2MUTA

Solution structure of the f231l mutant ercc1-xpf dimerization region
Total Genus 27
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
27
sequence length
96
structure length
96
Chain Sequence
RIRRRYNMADLLMEKLEQDLVSRVTECLTTVKSVNKTDSQTLLTTFGSLEQLIAASREDLALCPGLGPQKARRLFDVLHEPFLKVPGGLEHHHHHH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Hydrolase
molecule keywords DNA excision repair protein ERCC-1
publication title The Cerebro-oculo-facio-skeletal Syndrome Point Mutation F231L in the ERCC1 DNA Repair Protein Causes Dissociation of the ERCC1-XPF Complex.
pubmed doi rcsb
source organism Homo sapiens
total genus 27
structure length 96
sequence length 96
ec nomenclature
pdb deposition date 2014-09-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00633 HHH Helix-hairpin-helix motif
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.20 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 5' to 3' exonuclease, C-terminal subdomain 2mutA00
3C2LA 7ICMA 4YD2A 4P4OA 3UQ0A 4TQSA 4DL2A 3KTQA 4KLSA 5J29A 1ZQQA 4F4YA 2W9CB 1ZQMA 4YR3A 3JPTA 5L1JA 4J9NA 2KZZA 5KFIA 5KFCA 4TQRA 3ZDDA 2XCAA 2KN7A 3HX0A 9ICSA 4XRHA 4P4PA 3ZD8A 1D9DA 2C2RA 1QSSA 8ICBA 5EOZA 8ICJA 4NLZA 4C8MA 4O9MA 5DGBA 1DGSA 2M9NA 4MEXA 3RJEA 4I27A 8ICWA 3RRGA 5BOLA 3GIJA 4B9UA 4JV0A 2F1JA 5IIOA 1X9MA 3H8JA 3MR3A 5KG0A 4K4HA 4PHPA 5CWRA 8ICCA 2XY7A 2VA3A 4Z6DA 3LWLA 4F5QA 4XQ8A 5IIMA 3SV4A 2BGWA 5DB7A 4UB1A 1XO1A 1IXRA 2ZTEA 3BQTA 5J0OA 4QZBA 2W9BB 3PW4A 3Q8SB 1D8YA 4PGYA 5DQGA 3T5JA 3PW5A 4RQ4A 4C8KA 1L3SA 3OJUA 4MFCA 1AROP 5KFRA 4PHEA 3UXOA 1XWLA 1SKSA 4KLMA 3EPGA 3Q8LA 3LWMA 3ZDCA 4F5OA 4RT2A 1TK5A 3G6YA 4PH5A 4ED1A 4P4MA 4DQPA 1SL1A 4F8RA 5KFDA 1TAUA 2R8GA 1D8LA 3M8RA 4UAWA 3ORYA 1KTQA 4M9GA 5CA7A 2XY6A 3PX0A 4I2CA 5DLFA 3FDSA 3RJGA 3Q8QB 2ZTDA 5KFYA 5KT6A 1L3VA 8ICAA 4RPYA 4R8UA 2RDIA 5J0UA 4K4IA 3BQ2A 3BJYA 1TAQA 4J9MA 4DL5A 1S0NA 3M9MB 3FYHA 4EYIB 3GV8B 1ZQBA 4GXJA 4RQ2A 3JPOA 3TQ1A 2ASDA 3GILA 9ICOA 3PO5A 5J0WA 1ZYQA 1KDHA 5JUMA 4MFFA 1ZQPA 3GDXA 4KLQA 4BWMA 2BDPA 1H38A 3QEAZ 5IINA 1QLNA 4G3IA 3PMNA 4IQUA 3C23A 2JEIA 4QZ8A 4DF8A 1MQ2A 2ZJ8A 3OSPA 4DQRA 4J9QA 1MSWD 1BPZA 4TUSA 2BPCA 1XS9D 4DF4A 3RJFA 3Q8PB 4RZRA 5KFMA 9ICPA 3JPRA 5L1LA 5J2IA 3TAPA 1B22A 3RB4A 1NK6A 5DG8A 1MC8A 3H8WA 4F2SA 3RBDA 3EPIA 9ICKA 1TK0A 3HW8A 4Z6FA 1Y88A 5J0PA 1T8EA 4PHDA 5DDMA 1ZQHA 1S0VA 4YXJA 5J2KA 5J0YA 1NJWA 2PFOA 9ICTA 5KT7A 3ZDEA 4TURA 4I2IA 3SV3A 4UB2A 4MF8A 9ICWA 4M6WA 5KFAA 3T5KA 2W9MA 1T7PA 2UVUA 2UVRA 4DSFA 1ZJMA 4KMUA 4B9VA 5KG2A 1Z3EB 1L3UA 2BPGA 1SZPA 3ETLA 4DFPA 5DLGA 4QWAA 4JV2A 4EZ9A 1U45A 2FLLA 3H7IA 1RXWA 3PO4A 4F4KA 4MFAA 1JMSA 2MUTA 3RTVA 5KFOA 1ZQVA 4QZDA 2XGQA 4P2HA 1Z00B 4LZGA 3HPOA 1RYSA 2VANA 4Z6EA 2H5XA 5DGAA 1ZQNA 4R64A 4EEYA 1TVAA 4I2BA 4BDPA 2JEGA 3RBEA 8ICIA 4KLIA 1XSNA 3Q8KA 8ICEA 1WCNA 3QZ7A 1TV9A 3LDAA 5KFFA 1L5UA 2A1JA 1NOMA 3GFKB 2BQRA 1ZQSA 5J2EA 2JEFA 4DSJA 1RZTA 1KFSA 1T4GA 8ICMA 3JPPA 4IRKA 4O3SA 3K75D 5DBCA 4RPXA 9ICLA 4E0DA 1LB2B 1K1QA 1KFDA 1PZNA 5KFVA 3RAQA 2XGPA 2PFNA 2PI5A 3M9OB 8ICVA 3RAXA 4EBCA 2NRVA 5KT4A 3Q8MA 9ICIA 4YVZA 4YMOA 7ICHA 5KFWA 5KG4A 2C2EA 1S10A 4JK1A 1KLNA 5KFGA 3V6KA 4EYHB 4QZHA 2KFNA 4J9OA 4QZEA 2W9CA 1XSLA 4IQTA 5J2AA 4DQIA 4FS1A 7ICNA 5CJ7A 3IM1A 2FPLA 2KTQA 4J9LA 1HUOA 5J0XA 4NM2A 5CHGA 3PR5B 5KFTA 4I2FA 4IRDA 4YG2A 1SL2A 3TAQA 5KFNA 4O3OA 3NGDA 1NKBA 1X9SA 5J2HA 4B9SA 2JZBB 2Y1IA 9ICVA 2NRXA 5L9XA 4RNNA 4KLFA 4R66A 3BQ0A 2VA2A 2KZMA 2W9BA 4DS4A 4YD1A 1ZQEA 4QWBA 4BXOA 1JIHA 5IIJA 3TARA 5EWEA 2HHWA 2Y1JA 4UAYA 5HNKA 3EW9A 7ICKA 2IHMA 3UXPA 2FPMA 1ZQFA 9ICBA 5KT2A 5HHHA 2AGQA 2AGOA 2ZJ5A 3RH5A 1JN3A 3RR7A 5J2FA 4IR1A 4KTQA 3C1YA 3MR6A 4LZDA 5KT3A 5L1KA 2FMQA 4ELTA 4YR2A 4KLTA 4MEYA 2P66A 4R8UB 5DDYA 2PXIA 4F5NA 4RPZA 4RQ1A 4EBEA 1ZQCA 2JEJA 4KLJA 3OGUA 4F93B 8ICSA 4M9LA 2AJQA 4QWDA 4BGDA 2W8KA 4EZ6A 4DOAA 3KHLA 4M04A 3ZDBA 4BWJA 2BR0A 5J0SA 4RU9A 4DOCA 3JPQA 1JXLA 2XC9A 4J9SA 5HHIA 4IRCA 3UQ2A 4O3PA 1DOQA 5DBAA 3RH6A 2I9GA 3V7JA 5KFUA 1NK7A 4DFJA 5DQHA 3PNCA 4RNOA 1MQ3A 8ICZA 5J2BA 8ICLA 5DG7A 4QW9A 4DFMA 2ZTCA 3OHBA 4O5CA 3MGIA 1B43A 3C1ZA 3T5LA 1UA0A 4DEZA 1D9FA 1ZETA 5KG3A 7ICFA 3MBYA 4IR9A 4JWMA 1U49A 3OSNA 3N97B 4ECZA 9ICUA 4ECXA 4M0AA 2Q0ZX 4ECYA 5BOMA 3EYZA 2ASJA 3GV5B 3MGHA 4RUAA 4YQWA 1BGXT 4C8NA 4DL7A 1TKDA 3RB0A 4F4XA 5D4BA 3MDCA 3BDPA 4KLLA 4Q8FA 3MFHA 4UB5A 4DL6A 1T3NA 1HJPA 4Q45A 4GXIA 4ED2A 3PW7A 4FBUA 7ICEA 3V7LA 2V4RA 3PW0A 5KFPA 2HHTA 1NK5A 5HP4A 5KFBA 3NTUA 4QZIA 5EWFA 3JPSA 4J9KA 9ICFA 1BPEA 3QEBZ 3H40A 2ISOA 4KN4A 4R65A 4ELVA 4RT3A 4YR0A 4DS5A 4JWNA 2MAXA 1ZQUA 4DOBA 3PY8A 5CB1A 3K4GA 5HMLA 4M6WB 4JUZA 1U9LA 5DB9A 3TI0A 9ICAA 4B9NA 3GV7B 3HP6A 2FLNA 1BPDA 2BQ3A 4DLGA 5DB8A 5F9LA 2IBKA 8ICNA 4XUSA 4O3NA 4CCHA 5DBBA 2AGPA 4O3RA 2ASLA 1XU4A 2LYHA 4O0IA 4KITB 3JPNA 4Q8EA 1S97A 5IIIA 1S76D 4ED7A 4UQGA 1U47A 1K1SA 2MUTB 1ZQKA 4DWIA 3ZDAA 2B21A 1S9FA 1KSPA 1CEZA 8ICRA 3PX6A 2UVWA 3SYZA 4F5PA 1KEJA 3V6HA 4QZCA 4F92B 3PX4A 2BCQA 5KFZA 2FMSA 3RJIA 1A77A 2FPKA 2HHUA 7ICOA 4YP3A 5KFJA 3V7KA 4GLXA 2GWSA 3UXNA 4ED0A 3TFRA 4Q43A 2I1QA 3V6JA 4I2EA 4YXMA 3THVA 1ZQYA 1XSPA 1UA1A 1U4BA 4KLHA 3RB6A 5J2JA 1NKEA 4QWEA 4QZFA 3GIMA 1N48A 2ATLA 2ISPA 4ECRA 2VA8A 2HVIA 2V4QA 4M2YA 3SI8A 1KFTA 9ICMA 1Z00A 4NY8A 4O3QA 3MFIA 2PI4A 4EBDA 4NLGA 9ICQA 4C8OA 5CP2A 1SL0A 3GIKA 2IHNA 4I2HA 2PFQA 3ZD9A 2NRTA 4M47A 4KN7A 2KFZA 2F1IA 4ECVA 3H4DA 5F9NA 3C5FA 4PGQA 4I2JA 4M9HA 5KG5A 4HYKA 2AU0A 1ZQRA 3PV8A 3MR5A 2RDJA 4K4GA 2J6UA 9ICEA 7ICTA 1S0OA 4UBBA 8ICPA 1ZQXA 5EWGA 4FS2A 2BQUA 2BCVA 4DSEA 3Q8RB 5D46A 2BHNA 5C5JA 5KG7A 2XO7A 3RJKA 2P6UA 4ECSA 1TFRA 8ICQA 4NXZA 4UBCA 3TFSA 1C7YA 4UB4A 5J0TA 7ICUA 1BPBA 3PVXA 2C2DA 2XY5A 4O5KA 2DFLA 4YFKA 2FMPA 2ALZA 5DQIA 2DPIA 5BPCA 4Z6CA 3LK9A 2IA6A 3IHQB 4KLDA 2HHSA 1EXNA 3MR2A 1UT8A 3RB3A 2PFPA 2HHVA 4O5EA 1UT5A 3EZ5A 4KLUA 3C5GA 4I2AA 5J2GA 4KLGA 3M8SA 4JV1A 3OHAA 3GQCA 4ECWA 8ICFA 2BCRA 2HW3A 1TK8A 3TANA 4BXOB 1NK0A 3KHGA 3QE9Y 1JX4A 7ICRA 3B0XA 9ICGA 2R8IA 4ELUA 2OWOA 9ICRA 9ICHA 7ICSA 4KLOA 4I29A 7ICGA 3KHRA 3AUOA 3RH4A 4GC6A 4RQ3A 3H4BA 2FLPA 4PHAA 5HMMA 4TUPA 5DB6A 3MDAA 2JZBA 3ISDA 3MABA 2J6SA 4F3OA 5J0QA 9ICJA 5DG9A 4J9RA 4FBTA 1SKWA 5KFEA 3T5HA 3BQ1A 3RRHA 2DPJA 4F4ZA 1ZQAA 2BPFA 1NJYA 4TUQA 2V9WA 1HUZA 4XA5A 4QZ9A 4F50A 4X5VA 3AU6A 7ICVA 4MF2A 4NLNA 2R8JA 3E2EA 5L1IA 1ZQIA 5KG1A 4F5RA 5KTQA 2NRWA 3C21A 1L3TA 2ZUCA 7ICJA 7ICQA 4F91B 1NKCA 8ICXA 2BCSA 1QSLA 4YCXA 3SZ2A 1ZJNA 9ICCA 2W8LA 4GXKA 5KFLA 4PGXA 1LV5A 3B0YA 4YMMA 4DFKA 4M9JA 4RQ0A 4DQQA 4I28A 4YMNA 8ICTA 3RJJA 1U48A 4M9NA 2HHXA 4F4WA 4RQ6A 3N4MB 2C22A 2BCUA 1NK8A 4IQWA 4ED3A 3KHHA 1WCLA 4QW8A 1BPXA 3PMLA 2ZUDA 3UPQA 1QTMA 1X9WA 4RNMA 4R63A 1RXVA 2HHQA 4RQ8A 3V72A 4C8LA 1CUKA 2AQ0A 2NRZA 8ICGA 3G6XA 2ZUBA 4LVSA 7ICPA 2UVVA 5KG6A 1KRPA 3G6VA 2KZ3A 4Q44A 4DL3A 2W9AA 3RJHA 4DLEA 4I2GA 1RYRA 3PR4A 2BKEA 1V9PA 2WTFA 5CR0A 4UAZA 1NK4A 4DSKA 8ICKA 3RR8A 3ISBA 4DSIA 4RUCA 1ZQGA 4NLKA 4ECUA 2IMWP 3AU2A 5D49A 4PPXA 5TZVA 2C28A 2ZJAA 1ZQDA 4FO6A 4DSLA 1NJXA 1ZQJA 1ZQZA 4DQSA 1ZQTA 1XC9A 1SKRA 1ZQWA 4RQ5A 4ED6A 2P6RA 5KFHA 4DO9A 4J9PA 4YN4A 1N56A 4B9MA 4NM1A 3GIIA 3PW2A 4RQ7A 5J2DA 3HWTA 1QSYA 2R8HA 2HVHA 8ICHA 5KFXA 4DL4A 4B9LA 3HT3A 3M9NB 2J6TA 2XCPA 9ICNA 2F1HA 4ED8A 1ZQLA 8ICUA 4UB3A 1BVSA 5KFSA 5DKWA 4I2DA 2A1JB 4ECQA 1BPYA 5J2CA 4ZH4A 4KLEA 4QZGA 3EWAA 1S0MA 3C2KA 5KFKA 2AQ4A 1NJZA 7ICLA 4GC7A 5J0RA 1A76A 4IQVA 2R8KA 9ICXA 3OJSA 1IM4A 7ICIA 1JXEA 4QZAA 5IIKA 3QZ8A 4ECTA 3T3FA 3ISCA 3H8SA 5IILA 4B9TA 8ICYA 8ICOA 5KFQA 4QWCA 4F2RA 3C2MA 1NK9A 1ZQOA 1S77D 1X2IA 5KT5A 1COOA 1RPLA
chains in the Genus database with same CATH superfamily
4IC9A 2Y0SF 3UQ0A 3KTQA 1KBUA 4DL2A 4KLSA 4F4YA 1ZQMA 4YR3A 1HEKA 4TQRA 4G9BA 3HX0A 2KN7A 2A3VA 4O9MA 5DGBA 8ICWA 3RRGA 1XNSA 2F1JA 5IIOA 2OM6A 5AKXA 2VA3A 3PW4A 1D8YA 5GTHU 2W11A 2YN4A 2E8OA 5ALQA 1XWLA 3LWMA 3ZDCA 2K4HA 4P4MA 2R8GA 5EE1A 5TISU 2ESEA 2EAMA 5AM1A 2K4IA 4I2CA 5KT6A 5E79U 3L5KA 4K4IA 3BJYA 1A0PA 4FZNA 3JPOA 3TQ1A 2ASDA 2CPRA 1OUQA 1ZQPA 4KLQA 4BWMA 1H38A 4G3IA 5T14A 1KL9A 4DCCA 2QKQA 4DF8A 2ZJ8A 1QH9A 2JH7A 3RJFA 4RZRA 3HILA 3H8WA 5KNIA 9ICKA 1S8OA 1Y88A 2OHFA 5J0YA 5KT7A 2GO7A 1LKYB 5AI4A 2NO4A 4UB2A 4M6WA 5KFAA 4DSFA 4KMUA 4PL1A 3ETLA 5DLGA 4QWAA 4EZ9A 5GTIU 1U45A 2FLLA 3IN5A 2K89A 1JMSA 5JU5A 2XGQA 4P2HA 4LZGA 3HPOA 2YMPA 2KK0A 1ZQNA 2VANA 5DGAA 3HRDD 2DL0A 3NVWA 1WCNA 3QZ7A 3LDAA 1L5UA 1DK2A 2QLTA 5J2EA 1KFSA 1B0XA 8ICMA 3JPPA 3S6JA 4C7YA 1LB2B 1K1QA 1PZNA 2PI5A 3TADA 5KT4A 9ICIA 1JALA 7ICHA 2C2EA 4CF5A 3A0BU 5KFGA 3V6KA 4BJQA 2XVTA 2Q4TA 4IQTA 2D8CA 7ICNA 5ALLA 2KTQA 1PVRA 3WKDA 1HUOA 5CHGA 5KFTA 3TADC 3U26A 3KFUF 2E5SA 5ALPA 3NUQA 1NKBA 2VKQA 1X9SA 5J2HA 2MSNA 5AKZA 4KLFA 2VA2A 1JIHA 5ALVA 1MA7A 9ICBA 5HHHA 2PMZF 2AGQA 3RH5A 3RR7A 4IR1A 3D6JA 3C1YA 5KT3A 4KLTA 2OCEA 4MEYA 2PXIA 4RPZA 3WKEA 2HOQA 4BGDA 4BWJA 4IRCA 3UQ2A 5JTIA 4EENA 4NJ8A 5KFUA 3PNCA 4RNOA 3ICXA 8ICZA 5J2BA 5DG7A 1B43A 5AM4A 3T5LA 3WK8A 1OXJA 3CW2C 3MBYA 4JWMA 3KD3A 3OSNA 9ICUA 4M0AA 4DL7A 4RUAA 3M6KA 4KLLA 2JR5A 4UB5A 1T3NA 1HJPA 7ICEA 4FBUA 4CNQA 2W54A 1Q3VA 2EZYA 4J9KA 4QZIA 2IOHA 2ISOA 2Y9UA 4ELVA 4RT3A 4DS5A 2W7OA 5HMLA 9ICAA 3HP6A 1L7PA 2FLNA 3IG8A 2W3SA 4DLGA 5DB8A 1F5SA 5F9LA 4U6PA 4O3RA 2CRXA 4UAVA 3JPNA 2OYYA 4DWIA 3F2BA 8ICRA 2KVCA 2UVWA 4F5PA 3PX4A 4QZCA 1QQ5A 2FPKA 1SXDA 4FFDA 5KFJA 3TFRA 4C7ZA 4I2EA 3THVA 1XSPA 4QZFA 2ATLA 2Z7JA 2ISPA 2V4QA 4M2YA 1C20A 4UATA 1Z00A 4NLGA 5AM5A 4C8OA 5CP2A 2WF6A 2PFQA 3ZD9A 1V85A 1DXSA 3WK5A 4M9HA 5KG5A 5AK4A 9ICEA 3MR5A 3K1RB 2RDJA 4OJ5A 2FE9A 8ICPA 2I6XA 5EE9A 5KG7A 2P6UA 2KMDA 4NXZA 1FFUA 1GO3F 1BPBA 3PVXA 2C2DA 2DFLA 4YFKA 1FFVA 4NL9C 4Z6CA 2HHSA 2AH5A 1EXNA 2PFPA 3PZPA 4Y2XA 3C5GA 4JV1A 2ZIXA 8ICFA 1NK0A 3QE9Y 2R8IA 4ELUA 3PSPA 3RH4A 3H4BA 5HMMA 3MDAA 3ISDA 4F3OA 3SR6A 4J9RA 3H8MA 3T5HA 3NVYA 2V9WA 4X5VA 7ICVA 4NLNA 1T3QA 3SAHA 5L1IA 1IIPA 1ZQIA 3C21A 2WB1F 3C29A 4OCZA 1NKCA 5B66U 5KFLA 4PGXA 1LV5A 3K1ZA 4YMMA 4YMNA 2H3VA 3N4MB 1JRPA 2BCUA 4ACOA 4IQWA 3PMLA 2ZUDA 1RXVA 4R63A 1CUKA 2ZIVA 2EDUA 4EX6A 3G6XA 2UVVA 1KRPA 5HR6A 4DL3A 1V9PA 1L7OA 2FI1A 4UAZA 4DSKA 3ISBA 3AU2A 4GIBA 1J2MA 1F44A 2NV3A 1ZQDA 1XC9A 1ZQWA 4RQ5A 3MC1A 5KFHA 2FDRA 4J9PA 2BDUA 3GIIA 2G0AA 1QSYA 2R8HA 2O6KA 4DL4A 9ICNA 3F53A 2F1HA 5JRTA 4ECQA 1BPYA 4ZH4A 1S0MA 5J0RA 3MGVA 4IQVA 3N7RC 2HHTA 2P35A 3QZ8A 8ICYA 4B9TA 1SWVA 4F2RA 1ZQOA 1S77D 2FJ6A 1YT3A 1COOA 2ZIUA 4OD0A 3F2DA 4P4OA 1ZQQA 3SAFA 5L1JA 1S5LU 5KFIA 9ICSA 4P4PA 2C2RA 5AK5A 5EOZA 1DGSA 2M9NA 3RJEA 5BOLA 5ALDA 2K4PA 2KHVA 4Z6DA 2BGWA 3QUTA 4XQ8A 3SQIA 5DB7A 1XO1A 1ZXIA 2ZTEA 5J0OA 4QZBA 3Q8SB 4PGYA 3PW5A 4MFCA 1AROP 4PHEA 3SMVA 1FO4A 3EPGA 3Q8LA 5CEHA 1SGGA 2YX8A 3KZXA 1SL1A 4F8RA 1D8LA 5EE3A 1PK1A 4UAWA 2DWQA 2XY6A 3BQ7A 3Q8QB 5KFYA 1L3VA 8ICAA 3BQ2A 1S0NA 2KSOA 3ALRA 3FYHA 4EYIB 2F76X 3GILA 1KDHA 5IINA 1MQ2A 3OSPA 2R18A 1BPZA 4TUSA 1XS9D 3Q8PB 9ICPA 1MN8A 3UM9A 3LYSA 3RB4A 4QNLA 4F2SA 3RBDA 3EPIA 1TAMA 1NJWA 5G5GA 3QU7A 4I2IA 2M0NA 3F5AA 2W9MA 1T7PA 2UVUA 5AICA 4BX9C 3PSFA 5KG2A 1L3UA 2YMLA 1BNPA 1SZPA 1KKXA 2DUYA 3QXGA 5ALUA 3TACB 3ZI4A 3H7IA 3F5EA 3RTVA 2WB1C 1ZQVA 1Z00B 1RYSA 4Z6EA 2DKXA 2JHDA 8ICIA 3RBEA 4KLIA 1TE2A 2KJ8A 1O08A 1N5XA 4GFJA 1NOMA 2JEFA 1ZQSA 4DSJA 4U7CA 3K75D 5DBCA 4E0DA 1KFDA 5KFVA 2NRVA 3Q8MA 2E1FA 1SWWA 5KFWA 1S10A 5KAFU 1KLNA 4EYHB 4QZHA 4J9OA 2KEYA 1XSLA 2ZIXB 5J2AA 1AQ6A 5CJ7A 1P7DA 4J9LA 1J2NA 3PR5B 1SL2A 4O3OA 3NGDA 4B9SA 2YQEA 4RNNA 4R66A 2KZMA 1ZQEA 4AYBF 3BZKA 2IOFK 4UAYA 1QQ7A 2FPMA 1ZQFA 5KT2A 2HOIA 4KTQA 3MR6A 1PK3A 4YR2A 3NVVA 2KFZA 4F5NA 1X9XA 5DDYA 4EBEA 2JEJA 4QWDA 4P0QA 4M04A 2BR0A 5J0SA 2KJ5A 4UB6U 4DOCA 4J9SA 5HHIA 1LVHA 2LKYA 1NK7A 5DQHA 4EX7A 1MQ3A 2K60A 5EE0A 8ICLA 2WF5A 3DEEA 2ZTCA 3OHBA 3MGIA 2ZIVB 4DEZA 1ZETA 2HI0A 1N62A 5BOMA 3EYZA 2ASJA 3GV5B 1JUDA 1TKDA 1BGXT 4UARA 4C8NA 4DL6A 1Z19A 2EAPA 4ED2A 3PW7A 3V7LA 2V4RA 2JGAA 5HP4A 1NK5A 9ICFA 3JPSA 2JXJA 3QEBZ 3H40A 4R65A 1RYUA 4YR0A 3N7SC 3TI0A 5DB9A 4B9NA 1BPDA 2F3NA 3QU5A 3C28A 8ICNA 2AGPA 1V38A 5AI0A 4O0IA 1N5WA 5IIIA 1Q8KA 4ED7A 4OJLA 1U47A 2MUTB 1ZQKA 3ZDAA 1S9FA 2QB0A 3SYZA 2YTUA 5KFZA 3RJIA 3HJEA 2LHTA 2HHUA 4GLXA 5AKLA 3UXNA 2I1QA 3V6JA 2MA1A 1NNLA 1U4BA 3N7PD 2ZIUB 3RB6A 2LMRA 5J2JA 2HVIA 1X42A 1QCKA 4O3QA 3MFIA 4EBDA 3BS5B 4M47A 2EZZA 3UMGA 3M1YA 2AU0A 1ZQRA 1S0OA 4UBBA 3I28A 2BHNA 5C5JA 3RJKA 4US9A 4UBCA 4UB4A 2XY5A 2FMPA 2IA6A 5DQIA 2DPIA 5BPCA 2HHVA 4O5EA 1UT5A 4KLGA 4ECWA 2BCRA 1PK1B 2WAQF 3KHGA 4I29A 4KX3A 3AUOA 4GC6A 4RQNA 4RQ3A 2LM4A 4TUPA 2JZBA 3MABA 1VLBA 3IRUA 2KSOB 2DGZA 1ZD2P 2Y0SC 3EUB2 2BPFA 5A0LA 4F50A 1NZBA 5ALNA 1O03A 3GU3A 2R8JA 2JV3A 1PVQA 5KG1A 7ICJA 8ICXA 1QSLA 4YCXA 3SZ2A 2K8CB 5ALWA 3F2CA 3QX7A 1WG8A 4M9JA 4NLBA 2F8LA 8ICTA 4Y2SA 1U48A 2HHXA 5ALOA 2DQNB 4F4WA 4RQ6A 8ICGA 4C8LA 2NRZA 2ZUBA 4LVSA 5KG6A 3G6VA 2OH2A 3BS7A 4Y2TA 4DLEA 4I2GA 3M7DA 2BKEA 2ZIWA 1NK4A 8ICKA 3RR8A 3IP4B 4DSIA 4ECUA 5D49A 3QUQA 4UW9A 1ZQZA 4DQSA 1SV4A 4ED6A 4YN4A 1N56A 4NM1A 3PW2A 3HWTA 4UAUA 2GH1A 1M6YA 3HT3A 4BUGA 2HSZA 4OO1J 8ICUA 5KFSA 4I2DA 1RDFA 4KLEA 3EWAA 3ETRA 1NJZA 1A76A 2H3QA 2R8KA 1IM4A 4QZAA 5IIKA 3QYPA 5KFQA 2H3ZA 3C2MA 4MHVA 7ICMA 4YD2A 4TQSA 5J29A 4J9NA 3I76A 3ZDDA 2HCFA 3ZD8A 1D9DA 1QSSA 5J8YA 2RP5A 1L6NA 4C8MA 3NASA 1YZ7A 3H8JA 5KG0A 4PHPA 5CWRA 2XY7A 3LWLA 3SV4A 4UB1A 1IXRA 5DQGA 3AQEA 4O3MA 2I5HA 4RQ4A 5AK3A 5J8YC 5KFRA 1N63A 4IS7A 3UXOA 1SKSA 4KLMA 4RT2A 2CXYA 3CRXA 4ED1A 2E8MA 5KFDA 4P0QB 3M8RA 4IL6U 4WJ3B 5CA7A 3QU9A 3PX0A 3FDSA 4A8EA 2ZTDA 1A6SA 4RPYA 2RDIA 1TAQA 4J9MA 4DL5A 1PVPA 2W43A 4Y2UA 3GV8B 1ZQBA 3A0HU 4GXJA 4RQ2A 3AMZA 4LJXA 3PO5A 5J0WA 9ICOA 4MFFA 3GDXA 2AHOB 1X66A 3PMNA 1DGJA 1WUDA 4B6JA 4DQRA 2E1EA 4J9QA 1MSWD 4OJPA 5B5EU 2HDOA 2BPCA 5KFMA 3JPRA 4C4TA 1B22A 3AN1A 1NK6A 2KICA 1MC8A 2RRDA 1TK0A 2KV2A 4Z6FA 4CE6A 5J0PA 1ZQHA 4PHDA 5DDMA 2PMZC 1S0VA 5J2KA 2LM1A 2PFOA 1DK3A 5KL1B 3ZDEA 4TURA 2HBJA 4C4SA 3BZCA 2WF9A 3SV3A 4Y2PA 3T5KA 2KNJA 2JRZA 2QB0B 1ZOLA 2UVRA 4B9VA 1KW4A 3E0FA 3H0RB 2W7PA 4HAIA 1ECWA 2HBLA 1X40A 4Y2JA 4MFAA 2MUTA 4EEKA 5KFOA 4OJ6A 4QZDA 2HOFA 2EANA 4R64A 4EEYA 1HIWA 3UMCA 1BNOA 1TVAA 4I2BA 2JEGA 3Q8KA 8ICEA 3B9JA 5AK6A 1WWUA 2A1JA 3QU4A 2F44A 1RZTA 3OPXA 4IRKA 4O3SA 3VCBA 1JI7A 9ICLA 2HBMA 3BS5A 3RAQA 3M9OB 3RAXA 4YVZA 1SV0A 4KX5A 5H2FU 1ZRNA 2W9CA 4DQIA 4PL2A 3IV6A 2FPLA 2G07A 1ZD5A 5J0XA 4I2FA 4IRDA 4YG2A 5KL8B 5KFNA 2JZBB 2Y1IA 9ICVA 2NRXA 2W9BA 4DS4A 4YD1A 4QWBA 1ZQ1C 7ICKA 5AI6A 2IHMA 3UXPA 2AGOA 1JN3A 5J2FA 4NWIA 4ELTA 2P66A 4R8UB 1ZQCA 2E3TA 3OGUA 4F93B 1N61A 2D3DA 1FEZA 2G06A 4DOAA 5AI5A 3JPQA 4C80A 4UASA 2KKVA 3DDHA 5DBAA 1Z1BA 3RH6A 3VC8A 2B6GA 3V7JA 3ONNA 4DFJA 2KD1A 5ALYA 1RM6C 2F77X 1JROA 2H3FA 2F2AB 1Z1VA 5KG3A 7ICFA 4IR9A 1U49A 3N97B 4CF3A 1Q3UA 4ECXA 3L4PA 3D2QA 3RB0A 4Q8FA 2ZIWB 4GXIA 2WF8A 5KFPA 3O0FA 5KFBA 2NYVA 2KIVA 4KN4A 2VJ4A 1ZD3A 4JWNA 1ZQUA 4DOBA 3KBBA 1ED1A 4Y2QA 4DFDA 3H0LB 1DRGA 5C0YA 5AKKA 2IBKA 4PJ0U 4O3NA 1XU4A 2LYHA 1S97A 1S76D 4UQGA 1K1SA 2OXOA 1CEZA 2B21A 1KSPA 3PX6A 4NLZA 4Y2RA 3V6HA 2BCQA 4F92B 5AKEA 3V7KA 2GWSA 3OTQA 4ED0A 4Q43A 4QIWF 1ZD4A 4YXMA 1V97A 1ZQYA 4KLHA 2RLTA 4EELA 4ECRA 1D8BA 2YB1A 4NY8A 2PI4A 2N1RA 4J03A 4C4RA 1WWVA 2QARA 2NRTA 4KN7A 4FE3A 3H4DA 5F9NA 3SENA 4PGQA 4HYKA 2D6FC 1N2XA 3WKAA 2BQUA 4QJFB 5D46A 5ALFA 2XO7A 2H3IA 1TFRA 4ECSA 3TFSA 2JH1A 2EQYA 2ZXIA 2ALZA 4KLDA 3LK9A 3MR2A 1UT8A 3EZ5A 2DBYA 4KLUA 2K4EA 1YZ6A 4I2AA 2ZXHA 5J2GA 3RF9A 2IOFA 3GQCA 4P0PA 2F8KA 3TANA 4BXOB 4US8A 7ICRA 9ICGA 1UQVA 9ICRA 1B4FA 7ICGA 4AP9A 2YB4A 5ALKA 5DB6A 2DKZA 2J6SA 3WK9A 3LVVA 2VJ5A 5DG9A 2L5YA 1SKWA 5KFEA 3BQ1A 1SB3C 1URJA 4F4ZA 1ZQAA 3AEVA 2LYAA 1XO0A 4QZ9A 2NRWA 5KTQA 2ZUCA 7ICQA 4GXKA 1CI4A 3B0YA 4Y2YA 3RJJA 4M9NA 2HMXA 2CN1A 1NK8A 4ED3A 4QW8A 1BPXA 1QTMA 4USAA 1OW5A 2KG5A 4RNMA 2HHQA 7ICPA 1Z4NA 3AM9A 1RQLA 3D2NA 2W9AA 3PR4A 4UB8U 5CR0A 4RUCA 1ZQGA 4NLKA 1VDVA 2IMWP 4PPXA 5TZVA 4DSLA 2G5IB 4FO6A 1NJXA 3WKCA 1ZQTA 1SKRA 2WFAA 4DO9A 2W03A 5ALMA 4RQ7A 5J2DA 8ICHA 4B9LA 1UHUA 3M9NB 5AM3A 1ZQLA 4UB3A 2YY6A 1BVSA 2A1JB 4QZGA 3C2KA 7ICLA 2AQ4A 4GC7A 3OJSA 1FIQA 3T3FA 5IILA 5ALJA 2GLEA 3H8SA 4RQMA 3E58A 3IDWA 5KT5A 1RPLA 3C2LA 2A19A 3UMBA 2W9CB 3JPTA 2KZZA 2KOBA 5ALSA 5KFCA 2K8BB 2XCAA 3KKAA 4XRHA 8ICBA 8ICJA 4NV0A 1PUZA 4MEXA 4I27A 3GIJA 3HKZF 4B9UA 4JV0A 2E8PA 1X9MA 3MR3A 4K4HA 8ICCA 2EH9A 4F5QA 5IIMA 2W9BB 3BQTA 3T5JA 3GZFA 3KKAC 4C8KA 1L3SA 3OJUA 2KHQA 1QQ6A 1L8OA 1SIJA 4F5OA 1TK5A 2A1AA 3G6YA 4FZLA 4PH5A 4DQPA 2YMMA 1TAUA 4QIWC 3NS1A 1COKA 4ICAA 3ORYA 1KTQA 4M9GA 5DLFA 2XI9A 3RJGA 4F71A 3WK4A 5FP0A 1KN5A 1NI3A 4R8UA 5J0UA 4JB3A 4NLCA 2JMGA 3M9MB 3SEIA 4PZNA 1J97A 5L1MA 1ZYQA 5ALIA 5JUMA 2BDPA 1SZHA 3QEAZ 1QLNA 4IQUA 3R9KA 3C23A 2JEIA 4QZ8A 4DF4A 5L1LA 5J2IA 3TAPA 4AYBC 5DG8A 2BZFA 3PSIA 3HW8A 1T8EA 4YXJA 2PKEA 5AI8A 9ICTA 5F3XB 2MRLA 4MF8A 9ICWA 2LYBA 2W04A 1ZJMA 1RQNA 1Z3EB 2BPGA 2WF7A 4FZMA 3WK6A 4DFPA 4OJOA 4JV2A 5AKGA 1RXWA 3PO4A 4F4KA 1WYGA 2H5XA 3NRWA 2NO5A 2QARB 4BDPA 1N60A 1XSNA 2KJ9A 1TV9A 5KFFA 3GFKB 2BQRA 3J81j 1NZPA 1T4GA 2RQ5A 2YMQA 4RPXA 3CYMA 4JMUA 2RHFA 2XGPA 2PFNA 8ICVA 4EBCA 4CRXA 2HBKA 4YMOA 5AKJA 5KG4A 1ZRMA 3TKAA 4JK1A 4NL9A 2ES6A 3WU2U 2KFNA 4QZEA 2ZG6A 3CNHA 4FS1A 4P0PB 2OEHA 3IM1A 4NM2A 2QB1A 4ZOHC 3TAQA 3PSTA 4CF4A 5L9XA 1X6JA 3BQ0A 4BXOA 5IIJA 3TARA 4CDGA 5EWEA 2Y1JA 2HHWA 5HNKA 3EW9A 5ALHA 5AIBA 2ZJ5A 2DF4B 5L1KA 4LZDA 2FMQA 5ALRA 3QU2A 4RQ1A 4KLJA 3H0MB 8ICSA 4M9LA 2AJQA 2W8KA 4EZ6A 3KHLA 3ZDBA 2XIDA 1JXLA 4RU9A 2XC9A 2G08A 4O3PA 1DOQA 2I9GA 2G5HB 2LI6A 4QW9A 4DFMA 3SAGA 2Y9TA 4O5CA 3C1ZA 3HKZC 1UA0A 1D9FA 3QUCA 5ALZA 4ECZA 2Q0ZX 4ECYA 3MGHA 4YQWA 4F4XA 2WAQC 3MDCA 5D4BA 3BDPA 2KVSA 3MFHA 3RFAA 4Q45A 3CP8A 1L8LA 3PW0A 5AIAA 3I1YA 3QUBA 3NTUA 5EWFA 1BPEA 2LPEA 3AL0B 3KOOA 2MAXA 3PY8A 5CB1A 1L7MA 3K4GA 4M6WB 4JUZA 1U9LA 1Q46A 2K8AA 3GV7B 1L7NA 5ALTA 2E8NA 2BQ3A 4XUSA 4CCHA 5DBBA 3FC4A 2ASLA 3NRZA 5AI9A 4KITB 2AXTU 4Q8EA 4C0ZA 1LKYA 1IV8A 5CRXA 3FAHA 2FMSA 1KEJA 2KP7A 1A77A 1F0MA 7ICOA 4YP3A 1KQQA 4CGZA 1UA1A 1NKEA 4QWEA 3GIMA 1N48A 3LVWA 2VA8A 1KFTA 3ED5A 3SI8A 9ICMA 5AKYA 4KMOB 9ICQA 1SL0A 3GIKA 2IHNA 4I2HA 2F1IA 4ECVA 3DV9A 2LBOA 4F72A 3C5FA 3SD7A 4I2JA 4K4GA 3PV8A 3N28A 2J6UA 7ICTA 3AQFA 1ZQXA 5EWGA 1SXEA 4FS2A 2BCVA 4DSEA 3Q8RB 3NVZA 8ICQA 3M6ZA 1C7YA 5J0TA 7ICUA 2KE7A 4O5KA 1SV0C 3IHQB 2XICA 3RB3A 5ALEA 3M8SA 3OHAA 2HW3A 1TK8A 1JX4A 3B0XA 2OWOA 7ICSA 9ICHA 4KLOA 1CRXA 3KHRA 2VIXA 2FLPA 4PHAA 2B0CA 2ODGA 3QNMA 5J0QA 9ICJA 4FBTA 3RRHA 2DPJA 2WHEA 1NJYA 4TUQA 1HUZA 3IG5A 4XA5A 3AU6A 5ALGA 4MF2A 5KAIU 5AKHA 3E2EA 4F5RA 1L3TA 4F91B 2BCSA 1VJ5A 1T94A 1IG6A 1ZJNA 9ICCA 2W8LA 2G09A 1UPHA 3KZIU 4DFKA 4RQ0A 4DQQA 4I28A 5K4LA 5AHXA 2C22A 5AM0A 3KHHA 2EZXA 1WCLA 3UPQA 1X6IA 1X9WA 1Z4OA 4RQ8A 3V72A 5AKIA 2AQ0A 3WKBA 2KZ3A 5ALXA 4Q44A 4PZOA 2W3RA 3FM9A 3RJHA 1RYRA 2EAOA 2W55A 2WTFA 2KKPA 3L3FX 3T79A 2C28A 5G5HA 2ZJAA 1ZQJA 1K5OA 2P6RA 4B9MA 2HVHA 5KFXA 2GOLA 2J6TA 5HR7A 2XCPA 3WK7A 1UCVA 4ED8A 1RG6A 5DKWA 5J2CA 2KIWA 5KFKA 2MU2A 9ICXA 7ICIA 1JXEA 4ECTA 5AM2A 3ISCA 4Y2VA 8ICOA 4QWCA 1NK9A 3D2SA 1X2IA
chains in the Genus database with same CATH topology
3C2LA 7ICMA 4YD2A 4P4OA 3UQ0A 4TQSA 4DL2A 3KTQA 4KLSA 5J29A 1ZQQA 4F4YA 2W9CB 1ZQMA 4YR3A 3JPTA 5L1JA 4J9NA 2KZZA 5KFIA 5KFCA 4TQRA 3ZDDA 2XCAA 2KN7A 3HX0A 9ICSA 4XRHA 4P4PA 3ZD8A 1D9DA 2C2RA 1QSSA 8ICBA 5EOZA 8ICJA 4NLZA 4C8MA 4O9MA 5DGBA 1DGSA 2M9NA 4MEXA 3RJEA 4I27A 8ICWA 3RRGA 5BOLA 3GIJA 4B9UA 4JV0A 2F1JA 5IIOA 1X9MA 3H8JA 3MR3A 5KG0A 4K4HA 4PHPA 5CWRA 8ICCA 2XY7A 2VA3A 4Z6DA 3LWLA 4F5QA 4XQ8A 5IIMA 3SV4A 2BGWA 5DB7A 4UB1A 1XO1A 1IXRA 2ZTEA 3BQTA 5J0OA 4QZBA 2W9BB 3PW4A 3Q8SB 1D8YA 4PGYA 5DQGA 3T5JA 3PW5A 4RQ4A 4C8KA 1L3SA 3OJUA 4MFCA 1AROP 5KFRA 4PHEA 3UXOA 1XWLA 1SKSA 4KLMA 3EPGA 3Q8LA 3LWMA 3ZDCA 4F5OA 4RT2A 1TK5A 3G6YA 4PH5A 4ED1A 4P4MA 4DQPA 1SL1A 4F8RA 5KFDA 1TAUA 2R8GA 1D8LA 3M8RA 4UAWA 3ORYA 1KTQA 4M9GA 5CA7A 2XY6A 3PX0A 4I2CA 5DLFA 3FDSA 3RJGA 3Q8QB 2ZTDA 5KFYA 5KT6A 1L3VA 8ICAA 4RPYA 4R8UA 2RDIA 5J0UA 4K4IA 3BQ2A 3BJYA 1TAQA 4J9MA 4DL5A 1S0NA 3M9MB 3FYHA 4EYIB 3GV8B 1ZQBA 4GXJA 4RQ2A 3JPOA 3TQ1A 2ASDA 3GILA 9ICOA 3PO5A 5J0WA 1ZYQA 1KDHA 5JUMA 4MFFA 1ZQPA 3GDXA 4KLQA 4BWMA 2BDPA 1H38A 3QEAZ 5IINA 1QLNA 4G3IA 3PMNA 4IQUA 3C23A 2JEIA 4QZ8A 4DF8A 1MQ2A 2ZJ8A 3OSPA 4DQRA 4J9QA 1MSWD 1BPZA 4TUSA 2BPCA 1XS9D 4DF4A 3RJFA 3Q8PB 4RZRA 5KFMA 9ICPA 3JPRA 5L1LA 5J2IA 3TAPA 1B22A 3RB4A 1NK6A 5DG8A 1MC8A 3H8WA 4F2SA 3RBDA 3EPIA 9ICKA 1TK0A 3HW8A 4Z6FA 1Y88A 5J0PA 1T8EA 4PHDA 5DDMA 1ZQHA 1S0VA 4YXJA 5J2KA 5J0YA 1NJWA 2PFOA 9ICTA 5KT7A 3ZDEA 4TURA 4I2IA 3SV3A 4UB2A 4MF8A 9ICWA 4M6WA 5KFAA 3T5KA 2W9MA 1T7PA 2UVUA 2UVRA 4DSFA 1ZJMA 4KMUA 4B9VA 5KG2A 1Z3EB 1L3UA 2BPGA 1SZPA 3ETLA 4DFPA 5DLGA 4QWAA 4JV2A 4EZ9A 1U45A 2FLLA 3H7IA 1RXWA 3PO4A 4F4KA 4MFAA 1JMSA 2MUTA 3RTVA 5KFOA 1ZQVA 4QZDA 2XGQA 4P2HA 1Z00B 4LZGA 3HPOA 1RYSA 2VANA 4Z6EA 2H5XA 5DGAA 1ZQNA 4R64A 4EEYA 1TVAA 4I2BA 4BDPA 2JEGA 3RBEA 8ICIA 4KLIA 1XSNA 3Q8KA 8ICEA 1WCNA 3QZ7A 1TV9A 3LDAA 5KFFA 1L5UA 2A1JA 1NOMA 3GFKB 2BQRA 1ZQSA 5J2EA 2JEFA 4DSJA 1RZTA 1KFSA 1T4GA 8ICMA 3JPPA 4IRKA 4O3SA 3K75D 5DBCA 4RPXA 9ICLA 4E0DA 1LB2B 1K1QA 1KFDA 1PZNA 5KFVA 3RAQA 2XGPA 2PFNA 2PI5A 3M9OB 8ICVA 3RAXA 4EBCA 2NRVA 5KT4A 3Q8MA 9ICIA 4YVZA 4YMOA 7ICHA 5KFWA 5KG4A 2C2EA 1S10A 4JK1A 1KLNA 5KFGA 3V6KA 4EYHB 4QZHA 2KFNA 4J9OA 4QZEA 2W9CA 1XSLA 4IQTA 5J2AA 4DQIA 4FS1A 7ICNA 5CJ7A 3IM1A 2FPLA 2KTQA 4J9LA 1HUOA 5J0XA 4NM2A 5CHGA 3PR5B 5KFTA 4I2FA 4IRDA 4YG2A 1SL2A 3TAQA 5KFNA 4O3OA 3NGDA 1NKBA 1X9SA 5J2HA 4B9SA 2JZBB 2Y1IA 9ICVA 2NRXA 5L9XA 4RNNA 4KLFA 4R66A 3BQ0A 2VA2A 2KZMA 2W9BA 4DS4A 4YD1A 1ZQEA 4QWBA 4BXOA 1JIHA 5IIJA 3TARA 5EWEA 2HHWA 2Y1JA 4UAYA 5HNKA 3EW9A 7ICKA 2IHMA 3UXPA 2FPMA 1ZQFA 9ICBA 5KT2A 5HHHA 2AGQA 2AGOA 2ZJ5A 3RH5A 1JN3A 3RR7A 5J2FA 4IR1A 4KTQA 3C1YA 3MR6A 4LZDA 5KT3A 5L1KA 2FMQA 4ELTA 4YR2A 4KLTA 4MEYA 2P66A 4R8UB 5DDYA 2PXIA 4F5NA 4RPZA 4RQ1A 4EBEA 1ZQCA 2JEJA 4KLJA 3OGUA 4F93B 8ICSA 4M9LA 2AJQA 4QWDA 4BGDA 2W8KA 4EZ6A 4DOAA 3KHLA 4M04A 3ZDBA 4BWJA 2BR0A 5J0SA 4RU9A 4DOCA 3JPQA 1JXLA 2XC9A 4J9SA 5HHIA 4IRCA 3UQ2A 4O3PA 1DOQA 5DBAA 3RH6A 2I9GA 3V7JA 5KFUA 1NK7A 4DFJA 5DQHA 3PNCA 4RNOA 1MQ3A 8ICZA 5J2BA 8ICLA 5DG7A 4QW9A 4DFMA 2ZTCA 3OHBA 4O5CA 3MGIA 1B43A 3C1ZA 3T5LA 1UA0A 4DEZA 1D9FA 1ZETA 5KG3A 7ICFA 3MBYA 4IR9A 4JWMA 1U49A 3OSNA 3N97B 4ECZA 9ICUA 4ECXA 4M0AA 2Q0ZX 4ECYA 5BOMA 3EYZA 2ASJA 3GV5B 3MGHA 4RUAA 4YQWA 1BGXT 4C8NA 4DL7A 1TKDA 3RB0A 4F4XA 5D4BA 3MDCA 3BDPA 4KLLA 4Q8FA 3MFHA 4UB5A 4DL6A 1T3NA 1HJPA 4Q45A 4GXIA 4ED2A 3PW7A 4FBUA 7ICEA 3V7LA 2V4RA 3PW0A 5KFPA 2HHTA 1NK5A 5HP4A 5KFBA 3NTUA 4QZIA 5EWFA 3JPSA 4J9KA 9ICFA 1BPEA 3QEBZ 3H40A 2ISOA 4KN4A 4R65A 4ELVA 4RT3A 4YR0A 4DS5A 4JWNA 2MAXA 1ZQUA 4DOBA 3PY8A 5CB1A 3K4GA 5HMLA 4M6WB 4JUZA 1U9LA 5DB9A 3TI0A 9ICAA 4B9NA 3GV7B 3HP6A 2FLNA 1BPDA 2BQ3A 4DLGA 5DB8A 5F9LA 2IBKA 8ICNA 4XUSA 4O3NA 4CCHA 5DBBA 2AGPA 4O3RA 2ASLA 1XU4A 2LYHA 4O0IA 4KITB 3JPNA 4Q8EA 1S97A 5IIIA 1S76D 4ED7A 4UQGA 1U47A 1K1SA 2MUTB 1ZQKA 4DWIA 3ZDAA 2B21A 1S9FA 1KSPA 1CEZA 8ICRA 3PX6A 2UVWA 3SYZA 4F5PA 1KEJA 3V6HA 4QZCA 4F92B 3PX4A 2BCQA 5KFZA 2FMSA 3RJIA 1A77A 2FPKA 2HHUA 7ICOA 4YP3A 5KFJA 3V7KA 4GLXA 2GWSA 3UXNA 4ED0A 3TFRA 4Q43A 2I1QA 3V6JA 4I2EA 4YXMA 3THVA 1ZQYA 1XSPA 1UA1A 1U4BA 4KLHA 3RB6A 5J2JA 1NKEA 4QWEA 4QZFA 3GIMA 1N48A 2ATLA 2ISPA 4ECRA 2VA8A 2HVIA 2V4QA 4M2YA 3SI8A 1KFTA 9ICMA 1Z00A 4NY8A 4O3QA 3MFIA 2PI4A 4EBDA 4NLGA 9ICQA 4C8OA 5CP2A 1SL0A 3GIKA 2IHNA 4I2HA 2PFQA 3ZD9A 2NRTA 4M47A 4KN7A 2KFZA 2F1IA 4ECVA 3H4DA 5F9NA 3C5FA 4PGQA 4I2JA 4M9HA 5KG5A 4HYKA 2AU0A 1ZQRA 3PV8A 3MR5A 2RDJA 4K4GA 2J6UA 9ICEA 7ICTA 1S0OA 4UBBA 8ICPA 1ZQXA 5EWGA 4FS2A 2BQUA 2BCVA 4DSEA 3Q8RB 5D46A 2BHNA 5C5JA 5KG7A 2XO7A 3RJKA 2P6UA 4ECSA 1TFRA 8ICQA 4NXZA 4UBCA 3TFSA 1C7YA 4UB4A 5J0TA 7ICUA 1BPBA 3PVXA 2C2DA 2XY5A 4O5KA 2DFLA 4YFKA 2FMPA 2ALZA 5DQIA 2DPIA 5BPCA 4Z6CA 3LK9A 2IA6A 3IHQB 4KLDA 2HHSA 1EXNA 3MR2A 1UT8A 3RB3A 2PFPA 2HHVA 4O5EA 1UT5A 3EZ5A 4KLUA 3C5GA 4I2AA 5J2GA 4KLGA 3M8SA 4JV1A 3OHAA 3GQCA 4ECWA 8ICFA 2BCRA 2HW3A 1TK8A 3TANA 4BXOB 1NK0A 3KHGA 3QE9Y 1JX4A 7ICRA 3B0XA 9ICGA 2R8IA 4ELUA 2OWOA 9ICRA 9ICHA 7ICSA 4KLOA 4I29A 7ICGA 3KHRA 3AUOA 3RH4A 4GC6A 4RQ3A 3H4BA 2FLPA 4PHAA 5HMMA 4TUPA 5DB6A 3MDAA 2JZBA 3ISDA 3MABA 2J6SA 4F3OA 5J0QA 9ICJA 5DG9A 4J9RA 4FBTA 1SKWA 5KFEA 3T5HA 3BQ1A 3RRHA 2DPJA 4F4ZA 1ZQAA 2BPFA 1NJYA 4TUQA 2V9WA 1HUZA 4XA5A 4QZ9A 4F50A 4X5VA 3AU6A 7ICVA 4MF2A 4NLNA 2R8JA 3E2EA 5L1IA 1ZQIA 5KG1A 4F5RA 5KTQA 2NRWA 3C21A 1L3TA 2ZUCA 7ICJA 7ICQA 4F91B 1NKCA 8ICXA 2BCSA 1QSLA 4YCXA 3SZ2A 1ZJNA 9ICCA 2W8LA 4GXKA 5KFLA 4PGXA 1LV5A 3B0YA 4YMMA 4DFKA 4M9JA 4RQ0A 4DQQA 4I28A 4YMNA 8ICTA 3RJJA 1U48A 4M9NA 2HHXA 4F4WA 4RQ6A 3N4MB 2C22A 2BCUA 1NK8A 4IQWA 4ED3A 3KHHA 1WCLA 4QW8A 1BPXA 3PMLA 2ZUDA 3UPQA 1QTMA 1X9WA 4RNMA 4R63A 1RXVA 2HHQA 4RQ8A 3V72A 4C8LA 1CUKA 2AQ0A 2NRZA 8ICGA 3G6XA 2ZUBA 4LVSA 7ICPA 2UVVA 5KG6A 1KRPA 3G6VA 2KZ3A 4Q44A 4DL3A 2W9AA 3RJHA 4DLEA 4I2GA 1RYRA 3PR4A 2BKEA 1V9PA 2WTFA 5CR0A 4UAZA 1NK4A 4DSKA 8ICKA 3RR8A 3ISBA 4DSIA 4RUCA 1ZQGA 4NLKA 4ECUA 2IMWP 3AU2A 5D49A 4PPXA 5TZVA 2C28A 2ZJAA 1ZQDA 4FO6A 4DSLA 1NJXA 1ZQJA 1ZQZA 4DQSA 1ZQTA 1XC9A 1SKRA 1ZQWA 4RQ5A 4ED6A 2P6RA 5KFHA 4DO9A 4J9PA 4YN4A 1N56A 4B9MA 4NM1A 3GIIA 3PW2A 4RQ7A 5J2DA 3HWTA 1QSYA 2R8HA 2HVHA 8ICHA 5KFXA 4DL4A 4B9LA 3HT3A 3M9NB 2J6TA 2XCPA 9ICNA 2F1HA 4ED8A 1ZQLA 8ICUA 4UB3A 1BVSA 5KFSA 5DKWA 4I2DA 2A1JB 4ECQA 1BPYA 5J2CA 4ZH4A 4KLEA 4QZGA 3EWAA 1S0MA 3C2KA 5KFKA 2AQ4A 1NJZA 7ICLA 4GC7A 5J0RA 1A76A 4IQVA 2R8KA 9ICXA 3OJSA 1IM4A 7ICIA 1JXEA 4QZAA 5IIKA 3QZ8A 4ECTA 3T3FA 3ISCA 3H8SA 5IILA 4B9TA 8ICYA 8ICOA 5KFQA 4QWCA 4F2RA 3C2MA 1NK9A 1ZQOA 1S77D 1X2IA 5KT5A 1COOA 1RPLA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3C2L A;  7ICM A;  4YD2 A;  4P4O A;  3UQ0 A;  4TQS A;  4DL2 A;  3KTQ A;  4KLS A;  5J29 A;  1ZQQ A;  4F4Y A;  2W9C B;  1ZQM A;  4YR3 A;  3JPT A;  5L1J A;  4J9N A;  2KZZ A;  5KFI A;  5KFC A;  4TQR A;  3ZDD A;  2XCA A;  2KN7 A;  3HX0 A;  9ICS A;  4XRH A;  4P4P A;  3ZD8 A;  1D9D A;  2C2R A;  1QSS A;  8ICB A;  5EOZ A;  8ICJ A;  4NLZ A;  4C8M A;  4O9M A;  5DGB A;  1DGS A;  2M9N A;  4MEX A;  3RJE A;  4I27 A;  8ICW A;  3RRG A;  5BOL A;  3GIJ A;  4B9U A;  4JV0 A;  2F1J A;  5IIO A;  1X9M A;  3H8J A;  3MR3 A;  5KG0 A;  4K4H A;  4PHP A;  5CWR A;  8ICC A;  2XY7 A;  2VA3 A;  4Z6D A;  3LWL A;  4F5Q A;  4XQ8 A;  5IIM A;  3SV4 A;  2BGW A;  5DB7 A;  4UB1 A;  1XO1 A;  1IXR A;  2ZTE A;  3BQT A;  5J0O A;  4QZB A;  2W9B B;  3PW4 A;  3Q8S B;  1D8Y A;  4PGY A;  5DQG A;  3T5J A;  3PW5 A;  4RQ4 A;  4C8K A;  1L3S A;  3OJU A;  4MFC A;  1ARO P;  5KFR A;  4PHE A;  3UXO A;  1XWL A;  1SKS A;  4KLM A;  3EPG A;  3Q8L A;  3LWM A;  3ZDC A;  4F5O A;  4RT2 A;  1TK5 A;  3G6Y A;  4PH5 A;  4ED1 A;  4P4M A;  4DQP A;  1SL1 A;  4F8R A;  5KFD A;  1TAU A;  2R8G A;  1D8L A;  3M8R A;  4UAW A;  3ORY A;  1KTQ A;  4M9G A;  5CA7 A;  2XY6 A;  3PX0 A;  4I2C A;  5DLF A;  3FDS A;  3RJG A;  3Q8Q B;  2ZTD A;  5KFY A;  5KT6 A;  1L3V A;  8ICA A;  4RPY A;  4R8U A;  2RDI A;  5J0U A;  4K4I A;  3BQ2 A;  3BJY A;  1TAQ A;  4J9M A;  4DL5 A;  1S0N A;  3M9M B;  3FYH A;  4EYI B;  3GV8 B;  1ZQB A;  4GXJ A;  4RQ2 A;  3JPO A;  3TQ1 A;  2ASD A;  3GIL A;  9ICO A;  3PO5 A;  5J0W A;  1ZYQ A;  1KDH A;  5JUM A;  4MFF A;  1ZQP A;  3GDX A;  4KLQ A;  4BWM A;  2BDP A;  1H38 A;  3QEA Z;  5IIN A;  1QLN A;  4G3I A;  3PMN A;  4IQU A;  3C23 A;  2JEI A;  4QZ8 A;  4DF8 A;  1MQ2 A;  2ZJ8 A;  3OSP A;  4DQR A;  4J9Q A;  1MSW D;  1BPZ A;  4TUS A;  2BPC A;  1XS9 D;  4DF4 A;  3RJF A;  3Q8P B;  4RZR A;  5KFM A;  9ICP A;  3JPR A;  5L1L A;  5J2I A;  3TAP A;  1B22 A;  3RB4 A;  1NK6 A;  5DG8 A;  1MC8 A;  3H8W A;  4F2S A;  3RBD A;  3EPI A;  9ICK A;  1TK0 A;  3HW8 A;  4Z6F A;  1Y88 A;  5J0P A;  1T8E A;  4PHD A;  5DDM A;  1ZQH A;  1S0V A;  4YXJ A;  5J2K A;  5J0Y A;  1NJW A;  2PFO A;  9ICT A;  5KT7 A;  3ZDE A;  4TUR A;  4I2I A;  3SV3 A;  4UB2 A;  4MF8 A;  9ICW A;  4M6W A;  5KFA A;  3T5K A;  2W9M A;  1T7P A;  2UVU A;  2UVR A;  4DSF A;  1ZJM A;  4KMU A;  4B9V A;  5KG2 A;  1Z3E B;  1L3U A;  2BPG A;  1SZP A;  3ETL A;  4DFP A;  5DLG A;  4QWA A;  4JV2 A;  4EZ9 A;  1U45 A;  2FLL A;  3H7I A;  1RXW A;  3PO4 A;  4F4K A;  4MFA A;  1JMS A;  2MUT A;  3RTV A;  5KFO A;  1ZQV A;  4QZD A;  2XGQ A;  4P2H A;  1Z00 B;  4LZG A;  3HPO A;  1RYS A;  2VAN A;  4Z6E A;  2H5X A;  5DGA A;  1ZQN A;  4R64 A;  4EEY A;  1TVA A;  4I2B A;  4BDP A;  2JEG A;  3RBE A;  8ICI A;  4KLI A;  1XSN A;  3Q8K A;  8ICE A;  1WCN A;  3QZ7 A;  1TV9 A;  3LDA A;  5KFF A;  1L5U A;  2A1J A;  1NOM A;  3GFK B;  2BQR A;  1ZQS A;  5J2E A;  2JEF A;  4DSJ A;  1RZT A;  1KFS A;  1T4G A;  8ICM A;  3JPP A;  4IRK A;  4O3S A;  3K75 D;  5DBC A;  4RPX A;  9ICL A;  4E0D A;  1LB2 B;  1K1Q A;  1KFD A;  1PZN A;  5KFV A;  3RAQ A;  2XGP A;  2PFN A;  2PI5 A;  3M9O B;  8ICV A;  3RAX A;  4EBC A;  2NRV A;  5KT4 A;  3Q8M A;  9ICI A;  4YVZ A;  4YMO A;  7ICH A;  5KFW A;  5KG4 A;  2C2E A;  1S10 A;  4JK1 A;  1KLN A;  5KFG A;  3V6K A;  4EYH B;  4QZH A;  2KFN A;  4J9O A;  4QZE A;  2W9C A;  1XSL A;  4IQT A;  5J2A A;  4DQI A;  4FS1 A;  7ICN A;  5CJ7 A;  3IM1 A;  2FPL A;  2KTQ A;  4J9L A;  1HUO A;  5J0X A;  4NM2 A;  5CHG A;  3PR5 B;  5KFT A;  4I2F A;  4IRD A;  4YG2 A;  1SL2 A;  3TAQ A;  5KFN A;  4O3O A;  3NGD A;  1NKB A;  1X9S A;  5J2H A;  4B9S A;  2JZB B;  2Y1I A;  9ICV A;  2NRX A;  5L9X A;  4RNN A;  4KLF A;  4R66 A;  3BQ0 A;  2VA2 A;  2KZM A;  2W9B A;  4DS4 A;  4YD1 A;  1ZQE A;  4QWB A;  4BXO A;  1JIH A;  5IIJ A;  3TAR A;  5EWE A;  2HHW A;  2Y1J A;  4UAY A;  5HNK A;  3EW9 A;  7ICK A;  2IHM A;  3UXP A;  2FPM A;  1ZQF A;  9ICB A;  5KT2 A;  5HHH A;  2AGQ A;  2AGO A;  2ZJ5 A;  3RH5 A;  1JN3 A;  3RR7 A;  5J2F A;  4IR1 A;  4KTQ A;  3C1Y A;  3MR6 A;  4LZD A;  5KT3 A;  5L1K A;  2FMQ A;  4ELT A;  4YR2 A;  4KLT A;  4MEY A;  2P66 A;  4R8U B;  5DDY A;  2PXI A;  4F5N A;  4RPZ A;  4RQ1 A;  4EBE A;  1ZQC A;  2JEJ A;  4KLJ A;  3OGU A;  4F93 B;  8ICS A;  4M9L A;  2AJQ A;  4QWD A;  4BGD A;  2W8K A;  4EZ6 A;  4DOA A;  3KHL A;  4M04 A;  3ZDB A;  4BWJ A;  2BR0 A;  5J0S A;  4RU9 A;  4DOC A;  3JPQ A;  1JXL A;  2XC9 A;  4J9S A;  5HHI A;  4IRC A;  3UQ2 A;  4O3P A;  1DOQ A;  5DBA A;  3RH6 A;  2I9G A;  3V7J A;  5KFU A;  1NK7 A;  4DFJ A;  5DQH A;  3PNC A;  4RNO A;  1MQ3 A;  8ICZ A;  5J2B A;  8ICL A;  5DG7 A;  4QW9 A;  4DFM A;  2ZTC A;  3OHB A;  4O5C A;  3MGI A;  1B43 A;  3C1Z A;  3T5L A;  1UA0 A;  4DEZ A;  1D9F A;  1ZET A;  5KG3 A;  7ICF A;  3MBY A;  4IR9 A;  4JWM A;  1U49 A;  3OSN A;  3N97 B;  4ECZ A;  9ICU A;  4ECX A;  4M0A A;  2Q0Z X;  4ECY A;  5BOM A;  3EYZ A;  2ASJ A;  3GV5 B;  3MGH A;  4RUA A;  4YQW A;  1BGX T;  4C8N A;  4DL7 A;  1TKD A;  3RB0 A;  4F4X A;  5D4B A;  3MDC A;  3BDP A;  4KLL A;  4Q8F A;  3MFH A;  4UB5 A;  4DL6 A;  1T3N A;  1HJP A;  4Q45 A;  4GXI A;  4ED2 A;  3PW7 A;  4FBU A;  7ICE A;  3V7L A;  2V4R A;  3PW0 A;  5KFP A;  2HHT A;  1NK5 A;  5HP4 A;  5KFB A;  3NTU A;  4QZI A;  5EWF A;  3JPS A;  4J9K A;  9ICF A;  1BPE A;  3QEB Z;  3H40 A;  2ISO A;  4KN4 A;  4R65 A;  4ELV A;  4RT3 A;  4YR0 A;  4DS5 A;  4JWN A;  2MAX A;  1ZQU A;  4DOB A;  3PY8 A;  5CB1 A;  3K4G A;  5HML A;  4M6W B;  4JUZ A;  1U9L A;  5DB9 A;  3TI0 A;  9ICA A;  4B9N A;  3GV7 B;  3HP6 A;  2FLN A;  1BPD A;  2BQ3 A;  4DLG A;  5DB8 A;  5F9L A;  2IBK A;  8ICN A;  4XUS A;  4O3N A;  4CCH A;  5DBB A;  2AGP A;  4O3R A;  2ASL A;  1XU4 A;  2LYH A;  4O0I A;  4KIT B;  3JPN A;  4Q8E A;  1S97 A;  5III A;  1S76 D;  4ED7 A;  4UQG A;  1U47 A;  1K1S A;  2MUT B;  1ZQK A;  4DWI A;  3ZDA A;  2B21 A;  1S9F A;  1KSP A;  1CEZ A;  8ICR A;  3PX6 A;  2UVW A;  3SYZ A;  4F5P A;  1KEJ A;  3V6H A;  4QZC A;  4F92 B;  3PX4 A;  2BCQ A;  5KFZ A;  2FMS A;  3RJI A;  1A77 A;  2FPK A;  2HHU A;  7ICO A;  4YP3 A;  5KFJ A;  3V7K A;  4GLX A;  2GWS A;  3UXN A;  4ED0 A;  3TFR A;  4Q43 A;  2I1Q A;  3V6J A;  4I2E A;  4YXM A;  3THV A;  1ZQY A;  1XSP A;  1UA1 A;  1U4B A;  4KLH A;  3RB6 A;  5J2J A;  1NKE A;  4QWE A;  4QZF A;  3GIM A;  1N48 A;  2ATL A;  2ISP A;  4ECR A;  2VA8 A;  2HVI A;  2V4Q A;  4M2Y A;  3SI8 A;  1KFT A;  9ICM A;  1Z00 A;  4NY8 A;  4O3Q A;  3MFI A;  2PI4 A;  4EBD A;  4NLG A;  9ICQ A;  4C8O A;  5CP2 A;  1SL0 A;  3GIK A;  2IHN A;  4I2H A;  2PFQ A;  3ZD9 A;  2NRT A;  4M47 A;  4KN7 A;  2KFZ A;  2F1I A;  4ECV A;  3H4D A;  5F9N A;  3C5F A;  4PGQ A;  4I2J A;  4M9H A;  5KG5 A;  4HYK A;  2AU0 A;  1ZQR A;  3PV8 A;  3MR5 A;  2RDJ A;  4K4G A;  2J6U A;  9ICE A;  7ICT A;  1S0O A;  4UBB A;  8ICP A;  1ZQX A;  5EWG A;  4FS2 A;  2BQU A;  2BCV A;  4DSE A;  3Q8R B;  5D46 A;  2BHN A;  5C5J A;  5KG7 A;  2XO7 A;  3RJK A;  2P6U A;  4ECS A;  1TFR A;  8ICQ A;  4NXZ A;  4UBC A;  3TFS A;  1C7Y A;  4UB4 A;  5J0T A;  7ICU A;  1BPB A;  3PVX A;  2C2D A;  2XY5 A;  4O5K A;  2DFL A;  4YFK A;  2FMP A;  2ALZ A;  5DQI A;  2DPI A;  5BPC A;  4Z6C A;  3LK9 A;  2IA6 A;  3IHQ B;  4KLD A;  2HHS A;  1EXN A;  3MR2 A;  1UT8 A;  3RB3 A;  2PFP A;  2HHV A;  4O5E A;  1UT5 A;  3EZ5 A;  4KLU A;  3C5G A;  4I2A A;  5J2G A;  4KLG A;  3M8S A;  4JV1 A;  3OHA A;  3GQC A;  4ECW A;  8ICF A;  2BCR A;  2HW3 A;  1TK8 A;  3TAN A;  4BXO B;  1NK0 A;  3KHG A;  3QE9 Y;  1JX4 A;  7ICR A;  3B0X A;  9ICG A;  2R8I A;  4ELU A;  2OWO A;  9ICR A;  9ICH A;  7ICS A;  4KLO A;  4I29 A;  7ICG A;  3KHR A;  3AUO A;  3RH4 A;  4GC6 A;  4RQ3 A;  3H4B A;  2FLP A;  4PHA A;  5HMM A;  4TUP A;  5DB6 A;  3MDA A;  2JZB A;  3ISD A;  3MAB A;  2J6S A;  4F3O A;  5J0Q A;  9ICJ A;  5DG9 A;  4J9R A;  4FBT A;  1SKW A;  5KFE A;  3T5H A;  3BQ1 A;  3RRH A;  2DPJ A;  4F4Z A;  1ZQA A;  2BPF A;  1NJY A;  4TUQ A;  2V9W A;  1HUZ A;  4XA5 A;  4QZ9 A;  4F50 A;  4X5V A;  3AU6 A;  7ICV A;  4MF2 A;  4NLN A;  2R8J A;  3E2E A;  5L1I A;  1ZQI A;  5KG1 A;  4F5R A;  5KTQ A;  2NRW A;  3C21 A;  1L3T A;  2ZUC A;  7ICJ A;  7ICQ A;  4F91 B;  1NKC A;  8ICX A;  2BCS A;  1QSL A;  4YCX A;  3SZ2 A;  1ZJN A;  9ICC A;  2W8L A;  4GXK A;  5KFL A;  4PGX A;  1LV5 A;  3B0Y A;  4YMM A;  4DFK A;  4M9J A;  4RQ0 A;  4DQQ A;  4I28 A;  4YMN A;  8ICT A;  3RJJ A;  1U48 A;  4M9N A;  2HHX A;  4F4W A;  4RQ6 A;  3N4M B;  2C22 A;  2BCU A;  1NK8 A;  4IQW A;  4ED3 A;  3KHH A;  1WCL A;  4QW8 A;  1BPX A;  3PML A;  2ZUD A;  3UPQ A;  1QTM A;  1X9W A;  4RNM A;  4R63 A;  1RXV A;  2HHQ A;  4RQ8 A;  3V72 A;  4C8L A;  1CUK A;  2AQ0 A;  2NRZ A;  8ICG A;  3G6X A;  2ZUB A;  4LVS A;  7ICP A;  2UVV A;  5KG6 A;  1KRP A;  3G6V A;  2KZ3 A;  4Q44 A;  4DL3 A;  2W9A A;  3RJH A;  4DLE A;  4I2G A;  1RYR A;  3PR4 A;  2BKE A;  1V9P A;  2WTF A;  5CR0 A;  4UAZ A;  1NK4 A;  4DSK A;  8ICK A;  3RR8 A;  3ISB A;  4DSI A;  4RUC A;  1ZQG A;  4NLK A;  4ECU A;  2IMW P;  3AU2 A;  5D49 A;  4PPX A;  5TZV A;  2C28 A;  2ZJA A;  1ZQD A;  4FO6 A;  4DSL A;  1NJX A;  1ZQJ A;  1ZQZ A;  4DQS A;  1ZQT A;  1XC9 A;  1SKR A;  1ZQW A;  4RQ5 A;  4ED6 A;  2P6R A;  5KFH A;  4DO9 A;  4J9P A;  4YN4 A;  1N56 A;  4B9M A;  4NM1 A;  3GII A;  3PW2 A;  4RQ7 A;  5J2D A;  3HWT A;  1QSY A;  2R8H A;  2HVH A;  8ICH A;  5KFX A;  4DL4 A;  4B9L A;  3HT3 A;  3M9N B;  2J6T A;  2XCP A;  9ICN A;  2F1H A;  4ED8 A;  1ZQL A;  8ICU A;  4UB3 A;  1BVS A;  5KFS A;  5DKW A;  4I2D A;  2A1J B;  4ECQ A;  1BPY A;  5J2C A;  4ZH4 A;  4KLE A;  4QZG A;  3EWA A;  1S0M A;  3C2K A;  5KFK A;  2AQ4 A;  1NJZ A;  7ICL A;  4GC7 A;  5J0R A;  1A76 A;  4IQV A;  2R8K A;  9ICX A;  3OJS A;  1IM4 A;  7ICI A;  1JXE A;  4QZA A;  5IIK A;  3QZ8 A;  4ECT A;  3T3F A;  3ISC A;  3H8S A;  5IIL A;  4B9T A;  8ICY A;  8ICO A;  5KFQ A;  4QWC A;  4F2R A;  3C2M A;  1NK9 A;  1ZQO A;  1S77 D;  1X2I A;  5KT5 A;  1COO A;  1RPL A; 
#chains in the Genus database with same CATH topology
 4IC9 A;  2Y0S F;  3UQ0 A;  3KTQ A;  1KBU A;  4DL2 A;  4KLS A;  4F4Y A;  1ZQM A;  4YR3 A;  1HEK A;  4TQR A;  4G9B A;  3HX0 A;  2KN7 A;  2A3V A;  4O9M A;  5DGB A;  8ICW A;  3RRG A;  1XNS A;  2F1J A;  5IIO A;  2OM6 A;  5AKX A;  2VA3 A;  3PW4 A;  1D8Y A;  5GTH U;  2W11 A;  2YN4 A;  2E8O A;  5ALQ A;  1XWL A;  3LWM A;  3ZDC A;  2K4H A;  4P4M A;  2R8G A;  5EE1 A;  5TIS U;  2ESE A;  2EAM A;  5AM1 A;  2K4I A;  4I2C A;  5KT6 A;  5E79 U;  3L5K A;  4K4I A;  3BJY A;  1A0P A;  4FZN A;  3JPO A;  3TQ1 A;  2ASD A;  2CPR A;  1OUQ A;  1ZQP A;  4KLQ A;  4BWM A;  1H38 A;  4G3I A;  5T14 A;  1KL9 A;  4DCC A;  2QKQ A;  4DF8 A;  2ZJ8 A;  1QH9 A;  2JH7 A;  3RJF A;  4RZR A;  3HIL A;  3H8W A;  5KNI A;  9ICK A;  1S8O A;  1Y88 A;  2OHF A;  5J0Y A;  5KT7 A;  2GO7 A;  1LKY B;  5AI4 A;  2NO4 A;  4UB2 A;  4M6W A;  5KFA A;  4DSF A;  4KMU A;  4PL1 A;  3ETL A;  5DLG A;  4QWA A;  4EZ9 A;  5GTI U;  1U45 A;  2FLL A;  3IN5 A;  2K89 A;  1JMS A;  5JU5 A;  2XGQ A;  4P2H A;  4LZG A;  3HPO A;  2YMP A;  2KK0 A;  1ZQN A;  2VAN A;  5DGA A;  3HRD D;  2DL0 A;  3NVW A;  1WCN A;  3QZ7 A;  3LDA A;  1L5U A;  1DK2 A;  2QLT A;  5J2E A;  1KFS A;  1B0X A;  8ICM A;  3JPP A;  3S6J A;  4C7Y A;  1LB2 B;  1K1Q A;  1PZN A;  2PI5 A;  3TAD A;  5KT4 A;  9ICI A;  1JAL A;  7ICH A;  2C2E A;  4CF5 A;  3A0B U;  5KFG A;  3V6K A;  4BJQ A;  2XVT A;  2Q4T A;  4IQT A;  2D8C A;  7ICN A;  5ALL A;  2KTQ A;  1PVR A;  3WKD A;  1HUO A;  5CHG A;  5KFT A;  3TAD C;  3U26 A;  3KFU F;  2E5S A;  5ALP A;  3NUQ A;  1NKB A;  2VKQ A;  1X9S A;  5J2H A;  2MSN A;  5AKZ A;  4KLF A;  2VA2 A;  1JIH A;  5ALV A;  1MA7 A;  9ICB A;  5HHH A;  2PMZ F;  2AGQ A;  3RH5 A;  3RR7 A;  4IR1 A;  3D6J A;  3C1Y A;  5KT3 A;  4KLT A;  2OCE A;  4MEY A;  2PXI A;  4RPZ A;  3WKE A;  2HOQ A;  4BGD A;  4BWJ A;  4IRC A;  3UQ2 A;  5JTI A;  4EEN A;  4NJ8 A;  5KFU A;  3PNC A;  4RNO A;  3ICX A;  8ICZ A;  5J2B A;  5DG7 A;  1B43 A;  5AM4 A;  3T5L A;  3WK8 A;  1OXJ A;  3CW2 C;  3MBY A;  4JWM A;  3KD3 A;  3OSN A;  9ICU A;  4M0A A;  4DL7 A;  4RUA A;  3M6K A;  4KLL A;  2JR5 A;  4UB5 A;  1T3N A;  1HJP A;  7ICE A;  4FBU A;  4CNQ A;  2W54 A;  1Q3V A;  2EZY A;  4J9K A;  4QZI A;  2IOH A;  2ISO A;  2Y9U A;  4ELV A;  4RT3 A;  4DS5 A;  2W7O A;  5HML A;  9ICA A;  3HP6 A;  1L7P A;  2FLN A;  3IG8 A;  2W3S A;  4DLG A;  5DB8 A;  1F5S A;  5F9L A;  4U6P A;  4O3R A;  2CRX A;  4UAV A;  3JPN A;  2OYY A;  4DWI A;  3F2B A;  8ICR A;  2KVC A;  2UVW A;  4F5P A;  3PX4 A;  4QZC A;  1QQ5 A;  2FPK A;  1SXD A;  4FFD A;  5KFJ A;  3TFR A;  4C7Z A;  4I2E A;  3THV A;  1XSP A;  4QZF A;  2ATL A;  2Z7J A;  2ISP A;  2V4Q A;  4M2Y A;  1C20 A;  4UAT A;  1Z00 A;  4NLG A;  5AM5 A;  4C8O A;  5CP2 A;  2WF6 A;  2PFQ A;  3ZD9 A;  1V85 A;  1DXS A;  3WK5 A;  4M9H A;  5KG5 A;  5AK4 A;  9ICE A;  3MR5 A;  3K1R B;  2RDJ A;  4OJ5 A;  2FE9 A;  8ICP A;  2I6X A;  5EE9 A;  5KG7 A;  2P6U A;  2KMD A;  4NXZ A;  1FFU A;  1GO3 F;  1BPB A;  3PVX A;  2C2D A;  2DFL A;  4YFK A;  1FFV A;  4NL9 C;  4Z6C A;  2HHS A;  2AH5 A;  1EXN A;  2PFP A;  3PZP A;  4Y2X A;  3C5G A;  4JV1 A;  2ZIX A;  8ICF A;  1NK0 A;  3QE9 Y;  2R8I A;  4ELU A;  3PSP A;  3RH4 A;  3H4B A;  5HMM A;  3MDA A;  3ISD A;  4F3O A;  3SR6 A;  4J9R A;  3H8M A;  3T5H A;  3NVY A;  2V9W A;  4X5V A;  7ICV A;  4NLN A;  1T3Q A;  3SAH A;  5L1I A;  1IIP A;  1ZQI A;  3C21 A;  2WB1 F;  3C29 A;  4OCZ A;  1NKC A;  5B66 U;  5KFL A;  4PGX A;  1LV5 A;  3K1Z A;  4YMM A;  4YMN A;  2H3V A;  3N4M B;  1JRP A;  2BCU A;  4ACO A;  4IQW A;  3PML A;  2ZUD A;  1RXV A;  4R63 A;  1CUK A;  2ZIV A;  2EDU A;  4EX6 A;  3G6X A;  2UVV A;  1KRP A;  5HR6 A;  4DL3 A;  1V9P A;  1L7O A;  2FI1 A;  4UAZ A;  4DSK A;  3ISB A;  3AU2 A;  4GIB A;  1J2M A;  1F44 A;  2NV3 A;  1ZQD A;  1XC9 A;  1ZQW A;  4RQ5 A;  3MC1 A;  5KFH A;  2FDR A;  4J9P A;  2BDU A;  3GII A;  2G0A A;  1QSY A;  2R8H A;  2O6K A;  4DL4 A;  9ICN A;  3F53 A;  2F1H A;  5JRT A;  4ECQ A;  1BPY A;  4ZH4 A;  1S0M A;  5J0R A;  3MGV A;  4IQV A;  3N7R C;  2HHT A;  2P35 A;  3QZ8 A;  8ICY A;  4B9T A;  1SWV A;  4F2R A;  1ZQO A;  1S77 D;  2FJ6 A;  1YT3 A;  1COO A;  2ZIU A;  4OD0 A;  3F2D A;  4P4O A;  1ZQQ A;  3SAF A;  5L1J A;  1S5L U;  5KFI A;  9ICS A;  4P4P A;  2C2R A;  5AK5 A;  5EOZ A;  1DGS A;  2M9N A;  3RJE A;  5BOL A;  5ALD A;  2K4P A;  2KHV A;  4Z6D A;  2BGW A;  3QUT A;  4XQ8 A;  3SQI A;  5DB7 A;  1XO1 A;  1ZXI A;  2ZTE A;  5J0O A;  4QZB A;  3Q8S B;  4PGY A;  3PW5 A;  4MFC A;  1ARO P;  4PHE A;  3SMV A;  1FO4 A;  3EPG A;  3Q8L A;  5CEH A;  1SGG A;  2YX8 A;  3KZX A;  1SL1 A;  4F8R A;  1D8L A;  5EE3 A;  1PK1 A;  4UAW A;  2DWQ A;  2XY6 A;  3BQ7 A;  3Q8Q B;  5KFY A;  1L3V A;  8ICA A;  3BQ2 A;  1S0N A;  2KSO A;  3ALR A;  3FYH A;  4EYI B;  2F76 X;  3GIL A;  1KDH A;  5IIN A;  1MQ2 A;  3OSP A;  2R18 A;  1BPZ A;  4TUS A;  1XS9 D;  3Q8P B;  9ICP A;  1MN8 A;  3UM9 A;  3LYS A;  3RB4 A;  4QNL A;  4F2S A;  3RBD A;  3EPI A;  1TAM A;  1NJW A;  5G5G A;  3QU7 A;  4I2I A;  2M0N A;  3F5A A;  2W9M A;  1T7P A;  2UVU A;  5AIC A;  4BX9 C;  3PSF A;  5KG2 A;  1L3U A;  2YML A;  1BNP A;  1SZP A;  1KKX A;  2DUY A;  3QXG A;  5ALU A;  3TAC B;  3ZI4 A;  3H7I A;  3F5E A;  3RTV A;  2WB1 C;  1ZQV A;  1Z00 B;  1RYS A;  4Z6E A;  2DKX A;  2JHD A;  8ICI A;  3RBE A;  4KLI A;  1TE2 A;  2KJ8 A;  1O08 A;  1N5X A;  4GFJ A;  1NOM A;  2JEF A;  1ZQS A;  4DSJ A;  4U7C A;  3K75 D;  5DBC A;  4E0D A;  1KFD A;  5KFV A;  2NRV A;  3Q8M A;  2E1F A;  1SWW A;  5KFW A;  1S10 A;  5KAF U;  1KLN A;  4EYH B;  4QZH A;  4J9O A;  2KEY A;  1XSL A;  2ZIX B;  5J2A A;  1AQ6 A;  5CJ7 A;  1P7D A;  4J9L A;  1J2N A;  3PR5 B;  1SL2 A;  4O3O A;  3NGD A;  4B9S A;  2YQE A;  4RNN A;  4R66 A;  2KZM A;  1ZQE A;  4AYB F;  3BZK A;  2IOF K;  4UAY A;  1QQ7 A;  2FPM A;  1ZQF A;  5KT2 A;  2HOI A;  4KTQ A;  3MR6 A;  1PK3 A;  4YR2 A;  3NVV A;  2KFZ A;  4F5N A;  1X9X A;  5DDY A;  4EBE A;  2JEJ A;  4QWD A;  4P0Q A;  4M04 A;  2BR0 A;  5J0S A;  2KJ5 A;  4UB6 U;  4DOC A;  4J9S A;  5HHI A;  1LVH A;  2LKY A;  1NK7 A;  5DQH A;  4EX7 A;  1MQ3 A;  2K60 A;  5EE0 A;  8ICL A;  2WF5 A;  3DEE A;  2ZTC A;  3OHB A;  3MGI A;  2ZIV B;  4DEZ A;  1ZET A;  2HI0 A;  1N62 A;  5BOM A;  3EYZ A;  2ASJ A;  3GV5 B;  1JUD A;  1TKD A;  1BGX T;  4UAR A;  4C8N A;  4DL6 A;  1Z19 A;  2EAP A;  4ED2 A;  3PW7 A;  3V7L A;  2V4R A;  2JGA A;  5HP4 A;  1NK5 A;  9ICF A;  3JPS A;  2JXJ A;  3QEB Z;  3H40 A;  4R65 A;  1RYU A;  4YR0 A;  3N7S C;  3TI0 A;  5DB9 A;  4B9N A;  1BPD A;  2F3N A;  3QU5 A;  3C28 A;  8ICN A;  2AGP A;  1V38 A;  5AI0 A;  4O0I A;  1N5W A;  5III A;  1Q8K A;  4ED7 A;  4OJL A;  1U47 A;  2MUT B;  1ZQK A;  3ZDA A;  1S9F A;  2QB0 A;  3SYZ A;  2YTU A;  5KFZ A;  3RJI A;  3HJE A;  2LHT A;  2HHU A;  4GLX A;  5AKL A;  3UXN A;  2I1Q A;  3V6J A;  2MA1 A;  1NNL A;  1U4B A;  3N7P D;  2ZIU B;  3RB6 A;  2LMR A;  5J2J A;  2HVI A;  1X42 A;  1QCK A;  4O3Q A;  3MFI A;  4EBD A;  3BS5 B;  4M47 A;  2EZZ A;  3UMG A;  3M1Y A;  2AU0 A;  1ZQR A;  1S0O A;  4UBB A;  3I28 A;  2BHN A;  5C5J A;  3RJK A;  4US9 A;  4UBC A;  4UB4 A;  2XY5 A;  2FMP A;  2IA6 A;  5DQI A;  2DPI A;  5BPC A;  2HHV A;  4O5E A;  1UT5 A;  4KLG A;  4ECW A;  2BCR A;  1PK1 B;  2WAQ F;  3KHG A;  4I29 A;  4KX3 A;  3AUO A;  4GC6 A;  4RQN A;  4RQ3 A;  2LM4 A;  4TUP A;  2JZB A;  3MAB A;  1VLB A;  3IRU A;  2KSO B;  2DGZ A;  1ZD2 P;  2Y0S C;  3EUB 2;  2BPF A;  5A0L A;  4F50 A;  1NZB A;  5ALN A;  1O03 A;  3GU3 A;  2R8J A;  2JV3 A;  1PVQ A;  5KG1 A;  7ICJ A;  8ICX A;  1QSL A;  4YCX A;  3SZ2 A;  2K8C B;  5ALW A;  3F2C A;  3QX7 A;  1WG8 A;  4M9J A;  4NLB A;  2F8L A;  8ICT A;  4Y2S A;  1U48 A;  2HHX A;  5ALO A;  2DQN B;  4F4W A;  4RQ6 A;  8ICG A;  4C8L A;  2NRZ A;  2ZUB A;  4LVS A;  5KG6 A;  3G6V A;  2OH2 A;  3BS7 A;  4Y2T A;  4DLE A;  4I2G A;  3M7D A;  2BKE A;  2ZIW A;  1NK4 A;  8ICK A;  3RR8 A;  3IP4 B;  4DSI A;  4ECU A;  5D49 A;  3QUQ A;  4UW9 A;  1ZQZ A;  4DQS A;  1SV4 A;  4ED6 A;  4YN4 A;  1N56 A;  4NM1 A;  3PW2 A;  3HWT A;  4UAU A;  2GH1 A;  1M6Y A;  3HT3 A;  4BUG A;  2HSZ A;  4OO1 J;  8ICU A;  5KFS A;  4I2D A;  1RDF A;  4KLE A;  3EWA A;  3ETR A;  1NJZ A;  1A76 A;  2H3Q A;  2R8K A;  1IM4 A;  4QZA A;  5IIK A;  3QYP A;  5KFQ A;  2H3Z A;  3C2M A;  4MHV A;  7ICM A;  4YD2 A;  4TQS A;  5J29 A;  4J9N A;  3I76 A;  3ZDD A;  2HCF A;  3ZD8 A;  1D9D A;  1QSS A;  5J8Y A;  2RP5 A;  1L6N A;  4C8M A;  3NAS A;  1YZ7 A;  3H8J A;  5KG0 A;  4PHP A;  5CWR A;  2XY7 A;  3LWL A;  3SV4 A;  4UB1 A;  1IXR A;  5DQG A;  3AQE A;  4O3M A;  2I5H A;  4RQ4 A;  5AK3 A;  5J8Y C;  5KFR A;  1N63 A;  4IS7 A;  3UXO A;  1SKS A;  4KLM A;  4RT2 A;  2CXY A;  3CRX A;  4ED1 A;  2E8M A;  5KFD A;  4P0Q B;  3M8R A;  4IL6 U;  4WJ3 B;  5CA7 A;  3QU9 A;  3PX0 A;  3FDS A;  4A8E A;  2ZTD A;  1A6S A;  4RPY A;  2RDI A;  1TAQ A;  4J9M A;  4DL5 A;  1PVP A;  2W43 A;  4Y2U A;  3GV8 B;  1ZQB A;  3A0H U;  4GXJ A;  4RQ2 A;  3AMZ A;  4LJX A;  3PO5 A;  5J0W A;  9ICO A;  4MFF A;  3GDX A;  2AHO B;  1X66 A;  3PMN A;  1DGJ A;  1WUD A;  4B6J A;  4DQR A;  2E1E A;  4J9Q A;  1MSW D;  4OJP A;  5B5E U;  2HDO A;  2BPC A;  5KFM A;  3JPR A;  4C4T A;  1B22 A;  3AN1 A;  1NK6 A;  2KIC A;  1MC8 A;  2RRD A;  1TK0 A;  2KV2 A;  4Z6F A;  4CE6 A;  5J0P A;  1ZQH A;  4PHD A;  5DDM A;  2PMZ C;  1S0V A;  5J2K A;  2LM1 A;  2PFO A;  1DK3 A;  5KL1 B;  3ZDE A;  4TUR A;  2HBJ A;  4C4S A;  3BZC A;  2WF9 A;  3SV3 A;  4Y2P A;  3T5K A;  2KNJ A;  2JRZ A;  2QB0 B;  1ZOL A;  2UVR A;  4B9V A;  1KW4 A;  3E0F A;  3H0R B;  2W7P A;  4HAI A;  1ECW A;  2HBL A;  1X40 A;  4Y2J A;  4MFA A;  2MUT A;  4EEK A;  5KFO A;  4OJ6 A;  4QZD A;  2HOF A;  2EAN A;  4R64 A;  4EEY A;  1HIW A;  3UMC A;  1BNO A;  1TVA A;  4I2B A;  2JEG A;  3Q8K A;  8ICE A;  3B9J A;  5AK6 A;  1WWU A;  2A1J A;  3QU4 A;  2F44 A;  1RZT A;  3OPX A;  4IRK A;  4O3S A;  3VCB A;  1JI7 A;  9ICL A;  2HBM A;  3BS5 A;  3RAQ A;  3M9O B;  3RAX A;  4YVZ A;  1SV0 A;  4KX5 A;  5H2F U;  1ZRN A;  2W9C A;  4DQI A;  4PL2 A;  3IV6 A;  2FPL A;  2G07 A;  1ZD5 A;  5J0X A;  4I2F A;  4IRD A;  4YG2 A;  5KL8 B;  5KFN A;  2JZB B;  2Y1I A;  9ICV A;  2NRX A;  2W9B A;  4DS4 A;  4YD1 A;  4QWB A;  1ZQ1 C;  7ICK A;  5AI6 A;  2IHM A;  3UXP A;  2AGO A;  1JN3 A;  5J2F A;  4NWI A;  4ELT A;  2P66 A;  4R8U B;  1ZQC A;  2E3T A;  3OGU A;  4F93 B;  1N61 A;  2D3D A;  1FEZ A;  2G06 A;  4DOA A;  5AI5 A;  3JPQ A;  4C80 A;  4UAS A;  2KKV A;  3DDH A;  5DBA A;  1Z1B A;  3RH6 A;  3VC8 A;  2B6G A;  3V7J A;  3ONN A;  4DFJ A;  2KD1 A;  5ALY A;  1RM6 C;  2F77 X;  1JRO A;  2H3F A;  2F2A B;  1Z1V A;  5KG3 A;  7ICF A;  4IR9 A;  1U49 A;  3N97 B;  4CF3 A;  1Q3U A;  4ECX A;  3L4P A;  3D2Q A;  3RB0 A;  4Q8F A;  2ZIW B;  4GXI A;  2WF8 A;  5KFP A;  3O0F A;  5KFB A;  2NYV A;  2KIV A;  4KN4 A;  2VJ4 A;  1ZD3 A;  4JWN A;  1ZQU A;  4DOB A;  3KBB A;  1ED1 A;  4Y2Q A;  4DFD A;  3H0L B;  1DRG A;  5C0Y A;  5AKK A;  2IBK A;  4PJ0 U;  4O3N A;  1XU4 A;  2LYH A;  1S97 A;  1S76 D;  4UQG A;  1K1S A;  2OXO A;  1CEZ A;  2B21 A;  1KSP A;  3PX6 A;  4NLZ A;  4Y2R A;  3V6H A;  2BCQ A;  4F92 B;  5AKE A;  3V7K A;  2GWS A;  3OTQ A;  4ED0 A;  4Q43 A;  4QIW F;  1ZD4 A;  4YXM A;  1V97 A;  1ZQY A;  4KLH A;  2RLT A;  4EEL A;  4ECR A;  1D8B A;  2YB1 A;  4NY8 A;  2PI4 A;  2N1R A;  4J03 A;  4C4R A;  1WWV A;  2QAR A;  2NRT A;  4KN7 A;  4FE3 A;  3H4D A;  5F9N A;  3SEN A;  4PGQ A;  4HYK A;  2D6F C;  1N2X A;  3WKA A;  2BQU A;  4QJF B;  5D46 A;  5ALF A;  2XO7 A;  2H3I A;  1TFR A;  4ECS A;  3TFS A;  2JH1 A;  2EQY A;  2ZXI A;  2ALZ A;  4KLD A;  3LK9 A;  3MR2 A;  1UT8 A;  3EZ5 A;  2DBY A;  4KLU A;  2K4E A;  1YZ6 A;  4I2A A;  2ZXH A;  5J2G A;  3RF9 A;  2IOF A;  3GQC A;  4P0P A;  2F8K A;  3TAN A;  4BXO B;  4US8 A;  7ICR A;  9ICG A;  1UQV A;  9ICR A;  1B4F A;  7ICG A;  4AP9 A;  2YB4 A;  5ALK A;  5DB6 A;  2DKZ A;  2J6S A;  3WK9 A;  3LVV A;  2VJ5 A;  5DG9 A;  2L5Y A;  1SKW A;  5KFE A;  3BQ1 A;  1SB3 C;  1URJ A;  4F4Z A;  1ZQA A;  3AEV A;  2LYA A;  1XO0 A;  4QZ9 A;  2NRW A;  5KTQ A;  2ZUC A;  7ICQ A;  4GXK A;  1CI4 A;  3B0Y A;  4Y2Y A;  3RJJ A;  4M9N A;  2HMX A;  2CN1 A;  1NK8 A;  4ED3 A;  4QW8 A;  1BPX A;  1QTM A;  4USA A;  1OW5 A;  2KG5 A;  4RNM A;  2HHQ A;  7ICP A;  1Z4N A;  3AM9 A;  1RQL A;  3D2N A;  2W9A A;  3PR4 A;  4UB8 U;  5CR0 A;  4RUC A;  1ZQG A;  4NLK A;  1VDV A;  2IMW P;  4PPX A;  5TZV A;  4DSL A;  2G5I B;  4FO6 A;  1NJX A;  3WKC A;  1ZQT A;  1SKR A;  2WFA A;  4DO9 A;  2W03 A;  5ALM A;  4RQ7 A;  5J2D A;  8ICH A;  4B9L A;  1UHU A;  3M9N B;  5AM3 A;  1ZQL A;  4UB3 A;  2YY6 A;  1BVS A;  2A1J B;  4QZG A;  3C2K A;  7ICL A;  2AQ4 A;  4GC7 A;  3OJS A;  1FIQ A;  3T3F A;  5IIL A;  5ALJ A;  2GLE A;  3H8S A;  4RQM A;  3E58 A;  3IDW A;  5KT5 A;  1RPL A;  3C2L A;  2A19 A;  3UMB A;  2W9C B;  3JPT A;  2KZZ A;  2KOB A;  5ALS A;  5KFC A;  2K8B B;  2XCA A;  3KKA A;  4XRH A;  8ICB A;  8ICJ A;  4NV0 A;  1PUZ A;  4MEX A;  4I27 A;  3GIJ A;  3HKZ F;  4B9U A;  4JV0 A;  2E8P A;  1X9M A;  3MR3 A;  4K4H A;  8ICC A;  2EH9 A;  4F5Q A;  5IIM A;  2W9B B;  3BQT A;  3T5J A;  3GZF A;  3KKA C;  4C8K A;  1L3S A;  3OJU A;  2KHQ A;  1QQ6 A;  1L8O A;  1SIJ A;  4F5O A;  1TK5 A;  2A1A A;  3G6Y A;  4FZL A;  4PH5 A;  4DQP A;  2YMM A;  1TAU A;  4QIW C;  3NS1 A;  1COK A;  4ICA A;  3ORY A;  1KTQ A;  4M9G A;  5DLF A;  2XI9 A;  3RJG A;  4F71 A;  3WK4 A;  5FP0 A;  1KN5 A;  1NI3 A;  4R8U A;  5J0U A;  4JB3 A;  4NLC A;  2JMG A;  3M9M B;  3SEI A;  4PZN A;  1J97 A;  5L1M A;  1ZYQ A;  5ALI A;  5JUM A;  2BDP A;  1SZH A;  3QEA Z;  1QLN A;  4IQU A;  3R9K A;  3C23 A;  2JEI A;  4QZ8 A;  4DF4 A;  5L1L A;  5J2I A;  3TAP A;  4AYB C;  5DG8 A;  2BZF A;  3PSI A;  3HW8 A;  1T8E A;  4YXJ A;  2PKE A;  5AI8 A;  9ICT A;  5F3X B;  2MRL A;  4MF8 A;  9ICW A;  2LYB A;  2W04 A;  1ZJM A;  1RQN A;  1Z3E B;  2BPG A;  2WF7 A;  4FZM A;  3WK6 A;  4DFP A;  4OJO A;  4JV2 A;  5AKG A;  1RXW A;  3PO4 A;  4F4K A;  1WYG A;  2H5X A;  3NRW A;  2NO5 A;  2QAR B;  4BDP A;  1N60 A;  1XSN A;  2KJ9 A;  1TV9 A;  5KFF A;  3GFK B;  2BQR A;  3J81 j;  1NZP A;  1T4G A;  2RQ5 A;  2YMQ A;  4RPX A;  3CYM A;  4JMU A;  2RHF A;  2XGP A;  2PFN A;  8ICV A;  4EBC A;  4CRX A;  2HBK A;  4YMO A;  5AKJ A;  5KG4 A;  1ZRM A;  3TKA A;  4JK1 A;  4NL9 A;  2ES6 A;  3WU2 U;  2KFN A;  4QZE A;  2ZG6 A;  3CNH A;  4FS1 A;  4P0P B;  2OEH A;  3IM1 A;  4NM2 A;  2QB1 A;  4ZOH C;  3TAQ A;  3PST A;  4CF4 A;  5L9X A;  1X6J A;  3BQ0 A;  4BXO A;  5IIJ A;  3TAR A;  4CDG A;  5EWE A;  2Y1J A;  2HHW A;  5HNK A;  3EW9 A;  5ALH A;  5AIB A;  2ZJ5 A;  2DF4 B;  5L1K A;  4LZD A;  2FMQ A;  5ALR A;  3QU2 A;  4RQ1 A;  4KLJ A;  3H0M B;  8ICS A;  4M9L A;  2AJQ A;  2W8K A;  4EZ6 A;  3KHL A;  3ZDB A;  2XID A;  1JXL A;  4RU9 A;  2XC9 A;  2G08 A;  4O3P A;  1DOQ A;  2I9G A;  2G5H B;  2LI6 A;  4QW9 A;  4DFM A;  3SAG A;  2Y9T A;  4O5C A;  3C1Z A;  3HKZ C;  1UA0 A;  1D9F A;  3QUC A;  5ALZ A;  4ECZ A;  2Q0Z X;  4ECY A;  3MGH A;  4YQW A;  4F4X A;  2WAQ C;  3MDC A;  5D4B A;  3BDP A;  2KVS A;  3MFH A;  3RFA A;  4Q45 A;  3CP8 A;  1L8L A;  3PW0 A;  5AIA A;  3I1Y A;  3QUB A;  3NTU A;  5EWF A;  1BPE A;  2LPE A;  3AL0 B;  3KOO A;  2MAX A;  3PY8 A;  5CB1 A;  1L7M A;  3K4G A;  4M6W B;  4JUZ A;  1U9L A;  1Q46 A;  2K8A A;  3GV7 B;  1L7N A;  5ALT A;  2E8N A;  2BQ3 A;  4XUS A;  4CCH A;  5DBB A;  3FC4 A;  2ASL A;  3NRZ A;  5AI9 A;  4KIT B;  2AXT U;  4Q8E A;  4C0Z A;  1LKY A;  1IV8 A;  5CRX A;  3FAH A;  2FMS A;  1KEJ A;  2KP7 A;  1A77 A;  1F0M A;  7ICO A;  4YP3 A;  1KQQ A;  4CGZ A;  1UA1 A;  1NKE A;  4QWE A;  3GIM A;  1N48 A;  3LVW A;  2VA8 A;  1KFT A;  3ED5 A;  3SI8 A;  9ICM A;  5AKY A;  4KMO B;  9ICQ A;  1SL0 A;  3GIK A;  2IHN A;  4I2H A;  2F1I A;  4ECV A;  3DV9 A;  2LBO A;  4F72 A;  3C5F A;  3SD7 A;  4I2J A;  4K4G A;  3PV8 A;  3N28 A;  2J6U A;  7ICT A;  3AQF A;  1ZQX A;  5EWG A;  1SXE A;  4FS2 A;  2BCV A;  4DSE A;  3Q8R B;  3NVZ A;  8ICQ A;  3M6Z A;  1C7Y A;  5J0T A;  7ICU A;  2KE7 A;  4O5K A;  1SV0 C;  3IHQ B;  2XIC A;  3RB3 A;  5ALE A;  3M8S A;  3OHA A;  2HW3 A;  1TK8 A;  1JX4 A;  3B0X A;  2OWO A;  7ICS A;  9ICH A;  4KLO A;  1CRX A;  3KHR A;  2VIX A;  2FLP A;  4PHA A;  2B0C A;  2ODG A;  3QNM A;  5J0Q A;  9ICJ A;  4FBT A;  3RRH A;  2DPJ A;  2WHE A;  1NJY A;  4TUQ A;  1HUZ A;  3IG5 A;  4XA5 A;  3AU6 A;  5ALG A;  4MF2 A;  5KAI U;  5AKH A;  3E2E A;  4F5R A;  1L3T A;  4F91 B;  2BCS A;  1VJ5 A;  1T94 A;  1IG6 A;  1ZJN A;  9ICC A;  2W8L A;  2G09 A;  1UPH A;  3KZI U;  4DFK A;  4RQ0 A;  4DQQ A;  4I28 A;  5K4L A;  5AHX A;  2C22 A;  5AM0 A;  3KHH A;  2EZX A;  1WCL A;  3UPQ A;  1X6I A;  1X9W A;  1Z4O A;  4RQ8 A;  3V72 A;  5AKI A;  2AQ0 A;  3WKB A;  2KZ3 A;  5ALX A;  4Q44 A;  4PZO A;  2W3R A;  3FM9 A;  3RJH A;  1RYR A;  2EAO A;  2W55 A;  2WTF A;  2KKP A;  3L3F X;  3T79 A;  2C28 A;  5G5H A;  2ZJA A;  1ZQJ A;  1K5O A;  2P6R A;  4B9M A;  2HVH A;  5KFX A;  2GOL A;  2J6T A;  5HR7 A;  2XCP A;  3WK7 A;  1UCV A;  4ED8 A;  1RG6 A;  5DKW A;  5J2C A;  2KIW A;  5KFK A;  2MU2 A;  9ICX A;  7ICI A;  1JXE A;  4ECT A;  5AM2 A;  3ISC A;  4Y2V A;  8ICO A;  4QWC A;  1NK9 A;  3D2S A;  1X2I A; 
#chains in the Genus database with same CATH homology
 3C2L A;  7ICM A;  4YD2 A;  4P4O A;  3UQ0 A;  4TQS A;  4DL2 A;  3KTQ A;  4KLS A;  5J29 A;  1ZQQ A;  4F4Y A;  2W9C B;  1ZQM A;  4YR3 A;  3JPT A;  5L1J A;  4J9N A;  2KZZ A;  5KFI A;  5KFC A;  4TQR A;  3ZDD A;  2XCA A;  2KN7 A;  3HX0 A;  9ICS A;  4XRH A;  4P4P A;  3ZD8 A;  1D9D A;  2C2R A;  1QSS A;  8ICB A;  5EOZ A;  8ICJ A;  4NLZ A;  4C8M A;  4O9M A;  5DGB A;  1DGS A;  2M9N A;  4MEX A;  3RJE A;  4I27 A;  8ICW A;  3RRG A;  5BOL A;  3GIJ A;  4B9U A;  4JV0 A;  2F1J A;  5IIO A;  1X9M A;  3H8J A;  3MR3 A;  5KG0 A;  4K4H A;  4PHP A;  5CWR A;  8ICC A;  2XY7 A;  2VA3 A;  4Z6D A;  3LWL A;  4F5Q A;  4XQ8 A;  5IIM A;  3SV4 A;  2BGW A;  5DB7 A;  4UB1 A;  1XO1 A;  1IXR A;  2ZTE A;  3BQT A;  5J0O A;  4QZB A;  2W9B B;  3PW4 A;  3Q8S B;  1D8Y A;  4PGY A;  5DQG A;  3T5J A;  3PW5 A;  4RQ4 A;  4C8K A;  1L3S A;  3OJU A;  4MFC A;  1ARO P;  5KFR A;  4PHE A;  3UXO A;  1XWL A;  1SKS A;  4KLM A;  3EPG A;  3Q8L A;  3LWM A;  3ZDC A;  4F5O A;  4RT2 A;  1TK5 A;  3G6Y A;  4PH5 A;  4ED1 A;  4P4M A;  4DQP A;  1SL1 A;  4F8R A;  5KFD A;  1TAU A;  2R8G A;  1D8L A;  3M8R A;  4UAW A;  3ORY A;  1KTQ A;  4M9G A;  5CA7 A;  2XY6 A;  3PX0 A;  4I2C A;  5DLF A;  3FDS A;  3RJG A;  3Q8Q B;  2ZTD A;  5KFY A;  5KT6 A;  1L3V A;  8ICA A;  4RPY A;  4R8U A;  2RDI A;  5J0U A;  4K4I A;  3BQ2 A;  3BJY A;  1TAQ A;  4J9M A;  4DL5 A;  1S0N A;  3M9M B;  3FYH A;  4EYI B;  3GV8 B;  1ZQB A;  4GXJ A;  4RQ2 A;  3JPO A;  3TQ1 A;  2ASD A;  3GIL A;  9ICO A;  3PO5 A;  5J0W A;  1ZYQ A;  1KDH A;  5JUM A;  4MFF A;  1ZQP A;  3GDX A;  4KLQ A;  4BWM A;  2BDP A;  1H38 A;  3QEA Z;  5IIN A;  1QLN A;  4G3I A;  3PMN A;  4IQU A;  3C23 A;  2JEI A;  4QZ8 A;  4DF8 A;  1MQ2 A;  2ZJ8 A;  3OSP A;  4DQR A;  4J9Q A;  1MSW D;  1BPZ A;  4TUS A;  2BPC A;  1XS9 D;  4DF4 A;  3RJF A;  3Q8P B;  4RZR A;  5KFM A;  9ICP A;  3JPR A;  5L1L A;  5J2I A;  3TAP A;  1B22 A;  3RB4 A;  1NK6 A;  5DG8 A;  1MC8 A;  3H8W A;  4F2S A;  3RBD A;  3EPI A;  9ICK A;  1TK0 A;  3HW8 A;  4Z6F A;  1Y88 A;  5J0P A;  1T8E A;  4PHD A;  5DDM A;  1ZQH A;  1S0V A;  4YXJ A;  5J2K A;  5J0Y A;  1NJW A;  2PFO A;  9ICT A;  5KT7 A;  3ZDE A;  4TUR A;  4I2I A;  3SV3 A;  4UB2 A;  4MF8 A;  9ICW A;  4M6W A;  5KFA A;  3T5K A;  2W9M A;  1T7P A;  2UVU A;  2UVR A;  4DSF A;  1ZJM A;  4KMU A;  4B9V A;  5KG2 A;  1Z3E B;  1L3U A;  2BPG A;  1SZP A;  3ETL A;  4DFP A;  5DLG A;  4QWA A;  4JV2 A;  4EZ9 A;  1U45 A;  2FLL A;  3H7I A;  1RXW A;  3PO4 A;  4F4K A;  4MFA A;  1JMS A;  2MUT A;  3RTV A;  5KFO A;  1ZQV A;  4QZD A;  2XGQ A;  4P2H A;  1Z00 B;  4LZG A;  3HPO A;  1RYS A;  2VAN A;  4Z6E A;  2H5X A;  5DGA A;  1ZQN A;  4R64 A;  4EEY A;  1TVA A;  4I2B A;  4BDP A;  2JEG A;  3RBE A;  8ICI A;  4KLI A;  1XSN A;  3Q8K A;  8ICE A;  1WCN A;  3QZ7 A;  1TV9 A;  3LDA A;  5KFF A;  1L5U A;  2A1J A;  1NOM A;  3GFK B;  2BQR A;  1ZQS A;  5J2E A;  2JEF A;  4DSJ A;  1RZT A;  1KFS A;  1T4G A;  8ICM A;  3JPP A;  4IRK A;  4O3S A;  3K75 D;  5DBC A;  4RPX A;  9ICL A;  4E0D A;  1LB2 B;  1K1Q A;  1KFD A;  1PZN A;  5KFV A;  3RAQ A;  2XGP A;  2PFN A;  2PI5 A;  3M9O B;  8ICV A;  3RAX A;  4EBC A;  2NRV A;  5KT4 A;  3Q8M A;  9ICI A;  4YVZ A;  4YMO A;  7ICH A;  5KFW A;  5KG4 A;  2C2E A;  1S10 A;  4JK1 A;  1KLN A;  5KFG A;  3V6K A;  4EYH B;  4QZH A;  2KFN A;  4J9O A;  4QZE A;  2W9C A;  1XSL A;  4IQT A;  5J2A A;  4DQI A;  4FS1 A;  7ICN A;  5CJ7 A;  3IM1 A;  2FPL A;  2KTQ A;  4J9L A;  1HUO A;  5J0X A;  4NM2 A;  5CHG A;  3PR5 B;  5KFT A;  4I2F A;  4IRD A;  4YG2 A;  1SL2 A;  3TAQ A;  5KFN A;  4O3O A;  3NGD A;  1NKB A;  1X9S A;  5J2H A;  4B9S A;  2JZB B;  2Y1I A;  9ICV A;  2NRX A;  5L9X A;  4RNN A;  4KLF A;  4R66 A;  3BQ0 A;  2VA2 A;  2KZM A;  2W9B A;  4DS4 A;  4YD1 A;  1ZQE A;  4QWB A;  4BXO A;  1JIH A;  5IIJ A;  3TAR A;  5EWE A;  2HHW A;  2Y1J A;  4UAY A;  5HNK A;  3EW9 A;  7ICK A;  2IHM A;  3UXP A;  2FPM A;  1ZQF A;  9ICB A;  5KT2 A;  5HHH A;  2AGQ A;  2AGO A;  2ZJ5 A;  3RH5 A;  1JN3 A;  3RR7 A;  5J2F A;  4IR1 A;  4KTQ A;  3C1Y A;  3MR6 A;  4LZD A;  5KT3 A;  5L1K A;  2FMQ A;  4ELT A;  4YR2 A;  4KLT A;  4MEY A;  2P66 A;  4R8U B;  5DDY A;  2PXI A;  4F5N A;  4RPZ A;  4RQ1 A;  4EBE A;  1ZQC A;  2JEJ A;  4KLJ A;  3OGU A;  4F93 B;  8ICS A;  4M9L A;  2AJQ A;  4QWD A;  4BGD A;  2W8K A;  4EZ6 A;  4DOA A;  3KHL A;  4M04 A;  3ZDB A;  4BWJ A;  2BR0 A;  5J0S A;  4RU9 A;  4DOC A;  3JPQ A;  1JXL A;  2XC9 A;  4J9S A;  5HHI A;  4IRC A;  3UQ2 A;  4O3P A;  1DOQ A;  5DBA A;  3RH6 A;  2I9G A;  3V7J A;  5KFU A;  1NK7 A;  4DFJ A;  5DQH A;  3PNC A;  4RNO A;  1MQ3 A;  8ICZ A;  5J2B A;  8ICL A;  5DG7 A;  4QW9 A;  4DFM A;  2ZTC A;  3OHB A;  4O5C A;  3MGI A;  1B43 A;  3C1Z A;  3T5L A;  1UA0 A;  4DEZ A;  1D9F A;  1ZET A;  5KG3 A;  7ICF A;  3MBY A;  4IR9 A;  4JWM A;  1U49 A;  3OSN A;  3N97 B;  4ECZ A;  9ICU A;  4ECX A;  4M0A A;  2Q0Z X;  4ECY A;  5BOM A;  3EYZ A;  2ASJ A;  3GV5 B;  3MGH A;  4RUA A;  4YQW A;  1BGX T;  4C8N A;  4DL7 A;  1TKD A;  3RB0 A;  4F4X A;  5D4B A;  3MDC A;  3BDP A;  4KLL A;  4Q8F A;  3MFH A;  4UB5 A;  4DL6 A;  1T3N A;  1HJP A;  4Q45 A;  4GXI A;  4ED2 A;  3PW7 A;  4FBU A;  7ICE A;  3V7L A;  2V4R A;  3PW0 A;  5KFP A;  2HHT A;  1NK5 A;  5HP4 A;  5KFB A;  3NTU A;  4QZI A;  5EWF A;  3JPS A;  4J9K A;  9ICF A;  1BPE A;  3QEB Z;  3H40 A;  2ISO A;  4KN4 A;  4R65 A;  4ELV A;  4RT3 A;  4YR0 A;  4DS5 A;  4JWN A;  2MAX A;  1ZQU A;  4DOB A;  3PY8 A;  5CB1 A;  3K4G A;  5HML A;  4M6W B;  4JUZ A;  1U9L A;  5DB9 A;  3TI0 A;  9ICA A;  4B9N A;  3GV7 B;  3HP6 A;  2FLN A;  1BPD A;  2BQ3 A;  4DLG A;  5DB8 A;  5F9L A;  2IBK A;  8ICN A;  4XUS A;  4O3N A;  4CCH A;  5DBB A;  2AGP A;  4O3R A;  2ASL A;  1XU4 A;  2LYH A;  4O0I A;  4KIT B;  3JPN A;  4Q8E A;  1S97 A;  5III A;  1S76 D;  4ED7 A;  4UQG A;  1U47 A;  1K1S A;  2MUT B;  1ZQK A;  4DWI A;  3ZDA A;  2B21 A;  1S9F A;  1KSP A;  1CEZ A;  8ICR A;  3PX6 A;  2UVW A;  3SYZ A;  4F5P A;  1KEJ A;  3V6H A;  4QZC A;  4F92 B;  3PX4 A;  2BCQ A;  5KFZ A;  2FMS A;  3RJI A;  1A77 A;  2FPK A;  2HHU A;  7ICO A;  4YP3 A;  5KFJ A;  3V7K A;  4GLX A;  2GWS A;  3UXN A;  4ED0 A;  3TFR A;  4Q43 A;  2I1Q A;  3V6J A;  4I2E A;  4YXM A;  3THV A;  1ZQY A;  1XSP A;  1UA1 A;  1U4B A;  4KLH A;  3RB6 A;  5J2J A;  1NKE A;  4QWE A;  4QZF A;  3GIM A;  1N48 A;  2ATL A;  2ISP A;  4ECR A;  2VA8 A;  2HVI A;  2V4Q A;  4M2Y A;  3SI8 A;  1KFT A;  9ICM A;  1Z00 A;  4NY8 A;  4O3Q A;  3MFI A;  2PI4 A;  4EBD A;  4NLG A;  9ICQ A;  4C8O A;  5CP2 A;  1SL0 A;  3GIK A;  2IHN A;  4I2H A;  2PFQ A;  3ZD9 A;  2NRT A;  4M47 A;  4KN7 A;  2KFZ A;  2F1I A;  4ECV A;  3H4D A;  5F9N A;  3C5F A;  4PGQ A;  4I2J A;  4M9H A;  5KG5 A;  4HYK A;  2AU0 A;  1ZQR A;  3PV8 A;  3MR5 A;  2RDJ A;  4K4G A;  2J6U A;  9ICE A;  7ICT A;  1S0O A;  4UBB A;  8ICP A;  1ZQX A;  5EWG A;  4FS2 A;  2BQU A;  2BCV A;  4DSE A;  3Q8R B;  5D46 A;  2BHN A;  5C5J A;  5KG7 A;  2XO7 A;  3RJK A;  2P6U A;  4ECS A;  1TFR A;  8ICQ A;  4NXZ A;  4UBC A;  3TFS A;  1C7Y A;  4UB4 A;  5J0T A;  7ICU A;  1BPB A;  3PVX A;  2C2D A;  2XY5 A;  4O5K A;  2DFL A;  4YFK A;  2FMP A;  2ALZ A;  5DQI A;  2DPI A;  5BPC A;  4Z6C A;  3LK9 A;  2IA6 A;  3IHQ B;  4KLD A;  2HHS A;  1EXN A;  3MR2 A;  1UT8 A;  3RB3 A;  2PFP A;  2HHV A;  4O5E A;  1UT5 A;  3EZ5 A;  4KLU A;  3C5G A;  4I2A A;  5J2G A;  4KLG A;  3M8S A;  4JV1 A;  3OHA A;  3GQC A;  4ECW A;  8ICF A;  2BCR A;  2HW3 A;  1TK8 A;  3TAN A;  4BXO B;  1NK0 A;  3KHG A;  3QE9 Y;  1JX4 A;  7ICR A;  3B0X A;  9ICG A;  2R8I A;  4ELU A;  2OWO A;  9ICR A;  9ICH A;  7ICS A;  4KLO A;  4I29 A;  7ICG A;  3KHR A;  3AUO A;  3RH4 A;  4GC6 A;  4RQ3 A;  3H4B A;  2FLP A;  4PHA A;  5HMM A;  4TUP A;  5DB6 A;  3MDA A;  2JZB A;  3ISD A;  3MAB A;  2J6S A;  4F3O A;  5J0Q A;  9ICJ A;  5DG9 A;  4J9R A;  4FBT A;  1SKW A;  5KFE A;  3T5H A;  3BQ1 A;  3RRH A;  2DPJ A;  4F4Z A;  1ZQA A;  2BPF A;  1NJY A;  4TUQ A;  2V9W A;  1HUZ A;  4XA5 A;  4QZ9 A;  4F50 A;  4X5V A;  3AU6 A;  7ICV A;  4MF2 A;  4NLN A;  2R8J A;  3E2E A;  5L1I A;  1ZQI A;  5KG1 A;  4F5R A;  5KTQ A;  2NRW A;  3C21 A;  1L3T A;  2ZUC A;  7ICJ A;  7ICQ A;  4F91 B;  1NKC A;  8ICX A;  2BCS A;  1QSL A;  4YCX A;  3SZ2 A;  1ZJN A;  9ICC A;  2W8L A;  4GXK A;  5KFL A;  4PGX A;  1LV5 A;  3B0Y A;  4YMM A;  4DFK A;  4M9J A;  4RQ0 A;  4DQQ A;  4I28 A;  4YMN A;  8ICT A;  3RJJ A;  1U48 A;  4M9N A;  2HHX A;  4F4W A;  4RQ6 A;  3N4M B;  2C22 A;  2BCU A;  1NK8 A;  4IQW A;  4ED3 A;  3KHH A;  1WCL A;  4QW8 A;  1BPX A;  3PML A;  2ZUD A;  3UPQ A;  1QTM A;  1X9W A;  4RNM A;  4R63 A;  1RXV A;  2HHQ A;  4RQ8 A;  3V72 A;  4C8L A;  1CUK A;  2AQ0 A;  2NRZ A;  8ICG A;  3G6X A;  2ZUB A;  4LVS A;  7ICP A;  2UVV A;  5KG6 A;  1KRP A;  3G6V A;  2KZ3 A;  4Q44 A;  4DL3 A;  2W9A A;  3RJH A;  4DLE A;  4I2G A;  1RYR A;  3PR4 A;  2BKE A;  1V9P A;  2WTF A;  5CR0 A;  4UAZ A;  1NK4 A;  4DSK A;  8ICK A;  3RR8 A;  3ISB A;  4DSI A;  4RUC A;  1ZQG A;  4NLK A;  4ECU A;  2IMW P;  3AU2 A;  5D49 A;  4PPX A;  5TZV A;  2C28 A;  2ZJA A;  1ZQD A;  4FO6 A;  4DSL A;  1NJX A;  1ZQJ A;  1ZQZ A;  4DQS A;  1ZQT A;  1XC9 A;  1SKR A;  1ZQW A;  4RQ5 A;  4ED6 A;  2P6R A;  5KFH A;  4DO9 A;  4J9P A;  4YN4 A;  1N56 A;  4B9M A;  4NM1 A;  3GII A;  3PW2 A;  4RQ7 A;  5J2D A;  3HWT A;  1QSY A;  2R8H A;  2HVH A;  8ICH A;  5KFX A;  4DL4 A;  4B9L A;  3HT3 A;  3M9N B;  2J6T A;  2XCP A;  9ICN A;  2F1H A;  4ED8 A;  1ZQL A;  8ICU A;  4UB3 A;  1BVS A;  5KFS A;  5DKW A;  4I2D A;  2A1J B;  4ECQ A;  1BPY A;  5J2C A;  4ZH4 A;  4KLE A;  4QZG A;  3EWA A;  1S0M A;  3C2K A;  5KFK A;  2AQ4 A;  1NJZ A;  7ICL A;  4GC7 A;  5J0R A;  1A76 A;  4IQV A;  2R8K A;  9ICX A;  3OJS A;  1IM4 A;  7ICI A;  1JXE A;  4QZA A;  5IIK A;  3QZ8 A;  4ECT A;  3T3F A;  3ISC A;  3H8S A;  5IIL A;  4B9T A;  8ICY A;  8ICO A;  5KFQ A;  4QWC A;  4F2R A;  3C2M A;  1NK9 A;  1ZQO A;  1S77 D;  1X2I A;  5KT5 A;  1COO A;  1RPL A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...