1JI7A 1V38A 4IS7A 1Z1VA 1V85A 2Y9UA 4PZNA 3TADA 2QB0B 2K4PA 5J8YC 1LKYA 1X9XA 2FE9A 4RQMA 2DKXA 2ESEA 3K1RB 1SV0C 2EAOA 2KMDA 2DL0A 1B0XA 2K60A 4NL9C 1SXDA 2E8PA 3SENA 1PK3A 2KSOB 5JRTA 2KIVA 3BQ7A 1UCVA 1KW4A 1SV4A 2ES6A 3H8MA 2LMRA 2QARA 4RQNA 1SXEA 2B6GA
chains in the Genus database with same CATH superfamily
1SGGA 3IG8A 2C22A 4F4KA 2RDIA 2K4IA 3IRUA 1KDHA 3JPRA 2ZJ5A 1LB2B 4CF4A 4Q8FA 2HHTA 3C5GA 4KN7A 2BPCA 2BDPA 1S0OA 3HJEA 8ICVA 1ZYQA 1ZQTA 4JMUA 9ICVA 2HSZA 4DCCA 4ECWA 5GTHU 4QW9A 3QXGA 4UASA 4KLUA 4F5NA 3ISBA 3PZPA 4TUSA 2WB1C 4QWEA 3MR5A 3QZ8A 2H3IA 1QLNA 1MQ3A 3B0XA 2XI9A 5ALIA 5KL1B 5L1MA 4DS4A 2XO7A 2I1QA 3A0HU 1NNLA 4RQ2A 2DFLA 5AKLA 5KFVA 4YN4A 5KG6A 1DRGA 2EZXA 3RRHA 5ALVA 2NYVA 5J2FA 4RNNA 5AKEA 2JEFA 1ZQYA 4J9KA 1DOQA 5KFTA 4F71A 4I2JA 2LBOA 1JMSA 1SKWA 1ZQOA 5AKJA 2YQEA 3SAFA 8ICAA 4EEYA 4Y2RA 5AM4A 9ICOA 1S97A 2KNJA 4QZBA 4R63A 5KFXA 3IP4B 3D2SA 2F77X 1UPHA 1X42A 2KIWA 2JH1A 1V85A 4O0IA 5DB8A 1TV9A 2F76X 4EX7A 1P7DA 4NWIA 3EPIA 2W03A 1ZQCA 4EX6A 5DDYA 2KMDA 2DPJA 4ACOA 5J0UA 2F8LA 4ED7A 4JV1A 1ZXIA 2ODGA 5ALJA 5DQHA 3SZ2A 2IHNA 4DSLA 3ZDEA 2UVWA 3UMGA 4LZGA 4YQWA 1XSPA 4Q8EA 1HUZA 4KITB 2VA3A 2FPMA 4OCZA 5G5HA 4US8A 2HBMA 1X9WA 1ZQPA 5ALHA 1CEZA 2E3TA 5KFWA 4LZDA 2AGQA 4FZNA 5CHGA 2KTQA 4QNLA 1TK8A 4DFPA 2Y1JA 1T4GA 4UB1A 3C1YA 1SKSA 1NZPA 1A6SA 4M9LA 1K1SA 4US9A 1ZQWA 4ELTA 4BUGA 2YB4A 5DQGA 3SR6A 4YR2A 1Z1BA 1RXWA 4J9NA 4Y2TA 2VIXA 4Y2UA 9ICXA 2VJ5A 5ALZA 1TVAA 4MFAA 3OJSA 4I27A 5AI9A 4F2RA 4FZLA 4GFJA 1ZQMA 4M47A 4J9RA 3WK4A 1F44A 4NV0A 2QB1A 1SKRA 3QUCA 2KJ5A 1N2XA 1L7OA 2Q4TA 2CPRA 2HHVA 2LM1A 3OGUA 5KFMA 3PMLA 1MQ2A 2OH2A 4C0ZA 8ICRA 4F2SA 3PW5A 7ICEA 2F2AB 4QIWC 4YCXA 1SV0C 2M9NA 1WUDA 2K8BB 4YFKA 1TK0A 4K4IA 1JXLA 3NASA 1BPEA 3BQ1A 2JXJA 2OXOA 9ICPA 3N7RC 1WCNA 2JRZA 3C1ZA 1IIPA 3N28A 9ICIA 5DBBA 2G07A 9ICBA 2NRTA 3RH6A 2KZ3A 4RQ8A 5KG4A 4PHPA 4F3OA 1Z3EB 4YVZA 4KLEA 1T8EA 2A1JB 2DUYA 4F92B 3WKAA 5AKGA 2W04A 5DG7A 1XNSA 2KV2A 3PR5B 4RPXA 1KLNA 4F50A 3V7LA 1V97A 3MR6A 3PVXA 4QW8A 1UA1A 3PX6A 1HJPA 3RFAA 3IV6A 4RUCA 3NVVA 2PI5A 3AQFA 2GLEA 3RJKA 1XC9A 1S0VA 4DQPA 2ZIWB 1COKA 2KFZA 1KFTA 3RBDA 4JV2A 4ELVA 2HHSA 3S6JA 1WG8A 3QU9A 1XSLA 4QWDA 5IIKA 5C5JA 4JV0A 3N97B 1KQQA 5ALFA 1N63A 8ICOA 2YMQA 1TE2A 4IRCA 4GXJA 1UQVA 3E58A 1CI4A 2K8CB 4I2HA 3C2MA 2BGWA 5KFHA 3EPGA 5L1LA 7ICPA 4C4RA 2WHEA 4IS7A 4PZNA 3JPTA 2HMXA 5J8YC 4R8UA 1TKDA 5J0XA 1ZRMA 2W3RA 4Q45A 1D9FA 4B9VA 7ICVA 5J2IA 2XICA 1IM4A 8ICCA 4Y2QA 2ATLA 5KFSA 2E1FA 2VJ4A 4C8LA 2WAQF 5KAFU 1D9DA 2HHQA 5KT7A 1DK3A 4KN4A 5J0OA 2ZIVA 3V7JA 3UMBA 4TUQA 5EWGA 3G6YA 4PZOA 5JU5A 1S8OA 3T79A 5KG1A 1PZNA 4DL3A 4B6JA 1BPDA 2KP7A 5E79U 3CNHA 3BDPA 2KK0A 3LWLA 1DK2A 5EE0A 4MF8A 4CGZA 4Y2SA 3WK8A 2FLLA 2KE7A 2KEYA 2I9GA 4Z6DA 4YMOA 4J9MA 4DSKA 4EBDA 2FPKA 3M9NB 3EWAA 4I2DA 2D3DA 5DG9A 3L5KA 4R65A 4I2BA 4R8UB 8ICNA 4QZ9A 3TANA 4Y2PA 2LI6A 1B43A 1TAUA 4YMMA 1VJ5A 3SMVA 4UAYA 1QCKA 4QZAA 3SAHA 4O3SA 3TADC 2VA2A 3H0MB 3H4BA 5IIIA 2UVUA 3JPQA 2C2EA 3G6XA 4HAIA 2YMPA 1U49A 3KZXA 4GIBA 1IV8A 2MUTB 2F1IA 1N5WA 4RNOA 4DL6A 5KFCA 1NK4A 1QQ5A 5KT3A 4QZCA 1K5OA 1K1QA 4QWCA 4FS1A 4NLKA 2WTFA 3KD3A 2K89A 3TACB 4UQGA 2KKVA 4GXIA 2KFNA 2RLTA 4PL2A 9ICAA 1S0MA 7ICUA 2CN1A 3WKBA 2W9AA 4QWBA 3M6KA 2W9BB 4PHAA 2IOFA 7ICJA 4C7YA 2OEHA 2LYBA 4DQSA 4DFMA 1J97A 3H8MA 7ICOA 4MEXA 5TZVA 3T5KA 2J6SA 3M1YA 4UB6U 3T5JA 2F3NA 4O9MA 4M6WA 3QNMA 4ED0A 3ED5A 3WK9A 1SL1A 2AQ0A 3B9JA 9ICNA 2R8GA 3EUB2 3GIIA 1NZBA 2HOIA 1RG6A 2L5YA 2RP5A 4RT3A 3ZD8A 2JEIA 3GZFA 3SAGA 1ZOLA 5HP4A 4Q44A 1ZQBA 2ZTDA 3V7KA 5J2GA 2NO4A 1COOA 1F5SA 2MRLA 5ALRA 2JZBA 1ZQKA 5J0RA 4DSIA 5A0LA 5ALWA 3MC1A 4RT2A 3LYSA 3J81j 2HOQA 2YB1A 4QZGA 3AEVA 4P0PA 2E1EA 4B9TA 2PMZC 3Q8SB 3T5LA 3LDAA 5EWFA 3ONNA 2G0AA 3PSFA 2G5IB 3KHGA 1S0NA 5J29A 4Z6CA 4M6WB 4J9SA 1WWVA 1KFSA 2PI4A 5DB6A 2ASLA 2BPFA 3RJHA 3ZDAA 2GH1A 1ZETA 1FFVA 4UAVA 1L8OA 2BKEA 1LKYA 3MGVA 2RQ5A 4RQMA 2KHQA 2HI0A 5DDMA 5HMMA 2K4EA 3H8JA 5IINA 4PHEA 4I2FA 1AROP 4RU9A 4IQTA 2ISPA 3RR8A 5J0YA 2RHFA 2KIVA 3BQ7A 4I2AA 3JPOA 3H7IA 4LJXA 3ZDCA 2WAQC 8ICWA 7ICSA 2W43A 1L3VA 3AUOA 2KZZA 4F5OA 2F1JA 3WKEA 1NK6A 2IBKA 3I76A 1NK8A 5DB9A 3LVVA 2KZMA 5J2EA 3QU2A 3HRDD 4BWMA 4DSJA 5T14A 2KICA 5J0WA 1IG6A 3N4MB 2HBLA 2GO7A 4JUZA 1ZQQA 9ICEA 3PX4A 3KBBA 4EELA 3TAQA 3O0FA 2LYAA 3GIMA 4DWIA 1UT8A 5CWRA 4XUSA 2PFPA 2E8NA 4DOAA 2BZFA 5KG3A 2Y0SC 4DO9A 3V72A 2WF6A 4QZHA 4QJFB 5DG8A 4NJ8A 4X5VA 5DLFA 3H4DA 2AHOB 3FDSA 4MF2A 3PV8A 2UVRA 1T3QA 1U48A 7ICLA 5L1KA 2D8CA 2F44A 2KD1A 4HYKA 2ZUCA 2ZIUB 1RM6C 3IM1A 4DSFA 3RJGA 4P0QA 2M0NA 5AHXA 4UBCA 3CRXA 1V38A 5HR6A 3AU6A 5ALEA 3PSPA 2PFNA 3Q8QB 8ICFA 4NY8A 5KFRA 4F5QA 2P35A 1IXRA 3TFSA 5ALSA 1FO4A 4PJ0U 1XO0A 2K60A 1UCVA 2ZTEA 5AKYA 4EBEA 3DV9A 2WFAA 4UB4A 1U45A 7ICNA 1XSNA 1TK5A 5BOLA 7ICMA 4F93B 1DGSA 5AIBA 4ZOHC 5AM1A 1RZTA 4K4HA 1SZHA 1NK5A 1FEZA 4DEZA 1JX4A 4IR1A 2W9MA 2YN4A 3RF9A 2BQ3A 4P0QB 3AU2A 3BZKA 2BDUA 1NOMA 1N48A 1KKXA 3ORYA 2DF4B 4OJ5A 5KG7A 1ZQXA 1GO3F 3DDHA 3ETLA 4USAA 2EH9A 3B0YA 4YD2A 2KVCA 4RPZA 5L1IA 4FO6A 4CF3A 3GU3A 3V6HA 2A3VA 3WKDA 4BXOA 2KHVA 8ICXA 4RQ1A 4G3IA 3WK5A 3RR7A 1ZQ1C 5EWEA 1X66A 1WCLA 4CF5A 1X40A 5AI0A 4KLFA 3PSTA 4DQQA 2F1HA 1BPYA 4OJOA 2IA6A 5DBCA 2PKEA 2HW3A 4QZFA 1N62A 5AKXA 4FFDA 1PVRA 2E8OA 1RXVA 2E5SA 4UAWA 4NXZA 1J2NA 3HILA 2C28A 3ISDA 1A0PA 3KKAA 2DWQA 4F5RA 3KFUF 5HR7A 1BNOA 1ZQEA 1SWVA 3ZI4A 4QWAA 3FM9A 8ICLA 5KG5A 4DF4A 3WU2U 1SWWA 4C4TA 3I28A 1FIQA 2JGAA 2H3QA 1Y88A 4J9LA 3SD7A 3ISCA 1L5UA 2VANA 2WF5A 3OHBA 5AI5A 2LMRA 3PR4A 2AGPA 3D2NA 1XU4A 4BXOB 7ICIA 3M8RA 2IOHA 5ALDA 3AM9A 1KRPA 2XC9A 4QZEA 1Z4NA 4UB5A 2HDOA 3C28A 4DL7A 5EE1A 1JXEA 4O5KA 3GILA 4DOBA 4UATA 2AJQA 3H0RB 5AKZA 3SYZA 1M6YA 3MDCA 4KLHA 3BS5A 4ICAA 5DBAA 2ASDA 4O5CA 3WK6A 1ZD3A 4MEYA 3HPOA 5AI8A 4IRDA 1B4FA 3MGIA 4Z6EA 2FMPA 3MGHA 4Y2XA 2FLNA 1U9LA 3HW8A 4Y2YA 3WKCA 4M9JA 1PK1A 2D6FC 1S10A 1PUZA 8ICSA 3QEAZ 4DLGA 4U7CA 1N61A 3C21A 2W7OA 3THVA 2ZXHA 2ZIXA 4ECRA 7ICGA 5HNKA 5KFJA 4RQ4A 4EZ6A 8ICTA 4F5PA 5EE9A 2F8KA 5DKWA 2V4QA 5DLGA 3C2LA 2HHUA 1ZRNA 8ICYA 5AK6A 5CRXA 1BPBA 1ZQZA 4FBUA 4I28A 3NRZA 4NLCA 5ALPA 3HP6A 2DKXA 4ECVA 3QUBA 1KFDA 1J2MA 2EZZA 1Q3VA 2GWSA 3OJUA 3F2CA 1UT5A 2KVSA 1PK3A 5J0QA 1QSYA 3QZ7A 7ICFA 9ICKA 4UW9A 2FJ6A 2LKYA 2HOFA 4M9NA 3NRWA 5TISU 5KFZA 3Q8KA 1HUOA 3PY8A 4ECSA 4Z6FA 1QTMA 2Q0ZX 9ICGA 3MABA 3UQ2A 2H3ZA 3NTUA 1JRPA 3T3FA 4B9UA 3D2QA 2W9CA 3C29A 8ICBA 4DOCA 3HKZF 4M9GA 5J0PA 5J2AA 1PVQA 1N5XA 2V9WA 1N60A 2MAXA 4A8EA 1L7NA 3ZDBA 3OPXA 3BJYA 3RAXA 3SI8A 3M6ZA 1L3SA 3VC8A 5AM3A 4O3OA 3EW9A 4DFJA 3NUQA 3BZCA 3HWTA 3LK9A 1WYGA 5CJ7A 5G5GA 4WJ3B 8ICGA 5KTQA 5J2JA 2WF7A 3OSNA 2R8HA 4YP3A 4C7ZA 3LWMA 3KTQA 5F3XB 5CB1A 2HHXA 1MN8A 4EBCA 5KFUA 3ZD9A 2BCVA 3UQ0A 3CYMA 4DL5A 4C8OA 3UXPA 4KTQA 3RRGA 2G5HB 4K4GA 3IG5A 2AXTU 1ZQDA 5H2FU 2N1RA 4NLGA 2W9CB 4OJPA 2VA8A 3MR2A 3FC4A 2W8KA 2BPGA 3EZ5A 1VLBA 2ZIVB 3M9MB 5AKKA 3K1RB 4PGQA 3RB3A 5ALQA 3L3FX 4AYBF 4YD1A 2EAOA 4FBTA 3UM9A 4J9OA 3MDAA 1KEJA 1SV4A 4UB3A 5KFDA 5KFLA 3GIJA 4OJ6A 2J6TA 3Q8PB 1SXEA 1U47A 1D8YA 2KKPA 4ECQA 2MU2A 5J2HA 3BQ2A 2BQRA 2H5XA 2KSOA 4KLOA 1SV0A 3K4GA 2KOBA 5EOZA 1L8LA 4O3RA 3LVWA 2CRXA 3IHQB 4OO1J 1RQNA 2W11A 5D46A 1UHUA 3K75D 1RQLA 4C80A 5DGBA 1T3NA 2G09A 2ZTCA 3NVWA 4CE6A 1T94A 1ZQRA 2E8MA 2WF9A 4GLXA 4XRHA 1AQ6A 2IOFK 2YTUA 4NL9A 5JTIA 5CEHA 2KJ9A 1U4BA 2ASJA 1LVHA 1SB3C 4PPXA 1QQ7A 1L3UA 5AK4A 5EE3A 3PX0A 4BDPA 2G08A 4RQ6A 2W3SA 4YXJA 1NJWA 3F2DA 3RB0A 4M2YA 4JK1A 5HHHA 5CA7A 5KFGA 1JN3A 4BWJA 1SL0A 4ED2A 5KFAA 5KT5A 3NGDA 4DFDA 3M7DA 3NS1A 4PH5A 1NKEA 8ICPA 4FE3A 5IIMA 1VDVA 4GC6A 3QE9Y 1NJXA 4DSEA 1Z4OA 3R9KA 2FMSA 1KW4A 5J2KA 2K8AA 1N56A 3D6JA 9ICTA 3FYHA 5ALNA 9ICRA 5ALXA 2ZUBA 3CW2C 5GTIU 4F91B 1O03A 5J8YA 4QZIA 4O3QA 5DB7A 2JZBB 4F4XA 1KSPA 4PL1A 4ECYA 2OYYA 1NK0A 5KT6A 2EZYA 4M04A 1ZQIA 3JPPA 2QB0A 4YR0A 1ZQUA 3Q8LA 3HKZC 3QX7A 4QZ8A 4P0PB 4ED3A 5IIOA 3KOOA 2K4HA 5KFQA 1C20A 1ZQHA 1ZQSA 5D49A 1B22A 3AQEA 1NKCA 2J6UA 1KN5A 2HBKA 5BOMA 3TARA 5J0SA 2R8JA 2Y1IA 3OHAA 4F4WA 4TUPA 4B9SA 3VCBA 1L6NA 3TI0A 8ICZA 4QIWF 3H0LB 5J2DA 4F72A 5ALKA 2R8IA 1LKYB 3M9OB 4EYIB 1KL9A 2YX8A 2NRZA 2ISOA 4EEKA 3SV3A 4RQ5A 1KTQA 4CRXA 3FAHA 2FLPA 4Y2VA 4JWMA 1MSWD 4J9PA 1JI7A 5L9XA 2Y9UA 3TADA 4P2HA 8ICHA 2QB0B 5B66U 1YT3A 1OUQA 4UAZA 3Q8RB 4KLMA 1S5LU 4PGXA 1NK7A 8ICQA 2A19A 3RB4A 3RJJA 2JHDA 5KFNA 4AYBC 1S77D 4ECTA 2B0CA 2AGOA 1B0XA 3QUQA 2E8PA 3JPNA 2NV3A 4UBBA 3NVZA 1ZQFA 3RJIA 4IC9A 4KX3A 2BHNA 1BPZA 1RYSA 2JMGA 2LPEA 2EQYA 4B9LA 4PGYA 4FZMA 2FDRA 1RYUA 3PW0A 4Q43A 3G6VA 3UXOA 3PW4A 3BS7A 4UAUA 1Q8KA 2UVVA 2XCAA 3IDWA 1ZQNA 9ICHA 5ALTA 4ZH4A 5KFBA 4P4PA 2EAPA 5KNIA 4C4SA 1YZ7A 3NVYA 2JV3A 2XIDA 9ICSA 1JROA 8ICJA 1EXNA 3PSIA 1NJZA 2DKZA 4BJQA 4B9MA 3DEEA 1O08A 3C2KA 1V9PA 2JEJA 5DGAA 1ZD2P 3E2EA 4O3MA 3RB6A 4JWNA 3SQIA 4IRKA 1X2IA 1BVSA 5AK5A 5J2BA 2ZG6A 5ALUA 5AKHA 4RNMA 4C8KA 1HIWA 2OHFA 5F9LA 4MFFA 4Y2JA 5B5EU 2A1AA 4TQSA 2ZXIA 5AIAA 1RYRA 1X9XA 2FE9A 2KN7A 3MR3A 3HX0A 2BR0A 5JRTA 1ZD4A 1L7PA 4RQNA 1S76D 1QH9A 1L7MA 3V6KA 3PO5A 2NRXA 2P6RA 2R8KA 3QYPA 3TFRA 5FP0A 9ICLA 5AM2A 2I6XA 4I2GA 3QU5A 4KMOB 5L1JA 1HEKA 2Y9TA 4P4OA 2LYHA 4EZ9A 4IQVA 3PW7A 2C2RA 3ALRA 5KAIU 2EAMA 4NM2A 4E0DA 4YXMA 3F5AA 4J03A 1ECWA 2W55A 2O6KA 5AICA 4RUAA 3RH5A 2A1JA 2LM4A 4UB8U 3TQ1A 4CDGA 1PVPA 2BQUA 1FFUA 1SL2A 1TAQA 2RRDA 2HHWA 3SEIA 3GV5B 2R18A 4DLEA 1TAMA 3N7SC 4UARA 4O3PA 2W54A 3QU4A 5KFPA 3PO4A 4C8MA 4RZRA 4F4YA 3C23A 2ZIWA 2XGPA 4DQIA 3GV8B 4ED1A 5ALGA 5BPCA 1XWLA 3TKAA 1X9MA 4M9HA 4ECXA 2NRWA 1OXJA 5IILA 4JB3A 1QSLA 8ICEA 4FS2A 2K4PA 2JR5A 2FPLA 3H8WA 4XA5A 5AI6A 8ICMA 2DL0A 2MSNA 2W8LA 4NL9C 3SENA 1TFRA 4EYHB 2HCFA 4BGDA 5AKIA 4KLLA 3OTQA 1X6JA 2W7PA 4PHDA 3AL0B 3BQTA 4NLBA 2JEGA 2EDUA 4EENA 5J2CA 2JH7A 3L4PA 3BS5B 5KFIA 1A77A 2KJ8A 2MA1A 5CP2A 3RAQA 1ZQGA 2IMWP 4ED6A 3OSPA 3RBEA 2EANA 5KFYA 5KG0A 1LV5A 3HT3A 2PFQA 2PMZF 5J0TA 1DGJA 3U26A 1PK1B 2BCSA 4AP9A 4O3NA 2FI1A 2B21A 2H3FA 1CRXA 3MFHA 4I29A 2ZIXB 1OW5A 2XCPA 3SV4A 5KFKA 9ICJA 2ZUDA 4CCHA 4ED8A 3F53A 1C7YA 3KHLA 3ETRA 4DS5A 2GOLA 8ICKA 1ZQVA 4F4ZA 2V4RA 3K1ZA 3RTVA 2H3VA 5F9NA 3KHHA 9ICQA 5HMLA 1RDFA 4DF8A 1X9SA 4I2IA 5D4BA 4NLZA 3M8SA 3RH4A 4ELUA 3F5EA 3RJFA 2ALZA 4KLGA 4KLTA 8ICUA 4GXKA 3BQ0A 3PW2A 3KHRA 4C8NA 1Z1VA 3UXNA 2MUTA 4IL6U 4F8RA 4RQ7A 4KLJA 7ICHA 5KFFA 3IN5A 5ALOA 1QSSA 1QQ6A 3PMNA 2XY7A 4XQ8A 3QU7A 3CP8A 2P66A 5AM5A 3TAPA 4IR9A 2XY5A 2ES6A 2G06A 4ECZA 1Z00A 2YY6A 5ALLA 4OJLA 4DL2A 2B6GA 1T7PA 1Q46A 3UPQA 2FMQA 2DPIA 2WF8A 1YZ6A 4LVSA 2W9BA 1H38A 2C2DA 5KL8B 4YMNA 2XY6A 4QZDA 1JALA 1NKBA 1DXSA 2Y0SF 1ZQJA 4R64A 2HVIA 2P6UA 5AI4A 1JUDA 3ICXA 3MFIA 7ICRA 7ICKA 2WB1F 1L3TA 5HHIA 4CNQA 9ICFA 3JPSA 2CXYA 3AMZA 4ECUA 4KLDA 4U6PA 2I5HA 5ALYA 4J9QA 5AM0A 2DQNB 9ICCA 2KG5A 4MFCA 2PXIA 1BGXT 2YMLA 5DQIA 1SIJA 1Z00B 1BPXA 1D8LA 5IIJA 4I2CA 1ZJMA 3T5HA 9ICMA 7ICTA 4RQ3A 5JUMA 3WK7A 3KZIU 5AK3A 1NI3A 4GC7A 1NJYA 2Z7JA 5KFOA 1CUKA 4RQ0A 3Q8MA 2OCEA 3I1YA 1ZD5A 4TURA 1XO1A 1Q3UA 1JIHA 4NM1A 4I2EA 1SXDA 1ED1A 4TQRA 2KSOB 4DL4A 5C0YA 3GV7B 2XGQA 2QARA 3H40A 2QLTA 3N7PD 2DBYA 3E0FA 4BX9C 1MA7A 3QUTA 4MHVA 1F0MA 1XS9D 3V6JA 4KLQA 1WWUA 2XVTA 2ZJAA 5ALMA 5KT2A 1KBUA 2VKQA 1ZJNA 2BCRA 2IHMA 3GIKA 2QKQA 1Z19A 4KLIA 3F2BA 4B9NA 1RPLA 1X6IA 3H8SA 2OWOA 1MC8A 5CR0A 2HVHA 4KLSA 2OM6A 2PFOA 2RDJA 3RJEA 3EYZA 2NO5A 3C5FA 3GDXA 2AU0A 3PNCA 3KKAC 3AN1A 1SZPA 2QARB 1ZQLA 2LHTA 3QEBZ 4KMUA 5KFEA 3ZDDA 2NRVA 2ZJ8A 4UB2A 7ICQA 1D8BA 8ICIA 3UMCA 5KG2A 4RPYA 2DGZA 4IQWA 4R66A 1NK9A 4KX5A 4YR3A 2BCUA 4M0AA 1BNPA 2YMMA 5K4LA 9ICUA 2HBJA 4OD0A 4NLNA 2AH5A 4O5EA 1UA0A 4P4MA 2BCQA 1ZQAA 2ESEA 2ZIUA 1URJA 2AQ4A 3GQCA 4G9BA 4DFKA 5KT4A 3MBYA 9ICWA 3GFKB 4IQUA 4YG2A 4DQRA 3A0BU 1S9FA 1A76A
chains in the Genus database with same CATH topology
2LPEA 4PZOA 1SGGA 3BS5B 5JU5A 2F3NA 5J8YA 4MHVA 1F0MA 2KSOA 2EANA 1WWUA 3BS7A 1SV0A 2Y9TA 1DXSA 1RG6A 2KE7A 2L5YA 2QKQA 3IDWA 2QB0A 1PK1B 3BS5A 2EAMA 2EAPA 5KNIA 2D3DA 2GLEA 2JV3A 1B4FA 1OW5A 5L1MA 1COKA 2DKZA 3KKAC 2E8MA 2E8NA 1PK1A 3TADC 2KG5A 3SEIA 2YTUA 4NL9A 5JTIA 1X66A 4NJ8A 2QARB 1X40A 5F3XB 1LKYB 1UQVA 2D8CA 2F44A 2QB1A 2E8OA 2F8KA 1WWVA 3HILA 3TACB 1OXJA 3KKAA 1JI7A 1V38A 4IS7A 1Z1VA 1V85A 2Y9UA 4PZNA 3TADA 2QB0B 2K4PA 5J8YC 1LKYA 1X9XA 2FE9A 4RQMA 2DKXA 2ESEA 3K1RB 1SV0C 2EAOA 2KMDA 2DL0A 1B0XA 2K60A 4NL9C 1SXDA 2E8PA 3SENA 1PK3A 2KSOB 5JRTA 2KIVA 3BQ7A 1UCVA 1KW4A 1SV4A 2ES6A 3H8MA 2LMRA 2QARA 4RQNA 1SXEA 2B6GA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2LPE A;  4PZO A;  1SGG A;  3BS5 B;  5JU5 A;  2F3N A;  5J8Y A;  4MHV A;  1F0M A;  2KSO A;  2EAN A;  1WWU A;  3BS7 A;  1SV0 A;  2Y9T A;  1DXS A;  1RG6 A;  2KE7 A;  2L5Y A;  2QKQ A;  3IDW A;  2QB0 A;  1PK1 B;  3BS5 A;  2EAM A;  2EAP A;  5KNI A;  2D3D A;  2GLE A;  2JV3 A;  1B4F A;  1OW5 A;  5L1M A;  1COK A;  2DKZ A;  3KKA C;  2E8M A;  2E8N A;  1PK1 A;  3TAD C;  2KG5 A;  3SEI A;  2YTU A;  4NL9 A;  5JTI A;  1X66 A;  4NJ8 A;  2QAR B;  1X40 A;  5F3X B;  1LKY B;  1UQV A;  2D8C A;  2F44 A;  2QB1 A;  2E8O A;  2F8K A;  1WWV A;  3HIL A;  3TAC B;  1OXJ A;  3KKA A;  1JI7 A;  1V38 A;  4IS7 A;  1Z1V A;  1V85 A;  2Y9U A;  4PZN A;  3TAD A;  2QB0 B;  2K4P A;  5J8Y C;  1LKY A;  1X9X A;  2FE9 A;  4RQM A;  2DKX A;  2ESE A;  3K1R B;  1SV0 C;  2EAO A;  2KMD A;  2DL0 A;  1B0X A;  2K60 A;  4NL9 C;  1SXD A;  2E8P A;  3SEN A;  1PK3 A;  2KSO B;  5JRT A;  2KIV A;  3BQ7 A;  1UCV A;  1KW4 A;  1SV4 A;  2ES6 A;  3H8M A;  2LMR A;  2QAR A;  4RQN A;  1SXE A;  2B6G A; 
#chains in the Genus database with same CATH topology
 1SGG A;  3IG8 A;  2C22 A;  4F4K A;  2RDI A;  2K4I A;  3IRU A;  1KDH A;  3JPR A;  2ZJ5 A;  1LB2 B;  4CF4 A;  4Q8F A;  2HHT A;  3C5G A;  4KN7 A;  2BPC A;  2BDP A;  1S0O A;  3HJE A;  8ICV A;  1ZYQ A;  1ZQT A;  4JMU A;  9ICV A;  2HSZ A;  4DCC A;  4ECW A;  5GTH U;  4QW9 A;  3QXG A;  4UAS A;  4KLU A;  4F5N A;  3ISB A;  3PZP A;  4TUS A;  2WB1 C;  4QWE A;  3MR5 A;  3QZ8 A;  2H3I A;  1QLN A;  1MQ3 A;  3B0X A;  2XI9 A;  5ALI A;  5KL1 B;  5L1M A;  4DS4 A;  2XO7 A;  2I1Q A;  3A0H U;  1NNL A;  4RQ2 A;  2DFL A;  5AKL A;  5KFV A;  4YN4 A;  5KG6 A;  1DRG A;  2EZX A;  3RRH A;  5ALV A;  2NYV A;  5J2F A;  4RNN A;  5AKE A;  2JEF A;  1ZQY A;  4J9K A;  1DOQ A;  5KFT A;  4F71 A;  4I2J A;  2LBO A;  1JMS A;  1SKW A;  1ZQO A;  5AKJ A;  2YQE A;  3SAF A;  8ICA A;  4EEY A;  4Y2R A;  5AM4 A;  9ICO A;  1S97 A;  2KNJ A;  4QZB A;  4R63 A;  5KFX A;  3IP4 B;  3D2S A;  2F77 X;  1UPH A;  1X42 A;  2KIW A;  2JH1 A;  1V85 A;  4O0I A;  5DB8 A;  1TV9 A;  2F76 X;  4EX7 A;  1P7D A;  4NWI A;  3EPI A;  2W03 A;  1ZQC A;  4EX6 A;  5DDY A;  2KMD A;  2DPJ A;  4ACO A;  5J0U A;  2F8L A;  4ED7 A;  4JV1 A;  1ZXI A;  2ODG A;  5ALJ A;  5DQH A;  3SZ2 A;  2IHN A;  4DSL A;  3ZDE A;  2UVW A;  3UMG A;  4LZG A;  4YQW A;  1XSP A;  4Q8E A;  1HUZ A;  4KIT B;  2VA3 A;  2FPM A;  4OCZ A;  5G5H A;  4US8 A;  2HBM A;  1X9W A;  1ZQP A;  5ALH A;  1CEZ A;  2E3T A;  5KFW A;  4LZD A;  2AGQ A;  4FZN A;  5CHG A;  2KTQ A;  4QNL A;  1TK8 A;  4DFP A;  2Y1J A;  1T4G A;  4UB1 A;  3C1Y A;  1SKS A;  1NZP A;  1A6S A;  4M9L A;  1K1S A;  4US9 A;  1ZQW A;  4ELT A;  4BUG A;  2YB4 A;  5DQG A;  3SR6 A;  4YR2 A;  1Z1B A;  1RXW A;  4J9N A;  4Y2T A;  2VIX A;  4Y2U A;  9ICX A;  2VJ5 A;  5ALZ A;  1TVA A;  4MFA A;  3OJS A;  4I27 A;  5AI9 A;  4F2R A;  4FZL A;  4GFJ A;  1ZQM A;  4M47 A;  4J9R A;  3WK4 A;  1F44 A;  4NV0 A;  2QB1 A;  1SKR A;  3QUC A;  2KJ5 A;  1N2X A;  1L7O A;  2Q4T A;  2CPR A;  2HHV A;  2LM1 A;  3OGU A;  5KFM A;  3PML A;  1MQ2 A;  2OH2 A;  4C0Z A;  8ICR A;  4F2S A;  3PW5 A;  7ICE A;  2F2A B;  4QIW C;  4YCX A;  1SV0 C;  2M9N A;  1WUD A;  2K8B B;  4YFK A;  1TK0 A;  4K4I A;  1JXL A;  3NAS A;  1BPE A;  3BQ1 A;  2JXJ A;  2OXO A;  9ICP A;  3N7R C;  1WCN A;  2JRZ A;  3C1Z A;  1IIP A;  3N28 A;  9ICI A;  5DBB A;  2G07 A;  9ICB A;  2NRT A;  3RH6 A;  2KZ3 A;  4RQ8 A;  5KG4 A;  4PHP A;  4F3O A;  1Z3E B;  4YVZ A;  4KLE A;  1T8E A;  2A1J B;  2DUY A;  4F92 B;  3WKA A;  5AKG A;  2W04 A;  5DG7 A;  1XNS A;  2KV2 A;  3PR5 B;  4RPX A;  1KLN A;  4F50 A;  3V7L A;  1V97 A;  3MR6 A;  3PVX A;  4QW8 A;  1UA1 A;  3PX6 A;  1HJP A;  3RFA A;  3IV6 A;  4RUC A;  3NVV A;  2PI5 A;  3AQF A;  2GLE A;  3RJK A;  1XC9 A;  1S0V A;  4DQP A;  2ZIW B;  1COK A;  2KFZ A;  1KFT A;  3RBD A;  4JV2 A;  4ELV A;  2HHS A;  3S6J A;  1WG8 A;  3QU9 A;  1XSL A;  4QWD A;  5IIK A;  5C5J A;  4JV0 A;  3N97 B;  1KQQ A;  5ALF A;  1N63 A;  8ICO A;  2YMQ A;  1TE2 A;  4IRC A;  4GXJ A;  1UQV A;  3E58 A;  1CI4 A;  2K8C B;  4I2H A;  3C2M A;  2BGW A;  5KFH A;  3EPG A;  5L1L A;  7ICP A;  4C4R A;  2WHE A;  4IS7 A;  4PZN A;  3JPT A;  2HMX A;  5J8Y C;  4R8U A;  1TKD A;  5J0X A;  1ZRM A;  2W3R A;  4Q45 A;  1D9F A;  4B9V A;  7ICV A;  5J2I A;  2XIC A;  1IM4 A;  8ICC A;  4Y2Q A;  2ATL A;  5KFS A;  2E1F A;  2VJ4 A;  4C8L A;  2WAQ F;  5KAF U;  1D9D A;  2HHQ A;  5KT7 A;  1DK3 A;  4KN4 A;  5J0O A;  2ZIV A;  3V7J A;  3UMB A;  4TUQ A;  5EWG A;  3G6Y A;  4PZO A;  5JU5 A;  1S8O A;  3T79 A;  5KG1 A;  1PZN A;  4DL3 A;  4B6J A;  1BPD A;  2KP7 A;  5E79 U;  3CNH A;  3BDP A;  2KK0 A;  3LWL A;  1DK2 A;  5EE0 A;  4MF8 A;  4CGZ A;  4Y2S A;  3WK8 A;  2FLL A;  2KE7 A;  2KEY A;  2I9G A;  4Z6D A;  4YMO A;  4J9M A;  4DSK A;  4EBD A;  2FPK A;  3M9N B;  3EWA A;  4I2D A;  2D3D A;  5DG9 A;  3L5K A;  4R65 A;  4I2B A;  4R8U B;  8ICN A;  4QZ9 A;  3TAN A;  4Y2P A;  2LI6 A;  1B43 A;  1TAU A;  4YMM A;  1VJ5 A;  3SMV A;  4UAY A;  1QCK A;  4QZA A;  3SAH A;  4O3S A;  3TAD C;  2VA2 A;  3H0M B;  3H4B A;  5III A;  2UVU A;  3JPQ A;  2C2E A;  3G6X A;  4HAI A;  2YMP A;  1U49 A;  3KZX A;  4GIB A;  1IV8 A;  2MUT B;  2F1I A;  1N5W A;  4RNO A;  4DL6 A;  5KFC A;  1NK4 A;  1QQ5 A;  5KT3 A;  4QZC A;  1K5O A;  1K1Q A;  4QWC A;  4FS1 A;  4NLK A;  2WTF A;  3KD3 A;  2K89 A;  3TAC B;  4UQG A;  2KKV A;  4GXI A;  2KFN A;  2RLT A;  4PL2 A;  9ICA A;  1S0M A;  7ICU A;  2CN1 A;  3WKB A;  2W9A A;  4QWB A;  3M6K A;  2W9B B;  4PHA A;  2IOF A;  7ICJ A;  4C7Y A;  2OEH A;  2LYB A;  4DQS A;  4DFM A;  1J97 A;  3H8M A;  7ICO A;  4MEX A;  5TZV A;  3T5K A;  2J6S A;  3M1Y A;  4UB6 U;  3T5J A;  2F3N A;  4O9M A;  4M6W A;  3QNM A;  4ED0 A;  3ED5 A;  3WK9 A;  1SL1 A;  2AQ0 A;  3B9J A;  9ICN A;  2R8G A;  3EUB 2;  3GII A;  1NZB A;  2HOI A;  1RG6 A;  2L5Y A;  2RP5 A;  4RT3 A;  3ZD8 A;  2JEI A;  3GZF A;  3SAG A;  1ZOL A;  5HP4 A;  4Q44 A;  1ZQB A;  2ZTD A;  3V7K A;  5J2G A;  2NO4 A;  1COO A;  1F5S A;  2MRL A;  5ALR A;  2JZB A;  1ZQK A;  5J0R A;  4DSI A;  5A0L A;  5ALW A;  3MC1 A;  4RT2 A;  3LYS A;  3J81 j;  2HOQ A;  2YB1 A;  4QZG A;  3AEV A;  4P0P A;  2E1E A;  4B9T A;  2PMZ C;  3Q8S B;  3T5L A;  3LDA A;  5EWF A;  3ONN A;  2G0A A;  3PSF A;  2G5I B;  3KHG A;  1S0N A;  5J29 A;  4Z6C A;  4M6W B;  4J9S A;  1WWV A;  1KFS A;  2PI4 A;  5DB6 A;  2ASL A;  2BPF A;  3RJH A;  3ZDA A;  2GH1 A;  1ZET A;  1FFV A;  4UAV A;  1L8O A;  2BKE A;  1LKY A;  3MGV A;  2RQ5 A;  4RQM A;  2KHQ A;  2HI0 A;  5DDM A;  5HMM A;  2K4E A;  3H8J A;  5IIN A;  4PHE A;  4I2F A;  1ARO P;  4RU9 A;  4IQT A;  2ISP A;  3RR8 A;  5J0Y A;  2RHF A;  2KIV A;  3BQ7 A;  4I2A A;  3JPO A;  3H7I A;  4LJX A;  3ZDC A;  2WAQ C;  8ICW A;  7ICS A;  2W43 A;  1L3V A;  3AUO A;  2KZZ A;  4F5O A;  2F1J A;  3WKE A;  1NK6 A;  2IBK A;  3I76 A;  1NK8 A;  5DB9 A;  3LVV A;  2KZM A;  5J2E A;  3QU2 A;  3HRD D;  4BWM A;  4DSJ A;  5T14 A;  2KIC A;  5J0W A;  1IG6 A;  3N4M B;  2HBL A;  2GO7 A;  4JUZ A;  1ZQQ A;  9ICE A;  3PX4 A;  3KBB A;  4EEL A;  3TAQ A;  3O0F A;  2LYA A;  3GIM A;  4DWI A;  1UT8 A;  5CWR A;  4XUS A;  2PFP A;  2E8N A;  4DOA A;  2BZF A;  5KG3 A;  2Y0S C;  4DO9 A;  3V72 A;  2WF6 A;  4QZH A;  4QJF B;  5DG8 A;  4NJ8 A;  4X5V A;  5DLF A;  3H4D A;  2AHO B;  3FDS A;  4MF2 A;  3PV8 A;  2UVR A;  1T3Q A;  1U48 A;  7ICL A;  5L1K A;  2D8C A;  2F44 A;  2KD1 A;  4HYK A;  2ZUC A;  2ZIU B;  1RM6 C;  3IM1 A;  4DSF A;  3RJG A;  4P0Q A;  2M0N A;  5AHX A;  4UBC A;  3CRX A;  1V38 A;  5HR6 A;  3AU6 A;  5ALE A;  3PSP A;  2PFN A;  3Q8Q B;  8ICF A;  4NY8 A;  5KFR A;  4F5Q A;  2P35 A;  1IXR A;  3TFS A;  5ALS A;  1FO4 A;  4PJ0 U;  1XO0 A;  2K60 A;  1UCV A;  2ZTE A;  5AKY A;  4EBE A;  3DV9 A;  2WFA A;  4UB4 A;  1U45 A;  7ICN A;  1XSN A;  1TK5 A;  5BOL A;  7ICM A;  4F93 B;  1DGS A;  5AIB A;  4ZOH C;  5AM1 A;  1RZT A;  4K4H A;  1SZH A;  1NK5 A;  1FEZ A;  4DEZ A;  1JX4 A;  4IR1 A;  2W9M A;  2YN4 A;  3RF9 A;  2BQ3 A;  4P0Q B;  3AU2 A;  3BZK A;  2BDU A;  1NOM A;  1N48 A;  1KKX A;  3ORY A;  2DF4 B;  4OJ5 A;  5KG7 A;  1ZQX A;  1GO3 F;  3DDH A;  3ETL A;  4USA A;  2EH9 A;  3B0Y A;  4YD2 A;  2KVC A;  4RPZ A;  5L1I A;  4FO6 A;  4CF3 A;  3GU3 A;  3V6H A;  2A3V A;  3WKD A;  4BXO A;  2KHV A;  8ICX A;  4RQ1 A;  4G3I A;  3WK5 A;  3RR7 A;  1ZQ1 C;  5EWE A;  1X66 A;  1WCL A;  4CF5 A;  1X40 A;  5AI0 A;  4KLF A;  3PST A;  4DQQ A;  2F1H A;  1BPY A;  4OJO A;  2IA6 A;  5DBC A;  2PKE A;  2HW3 A;  4QZF A;  1N62 A;  5AKX A;  4FFD A;  1PVR A;  2E8O A;  1RXV A;  2E5S A;  4UAW A;  4NXZ A;  1J2N A;  3HIL A;  2C28 A;  3ISD A;  1A0P A;  3KKA A;  2DWQ A;  4F5R A;  3KFU F;  5HR7 A;  1BNO A;  1ZQE A;  1SWV A;  3ZI4 A;  4QWA A;  3FM9 A;  8ICL A;  5KG5 A;  4DF4 A;  3WU2 U;  1SWW A;  4C4T A;  3I28 A;  1FIQ A;  2JGA A;  2H3Q A;  1Y88 A;  4J9L A;  3SD7 A;  3ISC A;  1L5U A;  2VAN A;  2WF5 A;  3OHB A;  5AI5 A;  2LMR A;  3PR4 A;  2AGP A;  3D2N A;  1XU4 A;  4BXO B;  7ICI A;  3M8R A;  2IOH A;  5ALD A;  3AM9 A;  1KRP A;  2XC9 A;  4QZE A;  1Z4N A;  4UB5 A;  2HDO A;  3C28 A;  4DL7 A;  5EE1 A;  1JXE A;  4O5K A;  3GIL A;  4DOB A;  4UAT A;  2AJQ A;  3H0R B;  5AKZ A;  3SYZ A;  1M6Y A;  3MDC A;  4KLH A;  3BS5 A;  4ICA A;  5DBA A;  2ASD A;  4O5C A;  3WK6 A;  1ZD3 A;  4MEY A;  3HPO A;  5AI8 A;  4IRD A;  1B4F A;  3MGI A;  4Z6E A;  2FMP A;  3MGH A;  4Y2X A;  2FLN A;  1U9L A;  3HW8 A;  4Y2Y A;  3WKC A;  4M9J A;  1PK1 A;  2D6F C;  1S10 A;  1PUZ A;  8ICS A;  3QEA Z;  4DLG A;  4U7C A;  1N61 A;  3C21 A;  2W7O A;  3THV A;  2ZXH A;  2ZIX A;  4ECR A;  7ICG A;  5HNK A;  5KFJ A;  4RQ4 A;  4EZ6 A;  8ICT A;  4F5P A;  5EE9 A;  2F8K A;  5DKW A;  2V4Q A;  5DLG A;  3C2L A;  2HHU A;  1ZRN A;  8ICY A;  5AK6 A;  5CRX A;  1BPB A;  1ZQZ A;  4FBU A;  4I28 A;  3NRZ A;  4NLC A;  5ALP A;  3HP6 A;  2DKX A;  4ECV A;  3QUB A;  1KFD A;  1J2M A;  2EZZ A;  1Q3V A;  2GWS A;  3OJU A;  3F2C A;  1UT5 A;  2KVS A;  1PK3 A;  5J0Q A;  1QSY A;  3QZ7 A;  7ICF A;  9ICK A;  4UW9 A;  2FJ6 A;  2LKY A;  2HOF A;  4M9N A;  3NRW A;  5TIS U;  5KFZ A;  3Q8K A;  1HUO A;  3PY8 A;  4ECS A;  4Z6F A;  1QTM A;  2Q0Z X;  9ICG A;  3MAB A;  3UQ2 A;  2H3Z A;  3NTU A;  1JRP A;  3T3F A;  4B9U A;  3D2Q A;  2W9C A;  3C29 A;  8ICB A;  4DOC A;  3HKZ F;  4M9G A;  5J0P A;  5J2A A;  1PVQ A;  1N5X A;  2V9W A;  1N60 A;  2MAX A;  4A8E A;  1L7N A;  3ZDB A;  3OPX A;  3BJY A;  3RAX A;  3SI8 A;  3M6Z A;  1L3S A;  3VC8 A;  5AM3 A;  4O3O A;  3EW9 A;  4DFJ A;  3NUQ A;  3BZC A;  3HWT A;  3LK9 A;  1WYG A;  5CJ7 A;  5G5G A;  4WJ3 B;  8ICG A;  5KTQ A;  5J2J A;  2WF7 A;  3OSN A;  2R8H A;  4YP3 A;  4C7Z A;  3LWM A;  3KTQ A;  5F3X B;  5CB1 A;  2HHX A;  1MN8 A;  4EBC A;  5KFU A;  3ZD9 A;  2BCV A;  3UQ0 A;  3CYM A;  4DL5 A;  4C8O A;  3UXP A;  4KTQ A;  3RRG A;  2G5H B;  4K4G A;  3IG5 A;  2AXT U;  1ZQD A;  5H2F U;  2N1R A;  4NLG A;  2W9C B;  4OJP A;  2VA8 A;  3MR2 A;  3FC4 A;  2W8K A;  2BPG A;  3EZ5 A;  1VLB A;  2ZIV B;  3M9M B;  5AKK A;  3K1R B;  4PGQ A;  3RB3 A;  5ALQ A;  3L3F X;  4AYB F;  4YD1 A;  2EAO A;  4FBT A;  3UM9 A;  4J9O A;  3MDA A;  1KEJ A;  1SV4 A;  4UB3 A;  5KFD A;  5KFL A;  3GIJ A;  4OJ6 A;  2J6T A;  3Q8P B;  1SXE A;  1U47 A;  1D8Y A;  2KKP A;  4ECQ A;  2MU2 A;  5J2H A;  3BQ2 A;  2BQR A;  2H5X A;  2KSO A;  4KLO A;  1SV0 A;  3K4G A;  2KOB A;  5EOZ A;  1L8L A;  4O3R A;  3LVW A;  2CRX A;  3IHQ B;  4OO1 J;  1RQN A;  2W11 A;  5D46 A;  1UHU A;  3K75 D;  1RQL A;  4C80 A;  5DGB A;  1T3N A;  2G09 A;  2ZTC A;  3NVW A;  4CE6 A;  1T94 A;  1ZQR A;  2E8M A;  2WF9 A;  4GLX A;  4XRH A;  1AQ6 A;  2IOF K;  2YTU A;  4NL9 A;  5JTI A;  5CEH A;  2KJ9 A;  1U4B A;  2ASJ A;  1LVH A;  1SB3 C;  4PPX A;  1QQ7 A;  1L3U A;  5AK4 A;  5EE3 A;  3PX0 A;  4BDP A;  2G08 A;  4RQ6 A;  2W3S A;  4YXJ A;  1NJW A;  3F2D A;  3RB0 A;  4M2Y A;  4JK1 A;  5HHH A;  5CA7 A;  5KFG A;  1JN3 A;  4BWJ A;  1SL0 A;  4ED2 A;  5KFA A;  5KT5 A;  3NGD A;  4DFD A;  3M7D A;  3NS1 A;  4PH5 A;  1NKE A;  8ICP A;  4FE3 A;  5IIM A;  1VDV A;  4GC6 A;  3QE9 Y;  1NJX A;  4DSE A;  1Z4O A;  3R9K A;  2FMS A;  1KW4 A;  5J2K A;  2K8A A;  1N56 A;  3D6J A;  9ICT A;  3FYH A;  5ALN A;  9ICR A;  5ALX A;  2ZUB A;  3CW2 C;  5GTI U;  4F91 B;  1O03 A;  5J8Y A;  4QZI A;  4O3Q A;  5DB7 A;  2JZB B;  4F4X A;  1KSP A;  4PL1 A;  4ECY A;  2OYY A;  1NK0 A;  5KT6 A;  2EZY A;  4M04 A;  1ZQI A;  3JPP A;  2QB0 A;  4YR0 A;  1ZQU A;  3Q8L A;  3HKZ C;  3QX7 A;  4QZ8 A;  4P0P B;  4ED3 A;  5IIO A;  3KOO A;  2K4H A;  5KFQ A;  1C20 A;  1ZQH A;  1ZQS A;  5D49 A;  1B22 A;  3AQE A;  1NKC A;  2J6U A;  1KN5 A;  2HBK A;  5BOM A;  3TAR A;  5J0S A;  2R8J A;  2Y1I A;  3OHA A;  4F4W A;  4TUP A;  4B9S A;  3VCB A;  1L6N A;  3TI0 A;  8ICZ A;  4QIW F;  3H0L B;  5J2D A;  4F72 A;  5ALK A;  2R8I A;  1LKY B;  3M9O B;  4EYI B;  1KL9 A;  2YX8 A;  2NRZ A;  2ISO A;  4EEK A;  3SV3 A;  4RQ5 A;  1KTQ A;  4CRX A;  3FAH A;  2FLP A;  4Y2V A;  4JWM A;  1MSW D;  4J9P A;  1JI7 A;  5L9X A;  2Y9U A;  3TAD A;  4P2H A;  8ICH A;  2QB0 B;  5B66 U;  1YT3 A;  1OUQ A;  4UAZ A;  3Q8R B;  4KLM A;  1S5L U;  4PGX A;  1NK7 A;  8ICQ A;  2A19 A;  3RB4 A;  3RJJ A;  2JHD A;  5KFN A;  4AYB C;  1S77 D;  4ECT A;  2B0C A;  2AGO A;  1B0X A;  3QUQ A;  2E8P A;  3JPN A;  2NV3 A;  4UBB A;  3NVZ A;  1ZQF A;  3RJI A;  4IC9 A;  4KX3 A;  2BHN A;  1BPZ A;  1RYS A;  2JMG A;  2LPE A;  2EQY A;  4B9L A;  4PGY A;  4FZM A;  2FDR A;  1RYU A;  3PW0 A;  4Q43 A;  3G6V A;  3UXO A;  3PW4 A;  3BS7 A;  4UAU A;  1Q8K A;  2UVV A;  2XCA A;  3IDW A;  1ZQN A;  9ICH A;  5ALT A;  4ZH4 A;  5KFB A;  4P4P A;  2EAP A;  5KNI A;  4C4S A;  1YZ7 A;  3NVY A;  2JV3 A;  2XID A;  9ICS A;  1JRO A;  8ICJ A;  1EXN A;  3PSI A;  1NJZ A;  2DKZ A;  4BJQ A;  4B9M A;  3DEE A;  1O08 A;  3C2K A;  1V9P A;  2JEJ A;  5DGA A;  1ZD2 P;  3E2E A;  4O3M A;  3RB6 A;  4JWN A;  3SQI A;  4IRK A;  1X2I A;  1BVS A;  5AK5 A;  5J2B A;  2ZG6 A;  5ALU A;  5AKH A;  4RNM A;  4C8K A;  1HIW A;  2OHF A;  5F9L A;  4MFF A;  4Y2J A;  5B5E U;  2A1A A;  4TQS A;  2ZXI A;  5AIA A;  1RYR A;  1X9X A;  2FE9 A;  2KN7 A;  3MR3 A;  3HX0 A;  2BR0 A;  5JRT A;  1ZD4 A;  1L7P A;  4RQN A;  1S76 D;  1QH9 A;  1L7M A;  3V6K A;  3PO5 A;  2NRX A;  2P6R A;  2R8K A;  3QYP A;  3TFR A;  5FP0 A;  9ICL A;  5AM2 A;  2I6X A;  4I2G A;  3QU5 A;  4KMO B;  5L1J A;  1HEK A;  2Y9T A;  4P4O A;  2LYH A;  4EZ9 A;  4IQV A;  3PW7 A;  2C2R A;  3ALR A;  5KAI U;  2EAM A;  4NM2 A;  4E0D A;  4YXM A;  3F5A A;  4J03 A;  1ECW A;  2W55 A;  2O6K A;  5AIC A;  4RUA A;  3RH5 A;  2A1J A;  2LM4 A;  4UB8 U;  3TQ1 A;  4CDG A;  1PVP A;  2BQU A;  1FFU A;  1SL2 A;  1TAQ A;  2RRD A;  2HHW A;  3SEI A;  3GV5 B;  2R18 A;  4DLE A;  1TAM A;  3N7S C;  4UAR A;  4O3P A;  2W54 A;  3QU4 A;  5KFP A;  3PO4 A;  4C8M A;  4RZR A;  4F4Y A;  3C23 A;  2ZIW A;  2XGP A;  4DQI A;  3GV8 B;  4ED1 A;  5ALG A;  5BPC A;  1XWL A;  3TKA A;  1X9M A;  4M9H A;  4ECX A;  2NRW A;  1OXJ A;  5IIL A;  4JB3 A;  1QSL A;  8ICE A;  4FS2 A;  2K4P A;  2JR5 A;  2FPL A;  3H8W A;  4XA5 A;  5AI6 A;  8ICM A;  2DL0 A;  2MSN A;  2W8L A;  4NL9 C;  3SEN A;  1TFR A;  4EYH B;  2HCF A;  4BGD A;  5AKI A;  4KLL A;  3OTQ A;  1X6J A;  2W7P A;  4PHD A;  3AL0 B;  3BQT A;  4NLB A;  2JEG A;  2EDU A;  4EEN A;  5J2C A;  2JH7 A;  3L4P A;  3BS5 B;  5KFI A;  1A77 A;  2KJ8 A;  2MA1 A;  5CP2 A;  3RAQ A;  1ZQG A;  2IMW P;  4ED6 A;  3OSP A;  3RBE A;  2EAN A;  5KFY A;  5KG0 A;  1LV5 A;  3HT3 A;  2PFQ A;  2PMZ F;  5J0T A;  1DGJ A;  3U26 A;  1PK1 B;  2BCS A;  4AP9 A;  4O3N A;  2FI1 A;  2B21 A;  2H3F A;  1CRX A;  3MFH A;  4I29 A;  2ZIX B;  1OW5 A;  2XCP A;  3SV4 A;  5KFK A;  9ICJ A;  2ZUD A;  4CCH A;  4ED8 A;  3F53 A;  1C7Y A;  3KHL A;  3ETR A;  4DS5 A;  2GOL A;  8ICK A;  1ZQV A;  4F4Z A;  2V4R A;  3K1Z A;  3RTV A;  2H3V A;  5F9N A;  3KHH A;  9ICQ A;  5HML A;  1RDF A;  4DF8 A;  1X9S A;  4I2I A;  5D4B A;  4NLZ A;  3M8S A;  3RH4 A;  4ELU A;  3F5E A;  3RJF A;  2ALZ A;  4KLG A;  4KLT A;  8ICU A;  4GXK A;  3BQ0 A;  3PW2 A;  3KHR A;  4C8N A;  1Z1V A;  3UXN A;  2MUT A;  4IL6 U;  4F8R A;  4RQ7 A;  4KLJ A;  7ICH A;  5KFF A;  3IN5 A;  5ALO A;  1QSS A;  1QQ6 A;  3PMN A;  2XY7 A;  4XQ8 A;  3QU7 A;  3CP8 A;  2P66 A;  5AM5 A;  3TAP A;  4IR9 A;  2XY5 A;  2ES6 A;  2G06 A;  4ECZ A;  1Z00 A;  2YY6 A;  5ALL A;  4OJL A;  4DL2 A;  2B6G A;  1T7P A;  1Q46 A;  3UPQ A;  2FMQ A;  2DPI A;  2WF8 A;  1YZ6 A;  4LVS A;  2W9B A;  1H38 A;  2C2D A;  5KL8 B;  4YMN A;  2XY6 A;  4QZD A;  1JAL A;  1NKB A;  1DXS A;  2Y0S F;  1ZQJ A;  4R64 A;  2HVI A;  2P6U A;  5AI4 A;  1JUD A;  3ICX A;  3MFI A;  7ICR A;  7ICK A;  2WB1 F;  1L3T A;  5HHI A;  4CNQ A;  9ICF A;  3JPS A;  2CXY A;  3AMZ A;  4ECU A;  4KLD A;  4U6P A;  2I5H A;  5ALY A;  4J9Q A;  5AM0 A;  2DQN B;  9ICC A;  2KG5 A;  4MFC A;  2PXI A;  1BGX T;  2YML A;  5DQI A;  1SIJ A;  1Z00 B;  1BPX A;  1D8L A;  5IIJ A;  4I2C A;  1ZJM A;  3T5H A;  9ICM A;  7ICT A;  4RQ3 A;  5JUM A;  3WK7 A;  3KZI U;  5AK3 A;  1NI3 A;  4GC7 A;  1NJY A;  2Z7J A;  5KFO A;  1CUK A;  4RQ0 A;  3Q8M A;  2OCE A;  3I1Y A;  1ZD5 A;  4TUR A;  1XO1 A;  1Q3U A;  1JIH A;  4NM1 A;  4I2E A;  1SXD A;  1ED1 A;  4TQR A;  2KSO B;  4DL4 A;  5C0Y A;  3GV7 B;  2XGQ A;  2QAR A;  3H40 A;  2QLT A;  3N7P D;  2DBY A;  3E0F A;  4BX9 C;  1MA7 A;  3QUT A;  4MHV A;  1F0M A;  1XS9 D;  3V6J A;  4KLQ A;  1WWU A;  2XVT A;  2ZJA A;  5ALM A;  5KT2 A;  1KBU A;  2VKQ A;  1ZJN A;  2BCR A;  2IHM A;  3GIK A;  2QKQ A;  1Z19 A;  4KLI A;  3F2B A;  4B9N A;  1RPL A;  1X6I A;  3H8S A;  2OWO A;  1MC8 A;  5CR0 A;  2HVH A;  4KLS A;  2OM6 A;  2PFO A;  2RDJ A;  3RJE A;  3EYZ A;  2NO5 A;  3C5F A;  3GDX A;  2AU0 A;  3PNC A;  3KKA C;  3AN1 A;  1SZP A;  2QAR B;  1ZQL A;  2LHT A;  3QEB Z;  4KMU A;  5KFE A;  3ZDD A;  2NRV A;  2ZJ8 A;  4UB2 A;  7ICQ A;  1D8B A;  8ICI A;  3UMC A;  5KG2 A;  4RPY A;  2DGZ A;  4IQW A;  4R66 A;  1NK9 A;  4KX5 A;  4YR3 A;  2BCU A;  4M0A A;  1BNP A;  2YMM A;  5K4L A;  9ICU A;  2HBJ A;  4OD0 A;  4NLN A;  2AH5 A;  4O5E A;  1UA0 A;  4P4M A;  2BCQ A;  1ZQA A;  2ESE A;  2ZIU A;  1URJ A;  2AQ4 A;  3GQC A;  4G9B A;  4DFK A;  5KT4 A;  3MBY A;  9ICW A;  3GFK B;  4IQU A;  4YG2 A;  4DQR A;  3A0B U;  1S9F A;  1A76 A; 
#chains in the Genus database with same CATH homology
 2LPE A;  4PZO A;  1SGG A;  3BS5 B;  5JU5 A;  2F3N A;  5J8Y A;  4MHV A;  1F0M A;  2KSO A;  2EAN A;  1WWU A;  3BS7 A;  1SV0 A;  2Y9T A;  1DXS A;  1RG6 A;  2KE7 A;  2L5Y A;  2QKQ A;  3IDW A;  2QB0 A;  1PK1 B;  3BS5 A;  2EAM A;  2EAP A;  5KNI A;  2D3D A;  2GLE A;  2JV3 A;  1B4F A;  1OW5 A;  5L1M A;  1COK A;  2DKZ A;  3KKA C;  2E8M A;  2E8N A;  1PK1 A;  3TAD C;  2KG5 A;  3SEI A;  2YTU A;  4NL9 A;  5JTI A;  1X66 A;  4NJ8 A;  2QAR B;  1X40 A;  5F3X B;  1LKY B;  1UQV A;  2D8C A;  2F44 A;  2QB1 A;  2E8O A;  2F8K A;  1WWV A;  3HIL A;  3TAC B;  1OXJ A;  3KKA A;  1JI7 A;  1V38 A;  4IS7 A;  1Z1V A;  1V85 A;  2Y9U A;  4PZN A;  3TAD A;  2QB0 B;  2K4P A;  5J8Y C;  1LKY A;  1X9X A;  2FE9 A;  4RQM A;  2DKX A;  2ESE A;  3K1R B;  1SV0 C;  2EAO A;  2KMD A;  2DL0 A;  1B0X A;  2K60 A;  4NL9 C;  1SXD A;  2E8P A;  3SEN A;  1PK3 A;  2KSO B;  5JRT A;  2KIV A;  3BQ7 A;  1UCV A;  1KW4 A;  1SV4 A;  2ES6 A;  3H8M A;  2LMR A;  2QAR A;  4RQN A;  1SXE A;  2B6G A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...