2MUTA

Solution structure of the f231l mutant ercc1-xpf dimerization region
Total Genus 27
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
27
sequence length
96
structure length
96
Chain Sequence
RIRRRYNMADLLMEKLEQDLVSRVTECLTTVKSVNKTDSQTLLTTFGSLEQLIAASREDLALCPGLGPQKARRLFDVLHEPFLKVPGGLEHHHHHH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords DNA excision repair protein ERCC-1
publication title The Cerebro-oculo-facio-skeletal Syndrome Point Mutation F231L in the ERCC1 DNA Repair Protein Causes Dissociation of the ERCC1-XPF Complex.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase
total genus 27
structure length 96
sequence length 96
ec nomenclature
pdb deposition date 2014-09-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00633 HHH Helix-hairpin-helix motif
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.20 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 5' to 3' exonuclease, C-terminal subdomain 2mutA00
5JUMA 4RQ2A 4O5KA 4ECYA 3LDAA 2BQ3A 5DDMA 1U49A 2VA3A 8ICVA 3GIKA 4TUSA 3TANA 4M9HA 3RB4A 4O3OA 9ICVA 2XY7A 3G6VA 1NK9A 3RJJA 3OHAA 1XC9A 1ZQFA 4DSKA 9ICNA 1L3SA 7ICJA 3BJYA 2ZTEA 3T3FA 3GIIA 2UVVA 1ZQBA 3PO5A 7ICPA 1SKWA 2AQ0A 2RDJA 8ICTA 3EW9A 4NY8A 2HHSA 5HP4A 3RH6A 1JMSA 1UA1A 4F8RA 4PHAA 4ECXA 2F1JA 4NLKA 4CCHA 4RPZA 5KT2A 4O0IA 1RZTA 1BPYA 3HW8A 5KFEA 4EBDA 4BWMA 7ICFA 5DG7A 1NJWA 5KG5A 5KTQA 4ED0A 1WCLA 4F5RA 5IIIA 5CP2A 4NM2A 5CA7A 3V7KA 1XSLA 3ETLA 4QWBA 4JK1A 4IQUA 4ECZA 4O5CA 3PMNA 4IQVA 2BCQA 4F93B 1N48A 4I28A 4PH5A 1KFDA 4DS5A 3JPPA 2B21A 4LZDA 4GLXA 3TARA 1ZJMA 1XS9D 4F4KA 5L1KA 2C2EA 2WTFA 3UQ0A 4DQPA 5KG1A 2JZBB 4KITB 3GFKB 4JWNA 4RQ5A 4QZGA 2V4QA 1U45A 1NJZA 1TK8A 2FLPA 1V9PA 4RT3A 3OSPA 3ZDBA 1XO1A 3IM1A 4DL7A 5DLGA 3QE9Y 1ZQCA 4I2BA 4FBTA 4F3OA 1KLNA 4YD2A 5J0TA 2ISOA 2AU0A 5KT7A 3MGHA 3H4DA 4GXKA 3AU6A 9ICGA 4PGYA 5J0RA 4PHPA 5HNKA 4RZRA 4QZDA 4RQ8A 4P4PA 4RUCA 1ZYQA 9ICIA 1COOA 4GXIA 2AGOA 4KLEA 4I2IA 2NRZA 3Q8QB 1TKDA 4DO9A 8ICQA 1X9SA 2PFQA 3RR7A 3T5HA 4TUQA 2BQUA 3Q8LA 1NKEA 4EEYA 5KFRA 4UAZA 4IQTA 5KG6A 4RT2A 4UBCA 2V9WA 1UT8A 1BPZA 3FDSA 3C1ZA 1QLNA 4UAWA 1LB2B 4O5EA 4ECUA 1N56A 4I2FA 4K4GA 4DSFA 4J9LA 4B9LA 4M2YA 4DSEA 4UQGA 8ICKA 5KFIA 8ICEA 3FYHA 9ICCA 2Y1JA 1H38A 4J9PA 3GILA 1JX4A 2RDIA 4YR3A 4Q45A 9ICMA 2BQRA 3HPOA 3UXNA 5KFDA 3SYZA 1SL1A 3HX0A 5KFMA 4J9SA 5DB8A 4B9MA 3EPGA 2MUTA 2I9GA 8ICJA 5J0UA 1ZQWA 5J2KA 1KRPA 3KTQA 3RJKA 4DL4A 1NK5A 1ZQDA 1Z00A 1S76D 2XCAA 3V72A 3Q8PB 4TUPA 3Q8RB 4Q43A 4ED3A 4EZ6A 1SL2A 5KFUA 5KG4A 5D49A 4QZIA 2XGPA 2HHUA 4I2JA 3M9OB 2ZJ5A 5F9LA 1IM4A 5KFBA 3RJHA 4DQQA 4E0DA 3JPNA 9ICRA 2VANA 5DBCA 3V6JA 2NRVA 2KZMA 2FPMA 5KFJA 4PGQA 1ZQHA 4M9GA 2DPJA 1NK0A 1ZQOA 1Z3EB 4IRCA 4FO6A 1ZQKA 3PY8A 3ORYA 3RB6A 1TAQA 5KFXA 5KFLA 5J0YA 1ZQEA 2HVIA 5J2IA 5KFKA 3MDCA 5DKWA 1SL0A 4J9NA 3MFHA 2BR0A 4ECSA 1U47A 1D8LA 1ZQRA 1D9DA 4I2EA 3H8SA 4KLHA 1ZQYA 1BPDA 4Q44A 3Q8KA 4QZCA 4RQ7A 5KFVA 4DEZA 4YN4A 2JEFA 1ZQXA 4ECRA 4KLJA 4PGXA 5CWRA 3GV5B 4Z6DA 5IILA 2KN7A 1KEJA 4RQ1A 5L1JA 2PI5A 8ICBA 1BGXT 5KFNA 2W9CA 1QTMA 4MFCA 2IHMA 2Q0ZX 4FBUA 4I2DA 4RQ3A 2BPFA 3SI8A 1T4GA 5J2AA 4DL3A 1TK5A 4TURA 4F92B 4DOAA 2IMWP 8ICUA 2I1QA 4QW8A 4YMNA 3RJFA 2KFZA 3NGDA 7ICKA 1JN3A 4B9VA 3QEAZ 4O3QA 4QWAA 5DLFA 4UB4A 4EYHB 4R66A 5KFQA 3C2LA 4JV1A 8ICHA 3K4GA 5L1IA 3BQTA 3G6YA 4I2AA 2ASDA 4Q8FA 4F4ZA 5D4BA 5KG7A 5J0OA 4MF8A 2J6UA 2J6SA 4I2GA 1ZQVA 5J2EA 9ICLA 3UQ2A 4JWMA 1TVAA 3MR5A 5DQGA 2MUTB 2HVHA 9ICTA 3GDXA 3V7LA 4ECWA 4Z6FA 7ICRA 5J2GA 2BKEA 1XU4A 3M8RA 4QZAA 3IHQB 5DQHA 1Z00B 1RXVA 4QWDA 4YMOA 3PW2A 1ZQSA 5J29A 5J2BA 2PFPA 1WCNA 5KFAA 4YR2A 4F50A 4KTQA 2ZTCA 1ZQZA 1KTQA 5DG9A 4F4YA 1B22A 2BCSA 5KFTA 4IQWA 7ICVA 4DWIA 4C8KA 4M0AA 1ZQNA 8ICYA 8ICMA 2HHVA 5KT6A 3HP6A 3MR3A 2IA6A 3RTVA 4G3IA 2KZZA 4UB5A 2HW3A 4Z6EA 4UB1A 4F4WA 5CB1A 1NK7A 5J2JA 4ED8A 1T7PA 3EPIA 4DQRA 1T3NA 4KMUA 4ELVA 2ZUBA 3GIJA 9ICSA 5HHIA 5IIOA 3PMLA 4BXOB 3RAQA 3Q8MA 5KFGA 2C2RA 2OWOA 3C1YA 3V6KA 5DGBA 2W8KA 4YR0A 5BPCA 3PW7A 4NLGA 5DBAA 3M8SA 4K4IA 3MBYA 4DLEA 3T5JA 4NLZA 2KFNA 7ICTA 1L3VA 1ZQMA 2FLNA 4Z6CA 1SKSA 1XSNA 5C5JA 2FMPA 3MABA 4R8UA 3RB3A 3E2EA 2ALZA 3LK9A 9ICQA 4RPXA 9ICPA 1S10A 5KFOA 5DBBA 4YMMA 1KFSA 3H8JA 3ZDEA 4UB3A 4I2HA 4F4XA 3AUOA 3AU2A 4M6WA 4F91B 3JPOA 1Y88A 4B9NA 4J9RA 5KT5A 4R65A 8ICAA 2XC9A 2FLLA 2W9CB 1S9FA 1RYSA 7ICGA 4QZEA 1DOQA 4I27A 4QZBA 3SV3A 7ICLA 4BDPA 3OGUA 3ZD8A 5KG0A 4ELTA 4EBEA 4DOBA 4DSJA 3RAXA 4RPYA 4MFAA 2ATLA 5KFYA 3RJIA 1QSSA 2BHNA 3PR5B 5J2CA 4KLSA 3TAQA 5EWEA 4DL2A 1ZQTA 5J0SA 3ZDAA 3C23A 4K4HA 1DGSA 8ICGA 4HYKA 2GWSA 2F1IA 3PO4A 4J9QA 1NJXA 1ZQPA 4I2CA 4F2SA 4QZFA 5KG2A 4QZHA 3MGIA 3B0YA 4KN7A 4B9TA 3H7IA 3V6HA 1C7YA 3PV8A 7ICUA 4O9MA 9ICUA 4KLMA 4O3SA 2KTQA 4MFFA 4TQSA 5L1LA 4JUZA 4QZ8A 2XO7A 2BCUA 1ZQAA 5J2DA 4YVZA 7ICOA 3JPTA 1AROP 3NTUA 4ED7A 9ICJA 1MSWD 2BPCA 4NM1A 4YD1A 3MR2A 1CUKA 3N4MB 4RNMA 2XY5A 2W9MA 3BQ0A 4KLOA 8ICRA 4DLGA 5BOLA 4DSLA 5KFSA 3G6XA 5J0PA 1U9LA 2W8LA 4YXJA 4KLLA 4P2HA 2MAXA 4BWJA 5CHGA 4EBCA 2BPGA 1HUZA 3ZDCA 4C8LA 4LVSA 9ICAA 2FPKA 2HHWA 3C2KA 5J0QA 4DFKA 4TQRA 4XUSA 3SV4A 1TAUA 3TFSA 3OHBA 4C8NA 1X9MA 2JZBA 4UB2A 9ICOA 1RPLA 5TZVA 2C2DA 3QEBZ 2R8HA 4RQ6A 3JPSA 4J9OA 7ICQA 1S0VA 2ZTDA 3ISCA 8ICSA 4R8UB 3RBEA 1XSPA 5EOZA 3EWAA 9ICBA 2ASJA 4MEXA 9ICXA 4EZ9A 3RRHA 5KFFA 3PW5A 3PW4A 4RNNA 3PX0A 4M6WB 4IR9A 3RRGA 8ICOA 3T5KA 3C21A 4RQ0A 4RQ4A 2ZJ8A 3M9NB 3N97B 1U48A 1HUOA 5HMLA 1TFRA 5KFHA 5J2HA 4ECVA 1D8YA 5DB7A 3V7JA 2PI4A 3PR4A 3M9MB 3H8WA 4F5QA 4DQIA 2NRXA 4KLUA 8ICZA 2Y1IA 1JIHA 1MC8A 1NJYA 1KDHA 4JV2A 2C28A 4F5NA 8ICFA 5J2FA 5EWFA 5KFPA 4FS1A 2R8KA 1BVSA 3MFIA 2LYHA 2XCPA 4ED1A 3LWMA 1T8EA 3RJGA 3EZ5A 2V4RA 4YFKA 2JEIA 1A77A 1UA0A 2KZ3A 5KT3A 7ICMA 4NXZA 3T5LA 3OJUA 5KFCA 1TK0A 4DSIA 3EYZA 1JXEA 4RUAA 4DF8A 3RJEA 4XA5A 1L3TA 1EXNA 2NRWA 2ZJAA 4QWEA 2ISPA 4DQSA 1RYRA 4F2RA 4KLIA 1BPXA 1BPBA 2M9NA 4O3NA 4YQWA 3MR6A 1CEZA 3KHLA 5HMMA 3Q8SB 4IR1A 3C2MA 2P66A 2A1JA 3HWTA 1NKBA 3MDAA 1QSLA 8ICCA 2UVUA 4PPXA 4B9UA 5DDYA 2H5XA 4O3PA 4DFJA 3RBDA 2IHNA 5J0WA 2PXIA 3TFRA 9ICFA 2VA2A 4XRHA 4NLNA 4X5VA 2HHQA 4ZH4A 4KLFA 5EWGA 2DFLA 4ED2A 4F5OA 4GC7A 4DL5A 1MQ2A 2BCRA 1NK6A 1L3UA 2PFNA 1BPEA 7ICNA 3PX6A 3GQCA 3PVXA 4R64A 1SZPA 3RH5A 5D46A 1ZJNA 4J9MA 2AGPA 1SKRA 3ISDA 3JPQA 2FPLA 4KLTA 5DQIA 7ICEA 4YP3A 3H40A 2JEGA 4KLGA 3OSNA 2W9BA 4P4MA 1XWLA 4BGDA 3TQ1A 1NK4A 1MQ3A 4KLDA 2HHXA 4KN4A 5KG3A 2W9AA 3ZD9A 3RB0A 5KFWA 3SZ2A 1S0OA 8ICLA 9ICWA 8ICPA 5J0XA 2PFOA 4IRDA 4Q8EA 1L5UA 8ICIA 4O3RA 3BDPA 5F9NA 3KHHA 2XY6A 1LV5A 3OJSA 7ICIA 4LZGA 2VA8A 4YCXA 1X9WA 4QW9A 1K1QA 5CR0A 4UAYA 2UVRA 3H4BA 3C5GA 4DL6A 4PHEA 4DFPA 4GXJA 4I29A 3PW0A 1ZQIA 4QZ9A 4MEYA 4DOCA 4UBBA 1RXWA 1X2IA 9ICEA 2F1HA 1KFTA 1TV9A 1QSYA 2UVWA 4ELUA 1IXRA 5HHHA 3RR8A 3RH4A 2BCVA 1ZQUA 3HT3A 2C22A 1U4BA 1S0NA 3UXPA 1PZNA 4KLQA 5CJ7A 3KHRA 4ECTA 4ED6A 1KSPA 4B9SA 2R8GA 3GV8B 1B43A 3KHGA 2P6RA 3ZDDA 2J6TA 7ICHA 8ICNA 2FMSA 4GC6A 1NOMA 4JV0A 5DG8A 3JPRA 3TI0A 5L9XA 7ICSA 2P6UA 4MF2A 1S77D 3BQ1A 3TAPA 1S97A 4RU9A 2BGWA 5BOMA 3GIMA 4DS4A 3LWLA 2A1JB 4DFMA 4RNOA 4QWCA 4P4OA 5DB9A 2JEJA 2IBKA 1A76A 2ZUDA 4PHDA 4C8OA 3QZ8A 5IIKA 3B0XA 5IIJA 5DGAA 3UPQA 5DB6A 1NK8A 1ZQLA 1NKCA 3K75D 9ICHA 1JXLA 2ZUCA 9ICKA 8ICXA 4M04A 2AGQA 3ISBA 1UT5A 3BQ2A 5IIMA 4IRKA 2ASLA 3C5FA 4C8MA 1ZQGA 1D9FA 5KT4A 4DF4A 3THVA 2FMQA 4BXOA 2HHTA 3GV7B 4EYIB 1ZQQA 4XQ8A 4M9LA 4J9KA 4F5PA 5KFZA 3PX4A 1ZQJA 2W9BB 2XGQA 2R8JA 1K1SA 4M9JA 2R8IA 2AJQA 8ICWA 4YXMA 4R63A 2AQ4A 1ZETA 2DPIA 5IINA 1HJPA 4FS2A 2BDPA 3QZ7A 4M9NA 3UXOA 1S0MA 2NRTA 4ECQA 4M47A 3PNCA 4YG2A
chains in the Genus database with same CATH superfamily
4O5KA 3LDAA 2VA3A 2VIXA 4EX7A 3AEVA 3RJJA 2JHDA 3LVVA 2AQ0A 3EW9A 1ED1A 1UA1A 4ECXA 4C7YA 5ALSA 3NASA 5KFEA 1GO3F 1WCLA 5ALFA 5GTHU 5AM0A 1N48A 5ALLA 1L7OA 3JPPA 2B21A 4F4KA 1JRPA 2ZG6A 5ALRA 3F53A 3UQ0A 4DQPA 1NJZA 3OSPA 3ZDBA 3IM1A 1ZQCA 3QE9Y 4FBTA 2GO7A 3RF9A 2DGZA 5J0TA 2ISOA 9ICGA 3VCBA 4RQ8A 5AM5A 4RUCA 2AGOA 2VJ4A 2KJ9A 8ICQA 2ZIUA 2D8CA 3O0FA 2BQUA 3N28A 4IQTA 1X6JA 5AKZA 1BPZA 2WF8A 3FDSA 1QLNA 3UMCA 4J9LA 4DSEA 2L5YA 2G06A 8ICKA 2RHFA 3FYHA 9ICCA 3CW2C 1H38A 3GILA 4Q45A 3HPOA 2E8MA 5KFDA 3SYZA 1SL1A 2OH2A 2YMMA 5DB8A 4B9MA 2I9GA 2HBMA 2F2AB 3BQ7A 3RJKA 1NK5A 1ZQDA 3A0HU 3V72A 2GLEA 4P0QB 2ZJ5A 1L7MA 9ICRA 2VANA 3IG8A 2KZMA 2FPMA 1SGGA 4PGQA 2WB1F 2YX8A 3N7RC 3ORYA 3QU4A 3RB6A 1ZQEA 5KFKA 2B6GA 2K89A 4DFDA 2E5SA 3UMGA 4PGXA 3PSFA 1L8OA 1KEJA 4KX5A 5KFNA 5ALUA 2IHMA 3PZPA 4FBUA 4RQMA 1TK5A 2G5IB 4F92B 2B0CA 4TURA 1XNSA 3RJFA 2KEYA 4O3QA 4QWAA 1B0XA 1PUZA 2NO4A 5DLFA 4UB4A 4UARA 5KFQA 1X40A 4JV1A 3BQTA 4F4ZA 1TAMA 5J2EA 2RQ5A 2HVHA 3V7LA 5DQHA 1RXVA 3BZCA 2HOQA 1WCNA 3VC8A 4YR2A 4F50A 4KTQA 2KOBA 4F4YA 2JH7A 2HHVA 3A0BU 3HP6A 2IA6A 4CRXA 2HW3A 5CB1A 2LPEA 1T3NA 4KMUA 3GIJA 2C2RA 5KFGA 3DV9A 5DGBA 4OJ6A 3M8SA 3T5JA 5AI4A 2HSZA 3MGVA 1C20A 1XSNA 5C5JA 2RLTA 4QIWC 2FMPA 5KFOA 4I2HA 3I28A 3H8JA 4UB3A 4F4XA 3JPOA 2AHOB 4R65A 8ICAA 2K4IA 2XC9A 7ICGA 1DOQA 4I27A 4QZBA 2OEHA 1KL9A 3SV3A 3ZD8A 5KG0A 2ZIVA 3RAXA 4MFAA 1PVPA 5AKGA 2BHNA 3PR5B 3F5AA 3TAQA 2KIVA 5J0SA 4K4HA 2GWSA 4CNQA 2KKVA 3WKCA 1KKXA 2H3IA 2PMZF 5AI9A 4QZFA 5KG2A 3B0YA 4B9TA 7ICUA 3V6HA 3PV8A 4O3SA 5ALVA 5J2DA 1AROP 3TADA 9ICJA 5AKXA 1MSWD 5JTIA 4YD1A 3IP4B 3N4MB 2XY5A 2W9MA 5J8YC 5ALQA 1U9LA 5B66U 2W55A 2JMGA 2FPKA 1N5WA 2H3ZA 4DFKA 2E8NA 1TAUA 1X9MA 3OHBA 9ICOA 3QEBZ 4RQ6A 2D6FC 7ICQA 1S0VA 1HIWA 3RBEA 3AL0B 4EZ9A 2JXJA 3PX0A 8ICOA 3N97B 3BS5A 3CNHA 5AKHA 5HMLA 1TFRA 4ECVA 3OPXA 4KLUA 5ALTA 8ICZA 1JIHA 4JV2A 5ALMA 2C28A 2KJ5A 1L8LA 2QB0B 5J2FA 1SV4A 2R8KA 4UASA 1T8EA 3RJGA 2EZZA 1FIQA 4CGZA 2K4HA 2KZ3A 1TK0A 4G9BA 3EYZA 4WJ3B 1L3TA 4F2RA 4KLIA 4YQWA 1OXJA 1WWVA 3HWTA 1QSLA 3NRWA 5KAIU 3RBDA 9ICFA 5K4LA 2G07A 4XRHA 4NLNA 4ZH4A 5EWGA 4JMUA 4OCZA 2Z7JA 1NK6A 4IC9A 3GQCA 3PVXA 3PSTA 1SZPA 3RH5A 3KD3A 1ZJNA 4J9MA 1SKRA 1N60A 5GTIU 3JPQA 3E58A 3H40A 3NVWA 3TQ1A 1MQ3A 2W9AA 1S0OA 5KFWA 3SZ2A 2I6XA 5FP0A 2E1EA 5ALYA 5F9NA 1LV5A 2VA8A 4YCXA 1NI3A 1K1QA 1X42A 4IS7A 3H4BA 4DFPA 3PW0A 1ZQIA 4QZ9A 4MEYA 2AXTU 1RXWA 9ICEA 3IV6A 2ES6A 3SQIA 2W04A 2KJ8A 3N7PD 2BCVA 1ZQUA 1S0NA 3GZFA 2HBJA 1KSPA 4LJXA 2R8GA 1J2NA 2YN4A 1XO0A 3KHGA 2J6TA 8ICNA 3AMZA 1ZRNA 4GC6A 3TKAA 1ZRMA 2WF9A 1S77D 3BQ1A 1S97A 4DFMA 4P4OA 1DXSA 1YZ7A 3ONNA 5DB6A 3L4PA 1PK3A 1NKCA 1ZOLA 1ZQLA 3FAHA 5CEHA 9ICHA 2ZUCA 4M04A 5ALKA 4IL6U 1UT5A 3BQ2A 4IRKA 2ASLA 1D9FA 5KT4A 2QARB 4DF4A 4Y2UA 4F5PA 1ZQJA 2W9BB 2YB4A 2R8IA 2AJQA 1T3QA 8ICWA 2ZIXA 1FO4A 4FS2A 4M47A 3PNCA 9ICNA 2BQ3A 5DDMA 3GIKA 5AKIA 1Q46A 2F3NA 3G6VA 1NK9A 4U7CA 4CE6A 4DSKA 1KBUA 4EENA 1L3SA 3BJYA 2ZTEA 3T3FA 2UVVA 1ZQBA 1SKWA 5HP4A 1NZBA 3WK4A 1JMSA 4F8RA 4OJLA 2F1JA 1B4FA 4RPZA 5KT2A 4O0IA 1BPYA 7ICFA 5DG7A 5KG5A 5KTQA 4ED0A 4EX6A 2KVCA 5CA7A 3V7KA 3ETLA 4QWBA 3BS7A 4IQUA 3PMNA 4NJ8A 4PH5A 1ZJMA 3WKDA 2WTFA 5ALWA 1Z4NA 4JWNA 1XO1A 3WKBA 4DL7A 5DLGA 1WUDA 4F3OA 3MGHA 1YZ6A 3ALRA 4P4PA 4PHPA 5HNKA 1ZYQA 9ICIA 4C4SA 1COOA 4C7ZA 4DO9A 3T5HA 4TUQA 4FZNA 3M7DA 2KSOB 4UAZA 1UT8A 3WK8A 4FZLA 1LB2B 4ECUA 1URJA 1UHUA 1F44A 4DSFA 4M2YA 4NWIA 4O3MA 4Y2VA 4J9PA 2EZXA 1Q3UA 2E3TA 5L1MA 3EPGA 5J0UA 3BZKA 2Q4TA 1ZQWA 3KTQA 4DL4A 1Z00A 2XCAA 4TUPA 4ED3A 2XGPA 3M9OB 5F9LA 4DQQA 3F2BA 1D8BA 4Y2SA 5KFJA 3I76A 1NK0A 3QUTA 1ZQOA 2DUYA 1QQ5A 4FO6A 3PY8A 2K4PA 3DEEA 5J2IA 3MDCA 4J9NA 1D8LA 1D9DA 4PJ0U 3H0LB 1ZQYA 1BPDA 4Q44A 5ALNA 4DEZA 5AI6A 4KLJA 1SV0A 2XIDA 2JR5A 2BZFA 2KN7A 5L1JA 5ALEA 8ICBA 1BGXT 1QTMA 4I2DA 3SI8A 1MN8A 1T4GA 1NZPA 4DOAA 3NGDA 4B9VA 2EANA 3OTQA 4I2AA 5L1IA 5KG7A 2J6UA 4NLBA 1VDVA 9ICLA 1ZXIA 4JWMA 5DQGA 4ECWA 2LYBA 1SWWA 2BKEA 1N61A 4QZAA 3IHQB 4QWDA 4PL1A 3PW2A 5J29A 2PFPA 1ZQZA 4PZOA 4IQWA 4C8KA 5KT6A 3MR3A 4G3IA 2KZZA 1NK7A 1Z4OA 1NNLA 2HOFA 2OCEA 2LM1A 4NV0A 2O6KA 5B5EU 4YR0A 4EELA 5BPCA 3PW7A 2A1AA 4NLZA 2KFNA 1ZQMA 2WF6A 4R8UA 3E2EA 3RB3A 3PSIA 1PK1A 9ICQA 4RPXA 4F72A 5EE3A 1S10A 5DBBA 2H3VA 3AU2A 4M6WA 3M6ZA 4F91B 1Y88A 4J9RA 1DK2A 5KT5A 1SXEA 1S9FA 1RYSA 4QZEA 4BDPA 4EBEA 2F8KA 4DOBA 4DSJA 5KFYA 1RQNA 3RJIA 3CYMA 3RFAA 5EWEA 3PSPA 1DGSA 2F1IA 4J9QA 1RDFA 3I1YA 4QZHA 4KN7A 1C7YA 4MFFA 2KG5A 4Y2YA 2HMXA 5ALHA 5E79U 3NTUA 1ZD2P 4GFJA 3NVYA 1IG6A 3NRZA 3EUB2 4UB8U 5BOLA 4Y2JA 4OJ5A 5KFSA 5J0PA 4P2HA 3TACB 1LKYB 4BWJA 4EBCA 2HHWA 5AK6A 1SIJA 3C28A 4XUSA 3SV4A 2DF4B 3TFSA 2RRDA 3LVWA 1RM6C 5TZVA 3LYSA 1ECWA 4J9OA 3ISCA 9ICXA 3EWAA 2ASJA 4MEXA 3PW5A 3PW4A 4IR9A 3RRGA 3C21A 3SAHA 5ALXA 3UMBA 1U48A 5KFHA 9ICTA 2ZIVB 3H8WA 2DL0A 5AK5A 4BX9C 1MC8A 4CDGA 2BDUA 3AM9A 2FI1A 3KZIU 2YTUA 2WF7A 3IDWA 3KKAA 3EZ5A 1UA0A 5KFCA 1WYGA 3D2QA 1EXNA 2ZJAA 4QWEA 3SAGA 4UW9A 1BPBA 1BPXA 1CEZA 3MR6A 1CI4A 5CRXA 3KHLA 3Q8SB 4IR1A 2P66A 2HI0A 3M1YA 1NKBA 2ODGA 4UATA 2UVUA 4PPXA 4AYBF 5DDYA 2IHNA 2PXIA 2HHQA 4KLFA 1MQ2A 2YMPA 1O03A 7ICNA 1SV0C 3PX6A 4R64A 2F8LA 3QU2A 2FPLA 4KLTA 2JEGA 2GH1A 1L7PA 1XWLA 2DKXA 4KLDA 5KG3A 1T94A 3RB0A 3QX7A 8ICLA 9ICWA 8ICPA 3ICXA 3BS5B 5J0XA 4IRDA 4Q8EA 4O3RA 3BDPA 1PVRA 1JROA 2LHTA 7ICIA 4LZGA 3F5EA 4FE3A 3E0FA 5ALJA 4PHEA 2EAPA 1X2IA 2F1HA 1CRXA 1TE2A 1JALA 1IXRA 3HT3A 5TISU 3UXPA 1PZNA 1M6YA 5CJ7A 4KLQA 1P7DA 2P6RA 1N2XA 7ICHA 1NOMA 3N7SC 4JV0A 5DG8A 3WK7A 2P6UA 1OUQA 2CRXA 2IBKA 1DK3A 1A76A 4PHDA 5IIJA 3U26A 1Q3VA 4Y2TA 1NK8A 8ICXA 3ISBA 3C5FA 5ALIA 4CF3A 3IRUA 3GV7B 4XQ8A 4M9LA 4J9KA 3PX4A 4UB6U 2R8JA 2W7OA 1HJPA 3DDHA 4YG2A 4RQ2A 2LI6A 4ECYA 2NV3A 1U49A 4QJFB 1K5OA 4TUSA 3TANA 5AK4A 3RB4A 1J97A 2W43A 2W03A 7ICJA 3GIIA 8ICTA 2W54A 4NY8A 4PHAA 4NLKA 4ICAA 1N5XA 4BWMA 1PVQA 4F5RA 5IIIA 4NM2A 1COKA 2MRLA 3NVZA 4I28A 1KFDA 4DS5A 4GLXA 4LZDA 3TARA 1XS9D 3MC1A 2JZBB 5AHXA 1X6IA 4KITB 3GFKB 4RQ5A 4QZGA 2V4QA 1U45A 2W7PA 4RT3A 5F3XB 4I2BA 2M0NA 1KLNA 2IOFK 4YD2A 2AU0A 5KT7A 5J0RA 4PGYA 5JRTA 5AIAA 5AKKA 4I2IA 2NRZA 3Q8QB 1TKDA 4U6PA 2PFQA 1N63A 3Q8LA 4EEYA 2ZIXB 5KFRA 1QH9A 2V9WA 3L3FX 4UBCA 2FDRA 3J81j 2GOLA 3C1ZA 4UAWA 4I2FA 1Z1BA 4B9LA 4UQGA 2KMDA 3NS1A 5KFIA 2Y1JA 2DKZA 2XI9A 2RDIA 1V38A 2QB0A 9ICMA 3R9KA 4JB3A 3KFUF 1JUDA 5KFMA 4J9SA 2MUTA 2QB1A 2HOIA 1KRPA 5AM3A 5J2KA 4ACOA 3Q8PB 3Q8RB 4EZ6A 1SL2A 5KFUA 5KG4A 4QZIA 4I2JA 3K1ZA 5KFBA 4RQNA 4E0DA 2K8BB 2NO5A 3NVVA 2NRVA 1QCKA 1ZQHA 1Z3EB 2HDOA 4IRCA 1ZQKA 1KW4A 1TAQA 5KFXA 5KFLA 5J0YA 4NLCA 1ZD5A 2JV3A 5DKWA 1SL0A 3MFHA 2BR0A 1U47A 1UCVA 1ZQRA 4P0PA 5KAFU 5KFVA 2JEFA 2G5HB 1ZQXA 4ECRA 4FFDA 3GV5B 2NYVA 5IILA 4RQ1A 2PI5A 2W9CA 2AH5A 2CN1A 4MFCA 2Q0ZX 5J2AA 2CXYA 1QQ6A 3TADC 4QW8A 1ZD4A 2LMRA 4AYBC 1DRGA 4EYHB 3C2LA 3G6YA 3NUQA 5AKJA 2J6SA 2K8CB 4I2GA 1ZQVA 2HCFA 2WAQF 3UQ2A 1TVAA 3GDXA 2WHEA 4Z6FA 7ICRA 5J2GA 4C80A 1XU4A 3M8RA 1Z00B 3CRXA 2ZTCA 2BCSA 5KFTA 1JI7A 4DWIA 4M0AA 1ZQNA 3SMVA 1IIPA 3K1RB 3RTVA 4PZNA 4UB5A 1ZD3A 3KZXA 4UB1A 4F4WA 2A3VA 4ED8A 1T7PA 3EPIA 2KIWA 4ELVA 2ZUBA 4OJOA 9ICSA 5HHIA 3PMLA 4BXOB 3KOOA 2OWOA 3V6KA 1S5LU 1OW5A 3MBYA 4Z6CA 1SKSA 4OO1J 2ALZA 9ICPA 3ZDEA 3AUOA 2WFAA 1QQ7A 2N1RA 2MSNA 2FLLA 1VJ5A 3OGUA 2I5HA 4RPYA 4C0ZA 3H0RB 3WKEA 5J2CA 4KLSA 3QU5A 4US8A 4DL2A 1ZQTA 2KKPA 1BNOA 3C23A 1Z1VA 1NJXA 4I2CA 4F2SA 5AKYA 2ZXHA 4O9MA 2KTQA 3QU9A 4TQSA 4JUZA 2BCUA 7ICOA 1SB3C 3QUBA 4ED7A 2W3RA 3WU2U 5AICA 4NM1A 2EDUA 3MR2A 1CUKA 4RNMA 3AN1A 4KLOA 3BQ0A 8ICRA 3G6XA 2W8LA 4YXJA 3HKZC 1X66A 2MAXA 2YB1A 5CHGA 1WWUA 4LVSA 1HUZA 2F44A 4ZOHC 2R18A 4CF4A 4C8NA 4UB2A 4BUGA 1RPLA 3JPSA 2ZIUB 2ZTDA 9ICBA 8ICSA 4B6JA 4R8UB 1XSPA 5EOZA 3RRHA 2HBLA 4M6WB 5ALPA 3T5KA 4RQ0A 3IN5A 1RG6A 2ZJ8A 1HUOA 2PKEA 2K4EA 2PI4A 1D8YA 3V7JA 5DB7A 4F5QA 3M9MB 4DQIA 2KSOA 2Y1IA 5AM2A 4OD0A 8ICFA 3B9JA 5KFPA 2P35A 1BVSA 2LYHA 4ED1A 1KQQA 5EE0A 5KT3A 2IOHA 7ICMA 3T5LA 4DSIA 3OJUA 1MA7A 4RUAA 2Y9TA 3UM9A 4DQSA 3WK9A 1RYRA 1N62A 4O3NA 2ZIWA 2QLTA 2A1JA 4B9UA 4O3PA 4DFJA 5J0WA 3TFRA 4X5VA 2DFLA 1L3UA 2LYAA 3QUQA 4A8EA 2W11A 1DGJA 4Y2XA 2KVSA 5J8YA 4PL2A 5DQIA 4YP3A 4KLGA 3OSNA 4P4MA 1NK4A 2HHXA 4KN4A 3ZD9A 2PFOA 1L5UA 5AKEA 4QW9A 5CR0A 2UVRA 3C5GA 1L6NA 2DQNB 4GXJA 1O08A 4DOCA 2KE7A 2VKQA 5AI0A 1KFTA 1QSYA 2VJ5A 3RH4A 2C22A 3KHRA 4ECTA 4B9SA 3D2SA 3GV8B 2G0AA 2KHVA 3ZDDA 1RYUA 2FMSA 3JPRA 2KICA 4MF2A 5EE1A 4RU9A 2BGWA 5BOMA 3GIMA 4DS4A 4RNOA 3ETRA 2JEJA 2ZUDA 4C8OA 5DGAA 3UPQA 2CPRA 3H8MA 3K75D 4UAVA 5ALOA 2XVTA 5IIMA 4F71A 4C8MA 5ALDA 2FMQA 3SAFA 1V85A 2WAQC 5KFZA 2XICA 2FE9A 1AQ6A 4YXMA 3F2DA 2AQ4A 2YMLA 5IINA 1S0MA 2NRTA 1SXDA 4OJPA 4ECQA 5HR7A 5JUMA 8ICVA 4M9HA 4O3OA 9ICVA 2XY7A 3OHAA 1XC9A 1ZQFA 5G5HA 3PO5A 7ICPA 2RDJA 2HHSA 3RH6A 2KP7A 4CCHA 1RZTA 2G09A 3HW8A 4EBDA 2KV2A 1NJWA 1HEKA 4Y2QA 1Q8KA 4KX3A 5CP2A 4J03A 1XSLA 4P0QA 4FZMA 3QU7A 4JK1A 4ECZA 1ZQ1C 4O5CA 5H2FU 4IQVA 2BCQA 4F93B 5AKLA 3D6JA 2KD1A 3GU3A 5L1KA 1A0PA 4C4RA 2C2EA 5KG1A 3HJEA 1TK8A 2FLPA 1LKYA 1V9PA 3FC4A 4I2EA 5HR6A 2YQEA 2OYYA 3H4DA 4GXKA 3AU6A 4RZRA 4QZDA 1FEZA 4GXIA 4KLEA 2G08A 1X9SA 3RR7A 1NKEA 5KG6A 4RT2A 5G5GA 1KN5A 4O5EA 1N56A 4K4GA 3HRDD 2MA1A 8ICEA 5T14A 1JX4A 4YR3A 2BQRA 3UXNA 3HX0A 5JU5A 3QXGA 8ICJA 1SWVA 2KHQA 1S76D 4Q43A 5D49A 2HHUA 1RQLA 4UAUA 1IM4A 3RJHA 2Y0SF 3JPNA 5DBCA 3V6JA 1Z19A 4M9GA 2DPJA 1VLBA 3S6JA 2EH9A 2HVIA 1UPHA 4BJQA 1IV8A 4ECSA 4KLHA 3H8SA 2JRZA 3Q8KA 4QZCA 4RQ7A 4YN4A 3HKZF 3L5KA 4NL9A 5C0YA 5CWRA 4Z6DA 2JGAA 2JH1A 3CP8A 4RQ3A 2BPFA 2EQYA 4DL3A 5AM1A 4DCCA 2IMWP 8ICUA 2I1QA 4YMNA 2KFZA 7ICKA 1JN3A 3QEAZ 4R66A 8ICHA 3K4GA 4Q8FA 5KL1B 2ASDA 5D4BA 5J0OA 4MF8A 2OHFA 2W3SA 1FFUA 3MR5A 2MUTB 2OXOA 4YMOA 1ZQSA 5J2BA 5KFAA 1B22A 3T79A 5DG9A 1KTQA 7ICVA 1BNPA 8ICYA 8ICMA 2EZYA 2D3DA 4Z6EA 5J2JA 4DQRA 2E8PA 2F76X 5IIOA 3RAQA 3Q8MA 2EAOA 3C29A 3C1YA 2W8KA 4NLGA 5DBAA 4K4IA 4DLEA 7ICTA 1L3VA 2FLNA 4P0PB 2ESEA 3MABA 3LK9A 2IOFA 4YMMA 1KFSA 4GIBA 3QYPA 5AIBA 4B9NA 3KKAC 2W9CB 7ICLA 4ELTA 2ATLA 1QSSA 2HBKA 1L7NA 3ZDAA 8ICGA 4HYKA 3PO4A 2RP5A 1S8OA 1ZQPA 2K60A 2H3QA 3MGIA 4MHVA 3H7IA 3KBBA 9ICUA 4KLMA 1A6SA 2WB1C 5L1LA 4QZ8A 2XO7A 1ZQAA 4YVZA 2K8AA 3JPTA 3AQEA 5AI5A 2BPCA 2DWQA 4USAA 4DLGA 4DSLA 4KLLA 4KMOB 2EAMA 9ICAA 2BPGA 3ZDCA 4C8LA 2E8OA 3C2KA 5J0QA 2A19A 3SEIA 4TQRA 2JZBA 3FM9A 3M6KA 2C2DA 2R8HA 3WKAA 5KFFA 3H0MB 4RNNA 4RQ4A 3M9NB 5KL8B 1F0MA 5J2HA 3F2CA 3PR4A 2ZXIA 2H3FA 2NRXA 1NJYA 1KDHA 4F5NA 1V97A 3D2NA 1LVHA 4US9A 5EWFA 4FS1A 3SD7A 3MFIA 2XCPA 3LWMA 2V4RA 4YFKA 2JEIA 2LKYA 1A77A 2LM4A 4NXZA 1JXEA 4DF8A 3RJEA 4XA5A 2F77X 2NRWA 2ISPA 3IG5A 3WK5A 2M9NA 3ED5A 5HMMA 3C2MA 3MDAA 8ICCA 5AI8A 2E1FA 2Y9UA 2H5XA 4EEKA 2VA2A 4ED2A 4F5OA 4GC7A 4DL5A 2WF5A 2BCRA 2PFNA 1X9XA 1BPEA 4NL9C 2YMQA 5KNIA 3WK6A 2QARA 1J2MA 5D46A 2AGPA 1UQVA 3ISDA 7ICEA 4QNLA 2W9BA 4BGDA 5AM4A 2PMZC 5ALGA 8ICIA 2YY6A 3KHHA 2XY6A 3OJSA 1X9WA 4UAYA 4DL6A 3AQFA 4I29A 2Y0SC 1F5SA 4CF5A 4UBBA 5ALZA 3HILA 1TV9A 1SZHA 2UVWA 4QIWF 4ELUA 5HHHA 3RR8A 1U4BA 4ED6A 2OM6A 3ZI4A 2MU2A 1B43A 3SR6A 3QNMA 5EE9A 4AP9A 3TI0A 5L9XA 7ICSA 4HAIA 2QKQA 3TAPA 2ZIWB 5AK3A 2A1JB 3LWLA 4QWCA 5DB9A 3QZ8A 5IIKA 1YT3A 3B0XA 3SENA 4Y2PA 4C4TA 2LBOA 1WG8A 1JXLA 9ICKA 2AGQA 1PK1B 1ZQGA 4Y2RA 3QUCA 3THVA 4BXOA 2KK0A 2HHTA 5A0LA 4EYIB 1ZQQA 1FFVA 2XGQA 1K1SA 2DBYA 4M9JA 2FJ6A 4R63A 1ZETA 2DPIA 2BDPA 3QZ7A 4M9NA 3UXOA 2KNJA
chains in the Genus database with same CATH topology
5JUMA 4RQ2A 4O5KA 4ECYA 3LDAA 2BQ3A 5DDMA 1U49A 2VA3A 8ICVA 3GIKA 4TUSA 3TANA 4M9HA 3RB4A 4O3OA 9ICVA 2XY7A 3G6VA 1NK9A 3RJJA 3OHAA 1XC9A 1ZQFA 4DSKA 9ICNA 1L3SA 7ICJA 3BJYA 2ZTEA 3T3FA 3GIIA 2UVVA 1ZQBA 3PO5A 7ICPA 1SKWA 2AQ0A 2RDJA 8ICTA 3EW9A 4NY8A 2HHSA 5HP4A 3RH6A 1JMSA 1UA1A 4F8RA 4PHAA 4ECXA 2F1JA 4NLKA 4CCHA 4RPZA 5KT2A 4O0IA 1RZTA 1BPYA 3HW8A 5KFEA 4EBDA 4BWMA 7ICFA 5DG7A 1NJWA 5KG5A 5KTQA 4ED0A 1WCLA 4F5RA 5IIIA 5CP2A 4NM2A 5CA7A 3V7KA 1XSLA 3ETLA 4QWBA 4JK1A 4IQUA 4ECZA 4O5CA 3PMNA 4IQVA 2BCQA 4F93B 1N48A 4I28A 4PH5A 1KFDA 4DS5A 3JPPA 2B21A 4LZDA 4GLXA 3TARA 1ZJMA 1XS9D 4F4KA 5L1KA 2C2EA 2WTFA 3UQ0A 4DQPA 5KG1A 2JZBB 4KITB 3GFKB 4JWNA 4RQ5A 4QZGA 2V4QA 1U45A 1NJZA 1TK8A 2FLPA 1V9PA 4RT3A 3OSPA 3ZDBA 1XO1A 3IM1A 4DL7A 5DLGA 3QE9Y 1ZQCA 4I2BA 4FBTA 4F3OA 1KLNA 4YD2A 5J0TA 2ISOA 2AU0A 5KT7A 3MGHA 3H4DA 4GXKA 3AU6A 9ICGA 4PGYA 5J0RA 4PHPA 5HNKA 4RZRA 4QZDA 4RQ8A 4P4PA 4RUCA 1ZYQA 9ICIA 1COOA 4GXIA 2AGOA 4KLEA 4I2IA 2NRZA 3Q8QB 1TKDA 4DO9A 8ICQA 1X9SA 2PFQA 3RR7A 3T5HA 4TUQA 2BQUA 3Q8LA 1NKEA 4EEYA 5KFRA 4UAZA 4IQTA 5KG6A 4RT2A 4UBCA 2V9WA 1UT8A 1BPZA 3FDSA 3C1ZA 1QLNA 4UAWA 1LB2B 4O5EA 4ECUA 1N56A 4I2FA 4K4GA 4DSFA 4J9LA 4B9LA 4M2YA 4DSEA 4UQGA 8ICKA 5KFIA 8ICEA 3FYHA 9ICCA 2Y1JA 1H38A 4J9PA 3GILA 1JX4A 2RDIA 4YR3A 4Q45A 9ICMA 2BQRA 3HPOA 3UXNA 5KFDA 3SYZA 1SL1A 3HX0A 5KFMA 4J9SA 5DB8A 4B9MA 3EPGA 2MUTA 2I9GA 8ICJA 5J0UA 1ZQWA 5J2KA 1KRPA 3KTQA 3RJKA 4DL4A 1NK5A 1ZQDA 1Z00A 1S76D 2XCAA 3V72A 3Q8PB 4TUPA 3Q8RB 4Q43A 4ED3A 4EZ6A 1SL2A 5KFUA 5KG4A 5D49A 4QZIA 2XGPA 2HHUA 4I2JA 3M9OB 2ZJ5A 5F9LA 1IM4A 5KFBA 3RJHA 4DQQA 4E0DA 3JPNA 9ICRA 2VANA 5DBCA 3V6JA 2NRVA 2KZMA 2FPMA 5KFJA 4PGQA 1ZQHA 4M9GA 2DPJA 1NK0A 1ZQOA 1Z3EB 4IRCA 4FO6A 1ZQKA 3PY8A 3ORYA 3RB6A 1TAQA 5KFXA 5KFLA 5J0YA 1ZQEA 2HVIA 5J2IA 5KFKA 3MDCA 5DKWA 1SL0A 4J9NA 3MFHA 2BR0A 4ECSA 1U47A 1D8LA 1ZQRA 1D9DA 4I2EA 3H8SA 4KLHA 1ZQYA 1BPDA 4Q44A 3Q8KA 4QZCA 4RQ7A 5KFVA 4DEZA 4YN4A 2JEFA 1ZQXA 4ECRA 4KLJA 4PGXA 5CWRA 3GV5B 4Z6DA 5IILA 2KN7A 1KEJA 4RQ1A 5L1JA 2PI5A 8ICBA 1BGXT 5KFNA 2W9CA 1QTMA 4MFCA 2IHMA 2Q0ZX 4FBUA 4I2DA 4RQ3A 2BPFA 3SI8A 1T4GA 5J2AA 4DL3A 1TK5A 4TURA 4F92B 4DOAA 2IMWP 8ICUA 2I1QA 4QW8A 4YMNA 3RJFA 2KFZA 3NGDA 7ICKA 1JN3A 4B9VA 3QEAZ 4O3QA 4QWAA 5DLFA 4UB4A 4EYHB 4R66A 5KFQA 3C2LA 4JV1A 8ICHA 3K4GA 5L1IA 3BQTA 3G6YA 4I2AA 2ASDA 4Q8FA 4F4ZA 5D4BA 5KG7A 5J0OA 4MF8A 2J6UA 2J6SA 4I2GA 1ZQVA 5J2EA 9ICLA 3UQ2A 4JWMA 1TVAA 3MR5A 5DQGA 2MUTB 2HVHA 9ICTA 3GDXA 3V7LA 4ECWA 4Z6FA 7ICRA 5J2GA 2BKEA 1XU4A 3M8RA 4QZAA 3IHQB 5DQHA 1Z00B 1RXVA 4QWDA 4YMOA 3PW2A 1ZQSA 5J29A 5J2BA 2PFPA 1WCNA 5KFAA 4YR2A 4F50A 4KTQA 2ZTCA 1ZQZA 1KTQA 5DG9A 4F4YA 1B22A 2BCSA 5KFTA 4IQWA 7ICVA 4DWIA 4C8KA 4M0AA 1ZQNA 8ICYA 8ICMA 2HHVA 5KT6A 3HP6A 3MR3A 2IA6A 3RTVA 4G3IA 2KZZA 4UB5A 2HW3A 4Z6EA 4UB1A 4F4WA 5CB1A 1NK7A 5J2JA 4ED8A 1T7PA 3EPIA 4DQRA 1T3NA 4KMUA 4ELVA 2ZUBA 3GIJA 9ICSA 5HHIA 5IIOA 3PMLA 4BXOB 3RAQA 3Q8MA 5KFGA 2C2RA 2OWOA 3C1YA 3V6KA 5DGBA 2W8KA 4YR0A 5BPCA 3PW7A 4NLGA 5DBAA 3M8SA 4K4IA 3MBYA 4DLEA 3T5JA 4NLZA 2KFNA 7ICTA 1L3VA 1ZQMA 2FLNA 4Z6CA 1SKSA 1XSNA 5C5JA 2FMPA 3MABA 4R8UA 3RB3A 3E2EA 2ALZA 3LK9A 9ICQA 4RPXA 9ICPA 1S10A 5KFOA 5DBBA 4YMMA 1KFSA 3H8JA 3ZDEA 4UB3A 4I2HA 4F4XA 3AUOA 3AU2A 4M6WA 4F91B 3JPOA 1Y88A 4B9NA 4J9RA 5KT5A 4R65A 8ICAA 2XC9A 2FLLA 2W9CB 1S9FA 1RYSA 7ICGA 4QZEA 1DOQA 4I27A 4QZBA 3SV3A 7ICLA 4BDPA 3OGUA 3ZD8A 5KG0A 4ELTA 4EBEA 4DOBA 4DSJA 3RAXA 4RPYA 4MFAA 2ATLA 5KFYA 3RJIA 1QSSA 2BHNA 3PR5B 5J2CA 4KLSA 3TAQA 5EWEA 4DL2A 1ZQTA 5J0SA 3ZDAA 3C23A 4K4HA 1DGSA 8ICGA 4HYKA 2GWSA 2F1IA 3PO4A 4J9QA 1NJXA 1ZQPA 4I2CA 4F2SA 4QZFA 5KG2A 4QZHA 3MGIA 3B0YA 4KN7A 4B9TA 3H7IA 3V6HA 1C7YA 3PV8A 7ICUA 4O9MA 9ICUA 4KLMA 4O3SA 2KTQA 4MFFA 4TQSA 5L1LA 4JUZA 4QZ8A 2XO7A 2BCUA 1ZQAA 5J2DA 4YVZA 7ICOA 3JPTA 1AROP 3NTUA 4ED7A 9ICJA 1MSWD 2BPCA 4NM1A 4YD1A 3MR2A 1CUKA 3N4MB 4RNMA 2XY5A 2W9MA 3BQ0A 4KLOA 8ICRA 4DLGA 5BOLA 4DSLA 5KFSA 3G6XA 5J0PA 1U9LA 2W8LA 4YXJA 4KLLA 4P2HA 2MAXA 4BWJA 5CHGA 4EBCA 2BPGA 1HUZA 3ZDCA 4C8LA 4LVSA 9ICAA 2FPKA 2HHWA 3C2KA 5J0QA 4DFKA 4TQRA 4XUSA 3SV4A 1TAUA 3TFSA 3OHBA 4C8NA 1X9MA 2JZBA 4UB2A 9ICOA 1RPLA 5TZVA 2C2DA 3QEBZ 2R8HA 4RQ6A 3JPSA 4J9OA 7ICQA 1S0VA 2ZTDA 3ISCA 8ICSA 4R8UB 3RBEA 1XSPA 5EOZA 3EWAA 9ICBA 2ASJA 4MEXA 9ICXA 4EZ9A 3RRHA 5KFFA 3PW5A 3PW4A 4RNNA 3PX0A 4M6WB 4IR9A 3RRGA 8ICOA 3T5KA 3C21A 4RQ0A 4RQ4A 2ZJ8A 3M9NB 3N97B 1U48A 1HUOA 5HMLA 1TFRA 5KFHA 5J2HA 4ECVA 1D8YA 5DB7A 3V7JA 2PI4A 3PR4A 3M9MB 3H8WA 4F5QA 4DQIA 2NRXA 4KLUA 8ICZA 2Y1IA 1JIHA 1MC8A 1NJYA 1KDHA 4JV2A 2C28A 4F5NA 8ICFA 5J2FA 5EWFA 5KFPA 4FS1A 2R8KA 1BVSA 3MFIA 2LYHA 2XCPA 4ED1A 3LWMA 1T8EA 3RJGA 3EZ5A 2V4RA 4YFKA 2JEIA 1A77A 1UA0A 2KZ3A 5KT3A 7ICMA 4NXZA 3T5LA 3OJUA 5KFCA 1TK0A 4DSIA 3EYZA 1JXEA 4RUAA 4DF8A 3RJEA 4XA5A 1L3TA 1EXNA 2NRWA 2ZJAA 4QWEA 2ISPA 4DQSA 1RYRA 4F2RA 4KLIA 1BPXA 1BPBA 2M9NA 4O3NA 4YQWA 3MR6A 1CEZA 3KHLA 5HMMA 3Q8SB 4IR1A 3C2MA 2P66A 2A1JA 3HWTA 1NKBA 3MDAA 1QSLA 8ICCA 2UVUA 4PPXA 4B9UA 5DDYA 2H5XA 4O3PA 4DFJA 3RBDA 2IHNA 5J0WA 2PXIA 3TFRA 9ICFA 2VA2A 4XRHA 4NLNA 4X5VA 2HHQA 4ZH4A 4KLFA 5EWGA 2DFLA 4ED2A 4F5OA 4GC7A 4DL5A 1MQ2A 2BCRA 1NK6A 1L3UA 2PFNA 1BPEA 7ICNA 3PX6A 3GQCA 3PVXA 4R64A 1SZPA 3RH5A 5D46A 1ZJNA 4J9MA 2AGPA 1SKRA 3ISDA 3JPQA 2FPLA 4KLTA 5DQIA 7ICEA 4YP3A 3H40A 2JEGA 4KLGA 3OSNA 2W9BA 4P4MA 1XWLA 4BGDA 3TQ1A 1NK4A 1MQ3A 4KLDA 2HHXA 4KN4A 5KG3A 2W9AA 3ZD9A 3RB0A 5KFWA 3SZ2A 1S0OA 8ICLA 9ICWA 8ICPA 5J0XA 2PFOA 4IRDA 4Q8EA 1L5UA 8ICIA 4O3RA 3BDPA 5F9NA 3KHHA 2XY6A 1LV5A 3OJSA 7ICIA 4LZGA 2VA8A 4YCXA 1X9WA 4QW9A 1K1QA 5CR0A 4UAYA 2UVRA 3H4BA 3C5GA 4DL6A 4PHEA 4DFPA 4GXJA 4I29A 3PW0A 1ZQIA 4QZ9A 4MEYA 4DOCA 4UBBA 1RXWA 1X2IA 9ICEA 2F1HA 1KFTA 1TV9A 1QSYA 2UVWA 4ELUA 1IXRA 5HHHA 3RR8A 3RH4A 2BCVA 1ZQUA 3HT3A 2C22A 1U4BA 1S0NA 3UXPA 1PZNA 4KLQA 5CJ7A 3KHRA 4ECTA 4ED6A 1KSPA 4B9SA 2R8GA 3GV8B 1B43A 3KHGA 2P6RA 3ZDDA 2J6TA 7ICHA 8ICNA 2FMSA 4GC6A 1NOMA 4JV0A 5DG8A 3JPRA 3TI0A 5L9XA 7ICSA 2P6UA 4MF2A 1S77D 3BQ1A 3TAPA 1S97A 4RU9A 2BGWA 5BOMA 3GIMA 4DS4A 3LWLA 2A1JB 4DFMA 4RNOA 4QWCA 4P4OA 5DB9A 2JEJA 2IBKA 1A76A 2ZUDA 4PHDA 4C8OA 3QZ8A 5IIKA 3B0XA 5IIJA 5DGAA 3UPQA 5DB6A 1NK8A 1ZQLA 1NKCA 3K75D 9ICHA 1JXLA 2ZUCA 9ICKA 8ICXA 4M04A 2AGQA 3ISBA 1UT5A 3BQ2A 5IIMA 4IRKA 2ASLA 3C5FA 4C8MA 1ZQGA 1D9FA 5KT4A 4DF4A 3THVA 2FMQA 4BXOA 2HHTA 3GV7B 4EYIB 1ZQQA 4XQ8A 4M9LA 4J9KA 4F5PA 5KFZA 3PX4A 1ZQJA 2W9BB 2XGQA 2R8JA 1K1SA 4M9JA 2R8IA 2AJQA 8ICWA 4YXMA 4R63A 2AQ4A 1ZETA 2DPIA 5IINA 1HJPA 4FS2A 2BDPA 3QZ7A 4M9NA 3UXOA 1S0MA 2NRTA 4ECQA 4M47A 3PNCA 4YG2A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5JUM A;  4RQ2 A;  4O5K A;  4ECY A;  3LDA A;  2BQ3 A;  5DDM A;  1U49 A;  2VA3 A;  8ICV A;  3GIK A;  4TUS A;  3TAN A;  4M9H A;  3RB4 A;  4O3O A;  9ICV A;  2XY7 A;  3G6V A;  1NK9 A;  3RJJ A;  3OHA A;  1XC9 A;  1ZQF A;  4DSK A;  9ICN A;  1L3S A;  7ICJ A;  3BJY A;  2ZTE A;  3T3F A;  3GII A;  2UVV A;  1ZQB A;  3PO5 A;  7ICP A;  1SKW A;  2AQ0 A;  2RDJ A;  8ICT A;  3EW9 A;  4NY8 A;  2HHS A;  5HP4 A;  3RH6 A;  1JMS A;  1UA1 A;  4F8R A;  4PHA A;  4ECX A;  2F1J A;  4NLK A;  4CCH A;  4RPZ A;  5KT2 A;  4O0I A;  1RZT A;  1BPY A;  3HW8 A;  5KFE A;  4EBD A;  4BWM A;  7ICF A;  5DG7 A;  1NJW A;  5KG5 A;  5KTQ A;  4ED0 A;  1WCL A;  4F5R A;  5III A;  5CP2 A;  4NM2 A;  5CA7 A;  3V7K A;  1XSL A;  3ETL A;  4QWB A;  4JK1 A;  4IQU A;  4ECZ A;  4O5C A;  3PMN A;  4IQV A;  2BCQ A;  4F93 B;  1N48 A;  4I28 A;  4PH5 A;  1KFD A;  4DS5 A;  3JPP A;  2B21 A;  4LZD A;  4GLX A;  3TAR A;  1ZJM A;  1XS9 D;  4F4K A;  5L1K A;  2C2E A;  2WTF A;  3UQ0 A;  4DQP A;  5KG1 A;  2JZB B;  4KIT B;  3GFK B;  4JWN A;  4RQ5 A;  4QZG A;  2V4Q A;  1U45 A;  1NJZ A;  1TK8 A;  2FLP A;  1V9P A;  4RT3 A;  3OSP A;  3ZDB A;  1XO1 A;  3IM1 A;  4DL7 A;  5DLG A;  3QE9 Y;  1ZQC A;  4I2B A;  4FBT A;  4F3O A;  1KLN A;  4YD2 A;  5J0T A;  2ISO A;  2AU0 A;  5KT7 A;  3MGH A;  3H4D A;  4GXK A;  3AU6 A;  9ICG A;  4PGY A;  5J0R A;  4PHP A;  5HNK A;  4RZR A;  4QZD A;  4RQ8 A;  4P4P A;  4RUC A;  1ZYQ A;  9ICI A;  1COO A;  4GXI A;  2AGO A;  4KLE A;  4I2I A;  2NRZ A;  3Q8Q B;  1TKD A;  4DO9 A;  8ICQ A;  1X9S A;  2PFQ A;  3RR7 A;  3T5H A;  4TUQ A;  2BQU A;  3Q8L A;  1NKE A;  4EEY A;  5KFR A;  4UAZ A;  4IQT A;  5KG6 A;  4RT2 A;  4UBC A;  2V9W A;  1UT8 A;  1BPZ A;  3FDS A;  3C1Z A;  1QLN A;  4UAW A;  1LB2 B;  4O5E A;  4ECU A;  1N56 A;  4I2F A;  4K4G A;  4DSF A;  4J9L A;  4B9L A;  4M2Y A;  4DSE A;  4UQG A;  8ICK A;  5KFI A;  8ICE A;  3FYH A;  9ICC A;  2Y1J A;  1H38 A;  4J9P A;  3GIL A;  1JX4 A;  2RDI A;  4YR3 A;  4Q45 A;  9ICM A;  2BQR A;  3HPO A;  3UXN A;  5KFD A;  3SYZ A;  1SL1 A;  3HX0 A;  5KFM A;  4J9S A;  5DB8 A;  4B9M A;  3EPG A;  2MUT A;  2I9G A;  8ICJ A;  5J0U A;  1ZQW A;  5J2K A;  1KRP A;  3KTQ A;  3RJK A;  4DL4 A;  1NK5 A;  1ZQD A;  1Z00 A;  1S76 D;  2XCA A;  3V72 A;  3Q8P B;  4TUP A;  3Q8R B;  4Q43 A;  4ED3 A;  4EZ6 A;  1SL2 A;  5KFU A;  5KG4 A;  5D49 A;  4QZI A;  2XGP A;  2HHU A;  4I2J A;  3M9O B;  2ZJ5 A;  5F9L A;  1IM4 A;  5KFB A;  3RJH A;  4DQQ A;  4E0D A;  3JPN A;  9ICR A;  2VAN A;  5DBC A;  3V6J A;  2NRV A;  2KZM A;  2FPM A;  5KFJ A;  4PGQ A;  1ZQH A;  4M9G A;  2DPJ A;  1NK0 A;  1ZQO A;  1Z3E B;  4IRC A;  4FO6 A;  1ZQK A;  3PY8 A;  3ORY A;  3RB6 A;  1TAQ A;  5KFX A;  5KFL A;  5J0Y A;  1ZQE A;  2HVI A;  5J2I A;  5KFK A;  3MDC A;  5DKW A;  1SL0 A;  4J9N A;  3MFH A;  2BR0 A;  4ECS A;  1U47 A;  1D8L A;  1ZQR A;  1D9D A;  4I2E A;  3H8S A;  4KLH A;  1ZQY A;  1BPD A;  4Q44 A;  3Q8K A;  4QZC A;  4RQ7 A;  5KFV A;  4DEZ A;  4YN4 A;  2JEF A;  1ZQX A;  4ECR A;  4KLJ A;  4PGX A;  5CWR A;  3GV5 B;  4Z6D A;  5IIL A;  2KN7 A;  1KEJ A;  4RQ1 A;  5L1J A;  2PI5 A;  8ICB A;  1BGX T;  5KFN A;  2W9C A;  1QTM A;  4MFC A;  2IHM A;  2Q0Z X;  4FBU A;  4I2D A;  4RQ3 A;  2BPF A;  3SI8 A;  1T4G A;  5J2A A;  4DL3 A;  1TK5 A;  4TUR A;  4F92 B;  4DOA A;  2IMW P;  8ICU A;  2I1Q A;  4QW8 A;  4YMN A;  3RJF A;  2KFZ A;  3NGD A;  7ICK A;  1JN3 A;  4B9V A;  3QEA Z;  4O3Q A;  4QWA A;  5DLF A;  4UB4 A;  4EYH B;  4R66 A;  5KFQ A;  3C2L A;  4JV1 A;  8ICH A;  3K4G A;  5L1I A;  3BQT A;  3G6Y A;  4I2A A;  2ASD A;  4Q8F A;  4F4Z A;  5D4B A;  5KG7 A;  5J0O A;  4MF8 A;  2J6U A;  2J6S A;  4I2G A;  1ZQV A;  5J2E A;  9ICL A;  3UQ2 A;  4JWM A;  1TVA A;  3MR5 A;  5DQG A;  2MUT B;  2HVH A;  9ICT A;  3GDX A;  3V7L A;  4ECW A;  4Z6F A;  7ICR A;  5J2G A;  2BKE A;  1XU4 A;  3M8R A;  4QZA A;  3IHQ B;  5DQH A;  1Z00 B;  1RXV A;  4QWD A;  4YMO A;  3PW2 A;  1ZQS A;  5J29 A;  5J2B A;  2PFP A;  1WCN A;  5KFA A;  4YR2 A;  4F50 A;  4KTQ A;  2ZTC A;  1ZQZ A;  1KTQ A;  5DG9 A;  4F4Y A;  1B22 A;  2BCS A;  5KFT A;  4IQW A;  7ICV A;  4DWI A;  4C8K A;  4M0A A;  1ZQN A;  8ICY A;  8ICM A;  2HHV A;  5KT6 A;  3HP6 A;  3MR3 A;  2IA6 A;  3RTV A;  4G3I A;  2KZZ A;  4UB5 A;  2HW3 A;  4Z6E A;  4UB1 A;  4F4W A;  5CB1 A;  1NK7 A;  5J2J A;  4ED8 A;  1T7P A;  3EPI A;  4DQR A;  1T3N A;  4KMU A;  4ELV A;  2ZUB A;  3GIJ A;  9ICS A;  5HHI A;  5IIO A;  3PML A;  4BXO B;  3RAQ A;  3Q8M A;  5KFG A;  2C2R A;  2OWO A;  3C1Y A;  3V6K A;  5DGB A;  2W8K A;  4YR0 A;  5BPC A;  3PW7 A;  4NLG A;  5DBA A;  3M8S A;  4K4I A;  3MBY A;  4DLE A;  3T5J A;  4NLZ A;  2KFN A;  7ICT A;  1L3V A;  1ZQM A;  2FLN A;  4Z6C A;  1SKS A;  1XSN A;  5C5J A;  2FMP A;  3MAB A;  4R8U A;  3RB3 A;  3E2E A;  2ALZ A;  3LK9 A;  9ICQ A;  4RPX A;  9ICP A;  1S10 A;  5KFO A;  5DBB A;  4YMM A;  1KFS A;  3H8J A;  3ZDE A;  4UB3 A;  4I2H A;  4F4X A;  3AUO A;  3AU2 A;  4M6W A;  4F91 B;  3JPO A;  1Y88 A;  4B9N A;  4J9R A;  5KT5 A;  4R65 A;  8ICA A;  2XC9 A;  2FLL A;  2W9C B;  1S9F A;  1RYS A;  7ICG A;  4QZE A;  1DOQ A;  4I27 A;  4QZB A;  3SV3 A;  7ICL A;  4BDP A;  3OGU A;  3ZD8 A;  5KG0 A;  4ELT A;  4EBE A;  4DOB A;  4DSJ A;  3RAX A;  4RPY A;  4MFA A;  2ATL A;  5KFY A;  3RJI A;  1QSS A;  2BHN A;  3PR5 B;  5J2C A;  4KLS A;  3TAQ A;  5EWE A;  4DL2 A;  1ZQT A;  5J0S A;  3ZDA A;  3C23 A;  4K4H A;  1DGS A;  8ICG A;  4HYK A;  2GWS A;  2F1I A;  3PO4 A;  4J9Q A;  1NJX A;  1ZQP A;  4I2C A;  4F2S A;  4QZF A;  5KG2 A;  4QZH A;  3MGI A;  3B0Y A;  4KN7 A;  4B9T A;  3H7I A;  3V6H A;  1C7Y A;  3PV8 A;  7ICU A;  4O9M A;  9ICU A;  4KLM A;  4O3S A;  2KTQ A;  4MFF A;  4TQS A;  5L1L A;  4JUZ A;  4QZ8 A;  2XO7 A;  2BCU A;  1ZQA A;  5J2D A;  4YVZ A;  7ICO A;  3JPT A;  1ARO P;  3NTU A;  4ED7 A;  9ICJ A;  1MSW D;  2BPC A;  4NM1 A;  4YD1 A;  3MR2 A;  1CUK A;  3N4M B;  4RNM A;  2XY5 A;  2W9M A;  3BQ0 A;  4KLO A;  8ICR A;  4DLG A;  5BOL A;  4DSL A;  5KFS A;  3G6X A;  5J0P A;  1U9L A;  2W8L A;  4YXJ A;  4KLL A;  4P2H A;  2MAX A;  4BWJ A;  5CHG A;  4EBC A;  2BPG A;  1HUZ A;  3ZDC A;  4C8L A;  4LVS A;  9ICA A;  2FPK A;  2HHW A;  3C2K A;  5J0Q A;  4DFK A;  4TQR A;  4XUS A;  3SV4 A;  1TAU A;  3TFS A;  3OHB A;  4C8N A;  1X9M A;  2JZB A;  4UB2 A;  9ICO A;  1RPL A;  5TZV A;  2C2D A;  3QEB Z;  2R8H A;  4RQ6 A;  3JPS A;  4J9O A;  7ICQ A;  1S0V A;  2ZTD A;  3ISC A;  8ICS A;  4R8U B;  3RBE A;  1XSP A;  5EOZ A;  3EWA A;  9ICB A;  2ASJ A;  4MEX A;  9ICX A;  4EZ9 A;  3RRH A;  5KFF A;  3PW5 A;  3PW4 A;  4RNN A;  3PX0 A;  4M6W B;  4IR9 A;  3RRG A;  8ICO A;  3T5K A;  3C21 A;  4RQ0 A;  4RQ4 A;  2ZJ8 A;  3M9N B;  3N97 B;  1U48 A;  1HUO A;  5HML A;  1TFR A;  5KFH A;  5J2H A;  4ECV A;  1D8Y A;  5DB7 A;  3V7J A;  2PI4 A;  3PR4 A;  3M9M B;  3H8W A;  4F5Q A;  4DQI A;  2NRX A;  4KLU A;  8ICZ A;  2Y1I A;  1JIH A;  1MC8 A;  1NJY A;  1KDH A;  4JV2 A;  2C28 A;  4F5N A;  8ICF A;  5J2F A;  5EWF A;  5KFP A;  4FS1 A;  2R8K A;  1BVS A;  3MFI A;  2LYH A;  2XCP A;  4ED1 A;  3LWM A;  1T8E A;  3RJG A;  3EZ5 A;  2V4R A;  4YFK A;  2JEI A;  1A77 A;  1UA0 A;  2KZ3 A;  5KT3 A;  7ICM A;  4NXZ A;  3T5L A;  3OJU A;  5KFC A;  1TK0 A;  4DSI A;  3EYZ A;  1JXE A;  4RUA A;  4DF8 A;  3RJE A;  4XA5 A;  1L3T A;  1EXN A;  2NRW A;  2ZJA A;  4QWE A;  2ISP A;  4DQS A;  1RYR A;  4F2R A;  4KLI A;  1BPX A;  1BPB A;  2M9N A;  4O3N A;  4YQW A;  3MR6 A;  1CEZ A;  3KHL A;  5HMM A;  3Q8S B;  4IR1 A;  3C2M A;  2P66 A;  2A1J A;  3HWT A;  1NKB A;  3MDA A;  1QSL A;  8ICC A;  2UVU A;  4PPX A;  4B9U A;  5DDY A;  2H5X A;  4O3P A;  4DFJ A;  3RBD A;  2IHN A;  5J0W A;  2PXI A;  3TFR A;  9ICF A;  2VA2 A;  4XRH A;  4NLN A;  4X5V A;  2HHQ A;  4ZH4 A;  4KLF A;  5EWG A;  2DFL A;  4ED2 A;  4F5O A;  4GC7 A;  4DL5 A;  1MQ2 A;  2BCR A;  1NK6 A;  1L3U A;  2PFN A;  1BPE A;  7ICN A;  3PX6 A;  3GQC A;  3PVX A;  4R64 A;  1SZP A;  3RH5 A;  5D46 A;  1ZJN A;  4J9M A;  2AGP A;  1SKR A;  3ISD A;  3JPQ A;  2FPL A;  4KLT A;  5DQI A;  7ICE A;  4YP3 A;  3H40 A;  2JEG A;  4KLG A;  3OSN A;  2W9B A;  4P4M A;  1XWL A;  4BGD A;  3TQ1 A;  1NK4 A;  1MQ3 A;  4KLD A;  2HHX A;  4KN4 A;  5KG3 A;  2W9A A;  3ZD9 A;  3RB0 A;  5KFW A;  3SZ2 A;  1S0O A;  8ICL A;  9ICW A;  8ICP A;  5J0X A;  2PFO A;  4IRD A;  4Q8E A;  1L5U A;  8ICI A;  4O3R A;  3BDP A;  5F9N A;  3KHH A;  2XY6 A;  1LV5 A;  3OJS A;  7ICI A;  4LZG A;  2VA8 A;  4YCX A;  1X9W A;  4QW9 A;  1K1Q A;  5CR0 A;  4UAY A;  2UVR A;  3H4B A;  3C5G A;  4DL6 A;  4PHE A;  4DFP A;  4GXJ A;  4I29 A;  3PW0 A;  1ZQI A;  4QZ9 A;  4MEY A;  4DOC A;  4UBB A;  1RXW A;  1X2I A;  9ICE A;  2F1H A;  1KFT A;  1TV9 A;  1QSY A;  2UVW A;  4ELU A;  1IXR A;  5HHH A;  3RR8 A;  3RH4 A;  2BCV A;  1ZQU A;  3HT3 A;  2C22 A;  1U4B A;  1S0N A;  3UXP A;  1PZN A;  4KLQ A;  5CJ7 A;  3KHR A;  4ECT A;  4ED6 A;  1KSP A;  4B9S A;  2R8G A;  3GV8 B;  1B43 A;  3KHG A;  2P6R A;  3ZDD A;  2J6T A;  7ICH A;  8ICN A;  2FMS A;  4GC6 A;  1NOM A;  4JV0 A;  5DG8 A;  3JPR A;  3TI0 A;  5L9X A;  7ICS A;  2P6U A;  4MF2 A;  1S77 D;  3BQ1 A;  3TAP A;  1S97 A;  4RU9 A;  2BGW A;  5BOM A;  3GIM A;  4DS4 A;  3LWL A;  2A1J B;  4DFM A;  4RNO A;  4QWC A;  4P4O A;  5DB9 A;  2JEJ A;  2IBK A;  1A76 A;  2ZUD A;  4PHD A;  4C8O A;  3QZ8 A;  5IIK A;  3B0X A;  5IIJ A;  5DGA A;  3UPQ A;  5DB6 A;  1NK8 A;  1ZQL A;  1NKC A;  3K75 D;  9ICH A;  1JXL A;  2ZUC A;  9ICK A;  8ICX A;  4M04 A;  2AGQ A;  3ISB A;  1UT5 A;  3BQ2 A;  5IIM A;  4IRK A;  2ASL A;  3C5F A;  4C8M A;  1ZQG A;  1D9F A;  5KT4 A;  4DF4 A;  3THV A;  2FMQ A;  4BXO A;  2HHT A;  3GV7 B;  4EYI B;  1ZQQ A;  4XQ8 A;  4M9L A;  4J9K A;  4F5P A;  5KFZ A;  3PX4 A;  1ZQJ A;  2W9B B;  2XGQ A;  2R8J A;  1K1S A;  4M9J A;  2R8I A;  2AJQ A;  8ICW A;  4YXM A;  4R63 A;  2AQ4 A;  1ZET A;  2DPI A;  5IIN A;  1HJP A;  4FS2 A;  2BDP A;  3QZ7 A;  4M9N A;  3UXO A;  1S0M A;  2NRT A;  4ECQ A;  4M47 A;  3PNC A;  4YG2 A; 
#chains in the Genus database with same CATH topology
 4O5K A;  3LDA A;  2VA3 A;  2VIX A;  4EX7 A;  3AEV A;  3RJJ A;  2JHD A;  3LVV A;  2AQ0 A;  3EW9 A;  1ED1 A;  1UA1 A;  4ECX A;  4C7Y A;  5ALS A;  3NAS A;  5KFE A;  1GO3 F;  1WCL A;  5ALF A;  5GTH U;  5AM0 A;  1N48 A;  5ALL A;  1L7O A;  3JPP A;  2B21 A;  4F4K A;  1JRP A;  2ZG6 A;  5ALR A;  3F53 A;  3UQ0 A;  4DQP A;  1NJZ A;  3OSP A;  3ZDB A;  3IM1 A;  1ZQC A;  3QE9 Y;  4FBT A;  2GO7 A;  3RF9 A;  2DGZ A;  5J0T A;  2ISO A;  9ICG A;  3VCB A;  4RQ8 A;  5AM5 A;  4RUC A;  2AGO A;  2VJ4 A;  2KJ9 A;  8ICQ A;  2ZIU A;  2D8C A;  3O0F A;  2BQU A;  3N28 A;  4IQT A;  1X6J A;  5AKZ A;  1BPZ A;  2WF8 A;  3FDS A;  1QLN A;  3UMC A;  4J9L A;  4DSE A;  2L5Y A;  2G06 A;  8ICK A;  2RHF A;  3FYH A;  9ICC A;  3CW2 C;  1H38 A;  3GIL A;  4Q45 A;  3HPO A;  2E8M A;  5KFD A;  3SYZ A;  1SL1 A;  2OH2 A;  2YMM A;  5DB8 A;  4B9M A;  2I9G A;  2HBM A;  2F2A B;  3BQ7 A;  3RJK A;  1NK5 A;  1ZQD A;  3A0H U;  3V72 A;  2GLE A;  4P0Q B;  2ZJ5 A;  1L7M A;  9ICR A;  2VAN A;  3IG8 A;  2KZM A;  2FPM A;  1SGG A;  4PGQ A;  2WB1 F;  2YX8 A;  3N7R C;  3ORY A;  3QU4 A;  3RB6 A;  1ZQE A;  5KFK A;  2B6G A;  2K89 A;  4DFD A;  2E5S A;  3UMG A;  4PGX A;  3PSF A;  1L8O A;  1KEJ A;  4KX5 A;  5KFN A;  5ALU A;  2IHM A;  3PZP A;  4FBU A;  4RQM A;  1TK5 A;  2G5I B;  4F92 B;  2B0C A;  4TUR A;  1XNS A;  3RJF A;  2KEY A;  4O3Q A;  4QWA A;  1B0X A;  1PUZ A;  2NO4 A;  5DLF A;  4UB4 A;  4UAR A;  5KFQ A;  1X40 A;  4JV1 A;  3BQT A;  4F4Z A;  1TAM A;  5J2E A;  2RQ5 A;  2HVH A;  3V7L A;  5DQH A;  1RXV A;  3BZC A;  2HOQ A;  1WCN A;  3VC8 A;  4YR2 A;  4F50 A;  4KTQ A;  2KOB A;  4F4Y A;  2JH7 A;  2HHV A;  3A0B U;  3HP6 A;  2IA6 A;  4CRX A;  2HW3 A;  5CB1 A;  2LPE A;  1T3N A;  4KMU A;  3GIJ A;  2C2R A;  5KFG A;  3DV9 A;  5DGB A;  4OJ6 A;  3M8S A;  3T5J A;  5AI4 A;  2HSZ A;  3MGV A;  1C20 A;  1XSN A;  5C5J A;  2RLT A;  4QIW C;  2FMP A;  5KFO A;  4I2H A;  3I28 A;  3H8J A;  4UB3 A;  4F4X A;  3JPO A;  2AHO B;  4R65 A;  8ICA A;  2K4I A;  2XC9 A;  7ICG A;  1DOQ A;  4I27 A;  4QZB A;  2OEH A;  1KL9 A;  3SV3 A;  3ZD8 A;  5KG0 A;  2ZIV A;  3RAX A;  4MFA A;  1PVP A;  5AKG A;  2BHN A;  3PR5 B;  3F5A A;  3TAQ A;  2KIV A;  5J0S A;  4K4H A;  2GWS A;  4CNQ A;  2KKV A;  3WKC A;  1KKX A;  2H3I A;  2PMZ F;  5AI9 A;  4QZF A;  5KG2 A;  3B0Y A;  4B9T A;  7ICU A;  3V6H A;  3PV8 A;  4O3S A;  5ALV A;  5J2D A;  1ARO P;  3TAD A;  9ICJ A;  5AKX A;  1MSW D;  5JTI A;  4YD1 A;  3IP4 B;  3N4M B;  2XY5 A;  2W9M A;  5J8Y C;  5ALQ A;  1U9L A;  5B66 U;  2W55 A;  2JMG A;  2FPK A;  1N5W A;  2H3Z A;  4DFK A;  2E8N A;  1TAU A;  1X9M A;  3OHB A;  9ICO A;  3QEB Z;  4RQ6 A;  2D6F C;  7ICQ A;  1S0V A;  1HIW A;  3RBE A;  3AL0 B;  4EZ9 A;  2JXJ A;  3PX0 A;  8ICO A;  3N97 B;  3BS5 A;  3CNH A;  5AKH A;  5HML A;  1TFR A;  4ECV A;  3OPX A;  4KLU A;  5ALT A;  8ICZ A;  1JIH A;  4JV2 A;  5ALM A;  2C28 A;  2KJ5 A;  1L8L A;  2QB0 B;  5J2F A;  1SV4 A;  2R8K A;  4UAS A;  1T8E A;  3RJG A;  2EZZ A;  1FIQ A;  4CGZ A;  2K4H A;  2KZ3 A;  1TK0 A;  4G9B A;  3EYZ A;  4WJ3 B;  1L3T A;  4F2R A;  4KLI A;  4YQW A;  1OXJ A;  1WWV A;  3HWT A;  1QSL A;  3NRW A;  5KAI U;  3RBD A;  9ICF A;  5K4L A;  2G07 A;  4XRH A;  4NLN A;  4ZH4 A;  5EWG A;  4JMU A;  4OCZ A;  2Z7J A;  1NK6 A;  4IC9 A;  3GQC A;  3PVX A;  3PST A;  1SZP A;  3RH5 A;  3KD3 A;  1ZJN A;  4J9M A;  1SKR A;  1N60 A;  5GTI U;  3JPQ A;  3E58 A;  3H40 A;  3NVW A;  3TQ1 A;  1MQ3 A;  2W9A A;  1S0O A;  5KFW A;  3SZ2 A;  2I6X A;  5FP0 A;  2E1E A;  5ALY A;  5F9N A;  1LV5 A;  2VA8 A;  4YCX A;  1NI3 A;  1K1Q A;  1X42 A;  4IS7 A;  3H4B A;  4DFP A;  3PW0 A;  1ZQI A;  4QZ9 A;  4MEY A;  2AXT U;  1RXW A;  9ICE A;  3IV6 A;  2ES6 A;  3SQI A;  2W04 A;  2KJ8 A;  3N7P D;  2BCV A;  1ZQU A;  1S0N A;  3GZF A;  2HBJ A;  1KSP A;  4LJX A;  2R8G A;  1J2N A;  2YN4 A;  1XO0 A;  3KHG A;  2J6T A;  8ICN A;  3AMZ A;  1ZRN A;  4GC6 A;  3TKA A;  1ZRM A;  2WF9 A;  1S77 D;  3BQ1 A;  1S97 A;  4DFM A;  4P4O A;  1DXS A;  1YZ7 A;  3ONN A;  5DB6 A;  3L4P A;  1PK3 A;  1NKC A;  1ZOL A;  1ZQL A;  3FAH A;  5CEH A;  9ICH A;  2ZUC A;  4M04 A;  5ALK A;  4IL6 U;  1UT5 A;  3BQ2 A;  4IRK A;  2ASL A;  1D9F A;  5KT4 A;  2QAR B;  4DF4 A;  4Y2U A;  4F5P A;  1ZQJ A;  2W9B B;  2YB4 A;  2R8I A;  2AJQ A;  1T3Q A;  8ICW A;  2ZIX A;  1FO4 A;  4FS2 A;  4M47 A;  3PNC A;  9ICN A;  2BQ3 A;  5DDM A;  3GIK A;  5AKI A;  1Q46 A;  2F3N A;  3G6V A;  1NK9 A;  4U7C A;  4CE6 A;  4DSK A;  1KBU A;  4EEN A;  1L3S A;  3BJY A;  2ZTE A;  3T3F A;  2UVV A;  1ZQB A;  1SKW A;  5HP4 A;  1NZB A;  3WK4 A;  1JMS A;  4F8R A;  4OJL A;  2F1J A;  1B4F A;  4RPZ A;  5KT2 A;  4O0I A;  1BPY A;  7ICF A;  5DG7 A;  5KG5 A;  5KTQ A;  4ED0 A;  4EX6 A;  2KVC A;  5CA7 A;  3V7K A;  3ETL A;  4QWB A;  3BS7 A;  4IQU A;  3PMN A;  4NJ8 A;  4PH5 A;  1ZJM A;  3WKD A;  2WTF A;  5ALW A;  1Z4N A;  4JWN A;  1XO1 A;  3WKB A;  4DL7 A;  5DLG A;  1WUD A;  4F3O A;  3MGH A;  1YZ6 A;  3ALR A;  4P4P A;  4PHP A;  5HNK A;  1ZYQ A;  9ICI A;  4C4S A;  1COO A;  4C7Z A;  4DO9 A;  3T5H A;  4TUQ A;  4FZN A;  3M7D A;  2KSO B;  4UAZ A;  1UT8 A;  3WK8 A;  4FZL A;  1LB2 B;  4ECU A;  1URJ A;  1UHU A;  1F44 A;  4DSF A;  4M2Y A;  4NWI A;  4O3M A;  4Y2V A;  4J9P A;  2EZX A;  1Q3U A;  2E3T A;  5L1M A;  3EPG A;  5J0U A;  3BZK A;  2Q4T A;  1ZQW A;  3KTQ A;  4DL4 A;  1Z00 A;  2XCA A;  4TUP A;  4ED3 A;  2XGP A;  3M9O B;  5F9L A;  4DQQ A;  3F2B A;  1D8B A;  4Y2S A;  5KFJ A;  3I76 A;  1NK0 A;  3QUT A;  1ZQO A;  2DUY A;  1QQ5 A;  4FO6 A;  3PY8 A;  2K4P A;  3DEE A;  5J2I A;  3MDC A;  4J9N A;  1D8L A;  1D9D A;  4PJ0 U;  3H0L B;  1ZQY A;  1BPD A;  4Q44 A;  5ALN A;  4DEZ A;  5AI6 A;  4KLJ A;  1SV0 A;  2XID A;  2JR5 A;  2BZF A;  2KN7 A;  5L1J A;  5ALE A;  8ICB A;  1BGX T;  1QTM A;  4I2D A;  3SI8 A;  1MN8 A;  1T4G A;  1NZP A;  4DOA A;  3NGD A;  4B9V A;  2EAN A;  3OTQ A;  4I2A A;  5L1I A;  5KG7 A;  2J6U A;  4NLB A;  1VDV A;  9ICL A;  1ZXI A;  4JWM A;  5DQG A;  4ECW A;  2LYB A;  1SWW A;  2BKE A;  1N61 A;  4QZA A;  3IHQ B;  4QWD A;  4PL1 A;  3PW2 A;  5J29 A;  2PFP A;  1ZQZ A;  4PZO A;  4IQW A;  4C8K A;  5KT6 A;  3MR3 A;  4G3I A;  2KZZ A;  1NK7 A;  1Z4O A;  1NNL A;  2HOF A;  2OCE A;  2LM1 A;  4NV0 A;  2O6K A;  5B5E U;  4YR0 A;  4EEL A;  5BPC A;  3PW7 A;  2A1A A;  4NLZ A;  2KFN A;  1ZQM A;  2WF6 A;  4R8U A;  3E2E A;  3RB3 A;  3PSI A;  1PK1 A;  9ICQ A;  4RPX A;  4F72 A;  5EE3 A;  1S10 A;  5DBB A;  2H3V A;  3AU2 A;  4M6W A;  3M6Z A;  4F91 B;  1Y88 A;  4J9R A;  1DK2 A;  5KT5 A;  1SXE A;  1S9F A;  1RYS A;  4QZE A;  4BDP A;  4EBE A;  2F8K A;  4DOB A;  4DSJ A;  5KFY A;  1RQN A;  3RJI A;  3CYM A;  3RFA A;  5EWE A;  3PSP A;  1DGS A;  2F1I A;  4J9Q A;  1RDF A;  3I1Y A;  4QZH A;  4KN7 A;  1C7Y A;  4MFF A;  2KG5 A;  4Y2Y A;  2HMX A;  5ALH A;  5E79 U;  3NTU A;  1ZD2 P;  4GFJ A;  3NVY A;  1IG6 A;  3NRZ A;  3EUB 2;  4UB8 U;  5BOL A;  4Y2J A;  4OJ5 A;  5KFS A;  5J0P A;  4P2H A;  3TAC B;  1LKY B;  4BWJ A;  4EBC A;  2HHW A;  5AK6 A;  1SIJ A;  3C28 A;  4XUS A;  3SV4 A;  2DF4 B;  3TFS A;  2RRD A;  3LVW A;  1RM6 C;  5TZV A;  3LYS A;  1ECW A;  4J9O A;  3ISC A;  9ICX A;  3EWA A;  2ASJ A;  4MEX A;  3PW5 A;  3PW4 A;  4IR9 A;  3RRG A;  3C21 A;  3SAH A;  5ALX A;  3UMB A;  1U48 A;  5KFH A;  9ICT A;  2ZIV B;  3H8W A;  2DL0 A;  5AK5 A;  4BX9 C;  1MC8 A;  4CDG A;  2BDU A;  3AM9 A;  2FI1 A;  3KZI U;  2YTU A;  2WF7 A;  3IDW A;  3KKA A;  3EZ5 A;  1UA0 A;  5KFC A;  1WYG A;  3D2Q A;  1EXN A;  2ZJA A;  4QWE A;  3SAG A;  4UW9 A;  1BPB A;  1BPX A;  1CEZ A;  3MR6 A;  1CI4 A;  5CRX A;  3KHL A;  3Q8S B;  4IR1 A;  2P66 A;  2HI0 A;  3M1Y A;  1NKB A;  2ODG A;  4UAT A;  2UVU A;  4PPX A;  4AYB F;  5DDY A;  2IHN A;  2PXI A;  2HHQ A;  4KLF A;  1MQ2 A;  2YMP A;  1O03 A;  7ICN A;  1SV0 C;  3PX6 A;  4R64 A;  2F8L A;  3QU2 A;  2FPL A;  4KLT A;  2JEG A;  2GH1 A;  1L7P A;  1XWL A;  2DKX A;  4KLD A;  5KG3 A;  1T94 A;  3RB0 A;  3QX7 A;  8ICL A;  9ICW A;  8ICP A;  3ICX A;  3BS5 B;  5J0X A;  4IRD A;  4Q8E A;  4O3R A;  3BDP A;  1PVR A;  1JRO A;  2LHT A;  7ICI A;  4LZG A;  3F5E A;  4FE3 A;  3E0F A;  5ALJ A;  4PHE A;  2EAP A;  1X2I A;  2F1H A;  1CRX A;  1TE2 A;  1JAL A;  1IXR A;  3HT3 A;  5TIS U;  3UXP A;  1PZN A;  1M6Y A;  5CJ7 A;  4KLQ A;  1P7D A;  2P6R A;  1N2X A;  7ICH A;  1NOM A;  3N7S C;  4JV0 A;  5DG8 A;  3WK7 A;  2P6U A;  1OUQ A;  2CRX A;  2IBK A;  1DK3 A;  1A76 A;  4PHD A;  5IIJ A;  3U26 A;  1Q3V A;  4Y2T A;  1NK8 A;  8ICX A;  3ISB A;  3C5F A;  5ALI A;  4CF3 A;  3IRU A;  3GV7 B;  4XQ8 A;  4M9L A;  4J9K A;  3PX4 A;  4UB6 U;  2R8J A;  2W7O A;  1HJP A;  3DDH A;  4YG2 A;  4RQ2 A;  2LI6 A;  4ECY A;  2NV3 A;  1U49 A;  4QJF B;  1K5O A;  4TUS A;  3TAN A;  5AK4 A;  3RB4 A;  1J97 A;  2W43 A;  2W03 A;  7ICJ A;  3GII A;  8ICT A;  2W54 A;  4NY8 A;  4PHA A;  4NLK A;  4ICA A;  1N5X A;  4BWM A;  1PVQ A;  4F5R A;  5III A;  4NM2 A;  1COK A;  2MRL A;  3NVZ A;  4I28 A;  1KFD A;  4DS5 A;  4GLX A;  4LZD A;  3TAR A;  1XS9 D;  3MC1 A;  2JZB B;  5AHX A;  1X6I A;  4KIT B;  3GFK B;  4RQ5 A;  4QZG A;  2V4Q A;  1U45 A;  2W7P A;  4RT3 A;  5F3X B;  4I2B A;  2M0N A;  1KLN A;  2IOF K;  4YD2 A;  2AU0 A;  5KT7 A;  5J0R A;  4PGY A;  5JRT A;  5AIA A;  5AKK A;  4I2I A;  2NRZ A;  3Q8Q B;  1TKD A;  4U6P A;  2PFQ A;  1N63 A;  3Q8L A;  4EEY A;  2ZIX B;  5KFR A;  1QH9 A;  2V9W A;  3L3F X;  4UBC A;  2FDR A;  3J81 j;  2GOL A;  3C1Z A;  4UAW A;  4I2F A;  1Z1B A;  4B9L A;  4UQG A;  2KMD A;  3NS1 A;  5KFI A;  2Y1J A;  2DKZ A;  2XI9 A;  2RDI A;  1V38 A;  2QB0 A;  9ICM A;  3R9K A;  4JB3 A;  3KFU F;  1JUD A;  5KFM A;  4J9S A;  2MUT A;  2QB1 A;  2HOI A;  1KRP A;  5AM3 A;  5J2K A;  4ACO A;  3Q8P B;  3Q8R B;  4EZ6 A;  1SL2 A;  5KFU A;  5KG4 A;  4QZI A;  4I2J A;  3K1Z A;  5KFB A;  4RQN A;  4E0D A;  2K8B B;  2NO5 A;  3NVV A;  2NRV A;  1QCK A;  1ZQH A;  1Z3E B;  2HDO A;  4IRC A;  1ZQK A;  1KW4 A;  1TAQ A;  5KFX A;  5KFL A;  5J0Y A;  4NLC A;  1ZD5 A;  2JV3 A;  5DKW A;  1SL0 A;  3MFH A;  2BR0 A;  1U47 A;  1UCV A;  1ZQR A;  4P0P A;  5KAF U;  5KFV A;  2JEF A;  2G5H B;  1ZQX A;  4ECR A;  4FFD A;  3GV5 B;  2NYV A;  5IIL A;  4RQ1 A;  2PI5 A;  2W9C A;  2AH5 A;  2CN1 A;  4MFC A;  2Q0Z X;  5J2A A;  2CXY A;  1QQ6 A;  3TAD C;  4QW8 A;  1ZD4 A;  2LMR A;  4AYB C;  1DRG A;  4EYH B;  3C2L A;  3G6Y A;  3NUQ A;  5AKJ A;  2J6S A;  2K8C B;  4I2G A;  1ZQV A;  2HCF A;  2WAQ F;  3UQ2 A;  1TVA A;  3GDX A;  2WHE A;  4Z6F A;  7ICR A;  5J2G A;  4C80 A;  1XU4 A;  3M8R A;  1Z00 B;  3CRX A;  2ZTC A;  2BCS A;  5KFT A;  1JI7 A;  4DWI A;  4M0A A;  1ZQN A;  3SMV A;  1IIP A;  3K1R B;  3RTV A;  4PZN A;  4UB5 A;  1ZD3 A;  3KZX A;  4UB1 A;  4F4W A;  2A3V A;  4ED8 A;  1T7P A;  3EPI A;  2KIW A;  4ELV A;  2ZUB A;  4OJO A;  9ICS A;  5HHI A;  3PML A;  4BXO B;  3KOO A;  2OWO A;  3V6K A;  1S5L U;  1OW5 A;  3MBY A;  4Z6C A;  1SKS A;  4OO1 J;  2ALZ A;  9ICP A;  3ZDE A;  3AUO A;  2WFA A;  1QQ7 A;  2N1R A;  2MSN A;  2FLL A;  1VJ5 A;  3OGU A;  2I5H A;  4RPY A;  4C0Z A;  3H0R B;  3WKE A;  5J2C A;  4KLS A;  3QU5 A;  4US8 A;  4DL2 A;  1ZQT A;  2KKP A;  1BNO A;  3C23 A;  1Z1V A;  1NJX A;  4I2C A;  4F2S A;  5AKY A;  2ZXH A;  4O9M A;  2KTQ A;  3QU9 A;  4TQS A;  4JUZ A;  2BCU A;  7ICO A;  1SB3 C;  3QUB A;  4ED7 A;  2W3R A;  3WU2 U;  5AIC A;  4NM1 A;  2EDU A;  3MR2 A;  1CUK A;  4RNM A;  3AN1 A;  4KLO A;  3BQ0 A;  8ICR A;  3G6X A;  2W8L A;  4YXJ A;  3HKZ C;  1X66 A;  2MAX A;  2YB1 A;  5CHG A;  1WWU A;  4LVS A;  1HUZ A;  2F44 A;  4ZOH C;  2R18 A;  4CF4 A;  4C8N A;  4UB2 A;  4BUG A;  1RPL A;  3JPS A;  2ZIU B;  2ZTD A;  9ICB A;  8ICS A;  4B6J A;  4R8U B;  1XSP A;  5EOZ A;  3RRH A;  2HBL A;  4M6W B;  5ALP A;  3T5K A;  4RQ0 A;  3IN5 A;  1RG6 A;  2ZJ8 A;  1HUO A;  2PKE A;  2K4E A;  2PI4 A;  1D8Y A;  3V7J A;  5DB7 A;  4F5Q A;  3M9M B;  4DQI A;  2KSO A;  2Y1I A;  5AM2 A;  4OD0 A;  8ICF A;  3B9J A;  5KFP A;  2P35 A;  1BVS A;  2LYH A;  4ED1 A;  1KQQ A;  5EE0 A;  5KT3 A;  2IOH A;  7ICM A;  3T5L A;  4DSI A;  3OJU A;  1MA7 A;  4RUA A;  2Y9T A;  3UM9 A;  4DQS A;  3WK9 A;  1RYR A;  1N62 A;  4O3N A;  2ZIW A;  2QLT A;  2A1J A;  4B9U A;  4O3P A;  4DFJ A;  5J0W A;  3TFR A;  4X5V A;  2DFL A;  1L3U A;  2LYA A;  3QUQ A;  4A8E A;  2W11 A;  1DGJ A;  4Y2X A;  2KVS A;  5J8Y A;  4PL2 A;  5DQI A;  4YP3 A;  4KLG A;  3OSN A;  4P4M A;  1NK4 A;  2HHX A;  4KN4 A;  3ZD9 A;  2PFO A;  1L5U A;  5AKE A;  4QW9 A;  5CR0 A;  2UVR A;  3C5G A;  1L6N A;  2DQN B;  4GXJ A;  1O08 A;  4DOC A;  2KE7 A;  2VKQ A;  5AI0 A;  1KFT A;  1QSY A;  2VJ5 A;  3RH4 A;  2C22 A;  3KHR A;  4ECT A;  4B9S A;  3D2S A;  3GV8 B;  2G0A A;  2KHV A;  3ZDD A;  1RYU A;  2FMS A;  3JPR A;  2KIC A;  4MF2 A;  5EE1 A;  4RU9 A;  2BGW A;  5BOM A;  3GIM A;  4DS4 A;  4RNO A;  3ETR A;  2JEJ A;  2ZUD A;  4C8O A;  5DGA A;  3UPQ A;  2CPR A;  3H8M A;  3K75 D;  4UAV A;  5ALO A;  2XVT A;  5IIM A;  4F71 A;  4C8M A;  5ALD A;  2FMQ A;  3SAF A;  1V85 A;  2WAQ C;  5KFZ A;  2XIC A;  2FE9 A;  1AQ6 A;  4YXM A;  3F2D A;  2AQ4 A;  2YML A;  5IIN A;  1S0M A;  2NRT A;  1SXD A;  4OJP A;  4ECQ A;  5HR7 A;  5JUM A;  8ICV A;  4M9H A;  4O3O A;  9ICV A;  2XY7 A;  3OHA A;  1XC9 A;  1ZQF A;  5G5H A;  3PO5 A;  7ICP A;  2RDJ A;  2HHS A;  3RH6 A;  2KP7 A;  4CCH A;  1RZT A;  2G09 A;  3HW8 A;  4EBD A;  2KV2 A;  1NJW A;  1HEK A;  4Y2Q A;  1Q8K A;  4KX3 A;  5CP2 A;  4J03 A;  1XSL A;  4P0Q A;  4FZM A;  3QU7 A;  4JK1 A;  4ECZ A;  1ZQ1 C;  4O5C A;  5H2F U;  4IQV A;  2BCQ A;  4F93 B;  5AKL A;  3D6J A;  2KD1 A;  3GU3 A;  5L1K A;  1A0P A;  4C4R A;  2C2E A;  5KG1 A;  3HJE A;  1TK8 A;  2FLP A;  1LKY A;  1V9P A;  3FC4 A;  4I2E A;  5HR6 A;  2YQE A;  2OYY A;  3H4D A;  4GXK A;  3AU6 A;  4RZR A;  4QZD A;  1FEZ A;  4GXI A;  4KLE A;  2G08 A;  1X9S A;  3RR7 A;  1NKE A;  5KG6 A;  4RT2 A;  5G5G A;  1KN5 A;  4O5E A;  1N56 A;  4K4G A;  3HRD D;  2MA1 A;  8ICE A;  5T14 A;  1JX4 A;  4YR3 A;  2BQR A;  3UXN A;  3HX0 A;  5JU5 A;  3QXG A;  8ICJ A;  1SWV A;  2KHQ A;  1S76 D;  4Q43 A;  5D49 A;  2HHU A;  1RQL A;  4UAU A;  1IM4 A;  3RJH A;  2Y0S F;  3JPN A;  5DBC A;  3V6J A;  1Z19 A;  4M9G A;  2DPJ A;  1VLB A;  3S6J A;  2EH9 A;  2HVI A;  1UPH A;  4BJQ A;  1IV8 A;  4ECS A;  4KLH A;  3H8S A;  2JRZ A;  3Q8K A;  4QZC A;  4RQ7 A;  4YN4 A;  3HKZ F;  3L5K A;  4NL9 A;  5C0Y A;  5CWR A;  4Z6D A;  2JGA A;  2JH1 A;  3CP8 A;  4RQ3 A;  2BPF A;  2EQY A;  4DL3 A;  5AM1 A;  4DCC A;  2IMW P;  8ICU A;  2I1Q A;  4YMN A;  2KFZ A;  7ICK A;  1JN3 A;  3QEA Z;  4R66 A;  8ICH A;  3K4G A;  4Q8F A;  5KL1 B;  2ASD A;  5D4B A;  5J0O A;  4MF8 A;  2OHF A;  2W3S A;  1FFU A;  3MR5 A;  2MUT B;  2OXO A;  4YMO A;  1ZQS A;  5J2B A;  5KFA A;  1B22 A;  3T79 A;  5DG9 A;  1KTQ A;  7ICV A;  1BNP A;  8ICY A;  8ICM A;  2EZY A;  2D3D A;  4Z6E A;  5J2J A;  4DQR A;  2E8P A;  2F76 X;  5IIO A;  3RAQ A;  3Q8M A;  2EAO A;  3C29 A;  3C1Y A;  2W8K A;  4NLG A;  5DBA A;  4K4I A;  4DLE A;  7ICT A;  1L3V A;  2FLN A;  4P0P B;  2ESE A;  3MAB A;  3LK9 A;  2IOF A;  4YMM A;  1KFS A;  4GIB A;  3QYP A;  5AIB A;  4B9N A;  3KKA C;  2W9C B;  7ICL A;  4ELT A;  2ATL A;  1QSS A;  2HBK A;  1L7N A;  3ZDA A;  8ICG A;  4HYK A;  3PO4 A;  2RP5 A;  1S8O A;  1ZQP A;  2K60 A;  2H3Q A;  3MGI A;  4MHV A;  3H7I A;  3KBB A;  9ICU A;  4KLM A;  1A6S A;  2WB1 C;  5L1L A;  4QZ8 A;  2XO7 A;  1ZQA A;  4YVZ A;  2K8A A;  3JPT A;  3AQE A;  5AI5 A;  2BPC A;  2DWQ A;  4USA A;  4DLG A;  4DSL A;  4KLL A;  4KMO B;  2EAM A;  9ICA A;  2BPG A;  3ZDC A;  4C8L A;  2E8O A;  3C2K A;  5J0Q A;  2A19 A;  3SEI A;  4TQR A;  2JZB A;  3FM9 A;  3M6K A;  2C2D A;  2R8H A;  3WKA A;  5KFF A;  3H0M B;  4RNN A;  4RQ4 A;  3M9N B;  5KL8 B;  1F0M A;  5J2H A;  3F2C A;  3PR4 A;  2ZXI A;  2H3F A;  2NRX A;  1NJY A;  1KDH A;  4F5N A;  1V97 A;  3D2N A;  1LVH A;  4US9 A;  5EWF A;  4FS1 A;  3SD7 A;  3MFI A;  2XCP A;  3LWM A;  2V4R A;  4YFK A;  2JEI A;  2LKY A;  1A77 A;  2LM4 A;  4NXZ A;  1JXE A;  4DF8 A;  3RJE A;  4XA5 A;  2F77 X;  2NRW A;  2ISP A;  3IG5 A;  3WK5 A;  2M9N A;  3ED5 A;  5HMM A;  3C2M A;  3MDA A;  8ICC A;  5AI8 A;  2E1F A;  2Y9U A;  2H5X A;  4EEK A;  2VA2 A;  4ED2 A;  4F5O A;  4GC7 A;  4DL5 A;  2WF5 A;  2BCR A;  2PFN A;  1X9X A;  1BPE A;  4NL9 C;  2YMQ A;  5KNI A;  3WK6 A;  2QAR A;  1J2M A;  5D46 A;  2AGP A;  1UQV A;  3ISD A;  7ICE A;  4QNL A;  2W9B A;  4BGD A;  5AM4 A;  2PMZ C;  5ALG A;  8ICI A;  2YY6 A;  3KHH A;  2XY6 A;  3OJS A;  1X9W A;  4UAY A;  4DL6 A;  3AQF A;  4I29 A;  2Y0S C;  1F5S A;  4CF5 A;  4UBB A;  5ALZ A;  3HIL A;  1TV9 A;  1SZH A;  2UVW A;  4QIW F;  4ELU A;  5HHH A;  3RR8 A;  1U4B A;  4ED6 A;  2OM6 A;  3ZI4 A;  2MU2 A;  1B43 A;  3SR6 A;  3QNM A;  5EE9 A;  4AP9 A;  3TI0 A;  5L9X A;  7ICS A;  4HAI A;  2QKQ A;  3TAP A;  2ZIW B;  5AK3 A;  2A1J B;  3LWL A;  4QWC A;  5DB9 A;  3QZ8 A;  5IIK A;  1YT3 A;  3B0X A;  3SEN A;  4Y2P A;  4C4T A;  2LBO A;  1WG8 A;  1JXL A;  9ICK A;  2AGQ A;  1PK1 B;  1ZQG A;  4Y2R A;  3QUC A;  3THV A;  4BXO A;  2KK0 A;  2HHT A;  5A0L A;  4EYI B;  1ZQQ A;  1FFV A;  2XGQ A;  1K1S A;  2DBY A;  4M9J A;  2FJ6 A;  4R63 A;  1ZET A;  2DPI A;  2BDP A;  3QZ7 A;  4M9N A;  3UXO A;  2KNJ A; 
#chains in the Genus database with same CATH homology
 5JUM A;  4RQ2 A;  4O5K A;  4ECY A;  3LDA A;  2BQ3 A;  5DDM A;  1U49 A;  2VA3 A;  8ICV A;  3GIK A;  4TUS A;  3TAN A;  4M9H A;  3RB4 A;  4O3O A;  9ICV A;  2XY7 A;  3G6V A;  1NK9 A;  3RJJ A;  3OHA A;  1XC9 A;  1ZQF A;  4DSK A;  9ICN A;  1L3S A;  7ICJ A;  3BJY A;  2ZTE A;  3T3F A;  3GII A;  2UVV A;  1ZQB A;  3PO5 A;  7ICP A;  1SKW A;  2AQ0 A;  2RDJ A;  8ICT A;  3EW9 A;  4NY8 A;  2HHS A;  5HP4 A;  3RH6 A;  1JMS A;  1UA1 A;  4F8R A;  4PHA A;  4ECX A;  2F1J A;  4NLK A;  4CCH A;  4RPZ A;  5KT2 A;  4O0I A;  1RZT A;  1BPY A;  3HW8 A;  5KFE A;  4EBD A;  4BWM A;  7ICF A;  5DG7 A;  1NJW A;  5KG5 A;  5KTQ A;  4ED0 A;  1WCL A;  4F5R A;  5III A;  5CP2 A;  4NM2 A;  5CA7 A;  3V7K A;  1XSL A;  3ETL A;  4QWB A;  4JK1 A;  4IQU A;  4ECZ A;  4O5C A;  3PMN A;  4IQV A;  2BCQ A;  4F93 B;  1N48 A;  4I28 A;  4PH5 A;  1KFD A;  4DS5 A;  3JPP A;  2B21 A;  4LZD A;  4GLX A;  3TAR A;  1ZJM A;  1XS9 D;  4F4K A;  5L1K A;  2C2E A;  2WTF A;  3UQ0 A;  4DQP A;  5KG1 A;  2JZB B;  4KIT B;  3GFK B;  4JWN A;  4RQ5 A;  4QZG A;  2V4Q A;  1U45 A;  1NJZ A;  1TK8 A;  2FLP A;  1V9P A;  4RT3 A;  3OSP A;  3ZDB A;  1XO1 A;  3IM1 A;  4DL7 A;  5DLG A;  3QE9 Y;  1ZQC A;  4I2B A;  4FBT A;  4F3O A;  1KLN A;  4YD2 A;  5J0T A;  2ISO A;  2AU0 A;  5KT7 A;  3MGH A;  3H4D A;  4GXK A;  3AU6 A;  9ICG A;  4PGY A;  5J0R A;  4PHP A;  5HNK A;  4RZR A;  4QZD A;  4RQ8 A;  4P4P A;  4RUC A;  1ZYQ A;  9ICI A;  1COO A;  4GXI A;  2AGO A;  4KLE A;  4I2I A;  2NRZ A;  3Q8Q B;  1TKD A;  4DO9 A;  8ICQ A;  1X9S A;  2PFQ A;  3RR7 A;  3T5H A;  4TUQ A;  2BQU A;  3Q8L A;  1NKE A;  4EEY A;  5KFR A;  4UAZ A;  4IQT A;  5KG6 A;  4RT2 A;  4UBC A;  2V9W A;  1UT8 A;  1BPZ A;  3FDS A;  3C1Z A;  1QLN A;  4UAW A;  1LB2 B;  4O5E A;  4ECU A;  1N56 A;  4I2F A;  4K4G A;  4DSF A;  4J9L A;  4B9L A;  4M2Y A;  4DSE A;  4UQG A;  8ICK A;  5KFI A;  8ICE A;  3FYH A;  9ICC A;  2Y1J A;  1H38 A;  4J9P A;  3GIL A;  1JX4 A;  2RDI A;  4YR3 A;  4Q45 A;  9ICM A;  2BQR A;  3HPO A;  3UXN A;  5KFD A;  3SYZ A;  1SL1 A;  3HX0 A;  5KFM A;  4J9S A;  5DB8 A;  4B9M A;  3EPG A;  2MUT A;  2I9G A;  8ICJ A;  5J0U A;  1ZQW A;  5J2K A;  1KRP A;  3KTQ A;  3RJK A;  4DL4 A;  1NK5 A;  1ZQD A;  1Z00 A;  1S76 D;  2XCA A;  3V72 A;  3Q8P B;  4TUP A;  3Q8R B;  4Q43 A;  4ED3 A;  4EZ6 A;  1SL2 A;  5KFU A;  5KG4 A;  5D49 A;  4QZI A;  2XGP A;  2HHU A;  4I2J A;  3M9O B;  2ZJ5 A;  5F9L A;  1IM4 A;  5KFB A;  3RJH A;  4DQQ A;  4E0D A;  3JPN A;  9ICR A;  2VAN A;  5DBC A;  3V6J A;  2NRV A;  2KZM A;  2FPM A;  5KFJ A;  4PGQ A;  1ZQH A;  4M9G A;  2DPJ A;  1NK0 A;  1ZQO A;  1Z3E B;  4IRC A;  4FO6 A;  1ZQK A;  3PY8 A;  3ORY A;  3RB6 A;  1TAQ A;  5KFX A;  5KFL A;  5J0Y A;  1ZQE A;  2HVI A;  5J2I A;  5KFK A;  3MDC A;  5DKW A;  1SL0 A;  4J9N A;  3MFH A;  2BR0 A;  4ECS A;  1U47 A;  1D8L A;  1ZQR A;  1D9D A;  4I2E A;  3H8S A;  4KLH A;  1ZQY A;  1BPD A;  4Q44 A;  3Q8K A;  4QZC A;  4RQ7 A;  5KFV A;  4DEZ A;  4YN4 A;  2JEF A;  1ZQX A;  4ECR A;  4KLJ A;  4PGX A;  5CWR A;  3GV5 B;  4Z6D A;  5IIL A;  2KN7 A;  1KEJ A;  4RQ1 A;  5L1J A;  2PI5 A;  8ICB A;  1BGX T;  5KFN A;  2W9C A;  1QTM A;  4MFC A;  2IHM A;  2Q0Z X;  4FBU A;  4I2D A;  4RQ3 A;  2BPF A;  3SI8 A;  1T4G A;  5J2A A;  4DL3 A;  1TK5 A;  4TUR A;  4F92 B;  4DOA A;  2IMW P;  8ICU A;  2I1Q A;  4QW8 A;  4YMN A;  3RJF A;  2KFZ A;  3NGD A;  7ICK A;  1JN3 A;  4B9V A;  3QEA Z;  4O3Q A;  4QWA A;  5DLF A;  4UB4 A;  4EYH B;  4R66 A;  5KFQ A;  3C2L A;  4JV1 A;  8ICH A;  3K4G A;  5L1I A;  3BQT A;  3G6Y A;  4I2A A;  2ASD A;  4Q8F A;  4F4Z A;  5D4B A;  5KG7 A;  5J0O A;  4MF8 A;  2J6U A;  2J6S A;  4I2G A;  1ZQV A;  5J2E A;  9ICL A;  3UQ2 A;  4JWM A;  1TVA A;  3MR5 A;  5DQG A;  2MUT B;  2HVH A;  9ICT A;  3GDX A;  3V7L A;  4ECW A;  4Z6F A;  7ICR A;  5J2G A;  2BKE A;  1XU4 A;  3M8R A;  4QZA A;  3IHQ B;  5DQH A;  1Z00 B;  1RXV A;  4QWD A;  4YMO A;  3PW2 A;  1ZQS A;  5J29 A;  5J2B A;  2PFP A;  1WCN A;  5KFA A;  4YR2 A;  4F50 A;  4KTQ A;  2ZTC A;  1ZQZ A;  1KTQ A;  5DG9 A;  4F4Y A;  1B22 A;  2BCS A;  5KFT A;  4IQW A;  7ICV A;  4DWI A;  4C8K A;  4M0A A;  1ZQN A;  8ICY A;  8ICM A;  2HHV A;  5KT6 A;  3HP6 A;  3MR3 A;  2IA6 A;  3RTV A;  4G3I A;  2KZZ A;  4UB5 A;  2HW3 A;  4Z6E A;  4UB1 A;  4F4W A;  5CB1 A;  1NK7 A;  5J2J A;  4ED8 A;  1T7P A;  3EPI A;  4DQR A;  1T3N A;  4KMU A;  4ELV A;  2ZUB A;  3GIJ A;  9ICS A;  5HHI A;  5IIO A;  3PML A;  4BXO B;  3RAQ A;  3Q8M A;  5KFG A;  2C2R A;  2OWO A;  3C1Y A;  3V6K A;  5DGB A;  2W8K A;  4YR0 A;  5BPC A;  3PW7 A;  4NLG A;  5DBA A;  3M8S A;  4K4I A;  3MBY A;  4DLE A;  3T5J A;  4NLZ A;  2KFN A;  7ICT A;  1L3V A;  1ZQM A;  2FLN A;  4Z6C A;  1SKS A;  1XSN A;  5C5J A;  2FMP A;  3MAB A;  4R8U A;  3RB3 A;  3E2E A;  2ALZ A;  3LK9 A;  9ICQ A;  4RPX A;  9ICP A;  1S10 A;  5KFO A;  5DBB A;  4YMM A;  1KFS A;  3H8J A;  3ZDE A;  4UB3 A;  4I2H A;  4F4X A;  3AUO A;  3AU2 A;  4M6W A;  4F91 B;  3JPO A;  1Y88 A;  4B9N A;  4J9R A;  5KT5 A;  4R65 A;  8ICA A;  2XC9 A;  2FLL A;  2W9C B;  1S9F A;  1RYS A;  7ICG A;  4QZE A;  1DOQ A;  4I27 A;  4QZB A;  3SV3 A;  7ICL A;  4BDP A;  3OGU A;  3ZD8 A;  5KG0 A;  4ELT A;  4EBE A;  4DOB A;  4DSJ A;  3RAX A;  4RPY A;  4MFA A;  2ATL A;  5KFY A;  3RJI A;  1QSS A;  2BHN A;  3PR5 B;  5J2C A;  4KLS A;  3TAQ A;  5EWE A;  4DL2 A;  1ZQT A;  5J0S A;  3ZDA A;  3C23 A;  4K4H A;  1DGS A;  8ICG A;  4HYK A;  2GWS A;  2F1I A;  3PO4 A;  4J9Q A;  1NJX A;  1ZQP A;  4I2C A;  4F2S A;  4QZF A;  5KG2 A;  4QZH A;  3MGI A;  3B0Y A;  4KN7 A;  4B9T A;  3H7I A;  3V6H A;  1C7Y A;  3PV8 A;  7ICU A;  4O9M A;  9ICU A;  4KLM A;  4O3S A;  2KTQ A;  4MFF A;  4TQS A;  5L1L A;  4JUZ A;  4QZ8 A;  2XO7 A;  2BCU A;  1ZQA A;  5J2D A;  4YVZ A;  7ICO A;  3JPT A;  1ARO P;  3NTU A;  4ED7 A;  9ICJ A;  1MSW D;  2BPC A;  4NM1 A;  4YD1 A;  3MR2 A;  1CUK A;  3N4M B;  4RNM A;  2XY5 A;  2W9M A;  3BQ0 A;  4KLO A;  8ICR A;  4DLG A;  5BOL A;  4DSL A;  5KFS A;  3G6X A;  5J0P A;  1U9L A;  2W8L A;  4YXJ A;  4KLL A;  4P2H A;  2MAX A;  4BWJ A;  5CHG A;  4EBC A;  2BPG A;  1HUZ A;  3ZDC A;  4C8L A;  4LVS A;  9ICA A;  2FPK A;  2HHW A;  3C2K A;  5J0Q A;  4DFK A;  4TQR A;  4XUS A;  3SV4 A;  1TAU A;  3TFS A;  3OHB A;  4C8N A;  1X9M A;  2JZB A;  4UB2 A;  9ICO A;  1RPL A;  5TZV A;  2C2D A;  3QEB Z;  2R8H A;  4RQ6 A;  3JPS A;  4J9O A;  7ICQ A;  1S0V A;  2ZTD A;  3ISC A;  8ICS A;  4R8U B;  3RBE A;  1XSP A;  5EOZ A;  3EWA A;  9ICB A;  2ASJ A;  4MEX A;  9ICX A;  4EZ9 A;  3RRH A;  5KFF A;  3PW5 A;  3PW4 A;  4RNN A;  3PX0 A;  4M6W B;  4IR9 A;  3RRG A;  8ICO A;  3T5K A;  3C21 A;  4RQ0 A;  4RQ4 A;  2ZJ8 A;  3M9N B;  3N97 B;  1U48 A;  1HUO A;  5HML A;  1TFR A;  5KFH A;  5J2H A;  4ECV A;  1D8Y A;  5DB7 A;  3V7J A;  2PI4 A;  3PR4 A;  3M9M B;  3H8W A;  4F5Q A;  4DQI A;  2NRX A;  4KLU A;  8ICZ A;  2Y1I A;  1JIH A;  1MC8 A;  1NJY A;  1KDH A;  4JV2 A;  2C28 A;  4F5N A;  8ICF A;  5J2F A;  5EWF A;  5KFP A;  4FS1 A;  2R8K A;  1BVS A;  3MFI A;  2LYH A;  2XCP A;  4ED1 A;  3LWM A;  1T8E A;  3RJG A;  3EZ5 A;  2V4R A;  4YFK A;  2JEI A;  1A77 A;  1UA0 A;  2KZ3 A;  5KT3 A;  7ICM A;  4NXZ A;  3T5L A;  3OJU A;  5KFC A;  1TK0 A;  4DSI A;  3EYZ A;  1JXE A;  4RUA A;  4DF8 A;  3RJE A;  4XA5 A;  1L3T A;  1EXN A;  2NRW A;  2ZJA A;  4QWE A;  2ISP A;  4DQS A;  1RYR A;  4F2R A;  4KLI A;  1BPX A;  1BPB A;  2M9N A;  4O3N A;  4YQW A;  3MR6 A;  1CEZ A;  3KHL A;  5HMM A;  3Q8S B;  4IR1 A;  3C2M A;  2P66 A;  2A1J A;  3HWT A;  1NKB A;  3MDA A;  1QSL A;  8ICC A;  2UVU A;  4PPX A;  4B9U A;  5DDY A;  2H5X A;  4O3P A;  4DFJ A;  3RBD A;  2IHN A;  5J0W A;  2PXI A;  3TFR A;  9ICF A;  2VA2 A;  4XRH A;  4NLN A;  4X5V A;  2HHQ A;  4ZH4 A;  4KLF A;  5EWG A;  2DFL A;  4ED2 A;  4F5O A;  4GC7 A;  4DL5 A;  1MQ2 A;  2BCR A;  1NK6 A;  1L3U A;  2PFN A;  1BPE A;  7ICN A;  3PX6 A;  3GQC A;  3PVX A;  4R64 A;  1SZP A;  3RH5 A;  5D46 A;  1ZJN A;  4J9M A;  2AGP A;  1SKR A;  3ISD A;  3JPQ A;  2FPL A;  4KLT A;  5DQI A;  7ICE A;  4YP3 A;  3H40 A;  2JEG A;  4KLG A;  3OSN A;  2W9B A;  4P4M A;  1XWL A;  4BGD A;  3TQ1 A;  1NK4 A;  1MQ3 A;  4KLD A;  2HHX A;  4KN4 A;  5KG3 A;  2W9A A;  3ZD9 A;  3RB0 A;  5KFW A;  3SZ2 A;  1S0O A;  8ICL A;  9ICW A;  8ICP A;  5J0X A;  2PFO A;  4IRD A;  4Q8E A;  1L5U A;  8ICI A;  4O3R A;  3BDP A;  5F9N A;  3KHH A;  2XY6 A;  1LV5 A;  3OJS A;  7ICI A;  4LZG A;  2VA8 A;  4YCX A;  1X9W A;  4QW9 A;  1K1Q A;  5CR0 A;  4UAY A;  2UVR A;  3H4B A;  3C5G A;  4DL6 A;  4PHE A;  4DFP A;  4GXJ A;  4I29 A;  3PW0 A;  1ZQI A;  4QZ9 A;  4MEY A;  4DOC A;  4UBB A;  1RXW A;  1X2I A;  9ICE A;  2F1H A;  1KFT A;  1TV9 A;  1QSY A;  2UVW A;  4ELU A;  1IXR A;  5HHH A;  3RR8 A;  3RH4 A;  2BCV A;  1ZQU A;  3HT3 A;  2C22 A;  1U4B A;  1S0N A;  3UXP A;  1PZN A;  4KLQ A;  5CJ7 A;  3KHR A;  4ECT A;  4ED6 A;  1KSP A;  4B9S A;  2R8G A;  3GV8 B;  1B43 A;  3KHG A;  2P6R A;  3ZDD A;  2J6T A;  7ICH A;  8ICN A;  2FMS A;  4GC6 A;  1NOM A;  4JV0 A;  5DG8 A;  3JPR A;  3TI0 A;  5L9X A;  7ICS A;  2P6U A;  4MF2 A;  1S77 D;  3BQ1 A;  3TAP A;  1S97 A;  4RU9 A;  2BGW A;  5BOM A;  3GIM A;  4DS4 A;  3LWL A;  2A1J B;  4DFM A;  4RNO A;  4QWC A;  4P4O A;  5DB9 A;  2JEJ A;  2IBK A;  1A76 A;  2ZUD A;  4PHD A;  4C8O A;  3QZ8 A;  5IIK A;  3B0X A;  5IIJ A;  5DGA A;  3UPQ A;  5DB6 A;  1NK8 A;  1ZQL A;  1NKC A;  3K75 D;  9ICH A;  1JXL A;  2ZUC A;  9ICK A;  8ICX A;  4M04 A;  2AGQ A;  3ISB A;  1UT5 A;  3BQ2 A;  5IIM A;  4IRK A;  2ASL A;  3C5F A;  4C8M A;  1ZQG A;  1D9F A;  5KT4 A;  4DF4 A;  3THV A;  2FMQ A;  4BXO A;  2HHT A;  3GV7 B;  4EYI B;  1ZQQ A;  4XQ8 A;  4M9L A;  4J9K A;  4F5P A;  5KFZ A;  3PX4 A;  1ZQJ A;  2W9B B;  2XGQ A;  2R8J A;  1K1S A;  4M9J A;  2R8I A;  2AJQ A;  8ICW A;  4YXM A;  4R63 A;  2AQ4 A;  1ZET A;  2DPI A;  5IIN A;  1HJP A;  4FS2 A;  2BDP A;  3QZ7 A;  4M9N A;  3UXO A;  1S0M A;  2NRT A;  4ECQ A;  4M47 A;  3PNC A;  4YG2 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...