2MUTA

Solution structure of the f231l mutant ercc1-xpf dimerization region
Total Genus 27
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
27
sequence length
96
structure length
96
Chain Sequence
b'RIRRRYNMADLLMEKLEQDLVSRVTECLTTVKSVNKTDSQTLLTTFGSLEQLIAASREDLALCPGLGPQKARRLFDVLHEPFLKVPGGLEHHHHHH'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords DNA excision repair protein ERCC-1
publication title The Cerebro-oculo-facio-skeletal Syndrome Point Mutation F231L in the ERCC1 DNA Repair Protein Causes Dissociation of the ERCC1-XPF Complex.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase
total genus 27
structure length 96
sequence length 96
ec nomenclature
pdb deposition date 2014-09-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00633 HHH Helix-hairpin-helix motif
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.20 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 5' to 3' exonuclease, C-terminal subdomain 2mutA00
3KHHA 3PR5B 2PXIA 2BGWA 4YMOA 2BPCA 5HHIA 3K75D 4UBCA 1XSPA 4MFFA 5KG1A 5DKWA 2XGQA 3ZD8A 1ZQZA 1S0OA 5KFDA 1MQ3A 3T3FA 5J2DA 4O3OA 2MUTB 2NRVA 4YVZA 3UXNA 5EOZA 4QZBA 3RAQA 2BQUA 5KFRA 4J9KA 4Z6CA 4FS2A 5IIJA 4P4PA 4DL3A 4KLGA 2KFNA 4O3SA 5J2IA 3RH5A 2FMQA 2BKEA 4F91B 4ECQA 2I9GA 8ICPA 2BDPA 8ICEA 3UXOA 3ZDDA 2OWOA 3ZD9A 1COOA 4DSEA 2BPGA 4C8OA 2W9CA 1S9FA 4GXKA 4RNNA 4ECVA 4HYKA 2P6RA 4RUCA 2Q0ZX 4YMMA 3GIKA 3GIJA 4ECYA 2AGQA 1MC8A 2XY6A 4QWBA 3AU2A 1ZQRA 4MEXA 7ICMA 3B0XA 2FPKA 4UBBA 1JN3A 4YXJA 5CB1A 4DFMA 4YG2A 2FLPA 3SZ2A 2FLLA 3TAQA 2KZZA 4RQ7A 5IIMA 4ED7A 3ZDBA 2HHTA 3FDSA 4QZHA 1KRPA 3JPTA 5L9XA 5KFKA 5KFVA 4YD1A 3QZ8A 4YR2A 3G6VA 3C1ZA 8ICHA 4TUSA 3FYHA 2XCPA 3JPSA 5J0OA 3OSPA 4M9HA 3RH4A 4M9LA 2HHWA 1QLNA 3RB0A 2BQ3A 3PV8A 5IIKA 4G3IA 4ZH4A 3ISBA 1SKSA 1ZJNA 9ICVA 9ICCA 4F8RA 5KT3A 4DSKA 2W9BB 2ZUCA 4F5RA 5J29A 4IQUA 5KFYA 3GV8B 4MFCA 4RPYA 1T8EA 4QW8A 5J0WA 4UAWA 1JXLA 2IA6A 2VA2A 1MQ2A 3RJEA 3TANA 4I2AA 1KFTA 4Z6DA 1NJZA 2W9AA 5L1LA 3RBEA 4XUSA 3MR5A 7ICRA 1T3NA 4MF8A 3OJSA 4YXMA 4DWIA 1WCLA 1ZQEA 4QZGA 9ICRA 4RQ2A 4I2GA 7ICNA 1B22A 3GV7B 1KFDA 5KFWA 2BHNA 5KFGA 4KN7A 5KT4A 4DQIA 4ECZA 5L1JA 4YN4A 4ECWA 3IM1A 3MGIA 4R8UA 1TK8A 4ED8A 4RT2A 3K4GA 1RYRA 3PR4A 1TV9A 2C2EA 4NLKA 3MGHA 4DL6A 5HP4A 4QZIA 5DG7A 2JEIA 4BDPA 4O5EA 4XQ8A 5J2HA 5D4BA 7ICUA 5CR0A 1K1QA 2AQ4A 1KLNA 4ED1A 1ZQNA 4JWNA 7ICSA 8ICGA 1DOQA 4M47A 3OSNA 7ICIA 4EBCA 4TUPA 5IINA 1NK4A 4ECTA 3C23A 4O3PA 2XC9A 4NLGA 5J2GA 2AU0A 4DL2A 2R8IA 5EWEA 4RZRA 1U49A 4EZ9A 3N4MB 1D9FA 1IM4A 1ZQUA 5KG3A 4JK1A 1ZQAA 5KFHA 5J0QA 1T4GA 3LK9A 1SKWA 7ICVA 2BCVA 2V4QA 1A77A 2HVIA 1ZQQA 2KZ3A 5KFLA 4O3NA 3C5FA 3GFKB 4QZCA 4PGXA 4ED6A 2C2RA 2BCUA 7ICHA 5J0XA 4LVSA 5DBCA 4R65A 3OJUA 1TK5A 4M9GA 3M8RA 4ECUA 7ICEA 4QWAA 4KLOA 1X9WA 3V6HA 1TAQA 5KT5A 3UXPA 2NRZA 4RPZA 4O3QA 4M04A 3ORYA 5J0SA 4I2EA 8ICBA 1NKCA 5DBAA 2A1JB 3TFRA 2IHMA 4F93B 1S10A 4BXOB 5L1KA 3TFSA 5DB9A 2MAXA 4Z6FA 1SZPA 3MR2A 3IHQB 4O5KA 2VA8A 2JEFA 5EWGA 3TI0A 1Y88A 3QEBZ 9ICAA 4UAYA 7ICFA 2W9MA 4RQ6A 1KDHA 4MF2A 1S0VA 2F1JA 4YQWA 5DDMA 4DOBA 3EPIA 2Y1JA 5KFTA 3GDXA 1XU4A 3PW5A 4J9QA 1TVAA 1KFSA 4RU9A 1JX4A 9ICNA 4EYIB 5HMMA 2C22A 3GV5B 1WCNA 5F9NA 4M6WB 4IQTA 5CP2A 2AGOA 1ZQXA 3RRHA 4PGYA 4QZAA 9ICLA 2JZBB 5KG6A 3PO4A 4DEZA 4IRCA 9ICQA 2P6UA 1D8LA 1TKDA 1L3UA 3MFHA 1ZQOA 4KLFA 2UVUA 1RZTA 1NJXA 5J0TA 2KFZA 8ICNA 1KSPA 3LWLA 4F5QA 1BVSA 2ALZA 4P4MA 4NXZA 3RH6A 3NGDA 4IR9A 1RXWA 1X2IA 4F50A 1ZQFA 4YMNA 4B9NA 3EW9A 5KTQA 5J2CA 4F5NA 1EXNA 8ICZA 4GC6A 4IRDA 2ZTDA 4DOAA 5DGBA 1X9SA 5IILA 4KLHA 3LDAA 4RQ4A 1U45A 3B0YA 3C1YA 4QZEA 5CWRA 4RPXA 3OHAA 3V7JA 1TFRA 1UA1A 3RB3A 8ICOA 2XCAA 4RT3A 1KTQA 4YR3A 3T5KA 1SL0A 9ICIA 4I2DA 3PX4A 4QW9A 1U4BA 4GLXA 1U47A 4B9UA 4I2JA 7ICJA 2NRWA 2ISPA 5KFQA 3SV4A 3TARA 4C8NA 5DBBA 4QWCA 1PZNA 4YP3A 4QWEA 1Z00A 2H5XA 5DGAA 4B9LA 4J9MA 3GIIA 9ICXA 4PHPA 2VANA 4R64A 3C2LA 2HHVA 1CEZA 1QTMA 1ZETA 2DPJA 4NM1A 9ICFA 3M8SA 5IIOA 2W8LA 4M9NA 3C2MA 3RBDA 5BOLA 4R63A 2W8KA 2ISOA 8ICUA 3HPOA 5DG9A 4DS4A 4DSLA 2ZUDA 2HHQA 1RPLA 1ZQHA 1HJPA 3SI8A 1BPDA 3PMNA 2XY7A 4UB3A 2V4RA 4YD2A 4C8KA 1BPXA 8ICTA 4F2RA 4XA5A 2PFNA 7ICLA 1S0NA 4F4WA 3H4DA 4KLJA 3AUOA 2A1JA 5HNKA 3EPGA 3RJKA 3RB4A 2FLNA 4BXOA 2ZTEA 1D9DA 4I2BA 4ECXA 4M9JA 3N97B 3HT3A 4I2CA 4DF8A 3GIMA 1BPZA 7ICGA 2ZJ8A 3JPOA 2R8HA 7ICTA 2BQRA 4I2HA 2RDIA 1ZQYA 4DQPA 3TQ1A 4EBDA 1ZQIA 4PPXA 4DLEA 2I1QA 7ICKA 4KN4A 4JV1A 4YCXA 4F4ZA 1UA0A 5DB7A 5BPCA 1C7YA 8ICMA 5KFNA 4Q8EA 5KFXA 4DQRA 2R8GA 2WTFA 4MFAA 5TZVA 2MUTA 4UB5A 2W9CB 5KFAA 3BQ0A 3H4BA 2BPFA 1T7PA 2JZBA 3SV3A 3UPQA 3PX6A 3G6YA 2XY5A 1NK5A 4QZDA 3Q8PB 2BCRA 4ELUA 4EEYA 3PW0A 5J0YA 9ICBA 9ICWA 1ZQTA 4Q8FA 3RJFA 1H38A 2R8JA 4TQRA 1JXEA 3QZ7A 8ICAA 4J9NA 2B21A 3H7IA 4GXJA 1NK9A 4KMUA 4DSJA 1MSWD 4I27A 4DQSA 4PHAA 4Q44A 4KLLA 2J6SA 4BWMA 3EYZA 5KFSA 2DPIA 9ICKA 4J9PA 4J9SA 3RJIA 2ATLA 4F3OA 1XWLA 4UQGA 2UVWA 3UQ0A 4FS1A 1NJWA 1K1SA 3PO5A 4KTQA 4P2HA 3HX0A 3KHRA 1NK0A 4DS5A 3EWAA 3C21A 5KFFA 5CA7A 3T5HA 4TUQA 1D8YA 3SYZA 5J2FA 3G6XA 4DFKA 4I2IA 3MABA 5D46A 1SL2A 1ZQMA 3JPRA 4F5OA 1ZQPA 1U9LA 4RNMA 4K4GA 1L3TA 5DDYA 3Q8QB 1N56A 4BGDA 2NRXA 4UB1A 4ELVA 2FPMA 5J0RA 1CUKA 4DO9A 4TQSA 3PX0A 3ZDEA 4I29A 8ICJA 4Q43A 4DL7A 3Q8MA 4QWDA 1S97A 3PY8A 4UB2A 4O9MA 3H8WA 5KG7A 3EZ5A 3LWMA 3H40A 1NJYA 4NY8A 2W9BA 4KLMA 4JUZA 2HW3A 2FMPA 3V72A 4C8MA 3MDCA 3V7KA 4B9SA 3C5GA 2FMSA 8ICXA 5KFUA 5IIIA 3MR6A 5KFEA 5J2EA 5J2AA 3UQ2A 4KLUA 2J6UA 2BR0A 2AGPA 2UVVA 3RJGA 4RUAA 2KN7A 1S0MA 2PFPA 4KLIA 2HVHA 5KFOA 2PFOA 1NK6A 2KZMA 4ECSA 4DFPA 2ZJAA 2P66A 3HW8A 2AJQA 5DB6A 1ZQWA 2Y1IA 3OHBA 4DL5A 9ICOA 1TK0A 4PH5A 5DQHA 4DOCA 4QZFA 5J0PA 4PHDA 3KHLA 8ICIA 4YFKA 4NLZA 2AQ0A 5KFIA 3HP6A 2HHXA 5CJ7A 1ZYQA 3RAXA 4F5PA 3ISDA 3QE9Y 9ICMA 4X5VA 4JV2A 7ICQA 3RJJA 3MBYA 5J0UA 2IHNA 1ZQGA 2IMWP 4EZ6A 8ICRA 5KFBA 5D49A 4TURA 3HWTA 4BWJA 9ICGA 1KEJA 2LYHA 4K4IA 4KLDA 4IRKA 3H8JA 5KFZA 3JPNA 2DFLA 1U48A 1XC9A 1S76D 4UB4A 1Z3EB 3BDPA 4P4OA 3THVA 3PNCA 4KITB 5KG0A 5C5JA 4Z6EA 2HHSA 5KFJA 2FPLA 2PI4A 9ICSA 4JV0A 2F1IA 4F92B 4IQWA 3Q8LA 4FBTA 5J2BA 1QSSA 4M0AA 3M9NB 4EBEA 3H8SA 4LZDA 5CHGA 3MFIA 3M9OB 4RQ1A 4DQQA 1HUOA 1ZQLA 4C8LA 3MR3A 8ICQA 2ASJA 4O5CA 3RTVA 3V6JA 2RDJA 4O3RA 5DLFA 4DLGA 4QZ9A 4M2YA 2BCSA 3E2EA 5KFMA 1SKRA 3RR8A 4ECRA 2C2DA 1JMSA 1LB2B 5KG5A 5KFPA 5KT2A 1A76A 4IR1A 4EYHB 4DSFA 4B9MA 2PI5A 4B9VA 1BPBA 1L3VA 1RXVA 1QSYA 4J9OA 4NM2A 4F4YA 1BPEA 2C28A 3KTQA 9ICTA 4RNOA 4XRHA 1NOMA 2ZTCA 4DFJA 1SL1A 1DGSA 1UT8A 5KG2A 3OGUA 2GWSA 5JUMA 3V6KA 4PGQA 1XS9D 4B9TA 1XSNA 8ICSA 5KFCA 4RQ3A 4F4XA 1V9PA 9ICUA 4O0IA 4M6WA 2F1HA 3GQCA 3PW2A 1ZQCA 2ZUBA 2ZJ5A 1AROP 5HMLA 2ASDA 5DLGA 3C2KA 3ISCA 3M9MB 3PW7A 4JWMA 4GC7A 1RYSA 3MDAA 3T5JA 2JEGA 3ZDCA 3KHGA 1IXRA 3TAPA 5DQIA 1HUZA 1TAUA 3RRGA 4KLSA 3JPQA 5L1IA 3BJYA 3RB6A 4FBUA 8ICVA 4I28A 2JEJA 4F2SA 1S77D 5DB8A 7ICOA 1ZJMA 1LV5A 5HHHA 1X9MA 1NKEA 2V9WA 4K4HA 1ZQJA 3V7LA 9ICPA 3QEAZ 2KTQA 4RQ0A 3GILA 1BGXT 4ELTA 3Q8KA 4FO6A 8ICYA 5KT6A 4E0DA 5BOMA 1Z00B 4DL4A 5KT7A 2R8KA 4RQ5A 1L5UA 4KLEA 8ICCA 2BCQA 3BQ1A 8ICWA 4LZGA 5KG4A 4UAZA 2VA3A 1BPYA 8ICFA 4ED2A 1ZQBA 1NKBA 2IBKA 4MEYA 2NRTA 1NK7A 3PMLA 4ED0A 5F9LA 1ZQKA 2ASLA 1QSLA 1ZQVA 7ICPA 4F4KA 4J9RA 3PW4A 2XO7A 4Q45A 4YR0A 4RQ8A 3JPPA 1L3SA 3RR7A 5DG8A 8ICLA 8ICKA 9ICJA 3NTUA 4GXIA 4QZ8A 2HHUA 1XO1A 2M9NA 1ZQDA 3ETLA 4R66A 1JIHA 5J2KA 4KLTA 3Q8RB 2UVRA 3AU6A 4PHEA 2PFQA 9ICHA 3T5LA 3BQ2A 1ZQSA 1XSLA 1B43A 5J2JA 4DSIA 4NLNA 9ICEA 5EWFA 3RJHA 2J6TA 3BQTA 4ED3A 4DF4A 4J9LA 3ZDAA 4I2FA 1NK8A 2XGPA 5DQGA 4IQVA 3Q8SB 3PVXA 4KLQA 4R8UB 1N48A 4CCHA 1UT5A
chains in the Genus database with same CATH superfamily
2PXIA 1OXJA 4YMOA 4UBCA 2QLTA 1XSPA 2XGQA 2RP5A 2KIVA 1ZQZA 5AKKA 5J8YA 5J2DA 2MUTB 3UXNA 5HR7A 4QZBA 4P4PA 4DL3A 2KFNA 5HR6A 2BKEA 4ICAA 4F91B 2I9GA 2BDPA 2FJ6A 3ZD9A 2W9CA 4FE3A 4ECVA 4ECYA 2AGQA 2K8AA 2KJ8A 2E8PA 4DFMA 4YG2A 3SZ2A 5ALQA 5IIMA 4EX7A 3JPTA 1X6JA 4YD1A 3WK6A 3QZ8A 2VIXA 2OYYA 2RQ5A 4TUSA 3FYHA 2KE7A 5J0OA 3OSPA 4M9HA 4OD0A 3RH4A 4ZOHC 4ZH4A 9ICVA 5J8YC 3IP4B 4F8RA 3UM9A 3MGVA 4F5RA 4IQUA 4RPYA 4QW8A 4UAWA 2IA6A 1MQ2A 3GZFA 2WF6A 4J03A 2KVCA 5ALVA 2HBJA 3WK8A 3OJSA 4DWIA 1WCLA 4RQ2A 1KL9A 2ZG6A 3NRWA 5KFGA 5KT4A 3CNHA 2F2AB 5L1JA 3WKCA 1TK8A 1RYRA 2C2EA 2K4IA 3MGHA 3KBBA 4QZIA 5D4BA 2DKXA 1K1QA 3M6KA 8ICGA 1X6IA 4M47A 3OSNA 3J81j 2CN1A 5IINA 4ECTA 4EZ9A 1WYGA 2ZIUB 5KG3A 5J0QA 1B0XA 4KX5A 1A77A 2HVIA 1ZQQA 2CXYA 5KFLA 3C5FA 7ICHA 3GFKB 4LVSA 2MRLA 2G5HB 1TK5A 4M9GA 1L8OA 2EZXA 5KT5A 1DRGA 4RPZA 2IHMA 4BXOB 5L1KA 1PVRA 5DB9A 1SZPA 2VA8A 5EWGA 1RG6A 9ICAA 4UAYA 2IOFK 1KDHA 4YQWA 5DDMA 3EPIA 2ESEA 2H3IA 2FE9A 2LMRA 1TVAA 4RU9A 2ZIXB 1WCNA 5F9NA 4M6WB 3RRHA 2KKVA 2JZBB 5AKIA 1LKYB 2A19A 9ICQA 3M7DA 2P6UA 5AK6A 1L3UA 3MFHA 4AYBC 5J0TA 2ALZA 4QJFB 3F5EA 3FC4A 1SXEA 4B9NA 3EW9A 1EXNA 1PK3A 4GC6A 5EE0A 3OHAA 4RPXA 1N2XA 2ZIVB 3QUBA 4YR3A 1SL0A 4I2DA 3PX4A 4QW9A 5GTHU 1U47A 4B9UA 7ICJA 2NRWA 2ISPA 5KFQA 5ALMA 2RRDA 5DBBA 2ZXIA 2HSZA 1SV0C 4C4SA 2D8CA 1IV8A 3BS5B 5AKGA 1NNLA 3C2LA 1CEZA 1QTMA 9ICFA 5IIOA 2W8LA 3HPOA 5DG9A 3C28A 1F0MA 2LM1A 1BPDA 3PMNA 2KHVA 2V4RA 8ICTA 4C8KA 2ZIWA 4F2RA 4XA5A 1S0NA 3H4DA 2W04A 2B6GA 2L5YA 4ECXA 3HT3A 4A8EA 2JH1A 4C7YA 1BPZA 2ZXHA 3TADA 4EBDA 7ICKA 4JV1A 4YCXA 1UA0A 2KP7A 5DB7A 1C7YA 2VJ5A 5KFXA 1OW5A 2R8GA 5AK3A 2MUTA 4UB5A 4NWIA 3BQ0A 3G6YA 3Q8PB 3I1YA 5ALUA 2WB1C 9ICBA 2NYVA 1ZQTA 3RJFA 1H38A 3U26A 1WWVA 4DQSA 4KLLA 2J6SA 2DPIA 3IN5A 1XWLA 4F71A 4FS1A 1Q8KA 3HX0A 3KD3A 3CYMA 1D8YA 2DL0A 3MABA 4UB6U 5F3XB 3HILA 1L3TA 5DDYA 4BGDA 4UB1A 8ICJA 3PX0A 1CUKA 3KZIU 2D6FC 1QQ7A 8ICMA 4NY8A 5C0YA 4B9SA 3MDCA 5KNIA 3MR6A 1P7DA 1M6YA 2HDOA 4RUAA 5JU5A 3NUQA 2W54A 2P66A 3HW8A 2Y1IA 4DOCA 2LKYA 3QUQA 2HBKA 4Y2QA 1ZD2P 1ZYQA 4US9A 3KZXA 9ICMA 4JV2A 3RJJA 2W7OA 3CP8A 3HWTA 5D49A 2YMQA 9ICGA 4K4IA 2EZYA 3JPNA 2DFLA 4UB4A 4PL1A 2H3QA 5AKLA 5AM3A 3THVA 2ZIUA 4KITB 4Y2XA 5KG0A 2KICA 4UB8U 9ICSA 2WF8A 4JV0A 2K4PA 4IQWA 4M0AA 1ECWA 4OJOA 3MFIA 3K1RB 4RQ1A 1HUOA 2ODGA 2ASJA 2KIWA 1NZBA 1RDFA 4WJ3B 3AMZA 4M2YA 2BCSA 3E2EA 5KFMA 4QNLA 3SENA 2G06A 4ECRA 4DSFA 4NL9A 1L3VA 1V85A 3A0HU 2IOHA 4XRHA 1NOMA 2Y9UA 1PVQA 2Y0SC 5KG2A 2GWSA 3IG8A 4PGQA 1ZOLA 4MHVA 4U7CA 4F4XA 9ICUA 2E8MA 4M6WA 5ALHA 2EANA 1VDVA 3GQCA 1ZQCA 2ZUBA 1LKYA 2MSNA 5HMLA 4EEKA 1C20A 3CRXA 2JRZA 3MDAA 3T5JA 3ZDCA 1X66A 5ALTA 1J97A 3RRGA 3WKDA 3JPQA 5L1IA 4FBUA 2JEJA 4F2SA 5DB8A 1ZJMA 3WK7A 4K4HA 1ZQJA 5B5EU 1BGXT 4FO6A 8ICYA 2LYAA 4E0DA 5BOMA 1Z00B 5KT7A 5AK5A 1L5UA 2NO5A 3AL0B 3BQ1A 8ICWA 3L5KA 2OCEA 2EDUA 4ED2A 1ZQBA 2NRTA 2R18A 1QSLA 2YB1A 5F9LA 4F4KA 4J9RA 3PW4A 4Q45A 3E0FA 4RQ8A 2JV3A 3JPPA 3RR7A 4GIBA 8ICKA 3NTUA 3HKZC 4QZ8A 3ETLA 4R66A 3Q8RB 2E1EA 2UVRA 2PFQA 1ZQSA 4NLNA 9ICEA 3RJHA 1FEZA 1Z19A 4I2FA 3B9JA 2XGPA 5EE1A 3LVWA 3Q8LA 4I28A 4UW9A 3VCBA 2BPCA 3K75D 3ZD8A 5KFDA 4P0PB 2W3SA 2BQUA 4YVZA 5EOZA 3O0FA 2WFAA 4FS2A 2W55A 4Y2TA 2FMQA 4ECQA 4PL2A 4KMOB 2OWOA 4C0ZA 4C8OA 4EX6A 2Q4TA 4GXKA 4FZNA 4YMMA 1MC8A 2XY6A 2YQEA 4MEXA 2KV2A 4YXJA 5CB1A 3C29A 2FLLA 1HIWA 4Y2JA 2HHTA 4QZHA 5L9XA 4UAVA 4YR2A 4OJPA 3JPSA 4NLCA 2W7PA 1DXSA 4CNQA 1T3QA 2JR5A 4FFDA 1SKSA 1SWWA 5J29A 4MFCA 1QCKA 1UCVA 2LI6A 4Z6DA 1NJZA 1Z4NA 5CRXA 1QH9A 4XUSA 4FZLA 4MF8A 9ICRA 4I2GA 7ICNA 3GV7B 5KFWA 2OXOA 5KAFU 4ECWA 3IM1A 3PR4A 1N5WA 5DG7A 4BDPA 4O5EA 4XQ8A 5J2HA 7ICUA 2AQ4A 1ZQNA 7ICSA 1DOQA 4EBCA 4TUPA 4ACOA 1ZD3A 3C23A 4O3PA 3NASA 4NLGA 2H3ZA 2N1RA 2EQYA 4RQMA 4HAIA 1D9FA 2BDUA 1ZQAA 5KFHA 4JMUA 1SKWA 1N5XA 7ICVA 2KG5A 2C2RA 3OJUA 1N61A 4QWAA 5AKJA 1L7PA 4O3QA 2M0NA 2BZFA 5J0SA 2XIDA 5AM0A 3MR2A 4O5KA 1IIPA 3TI0A 1DK3A 5JRTA 3K1ZA 4DOBA 5B66U 1XU4A 4J9QA 2Z7JA 1JX4A 3GV5B 4PGYA 9ICLA 5AI4A 5AM4A 4DEZA 4IRCA 1D8LA 1TKDA 1ZQOA 4KLFA 2KFZA 2XICA 3TACB 3HKZF 4CF5A 4P4MA 3N7RC 1KQQA 1RXWA 2VKQA 5KTQA 4F5NA 4DOAA 5DGBA 5IILA 3LDAA 4RQ4A 1U45A 3FAHA 4QZEA 5CWRA 3V7JA 1PK1A 2ES6A 8ICOA 4RT3A 5ALRA 3UMBA 1JI7A 1QQ5A 1URJA 4GLXA 3SV4A 3L3FX 4QWCA 1Z00A 2PKEA 4B9LA 3UMCA 2MA1A 3GIIA 1L7MA 4PHPA 1K5OA 1JROA 4M9NA 1S8OA 1UPHA 3RBDA 2CPRA 3H0RB 5AKHA 3KOOA 2W8KA 8ICUA 4DS4A 4DSLA 2HHQA 1HJPA 2A1AA 3SI8A 2NV3A 3PSTA 4UB3A 2HI0A 4YD2A 1BPXA 4F4WA 2A1JA 5HNKA 3RJKA 2FLNA 3NS1A 3M6ZA 3AN1A 4DF8A 7ICGA 4I2HA 2WAQC 1ZQIA 4PPXA 4KN4A 5KL1B 4F4ZA 5BPCA 5KFNA 2GOLA 4P0PA 5TZVA 4G9BA 1Q46A 1O03A 3H4BA 2BPFA 1T7PA 3SV3A 3UPQA 2HMXA 1SV4A 1NK5A 4QZDA 5A0LA 3H0MB 9ICWA 4TQRA 3QZ7A 8ICAA 4J9NA 3H7IA 1NK9A 4DSJA 4PZNA 1MSWD 4I27A 3EYZA 4J9PA 3PO5A 4Y2RA 3HJEA 1DK2A 2LYBA 3C21A 3T5HA 4I2IA 1NZPA 2I5HA 1SL2A 1ZQMA 3S6JA 1ZQPA 4RNMA 5J0RA 4Y2YA 4DO9A 1PUZA 3ZDEA 3LWMA 1NJYA 2HW3A 3V72A 4C8MA 3C5GA 2FMSA 5IIIA 3WK4A 2J6UA 2UVVA 2G5IB 4KLIA 5KFOA 2KZMA 2AJQA 1ZQWA 3WKEA 9ICOA 4PH5A 5DQHA 1XO0A 4QZFA 5J0PA 2WF5A 8ICIA 5KFIA 3HP6A 4IL6U 3D2NA 3N7PD 2DBYA 3RAXA 4CF3A 2XI9A 4US8A 7ICQA 1ZQGA 1O08A 4BWJA 2LYHA 4KLDA 5KFZA 1Z3EB 4P4OA 3PNCA 5KL8B 3SAHA 2DGZA 3KFUF 1BNOA 2HHSA 2FPLA 3GU3A 2F1IA 4F92B 4FBTA 5J2BA 1QSSA 3F2BA 3M9NB 3IRUA 3H8SA 4LZDA 3M9OB 5AKZA 3EUB2 2HCFA 4QZ9A 1JUDA 4C7ZA 4PJ0U 5FP0A 1JMSA 1LB2B 5KFPA 4B9MA 2PI5A 1BPBA 1FIQA 1JALA 4J9OA 3VC8A 3KTQA 4RNOA 2ZTCA 5JUMA 1XS9D 1XSNA 2F3NA 1V9PA 4O0IA 2F1HA 2JH7A 5ALDA 5CEHA 2E3TA 3C2KA 3ISCA 1L7NA 4GC7A 2JEGA 1SIJA 1X40A 1TAUA 5DQIA 2WHEA 3RB6A 8ICVA 1TE2A 7ICOA 3V7LA 2KTQA 4RQ0A 3GILA 1OUQA 2LHTA 2G07A 5KT6A 4NLBA 4DL4A 5AM2A 1RYUA 2RLTA 2DF4B 4LZGA 5KG4A 4UAZA 2VA3A 2IBKA 2WAQF 4P0QA 7ICPA 1ZQVA 4YR0A 1J2MA 1L3SA 5DG8A 3TADC 4GXIA 2M9NA 1ZQDA 1JIHA 5J2JA 3R9KA 3BQTA 4PZOA 3ZDAA 5ALIA 1ZXIA 5E79U 4LJXA 5TISU 2EH9A 2AXTU 3QU5A 4Y2UA 1CI4A 2BGWA 5KG1A 3SAGA 1S0OA 3T3FA 2NRVA 4NLKA 4O3SA 1T94A 3RH5A 1XNSA 8ICPA 3AM9A 3HRDD 3UXOA 1COOA 2F76X 4DSEA 1S9FA 2P6RA 4RUCA 2Q0ZX 2GH1A 3GIKA 3GIJA 2GLEA 4QWBA 1ZQRA 7ICMA 1JN3A 4CGZA 2YY6A 5ALEA 2K8BB 5AIAA 3TAQA 2KZZA 2YB4A 4ED7A 3ZDBA 3FDSA 2KVSA 3F53A 5KFKA 5JTIA 2I6XA 2H3VA 2FDRA 5AK4A 2BQ3A 4G3IA 3ISBA 1ZJNA 5KT3A 4DSKA 2W9BB 2ZUCA 5KFYA 3GV8B 1T8EA 5J0WA 2VA2A 4I2AA 2W9AA 3RBEA 3MR5A 4YXMA 1ZQEA 4QZGA 1WG8A 3SQIA 2WF9A 1KFDA 2BHNA 4KN7A 4DQIA 4AP9A 1A0PA 3UMGA 1TV9A 3WKAA 3LYSA 4DL6A 1PK1B 5CR0A 2E8OA 3QUTA 7ICIA 2XC9A 2AU0A 4DL2A 3OTQA 5EWEA 1U49A 5AI6A 1IM4A 1ZQUA 2KK0A 3PSPA 1T4GA 3H8MA 3LK9A 3AQEA 4NL9C 2V4QA 2KZ3A 4O3NA 4QZCA 4PGXA 4ED6A 5J0XA 2YN4A 2QARA 1X9WA 3V6HA 2K4EA 1TAQA 5T14A 3UXPA 3ICXA 1B4FA 4M04A 3PZPA 3ORYA 4I2EA 3E58A 1NKCA 2A1JB 1S10A 3F2DA 2MAXA 3IHQB 2KHQA 2JEFA 2W9MA 4RQ6A 2F1JA 2PMZF 2Y1JA 5KFTA 3GDXA 3NRZA 1KFSA 9ICNA 5HMMA 5CP2A 4UATA 2AGOA 4QZAA 3LVVA 5KG6A 3PO4A 2UVUA 1RZTA 1NJXA 1F5SA 8ICNA 1KSPA 3RH6A 4BX9C 1FO4A 3NGDA 4IR9A 1ZQFA 4YMNA 1S5LU 8ICZA 1X9SA 4KLHA 2W03A 3B0YA 1TFRA 5ALKA 3RB3A 2YMLA 2XCAA 2K8CB 1UA1A 3I28A 3T5KA 2KD1A 1SB3C 3DV9A 4I2JA 2KSOA 3WU2U 3QX7A 4C8NA 2VJ4A 5ALSA 4QWEA 2JHDA 2H5XA 5DGAA 5EE3A 9ICXA 4U6PA 1ZD4A 1ZETA 2DPJA 4NM1A 3M8SA 2KOBA 5BOLA 2QB0A 2ZUDA 1RPLA 2NO4A 1DGJA 1ZQHA 2WF7A 2PFNA 7ICLA 2OH2A 1TAMA 4KLJA 3AUOA 3RB4A 2EAPA 4I2BA 1WWUA 2BQRA 2RDIA 5ALLA 4DQPA 3QXGA 4NJ8A 4DLEA 3SEIA 5G5HA 3SMVA 4DQRA 5ALYA 1Q3VA 2HBLA 2XY5A 3RFAA 2BCRA 4EEYA 3WK9A 3PW0A 4C4RA 2K4HA 2KJ5A 2YX8A 2R8JA 1JXEA 2GO7A 2B21A 4KMUA 4PHAA 1J2NA 3SR6A 4BWMA 4B6JA 5L1MA 4J9SA 2ATLA 1KBUA 4F3OA 2KKPA 3UQ0A 1NJWA 4DS5A 4TUQA 2G09A 5ALOA 5J2FA 2JXJA 1JRPA 3ONNA 3JPRA 4F5OA 1U9LA 4K4GA 2HBMA 3Q8QB 1N56A 1GO3F 2NRXA 4ELVA 2FPMA 9ICIA 4TQSA 4QWDA 1S97A 4O9MA 3EZ5A 3H40A 4KLMA 2W9BA 4JUZA 2FMPA 5ALPA 4NV0A 3V7KA 4JB3A 5KFEA 1MA7A 5J2AA 2AGPA 1S0MA 2PFPA 1KN5A 4O3MA 1NK6A 4DFPA 5ALGA 5DB6A 3OHBA 4DL5A 2JGAA 3KHLA 2HHXA 1L7OA 5GTIU 4F5PA 3ISDA 3QE9Y 4X5VA 2FI1A 8ICRA 5KFBA 4TURA 2OM6A 2W3RA 4P0QB 2DKZA 1N63A 4KX3A 3BDPA 4QIWF 3QU7A 3L4PA 4Z6EA 5KFJA 5ALJA 1FFVA 5ALNA 1L8LA 3AEVA 2MU2A 2F77X 4EBEA 5ALFA 4O5CA 3RTVA 2RDJA 4O3RA 5DLFA 1WUDA 3D6JA 4IC9A 4EYHB 1RQLA 4B9VA 5AHXA 3T79A 3SD7A 2YMMA 3QNMA 4NM2A 1BPEA 2C28A 9ICTA 1DGSA 1UT8A 2K89A 3OGUA 4Y2VA 3NVYA 5AI0A 1ZRMA 2DQNB 1IG6A 3PW2A 5AKXA 1RQNA 2ZJ5A 5AI8A 2HOFA 2ASDA 2F44A 5DLGA 3PW7A 4JWMA 1RYSA 5ALXA 1IXRA 3TAPA 1HUZA 2QKQA 2A3VA 5AICA 3D2SA 5HHHA 1ZRNA 9ICPA 3QEAZ 3Q8KA 3WKBA 2R8KA 4RQ5A 2G08A 3BS7A 1BPYA 8ICFA 4ED0A 2ASLA 2LBOA 2F8KA 8ICLA 1XO1A 3MC1A 5J2KA 4EENA 9ICHA 3T5LA 2J6TA 4ED3A 2E8NA 5DQGA 3F2CA 3Q8SB 3PVXA 2OHFA 3OPXA 3KKAA 4KLQA 2HOIA 1N48A 4USAA 3ED5A 5H2FU 4CCHA 1UT5A 3DEEA 1SV0A 3KHHA 3PR5B 1MN8A 3BZKA 5HHIA 2JMGA 1YT3A 4MFFA 5DKWA 1MQ3A 2KNJA 4O3OA 3RAQA 1NK8A 1NK0A 5KFRA 4J9KA 4Z6CA 5IIJA 4KLGA 5J2IA 1X42A 2EAOA 3PSIA 5AM5A 2CRXA 8ICEA 4OCZA 3ZDDA 2BPGA 4RNNA 4HYKA 3BQ7A 2K60A 2QARB 3AU2A 3B0XA 2FPKA 1QQ6A 4UBBA 3BZCA 3PSFA 2FLPA 4OO1J 4RQ7A 2KEYA 2HOQA 4OJLA 1KRPA 4UASA 5KFVA 3G6VA 3KKAC 3C1ZA 8ICHA 2AH5A 2XCPA 4M9LA 2HHWA 1QLNA 3RB0A 3PV8A 5IIKA 2YTUA 2P35A 9ICCA 1JXLA 2OEHA 3IDWA 3RJEA 1KFTA 3TANA 1ZQ1C 5L1LA 2G0AA 7ICRA 4CRXA 1T3NA 3SAFA 4F72A 1Z1BA 1B22A 1RM6C 2AHOB 4ECZA 4YN4A 1D8BA 3MGIA 4R8UA 4ED8A 4RT2A 3K4GA 5HP4A 2JEIA 3QU9A 4JWNA 1KLNA 4ED1A 2PMZC 1KKXA 2KSOB 1NK4A 5J2GA 2B0CA 3M1YA 2R8IA 4RZRA 3N4MB 5KAIU 4JK1A 2BCVA 4Y2PA 2IOFA 2BCUA 5DBCA 4R65A 2QB1A 2QB0B 3M8RA 4ECUA 7ICEA 4KLOA 5AM1A 2NRZA 2Y9TA 8ICBA 5DBAA 3TFRA 4F93B 3TFSA 1LVHA 2W11A 4Z6FA 1FFUA 1Y88A 3QEBZ 7ICFA 1N62A 1VJ5A 4MF2A 1S0VA 3PW5A 4EYIB 2C22A 2H3FA 4IQTA 1ZQXA 2KJ9A 4C4TA 2KMDA 3IG5A 3LWLA 4F5QA 1BVSA 1Z1VA 1UQVA 4NXZA 1X2IA 4F50A 5J2CA 4IRDA 2ZTDA 3C1YA 3D2QA 1KTQA 1CRXA 1U4BA 2F8LA 3TARA 2E5SA 3F5AA 5EE9A 1PZNA 4YP3A 3AQFA 2DUYA 4J9MA 4R64A 2VANA 1L6NA 2HHVA 5AKYA 3I76A 3C2MA 2ISOA 4R63A 4AYBF 4Y2SA 2XY7A 3EPGA 4BXOA 2ZTEA 4IS7A 1D9DA 4M9JA 3N97B 1SWVA 4I2CA 3GIMA 2ZJ8A 3JPOA 2R8HA 7ICTA 1ZQYA 4GFJA 3TQ1A 1PVPA 2I1QA 3N7SC 4Q8EA 1X9XA 1ZD5A 2WTFA 4MFAA 2ZIXA 3QUCA 2W9CB 5KFAA 2JZBA 3PX6A 4ELUA 1V38A 5J0YA 4Q8FA 3NVWA 4GXJA 4Q44A 1Q3UA 3ZI4A 5KFSA 9ICKA 3RJIA 2UVWA 4UQGA 1A6SA 3ETRA 1K1SA 4KTQA 4P2HA 3KHRA 2ZIVA 3EWAA 5KFFA 5CA7A 3SYZA 3G6XA 1UHUA 4DFKA 4DFDA 2XVTA 3IV6A 5D46A 3H0LB 5ALZA 3BS5A 4I29A 5G5GA 4Q43A 4DL7A 4QIWC 3Q8MA 5AI9A 3PY8A 4UB2A 1KW4A 2D3DA 3H8WA 5KG7A 4UAUA 3NVZA 3DDHA 8ICXA 3TKAA 1COKA 5KFUA 5J2EA 3UQ2A 4KLUA 2WB1F 2BR0A 3RJGA 2KN7A 2PFOA 1SZHA 4ECSA 2ZJAA 3QU4A 1TK0A 2O6KA 3NVVA 4PHDA 1N60A 4YFKA 4NLZA 2AQ0A 3N28A 1V97A 5CJ7A 3ALRA 5AKEA 3MBYA 5J0UA 2IHNA 2IMWP 4EZ6A 2E1FA 1KEJA 1BNPA 4IRKA 3H8JA 1U48A 1XC9A 1S76D 3FM9A 3WK5A 5C5JA 2PI4A 5AI5A 4C80A 2EZZA 4FZMA 5CHGA 2DWQA 4DQQA 4BJQA 1ZQLA 4C8LA 8ICQA 3MR3A 3A0BU 3V6JA 3QU2A 4DLGA 1VLBA 1SKRA 3RR8A 2C2DA 5KG5A 5KT2A 1A76A 4IR1A 1NI3A 1RXVA 1QSYA 2EAMA 1HEKA 2LM4A 4F4YA 1SXDA 4DFJA 1SL1A 3V6KA 1F44A 1YZ6A 4B9TA 4EELA 4UARA 8ICSA 5KFCA 4RQ3A 1SGGA 4CDGA 2LPEA 5AIBA 1AROP 2YMPA 3M9MB 3KHGA 2RHFA 1AQ6A 4KLSA 4CF4A 3BJYA 1S77D 1LV5A 1X9MA 4DCCA 1NKEA 2V9WA 3QYPA 4CE6A 4ELTA 4KLEA 8ICCA 2BCQA 1YZ7A 2W43A 1NKBA 2HVHA 4MEYA 1NK7A 1ED1A 3PMLA 1ZQKA 1Z4OA 2XO7A 2Y0SF 9ICJA 2HHUA 4BUGA 4KLTA 5K4LA 3AU6A 4PHEA 4OJ5A 3BQ2A 3RF9A 1B43A 1XSLA 2ZIWB 4DSIA 5EWFA 5ALWA 4DF4A 4J9LA 4OJ6A 3CW2C 4IQVA 4R8UB 4RQNA
chains in the Genus database with same CATH topology
3KHHA 3PR5B 2PXIA 2BGWA 4YMOA 2BPCA 5HHIA 3K75D 4UBCA 1XSPA 4MFFA 5KG1A 5DKWA 2XGQA 3ZD8A 1ZQZA 1S0OA 5KFDA 1MQ3A 3T3FA 5J2DA 4O3OA 2MUTB 2NRVA 4YVZA 3UXNA 5EOZA 4QZBA 3RAQA 2BQUA 5KFRA 4J9KA 4Z6CA 4FS2A 5IIJA 4P4PA 4DL3A 4KLGA 2KFNA 4O3SA 5J2IA 3RH5A 2FMQA 2BKEA 4F91B 4ECQA 2I9GA 8ICPA 2BDPA 8ICEA 3UXOA 3ZDDA 2OWOA 3ZD9A 1COOA 4DSEA 2BPGA 4C8OA 2W9CA 1S9FA 4GXKA 4RNNA 4ECVA 4HYKA 2P6RA 4RUCA 2Q0ZX 4YMMA 3GIKA 3GIJA 4ECYA 2AGQA 1MC8A 2XY6A 4QWBA 3AU2A 1ZQRA 4MEXA 7ICMA 3B0XA 2FPKA 4UBBA 1JN3A 4YXJA 5CB1A 4DFMA 4YG2A 2FLPA 3SZ2A 2FLLA 3TAQA 2KZZA 4RQ7A 5IIMA 4ED7A 3ZDBA 2HHTA 3FDSA 4QZHA 1KRPA 3JPTA 5L9XA 5KFKA 5KFVA 4YD1A 3QZ8A 4YR2A 3G6VA 3C1ZA 8ICHA 4TUSA 3FYHA 2XCPA 3JPSA 5J0OA 3OSPA 4M9HA 3RH4A 4M9LA 2HHWA 1QLNA 3RB0A 2BQ3A 3PV8A 5IIKA 4G3IA 4ZH4A 3ISBA 1SKSA 1ZJNA 9ICVA 9ICCA 4F8RA 5KT3A 4DSKA 2W9BB 2ZUCA 4F5RA 5J29A 4IQUA 5KFYA 3GV8B 4MFCA 4RPYA 1T8EA 4QW8A 5J0WA 4UAWA 1JXLA 2IA6A 2VA2A 1MQ2A 3RJEA 3TANA 4I2AA 1KFTA 4Z6DA 1NJZA 2W9AA 5L1LA 3RBEA 4XUSA 3MR5A 7ICRA 1T3NA 4MF8A 3OJSA 4YXMA 4DWIA 1WCLA 1ZQEA 4QZGA 9ICRA 4RQ2A 4I2GA 7ICNA 1B22A 3GV7B 1KFDA 5KFWA 2BHNA 5KFGA 4KN7A 5KT4A 4DQIA 4ECZA 5L1JA 4YN4A 4ECWA 3IM1A 3MGIA 4R8UA 1TK8A 4ED8A 4RT2A 3K4GA 1RYRA 3PR4A 1TV9A 2C2EA 4NLKA 3MGHA 4DL6A 5HP4A 4QZIA 5DG7A 2JEIA 4BDPA 4O5EA 4XQ8A 5J2HA 5D4BA 7ICUA 5CR0A 1K1QA 2AQ4A 1KLNA 4ED1A 1ZQNA 4JWNA 7ICSA 8ICGA 1DOQA 4M47A 3OSNA 7ICIA 4EBCA 4TUPA 5IINA 1NK4A 4ECTA 3C23A 4O3PA 2XC9A 4NLGA 5J2GA 2AU0A 4DL2A 2R8IA 5EWEA 4RZRA 1U49A 4EZ9A 3N4MB 1D9FA 1IM4A 1ZQUA 5KG3A 4JK1A 1ZQAA 5KFHA 5J0QA 1T4GA 3LK9A 1SKWA 7ICVA 2BCVA 2V4QA 1A77A 2HVIA 1ZQQA 2KZ3A 5KFLA 4O3NA 3C5FA 3GFKB 4QZCA 4PGXA 4ED6A 2C2RA 2BCUA 7ICHA 5J0XA 4LVSA 5DBCA 4R65A 3OJUA 1TK5A 4M9GA 3M8RA 4ECUA 7ICEA 4QWAA 4KLOA 1X9WA 3V6HA 1TAQA 5KT5A 3UXPA 2NRZA 4RPZA 4O3QA 4M04A 3ORYA 5J0SA 4I2EA 8ICBA 1NKCA 5DBAA 2A1JB 3TFRA 2IHMA 4F93B 1S10A 4BXOB 5L1KA 3TFSA 5DB9A 2MAXA 4Z6FA 1SZPA 3MR2A 3IHQB 4O5KA 2VA8A 2JEFA 5EWGA 3TI0A 1Y88A 3QEBZ 9ICAA 4UAYA 7ICFA 2W9MA 4RQ6A 1KDHA 4MF2A 1S0VA 2F1JA 4YQWA 5DDMA 4DOBA 3EPIA 2Y1JA 5KFTA 3GDXA 1XU4A 3PW5A 4J9QA 1TVAA 1KFSA 4RU9A 1JX4A 9ICNA 4EYIB 5HMMA 2C22A 3GV5B 1WCNA 5F9NA 4M6WB 4IQTA 5CP2A 2AGOA 1ZQXA 3RRHA 4PGYA 4QZAA 9ICLA 2JZBB 5KG6A 3PO4A 4DEZA 4IRCA 9ICQA 2P6UA 1D8LA 1TKDA 1L3UA 3MFHA 1ZQOA 4KLFA 2UVUA 1RZTA 1NJXA 5J0TA 2KFZA 8ICNA 1KSPA 3LWLA 4F5QA 1BVSA 2ALZA 4P4MA 4NXZA 3RH6A 3NGDA 4IR9A 1RXWA 1X2IA 4F50A 1ZQFA 4YMNA 4B9NA 3EW9A 5KTQA 5J2CA 4F5NA 1EXNA 8ICZA 4GC6A 4IRDA 2ZTDA 4DOAA 5DGBA 1X9SA 5IILA 4KLHA 3LDAA 4RQ4A 1U45A 3B0YA 3C1YA 4QZEA 5CWRA 4RPXA 3OHAA 3V7JA 1TFRA 1UA1A 3RB3A 8ICOA 2XCAA 4RT3A 1KTQA 4YR3A 3T5KA 1SL0A 9ICIA 4I2DA 3PX4A 4QW9A 1U4BA 4GLXA 1U47A 4B9UA 4I2JA 7ICJA 2NRWA 2ISPA 5KFQA 3SV4A 3TARA 4C8NA 5DBBA 4QWCA 1PZNA 4YP3A 4QWEA 1Z00A 2H5XA 5DGAA 4B9LA 4J9MA 3GIIA 9ICXA 4PHPA 2VANA 4R64A 3C2LA 2HHVA 1CEZA 1QTMA 1ZETA 2DPJA 4NM1A 9ICFA 3M8SA 5IIOA 2W8LA 4M9NA 3C2MA 3RBDA 5BOLA 4R63A 2W8KA 2ISOA 8ICUA 3HPOA 5DG9A 4DS4A 4DSLA 2ZUDA 2HHQA 1RPLA 1ZQHA 1HJPA 3SI8A 1BPDA 3PMNA 2XY7A 4UB3A 2V4RA 4YD2A 4C8KA 1BPXA 8ICTA 4F2RA 4XA5A 2PFNA 7ICLA 1S0NA 4F4WA 3H4DA 4KLJA 3AUOA 2A1JA 5HNKA 3EPGA 3RJKA 3RB4A 2FLNA 4BXOA 2ZTEA 1D9DA 4I2BA 4ECXA 4M9JA 3N97B 3HT3A 4I2CA 4DF8A 3GIMA 1BPZA 7ICGA 2ZJ8A 3JPOA 2R8HA 7ICTA 2BQRA 4I2HA 2RDIA 1ZQYA 4DQPA 3TQ1A 4EBDA 1ZQIA 4PPXA 4DLEA 2I1QA 7ICKA 4KN4A 4JV1A 4YCXA 4F4ZA 1UA0A 5DB7A 5BPCA 1C7YA 8ICMA 5KFNA 4Q8EA 5KFXA 4DQRA 2R8GA 2WTFA 4MFAA 5TZVA 2MUTA 4UB5A 2W9CB 5KFAA 3BQ0A 3H4BA 2BPFA 1T7PA 2JZBA 3SV3A 3UPQA 3PX6A 3G6YA 2XY5A 1NK5A 4QZDA 3Q8PB 2BCRA 4ELUA 4EEYA 3PW0A 5J0YA 9ICBA 9ICWA 1ZQTA 4Q8FA 3RJFA 1H38A 2R8JA 4TQRA 1JXEA 3QZ7A 8ICAA 4J9NA 2B21A 3H7IA 4GXJA 1NK9A 4KMUA 4DSJA 1MSWD 4I27A 4DQSA 4PHAA 4Q44A 4KLLA 2J6SA 4BWMA 3EYZA 5KFSA 2DPIA 9ICKA 4J9PA 4J9SA 3RJIA 2ATLA 4F3OA 1XWLA 4UQGA 2UVWA 3UQ0A 4FS1A 1NJWA 1K1SA 3PO5A 4KTQA 4P2HA 3HX0A 3KHRA 1NK0A 4DS5A 3EWAA 3C21A 5KFFA 5CA7A 3T5HA 4TUQA 1D8YA 3SYZA 5J2FA 3G6XA 4DFKA 4I2IA 3MABA 5D46A 1SL2A 1ZQMA 3JPRA 4F5OA 1ZQPA 1U9LA 4RNMA 4K4GA 1L3TA 5DDYA 3Q8QB 1N56A 4BGDA 2NRXA 4UB1A 4ELVA 2FPMA 5J0RA 1CUKA 4DO9A 4TQSA 3PX0A 3ZDEA 4I29A 8ICJA 4Q43A 4DL7A 3Q8MA 4QWDA 1S97A 3PY8A 4UB2A 4O9MA 3H8WA 5KG7A 3EZ5A 3LWMA 3H40A 1NJYA 4NY8A 2W9BA 4KLMA 4JUZA 2HW3A 2FMPA 3V72A 4C8MA 3MDCA 3V7KA 4B9SA 3C5GA 2FMSA 8ICXA 5KFUA 5IIIA 3MR6A 5KFEA 5J2EA 5J2AA 3UQ2A 4KLUA 2J6UA 2BR0A 2AGPA 2UVVA 3RJGA 4RUAA 2KN7A 1S0MA 2PFPA 4KLIA 2HVHA 5KFOA 2PFOA 1NK6A 2KZMA 4ECSA 4DFPA 2ZJAA 2P66A 3HW8A 2AJQA 5DB6A 1ZQWA 2Y1IA 3OHBA 4DL5A 9ICOA 1TK0A 4PH5A 5DQHA 4DOCA 4QZFA 5J0PA 4PHDA 3KHLA 8ICIA 4YFKA 4NLZA 2AQ0A 5KFIA 3HP6A 2HHXA 5CJ7A 1ZYQA 3RAXA 4F5PA 3ISDA 3QE9Y 9ICMA 4X5VA 4JV2A 7ICQA 3RJJA 3MBYA 5J0UA 2IHNA 1ZQGA 2IMWP 4EZ6A 8ICRA 5KFBA 5D49A 4TURA 3HWTA 4BWJA 9ICGA 1KEJA 2LYHA 4K4IA 4KLDA 4IRKA 3H8JA 5KFZA 3JPNA 2DFLA 1U48A 1XC9A 1S76D 4UB4A 1Z3EB 3BDPA 4P4OA 3THVA 3PNCA 4KITB 5KG0A 5C5JA 4Z6EA 2HHSA 5KFJA 2FPLA 2PI4A 9ICSA 4JV0A 2F1IA 4F92B 4IQWA 3Q8LA 4FBTA 5J2BA 1QSSA 4M0AA 3M9NB 4EBEA 3H8SA 4LZDA 5CHGA 3MFIA 3M9OB 4RQ1A 4DQQA 1HUOA 1ZQLA 4C8LA 3MR3A 8ICQA 2ASJA 4O5CA 3RTVA 3V6JA 2RDJA 4O3RA 5DLFA 4DLGA 4QZ9A 4M2YA 2BCSA 3E2EA 5KFMA 1SKRA 3RR8A 4ECRA 2C2DA 1JMSA 1LB2B 5KG5A 5KFPA 5KT2A 1A76A 4IR1A 4EYHB 4DSFA 4B9MA 2PI5A 4B9VA 1BPBA 1L3VA 1RXVA 1QSYA 4J9OA 4NM2A 4F4YA 1BPEA 2C28A 3KTQA 9ICTA 4RNOA 4XRHA 1NOMA 2ZTCA 4DFJA 1SL1A 1DGSA 1UT8A 5KG2A 3OGUA 2GWSA 5JUMA 3V6KA 4PGQA 1XS9D 4B9TA 1XSNA 8ICSA 5KFCA 4RQ3A 4F4XA 1V9PA 9ICUA 4O0IA 4M6WA 2F1HA 3GQCA 3PW2A 1ZQCA 2ZUBA 2ZJ5A 1AROP 5HMLA 2ASDA 5DLGA 3C2KA 3ISCA 3M9MB 3PW7A 4JWMA 4GC7A 1RYSA 3MDAA 3T5JA 2JEGA 3ZDCA 3KHGA 1IXRA 3TAPA 5DQIA 1HUZA 1TAUA 3RRGA 4KLSA 3JPQA 5L1IA 3BJYA 3RB6A 4FBUA 8ICVA 4I28A 2JEJA 4F2SA 1S77D 5DB8A 7ICOA 1ZJMA 1LV5A 5HHHA 1X9MA 1NKEA 2V9WA 4K4HA 1ZQJA 3V7LA 9ICPA 3QEAZ 2KTQA 4RQ0A 3GILA 1BGXT 4ELTA 3Q8KA 4FO6A 8ICYA 5KT6A 4E0DA 5BOMA 1Z00B 4DL4A 5KT7A 2R8KA 4RQ5A 1L5UA 4KLEA 8ICCA 2BCQA 3BQ1A 8ICWA 4LZGA 5KG4A 4UAZA 2VA3A 1BPYA 8ICFA 4ED2A 1ZQBA 1NKBA 2IBKA 4MEYA 2NRTA 1NK7A 3PMLA 4ED0A 5F9LA 1ZQKA 2ASLA 1QSLA 1ZQVA 7ICPA 4F4KA 4J9RA 3PW4A 2XO7A 4Q45A 4YR0A 4RQ8A 3JPPA 1L3SA 3RR7A 5DG8A 8ICLA 8ICKA 9ICJA 3NTUA 4GXIA 4QZ8A 2HHUA 1XO1A 2M9NA 1ZQDA 3ETLA 4R66A 1JIHA 5J2KA 4KLTA 3Q8RB 2UVRA 3AU6A 4PHEA 2PFQA 9ICHA 3T5LA 3BQ2A 1ZQSA 1XSLA 1B43A 5J2JA 4DSIA 4NLNA 9ICEA 5EWFA 3RJHA 2J6TA 3BQTA 4ED3A 4DF4A 4J9LA 3ZDAA 4I2FA 1NK8A 2XGPA 5DQGA 4IQVA 3Q8SB 3PVXA 4KLQA 4R8UB 1N48A 4CCHA 1UT5A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3KHH A;  3PR5 B;  2PXI A;  2BGW A;  4YMO A;  2BPC A;  5HHI A;  3K75 D;  4UBC A;  1XSP A;  4MFF A;  5KG1 A;  5DKW A;  2XGQ A;  3ZD8 A;  1ZQZ A;  1S0O A;  5KFD A;  1MQ3 A;  3T3F A;  5J2D A;  4O3O A;  2MUT B;  2NRV A;  4YVZ A;  3UXN A;  5EOZ A;  4QZB A;  3RAQ A;  2BQU A;  5KFR A;  4J9K A;  4Z6C A;  4FS2 A;  5IIJ A;  4P4P A;  4DL3 A;  4KLG A;  2KFN A;  4O3S A;  5J2I A;  3RH5 A;  2FMQ A;  2BKE A;  4F91 B;  4ECQ A;  2I9G A;  8ICP A;  2BDP A;  8ICE A;  3UXO A;  3ZDD A;  2OWO A;  3ZD9 A;  1COO A;  4DSE A;  2BPG A;  4C8O A;  2W9C A;  1S9F A;  4GXK A;  4RNN A;  4ECV A;  4HYK A;  2P6R A;  4RUC A;  2Q0Z X;  4YMM A;  3GIK A;  3GIJ A;  4ECY A;  2AGQ A;  1MC8 A;  2XY6 A;  4QWB A;  3AU2 A;  1ZQR A;  4MEX A;  7ICM A;  3B0X A;  2FPK A;  4UBB A;  1JN3 A;  4YXJ A;  5CB1 A;  4DFM A;  4YG2 A;  2FLP A;  3SZ2 A;  2FLL A;  3TAQ A;  2KZZ A;  4RQ7 A;  5IIM A;  4ED7 A;  3ZDB A;  2HHT A;  3FDS A;  4QZH A;  1KRP A;  3JPT A;  5L9X A;  5KFK A;  5KFV A;  4YD1 A;  3QZ8 A;  4YR2 A;  3G6V A;  3C1Z A;  8ICH A;  4TUS A;  3FYH A;  2XCP A;  3JPS A;  5J0O A;  3OSP A;  4M9H A;  3RH4 A;  4M9L A;  2HHW A;  1QLN A;  3RB0 A;  2BQ3 A;  3PV8 A;  5IIK A;  4G3I A;  4ZH4 A;  3ISB A;  1SKS A;  1ZJN A;  9ICV A;  9ICC A;  4F8R A;  5KT3 A;  4DSK A;  2W9B B;  2ZUC A;  4F5R A;  5J29 A;  4IQU A;  5KFY A;  3GV8 B;  4MFC A;  4RPY A;  1T8E A;  4QW8 A;  5J0W A;  4UAW A;  1JXL A;  2IA6 A;  2VA2 A;  1MQ2 A;  3RJE A;  3TAN A;  4I2A A;  1KFT A;  4Z6D A;  1NJZ A;  2W9A A;  5L1L A;  3RBE A;  4XUS A;  3MR5 A;  7ICR A;  1T3N A;  4MF8 A;  3OJS A;  4YXM A;  4DWI A;  1WCL A;  1ZQE A;  4QZG A;  9ICR A;  4RQ2 A;  4I2G A;  7ICN A;  1B22 A;  3GV7 B;  1KFD A;  5KFW A;  2BHN A;  5KFG A;  4KN7 A;  5KT4 A;  4DQI A;  4ECZ A;  5L1J A;  4YN4 A;  4ECW A;  3IM1 A;  3MGI A;  4R8U A;  1TK8 A;  4ED8 A;  4RT2 A;  3K4G A;  1RYR A;  3PR4 A;  1TV9 A;  2C2E A;  4NLK A;  3MGH A;  4DL6 A;  5HP4 A;  4QZI A;  5DG7 A;  2JEI A;  4BDP A;  4O5E A;  4XQ8 A;  5J2H A;  5D4B A;  7ICU A;  5CR0 A;  1K1Q A;  2AQ4 A;  1KLN A;  4ED1 A;  1ZQN A;  4JWN A;  7ICS A;  8ICG A;  1DOQ A;  4M47 A;  3OSN A;  7ICI A;  4EBC A;  4TUP A;  5IIN A;  1NK4 A;  4ECT A;  3C23 A;  4O3P A;  2XC9 A;  4NLG A;  5J2G A;  2AU0 A;  4DL2 A;  2R8I A;  5EWE A;  4RZR A;  1U49 A;  4EZ9 A;  3N4M B;  1D9F A;  1IM4 A;  1ZQU A;  5KG3 A;  4JK1 A;  1ZQA A;  5KFH A;  5J0Q A;  1T4G A;  3LK9 A;  1SKW A;  7ICV A;  2BCV A;  2V4Q A;  1A77 A;  2HVI A;  1ZQQ A;  2KZ3 A;  5KFL A;  4O3N A;  3C5F A;  3GFK B;  4QZC A;  4PGX A;  4ED6 A;  2C2R A;  2BCU A;  7ICH A;  5J0X A;  4LVS A;  5DBC A;  4R65 A;  3OJU A;  1TK5 A;  4M9G A;  3M8R A;  4ECU A;  7ICE A;  4QWA A;  4KLO A;  1X9W A;  3V6H A;  1TAQ A;  5KT5 A;  3UXP A;  2NRZ A;  4RPZ A;  4O3Q A;  4M04 A;  3ORY A;  5J0S A;  4I2E A;  8ICB A;  1NKC A;  5DBA A;  2A1J B;  3TFR A;  2IHM A;  4F93 B;  1S10 A;  4BXO B;  5L1K A;  3TFS A;  5DB9 A;  2MAX A;  4Z6F A;  1SZP A;  3MR2 A;  3IHQ B;  4O5K A;  2VA8 A;  2JEF A;  5EWG A;  3TI0 A;  1Y88 A;  3QEB Z;  9ICA A;  4UAY A;  7ICF A;  2W9M A;  4RQ6 A;  1KDH A;  4MF2 A;  1S0V A;  2F1J A;  4YQW A;  5DDM A;  4DOB A;  3EPI A;  2Y1J A;  5KFT A;  3GDX A;  1XU4 A;  3PW5 A;  4J9Q A;  1TVA A;  1KFS A;  4RU9 A;  1JX4 A;  9ICN A;  4EYI B;  5HMM A;  2C22 A;  3GV5 B;  1WCN A;  5F9N A;  4M6W B;  4IQT A;  5CP2 A;  2AGO A;  1ZQX A;  3RRH A;  4PGY A;  4QZA A;  9ICL A;  2JZB B;  5KG6 A;  3PO4 A;  4DEZ A;  4IRC A;  9ICQ A;  2P6U A;  1D8L A;  1TKD A;  1L3U A;  3MFH A;  1ZQO A;  4KLF A;  2UVU A;  1RZT A;  1NJX A;  5J0T A;  2KFZ A;  8ICN A;  1KSP A;  3LWL A;  4F5Q A;  1BVS A;  2ALZ A;  4P4M A;  4NXZ A;  3RH6 A;  3NGD A;  4IR9 A;  1RXW A;  1X2I A;  4F50 A;  1ZQF A;  4YMN A;  4B9N A;  3EW9 A;  5KTQ A;  5J2C A;  4F5N A;  1EXN A;  8ICZ A;  4GC6 A;  4IRD A;  2ZTD A;  4DOA A;  5DGB A;  1X9S A;  5IIL A;  4KLH A;  3LDA A;  4RQ4 A;  1U45 A;  3B0Y A;  3C1Y A;  4QZE A;  5CWR A;  4RPX A;  3OHA A;  3V7J A;  1TFR A;  1UA1 A;  3RB3 A;  8ICO A;  2XCA A;  4RT3 A;  1KTQ A;  4YR3 A;  3T5K A;  1SL0 A;  9ICI A;  4I2D A;  3PX4 A;  4QW9 A;  1U4B A;  4GLX A;  1U47 A;  4B9U A;  4I2J A;  7ICJ A;  2NRW A;  2ISP A;  5KFQ A;  3SV4 A;  3TAR A;  4C8N A;  5DBB A;  4QWC A;  1PZN A;  4YP3 A;  4QWE A;  1Z00 A;  2H5X A;  5DGA A;  4B9L A;  4J9M A;  3GII A;  9ICX A;  4PHP A;  2VAN A;  4R64 A;  3C2L A;  2HHV A;  1CEZ A;  1QTM A;  1ZET A;  2DPJ A;  4NM1 A;  9ICF A;  3M8S A;  5IIO A;  2W8L A;  4M9N A;  3C2M A;  3RBD A;  5BOL A;  4R63 A;  2W8K A;  2ISO A;  8ICU A;  3HPO A;  5DG9 A;  4DS4 A;  4DSL A;  2ZUD A;  2HHQ A;  1RPL A;  1ZQH A;  1HJP A;  3SI8 A;  1BPD A;  3PMN A;  2XY7 A;  4UB3 A;  2V4R A;  4YD2 A;  4C8K A;  1BPX A;  8ICT A;  4F2R A;  4XA5 A;  2PFN A;  7ICL A;  1S0N A;  4F4W A;  3H4D A;  4KLJ A;  3AUO A;  2A1J A;  5HNK A;  3EPG A;  3RJK A;  3RB4 A;  2FLN A;  4BXO A;  2ZTE A;  1D9D A;  4I2B A;  4ECX A;  4M9J A;  3N97 B;  3HT3 A;  4I2C A;  4DF8 A;  3GIM A;  1BPZ A;  7ICG A;  2ZJ8 A;  3JPO A;  2R8H A;  7ICT A;  2BQR A;  4I2H A;  2RDI A;  1ZQY A;  4DQP A;  3TQ1 A;  4EBD A;  1ZQI A;  4PPX A;  4DLE A;  2I1Q A;  7ICK A;  4KN4 A;  4JV1 A;  4YCX A;  4F4Z A;  1UA0 A;  5DB7 A;  5BPC A;  1C7Y A;  8ICM A;  5KFN A;  4Q8E A;  5KFX A;  4DQR A;  2R8G A;  2WTF A;  4MFA A;  5TZV A;  2MUT A;  4UB5 A;  2W9C B;  5KFA A;  3BQ0 A;  3H4B A;  2BPF A;  1T7P A;  2JZB A;  3SV3 A;  3UPQ A;  3PX6 A;  3G6Y A;  2XY5 A;  1NK5 A;  4QZD A;  3Q8P B;  2BCR A;  4ELU A;  4EEY A;  3PW0 A;  5J0Y A;  9ICB A;  9ICW A;  1ZQT A;  4Q8F A;  3RJF A;  1H38 A;  2R8J A;  4TQR A;  1JXE A;  3QZ7 A;  8ICA A;  4J9N A;  2B21 A;  3H7I A;  4GXJ A;  1NK9 A;  4KMU A;  4DSJ A;  1MSW D;  4I27 A;  4DQS A;  4PHA A;  4Q44 A;  4KLL A;  2J6S A;  4BWM A;  3EYZ A;  5KFS A;  2DPI A;  9ICK A;  4J9P A;  4J9S A;  3RJI A;  2ATL A;  4F3O A;  1XWL A;  4UQG A;  2UVW A;  3UQ0 A;  4FS1 A;  1NJW A;  1K1S A;  3PO5 A;  4KTQ A;  4P2H A;  3HX0 A;  3KHR A;  1NK0 A;  4DS5 A;  3EWA A;  3C21 A;  5KFF A;  5CA7 A;  3T5H A;  4TUQ A;  1D8Y A;  3SYZ A;  5J2F A;  3G6X A;  4DFK A;  4I2I A;  3MAB A;  5D46 A;  1SL2 A;  1ZQM A;  3JPR A;  4F5O A;  1ZQP A;  1U9L A;  4RNM A;  4K4G A;  1L3T A;  5DDY A;  3Q8Q B;  1N56 A;  4BGD A;  2NRX A;  4UB1 A;  4ELV A;  2FPM A;  5J0R A;  1CUK A;  4DO9 A;  4TQS A;  3PX0 A;  3ZDE A;  4I29 A;  8ICJ A;  4Q43 A;  4DL7 A;  3Q8M A;  4QWD A;  1S97 A;  3PY8 A;  4UB2 A;  4O9M A;  3H8W A;  5KG7 A;  3EZ5 A;  3LWM A;  3H40 A;  1NJY A;  4NY8 A;  2W9B A;  4KLM A;  4JUZ A;  2HW3 A;  2FMP A;  3V72 A;  4C8M A;  3MDC A;  3V7K A;  4B9S A;  3C5G A;  2FMS A;  8ICX A;  5KFU A;  5III A;  3MR6 A;  5KFE A;  5J2E A;  5J2A A;  3UQ2 A;  4KLU A;  2J6U A;  2BR0 A;  2AGP A;  2UVV A;  3RJG A;  4RUA A;  2KN7 A;  1S0M A;  2PFP A;  4KLI A;  2HVH A;  5KFO A;  2PFO A;  1NK6 A;  2KZM A;  4ECS A;  4DFP A;  2ZJA A;  2P66 A;  3HW8 A;  2AJQ A;  5DB6 A;  1ZQW A;  2Y1I A;  3OHB A;  4DL5 A;  9ICO A;  1TK0 A;  4PH5 A;  5DQH A;  4DOC A;  4QZF A;  5J0P A;  4PHD A;  3KHL A;  8ICI A;  4YFK A;  4NLZ A;  2AQ0 A;  5KFI A;  3HP6 A;  2HHX A;  5CJ7 A;  1ZYQ A;  3RAX A;  4F5P A;  3ISD A;  3QE9 Y;  9ICM A;  4X5V A;  4JV2 A;  7ICQ A;  3RJJ A;  3MBY A;  5J0U A;  2IHN A;  1ZQG A;  2IMW P;  4EZ6 A;  8ICR A;  5KFB A;  5D49 A;  4TUR A;  3HWT A;  4BWJ A;  9ICG A;  1KEJ A;  2LYH A;  4K4I A;  4KLD A;  4IRK A;  3H8J A;  5KFZ A;  3JPN A;  2DFL A;  1U48 A;  1XC9 A;  1S76 D;  4UB4 A;  1Z3E B;  3BDP A;  4P4O A;  3THV A;  3PNC A;  4KIT B;  5KG0 A;  5C5J A;  4Z6E A;  2HHS A;  5KFJ A;  2FPL A;  2PI4 A;  9ICS A;  4JV0 A;  2F1I A;  4F92 B;  4IQW A;  3Q8L A;  4FBT A;  5J2B A;  1QSS A;  4M0A A;  3M9N B;  4EBE A;  3H8S A;  4LZD A;  5CHG A;  3MFI A;  3M9O B;  4RQ1 A;  4DQQ A;  1HUO A;  1ZQL A;  4C8L A;  3MR3 A;  8ICQ A;  2ASJ A;  4O5C A;  3RTV A;  3V6J A;  2RDJ A;  4O3R A;  5DLF A;  4DLG A;  4QZ9 A;  4M2Y A;  2BCS A;  3E2E A;  5KFM A;  1SKR A;  3RR8 A;  4ECR A;  2C2D A;  1JMS A;  1LB2 B;  5KG5 A;  5KFP A;  5KT2 A;  1A76 A;  4IR1 A;  4EYH B;  4DSF A;  4B9M A;  2PI5 A;  4B9V A;  1BPB A;  1L3V A;  1RXV A;  1QSY A;  4J9O A;  4NM2 A;  4F4Y A;  1BPE A;  2C28 A;  3KTQ A;  9ICT A;  4RNO A;  4XRH A;  1NOM A;  2ZTC A;  4DFJ A;  1SL1 A;  1DGS A;  1UT8 A;  5KG2 A;  3OGU A;  2GWS A;  5JUM A;  3V6K A;  4PGQ A;  1XS9 D;  4B9T A;  1XSN A;  8ICS A;  5KFC A;  4RQ3 A;  4F4X A;  1V9P A;  9ICU A;  4O0I A;  4M6W A;  2F1H A;  3GQC A;  3PW2 A;  1ZQC A;  2ZUB A;  2ZJ5 A;  1ARO P;  5HML A;  2ASD A;  5DLG A;  3C2K A;  3ISC A;  3M9M B;  3PW7 A;  4JWM A;  4GC7 A;  1RYS A;  3MDA A;  3T5J A;  2JEG A;  3ZDC A;  3KHG A;  1IXR A;  3TAP A;  5DQI A;  1HUZ A;  1TAU A;  3RRG A;  4KLS A;  3JPQ A;  5L1I A;  3BJY A;  3RB6 A;  4FBU A;  8ICV A;  4I28 A;  2JEJ A;  4F2S A;  1S77 D;  5DB8 A;  7ICO A;  1ZJM A;  1LV5 A;  5HHH A;  1X9M A;  1NKE A;  2V9W A;  4K4H A;  1ZQJ A;  3V7L A;  9ICP A;  3QEA Z;  2KTQ A;  4RQ0 A;  3GIL A;  1BGX T;  4ELT A;  3Q8K A;  4FO6 A;  8ICY A;  5KT6 A;  4E0D A;  5BOM A;  1Z00 B;  4DL4 A;  5KT7 A;  2R8K A;  4RQ5 A;  1L5U A;  4KLE A;  8ICC A;  2BCQ A;  3BQ1 A;  8ICW A;  4LZG A;  5KG4 A;  4UAZ A;  2VA3 A;  1BPY A;  8ICF A;  4ED2 A;  1ZQB A;  1NKB A;  2IBK A;  4MEY A;  2NRT A;  1NK7 A;  3PML A;  4ED0 A;  5F9L A;  1ZQK A;  2ASL A;  1QSL A;  1ZQV A;  7ICP A;  4F4K A;  4J9R A;  3PW4 A;  2XO7 A;  4Q45 A;  4YR0 A;  4RQ8 A;  3JPP A;  1L3S A;  3RR7 A;  5DG8 A;  8ICL A;  8ICK A;  9ICJ A;  3NTU A;  4GXI A;  4QZ8 A;  2HHU A;  1XO1 A;  2M9N A;  1ZQD A;  3ETL A;  4R66 A;  1JIH A;  5J2K A;  4KLT A;  3Q8R B;  2UVR A;  3AU6 A;  4PHE A;  2PFQ A;  9ICH A;  3T5L A;  3BQ2 A;  1ZQS A;  1XSL A;  1B43 A;  5J2J A;  4DSI A;  4NLN A;  9ICE A;  5EWF A;  3RJH A;  2J6T A;  3BQT A;  4ED3 A;  4DF4 A;  4J9L A;  3ZDA A;  4I2F A;  1NK8 A;  2XGP A;  5DQG A;  4IQV A;  3Q8S B;  3PVX A;  4KLQ A;  4R8U B;  1N48 A;  4CCH A;  1UT5 A; 
#chains in the Genus database with same CATH topology
 2PXI A;  1OXJ A;  4YMO A;  4UBC A;  2QLT A;  1XSP A;  2XGQ A;  2RP5 A;  2KIV A;  1ZQZ A;  5AKK A;  5J8Y A;  5J2D A;  2MUT B;  3UXN A;  5HR7 A;  4QZB A;  4P4P A;  4DL3 A;  2KFN A;  5HR6 A;  2BKE A;  4ICA A;  4F91 B;  2I9G A;  2BDP A;  2FJ6 A;  3ZD9 A;  2W9C A;  4FE3 A;  4ECV A;  4ECY A;  2AGQ A;  2K8A A;  2KJ8 A;  2E8P A;  4DFM A;  4YG2 A;  3SZ2 A;  5ALQ A;  5IIM A;  4EX7 A;  3JPT A;  1X6J A;  4YD1 A;  3WK6 A;  3QZ8 A;  2VIX A;  2OYY A;  2RQ5 A;  4TUS A;  3FYH A;  2KE7 A;  5J0O A;  3OSP A;  4M9H A;  4OD0 A;  3RH4 A;  4ZOH C;  4ZH4 A;  9ICV A;  5J8Y C;  3IP4 B;  4F8R A;  3UM9 A;  3MGV A;  4F5R A;  4IQU A;  4RPY A;  4QW8 A;  4UAW A;  2IA6 A;  1MQ2 A;  3GZF A;  2WF6 A;  4J03 A;  2KVC A;  5ALV A;  2HBJ A;  3WK8 A;  3OJS A;  4DWI A;  1WCL A;  4RQ2 A;  1KL9 A;  2ZG6 A;  3NRW A;  5KFG A;  5KT4 A;  3CNH A;  2F2A B;  5L1J A;  3WKC A;  1TK8 A;  1RYR A;  2C2E A;  2K4I A;  3MGH A;  3KBB A;  4QZI A;  5D4B A;  2DKX A;  1K1Q A;  3M6K A;  8ICG A;  1X6I A;  4M47 A;  3OSN A;  3J81 j;  2CN1 A;  5IIN A;  4ECT A;  4EZ9 A;  1WYG A;  2ZIU B;  5KG3 A;  5J0Q A;  1B0X A;  4KX5 A;  1A77 A;  2HVI A;  1ZQQ A;  2CXY A;  5KFL A;  3C5F A;  7ICH A;  3GFK B;  4LVS A;  2MRL A;  2G5H B;  1TK5 A;  4M9G A;  1L8O A;  2EZX A;  5KT5 A;  1DRG A;  4RPZ A;  2IHM A;  4BXO B;  5L1K A;  1PVR A;  5DB9 A;  1SZP A;  2VA8 A;  5EWG A;  1RG6 A;  9ICA A;  4UAY A;  2IOF K;  1KDH A;  4YQW A;  5DDM A;  3EPI A;  2ESE A;  2H3I A;  2FE9 A;  2LMR A;  1TVA A;  4RU9 A;  2ZIX B;  1WCN A;  5F9N A;  4M6W B;  3RRH A;  2KKV A;  2JZB B;  5AKI A;  1LKY B;  2A19 A;  9ICQ A;  3M7D A;  2P6U A;  5AK6 A;  1L3U A;  3MFH A;  4AYB C;  5J0T A;  2ALZ A;  4QJF B;  3F5E A;  3FC4 A;  1SXE A;  4B9N A;  3EW9 A;  1EXN A;  1PK3 A;  4GC6 A;  5EE0 A;  3OHA A;  4RPX A;  1N2X A;  2ZIV B;  3QUB A;  4YR3 A;  1SL0 A;  4I2D A;  3PX4 A;  4QW9 A;  5GTH U;  1U47 A;  4B9U A;  7ICJ A;  2NRW A;  2ISP A;  5KFQ A;  5ALM A;  2RRD A;  5DBB A;  2ZXI A;  2HSZ A;  1SV0 C;  4C4S A;  2D8C A;  1IV8 A;  3BS5 B;  5AKG A;  1NNL A;  3C2L A;  1CEZ A;  1QTM A;  9ICF A;  5IIO A;  2W8L A;  3HPO A;  5DG9 A;  3C28 A;  1F0M A;  2LM1 A;  1BPD A;  3PMN A;  2KHV A;  2V4R A;  8ICT A;  4C8K A;  2ZIW A;  4F2R A;  4XA5 A;  1S0N A;  3H4D A;  2W04 A;  2B6G A;  2L5Y A;  4ECX A;  3HT3 A;  4A8E A;  2JH1 A;  4C7Y A;  1BPZ A;  2ZXH A;  3TAD A;  4EBD A;  7ICK A;  4JV1 A;  4YCX A;  1UA0 A;  2KP7 A;  5DB7 A;  1C7Y A;  2VJ5 A;  5KFX A;  1OW5 A;  2R8G A;  5AK3 A;  2MUT A;  4UB5 A;  4NWI A;  3BQ0 A;  3G6Y A;  3Q8P B;  3I1Y A;  5ALU A;  2WB1 C;  9ICB A;  2NYV A;  1ZQT A;  3RJF A;  1H38 A;  3U26 A;  1WWV A;  4DQS A;  4KLL A;  2J6S A;  2DPI A;  3IN5 A;  1XWL A;  4F71 A;  4FS1 A;  1Q8K A;  3HX0 A;  3KD3 A;  3CYM A;  1D8Y A;  2DL0 A;  3MAB A;  4UB6 U;  5F3X B;  3HIL A;  1L3T A;  5DDY A;  4BGD A;  4UB1 A;  8ICJ A;  3PX0 A;  1CUK A;  3KZI U;  2D6F C;  1QQ7 A;  8ICM A;  4NY8 A;  5C0Y A;  4B9S A;  3MDC A;  5KNI A;  3MR6 A;  1P7D A;  1M6Y A;  2HDO A;  4RUA A;  5JU5 A;  3NUQ A;  2W54 A;  2P66 A;  3HW8 A;  2Y1I A;  4DOC A;  2LKY A;  3QUQ A;  2HBK A;  4Y2Q A;  1ZD2 P;  1ZYQ A;  4US9 A;  3KZX A;  9ICM A;  4JV2 A;  3RJJ A;  2W7O A;  3CP8 A;  3HWT A;  5D49 A;  2YMQ A;  9ICG A;  4K4I A;  2EZY A;  3JPN A;  2DFL A;  4UB4 A;  4PL1 A;  2H3Q A;  5AKL A;  5AM3 A;  3THV A;  2ZIU A;  4KIT B;  4Y2X A;  5KG0 A;  2KIC A;  4UB8 U;  9ICS A;  2WF8 A;  4JV0 A;  2K4P A;  4IQW A;  4M0A A;  1ECW A;  4OJO A;  3MFI A;  3K1R B;  4RQ1 A;  1HUO A;  2ODG A;  2ASJ A;  2KIW A;  1NZB A;  1RDF A;  4WJ3 B;  3AMZ A;  4M2Y A;  2BCS A;  3E2E A;  5KFM A;  4QNL A;  3SEN A;  2G06 A;  4ECR A;  4DSF A;  4NL9 A;  1L3V A;  1V85 A;  3A0H U;  2IOH A;  4XRH A;  1NOM A;  2Y9U A;  1PVQ A;  2Y0S C;  5KG2 A;  2GWS A;  3IG8 A;  4PGQ A;  1ZOL A;  4MHV A;  4U7C A;  4F4X A;  9ICU A;  2E8M A;  4M6W A;  5ALH A;  2EAN A;  1VDV A;  3GQC A;  1ZQC A;  2ZUB A;  1LKY A;  2MSN A;  5HML A;  4EEK A;  1C20 A;  3CRX A;  2JRZ A;  3MDA A;  3T5J A;  3ZDC A;  1X66 A;  5ALT A;  1J97 A;  3RRG A;  3WKD A;  3JPQ A;  5L1I A;  4FBU A;  2JEJ A;  4F2S A;  5DB8 A;  1ZJM A;  3WK7 A;  4K4H A;  1ZQJ A;  5B5E U;  1BGX T;  4FO6 A;  8ICY A;  2LYA A;  4E0D A;  5BOM A;  1Z00 B;  5KT7 A;  5AK5 A;  1L5U A;  2NO5 A;  3AL0 B;  3BQ1 A;  8ICW A;  3L5K A;  2OCE A;  2EDU A;  4ED2 A;  1ZQB A;  2NRT A;  2R18 A;  1QSL A;  2YB1 A;  5F9L A;  4F4K A;  4J9R A;  3PW4 A;  4Q45 A;  3E0F A;  4RQ8 A;  2JV3 A;  3JPP A;  3RR7 A;  4GIB A;  8ICK A;  3NTU A;  3HKZ C;  4QZ8 A;  3ETL A;  4R66 A;  3Q8R B;  2E1E A;  2UVR A;  2PFQ A;  1ZQS A;  4NLN A;  9ICE A;  3RJH A;  1FEZ A;  1Z19 A;  4I2F A;  3B9J A;  2XGP A;  5EE1 A;  3LVW A;  3Q8L A;  4I28 A;  4UW9 A;  3VCB A;  2BPC A;  3K75 D;  3ZD8 A;  5KFD A;  4P0P B;  2W3S A;  2BQU A;  4YVZ A;  5EOZ A;  3O0F A;  2WFA A;  4FS2 A;  2W55 A;  4Y2T A;  2FMQ A;  4ECQ A;  4PL2 A;  4KMO B;  2OWO A;  4C0Z A;  4C8O A;  4EX6 A;  2Q4T A;  4GXK A;  4FZN A;  4YMM A;  1MC8 A;  2XY6 A;  2YQE A;  4MEX A;  2KV2 A;  4YXJ A;  5CB1 A;  3C29 A;  2FLL A;  1HIW A;  4Y2J A;  2HHT A;  4QZH A;  5L9X A;  4UAV A;  4YR2 A;  4OJP A;  3JPS A;  4NLC A;  2W7P A;  1DXS A;  4CNQ A;  1T3Q A;  2JR5 A;  4FFD A;  1SKS A;  1SWW A;  5J29 A;  4MFC A;  1QCK A;  1UCV A;  2LI6 A;  4Z6D A;  1NJZ A;  1Z4N A;  5CRX A;  1QH9 A;  4XUS A;  4FZL A;  4MF8 A;  9ICR A;  4I2G A;  7ICN A;  3GV7 B;  5KFW A;  2OXO A;  5KAF U;  4ECW A;  3IM1 A;  3PR4 A;  1N5W A;  5DG7 A;  4BDP A;  4O5E A;  4XQ8 A;  5J2H A;  7ICU A;  2AQ4 A;  1ZQN A;  7ICS A;  1DOQ A;  4EBC A;  4TUP A;  4ACO A;  1ZD3 A;  3C23 A;  4O3P A;  3NAS A;  4NLG A;  2H3Z A;  2N1R A;  2EQY A;  4RQM A;  4HAI A;  1D9F A;  2BDU A;  1ZQA A;  5KFH A;  4JMU A;  1SKW A;  1N5X A;  7ICV A;  2KG5 A;  2C2R A;  3OJU A;  1N61 A;  4QWA A;  5AKJ A;  1L7P A;  4O3Q A;  2M0N A;  2BZF A;  5J0S A;  2XID A;  5AM0 A;  3MR2 A;  4O5K A;  1IIP A;  3TI0 A;  1DK3 A;  5JRT A;  3K1Z A;  4DOB A;  5B66 U;  1XU4 A;  4J9Q A;  2Z7J A;  1JX4 A;  3GV5 B;  4PGY A;  9ICL A;  5AI4 A;  5AM4 A;  4DEZ A;  4IRC A;  1D8L A;  1TKD A;  1ZQO A;  4KLF A;  2KFZ A;  2XIC A;  3TAC B;  3HKZ F;  4CF5 A;  4P4M A;  3N7R C;  1KQQ A;  1RXW A;  2VKQ A;  5KTQ A;  4F5N A;  4DOA A;  5DGB A;  5IIL A;  3LDA A;  4RQ4 A;  1U45 A;  3FAH A;  4QZE A;  5CWR A;  3V7J A;  1PK1 A;  2ES6 A;  8ICO A;  4RT3 A;  5ALR A;  3UMB A;  1JI7 A;  1QQ5 A;  1URJ A;  4GLX A;  3SV4 A;  3L3F X;  4QWC A;  1Z00 A;  2PKE A;  4B9L A;  3UMC A;  2MA1 A;  3GII A;  1L7M A;  4PHP A;  1K5O A;  1JRO A;  4M9N A;  1S8O A;  1UPH A;  3RBD A;  2CPR A;  3H0R B;  5AKH A;  3KOO A;  2W8K A;  8ICU A;  4DS4 A;  4DSL A;  2HHQ A;  1HJP A;  2A1A A;  3SI8 A;  2NV3 A;  3PST A;  4UB3 A;  2HI0 A;  4YD2 A;  1BPX A;  4F4W A;  2A1J A;  5HNK A;  3RJK A;  2FLN A;  3NS1 A;  3M6Z A;  3AN1 A;  4DF8 A;  7ICG A;  4I2H A;  2WAQ C;  1ZQI A;  4PPX A;  4KN4 A;  5KL1 B;  4F4Z A;  5BPC A;  5KFN A;  2GOL A;  4P0P A;  5TZV A;  4G9B A;  1Q46 A;  1O03 A;  3H4B A;  2BPF A;  1T7P A;  3SV3 A;  3UPQ A;  2HMX A;  1SV4 A;  1NK5 A;  4QZD A;  5A0L A;  3H0M B;  9ICW A;  4TQR A;  3QZ7 A;  8ICA A;  4J9N A;  3H7I A;  1NK9 A;  4DSJ A;  4PZN A;  1MSW D;  4I27 A;  3EYZ A;  4J9P A;  3PO5 A;  4Y2R A;  3HJE A;  1DK2 A;  2LYB A;  3C21 A;  3T5H A;  4I2I A;  1NZP A;  2I5H A;  1SL2 A;  1ZQM A;  3S6J A;  1ZQP A;  4RNM A;  5J0R A;  4Y2Y A;  4DO9 A;  1PUZ A;  3ZDE A;  3LWM A;  1NJY A;  2HW3 A;  3V72 A;  4C8M A;  3C5G A;  2FMS A;  5III A;  3WK4 A;  2J6U A;  2UVV A;  2G5I B;  4KLI A;  5KFO A;  2KZM A;  2AJQ A;  1ZQW A;  3WKE A;  9ICO A;  4PH5 A;  5DQH A;  1XO0 A;  4QZF A;  5J0P A;  2WF5 A;  8ICI A;  5KFI A;  3HP6 A;  4IL6 U;  3D2N A;  3N7P D;  2DBY A;  3RAX A;  4CF3 A;  2XI9 A;  4US8 A;  7ICQ A;  1ZQG A;  1O08 A;  4BWJ A;  2LYH A;  4KLD A;  5KFZ A;  1Z3E B;  4P4O A;  3PNC A;  5KL8 B;  3SAH A;  2DGZ A;  3KFU F;  1BNO A;  2HHS A;  2FPL A;  3GU3 A;  2F1I A;  4F92 B;  4FBT A;  5J2B A;  1QSS A;  3F2B A;  3M9N B;  3IRU A;  3H8S A;  4LZD A;  3M9O B;  5AKZ A;  3EUB 2;  2HCF A;  4QZ9 A;  1JUD A;  4C7Z A;  4PJ0 U;  5FP0 A;  1JMS A;  1LB2 B;  5KFP A;  4B9M A;  2PI5 A;  1BPB A;  1FIQ A;  1JAL A;  4J9O A;  3VC8 A;  3KTQ A;  4RNO A;  2ZTC A;  5JUM A;  1XS9 D;  1XSN A;  2F3N A;  1V9P A;  4O0I A;  2F1H A;  2JH7 A;  5ALD A;  5CEH A;  2E3T A;  3C2K A;  3ISC A;  1L7N A;  4GC7 A;  2JEG A;  1SIJ A;  1X40 A;  1TAU A;  5DQI A;  2WHE A;  3RB6 A;  8ICV A;  1TE2 A;  7ICO A;  3V7L A;  2KTQ A;  4RQ0 A;  3GIL A;  1OUQ A;  2LHT A;  2G07 A;  5KT6 A;  4NLB A;  4DL4 A;  5AM2 A;  1RYU A;  2RLT A;  2DF4 B;  4LZG A;  5KG4 A;  4UAZ A;  2VA3 A;  2IBK A;  2WAQ F;  4P0Q A;  7ICP A;  1ZQV A;  4YR0 A;  1J2M A;  1L3S A;  5DG8 A;  3TAD C;  4GXI A;  2M9N A;  1ZQD A;  1JIH A;  5J2J A;  3R9K A;  3BQT A;  4PZO A;  3ZDA A;  5ALI A;  1ZXI A;  5E79 U;  4LJX A;  5TIS U;  2EH9 A;  2AXT U;  3QU5 A;  4Y2U A;  1CI4 A;  2BGW A;  5KG1 A;  3SAG A;  1S0O A;  3T3F A;  2NRV A;  4NLK A;  4O3S A;  1T94 A;  3RH5 A;  1XNS A;  8ICP A;  3AM9 A;  3HRD D;  3UXO A;  1COO A;  2F76 X;  4DSE A;  1S9F A;  2P6R A;  4RUC A;  2Q0Z X;  2GH1 A;  3GIK A;  3GIJ A;  2GLE A;  4QWB A;  1ZQR A;  7ICM A;  1JN3 A;  4CGZ A;  2YY6 A;  5ALE A;  2K8B B;  5AIA A;  3TAQ A;  2KZZ A;  2YB4 A;  4ED7 A;  3ZDB A;  3FDS A;  2KVS A;  3F53 A;  5KFK A;  5JTI A;  2I6X A;  2H3V A;  2FDR A;  5AK4 A;  2BQ3 A;  4G3I A;  3ISB A;  1ZJN A;  5KT3 A;  4DSK A;  2W9B B;  2ZUC A;  5KFY A;  3GV8 B;  1T8E A;  5J0W A;  2VA2 A;  4I2A A;  2W9A A;  3RBE A;  3MR5 A;  4YXM A;  1ZQE A;  4QZG A;  1WG8 A;  3SQI A;  2WF9 A;  1KFD A;  2BHN A;  4KN7 A;  4DQI A;  4AP9 A;  1A0P A;  3UMG A;  1TV9 A;  3WKA A;  3LYS A;  4DL6 A;  1PK1 B;  5CR0 A;  2E8O A;  3QUT A;  7ICI A;  2XC9 A;  2AU0 A;  4DL2 A;  3OTQ A;  5EWE A;  1U49 A;  5AI6 A;  1IM4 A;  1ZQU A;  2KK0 A;  3PSP A;  1T4G A;  3H8M A;  3LK9 A;  3AQE A;  4NL9 C;  2V4Q A;  2KZ3 A;  4O3N A;  4QZC A;  4PGX A;  4ED6 A;  5J0X A;  2YN4 A;  2QAR A;  1X9W A;  3V6H A;  2K4E A;  1TAQ A;  5T14 A;  3UXP A;  3ICX A;  1B4F A;  4M04 A;  3PZP A;  3ORY A;  4I2E A;  3E58 A;  1NKC A;  2A1J B;  1S10 A;  3F2D A;  2MAX A;  3IHQ B;  2KHQ A;  2JEF A;  2W9M A;  4RQ6 A;  2F1J A;  2PMZ F;  2Y1J A;  5KFT A;  3GDX A;  3NRZ A;  1KFS A;  9ICN A;  5HMM A;  5CP2 A;  4UAT A;  2AGO A;  4QZA A;  3LVV A;  5KG6 A;  3PO4 A;  2UVU A;  1RZT A;  1NJX A;  1F5S A;  8ICN A;  1KSP A;  3RH6 A;  4BX9 C;  1FO4 A;  3NGD A;  4IR9 A;  1ZQF A;  4YMN A;  1S5L U;  8ICZ A;  1X9S A;  4KLH A;  2W03 A;  3B0Y A;  1TFR A;  5ALK A;  3RB3 A;  2YML A;  2XCA A;  2K8C B;  1UA1 A;  3I28 A;  3T5K A;  2KD1 A;  1SB3 C;  3DV9 A;  4I2J A;  2KSO A;  3WU2 U;  3QX7 A;  4C8N A;  2VJ4 A;  5ALS A;  4QWE A;  2JHD A;  2H5X A;  5DGA A;  5EE3 A;  9ICX A;  4U6P A;  1ZD4 A;  1ZET A;  2DPJ A;  4NM1 A;  3M8S A;  2KOB A;  5BOL A;  2QB0 A;  2ZUD A;  1RPL A;  2NO4 A;  1DGJ A;  1ZQH A;  2WF7 A;  2PFN A;  7ICL A;  2OH2 A;  1TAM A;  4KLJ A;  3AUO A;  3RB4 A;  2EAP A;  4I2B A;  1WWU A;  2BQR A;  2RDI A;  5ALL A;  4DQP A;  3QXG A;  4NJ8 A;  4DLE A;  3SEI A;  5G5H A;  3SMV A;  4DQR A;  5ALY A;  1Q3V A;  2HBL A;  2XY5 A;  3RFA A;  2BCR A;  4EEY A;  3WK9 A;  3PW0 A;  4C4R A;  2K4H A;  2KJ5 A;  2YX8 A;  2R8J A;  1JXE A;  2GO7 A;  2B21 A;  4KMU A;  4PHA A;  1J2N A;  3SR6 A;  4BWM A;  4B6J A;  5L1M A;  4J9S A;  2ATL A;  1KBU A;  4F3O A;  2KKP A;  3UQ0 A;  1NJW A;  4DS5 A;  4TUQ A;  2G09 A;  5ALO A;  5J2F A;  2JXJ A;  1JRP A;  3ONN A;  3JPR A;  4F5O A;  1U9L A;  4K4G A;  2HBM A;  3Q8Q B;  1N56 A;  1GO3 F;  2NRX A;  4ELV A;  2FPM A;  9ICI A;  4TQS A;  4QWD A;  1S97 A;  4O9M A;  3EZ5 A;  3H40 A;  4KLM A;  2W9B A;  4JUZ A;  2FMP A;  5ALP A;  4NV0 A;  3V7K A;  4JB3 A;  5KFE A;  1MA7 A;  5J2A A;  2AGP A;  1S0M A;  2PFP A;  1KN5 A;  4O3M A;  1NK6 A;  4DFP A;  5ALG A;  5DB6 A;  3OHB A;  4DL5 A;  2JGA A;  3KHL A;  2HHX A;  1L7O A;  5GTI U;  4F5P A;  3ISD A;  3QE9 Y;  4X5V A;  2FI1 A;  8ICR A;  5KFB A;  4TUR A;  2OM6 A;  2W3R A;  4P0Q B;  2DKZ A;  1N63 A;  4KX3 A;  3BDP A;  4QIW F;  3QU7 A;  3L4P A;  4Z6E A;  5KFJ A;  5ALJ A;  1FFV A;  5ALN A;  1L8L A;  3AEV A;  2MU2 A;  2F77 X;  4EBE A;  5ALF A;  4O5C A;  3RTV A;  2RDJ A;  4O3R A;  5DLF A;  1WUD A;  3D6J A;  4IC9 A;  4EYH B;  1RQL A;  4B9V A;  5AHX A;  3T79 A;  3SD7 A;  2YMM A;  3QNM A;  4NM2 A;  1BPE A;  2C28 A;  9ICT A;  1DGS A;  1UT8 A;  2K89 A;  3OGU A;  4Y2V A;  3NVY A;  5AI0 A;  1ZRM A;  2DQN B;  1IG6 A;  3PW2 A;  5AKX A;  1RQN A;  2ZJ5 A;  5AI8 A;  2HOF A;  2ASD A;  2F44 A;  5DLG A;  3PW7 A;  4JWM A;  1RYS A;  5ALX A;  1IXR A;  3TAP A;  1HUZ A;  2QKQ A;  2A3V A;  5AIC A;  3D2S A;  5HHH A;  1ZRN A;  9ICP A;  3QEA Z;  3Q8K A;  3WKB A;  2R8K A;  4RQ5 A;  2G08 A;  3BS7 A;  1BPY A;  8ICF A;  4ED0 A;  2ASL A;  2LBO A;  2F8K A;  8ICL A;  1XO1 A;  3MC1 A;  5J2K A;  4EEN A;  9ICH A;  3T5L A;  2J6T A;  4ED3 A;  2E8N A;  5DQG A;  3F2C A;  3Q8S B;  3PVX A;  2OHF A;  3OPX A;  3KKA A;  4KLQ A;  2HOI A;  1N48 A;  4USA A;  3ED5 A;  5H2F U;  4CCH A;  1UT5 A;  3DEE A;  1SV0 A;  3KHH A;  3PR5 B;  1MN8 A;  3BZK A;  5HHI A;  2JMG A;  1YT3 A;  4MFF A;  5DKW A;  1MQ3 A;  2KNJ A;  4O3O A;  3RAQ A;  1NK8 A;  1NK0 A;  5KFR A;  4J9K A;  4Z6C A;  5IIJ A;  4KLG A;  5J2I A;  1X42 A;  2EAO A;  3PSI A;  5AM5 A;  2CRX A;  8ICE A;  4OCZ A;  3ZDD A;  2BPG A;  4RNN A;  4HYK A;  3BQ7 A;  2K60 A;  2QAR B;  3AU2 A;  3B0X A;  2FPK A;  1QQ6 A;  4UBB A;  3BZC A;  3PSF A;  2FLP A;  4OO1 J;  4RQ7 A;  2KEY A;  2HOQ A;  4OJL A;  1KRP A;  4UAS A;  5KFV A;  3G6V A;  3KKA C;  3C1Z A;  8ICH A;  2AH5 A;  2XCP A;  4M9L A;  2HHW A;  1QLN A;  3RB0 A;  3PV8 A;  5IIK A;  2YTU A;  2P35 A;  9ICC A;  1JXL A;  2OEH A;  3IDW A;  3RJE A;  1KFT A;  3TAN A;  1ZQ1 C;  5L1L A;  2G0A A;  7ICR A;  4CRX A;  1T3N A;  3SAF A;  4F72 A;  1Z1B A;  1B22 A;  1RM6 C;  2AHO B;  4ECZ A;  4YN4 A;  1D8B A;  3MGI A;  4R8U A;  4ED8 A;  4RT2 A;  3K4G A;  5HP4 A;  2JEI A;  3QU9 A;  4JWN A;  1KLN A;  4ED1 A;  2PMZ C;  1KKX A;  2KSO B;  1NK4 A;  5J2G A;  2B0C A;  3M1Y A;  2R8I A;  4RZR A;  3N4M B;  5KAI U;  4JK1 A;  2BCV A;  4Y2P A;  2IOF A;  2BCU A;  5DBC A;  4R65 A;  2QB1 A;  2QB0 B;  3M8R A;  4ECU A;  7ICE A;  4KLO A;  5AM1 A;  2NRZ A;  2Y9T A;  8ICB A;  5DBA A;  3TFR A;  4F93 B;  3TFS A;  1LVH A;  2W11 A;  4Z6F A;  1FFU A;  1Y88 A;  3QEB Z;  7ICF A;  1N62 A;  1VJ5 A;  4MF2 A;  1S0V A;  3PW5 A;  4EYI B;  2C22 A;  2H3F A;  4IQT A;  1ZQX A;  2KJ9 A;  4C4T A;  2KMD A;  3IG5 A;  3LWL A;  4F5Q A;  1BVS A;  1Z1V A;  1UQV A;  4NXZ A;  1X2I A;  4F50 A;  5J2C A;  4IRD A;  2ZTD A;  3C1Y A;  3D2Q A;  1KTQ A;  1CRX A;  1U4B A;  2F8L A;  3TAR A;  2E5S A;  3F5A A;  5EE9 A;  1PZN A;  4YP3 A;  3AQF A;  2DUY A;  4J9M A;  4R64 A;  2VAN A;  1L6N A;  2HHV A;  5AKY A;  3I76 A;  3C2M A;  2ISO A;  4R63 A;  4AYB F;  4Y2S A;  2XY7 A;  3EPG A;  4BXO A;  2ZTE A;  4IS7 A;  1D9D A;  4M9J A;  3N97 B;  1SWV A;  4I2C A;  3GIM A;  2ZJ8 A;  3JPO A;  2R8H A;  7ICT A;  1ZQY A;  4GFJ A;  3TQ1 A;  1PVP A;  2I1Q A;  3N7S C;  4Q8E A;  1X9X A;  1ZD5 A;  2WTF A;  4MFA A;  2ZIX A;  3QUC A;  2W9C B;  5KFA A;  2JZB A;  3PX6 A;  4ELU A;  1V38 A;  5J0Y A;  4Q8F A;  3NVW A;  4GXJ A;  4Q44 A;  1Q3U A;  3ZI4 A;  5KFS A;  9ICK A;  3RJI A;  2UVW A;  4UQG A;  1A6S A;  3ETR A;  1K1S A;  4KTQ A;  4P2H A;  3KHR A;  2ZIV A;  3EWA A;  5KFF A;  5CA7 A;  3SYZ A;  3G6X A;  1UHU A;  4DFK A;  4DFD A;  2XVT A;  3IV6 A;  5D46 A;  3H0L B;  5ALZ A;  3BS5 A;  4I29 A;  5G5G A;  4Q43 A;  4DL7 A;  4QIW C;  3Q8M A;  5AI9 A;  3PY8 A;  4UB2 A;  1KW4 A;  2D3D A;  3H8W A;  5KG7 A;  4UAU A;  3NVZ A;  3DDH A;  8ICX A;  3TKA A;  1COK A;  5KFU A;  5J2E A;  3UQ2 A;  4KLU A;  2WB1 F;  2BR0 A;  3RJG A;  2KN7 A;  2PFO A;  1SZH A;  4ECS A;  2ZJA A;  3QU4 A;  1TK0 A;  2O6K A;  3NVV A;  4PHD A;  1N60 A;  4YFK A;  4NLZ A;  2AQ0 A;  3N28 A;  1V97 A;  5CJ7 A;  3ALR A;  5AKE A;  3MBY A;  5J0U A;  2IHN A;  2IMW P;  4EZ6 A;  2E1F A;  1KEJ A;  1BNP A;  4IRK A;  3H8J A;  1U48 A;  1XC9 A;  1S76 D;  3FM9 A;  3WK5 A;  5C5J A;  2PI4 A;  5AI5 A;  4C80 A;  2EZZ A;  4FZM A;  5CHG A;  2DWQ A;  4DQQ A;  4BJQ A;  1ZQL A;  4C8L A;  8ICQ A;  3MR3 A;  3A0B U;  3V6J A;  3QU2 A;  4DLG A;  1VLB A;  1SKR A;  3RR8 A;  2C2D A;  5KG5 A;  5KT2 A;  1A76 A;  4IR1 A;  1NI3 A;  1RXV A;  1QSY A;  2EAM A;  1HEK A;  2LM4 A;  4F4Y A;  1SXD A;  4DFJ A;  1SL1 A;  3V6K A;  1F44 A;  1YZ6 A;  4B9T A;  4EEL A;  4UAR A;  8ICS A;  5KFC A;  4RQ3 A;  1SGG A;  4CDG A;  2LPE A;  5AIB A;  1ARO P;  2YMP A;  3M9M B;  3KHG A;  2RHF A;  1AQ6 A;  4KLS A;  4CF4 A;  3BJY A;  1S77 D;  1LV5 A;  1X9M A;  4DCC A;  1NKE A;  2V9W A;  3QYP A;  4CE6 A;  4ELT A;  4KLE A;  8ICC A;  2BCQ A;  1YZ7 A;  2W43 A;  1NKB A;  2HVH A;  4MEY A;  1NK7 A;  1ED1 A;  3PML A;  1ZQK A;  1Z4O A;  2XO7 A;  2Y0S F;  9ICJ A;  2HHU A;  4BUG A;  4KLT A;  5K4L A;  3AU6 A;  4PHE A;  4OJ5 A;  3BQ2 A;  3RF9 A;  1B43 A;  1XSL A;  2ZIW B;  4DSI A;  5EWF A;  5ALW A;  4DF4 A;  4J9L A;  4OJ6 A;  3CW2 C;  4IQV A;  4R8U B;  4RQN A; 
#chains in the Genus database with same CATH homology
 3KHH A;  3PR5 B;  2PXI A;  2BGW A;  4YMO A;  2BPC A;  5HHI A;  3K75 D;  4UBC A;  1XSP A;  4MFF A;  5KG1 A;  5DKW A;  2XGQ A;  3ZD8 A;  1ZQZ A;  1S0O A;  5KFD A;  1MQ3 A;  3T3F A;  5J2D A;  4O3O A;  2MUT B;  2NRV A;  4YVZ A;  3UXN A;  5EOZ A;  4QZB A;  3RAQ A;  2BQU A;  5KFR A;  4J9K A;  4Z6C A;  4FS2 A;  5IIJ A;  4P4P A;  4DL3 A;  4KLG A;  2KFN A;  4O3S A;  5J2I A;  3RH5 A;  2FMQ A;  2BKE A;  4F91 B;  4ECQ A;  2I9G A;  8ICP A;  2BDP A;  8ICE A;  3UXO A;  3ZDD A;  2OWO A;  3ZD9 A;  1COO A;  4DSE A;  2BPG A;  4C8O A;  2W9C A;  1S9F A;  4GXK A;  4RNN A;  4ECV A;  4HYK A;  2P6R A;  4RUC A;  2Q0Z X;  4YMM A;  3GIK A;  3GIJ A;  4ECY A;  2AGQ A;  1MC8 A;  2XY6 A;  4QWB A;  3AU2 A;  1ZQR A;  4MEX A;  7ICM A;  3B0X A;  2FPK A;  4UBB A;  1JN3 A;  4YXJ A;  5CB1 A;  4DFM A;  4YG2 A;  2FLP A;  3SZ2 A;  2FLL A;  3TAQ A;  2KZZ A;  4RQ7 A;  5IIM A;  4ED7 A;  3ZDB A;  2HHT A;  3FDS A;  4QZH A;  1KRP A;  3JPT A;  5L9X A;  5KFK A;  5KFV A;  4YD1 A;  3QZ8 A;  4YR2 A;  3G6V A;  3C1Z A;  8ICH A;  4TUS A;  3FYH A;  2XCP A;  3JPS A;  5J0O A;  3OSP A;  4M9H A;  3RH4 A;  4M9L A;  2HHW A;  1QLN A;  3RB0 A;  2BQ3 A;  3PV8 A;  5IIK A;  4G3I A;  4ZH4 A;  3ISB A;  1SKS A;  1ZJN A;  9ICV A;  9ICC A;  4F8R A;  5KT3 A;  4DSK A;  2W9B B;  2ZUC A;  4F5R A;  5J29 A;  4IQU A;  5KFY A;  3GV8 B;  4MFC A;  4RPY A;  1T8E A;  4QW8 A;  5J0W A;  4UAW A;  1JXL A;  2IA6 A;  2VA2 A;  1MQ2 A;  3RJE A;  3TAN A;  4I2A A;  1KFT A;  4Z6D A;  1NJZ A;  2W9A A;  5L1L A;  3RBE A;  4XUS A;  3MR5 A;  7ICR A;  1T3N A;  4MF8 A;  3OJS A;  4YXM A;  4DWI A;  1WCL A;  1ZQE A;  4QZG A;  9ICR A;  4RQ2 A;  4I2G A;  7ICN A;  1B22 A;  3GV7 B;  1KFD A;  5KFW A;  2BHN A;  5KFG A;  4KN7 A;  5KT4 A;  4DQI A;  4ECZ A;  5L1J A;  4YN4 A;  4ECW A;  3IM1 A;  3MGI A;  4R8U A;  1TK8 A;  4ED8 A;  4RT2 A;  3K4G A;  1RYR A;  3PR4 A;  1TV9 A;  2C2E A;  4NLK A;  3MGH A;  4DL6 A;  5HP4 A;  4QZI A;  5DG7 A;  2JEI A;  4BDP A;  4O5E A;  4XQ8 A;  5J2H A;  5D4B A;  7ICU A;  5CR0 A;  1K1Q A;  2AQ4 A;  1KLN A;  4ED1 A;  1ZQN A;  4JWN A;  7ICS A;  8ICG A;  1DOQ A;  4M47 A;  3OSN A;  7ICI A;  4EBC A;  4TUP A;  5IIN A;  1NK4 A;  4ECT A;  3C23 A;  4O3P A;  2XC9 A;  4NLG A;  5J2G A;  2AU0 A;  4DL2 A;  2R8I A;  5EWE A;  4RZR A;  1U49 A;  4EZ9 A;  3N4M B;  1D9F A;  1IM4 A;  1ZQU A;  5KG3 A;  4JK1 A;  1ZQA A;  5KFH A;  5J0Q A;  1T4G A;  3LK9 A;  1SKW A;  7ICV A;  2BCV A;  2V4Q A;  1A77 A;  2HVI A;  1ZQQ A;  2KZ3 A;  5KFL A;  4O3N A;  3C5F A;  3GFK B;  4QZC A;  4PGX A;  4ED6 A;  2C2R A;  2BCU A;  7ICH A;  5J0X A;  4LVS A;  5DBC A;  4R65 A;  3OJU A;  1TK5 A;  4M9G A;  3M8R A;  4ECU A;  7ICE A;  4QWA A;  4KLO A;  1X9W A;  3V6H A;  1TAQ A;  5KT5 A;  3UXP A;  2NRZ A;  4RPZ A;  4O3Q A;  4M04 A;  3ORY A;  5J0S A;  4I2E A;  8ICB A;  1NKC A;  5DBA A;  2A1J B;  3TFR A;  2IHM A;  4F93 B;  1S10 A;  4BXO B;  5L1K A;  3TFS A;  5DB9 A;  2MAX A;  4Z6F A;  1SZP A;  3MR2 A;  3IHQ B;  4O5K A;  2VA8 A;  2JEF A;  5EWG A;  3TI0 A;  1Y88 A;  3QEB Z;  9ICA A;  4UAY A;  7ICF A;  2W9M A;  4RQ6 A;  1KDH A;  4MF2 A;  1S0V A;  2F1J A;  4YQW A;  5DDM A;  4DOB A;  3EPI A;  2Y1J A;  5KFT A;  3GDX A;  1XU4 A;  3PW5 A;  4J9Q A;  1TVA A;  1KFS A;  4RU9 A;  1JX4 A;  9ICN A;  4EYI B;  5HMM A;  2C22 A;  3GV5 B;  1WCN A;  5F9N A;  4M6W B;  4IQT A;  5CP2 A;  2AGO A;  1ZQX A;  3RRH A;  4PGY A;  4QZA A;  9ICL A;  2JZB B;  5KG6 A;  3PO4 A;  4DEZ A;  4IRC A;  9ICQ A;  2P6U A;  1D8L A;  1TKD A;  1L3U A;  3MFH A;  1ZQO A;  4KLF A;  2UVU A;  1RZT A;  1NJX A;  5J0T A;  2KFZ A;  8ICN A;  1KSP A;  3LWL A;  4F5Q A;  1BVS A;  2ALZ A;  4P4M A;  4NXZ A;  3RH6 A;  3NGD A;  4IR9 A;  1RXW A;  1X2I A;  4F50 A;  1ZQF A;  4YMN A;  4B9N A;  3EW9 A;  5KTQ A;  5J2C A;  4F5N A;  1EXN A;  8ICZ A;  4GC6 A;  4IRD A;  2ZTD A;  4DOA A;  5DGB A;  1X9S A;  5IIL A;  4KLH A;  3LDA A;  4RQ4 A;  1U45 A;  3B0Y A;  3C1Y A;  4QZE A;  5CWR A;  4RPX A;  3OHA A;  3V7J A;  1TFR A;  1UA1 A;  3RB3 A;  8ICO A;  2XCA A;  4RT3 A;  1KTQ A;  4YR3 A;  3T5K A;  1SL0 A;  9ICI A;  4I2D A;  3PX4 A;  4QW9 A;  1U4B A;  4GLX A;  1U47 A;  4B9U A;  4I2J A;  7ICJ A;  2NRW A;  2ISP A;  5KFQ A;  3SV4 A;  3TAR A;  4C8N A;  5DBB A;  4QWC A;  1PZN A;  4YP3 A;  4QWE A;  1Z00 A;  2H5X A;  5DGA A;  4B9L A;  4J9M A;  3GII A;  9ICX A;  4PHP A;  2VAN A;  4R64 A;  3C2L A;  2HHV A;  1CEZ A;  1QTM A;  1ZET A;  2DPJ A;  4NM1 A;  9ICF A;  3M8S A;  5IIO A;  2W8L A;  4M9N A;  3C2M A;  3RBD A;  5BOL A;  4R63 A;  2W8K A;  2ISO A;  8ICU A;  3HPO A;  5DG9 A;  4DS4 A;  4DSL A;  2ZUD A;  2HHQ A;  1RPL A;  1ZQH A;  1HJP A;  3SI8 A;  1BPD A;  3PMN A;  2XY7 A;  4UB3 A;  2V4R A;  4YD2 A;  4C8K A;  1BPX A;  8ICT A;  4F2R A;  4XA5 A;  2PFN A;  7ICL A;  1S0N A;  4F4W A;  3H4D A;  4KLJ A;  3AUO A;  2A1J A;  5HNK A;  3EPG A;  3RJK A;  3RB4 A;  2FLN A;  4BXO A;  2ZTE A;  1D9D A;  4I2B A;  4ECX A;  4M9J A;  3N97 B;  3HT3 A;  4I2C A;  4DF8 A;  3GIM A;  1BPZ A;  7ICG A;  2ZJ8 A;  3JPO A;  2R8H A;  7ICT A;  2BQR A;  4I2H A;  2RDI A;  1ZQY A;  4DQP A;  3TQ1 A;  4EBD A;  1ZQI A;  4PPX A;  4DLE A;  2I1Q A;  7ICK A;  4KN4 A;  4JV1 A;  4YCX A;  4F4Z A;  1UA0 A;  5DB7 A;  5BPC A;  1C7Y A;  8ICM A;  5KFN A;  4Q8E A;  5KFX A;  4DQR A;  2R8G A;  2WTF A;  4MFA A;  5TZV A;  2MUT A;  4UB5 A;  2W9C B;  5KFA A;  3BQ0 A;  3H4B A;  2BPF A;  1T7P A;  2JZB A;  3SV3 A;  3UPQ A;  3PX6 A;  3G6Y A;  2XY5 A;  1NK5 A;  4QZD A;  3Q8P B;  2BCR A;  4ELU A;  4EEY A;  3PW0 A;  5J0Y A;  9ICB A;  9ICW A;  1ZQT A;  4Q8F A;  3RJF A;  1H38 A;  2R8J A;  4TQR A;  1JXE A;  3QZ7 A;  8ICA A;  4J9N A;  2B21 A;  3H7I A;  4GXJ A;  1NK9 A;  4KMU A;  4DSJ A;  1MSW D;  4I27 A;  4DQS A;  4PHA A;  4Q44 A;  4KLL A;  2J6S A;  4BWM A;  3EYZ A;  5KFS A;  2DPI A;  9ICK A;  4J9P A;  4J9S A;  3RJI A;  2ATL A;  4F3O A;  1XWL A;  4UQG A;  2UVW A;  3UQ0 A;  4FS1 A;  1NJW A;  1K1S A;  3PO5 A;  4KTQ A;  4P2H A;  3HX0 A;  3KHR A;  1NK0 A;  4DS5 A;  3EWA A;  3C21 A;  5KFF A;  5CA7 A;  3T5H A;  4TUQ A;  1D8Y A;  3SYZ A;  5J2F A;  3G6X A;  4DFK A;  4I2I A;  3MAB A;  5D46 A;  1SL2 A;  1ZQM A;  3JPR A;  4F5O A;  1ZQP A;  1U9L A;  4RNM A;  4K4G A;  1L3T A;  5DDY A;  3Q8Q B;  1N56 A;  4BGD A;  2NRX A;  4UB1 A;  4ELV A;  2FPM A;  5J0R A;  1CUK A;  4DO9 A;  4TQS A;  3PX0 A;  3ZDE A;  4I29 A;  8ICJ A;  4Q43 A;  4DL7 A;  3Q8M A;  4QWD A;  1S97 A;  3PY8 A;  4UB2 A;  4O9M A;  3H8W A;  5KG7 A;  3EZ5 A;  3LWM A;  3H40 A;  1NJY A;  4NY8 A;  2W9B A;  4KLM A;  4JUZ A;  2HW3 A;  2FMP A;  3V72 A;  4C8M A;  3MDC A;  3V7K A;  4B9S A;  3C5G A;  2FMS A;  8ICX A;  5KFU A;  5III A;  3MR6 A;  5KFE A;  5J2E A;  5J2A A;  3UQ2 A;  4KLU A;  2J6U A;  2BR0 A;  2AGP A;  2UVV A;  3RJG A;  4RUA A;  2KN7 A;  1S0M A;  2PFP A;  4KLI A;  2HVH A;  5KFO A;  2PFO A;  1NK6 A;  2KZM A;  4ECS A;  4DFP A;  2ZJA A;  2P66 A;  3HW8 A;  2AJQ A;  5DB6 A;  1ZQW A;  2Y1I A;  3OHB A;  4DL5 A;  9ICO A;  1TK0 A;  4PH5 A;  5DQH A;  4DOC A;  4QZF A;  5J0P A;  4PHD A;  3KHL A;  8ICI A;  4YFK A;  4NLZ A;  2AQ0 A;  5KFI A;  3HP6 A;  2HHX A;  5CJ7 A;  1ZYQ A;  3RAX A;  4F5P A;  3ISD A;  3QE9 Y;  9ICM A;  4X5V A;  4JV2 A;  7ICQ A;  3RJJ A;  3MBY A;  5J0U A;  2IHN A;  1ZQG A;  2IMW P;  4EZ6 A;  8ICR A;  5KFB A;  5D49 A;  4TUR A;  3HWT A;  4BWJ A;  9ICG A;  1KEJ A;  2LYH A;  4K4I A;  4KLD A;  4IRK A;  3H8J A;  5KFZ A;  3JPN A;  2DFL A;  1U48 A;  1XC9 A;  1S76 D;  4UB4 A;  1Z3E B;  3BDP A;  4P4O A;  3THV A;  3PNC A;  4KIT B;  5KG0 A;  5C5J A;  4Z6E A;  2HHS A;  5KFJ A;  2FPL A;  2PI4 A;  9ICS A;  4JV0 A;  2F1I A;  4F92 B;  4IQW A;  3Q8L A;  4FBT A;  5J2B A;  1QSS A;  4M0A A;  3M9N B;  4EBE A;  3H8S A;  4LZD A;  5CHG A;  3MFI A;  3M9O B;  4RQ1 A;  4DQQ A;  1HUO A;  1ZQL A;  4C8L A;  3MR3 A;  8ICQ A;  2ASJ A;  4O5C A;  3RTV A;  3V6J A;  2RDJ A;  4O3R A;  5DLF A;  4DLG A;  4QZ9 A;  4M2Y A;  2BCS A;  3E2E A;  5KFM A;  1SKR A;  3RR8 A;  4ECR A;  2C2D A;  1JMS A;  1LB2 B;  5KG5 A;  5KFP A;  5KT2 A;  1A76 A;  4IR1 A;  4EYH B;  4DSF A;  4B9M A;  2PI5 A;  4B9V A;  1BPB A;  1L3V A;  1RXV A;  1QSY A;  4J9O A;  4NM2 A;  4F4Y A;  1BPE A;  2C28 A;  3KTQ A;  9ICT A;  4RNO A;  4XRH A;  1NOM A;  2ZTC A;  4DFJ A;  1SL1 A;  1DGS A;  1UT8 A;  5KG2 A;  3OGU A;  2GWS A;  5JUM A;  3V6K A;  4PGQ A;  1XS9 D;  4B9T A;  1XSN A;  8ICS A;  5KFC A;  4RQ3 A;  4F4X A;  1V9P A;  9ICU A;  4O0I A;  4M6W A;  2F1H A;  3GQC A;  3PW2 A;  1ZQC A;  2ZUB A;  2ZJ5 A;  1ARO P;  5HML A;  2ASD A;  5DLG A;  3C2K A;  3ISC A;  3M9M B;  3PW7 A;  4JWM A;  4GC7 A;  1RYS A;  3MDA A;  3T5J A;  2JEG A;  3ZDC A;  3KHG A;  1IXR A;  3TAP A;  5DQI A;  1HUZ A;  1TAU A;  3RRG A;  4KLS A;  3JPQ A;  5L1I A;  3BJY A;  3RB6 A;  4FBU A;  8ICV A;  4I28 A;  2JEJ A;  4F2S A;  1S77 D;  5DB8 A;  7ICO A;  1ZJM A;  1LV5 A;  5HHH A;  1X9M A;  1NKE A;  2V9W A;  4K4H A;  1ZQJ A;  3V7L A;  9ICP A;  3QEA Z;  2KTQ A;  4RQ0 A;  3GIL A;  1BGX T;  4ELT A;  3Q8K A;  4FO6 A;  8ICY A;  5KT6 A;  4E0D A;  5BOM A;  1Z00 B;  4DL4 A;  5KT7 A;  2R8K A;  4RQ5 A;  1L5U A;  4KLE A;  8ICC A;  2BCQ A;  3BQ1 A;  8ICW A;  4LZG A;  5KG4 A;  4UAZ A;  2VA3 A;  1BPY A;  8ICF A;  4ED2 A;  1ZQB A;  1NKB A;  2IBK A;  4MEY A;  2NRT A;  1NK7 A;  3PML A;  4ED0 A;  5F9L A;  1ZQK A;  2ASL A;  1QSL A;  1ZQV A;  7ICP A;  4F4K A;  4J9R A;  3PW4 A;  2XO7 A;  4Q45 A;  4YR0 A;  4RQ8 A;  3JPP A;  1L3S A;  3RR7 A;  5DG8 A;  8ICL A;  8ICK A;  9ICJ A;  3NTU A;  4GXI A;  4QZ8 A;  2HHU A;  1XO1 A;  2M9N A;  1ZQD A;  3ETL A;  4R66 A;  1JIH A;  5J2K A;  4KLT A;  3Q8R B;  2UVR A;  3AU6 A;  4PHE A;  2PFQ A;  9ICH A;  3T5L A;  3BQ2 A;  1ZQS A;  1XSL A;  1B43 A;  5J2J A;  4DSI A;  4NLN A;  9ICE A;  5EWF A;  3RJH A;  2J6T A;  3BQT A;  4ED3 A;  4DF4 A;  4J9L A;  3ZDA A;  4I2F A;  1NK8 A;  2XGP A;  5DQG A;  4IQV A;  3Q8S B;  3PVX A;  4KLQ A;  4R8U B;  1N48 A;  4CCH A;  1UT5 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...