2MUTA

Solution structure of the f231l mutant ercc1-xpf dimerization region
Total Genus 27
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
27
sequence length
96
structure length
96
Chain Sequence
RIRRRYNMADLLMEKLEQDLVSRVTECLTTVKSVNKTDSQTLLTTFGSLEQLIAASREDLALCPGLGPQKARRLFDVLHEPFLKVPGGLEHHHHHH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title The Cerebro-oculo-facio-skeletal Syndrome Point Mutation F231L in the ERCC1 DNA Repair Protein Causes Dissociation of the ERCC1-XPF Complex.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase
molecule keywords DNA excision repair protein ERCC-1
total genus 27
structure length 96
sequence length 96
ec nomenclature
pdb deposition date 2014-09-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00633 HHH Helix-hairpin-helix motif
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.20 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 5' to 3' exonuclease, C-terminal subdomain 2mutA00
1QLNA 3LWLA 9ICSA 4M6WA 2J6SA 4M47A 1KDHA 2WTFA 2KZMA 8ICJA 4Q45A 5DB7A 1Y88A 1BGXT 1BPBA 1SKSA 9ICWA 1Z00B 5IIJA 2R8KA 1LB2B 5EOZA 4J9LA 3EPGA 5DB8A 4RNNA 5J0OA 2AGPA 1NJZA 1MQ3A 4GXIA 4QWCA 5BOLA 8ICKA 1DGSA 1ZQKA 4PHEA 5HMLA 4QWBA 3Q8PB 1NK4A 3HP6A 4O3PA 3H8WA 4ECTA 5KFTA 5J2GA 2VA8A 4KLTA 4M2YA 7ICEA 3PX6A 4KLSA 1IM4A 4KMUA 3JPSA 2ASDA 4M9GA 3HW8A 3PNCA 2FPMA 2ZJ5A 2ZUDA 5J0SA 5KFZA 2AQ4A 2W9CA 3Q8QB 1HUZA 5KFHA 4QZCA 4I2BA 1HUOA 4KLEA 4FO6A 3GV5B 1WCNA 2BCQA 1ZQLA 2W8LA 3ETLA 3Q8MA 5L1LA 4RQ7A 3KHLA 3BQ2A 5BPCA 1MSWD 4Q43A 8ICSA 5J2EA 1RXVA 1XU4A 4QZ8A 3TAPA 4DF8A 2VANA 4I2EA 3MFHA 4QW8A 1KEJA 4DEZA 3LK9A 3QZ7A 3MR5A 3PW5A 4LVSA 5J2KA 4DSEA 3RRHA 3THVA 3JPRA 3PMNA 9ICJA 3ZDCA 1ZQYA 5KFOA 2XGQA 4FBUA 4QW9A 2AGQA 1TK5A 4YXMA 4NLKA 4YVZA 1UT5A 4F92B 4MFFA 4YD1A 3OGUA 3C23A 4O5KA 1RXWA 4BWMA 5KFFA 1S77D 4O3QA 2IA6A 1RPLA 4KLFA 7ICRA 5KFXA 4J9QA 3T5HA 1ZQJA 2FMPA 1NK5A 4M9LA 2HHVA 4K4GA 5IINA 2PFPA 3RJFA 2ZUBA 3RJKA 9ICFA 9ICEA 8ICRA 4UBBA 4F93B 1TV9A 1NKCA 4ECWA 1NK8A 2JEGA 3RJHA 4KLIA 3PY8A 4KTQA 3C5FA 4NLZA 9ICTA 3K75D 8ICOA 3ZDAA 4PHPA 1N48A 1XSPA 4DWIA 4J9PA 1QSLA 4KLHA 5DBAA 4JK1A 4QWAA 3MGHA 2KFZA 5DDMA 5IIKA 3GDXA 1RYRA 2IHNA 4EEYA 2ISOA 5L1JA 4F4ZA 4I2JA 4Z6DA 4ECVA 3Q8SB 1XC9A 4GLXA 4PHAA 2P66A 3TQ1A 4EZ6A 4BWJA 3GQCA 4PHDA 2JZBA 4UB5A 4HYKA 5KFVA 2F1HA 3PMLA 1QSYA 2HHUA 4DLGA 8ICPA 1JX4A 3OJSA 3RAQA 1C7YA 2IMWP 4UQGA 4RNOA 4I28A 2XC9A 2ZTEA 3M8SA 3SV3A 3RBEA 3KTQA 5J2JA 3PVXA 3RB3A 5L1IA 5J2BA 1TAUA 4DOBA 5KT3A 4YR2A 4GXKA 1S0OA 4DL2A 5JUMA 1NK6A 1SL0A 1SL2A 4M9JA 3H7IA 8ICQA 5CJ7A 4E0DA 3RTVA 3SZ2A 3V6HA 2Y1IA 2F1JA 3ZD9A 5D46A 1S0MA 4CCHA 9ICNA 2JEFA 3G6XA 4ED6A 1S0NA 4ELVA 2H5XA 4DSFA 7ICUA 4KLDA 8ICAA 2BR0A 1N56A 4UAZA 2R8IA 9ICOA 2P6UA 2RDJA 2J6UA 2HHSA 4ECSA 3JPQA 2I9GA 4I2AA 5KG1A 9ICAA 1COOA 3V6JA 4F2RA 5DKWA 1K1SA 5DLGA 4ELUA 3UPQA 2A1JB 2DFLA 2PFNA 4IQTA 8ICWA 7ICTA 3H8JA 4JWMA 4TUSA 1ZQBA 4I27A 5J2FA 2FPKA 3HT3A 2PI4A 4TQRA 5CWRA 5F9LA 1LV5A 4RZRA 1NJWA 3PV8A 8ICZA 2KFNA 8ICTA 4O3SA 4IRCA 7ICNA 5J2DA 7ICKA 4J9RA 5DBCA 5F9NA 9ICVA 5KFBA 4EYHB 4O3RA 3H40A 2J6TA 8ICFA 2V4RA 2BHNA 4R8UA 4DLEA 7ICLA 5TZVA 2BPCA 2W9BB 4P4PA 1ZQRA 2KZZA 3ISDA 5J0XA 3C5GA 5DQHA 3C2LA 5CR0A 1MQ2A 2BCSA 2HHTA 8ICCA 3ISCA 2ZUCA 4ED7A 1CEZA 2ZTCA 2AGOA 4DQRA 2C22A 1X9WA 5DG8A 2JEIA 4ED2A 3V7KA 1XO1A 2PXIA 2HHWA 4M0AA 4XUSA 3ORYA 3HPOA 1ZQSA 2ISPA 4DSJA 1EXNA 4GXJA 3RJEA 1ZQZA 4J9MA 8ICNA 2XCAA 3RJGA 3PX0A 3NTUA 8ICIA 1NKBA 1RYSA 3JPTA 5D4BA 5KFWA 1ZQUA 4TURA 5DLFA 4C8MA 3BDPA 4DSLA 1ZQFA 4IQVA 4F50A 3OSPA 1AROP 5J0PA 2DPJA 4KLQA 1JXEA 4F5OA 2BQRA 3IM1A 1D9DA 2XY5A 1T4GA 4B9NA 4KLLA 2BGWA 8ICUA 3MABA 4IR9A 4IR1A 3RR8A 2R8HA 4F91B 1ZQNA 4RPXA 1U4BA 1KRPA 2UVVA 3BQ0A 2F1IA 2W9MA 1ZJMA 2FLPA 3RH6A 4KLGA 4RQ3A 1U48A 4JV2A 1ZQOA 4R8UB 2IHMA 2UVUA 3PW2A 4YMOA 4EBCA 1WCLA 4EBEA 3RJIA 1SKWA 2HVIA 1KFDA 1S9FA 1NJXA 7ICHA 3GIJA 1QSSA 5KG2A 3AUOA 7ICIA 4QZBA 5KFAA 4MFAA 5KFCA 4MEYA 5KT6A 4DS5A 1BPDA 1QTMA 1T7PA 5CHGA 2W9CB 5L1KA 4UB1A 1ZQHA 4DL6A 4LZGA 4DFMA 2R8JA 1B43A 4YG2A 5KT2A 4NM1A 4I29A 4YD2A 4RUAA 5KFYA 4Z6CA 1X2IA 5HHIA 5KFJA 5KT7A 5KG3A 2FMSA 5KFUA 3Q8RB 5KFKA 5KFGA 4QZDA 2W9AA 4DSIA 4NY8A 3EWAA 4R66A 4F2SA 1ZQWA 4QWEA 3MR3A 2AQ0A 5KTQA 4DL5A 3PW4A 4Q8EA 7ICJA 4UB3A 4UB2A 1TAQA 5KFPA 1TVAA 2HVHA 2AJQA 4I2DA 2Y1JA 2BCRA 7ICGA 5KFIA 1U49A 1D8LA 4QZGA 4KN4A 4Z6EA 1ZQCA 3GIIA 4NM2A 4QZEA 7ICPA 4QZAA 3N4MB 3Q8LA 2XO7A 3RH4A 3SV4A 3H4BA 1ZQVA 9ICQA 5KG7A 1KLNA 4IRKA 9ICRA 3FDSA 3E2EA 2V9WA 5KFNA 3SI8A 8ICVA 4MEXA 1S10A 3MDAA 1X9SA 3RBDA 1BPXA 2XGPA 1JIHA 4J9KA 5HHHA 3OSNA 5J2AA 3GFKB 4XA5A 4XRHA 3LDAA 5EWEA 4DS4A 2HHQA 2KZ3A 4C8NA 1SL1A 2HW3A 1ZQDA 5J2IA 4K4HA 7ICSA 3GV7B 4BGDA 7ICOA 1NK9A 1SKRA 4TUPA 1T8EA 4R64A 3PR5B 4DF4A 3JPPA 4RQ2A 1XSNA 2VA3A 4DQIA 3GV8B 4GC6A 7ICVA 4IQWA 3QEAZ 2NRXA 2FLLA 3FYHA 9ICCA 4BDPA 9ICKA 1DOQA 1Z00A 3C21A 4IQUA 4RT3A 2FPLA 4PGXA 3RRGA 4R63A 2P6RA 4QWDA 3MDCA 2V4QA 4LZDA 4YN4A 5DG7A 7ICQA 5IIOA 3LWMA 1L5UA 4UAYA 3EW9A 3AU2A 1H38A 4YR3A 4C8LA 4K4IA 3PW0A 3RB6A 3ZDBA 3QEBZ 3V6KA 2JZBB 3ZD8A 4QZFA 4C8OA 4DO9A 4B9SA 4YR0A 4TQSA 3TAQA 4B9MA 2RDIA 2W8KA 3ZDDA 5EWGA 4I2HA 1TFRA 5J0YA 3M9NB 4O0IA 3KHRA 2BCVA 2JEJA 4O9MA 1NKEA 4TUQA 2XY7A 5L9XA 5KG4A 3T3FA 4ECQA 4I2IA 1JN3A 4DFKA 3UQ0A 1ZETA 4F5RA 3UQ2A 5KFSA 2ASLA 4F3OA 2BCUA 1V9PA 5J2CA 9ICUA 2C2RA 3JPNA 1U45A 2BPGA 2NRZA 4Z6FA 4I2CA 4KLOA 3IHQB 3QZ8A 4M9HA 5CB1A 3MR6A 2C2EA 3RAXA 2ZJAA 1D9FA 5KG5A 4DQPA 2HHXA 3HX0A 8ICLA 1S76D 4ECRA 1KTQA 4UAWA 4F4WA 2IBKA 1IXRA 1BPYA 4UBCA 4YCXA 2B21A 4EYIB 1S97A 2DPIA 2PFQA 5D49A 4BXOB 4F4KA 4KLMA 4JV1A 4M04A 4FBTA 3MGIA 2UVRA 1ZYQA 3GIKA 3PO5A 3BQTA 5DG9A 1KFTA 4NLNA 8ICEA 9ICBA 5KG0A 4RQ4A 2BKEA 5DBBA 2LYHA 2ZTDA 5IIIA 5J2HA 5CP2A 4DL4A 3M9OB 3MR2A 3RR7A 1Z3EB 3GILA 4YMMA 3RB0A 4QZIA 5HP4A 1PZNA 4B9UA 4YMNA 4RNMA 4F5PA 4DL3A 3QE9Y 5KFMA 1UT8A 3T5JA 3Q8KA 3UXOA 4ECUA 9ICHA 2XCPA 2ASJA 4RPYA 3TFSA 4QZHA 2M9NA 3B0XA 4ED3A 4P4MA 1S0VA 3TI0A 4ECXA 4J9OA 5J0WA 3M9MB 5KG6A 3OHBA 1CUKA 3C2KA 4ECYA 4PPXA 3BJYA 5KFLA 4RQ1A 1A77A 3KHGA 3N97B 3K4GA 4KN7A 4YFKA 4DQQA 3PR4A 4YQWA 8ICMA 5HNKA 4R65A 1L3VA 1K1QA 9ICMA 4G3IA 3JPOA 4KLJA 3ZDEA 4F8RA 4NXZA 5J0RA 1SZPA 3EYZA 4JWNA 1HJPA 4Q8FA 2FLNA 5KT5A 4DQSA 2ZJ8A 5KFRA 1XS9D 3KHHA 1BPZA 7ICMA 2KN7A 1B22A 4P4OA 4DSKA 4M6WB 4FS1A 2C28A 4B9TA 4P2HA 3UXPA 4RUCA 4Q44A 4J9NA 1KSPA 9ICXA 1NOMA 5EWFA 4ELTA 4EBDA 1MC8A 4C8KA 3BQ1A 9ICPA 2XY6A 1ZQGA 3V7JA 4O3OA 1X9MA 2PI5A 4PH5A 1ZQIA 4MFCA 2MUTA 4IRDA 5HMMA 4XQ8A 3G6YA 1ZQAA 3AU6A 1U9LA 5CA7A 4RU9A 3MBYA 3RB4A 3C1YA 5IIMA 5BOMA 4F4XA 4ED1A 3EZ5A 2NRWA 5DQGA 3T5KA 4BXOA 3OJUA 4YXJA 5C5JA 4O3NA 5KT4A 3MFIA 3SYZA 3TANA 3EPIA 3B0YA 2BQ3A 1NJYA 1NK0A 4DOAA 4KITB 2BDPA 4RPZA 4ZH4A 3G6VA 4JV0A 9ICGA 8ICXA 4JUZA 4X5VA 2I1QA 5DB6A 1ZQEA 3H8SA 2ALZA 5KFQA 2UVWA 4NLGA 4B9LA 3HWTA 1T3NA 3H4DA 1L3UA 3RJJA 4B9VA 4I2FA 1D8YA 3UXNA 4F4YA 2KTQA 7ICFA 9ICIA 4F5NA 5IILA 3RH5A 1XWLA 4MF2A 5DB9A 3V7LA 1UA0A 1ZJNA 1L3SA 1U47A 1A76A 4ECZA 3TARA 1L3TA 8ICBA 1UA1A 8ICGA 4RQ0A 4YP3A 4DFPA 1BVSA 4F5QA 5J0QA 4ED0A 2NRTA 4DL7A 4KLUA 4RT2A 2Q0ZX 4QZ9A 2MAXA 4RQ6A 4DOCA 2BQUA 1RZTA 1ZQMA 1NK7A 5J0UA 4ED8A 4RQ8A 4O5EA 5KFDA 4PGYA 3TFRA 1BPEA 4EZ9A 2PFOA 2W9BA 1ZQTA 5J29A 3ISBA 2C2DA 1TK8A 9ICLA 4DFJA 2VA2A 3PO4A 3PW7A 3C2MA 2FMQA 5DGBA 1ZQXA 4GC7A 1JMSA 4M9NA 3OHAA 2ATLA 1KFSA 8ICYA 3GIMA 3V72A 4FS2A 2MUTB 1JXLA 4RQ5A 3NGDA 3C1ZA 5DGAA 1TKDA 2GWSA 4PGQA 3PX4A 2AU0A 5DQIA 1ZQPA 2BPFA 1TK0A 2R8GA 2OWOA 1XSLA 2A1JA 1ZQQA 4J9SA 2NRVA 5DDYA 3T5LA 5J0TA 4I2GA 3M8RA 4O5CA 4UB4A 4MF8A 8ICHA 5KFEA
chains in the Genus database with same CATH superfamily
3LWLA 9ICSA 4NLBA 1KQQA 2J6SA 2WF9A 1KDHA 4Q45A 2R8KA 2ZIVB 2W7PA 3EPGA 5DB8A 3MC1A 8ICKA 2WFAA 5ALHA 4PHEA 4QWBA 3Q8PB 1NK4A 4O3PA 5KFTA 5J2GA 5ALQA 4KLTA 4M2YA 2KJ8A 1IM4A 2QKQA 2DL0A 1SV0A 3PNCA 2A19A 2W9CA 3PSFA 1A0PA 3Q8QB 4QZCA 2CXYA 2BCQA 2W8LA 5L1LA 5GTIU 8ICSA 1RXVA 1XU4A 4QZ8A 5ALDA 3LK9A 4LVSA 9ICJA 3JPRA 3ZDCA 3QUTA 2HBKA 2HMXA 1LKYA 4YXMA 1ZD3A 2LM1A 4YVZA 2FDRA 4YD1A 3C23A 1S77D 2IA6A 1D8BA 4J9QA 5KAIU 1ZQJA 2HHVA 2OM6A 2JRZA 1HIWA 1NKCA 1NK8A 2JEGA 1KBUA 5ALKA 3N28A 2FJ6A 3ZDAA 1F0MA 4KLHA 4JK1A 4QWAA 3BQ7A 2YMMA 5DDMA 2ISOA 5L1JA 4F4ZA 4Z6DA 1XC9A 3GQCA 4PHDA 3K1ZA 2KE7A 8ICPA 3M6KA 3SAFA 1C7YA 1N60A 2IMWP 2ZTEA 2KSOB 1NZBA 3PVXA 5L1IA 5KT3A 3C29A 3V6HA 2Y1IA 1V38A 1L7MA 1L8LA 2H5XA 2K8AA 4PZOA 2WF6A 1WWUA 2E8NA 4ECSA 2I9GA 2JMGA 1COOA 3V6JA 5ALLA 2A1JB 2DFLA 1JUDA 4I27A 2PI4A 1RQNA 7ICNA 5J2DA 7ICKA 4J9RA 2H3IA 3MGVA 1RQLA 8ICFA 2V4RA 4DLEA 2W9BB 3SD7A 4UW9A 1ZQRA 4USAA 1RG6A 2K60A 8ICCA 2QLTA 2BCSA 2C22A 3NASA 2LMRA 1FEZA 2ISPA 3ORYA 4DSJA 3RJEA 1Q46A 8ICNA 1C20A 5L1MA 2K4PA 2H3ZA 5KFWA 3BDPA 3M7DA 2KD1A 1JXEA 4F5OA 1D9DA 1ZD4A 3RR8A 2R8HA 4OJ6A 4RPXA 1U4BA 2UVVA 3BQ0A 2F1IA 1ZJMA 1SV4A 2IHMA 2EANA 4YMOA 4EBEA 3RJIA 3S6JA 1SKWA 1NJXA 3GIJA 1QSSA 4QIWC 5KT6A 5ALPA 1T7PA 1TE2A 4Z6CA 1X2IA 5KFJA 2FMSA 3Q8RB 5KFGA 4NY8A 3EWAA 5EE9A 4Q8EA 3HRDD 1ZQ1C 1TVAA 4I2DA 3WK8A 5KFIA 1U49A 1D8LA 4BUGA 4QZGA 5CEHA 2EAPA 2IOFA 3IN5A 4QZAA 3N4MB 1YT3A 9ICQA 4UAVA 3FDSA 4RQMA 2B6GA 4NJ8A 8ICVA 4MEXA 1S10A 1BPXA 4EELA 5J2AA 5AIAA 3LDAA 1AQ6A 1T8EA 5EE0A 1XSNA 7ICVA 4U6PA 4DQIA 3GV8B 2HBMA 3QEAZ 9ICKA 4RT3A 4PGXA 4QWDA 2AXTU 2KP7A 4LZDA 2F8KA 2EZXA 1L5UA 1H38A 3FC4A 2OXOA 3WKCA 3KZXA 2NYVA 4QZFA 4B9SA 4B9MA 2KK0A 2RDIA 4CRXA 3T3FA 5ALRA 4DFKA 3ZI4A 4F3OA 5KFSA 5J2CA 1DK3A 2BPGA 3F2CA 3QZ8A 5CB1A 3MR6A 1A6SA 1MA7A 4JMUA 2ZJAA 1DXSA 8ICLA 1BPYA 4EYIB 2DPIA 2PFQA 2Y0SF 2KMDA 2RP5A 3DEEA 4CNQA 3PO5A 3NVVA 5DG9A 2W7OA 9ICBA 8ICEA 2WF5A 5KG0A 1KFTA 3I28A 5DBBA 2LYHA 2MA1A 5J2HA 5CP2A 2JR5A 3MR2A 1JALA 1Z3EB 3A0HU 4CF3A 4YMNA 2ASJA 2K89A 3M9MB 3OHBA 4RQ1A 1L8OA 1PK1B 1K1QA 3NVZA 3QNMA 3ZDEA 4F8RA 3EYZA 5KFRA 7ICMA 1B22A 4P2HA 3SENA 1MN8A 1KSPA 2WAQC 4J9NA 1UQVA 1Q3VA 4KMOB 2OEHA 3F5EA 3CP8A 5ALGA 1J97A 3BQ1A 1ZQGA 2DGZA 5ALEA 1X9MA 2IOHA 2MUTA 2LKYA 2XVTA 3AU6A 3KKAA 5GTHU 3BS5B 3RB4A 4PJ0U 5AM1A 3BZCA 2EQYA 3NVYA 5DQGA 3OJUA 2EDUA 5C5JA 3TANA 4O3NA 5JTIA 2EAOA 2ZIWB 1N63A 4DOAA 3WU2U 3CYMA 4OCZA 1ED1A 5AICA 2UVWA 2Y9TA 4B9LA 3HWTA 5G5GA 1D8YA 2KTQA 1Q3UA 2EAMA 7ICFA 1U47A 2W3SA 3SEIA 1UA1A 4C7ZA 3F2DA 4DL7A 5AKIA 2NRTA 1WYGA 4RT2A 4DOCA 1RZTA 5ALTA 5KFDA 3UMBA 1S8OA 2PFOA 1ZQTA 3PW7A 5AI4A 3C2MA 5AK6A 1JMSA 2ATLA 1F44A 5F3XB 1UPHA 5ALZA 3V72A 2MUTB 3C1ZA 3PX4A 2R8GA 4US8A 3IP4B 4J9SA 4FZLA 5DDYA 1SB3C 3T5LA 1WUDA 5KFEA 1QLNA 1GO3F 2WTFA 2KZMA 8ICJA 1Y88A 2GH1A 1X42A 2BDUA 4J9LA 4CE6A 3D2NA 4QWCA 4O3MA 2G09A 1QCKA 4PL1A 1NNLA 5ALYA 3PX6A 4KLSA 2ASDA 4M9GA 2ZJ5A 3F53A 4FO6A 3BS7A 1ZQLA 3ETLA 3O0FA 3Q8MA 3KHLA 4Q43A 1UCVA 3WKEA 2YN4A 2ZIXA 4I2EA 3PW5A 1KEJA 1S5LU 5J2KA 3C28A 3THVA 3PMNA 2K4EA 3F2BA 2XGQA 4FBUA 1ZRNA 5AI5A 1TK5A 2ZXIA 1UT5A 4F92B 4UATA 1J2MA 7ICRA 4M9LA 2PFPA 2VKQA 9ICFA 2WAQF 9ICEA 1SWWA 1TV9A 4KLIA 4NLZA 9ICTA 1RYUA 1N48A 2IHNA 4I2JA 1LKYB 4PHAA 2P66A 3TQ1A 2KJ5A 4BWJA 4HYKA 3PMLA 1BNOA 2HHUA 3M1YA 2WF8A 3OJSA 3RAQA 2CRXA 2O6KA 4I28A 3SV3A 5JRTA 5AK3A 3RBEA 5ALIA 2KNJA 5J2JA 5J2BA 4GXKA 1S0OA 4DL2A 1NK6A 2JH7A 8ICQA 3RTVA 3SZ2A 1Z4NA 9ICNA 1SXDA 4FZMA 4DSFA 4B6JA 2BR0A 2DUYA 2P6UA 2J6UA 2LI6A 1Z19A 4C0ZA 3PSIA 4F2RA 5DLGA 7ICTA 2W03A 3H8JA 4JWMA 1ZQBA 5HR7A 5J2FA 2YB4A 2KFNA 5ALFA 9ICVA 5F9NA 3N7SC 5KFBA 4O3RA 2J6TA 2BPCA 3IG8A 1PVRA 3C5GA 3C2LA 5CR0A 3ISCA 3WK7A 2AGOA 4C4TA 4DQRA 1X9WA 2JEIA 4ED2A 3V7KA 1XO1A 4M0AA 2YMPA 4Y2TA 4XUSA 5AKLA 1EXNA 1SGGA 1F5SA 5ALUA 1VLBA 4DSLA 2HSZA 1ZQFA 5A0LA 4GIBA 3OSPA 5J0PA 4KLQA 3IM1A 3GZFA 2JH1A 2BGWA 3MABA 4IR9A 4F91B 1KRPA 1O08A 2W9MA 2FLPA 4US9A 3RH6A 1U48A 1ZQOA 2L5YA 4EBCA 3OPXA 3AN1A 5AKEA 2YQEA 4AYBC 4C4SA 4MFAA 4MEYA 4DS5A 4UB1A 4DL6A 4LZGA 2R8JA 4YG2A 5KFYA 5HHIA 5KG3A 5KFUA 4QZDA 2W9AA 4F2SA 2AQ0A 4UB3A 2YB1A 3EUB2 4OD0A 2W04A 1ZQCA 3QU7A 7ICPA 1L6NA 2E8OA 3Q8LA 3HILA 3H4BA 1ZQVA 3TADC 2GLEA 3SI8A 1FFVA 3KZIU 3QUQA 3OSNA 3AQEA 3GFKB 1LVHA 4IC9A 4BGDA 7ICOA 1NK9A 1SKRA 3PR5B 2LPEA 4GC6A 4IQWA 1SIJA 3AM9A 9ICCA 1DOQA 1FO4A 1B0XA 2P6RA 2QARB 3MDCA 2V4QA 4YN4A 7ICQA 4UAYA 2G0AA 4U7CA 3ZDBA 1TAMA 2F44A 1T3QA 4CGZA 4DO9A 4I2HA 2W8KA 7ICEA 3M9NB 3KHRA 2BCVA 2OYYA 4I2IA 3FM9A 3NUQA 3JPNA 4M9HA 4DQPA 4NL9C 5KG5A 4ZOHC 4UAWA 1IXRA 1S97A 4F4KA 4JV1A 4M04A 2JXJA 3MGIA 3BQTA 3OTQA 4RQ4A 5IIIA 4DL4A 3RR7A 4UB8U 4YMMA 1K5OA 4QZIA 1PZNA 4DL3A 2WB1C 3Q8KA 5KFMA 1UT8A 9ICHA 3UXOA 4ECUA 4IL6U 4RPYA 2HOFA 4AP9A 1N62A 4PPXA 3KHGA 4YFKA 5HNKA 2E1EA 4Q8FA 1SZPA 5AK4A 1HJPA 1BPZA 2KN7A 4B9TA 2F76X 4Q44A 9ICXA 1NOMA 5AI9A 2WB1F 4O3OA 4NLCA 2PI5A 2DWQA 4PH5A 4MFCA 1ZOLA 5T14A 5HMMA 4KX3A 2ZXHA 3SAHA 2KKPA 3NRWA 4RU9A 4FFDA 2Y9UA 5BOMA 2LYBA 3R9KA 4F4XA 4ED1A 2NRWA 2PKEA 5AM5A 4F71A 3SYZA 3EPIA 4JV0A 2MSNA 4X5VA 2E3TA 4NV0A 2G06A 3AL0B 2KEYA 2W11A 2QB0B 1T3NA 3H4DA 4Y2SA 2W54A 4G9BA 4F4YA 3PSPA 5IILA 1XWLA 4MF2A 3IDWA 5ALVA 8ICBA 8ICGA 4YP3A 3KFUF 4DFPA 1BVSA 4F5QA 5J0QA 4ED0A 1YZ6A 4QZ9A 4RQ6A 1L7PA 2F8LA 5J0UA 2JGAA 4RQ8A 2E1FA 4PGYA 4OJPA 4EZ9A 3ISBA 2CN1A 4DFJA 2VA2A 3PO4A 2FMQA 3A0BU 4GC7A 4M9NA 1KFSA 1N5XA 2GOLA 1XO0A 1X66A 4FS2A 2YTUA 3NGDA 5DGAA 5AKKA 3L5KA 1XSLA 2B0CA 2NRVA 5J0TA 3HJEA 4M6WA 2ZIVA 5DB7A 1BGXT 1BPBA 1SKSA 1Z00B 5IIJA 4J03A 1LB2B 5EOZA 5AIBA 2OHFA 3NRZA 3QX7A 1NJZA 2YMLA 4GXIA 5BOLA 1DGSA 3SAGA 1FFUA 1N2XA 1URJA 3H8WA 4ECTA 5ALWA 1N61A 2VA8A 3QUCA 5KL8B 4KMUA 3NS1A 3TACB 2W55A 3HW8A 3ICXA 2AQ4A 5B5EU 1HUZA 5KFHA 5ALNA 1NZPA 3KKAC 3GV5B 2LM4A 4Y2XA 4RQ7A 3QU9A 5BPCA 2ZIUA 2DQNB 1RM6C 3MFHA 4QW8A 4BJQA 1ZQYA 5KFOA 4MHVA 2AGQA 2OH2A 2E8MA 4NLKA 3I1YA 4MFFA 4O5KA 3GU3A 1RPLA 4KLFA 3T5HA 4Y2QA 4K4GA 2ZUBA 3RJKA 4QNLA 5AHXA 4OO1J 2E5SA 3E0FA 2ZG6A 1VDVA 4F93B 3RJHA 4KTQA 2OCEA 8ICOA 5AM4A 3RF9A 4Y2JA 5DBAA 2IOFK 2KFZA 4CF4A 3Q8SB 4UASA 1CRXA 4FE3A 4NWIA 2JZBA 4UB5A 1QSYA 2F1HA 3L3FX 1DGJA 4UQGA 2XC9A 4EENA 1TAUA 1HEKA 3PSTA 5JUMA 4M9JA 4E0DA 2KIWA 2F1JA 3ZD9A 5D46A 1S0MA 3G6XA 4ELVA 2K4HA 2PMZF 2QARA 3D6JA 4F72A 4EX6A 1N56A 4UAZA 9ICOA 4P0QA 2RDJA 3ETRA 9ICAA 5DKWA 4Y2VA 4ELUA 1Z1VA 3UPQA 2PFNA 8ICWA 1ZRMA 4TUSA 3TKAA 5F9LA 1KN5A 4RZRA 1IG6A 8ICTA 4IRCA 2ODGA 1ZD2P 3WKDA 5DBCA 4EYHB 3H40A 2KVCA 2BHNA 4R8UA 7ICLA 5E79U 5TZVA 1PK3A 2XIDA 1ZXIA 3IG5A 3QU5A 1MQ2A 2K4IA 2H3FA 2HHWA 5EE1A 3HPOA 3LYSA 4J9MA 4PZNA 2XCAA 3RJGA 3PX0A 8ICIA 5D4BA 1ECWA 2GO7A 2RQ5A 5DLFA 2BQRA 2XY5A 3ED5A 2KOBA 4B9NA 4IR1A 1FIQA 1ZQNA 4RQ3A 4JV2A 3PW2A 4C4RA 3BS5A 1KFDA 3SMVA 5KG2A 3AUOA 3ONNA 7ICIA 1QQ6A 5KFAA 5KFCA 1BPDA 1QTMA 5KNIA 1SZHA 1ZQHA 4DFMA 4I29A 4YD2A 5KT7A 3UMGA 1PUZA 4R66A 1ZQWA 4DL5A 7ICJA 1OW5A 4UB2A 5KFPA 4P0PB 2HVHA 2AJQA 2BCRA 2ZIUB 4UAUA 2M0NA 4Z6EA 2DKZA 1ZD5A 3J81j 5AM2A 5KG7A 4IRKA 9ICRA 1NI3A 2V9WA 3D2QA 2JV3A 3MDAA 3RBDA 1JIHA 4J9KA 3KBBA 4DS4A 4XA5A 3WK6A 1SL1A 3N7RC 4K4HA 7ICSA 3GV7B 1T94A 2KG5A 4TUPA 3D2SA 4R64A 3CNHA 3JPPA 4DF4A 2FLLA 2DF4B 3FYHA 4BDPA 1Z00A 4IQUA 3RRGA 2FPLA 5DG7A 3LWMA 3EW9A 3AU2A 4YR3A 3PW0A 3QEBZ 1N5WA 2JZBB 1WG8A 4C8OA 4YR0A 3B9JA 1TFRA 5J0YA 2NO4A 2JEJA 1NKEA 3BZKA 5KG4A 1ZETA 3UQ0A 4LJXA 2ASLA 2C2RA 1U45A 2NRZA 4Z6FA 1X6IA 2C2EA 2DBYA 3RAXA 2LBOA 2HHXA 3HX0A 1KKXA 4ECRA 1KTQA 4F4WA 2IBKA 4BXOB 5AK5A 2B21A 4YCXA 5D49A 2FI1A 4KLMA 4FBTA 1X9XA 5KAFU 1DK2A 2UVRA 3GIKA 2H3QA 2BKEA 2ZTDA 4HAIA 2NO5A 3M9OB 1X6JA 3GILA 3PZPA 4F5PA 2K8BB 2KICA 2XCPA 3SQIA 2KVSA 2M9NA 3B0XA 1S0VA 3CW2C 4J9OA 5J0WA 5KG6A 1CUKA 4ECYA 3F5AA 2YX8A 3H0MB 3QUBA 3N97B 2VJ5A 4YQWA 2G08A 2RLTA 9ICMA 1M6YA 2HI0A 5C0YA 3T79A 4NXZA 3WK9A 2FLNA 2Z7JA 4DQSA 2ZJ8A 3M6ZA 3KHHA 4P4OA 4DSKA 4FS1A 2C28A 4ICAA 4RUCA 4JB3A 4ELTA 1V85A 4NL9A 2CPRA 2NV3A 4P0PA 9ICPA 2F77X 3V7JA 3WKBA 1RDFA 3G6YA 2A1AA 2G07A 3C1YA 1PK1A 5IIMA 1SV0C 1L7OA 4YXJA 1BNPA 5KT4A 1NJYA 2KJ9A 2XI9A 4KITB 4RPZA 3G6VA 3DV9A 2KSOA 3L4PA 4CDGA 4JUZA 8ICXA 1ZQEA 4AYBF 2R18A 4B9VA 1L3UA 3RJJA 3UXNA 1SXEA 9ICIA 4F5NA 3RH5A 5DB9A 1ZJNA 4Y2PA 3TARA 1L3TA 2A3VA 4RQ0A 2HOIA 2F2AB 3AQFA 2HCFA 2Q0ZX 2BQUA 1ZQMA 2KKVA 4ED8A 3AEVA 3TFRA 1BPEA 1TK8A 3RFAA 4EEKA 5DGBA 1ZQXA 3OHAA 1B4FA 3H8MA 8ICYA 2HDOA 2WHEA 2ESEA 4WJ3B 4RQ5A 4PGQA 1ZQPA 2BPFA 2OWOA 1ZQQA 3I76A 2W43A 4I2GA 3M8RA 4O5CA 4FZNA 4UB4A 8ICHA 2KIVA 4M47A 4KX5A 9ICWA 3FAHA 1Q8KA 1O03A 2I6XA 4RNNA 5J0OA 2AGPA 1MQ3A 1SWVA 1ZQKA 5HMLA 3HP6A 2KHQA 3JPSA 2FPMA 2ZUDA 1JRPA 5KFZA 5J0SA 4I2BA 1WWVA 4KLEA 1HUOA 5TISU 1WCNA 5KL1B 3BQ2A 1MSWD 5J2EA 4Y2UA 3TAPA 4DF8A 2VANA 4RQNA 4DEZA 3QZ7A 3MR5A 4DSEA 3RRHA 4QW9A 2JHDA 1COKA 3OGUA 3E58A 2AHOB 1RXWA 4BWMA 5KFFA 4O3QA 5KFXA 2VIXA 2FMPA 1NK5A 5IINA 3RJFA 4DFDA 4ACOA 8ICRA 4Y2YA 4UBBA 3AMZA 4ECWA 3PY8A 5AKZA 3C5FA 3K75D 4PHPA 1XSPA 4DWIA 4J9PA 1QSLA 3MGHA 4PL2A 5IIKA 3GDXA 1RYRA 2XICA 4EEYA 1J2NA 4ECVA 4GLXA 4EZ6A 2KHVA 5KFVA 4DLGA 1JX4A 5AI8A 2MRLA 4RNOA 3M8SA 1QQ7A 2HBJA 3QYPA 4A8EA 3KTQA 3RB3A 5ALJA 4DOBA 2H3VA 4YR2A 1SL2A 1SL0A 3H7IA 5CJ7A 2RHFA 4GFJA 4CCHA 2JEFA 1S0NA 4ED6A 5J8YC 2K8CB 5ALOA 7ICUA 4KLDA 8ICAA 2KV2A 2R8IA 3DDHA 2HHSA 3H0RB 5ALMA 3VC8A 3JPQA 4I2AA 5KG1A 1K1SA 1CI4A 4IQTA 3HT3A 2FPKA 3SR6A 4TQRA 5CWRA 1LV5A 1NJWA 3PV8A 8ICZA 4O3SA 2D3DA 2YY6A 5AI6A 2E8PA 4P4PA 1OXJA 2KZZA 3ISDA 5J0XA 5DQHA 2HHTA 2ZUCA 4ED7A 1CEZA 2ZTCA 5DG8A 2PXIA 3U26A 1ZQSA 2LYAA 1ZQZA 4QIWF 3NTUA 3TADA 1JI7A 1NKBA 1RYSA 3JPTA 1IIPA 1ZQUA 4TURA 4C8MA 4IQVA 4F50A 1AROP 2DPJA 1T4GA 3IV6A 4KLLA 2QB1A 8ICUA 2WF7A 4KLGA 4R8UB 2UVUA 1WCLA 2HVIA 7ICHA 1S9FA 3LVVA 4QZBA 5AI0A 4CF5A 1V97A 3HKZF 5CHGA 2W9CB 5L1KA 1B43A 4NM1A 5KT2A 4RUAA 3H0LB 5KFKA 1Z1BA 2ZIWA 4DSIA 4QWEA 5AKJA 3MR3A 5KTQA 3PW4A 1TAQA 2ZIXB 2W3RA 2Y1JA 3QU2A 7ICGA 5AKYA 4KN4A 3GIIA 4NM2A 4QZEA 2XO7A 3RH4A 3SV4A 1KLNA 2LHTA 1OUQA 3E2EA 2DKXA 5KFNA 1X9SA 2XGPA 5HHHA 4XRHA 5EWEA 2HHQA 1PVPA 2KZ3A 4C8NA 2HW3A 3QXGA 2HBLA 5J2IA 1ZQDA 1JROA 1KW4A 2VA3A 4RQ2A 5EE3A 2NRXA 3HKZC 3C21A 3UMCA 4R63A 5FP0A 5AM0A 5IIOA 4C8LA 4EX7A 4C80A 4K4IA 3RB6A 3V6KA 3ZD8A 2FE9A 4TQSA 3TAQA 2D8CA 1PVQA 3ZDDA 5EWGA 4O0IA 4O9MA 3IRUA 4TUQA 2XY7A 5L9XA 1XNSA 5ALSA 5HR6A 4ECQA 3KOOA 5B66U 1JN3A 4F5RA 3UQ2A 3WK4A 2BCUA 1V9PA 5J8YA 9ICUA 4I2CA 4KLOA 3IHQB 2I5HA 1D9FA 1P7DA 5G5HA 2HOQA 1S76D 4UBCA 1QH9A 1Z4OA 2G5HB 1ZYQA 2YMQA 2D6FC 2PMZC 1X40A 4NLNA 3RB0A 4B9UA 5HP4A 4RNMA 3QE9Y 3T5JA 4C7YA 3CRXA 3TFSA 4QZHA 4ED3A 4P4MA 3TI0A 5AKHA 4ECXA 3K1RB 3C2KA 3BJYA 5KFLA 1A77A 3VCBA 3K4GA 4KN7A 4DQQA 3PR4A 8ICMA 5AM3A 2EZZA 4R65A 1L3VA 4G3IA 5ALXA 3JPOA 4KLJA 2N1RA 5J0RA 4JWNA 5KT5A 1XS9D 5AKGA 4UB6U 4M6WB 3UXPA 2G5IB 5EWFA 1DRGA 4EBDA 1MC8A 4C8KA 3N7PD 2XY6A 2EZYA 2F3NA 2Q4TA 1ZQIA 4IRDA 4XQ8A 1ZQAA 4P0QB 5JU5A 1U9LA 5CA7A 3MBYA 5H2FU 3ALRA 3EZ5A 4UARA 3T5KA 4BXOA 3MFIA 2BQ3A 1NK0A 1UHUA 3B0YA 2BDPA 4ZH4A 3KD3A 9ICGA 4QJFB 3NVWA 2I1QA 5DB6A 4DCCA 3H8SA 2ALZA 5KFQA 4OJ5A 4NLGA 2VJ4A 5CRXA 2QB0A 4I2FA 1L7NA 3WKAA 2AH5A 3V7LA 2Y0SC 1UA0A 1L3SA 1KL9A 1A76A 4ECZA 1YZ7A 1VJ5A 5AKXA 3WK5A 2EH9A 4KLUA 2P35A 2MAXA 5K4LA 4Y2RA 1NK7A 4O5EA 1QQ5A 4OJOA 2W9BA 5J29A 2C2DA 9ICLA 3UM9A 3QU4A 1IV8A 4OJLA 3GIMA 4BX9C 1JXLA 1TKDA 2GWSA 2AU0A 5DQIA 1TK0A 2A1JA 2ES6A 4IS7A 2MU2A 4MF8A 2RRDA 2BZFA 3LVWA 4GXJA
chains in the Genus database with same CATH topology
1QLNA 3LWLA 9ICSA 4M6WA 2J6SA 4M47A 1KDHA 2WTFA 2KZMA 8ICJA 4Q45A 5DB7A 1Y88A 1BGXT 1BPBA 1SKSA 9ICWA 1Z00B 5IIJA 2R8KA 1LB2B 5EOZA 4J9LA 3EPGA 5DB8A 4RNNA 5J0OA 2AGPA 1NJZA 1MQ3A 4GXIA 4QWCA 5BOLA 8ICKA 1DGSA 1ZQKA 4PHEA 5HMLA 4QWBA 3Q8PB 1NK4A 3HP6A 4O3PA 3H8WA 4ECTA 5KFTA 5J2GA 2VA8A 4KLTA 4M2YA 7ICEA 3PX6A 4KLSA 1IM4A 4KMUA 3JPSA 2ASDA 4M9GA 3HW8A 3PNCA 2FPMA 2ZJ5A 2ZUDA 5J0SA 5KFZA 2AQ4A 2W9CA 3Q8QB 1HUZA 5KFHA 4QZCA 4I2BA 1HUOA 4KLEA 4FO6A 3GV5B 1WCNA 2BCQA 1ZQLA 2W8LA 3ETLA 3Q8MA 5L1LA 4RQ7A 3KHLA 3BQ2A 5BPCA 1MSWD 4Q43A 8ICSA 5J2EA 1RXVA 1XU4A 4QZ8A 3TAPA 4DF8A 2VANA 4I2EA 3MFHA 4QW8A 1KEJA 4DEZA 3LK9A 3QZ7A 3MR5A 3PW5A 4LVSA 5J2KA 4DSEA 3RRHA 3THVA 3JPRA 3PMNA 9ICJA 3ZDCA 1ZQYA 5KFOA 2XGQA 4FBUA 4QW9A 2AGQA 1TK5A 4YXMA 4NLKA 4YVZA 1UT5A 4F92B 4MFFA 4YD1A 3OGUA 3C23A 4O5KA 1RXWA 4BWMA 5KFFA 1S77D 4O3QA 2IA6A 1RPLA 4KLFA 7ICRA 5KFXA 4J9QA 3T5HA 1ZQJA 2FMPA 1NK5A 4M9LA 2HHVA 4K4GA 5IINA 2PFPA 3RJFA 2ZUBA 3RJKA 9ICFA 9ICEA 8ICRA 4UBBA 4F93B 1TV9A 1NKCA 4ECWA 1NK8A 2JEGA 3RJHA 4KLIA 3PY8A 4KTQA 3C5FA 4NLZA 9ICTA 3K75D 8ICOA 3ZDAA 4PHPA 1N48A 1XSPA 4DWIA 4J9PA 1QSLA 4KLHA 5DBAA 4JK1A 4QWAA 3MGHA 2KFZA 5DDMA 5IIKA 3GDXA 1RYRA 2IHNA 4EEYA 2ISOA 5L1JA 4F4ZA 4I2JA 4Z6DA 4ECVA 3Q8SB 1XC9A 4GLXA 4PHAA 2P66A 3TQ1A 4EZ6A 4BWJA 3GQCA 4PHDA 2JZBA 4UB5A 4HYKA 5KFVA 2F1HA 3PMLA 1QSYA 2HHUA 4DLGA 8ICPA 1JX4A 3OJSA 3RAQA 1C7YA 2IMWP 4UQGA 4RNOA 4I28A 2XC9A 2ZTEA 3M8SA 3SV3A 3RBEA 3KTQA 5J2JA 3PVXA 3RB3A 5L1IA 5J2BA 1TAUA 4DOBA 5KT3A 4YR2A 4GXKA 1S0OA 4DL2A 5JUMA 1NK6A 1SL0A 1SL2A 4M9JA 3H7IA 8ICQA 5CJ7A 4E0DA 3RTVA 3SZ2A 3V6HA 2Y1IA 2F1JA 3ZD9A 5D46A 1S0MA 4CCHA 9ICNA 2JEFA 3G6XA 4ED6A 1S0NA 4ELVA 2H5XA 4DSFA 7ICUA 4KLDA 8ICAA 2BR0A 1N56A 4UAZA 2R8IA 9ICOA 2P6UA 2RDJA 2J6UA 2HHSA 4ECSA 3JPQA 2I9GA 4I2AA 5KG1A 9ICAA 1COOA 3V6JA 4F2RA 5DKWA 1K1SA 5DLGA 4ELUA 3UPQA 2A1JB 2DFLA 2PFNA 4IQTA 8ICWA 7ICTA 3H8JA 4JWMA 4TUSA 1ZQBA 4I27A 5J2FA 2FPKA 3HT3A 2PI4A 4TQRA 5CWRA 5F9LA 1LV5A 4RZRA 1NJWA 3PV8A 8ICZA 2KFNA 8ICTA 4O3SA 4IRCA 7ICNA 5J2DA 7ICKA 4J9RA 5DBCA 5F9NA 9ICVA 5KFBA 4EYHB 4O3RA 3H40A 2J6TA 8ICFA 2V4RA 2BHNA 4R8UA 4DLEA 7ICLA 5TZVA 2BPCA 2W9BB 4P4PA 1ZQRA 2KZZA 3ISDA 5J0XA 3C5GA 5DQHA 3C2LA 5CR0A 1MQ2A 2BCSA 2HHTA 8ICCA 3ISCA 2ZUCA 4ED7A 1CEZA 2ZTCA 2AGOA 4DQRA 2C22A 1X9WA 5DG8A 2JEIA 4ED2A 3V7KA 1XO1A 2PXIA 2HHWA 4M0AA 4XUSA 3ORYA 3HPOA 1ZQSA 2ISPA 4DSJA 1EXNA 4GXJA 3RJEA 1ZQZA 4J9MA 8ICNA 2XCAA 3RJGA 3PX0A 3NTUA 8ICIA 1NKBA 1RYSA 3JPTA 5D4BA 5KFWA 1ZQUA 4TURA 5DLFA 4C8MA 3BDPA 4DSLA 1ZQFA 4IQVA 4F50A 3OSPA 1AROP 5J0PA 2DPJA 4KLQA 1JXEA 4F5OA 2BQRA 3IM1A 1D9DA 2XY5A 1T4GA 4B9NA 4KLLA 2BGWA 8ICUA 3MABA 4IR9A 4IR1A 3RR8A 2R8HA 4F91B 1ZQNA 4RPXA 1U4BA 1KRPA 2UVVA 3BQ0A 2F1IA 2W9MA 1ZJMA 2FLPA 3RH6A 4KLGA 4RQ3A 1U48A 4JV2A 1ZQOA 4R8UB 2IHMA 2UVUA 3PW2A 4YMOA 4EBCA 1WCLA 4EBEA 3RJIA 1SKWA 2HVIA 1KFDA 1S9FA 1NJXA 7ICHA 3GIJA 1QSSA 5KG2A 3AUOA 7ICIA 4QZBA 5KFAA 4MFAA 5KFCA 4MEYA 5KT6A 4DS5A 1BPDA 1QTMA 1T7PA 5CHGA 2W9CB 5L1KA 4UB1A 1ZQHA 4DL6A 4LZGA 4DFMA 2R8JA 1B43A 4YG2A 5KT2A 4NM1A 4I29A 4YD2A 4RUAA 5KFYA 4Z6CA 1X2IA 5HHIA 5KFJA 5KT7A 5KG3A 2FMSA 5KFUA 3Q8RB 5KFKA 5KFGA 4QZDA 2W9AA 4DSIA 4NY8A 3EWAA 4R66A 4F2SA 1ZQWA 4QWEA 3MR3A 2AQ0A 5KTQA 4DL5A 3PW4A 4Q8EA 7ICJA 4UB3A 4UB2A 1TAQA 5KFPA 1TVAA 2HVHA 2AJQA 4I2DA 2Y1JA 2BCRA 7ICGA 5KFIA 1U49A 1D8LA 4QZGA 4KN4A 4Z6EA 1ZQCA 3GIIA 4NM2A 4QZEA 7ICPA 4QZAA 3N4MB 3Q8LA 2XO7A 3RH4A 3SV4A 3H4BA 1ZQVA 9ICQA 5KG7A 1KLNA 4IRKA 9ICRA 3FDSA 3E2EA 2V9WA 5KFNA 3SI8A 8ICVA 4MEXA 1S10A 3MDAA 1X9SA 3RBDA 1BPXA 2XGPA 1JIHA 4J9KA 5HHHA 3OSNA 5J2AA 3GFKB 4XA5A 4XRHA 3LDAA 5EWEA 4DS4A 2HHQA 2KZ3A 4C8NA 1SL1A 2HW3A 1ZQDA 5J2IA 4K4HA 7ICSA 3GV7B 4BGDA 7ICOA 1NK9A 1SKRA 4TUPA 1T8EA 4R64A 3PR5B 4DF4A 3JPPA 4RQ2A 1XSNA 2VA3A 4DQIA 3GV8B 4GC6A 7ICVA 4IQWA 3QEAZ 2NRXA 2FLLA 3FYHA 9ICCA 4BDPA 9ICKA 1DOQA 1Z00A 3C21A 4IQUA 4RT3A 2FPLA 4PGXA 3RRGA 4R63A 2P6RA 4QWDA 3MDCA 2V4QA 4LZDA 4YN4A 5DG7A 7ICQA 5IIOA 3LWMA 1L5UA 4UAYA 3EW9A 3AU2A 1H38A 4YR3A 4C8LA 4K4IA 3PW0A 3RB6A 3ZDBA 3QEBZ 3V6KA 2JZBB 3ZD8A 4QZFA 4C8OA 4DO9A 4B9SA 4YR0A 4TQSA 3TAQA 4B9MA 2RDIA 2W8KA 3ZDDA 5EWGA 4I2HA 1TFRA 5J0YA 3M9NB 4O0IA 3KHRA 2BCVA 2JEJA 4O9MA 1NKEA 4TUQA 2XY7A 5L9XA 5KG4A 3T3FA 4ECQA 4I2IA 1JN3A 4DFKA 3UQ0A 1ZETA 4F5RA 3UQ2A 5KFSA 2ASLA 4F3OA 2BCUA 1V9PA 5J2CA 9ICUA 2C2RA 3JPNA 1U45A 2BPGA 2NRZA 4Z6FA 4I2CA 4KLOA 3IHQB 3QZ8A 4M9HA 5CB1A 3MR6A 2C2EA 3RAXA 2ZJAA 1D9FA 5KG5A 4DQPA 2HHXA 3HX0A 8ICLA 1S76D 4ECRA 1KTQA 4UAWA 4F4WA 2IBKA 1IXRA 1BPYA 4UBCA 4YCXA 2B21A 4EYIB 1S97A 2DPIA 2PFQA 5D49A 4BXOB 4F4KA 4KLMA 4JV1A 4M04A 4FBTA 3MGIA 2UVRA 1ZYQA 3GIKA 3PO5A 3BQTA 5DG9A 1KFTA 4NLNA 8ICEA 9ICBA 5KG0A 4RQ4A 2BKEA 5DBBA 2LYHA 2ZTDA 5IIIA 5J2HA 5CP2A 4DL4A 3M9OB 3MR2A 3RR7A 1Z3EB 3GILA 4YMMA 3RB0A 4QZIA 5HP4A 1PZNA 4B9UA 4YMNA 4RNMA 4F5PA 4DL3A 3QE9Y 5KFMA 1UT8A 3T5JA 3Q8KA 3UXOA 4ECUA 9ICHA 2XCPA 2ASJA 4RPYA 3TFSA 4QZHA 2M9NA 3B0XA 4ED3A 4P4MA 1S0VA 3TI0A 4ECXA 4J9OA 5J0WA 3M9MB 5KG6A 3OHBA 1CUKA 3C2KA 4ECYA 4PPXA 3BJYA 5KFLA 4RQ1A 1A77A 3KHGA 3N97B 3K4GA 4KN7A 4YFKA 4DQQA 3PR4A 4YQWA 8ICMA 5HNKA 4R65A 1L3VA 1K1QA 9ICMA 4G3IA 3JPOA 4KLJA 3ZDEA 4F8RA 4NXZA 5J0RA 1SZPA 3EYZA 4JWNA 1HJPA 4Q8FA 2FLNA 5KT5A 4DQSA 2ZJ8A 5KFRA 1XS9D 3KHHA 1BPZA 7ICMA 2KN7A 1B22A 4P4OA 4DSKA 4M6WB 4FS1A 2C28A 4B9TA 4P2HA 3UXPA 4RUCA 4Q44A 4J9NA 1KSPA 9ICXA 1NOMA 5EWFA 4ELTA 4EBDA 1MC8A 4C8KA 3BQ1A 9ICPA 2XY6A 1ZQGA 3V7JA 4O3OA 1X9MA 2PI5A 4PH5A 1ZQIA 4MFCA 2MUTA 4IRDA 5HMMA 4XQ8A 3G6YA 1ZQAA 3AU6A 1U9LA 5CA7A 4RU9A 3MBYA 3RB4A 3C1YA 5IIMA 5BOMA 4F4XA 4ED1A 3EZ5A 2NRWA 5DQGA 3T5KA 4BXOA 3OJUA 4YXJA 5C5JA 4O3NA 5KT4A 3MFIA 3SYZA 3TANA 3EPIA 3B0YA 2BQ3A 1NJYA 1NK0A 4DOAA 4KITB 2BDPA 4RPZA 4ZH4A 3G6VA 4JV0A 9ICGA 8ICXA 4JUZA 4X5VA 2I1QA 5DB6A 1ZQEA 3H8SA 2ALZA 5KFQA 2UVWA 4NLGA 4B9LA 3HWTA 1T3NA 3H4DA 1L3UA 3RJJA 4B9VA 4I2FA 1D8YA 3UXNA 4F4YA 2KTQA 7ICFA 9ICIA 4F5NA 5IILA 3RH5A 1XWLA 4MF2A 5DB9A 3V7LA 1UA0A 1ZJNA 1L3SA 1U47A 1A76A 4ECZA 3TARA 1L3TA 8ICBA 1UA1A 8ICGA 4RQ0A 4YP3A 4DFPA 1BVSA 4F5QA 5J0QA 4ED0A 2NRTA 4DL7A 4KLUA 4RT2A 2Q0ZX 4QZ9A 2MAXA 4RQ6A 4DOCA 2BQUA 1RZTA 1ZQMA 1NK7A 5J0UA 4ED8A 4RQ8A 4O5EA 5KFDA 4PGYA 3TFRA 1BPEA 4EZ9A 2PFOA 2W9BA 1ZQTA 5J29A 3ISBA 2C2DA 1TK8A 9ICLA 4DFJA 2VA2A 3PO4A 3PW7A 3C2MA 2FMQA 5DGBA 1ZQXA 4GC7A 1JMSA 4M9NA 3OHAA 2ATLA 1KFSA 8ICYA 3GIMA 3V72A 4FS2A 2MUTB 1JXLA 4RQ5A 3NGDA 3C1ZA 5DGAA 1TKDA 2GWSA 4PGQA 3PX4A 2AU0A 5DQIA 1ZQPA 2BPFA 1TK0A 2R8GA 2OWOA 1XSLA 2A1JA 1ZQQA 4J9SA 2NRVA 5DDYA 3T5LA 5J0TA 4I2GA 3M8RA 4O5CA 4UB4A 4MF8A 8ICHA 5KFEA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1QLN A;  3LWL A;  9ICS A;  4M6W A;  2J6S A;  4M47 A;  1KDH A;  2WTF A;  2KZM A;  8ICJ A;  4Q45 A;  5DB7 A;  1Y88 A;  1BGX T;  1BPB A;  1SKS A;  9ICW A;  1Z00 B;  5IIJ A;  2R8K A;  1LB2 B;  5EOZ A;  4J9L A;  3EPG A;  5DB8 A;  4RNN A;  5J0O A;  2AGP A;  1NJZ A;  1MQ3 A;  4GXI A;  4QWC A;  5BOL A;  8ICK A;  1DGS A;  1ZQK A;  4PHE A;  5HML A;  4QWB A;  3Q8P B;  1NK4 A;  3HP6 A;  4O3P A;  3H8W A;  4ECT A;  5KFT A;  5J2G A;  2VA8 A;  4KLT A;  4M2Y A;  7ICE A;  3PX6 A;  4KLS A;  1IM4 A;  4KMU A;  3JPS A;  2ASD A;  4M9G A;  3HW8 A;  3PNC A;  2FPM A;  2ZJ5 A;  2ZUD A;  5J0S A;  5KFZ A;  2AQ4 A;  2W9C A;  3Q8Q B;  1HUZ A;  5KFH A;  4QZC A;  4I2B A;  1HUO A;  4KLE A;  4FO6 A;  3GV5 B;  1WCN A;  2BCQ A;  1ZQL A;  2W8L A;  3ETL A;  3Q8M A;  5L1L A;  4RQ7 A;  3KHL A;  3BQ2 A;  5BPC A;  1MSW D;  4Q43 A;  8ICS A;  5J2E A;  1RXV A;  1XU4 A;  4QZ8 A;  3TAP A;  4DF8 A;  2VAN A;  4I2E A;  3MFH A;  4QW8 A;  1KEJ A;  4DEZ A;  3LK9 A;  3QZ7 A;  3MR5 A;  3PW5 A;  4LVS A;  5J2K A;  4DSE A;  3RRH A;  3THV A;  3JPR A;  3PMN A;  9ICJ A;  3ZDC A;  1ZQY A;  5KFO A;  2XGQ A;  4FBU A;  4QW9 A;  2AGQ A;  1TK5 A;  4YXM A;  4NLK A;  4YVZ A;  1UT5 A;  4F92 B;  4MFF A;  4YD1 A;  3OGU A;  3C23 A;  4O5K A;  1RXW A;  4BWM A;  5KFF A;  1S77 D;  4O3Q A;  2IA6 A;  1RPL A;  4KLF A;  7ICR A;  5KFX A;  4J9Q A;  3T5H A;  1ZQJ A;  2FMP A;  1NK5 A;  4M9L A;  2HHV A;  4K4G A;  5IIN A;  2PFP A;  3RJF A;  2ZUB A;  3RJK A;  9ICF A;  9ICE A;  8ICR A;  4UBB A;  4F93 B;  1TV9 A;  1NKC A;  4ECW A;  1NK8 A;  2JEG A;  3RJH A;  4KLI A;  3PY8 A;  4KTQ A;  3C5F A;  4NLZ A;  9ICT A;  3K75 D;  8ICO A;  3ZDA A;  4PHP A;  1N48 A;  1XSP A;  4DWI A;  4J9P A;  1QSL A;  4KLH A;  5DBA A;  4JK1 A;  4QWA A;  3MGH A;  2KFZ A;  5DDM A;  5IIK A;  3GDX A;  1RYR A;  2IHN A;  4EEY A;  2ISO A;  5L1J A;  4F4Z A;  4I2J A;  4Z6D A;  4ECV A;  3Q8S B;  1XC9 A;  4GLX A;  4PHA A;  2P66 A;  3TQ1 A;  4EZ6 A;  4BWJ A;  3GQC A;  4PHD A;  2JZB A;  4UB5 A;  4HYK A;  5KFV A;  2F1H A;  3PML A;  1QSY A;  2HHU A;  4DLG A;  8ICP A;  1JX4 A;  3OJS A;  3RAQ A;  1C7Y A;  2IMW P;  4UQG A;  4RNO A;  4I28 A;  2XC9 A;  2ZTE A;  3M8S A;  3SV3 A;  3RBE A;  3KTQ A;  5J2J A;  3PVX A;  3RB3 A;  5L1I A;  5J2B A;  1TAU A;  4DOB A;  5KT3 A;  4YR2 A;  4GXK A;  1S0O A;  4DL2 A;  5JUM A;  1NK6 A;  1SL0 A;  1SL2 A;  4M9J A;  3H7I A;  8ICQ A;  5CJ7 A;  4E0D A;  3RTV A;  3SZ2 A;  3V6H A;  2Y1I A;  2F1J A;  3ZD9 A;  5D46 A;  1S0M A;  4CCH A;  9ICN A;  2JEF A;  3G6X A;  4ED6 A;  1S0N A;  4ELV A;  2H5X A;  4DSF A;  7ICU A;  4KLD A;  8ICA A;  2BR0 A;  1N56 A;  4UAZ A;  2R8I A;  9ICO A;  2P6U A;  2RDJ A;  2J6U A;  2HHS A;  4ECS A;  3JPQ A;  2I9G A;  4I2A A;  5KG1 A;  9ICA A;  1COO A;  3V6J A;  4F2R A;  5DKW A;  1K1S A;  5DLG A;  4ELU A;  3UPQ A;  2A1J B;  2DFL A;  2PFN A;  4IQT A;  8ICW A;  7ICT A;  3H8J A;  4JWM A;  4TUS A;  1ZQB A;  4I27 A;  5J2F A;  2FPK A;  3HT3 A;  2PI4 A;  4TQR A;  5CWR A;  5F9L A;  1LV5 A;  4RZR A;  1NJW A;  3PV8 A;  8ICZ A;  2KFN A;  8ICT A;  4O3S A;  4IRC A;  7ICN A;  5J2D A;  7ICK A;  4J9R A;  5DBC A;  5F9N A;  9ICV A;  5KFB A;  4EYH B;  4O3R A;  3H40 A;  2J6T A;  8ICF A;  2V4R A;  2BHN A;  4R8U A;  4DLE A;  7ICL A;  5TZV A;  2BPC A;  2W9B B;  4P4P A;  1ZQR A;  2KZZ A;  3ISD A;  5J0X A;  3C5G A;  5DQH A;  3C2L A;  5CR0 A;  1MQ2 A;  2BCS A;  2HHT A;  8ICC A;  3ISC A;  2ZUC A;  4ED7 A;  1CEZ A;  2ZTC A;  2AGO A;  4DQR A;  2C22 A;  1X9W A;  5DG8 A;  2JEI A;  4ED2 A;  3V7K A;  1XO1 A;  2PXI A;  2HHW A;  4M0A A;  4XUS A;  3ORY A;  3HPO A;  1ZQS A;  2ISP A;  4DSJ A;  1EXN A;  4GXJ A;  3RJE A;  1ZQZ A;  4J9M A;  8ICN A;  2XCA A;  3RJG A;  3PX0 A;  3NTU A;  8ICI A;  1NKB A;  1RYS A;  3JPT A;  5D4B A;  5KFW A;  1ZQU A;  4TUR A;  5DLF A;  4C8M A;  3BDP A;  4DSL A;  1ZQF A;  4IQV A;  4F50 A;  3OSP A;  1ARO P;  5J0P A;  2DPJ A;  4KLQ A;  1JXE A;  4F5O A;  2BQR A;  3IM1 A;  1D9D A;  2XY5 A;  1T4G A;  4B9N A;  4KLL A;  2BGW A;  8ICU A;  3MAB A;  4IR9 A;  4IR1 A;  3RR8 A;  2R8H A;  4F91 B;  1ZQN A;  4RPX A;  1U4B A;  1KRP A;  2UVV A;  3BQ0 A;  2F1I A;  2W9M A;  1ZJM A;  2FLP A;  3RH6 A;  4KLG A;  4RQ3 A;  1U48 A;  4JV2 A;  1ZQO A;  4R8U B;  2IHM A;  2UVU A;  3PW2 A;  4YMO A;  4EBC A;  1WCL A;  4EBE A;  3RJI A;  1SKW A;  2HVI A;  1KFD A;  1S9F A;  1NJX A;  7ICH A;  3GIJ A;  1QSS A;  5KG2 A;  3AUO A;  7ICI A;  4QZB A;  5KFA A;  4MFA A;  5KFC A;  4MEY A;  5KT6 A;  4DS5 A;  1BPD A;  1QTM A;  1T7P A;  5CHG A;  2W9C B;  5L1K A;  4UB1 A;  1ZQH A;  4DL6 A;  4LZG A;  4DFM A;  2R8J A;  1B43 A;  4YG2 A;  5KT2 A;  4NM1 A;  4I29 A;  4YD2 A;  4RUA A;  5KFY A;  4Z6C A;  1X2I A;  5HHI A;  5KFJ A;  5KT7 A;  5KG3 A;  2FMS A;  5KFU A;  3Q8R B;  5KFK A;  5KFG A;  4QZD A;  2W9A A;  4DSI A;  4NY8 A;  3EWA A;  4R66 A;  4F2S A;  1ZQW A;  4QWE A;  3MR3 A;  2AQ0 A;  5KTQ A;  4DL5 A;  3PW4 A;  4Q8E A;  7ICJ A;  4UB3 A;  4UB2 A;  1TAQ A;  5KFP A;  1TVA A;  2HVH A;  2AJQ A;  4I2D A;  2Y1J A;  2BCR A;  7ICG A;  5KFI A;  1U49 A;  1D8L A;  4QZG A;  4KN4 A;  4Z6E A;  1ZQC A;  3GII A;  4NM2 A;  4QZE A;  7ICP A;  4QZA A;  3N4M B;  3Q8L A;  2XO7 A;  3RH4 A;  3SV4 A;  3H4B A;  1ZQV A;  9ICQ A;  5KG7 A;  1KLN A;  4IRK A;  9ICR A;  3FDS A;  3E2E A;  2V9W A;  5KFN A;  3SI8 A;  8ICV A;  4MEX A;  1S10 A;  3MDA A;  1X9S A;  3RBD A;  1BPX A;  2XGP A;  1JIH A;  4J9K A;  5HHH A;  3OSN A;  5J2A A;  3GFK B;  4XA5 A;  4XRH A;  3LDA A;  5EWE A;  4DS4 A;  2HHQ A;  2KZ3 A;  4C8N A;  1SL1 A;  2HW3 A;  1ZQD A;  5J2I A;  4K4H A;  7ICS A;  3GV7 B;  4BGD A;  7ICO A;  1NK9 A;  1SKR A;  4TUP A;  1T8E A;  4R64 A;  3PR5 B;  4DF4 A;  3JPP A;  4RQ2 A;  1XSN A;  2VA3 A;  4DQI A;  3GV8 B;  4GC6 A;  7ICV A;  4IQW A;  3QEA Z;  2NRX A;  2FLL A;  3FYH A;  9ICC A;  4BDP A;  9ICK A;  1DOQ A;  1Z00 A;  3C21 A;  4IQU A;  4RT3 A;  2FPL A;  4PGX A;  3RRG A;  4R63 A;  2P6R A;  4QWD A;  3MDC A;  2V4Q A;  4LZD A;  4YN4 A;  5DG7 A;  7ICQ A;  5IIO A;  3LWM A;  1L5U A;  4UAY A;  3EW9 A;  3AU2 A;  1H38 A;  4YR3 A;  4C8L A;  4K4I A;  3PW0 A;  3RB6 A;  3ZDB A;  3QEB Z;  3V6K A;  2JZB B;  3ZD8 A;  4QZF A;  4C8O A;  4DO9 A;  4B9S A;  4YR0 A;  4TQS A;  3TAQ A;  4B9M A;  2RDI A;  2W8K A;  3ZDD A;  5EWG A;  4I2H A;  1TFR A;  5J0Y A;  3M9N B;  4O0I A;  3KHR A;  2BCV A;  2JEJ A;  4O9M A;  1NKE A;  4TUQ A;  2XY7 A;  5L9X A;  5KG4 A;  3T3F A;  4ECQ A;  4I2I A;  1JN3 A;  4DFK A;  3UQ0 A;  1ZET A;  4F5R A;  3UQ2 A;  5KFS A;  2ASL A;  4F3O A;  2BCU A;  1V9P A;  5J2C A;  9ICU A;  2C2R A;  3JPN A;  1U45 A;  2BPG A;  2NRZ A;  4Z6F A;  4I2C A;  4KLO A;  3IHQ B;  3QZ8 A;  4M9H A;  5CB1 A;  3MR6 A;  2C2E A;  3RAX A;  2ZJA A;  1D9F A;  5KG5 A;  4DQP A;  2HHX A;  3HX0 A;  8ICL A;  1S76 D;  4ECR A;  1KTQ A;  4UAW A;  4F4W A;  2IBK A;  1IXR A;  1BPY A;  4UBC A;  4YCX A;  2B21 A;  4EYI B;  1S97 A;  2DPI A;  2PFQ A;  5D49 A;  4BXO B;  4F4K A;  4KLM A;  4JV1 A;  4M04 A;  4FBT A;  3MGI A;  2UVR A;  1ZYQ A;  3GIK A;  3PO5 A;  3BQT A;  5DG9 A;  1KFT A;  4NLN A;  8ICE A;  9ICB A;  5KG0 A;  4RQ4 A;  2BKE A;  5DBB A;  2LYH A;  2ZTD A;  5III A;  5J2H A;  5CP2 A;  4DL4 A;  3M9O B;  3MR2 A;  3RR7 A;  1Z3E B;  3GIL A;  4YMM A;  3RB0 A;  4QZI A;  5HP4 A;  1PZN A;  4B9U A;  4YMN A;  4RNM A;  4F5P A;  4DL3 A;  3QE9 Y;  5KFM A;  1UT8 A;  3T5J A;  3Q8K A;  3UXO A;  4ECU A;  9ICH A;  2XCP A;  2ASJ A;  4RPY A;  3TFS A;  4QZH A;  2M9N A;  3B0X A;  4ED3 A;  4P4M A;  1S0V A;  3TI0 A;  4ECX A;  4J9O A;  5J0W A;  3M9M B;  5KG6 A;  3OHB A;  1CUK A;  3C2K A;  4ECY A;  4PPX A;  3BJY A;  5KFL A;  4RQ1 A;  1A77 A;  3KHG A;  3N97 B;  3K4G A;  4KN7 A;  4YFK A;  4DQQ A;  3PR4 A;  4YQW A;  8ICM A;  5HNK A;  4R65 A;  1L3V A;  1K1Q A;  9ICM A;  4G3I A;  3JPO A;  4KLJ A;  3ZDE A;  4F8R A;  4NXZ A;  5J0R A;  1SZP A;  3EYZ A;  4JWN A;  1HJP A;  4Q8F A;  2FLN A;  5KT5 A;  4DQS A;  2ZJ8 A;  5KFR A;  1XS9 D;  3KHH A;  1BPZ A;  7ICM A;  2KN7 A;  1B22 A;  4P4O A;  4DSK A;  4M6W B;  4FS1 A;  2C28 A;  4B9T A;  4P2H A;  3UXP A;  4RUC A;  4Q44 A;  4J9N A;  1KSP A;  9ICX A;  1NOM A;  5EWF A;  4ELT A;  4EBD A;  1MC8 A;  4C8K A;  3BQ1 A;  9ICP A;  2XY6 A;  1ZQG A;  3V7J A;  4O3O A;  1X9M A;  2PI5 A;  4PH5 A;  1ZQI A;  4MFC A;  2MUT A;  4IRD A;  5HMM A;  4XQ8 A;  3G6Y A;  1ZQA A;  3AU6 A;  1U9L A;  5CA7 A;  4RU9 A;  3MBY A;  3RB4 A;  3C1Y A;  5IIM A;  5BOM A;  4F4X A;  4ED1 A;  3EZ5 A;  2NRW A;  5DQG A;  3T5K A;  4BXO A;  3OJU A;  4YXJ A;  5C5J A;  4O3N A;  5KT4 A;  3MFI A;  3SYZ A;  3TAN A;  3EPI A;  3B0Y A;  2BQ3 A;  1NJY A;  1NK0 A;  4DOA A;  4KIT B;  2BDP A;  4RPZ A;  4ZH4 A;  3G6V A;  4JV0 A;  9ICG A;  8ICX A;  4JUZ A;  4X5V A;  2I1Q A;  5DB6 A;  1ZQE A;  3H8S A;  2ALZ A;  5KFQ A;  2UVW A;  4NLG A;  4B9L A;  3HWT A;  1T3N A;  3H4D A;  1L3U A;  3RJJ A;  4B9V A;  4I2F A;  1D8Y A;  3UXN A;  4F4Y A;  2KTQ A;  7ICF A;  9ICI A;  4F5N A;  5IIL A;  3RH5 A;  1XWL A;  4MF2 A;  5DB9 A;  3V7L A;  1UA0 A;  1ZJN A;  1L3S A;  1U47 A;  1A76 A;  4ECZ A;  3TAR A;  1L3T A;  8ICB A;  1UA1 A;  8ICG A;  4RQ0 A;  4YP3 A;  4DFP A;  1BVS A;  4F5Q A;  5J0Q A;  4ED0 A;  2NRT A;  4DL7 A;  4KLU A;  4RT2 A;  2Q0Z X;  4QZ9 A;  2MAX A;  4RQ6 A;  4DOC A;  2BQU A;  1RZT A;  1ZQM A;  1NK7 A;  5J0U A;  4ED8 A;  4RQ8 A;  4O5E A;  5KFD A;  4PGY A;  3TFR A;  1BPE A;  4EZ9 A;  2PFO A;  2W9B A;  1ZQT A;  5J29 A;  3ISB A;  2C2D A;  1TK8 A;  9ICL A;  4DFJ A;  2VA2 A;  3PO4 A;  3PW7 A;  3C2M A;  2FMQ A;  5DGB A;  1ZQX A;  4GC7 A;  1JMS A;  4M9N A;  3OHA A;  2ATL A;  1KFS A;  8ICY A;  3GIM A;  3V72 A;  4FS2 A;  2MUT B;  1JXL A;  4RQ5 A;  3NGD A;  3C1Z A;  5DGA A;  1TKD A;  2GWS A;  4PGQ A;  3PX4 A;  2AU0 A;  5DQI A;  1ZQP A;  2BPF A;  1TK0 A;  2R8G A;  2OWO A;  1XSL A;  2A1J A;  1ZQQ A;  4J9S A;  2NRV A;  5DDY A;  3T5L A;  5J0T A;  4I2G A;  3M8R A;  4O5C A;  4UB4 A;  4MF8 A;  8ICH A;  5KFE A; 
#chains in the Genus database with same CATH topology
 3LWL A;  9ICS A;  4NLB A;  1KQQ A;  2J6S A;  2WF9 A;  1KDH A;  4Q45 A;  2R8K A;  2ZIV B;  2W7P A;  3EPG A;  5DB8 A;  3MC1 A;  8ICK A;  2WFA A;  5ALH A;  4PHE A;  4QWB A;  3Q8P B;  1NK4 A;  4O3P A;  5KFT A;  5J2G A;  5ALQ A;  4KLT A;  4M2Y A;  2KJ8 A;  1IM4 A;  2QKQ A;  2DL0 A;  1SV0 A;  3PNC A;  2A19 A;  2W9C A;  3PSF A;  1A0P A;  3Q8Q B;  4QZC A;  2CXY A;  2BCQ A;  2W8L A;  5L1L A;  5GTI U;  8ICS A;  1RXV A;  1XU4 A;  4QZ8 A;  5ALD A;  3LK9 A;  4LVS A;  9ICJ A;  3JPR A;  3ZDC A;  3QUT A;  2HBK A;  2HMX A;  1LKY A;  4YXM A;  1ZD3 A;  2LM1 A;  4YVZ A;  2FDR A;  4YD1 A;  3C23 A;  1S77 D;  2IA6 A;  1D8B A;  4J9Q A;  5KAI U;  1ZQJ A;  2HHV A;  2OM6 A;  2JRZ A;  1HIW A;  1NKC A;  1NK8 A;  2JEG A;  1KBU A;  5ALK A;  3N28 A;  2FJ6 A;  3ZDA A;  1F0M A;  4KLH A;  4JK1 A;  4QWA A;  3BQ7 A;  2YMM A;  5DDM A;  2ISO A;  5L1J A;  4F4Z A;  4Z6D A;  1XC9 A;  3GQC A;  4PHD A;  3K1Z A;  2KE7 A;  8ICP A;  3M6K A;  3SAF A;  1C7Y A;  1N60 A;  2IMW P;  2ZTE A;  2KSO B;  1NZB A;  3PVX A;  5L1I A;  5KT3 A;  3C29 A;  3V6H A;  2Y1I A;  1V38 A;  1L7M A;  1L8L A;  2H5X A;  2K8A A;  4PZO A;  2WF6 A;  1WWU A;  2E8N A;  4ECS A;  2I9G A;  2JMG A;  1COO A;  3V6J A;  5ALL A;  2A1J B;  2DFL A;  1JUD A;  4I27 A;  2PI4 A;  1RQN A;  7ICN A;  5J2D A;  7ICK A;  4J9R A;  2H3I A;  3MGV A;  1RQL A;  8ICF A;  2V4R A;  4DLE A;  2W9B B;  3SD7 A;  4UW9 A;  1ZQR A;  4USA A;  1RG6 A;  2K60 A;  8ICC A;  2QLT A;  2BCS A;  2C22 A;  3NAS A;  2LMR A;  1FEZ A;  2ISP A;  3ORY A;  4DSJ A;  3RJE A;  1Q46 A;  8ICN A;  1C20 A;  5L1M A;  2K4P A;  2H3Z A;  5KFW A;  3BDP A;  3M7D A;  2KD1 A;  1JXE A;  4F5O A;  1D9D A;  1ZD4 A;  3RR8 A;  2R8H A;  4OJ6 A;  4RPX A;  1U4B A;  2UVV A;  3BQ0 A;  2F1I A;  1ZJM A;  1SV4 A;  2IHM A;  2EAN A;  4YMO A;  4EBE A;  3RJI A;  3S6J A;  1SKW A;  1NJX A;  3GIJ A;  1QSS A;  4QIW C;  5KT6 A;  5ALP A;  1T7P A;  1TE2 A;  4Z6C A;  1X2I A;  5KFJ A;  2FMS A;  3Q8R B;  5KFG A;  4NY8 A;  3EWA A;  5EE9 A;  4Q8E A;  3HRD D;  1ZQ1 C;  1TVA A;  4I2D A;  3WK8 A;  5KFI A;  1U49 A;  1D8L A;  4BUG A;  4QZG A;  5CEH A;  2EAP A;  2IOF A;  3IN5 A;  4QZA A;  3N4M B;  1YT3 A;  9ICQ A;  4UAV A;  3FDS A;  4RQM A;  2B6G A;  4NJ8 A;  8ICV A;  4MEX A;  1S10 A;  1BPX A;  4EEL A;  5J2A A;  5AIA A;  3LDA A;  1AQ6 A;  1T8E A;  5EE0 A;  1XSN A;  7ICV A;  4U6P A;  4DQI A;  3GV8 B;  2HBM A;  3QEA Z;  9ICK A;  4RT3 A;  4PGX A;  4QWD A;  2AXT U;  2KP7 A;  4LZD A;  2F8K A;  2EZX A;  1L5U A;  1H38 A;  3FC4 A;  2OXO A;  3WKC A;  3KZX A;  2NYV A;  4QZF A;  4B9S A;  4B9M A;  2KK0 A;  2RDI A;  4CRX A;  3T3F A;  5ALR A;  4DFK A;  3ZI4 A;  4F3O A;  5KFS A;  5J2C A;  1DK3 A;  2BPG A;  3F2C A;  3QZ8 A;  5CB1 A;  3MR6 A;  1A6S A;  1MA7 A;  4JMU A;  2ZJA A;  1DXS A;  8ICL A;  1BPY A;  4EYI B;  2DPI A;  2PFQ A;  2Y0S F;  2KMD A;  2RP5 A;  3DEE A;  4CNQ A;  3PO5 A;  3NVV A;  5DG9 A;  2W7O A;  9ICB A;  8ICE A;  2WF5 A;  5KG0 A;  1KFT A;  3I28 A;  5DBB A;  2LYH A;  2MA1 A;  5J2H A;  5CP2 A;  2JR5 A;  3MR2 A;  1JAL A;  1Z3E B;  3A0H U;  4CF3 A;  4YMN A;  2ASJ A;  2K89 A;  3M9M B;  3OHB A;  4RQ1 A;  1L8O A;  1PK1 B;  1K1Q A;  3NVZ A;  3QNM A;  3ZDE A;  4F8R A;  3EYZ A;  5KFR A;  7ICM A;  1B22 A;  4P2H A;  3SEN A;  1MN8 A;  1KSP A;  2WAQ C;  4J9N A;  1UQV A;  1Q3V A;  4KMO B;  2OEH A;  3F5E A;  3CP8 A;  5ALG A;  1J97 A;  3BQ1 A;  1ZQG A;  2DGZ A;  5ALE A;  1X9M A;  2IOH A;  2MUT A;  2LKY A;  2XVT A;  3AU6 A;  3KKA A;  5GTH U;  3BS5 B;  3RB4 A;  4PJ0 U;  5AM1 A;  3BZC A;  2EQY A;  3NVY A;  5DQG A;  3OJU A;  2EDU A;  5C5J A;  3TAN A;  4O3N A;  5JTI A;  2EAO A;  2ZIW B;  1N63 A;  4DOA A;  3WU2 U;  3CYM A;  4OCZ A;  1ED1 A;  5AIC A;  2UVW A;  2Y9T A;  4B9L A;  3HWT A;  5G5G A;  1D8Y A;  2KTQ A;  1Q3U A;  2EAM A;  7ICF A;  1U47 A;  2W3S A;  3SEI A;  1UA1 A;  4C7Z A;  3F2D A;  4DL7 A;  5AKI A;  2NRT A;  1WYG A;  4RT2 A;  4DOC A;  1RZT A;  5ALT A;  5KFD A;  3UMB A;  1S8O A;  2PFO A;  1ZQT A;  3PW7 A;  5AI4 A;  3C2M A;  5AK6 A;  1JMS A;  2ATL A;  1F44 A;  5F3X B;  1UPH A;  5ALZ A;  3V72 A;  2MUT B;  3C1Z A;  3PX4 A;  2R8G A;  4US8 A;  3IP4 B;  4J9S A;  4FZL A;  5DDY A;  1SB3 C;  3T5L A;  1WUD A;  5KFE A;  1QLN A;  1GO3 F;  2WTF A;  2KZM A;  8ICJ A;  1Y88 A;  2GH1 A;  1X42 A;  2BDU A;  4J9L A;  4CE6 A;  3D2N A;  4QWC A;  4O3M A;  2G09 A;  1QCK A;  4PL1 A;  1NNL A;  5ALY A;  3PX6 A;  4KLS A;  2ASD A;  4M9G A;  2ZJ5 A;  3F53 A;  4FO6 A;  3BS7 A;  1ZQL A;  3ETL A;  3O0F A;  3Q8M A;  3KHL A;  4Q43 A;  1UCV A;  3WKE A;  2YN4 A;  2ZIX A;  4I2E A;  3PW5 A;  1KEJ A;  1S5L U;  5J2K A;  3C28 A;  3THV A;  3PMN A;  2K4E A;  3F2B A;  2XGQ A;  4FBU A;  1ZRN A;  5AI5 A;  1TK5 A;  2ZXI A;  1UT5 A;  4F92 B;  4UAT A;  1J2M A;  7ICR A;  4M9L A;  2PFP A;  2VKQ A;  9ICF A;  2WAQ F;  9ICE A;  1SWW A;  1TV9 A;  4KLI A;  4NLZ A;  9ICT A;  1RYU A;  1N48 A;  2IHN A;  4I2J A;  1LKY B;  4PHA A;  2P66 A;  3TQ1 A;  2KJ5 A;  4BWJ A;  4HYK A;  3PML A;  1BNO A;  2HHU A;  3M1Y A;  2WF8 A;  3OJS A;  3RAQ A;  2CRX A;  2O6K A;  4I28 A;  3SV3 A;  5JRT A;  5AK3 A;  3RBE A;  5ALI A;  2KNJ A;  5J2J A;  5J2B A;  4GXK A;  1S0O A;  4DL2 A;  1NK6 A;  2JH7 A;  8ICQ A;  3RTV A;  3SZ2 A;  1Z4N A;  9ICN A;  1SXD A;  4FZM A;  4DSF A;  4B6J A;  2BR0 A;  2DUY A;  2P6U A;  2J6U A;  2LI6 A;  1Z19 A;  4C0Z A;  3PSI A;  4F2R A;  5DLG A;  7ICT A;  2W03 A;  3H8J A;  4JWM A;  1ZQB A;  5HR7 A;  5J2F A;  2YB4 A;  2KFN A;  5ALF A;  9ICV A;  5F9N A;  3N7S C;  5KFB A;  4O3R A;  2J6T A;  2BPC A;  3IG8 A;  1PVR A;  3C5G A;  3C2L A;  5CR0 A;  3ISC A;  3WK7 A;  2AGO A;  4C4T A;  4DQR A;  1X9W A;  2JEI A;  4ED2 A;  3V7K A;  1XO1 A;  4M0A A;  2YMP A;  4Y2T A;  4XUS A;  5AKL A;  1EXN A;  1SGG A;  1F5S A;  5ALU A;  1VLB A;  4DSL A;  2HSZ A;  1ZQF A;  5A0L A;  4GIB A;  3OSP A;  5J0P A;  4KLQ A;  3IM1 A;  3GZF A;  2JH1 A;  2BGW A;  3MAB A;  4IR9 A;  4F91 B;  1KRP A;  1O08 A;  2W9M A;  2FLP A;  4US9 A;  3RH6 A;  1U48 A;  1ZQO A;  2L5Y A;  4EBC A;  3OPX A;  3AN1 A;  5AKE A;  2YQE A;  4AYB C;  4C4S A;  4MFA A;  4MEY A;  4DS5 A;  4UB1 A;  4DL6 A;  4LZG A;  2R8J A;  4YG2 A;  5KFY A;  5HHI A;  5KG3 A;  5KFU A;  4QZD A;  2W9A A;  4F2S A;  2AQ0 A;  4UB3 A;  2YB1 A;  3EUB 2;  4OD0 A;  2W04 A;  1ZQC A;  3QU7 A;  7ICP A;  1L6N A;  2E8O A;  3Q8L A;  3HIL A;  3H4B A;  1ZQV A;  3TAD C;  2GLE A;  3SI8 A;  1FFV A;  3KZI U;  3QUQ A;  3OSN A;  3AQE A;  3GFK B;  1LVH A;  4IC9 A;  4BGD A;  7ICO A;  1NK9 A;  1SKR A;  3PR5 B;  2LPE A;  4GC6 A;  4IQW A;  1SIJ A;  3AM9 A;  9ICC A;  1DOQ A;  1FO4 A;  1B0X A;  2P6R A;  2QAR B;  3MDC A;  2V4Q A;  4YN4 A;  7ICQ A;  4UAY A;  2G0A A;  4U7C A;  3ZDB A;  1TAM A;  2F44 A;  1T3Q A;  4CGZ A;  4DO9 A;  4I2H A;  2W8K A;  7ICE A;  3M9N B;  3KHR A;  2BCV A;  2OYY A;  4I2I A;  3FM9 A;  3NUQ A;  3JPN A;  4M9H A;  4DQP A;  4NL9 C;  5KG5 A;  4ZOH C;  4UAW A;  1IXR A;  1S97 A;  4F4K A;  4JV1 A;  4M04 A;  2JXJ A;  3MGI A;  3BQT A;  3OTQ A;  4RQ4 A;  5III A;  4DL4 A;  3RR7 A;  4UB8 U;  4YMM A;  1K5O A;  4QZI A;  1PZN A;  4DL3 A;  2WB1 C;  3Q8K A;  5KFM A;  1UT8 A;  9ICH A;  3UXO A;  4ECU A;  4IL6 U;  4RPY A;  2HOF A;  4AP9 A;  1N62 A;  4PPX A;  3KHG A;  4YFK A;  5HNK A;  2E1E A;  4Q8F A;  1SZP A;  5AK4 A;  1HJP A;  1BPZ A;  2KN7 A;  4B9T A;  2F76 X;  4Q44 A;  9ICX A;  1NOM A;  5AI9 A;  2WB1 F;  4O3O A;  4NLC A;  2PI5 A;  2DWQ A;  4PH5 A;  4MFC A;  1ZOL A;  5T14 A;  5HMM A;  4KX3 A;  2ZXH A;  3SAH A;  2KKP A;  3NRW A;  4RU9 A;  4FFD A;  2Y9U A;  5BOM A;  2LYB A;  3R9K A;  4F4X A;  4ED1 A;  2NRW A;  2PKE A;  5AM5 A;  4F71 A;  3SYZ A;  3EPI A;  4JV0 A;  2MSN A;  4X5V A;  2E3T A;  4NV0 A;  2G06 A;  3AL0 B;  2KEY A;  2W11 A;  2QB0 B;  1T3N A;  3H4D A;  4Y2S A;  2W54 A;  4G9B A;  4F4Y A;  3PSP A;  5IIL A;  1XWL A;  4MF2 A;  3IDW A;  5ALV A;  8ICB A;  8ICG A;  4YP3 A;  3KFU F;  4DFP A;  1BVS A;  4F5Q A;  5J0Q A;  4ED0 A;  1YZ6 A;  4QZ9 A;  4RQ6 A;  1L7P A;  2F8L A;  5J0U A;  2JGA A;  4RQ8 A;  2E1F A;  4PGY A;  4OJP A;  4EZ9 A;  3ISB A;  2CN1 A;  4DFJ A;  2VA2 A;  3PO4 A;  2FMQ A;  3A0B U;  4GC7 A;  4M9N A;  1KFS A;  1N5X A;  2GOL A;  1XO0 A;  1X66 A;  4FS2 A;  2YTU A;  3NGD A;  5DGA A;  5AKK A;  3L5K A;  1XSL A;  2B0C A;  2NRV A;  5J0T A;  3HJE A;  4M6W A;  2ZIV A;  5DB7 A;  1BGX T;  1BPB A;  1SKS A;  1Z00 B;  5IIJ A;  4J03 A;  1LB2 B;  5EOZ A;  5AIB A;  2OHF A;  3NRZ A;  3QX7 A;  1NJZ A;  2YML A;  4GXI A;  5BOL A;  1DGS A;  3SAG A;  1FFU A;  1N2X A;  1URJ A;  3H8W A;  4ECT A;  5ALW A;  1N61 A;  2VA8 A;  3QUC A;  5KL8 B;  4KMU A;  3NS1 A;  3TAC B;  2W55 A;  3HW8 A;  3ICX A;  2AQ4 A;  5B5E U;  1HUZ A;  5KFH A;  5ALN A;  1NZP A;  3KKA C;  3GV5 B;  2LM4 A;  4Y2X A;  4RQ7 A;  3QU9 A;  5BPC A;  2ZIU A;  2DQN B;  1RM6 C;  3MFH A;  4QW8 A;  4BJQ A;  1ZQY A;  5KFO A;  4MHV A;  2AGQ A;  2OH2 A;  2E8M A;  4NLK A;  3I1Y A;  4MFF A;  4O5K A;  3GU3 A;  1RPL A;  4KLF A;  3T5H A;  4Y2Q A;  4K4G A;  2ZUB A;  3RJK A;  4QNL A;  5AHX A;  4OO1 J;  2E5S A;  3E0F A;  2ZG6 A;  1VDV A;  4F93 B;  3RJH A;  4KTQ A;  2OCE A;  8ICO A;  5AM4 A;  3RF9 A;  4Y2J A;  5DBA A;  2IOF K;  2KFZ A;  4CF4 A;  3Q8S B;  4UAS A;  1CRX A;  4FE3 A;  4NWI A;  2JZB A;  4UB5 A;  1QSY A;  2F1H A;  3L3F X;  1DGJ A;  4UQG A;  2XC9 A;  4EEN A;  1TAU A;  1HEK A;  3PST A;  5JUM A;  4M9J A;  4E0D A;  2KIW A;  2F1J A;  3ZD9 A;  5D46 A;  1S0M A;  3G6X A;  4ELV A;  2K4H A;  2PMZ F;  2QAR A;  3D6J A;  4F72 A;  4EX6 A;  1N56 A;  4UAZ A;  9ICO A;  4P0Q A;  2RDJ A;  3ETR A;  9ICA A;  5DKW A;  4Y2V A;  4ELU A;  1Z1V A;  3UPQ A;  2PFN A;  8ICW A;  1ZRM A;  4TUS A;  3TKA A;  5F9L A;  1KN5 A;  4RZR A;  1IG6 A;  8ICT A;  4IRC A;  2ODG A;  1ZD2 P;  3WKD A;  5DBC A;  4EYH B;  3H40 A;  2KVC A;  2BHN A;  4R8U A;  7ICL A;  5E79 U;  5TZV A;  1PK3 A;  2XID A;  1ZXI A;  3IG5 A;  3QU5 A;  1MQ2 A;  2K4I A;  2H3F A;  2HHW A;  5EE1 A;  3HPO A;  3LYS A;  4J9M A;  4PZN A;  2XCA A;  3RJG A;  3PX0 A;  8ICI A;  5D4B A;  1ECW A;  2GO7 A;  2RQ5 A;  5DLF A;  2BQR A;  2XY5 A;  3ED5 A;  2KOB A;  4B9N A;  4IR1 A;  1FIQ A;  1ZQN A;  4RQ3 A;  4JV2 A;  3PW2 A;  4C4R A;  3BS5 A;  1KFD A;  3SMV A;  5KG2 A;  3AUO A;  3ONN A;  7ICI A;  1QQ6 A;  5KFA A;  5KFC A;  1BPD A;  1QTM A;  5KNI A;  1SZH A;  1ZQH A;  4DFM A;  4I29 A;  4YD2 A;  5KT7 A;  3UMG A;  1PUZ A;  4R66 A;  1ZQW A;  4DL5 A;  7ICJ A;  1OW5 A;  4UB2 A;  5KFP A;  4P0P B;  2HVH A;  2AJQ A;  2BCR A;  2ZIU B;  4UAU A;  2M0N A;  4Z6E A;  2DKZ A;  1ZD5 A;  3J81 j;  5AM2 A;  5KG7 A;  4IRK A;  9ICR A;  1NI3 A;  2V9W A;  3D2Q A;  2JV3 A;  3MDA A;  3RBD A;  1JIH A;  4J9K A;  3KBB A;  4DS4 A;  4XA5 A;  3WK6 A;  1SL1 A;  3N7R C;  4K4H A;  7ICS A;  3GV7 B;  1T94 A;  2KG5 A;  4TUP A;  3D2S A;  4R64 A;  3CNH A;  3JPP A;  4DF4 A;  2FLL A;  2DF4 B;  3FYH A;  4BDP A;  1Z00 A;  4IQU A;  3RRG A;  2FPL A;  5DG7 A;  3LWM A;  3EW9 A;  3AU2 A;  4YR3 A;  3PW0 A;  3QEB Z;  1N5W A;  2JZB B;  1WG8 A;  4C8O A;  4YR0 A;  3B9J A;  1TFR A;  5J0Y A;  2NO4 A;  2JEJ A;  1NKE A;  3BZK A;  5KG4 A;  1ZET A;  3UQ0 A;  4LJX A;  2ASL A;  2C2R A;  1U45 A;  2NRZ A;  4Z6F A;  1X6I A;  2C2E A;  2DBY A;  3RAX A;  2LBO A;  2HHX A;  3HX0 A;  1KKX A;  4ECR A;  1KTQ A;  4F4W A;  2IBK A;  4BXO B;  5AK5 A;  2B21 A;  4YCX A;  5D49 A;  2FI1 A;  4KLM A;  4FBT A;  1X9X A;  5KAF U;  1DK2 A;  2UVR A;  3GIK A;  2H3Q A;  2BKE A;  2ZTD A;  4HAI A;  2NO5 A;  3M9O B;  1X6J A;  3GIL A;  3PZP A;  4F5P A;  2K8B B;  2KIC A;  2XCP A;  3SQI A;  2KVS A;  2M9N A;  3B0X A;  1S0V A;  3CW2 C;  4J9O A;  5J0W A;  5KG6 A;  1CUK A;  4ECY A;  3F5A A;  2YX8 A;  3H0M B;  3QUB A;  3N97 B;  2VJ5 A;  4YQW A;  2G08 A;  2RLT A;  9ICM A;  1M6Y A;  2HI0 A;  5C0Y A;  3T79 A;  4NXZ A;  3WK9 A;  2FLN A;  2Z7J A;  4DQS A;  2ZJ8 A;  3M6Z A;  3KHH A;  4P4O A;  4DSK A;  4FS1 A;  2C28 A;  4ICA A;  4RUC A;  4JB3 A;  4ELT A;  1V85 A;  4NL9 A;  2CPR A;  2NV3 A;  4P0P A;  9ICP A;  2F77 X;  3V7J A;  3WKB A;  1RDF A;  3G6Y A;  2A1A A;  2G07 A;  3C1Y A;  1PK1 A;  5IIM A;  1SV0 C;  1L7O A;  4YXJ A;  1BNP A;  5KT4 A;  1NJY A;  2KJ9 A;  2XI9 A;  4KIT B;  4RPZ A;  3G6V A;  3DV9 A;  2KSO A;  3L4P A;  4CDG A;  4JUZ A;  8ICX A;  1ZQE A;  4AYB F;  2R18 A;  4B9V A;  1L3U A;  3RJJ A;  3UXN A;  1SXE A;  9ICI A;  4F5N A;  3RH5 A;  5DB9 A;  1ZJN A;  4Y2P A;  3TAR A;  1L3T A;  2A3V A;  4RQ0 A;  2HOI A;  2F2A B;  3AQF A;  2HCF A;  2Q0Z X;  2BQU A;  1ZQM A;  2KKV A;  4ED8 A;  3AEV A;  3TFR A;  1BPE A;  1TK8 A;  3RFA A;  4EEK A;  5DGB A;  1ZQX A;  3OHA A;  1B4F A;  3H8M A;  8ICY A;  2HDO A;  2WHE A;  2ESE A;  4WJ3 B;  4RQ5 A;  4PGQ A;  1ZQP A;  2BPF A;  2OWO A;  1ZQQ A;  3I76 A;  2W43 A;  4I2G A;  3M8R A;  4O5C A;  4FZN A;  4UB4 A;  8ICH A;  2KIV A;  4M47 A;  4KX5 A;  9ICW A;  3FAH A;  1Q8K A;  1O03 A;  2I6X A;  4RNN A;  5J0O A;  2AGP A;  1MQ3 A;  1SWV A;  1ZQK A;  5HML A;  3HP6 A;  2KHQ A;  3JPS A;  2FPM A;  2ZUD A;  1JRP A;  5KFZ A;  5J0S A;  4I2B A;  1WWV A;  4KLE A;  1HUO A;  5TIS U;  1WCN A;  5KL1 B;  3BQ2 A;  1MSW D;  5J2E A;  4Y2U A;  3TAP A;  4DF8 A;  2VAN A;  4RQN A;  4DEZ A;  3QZ7 A;  3MR5 A;  4DSE A;  3RRH A;  4QW9 A;  2JHD A;  1COK A;  3OGU A;  3E58 A;  2AHO B;  1RXW A;  4BWM A;  5KFF A;  4O3Q A;  5KFX A;  2VIX A;  2FMP A;  1NK5 A;  5IIN A;  3RJF A;  4DFD A;  4ACO A;  8ICR A;  4Y2Y A;  4UBB A;  3AMZ A;  4ECW A;  3PY8 A;  5AKZ A;  3C5F A;  3K75 D;  4PHP A;  1XSP A;  4DWI A;  4J9P A;  1QSL A;  3MGH A;  4PL2 A;  5IIK A;  3GDX A;  1RYR A;  2XIC A;  4EEY A;  1J2N A;  4ECV A;  4GLX A;  4EZ6 A;  2KHV A;  5KFV A;  4DLG A;  1JX4 A;  5AI8 A;  2MRL A;  4RNO A;  3M8S A;  1QQ7 A;  2HBJ A;  3QYP A;  4A8E A;  3KTQ A;  3RB3 A;  5ALJ A;  4DOB A;  2H3V A;  4YR2 A;  1SL2 A;  1SL0 A;  3H7I A;  5CJ7 A;  2RHF A;  4GFJ A;  4CCH A;  2JEF A;  1S0N A;  4ED6 A;  5J8Y C;  2K8C B;  5ALO A;  7ICU A;  4KLD A;  8ICA A;  2KV2 A;  2R8I A;  3DDH A;  2HHS A;  3H0R B;  5ALM A;  3VC8 A;  3JPQ A;  4I2A A;  5KG1 A;  1K1S A;  1CI4 A;  4IQT A;  3HT3 A;  2FPK A;  3SR6 A;  4TQR A;  5CWR A;  1LV5 A;  1NJW A;  3PV8 A;  8ICZ A;  4O3S A;  2D3D A;  2YY6 A;  5AI6 A;  2E8P A;  4P4P A;  1OXJ A;  2KZZ A;  3ISD A;  5J0X A;  5DQH A;  2HHT A;  2ZUC A;  4ED7 A;  1CEZ A;  2ZTC A;  5DG8 A;  2PXI A;  3U26 A;  1ZQS A;  2LYA A;  1ZQZ A;  4QIW F;  3NTU A;  3TAD A;  1JI7 A;  1NKB A;  1RYS A;  3JPT A;  1IIP A;  1ZQU A;  4TUR A;  4C8M A;  4IQV A;  4F50 A;  1ARO P;  2DPJ A;  1T4G A;  3IV6 A;  4KLL A;  2QB1 A;  8ICU A;  2WF7 A;  4KLG A;  4R8U B;  2UVU A;  1WCL A;  2HVI A;  7ICH A;  1S9F A;  3LVV A;  4QZB A;  5AI0 A;  4CF5 A;  1V97 A;  3HKZ F;  5CHG A;  2W9C B;  5L1K A;  1B43 A;  4NM1 A;  5KT2 A;  4RUA A;  3H0L B;  5KFK A;  1Z1B A;  2ZIW A;  4DSI A;  4QWE A;  5AKJ A;  3MR3 A;  5KTQ A;  3PW4 A;  1TAQ A;  2ZIX B;  2W3R A;  2Y1J A;  3QU2 A;  7ICG A;  5AKY A;  4KN4 A;  3GII A;  4NM2 A;  4QZE A;  2XO7 A;  3RH4 A;  3SV4 A;  1KLN A;  2LHT A;  1OUQ A;  3E2E A;  2DKX A;  5KFN A;  1X9S A;  2XGP A;  5HHH A;  4XRH A;  5EWE A;  2HHQ A;  1PVP A;  2KZ3 A;  4C8N A;  2HW3 A;  3QXG A;  2HBL A;  5J2I A;  1ZQD A;  1JRO A;  1KW4 A;  2VA3 A;  4RQ2 A;  5EE3 A;  2NRX A;  3HKZ C;  3C21 A;  3UMC A;  4R63 A;  5FP0 A;  5AM0 A;  5IIO A;  4C8L A;  4EX7 A;  4C80 A;  4K4I A;  3RB6 A;  3V6K A;  3ZD8 A;  2FE9 A;  4TQS A;  3TAQ A;  2D8C A;  1PVQ A;  3ZDD A;  5EWG A;  4O0I A;  4O9M A;  3IRU A;  4TUQ A;  2XY7 A;  5L9X A;  1XNS A;  5ALS A;  5HR6 A;  4ECQ A;  3KOO A;  5B66 U;  1JN3 A;  4F5R A;  3UQ2 A;  3WK4 A;  2BCU A;  1V9P A;  5J8Y A;  9ICU A;  4I2C A;  4KLO A;  3IHQ B;  2I5H A;  1D9F A;  1P7D A;  5G5H A;  2HOQ A;  1S76 D;  4UBC A;  1QH9 A;  1Z4O A;  2G5H B;  1ZYQ A;  2YMQ A;  2D6F C;  2PMZ C;  1X40 A;  4NLN A;  3RB0 A;  4B9U A;  5HP4 A;  4RNM A;  3QE9 Y;  3T5J A;  4C7Y A;  3CRX A;  3TFS A;  4QZH A;  4ED3 A;  4P4M A;  3TI0 A;  5AKH A;  4ECX A;  3K1R B;  3C2K A;  3BJY A;  5KFL A;  1A77 A;  3VCB A;  3K4G A;  4KN7 A;  4DQQ A;  3PR4 A;  8ICM A;  5AM3 A;  2EZZ A;  4R65 A;  1L3V A;  4G3I A;  5ALX A;  3JPO A;  4KLJ A;  2N1R A;  5J0R A;  4JWN A;  5KT5 A;  1XS9 D;  5AKG A;  4UB6 U;  4M6W B;  3UXP A;  2G5I B;  5EWF A;  1DRG A;  4EBD A;  1MC8 A;  4C8K A;  3N7P D;  2XY6 A;  2EZY A;  2F3N A;  2Q4T A;  1ZQI A;  4IRD A;  4XQ8 A;  1ZQA A;  4P0Q B;  5JU5 A;  1U9L A;  5CA7 A;  3MBY A;  5H2F U;  3ALR A;  3EZ5 A;  4UAR A;  3T5K A;  4BXO A;  3MFI A;  2BQ3 A;  1NK0 A;  1UHU A;  3B0Y A;  2BDP A;  4ZH4 A;  3KD3 A;  9ICG A;  4QJF B;  3NVW A;  2I1Q A;  5DB6 A;  4DCC A;  3H8S A;  2ALZ A;  5KFQ A;  4OJ5 A;  4NLG A;  2VJ4 A;  5CRX A;  2QB0 A;  4I2F A;  1L7N A;  3WKA A;  2AH5 A;  3V7L A;  2Y0S C;  1UA0 A;  1L3S A;  1KL9 A;  1A76 A;  4ECZ A;  1YZ7 A;  1VJ5 A;  5AKX A;  3WK5 A;  2EH9 A;  4KLU A;  2P35 A;  2MAX A;  5K4L A;  4Y2R A;  1NK7 A;  4O5E A;  1QQ5 A;  4OJO A;  2W9B A;  5J29 A;  2C2D A;  9ICL A;  3UM9 A;  3QU4 A;  1IV8 A;  4OJL A;  3GIM A;  4BX9 C;  1JXL A;  1TKD A;  2GWS A;  2AU0 A;  5DQI A;  1TK0 A;  2A1J A;  2ES6 A;  4IS7 A;  2MU2 A;  4MF8 A;  2RRD A;  2BZF A;  3LVW A;  4GXJ A; 
#chains in the Genus database with same CATH homology
 1QLN A;  3LWL A;  9ICS A;  4M6W A;  2J6S A;  4M47 A;  1KDH A;  2WTF A;  2KZM A;  8ICJ A;  4Q45 A;  5DB7 A;  1Y88 A;  1BGX T;  1BPB A;  1SKS A;  9ICW A;  1Z00 B;  5IIJ A;  2R8K A;  1LB2 B;  5EOZ A;  4J9L A;  3EPG A;  5DB8 A;  4RNN A;  5J0O A;  2AGP A;  1NJZ A;  1MQ3 A;  4GXI A;  4QWC A;  5BOL A;  8ICK A;  1DGS A;  1ZQK A;  4PHE A;  5HML A;  4QWB A;  3Q8P B;  1NK4 A;  3HP6 A;  4O3P A;  3H8W A;  4ECT A;  5KFT A;  5J2G A;  2VA8 A;  4KLT A;  4M2Y A;  7ICE A;  3PX6 A;  4KLS A;  1IM4 A;  4KMU A;  3JPS A;  2ASD A;  4M9G A;  3HW8 A;  3PNC A;  2FPM A;  2ZJ5 A;  2ZUD A;  5J0S A;  5KFZ A;  2AQ4 A;  2W9C A;  3Q8Q B;  1HUZ A;  5KFH A;  4QZC A;  4I2B A;  1HUO A;  4KLE A;  4FO6 A;  3GV5 B;  1WCN A;  2BCQ A;  1ZQL A;  2W8L A;  3ETL A;  3Q8M A;  5L1L A;  4RQ7 A;  3KHL A;  3BQ2 A;  5BPC A;  1MSW D;  4Q43 A;  8ICS A;  5J2E A;  1RXV A;  1XU4 A;  4QZ8 A;  3TAP A;  4DF8 A;  2VAN A;  4I2E A;  3MFH A;  4QW8 A;  1KEJ A;  4DEZ A;  3LK9 A;  3QZ7 A;  3MR5 A;  3PW5 A;  4LVS A;  5J2K A;  4DSE A;  3RRH A;  3THV A;  3JPR A;  3PMN A;  9ICJ A;  3ZDC A;  1ZQY A;  5KFO A;  2XGQ A;  4FBU A;  4QW9 A;  2AGQ A;  1TK5 A;  4YXM A;  4NLK A;  4YVZ A;  1UT5 A;  4F92 B;  4MFF A;  4YD1 A;  3OGU A;  3C23 A;  4O5K A;  1RXW A;  4BWM A;  5KFF A;  1S77 D;  4O3Q A;  2IA6 A;  1RPL A;  4KLF A;  7ICR A;  5KFX A;  4J9Q A;  3T5H A;  1ZQJ A;  2FMP A;  1NK5 A;  4M9L A;  2HHV A;  4K4G A;  5IIN A;  2PFP A;  3RJF A;  2ZUB A;  3RJK A;  9ICF A;  9ICE A;  8ICR A;  4UBB A;  4F93 B;  1TV9 A;  1NKC A;  4ECW A;  1NK8 A;  2JEG A;  3RJH A;  4KLI A;  3PY8 A;  4KTQ A;  3C5F A;  4NLZ A;  9ICT A;  3K75 D;  8ICO A;  3ZDA A;  4PHP A;  1N48 A;  1XSP A;  4DWI A;  4J9P A;  1QSL A;  4KLH A;  5DBA A;  4JK1 A;  4QWA A;  3MGH A;  2KFZ A;  5DDM A;  5IIK A;  3GDX A;  1RYR A;  2IHN A;  4EEY A;  2ISO A;  5L1J A;  4F4Z A;  4I2J A;  4Z6D A;  4ECV A;  3Q8S B;  1XC9 A;  4GLX A;  4PHA A;  2P66 A;  3TQ1 A;  4EZ6 A;  4BWJ A;  3GQC A;  4PHD A;  2JZB A;  4UB5 A;  4HYK A;  5KFV A;  2F1H A;  3PML A;  1QSY A;  2HHU A;  4DLG A;  8ICP A;  1JX4 A;  3OJS A;  3RAQ A;  1C7Y A;  2IMW P;  4UQG A;  4RNO A;  4I28 A;  2XC9 A;  2ZTE A;  3M8S A;  3SV3 A;  3RBE A;  3KTQ A;  5J2J A;  3PVX A;  3RB3 A;  5L1I A;  5J2B A;  1TAU A;  4DOB A;  5KT3 A;  4YR2 A;  4GXK A;  1S0O A;  4DL2 A;  5JUM A;  1NK6 A;  1SL0 A;  1SL2 A;  4M9J A;  3H7I A;  8ICQ A;  5CJ7 A;  4E0D A;  3RTV A;  3SZ2 A;  3V6H A;  2Y1I A;  2F1J A;  3ZD9 A;  5D46 A;  1S0M A;  4CCH A;  9ICN A;  2JEF A;  3G6X A;  4ED6 A;  1S0N A;  4ELV A;  2H5X A;  4DSF A;  7ICU A;  4KLD A;  8ICA A;  2BR0 A;  1N56 A;  4UAZ A;  2R8I A;  9ICO A;  2P6U A;  2RDJ A;  2J6U A;  2HHS A;  4ECS A;  3JPQ A;  2I9G A;  4I2A A;  5KG1 A;  9ICA A;  1COO A;  3V6J A;  4F2R A;  5DKW A;  1K1S A;  5DLG A;  4ELU A;  3UPQ A;  2A1J B;  2DFL A;  2PFN A;  4IQT A;  8ICW A;  7ICT A;  3H8J A;  4JWM A;  4TUS A;  1ZQB A;  4I27 A;  5J2F A;  2FPK A;  3HT3 A;  2PI4 A;  4TQR A;  5CWR A;  5F9L A;  1LV5 A;  4RZR A;  1NJW A;  3PV8 A;  8ICZ A;  2KFN A;  8ICT A;  4O3S A;  4IRC A;  7ICN A;  5J2D A;  7ICK A;  4J9R A;  5DBC A;  5F9N A;  9ICV A;  5KFB A;  4EYH B;  4O3R A;  3H40 A;  2J6T A;  8ICF A;  2V4R A;  2BHN A;  4R8U A;  4DLE A;  7ICL A;  5TZV A;  2BPC A;  2W9B B;  4P4P A;  1ZQR A;  2KZZ A;  3ISD A;  5J0X A;  3C5G A;  5DQH A;  3C2L A;  5CR0 A;  1MQ2 A;  2BCS A;  2HHT A;  8ICC A;  3ISC A;  2ZUC A;  4ED7 A;  1CEZ A;  2ZTC A;  2AGO A;  4DQR A;  2C22 A;  1X9W A;  5DG8 A;  2JEI A;  4ED2 A;  3V7K A;  1XO1 A;  2PXI A;  2HHW A;  4M0A A;  4XUS A;  3ORY A;  3HPO A;  1ZQS A;  2ISP A;  4DSJ A;  1EXN A;  4GXJ A;  3RJE A;  1ZQZ A;  4J9M A;  8ICN A;  2XCA A;  3RJG A;  3PX0 A;  3NTU A;  8ICI A;  1NKB A;  1RYS A;  3JPT A;  5D4B A;  5KFW A;  1ZQU A;  4TUR A;  5DLF A;  4C8M A;  3BDP A;  4DSL A;  1ZQF A;  4IQV A;  4F50 A;  3OSP A;  1ARO P;  5J0P A;  2DPJ A;  4KLQ A;  1JXE A;  4F5O A;  2BQR A;  3IM1 A;  1D9D A;  2XY5 A;  1T4G A;  4B9N A;  4KLL A;  2BGW A;  8ICU A;  3MAB A;  4IR9 A;  4IR1 A;  3RR8 A;  2R8H A;  4F91 B;  1ZQN A;  4RPX A;  1U4B A;  1KRP A;  2UVV A;  3BQ0 A;  2F1I A;  2W9M A;  1ZJM A;  2FLP A;  3RH6 A;  4KLG A;  4RQ3 A;  1U48 A;  4JV2 A;  1ZQO A;  4R8U B;  2IHM A;  2UVU A;  3PW2 A;  4YMO A;  4EBC A;  1WCL A;  4EBE A;  3RJI A;  1SKW A;  2HVI A;  1KFD A;  1S9F A;  1NJX A;  7ICH A;  3GIJ A;  1QSS A;  5KG2 A;  3AUO A;  7ICI A;  4QZB A;  5KFA A;  4MFA A;  5KFC A;  4MEY A;  5KT6 A;  4DS5 A;  1BPD A;  1QTM A;  1T7P A;  5CHG A;  2W9C B;  5L1K A;  4UB1 A;  1ZQH A;  4DL6 A;  4LZG A;  4DFM A;  2R8J A;  1B43 A;  4YG2 A;  5KT2 A;  4NM1 A;  4I29 A;  4YD2 A;  4RUA A;  5KFY A;  4Z6C A;  1X2I A;  5HHI A;  5KFJ A;  5KT7 A;  5KG3 A;  2FMS A;  5KFU A;  3Q8R B;  5KFK A;  5KFG A;  4QZD A;  2W9A A;  4DSI A;  4NY8 A;  3EWA A;  4R66 A;  4F2S A;  1ZQW A;  4QWE A;  3MR3 A;  2AQ0 A;  5KTQ A;  4DL5 A;  3PW4 A;  4Q8E A;  7ICJ A;  4UB3 A;  4UB2 A;  1TAQ A;  5KFP A;  1TVA A;  2HVH A;  2AJQ A;  4I2D A;  2Y1J A;  2BCR A;  7ICG A;  5KFI A;  1U49 A;  1D8L A;  4QZG A;  4KN4 A;  4Z6E A;  1ZQC A;  3GII A;  4NM2 A;  4QZE A;  7ICP A;  4QZA A;  3N4M B;  3Q8L A;  2XO7 A;  3RH4 A;  3SV4 A;  3H4B A;  1ZQV A;  9ICQ A;  5KG7 A;  1KLN A;  4IRK A;  9ICR A;  3FDS A;  3E2E A;  2V9W A;  5KFN A;  3SI8 A;  8ICV A;  4MEX A;  1S10 A;  3MDA A;  1X9S A;  3RBD A;  1BPX A;  2XGP A;  1JIH A;  4J9K A;  5HHH A;  3OSN A;  5J2A A;  3GFK B;  4XA5 A;  4XRH A;  3LDA A;  5EWE A;  4DS4 A;  2HHQ A;  2KZ3 A;  4C8N A;  1SL1 A;  2HW3 A;  1ZQD A;  5J2I A;  4K4H A;  7ICS A;  3GV7 B;  4BGD A;  7ICO A;  1NK9 A;  1SKR A;  4TUP A;  1T8E A;  4R64 A;  3PR5 B;  4DF4 A;  3JPP A;  4RQ2 A;  1XSN A;  2VA3 A;  4DQI A;  3GV8 B;  4GC6 A;  7ICV A;  4IQW A;  3QEA Z;  2NRX A;  2FLL A;  3FYH A;  9ICC A;  4BDP A;  9ICK A;  1DOQ A;  1Z00 A;  3C21 A;  4IQU A;  4RT3 A;  2FPL A;  4PGX A;  3RRG A;  4R63 A;  2P6R A;  4QWD A;  3MDC A;  2V4Q A;  4LZD A;  4YN4 A;  5DG7 A;  7ICQ A;  5IIO A;  3LWM A;  1L5U A;  4UAY A;  3EW9 A;  3AU2 A;  1H38 A;  4YR3 A;  4C8L A;  4K4I A;  3PW0 A;  3RB6 A;  3ZDB A;  3QEB Z;  3V6K A;  2JZB B;  3ZD8 A;  4QZF A;  4C8O A;  4DO9 A;  4B9S A;  4YR0 A;  4TQS A;  3TAQ A;  4B9M A;  2RDI A;  2W8K A;  3ZDD A;  5EWG A;  4I2H A;  1TFR A;  5J0Y A;  3M9N B;  4O0I A;  3KHR A;  2BCV A;  2JEJ A;  4O9M A;  1NKE A;  4TUQ A;  2XY7 A;  5L9X A;  5KG4 A;  3T3F A;  4ECQ A;  4I2I A;  1JN3 A;  4DFK A;  3UQ0 A;  1ZET A;  4F5R A;  3UQ2 A;  5KFS A;  2ASL A;  4F3O A;  2BCU A;  1V9P A;  5J2C A;  9ICU A;  2C2R A;  3JPN A;  1U45 A;  2BPG A;  2NRZ A;  4Z6F A;  4I2C A;  4KLO A;  3IHQ B;  3QZ8 A;  4M9H A;  5CB1 A;  3MR6 A;  2C2E A;  3RAX A;  2ZJA A;  1D9F A;  5KG5 A;  4DQP A;  2HHX A;  3HX0 A;  8ICL A;  1S76 D;  4ECR A;  1KTQ A;  4UAW A;  4F4W A;  2IBK A;  1IXR A;  1BPY A;  4UBC A;  4YCX A;  2B21 A;  4EYI B;  1S97 A;  2DPI A;  2PFQ A;  5D49 A;  4BXO B;  4F4K A;  4KLM A;  4JV1 A;  4M04 A;  4FBT A;  3MGI A;  2UVR A;  1ZYQ A;  3GIK A;  3PO5 A;  3BQT A;  5DG9 A;  1KFT A;  4NLN A;  8ICE A;  9ICB A;  5KG0 A;  4RQ4 A;  2BKE A;  5DBB A;  2LYH A;  2ZTD A;  5III A;  5J2H A;  5CP2 A;  4DL4 A;  3M9O B;  3MR2 A;  3RR7 A;  1Z3E B;  3GIL A;  4YMM A;  3RB0 A;  4QZI A;  5HP4 A;  1PZN A;  4B9U A;  4YMN A;  4RNM A;  4F5P A;  4DL3 A;  3QE9 Y;  5KFM A;  1UT8 A;  3T5J A;  3Q8K A;  3UXO A;  4ECU A;  9ICH A;  2XCP A;  2ASJ A;  4RPY A;  3TFS A;  4QZH A;  2M9N A;  3B0X A;  4ED3 A;  4P4M A;  1S0V A;  3TI0 A;  4ECX A;  4J9O A;  5J0W A;  3M9M B;  5KG6 A;  3OHB A;  1CUK A;  3C2K A;  4ECY A;  4PPX A;  3BJY A;  5KFL A;  4RQ1 A;  1A77 A;  3KHG A;  3N97 B;  3K4G A;  4KN7 A;  4YFK A;  4DQQ A;  3PR4 A;  4YQW A;  8ICM A;  5HNK A;  4R65 A;  1L3V A;  1K1Q A;  9ICM A;  4G3I A;  3JPO A;  4KLJ A;  3ZDE A;  4F8R A;  4NXZ A;  5J0R A;  1SZP A;  3EYZ A;  4JWN A;  1HJP A;  4Q8F A;  2FLN A;  5KT5 A;  4DQS A;  2ZJ8 A;  5KFR A;  1XS9 D;  3KHH A;  1BPZ A;  7ICM A;  2KN7 A;  1B22 A;  4P4O A;  4DSK A;  4M6W B;  4FS1 A;  2C28 A;  4B9T A;  4P2H A;  3UXP A;  4RUC A;  4Q44 A;  4J9N A;  1KSP A;  9ICX A;  1NOM A;  5EWF A;  4ELT A;  4EBD A;  1MC8 A;  4C8K A;  3BQ1 A;  9ICP A;  2XY6 A;  1ZQG A;  3V7J A;  4O3O A;  1X9M A;  2PI5 A;  4PH5 A;  1ZQI A;  4MFC A;  2MUT A;  4IRD A;  5HMM A;  4XQ8 A;  3G6Y A;  1ZQA A;  3AU6 A;  1U9L A;  5CA7 A;  4RU9 A;  3MBY A;  3RB4 A;  3C1Y A;  5IIM A;  5BOM A;  4F4X A;  4ED1 A;  3EZ5 A;  2NRW A;  5DQG A;  3T5K A;  4BXO A;  3OJU A;  4YXJ A;  5C5J A;  4O3N A;  5KT4 A;  3MFI A;  3SYZ A;  3TAN A;  3EPI A;  3B0Y A;  2BQ3 A;  1NJY A;  1NK0 A;  4DOA A;  4KIT B;  2BDP A;  4RPZ A;  4ZH4 A;  3G6V A;  4JV0 A;  9ICG A;  8ICX A;  4JUZ A;  4X5V A;  2I1Q A;  5DB6 A;  1ZQE A;  3H8S A;  2ALZ A;  5KFQ A;  2UVW A;  4NLG A;  4B9L A;  3HWT A;  1T3N A;  3H4D A;  1L3U A;  3RJJ A;  4B9V A;  4I2F A;  1D8Y A;  3UXN A;  4F4Y A;  2KTQ A;  7ICF A;  9ICI A;  4F5N A;  5IIL A;  3RH5 A;  1XWL A;  4MF2 A;  5DB9 A;  3V7L A;  1UA0 A;  1ZJN A;  1L3S A;  1U47 A;  1A76 A;  4ECZ A;  3TAR A;  1L3T A;  8ICB A;  1UA1 A;  8ICG A;  4RQ0 A;  4YP3 A;  4DFP A;  1BVS A;  4F5Q A;  5J0Q A;  4ED0 A;  2NRT A;  4DL7 A;  4KLU A;  4RT2 A;  2Q0Z X;  4QZ9 A;  2MAX A;  4RQ6 A;  4DOC A;  2BQU A;  1RZT A;  1ZQM A;  1NK7 A;  5J0U A;  4ED8 A;  4RQ8 A;  4O5E A;  5KFD A;  4PGY A;  3TFR A;  1BPE A;  4EZ9 A;  2PFO A;  2W9B A;  1ZQT A;  5J29 A;  3ISB A;  2C2D A;  1TK8 A;  9ICL A;  4DFJ A;  2VA2 A;  3PO4 A;  3PW7 A;  3C2M A;  2FMQ A;  5DGB A;  1ZQX A;  4GC7 A;  1JMS A;  4M9N A;  3OHA A;  2ATL A;  1KFS A;  8ICY A;  3GIM A;  3V72 A;  4FS2 A;  2MUT B;  1JXL A;  4RQ5 A;  3NGD A;  3C1Z A;  5DGA A;  1TKD A;  2GWS A;  4PGQ A;  3PX4 A;  2AU0 A;  5DQI A;  1ZQP A;  2BPF A;  1TK0 A;  2R8G A;  2OWO A;  1XSL A;  2A1J A;  1ZQQ A;  4J9S A;  2NRV A;  5DDY A;  3T5L A;  5J0T A;  4I2G A;  3M8R A;  4O5C A;  4UB4 A;  4MF8 A;  8ICH A;  5KFE A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...