1LV5A

Crystal structure of the closed conformation of bacillus dna polymerase i fragment bound to dna and dctp
Total Genus 190
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
190
sequence length
580
structure length
580
Chain Sequence
AKMAFTLADRVTEEMLADKAALVVEVVEENYHAAPIVGIAVVNEHGRFFLRPETALADPQFVAWLGDETKKKSMFDSKRAAVALKWKGIELCGVSFDLLLAAYLLDPAQGVDDVAAAAKMKQYEAVRPDEAVYGKGAKRAVPDEPVLAEHLVRKAAAIWELERPFLDELRRNEQDRLLVELEQPLSSILAEMEFAGVKVDTKRLEQMGKELAEQLGTVEQRIYELAGQEFNINSPKQLGVILFEKLQLPVLKKTKTGYSTSADVLEKLAPYHEIVENILHYRQLGKLQSTYIEGLLKVVRPDTKKVHTIFNQALTQTGRLSSTEPNLQNIPIRLEEGRKIRQAFVPSESDWLIFAADYSQIELRVLAHIAEDDNLMEAFRRDLDIHTKTAMDIFQVSEDEVTPNMRRQAKAVNFGIVYGISDYGLAQNLNISRKEAAEFIERYFESFPGVKRYMENIVQEAKQKGYVTTLLHRRRYLPDITSRNFNVRSFAERMAMNTPIQGSAADIIKKAMIDLNARLKEERLQAHLLLQVHDELILEAPKEEMERLCRLVPEVMEQAVTLRVPLKVDYHYGSTWYDAK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase/dna
molecule keywords 5'-D(*GP*GP*AP*TP*CP*AP*GP*CP*GP*A)-3'
publication title Processive DNA synthesis observed in a polymerase crystal suggests a mechanism for the prevention of frameshift mutations
pubmed doi rcsb
source organism Geobacillus stearothermophilus
total genus 190
structure length 580
sequence length 580
chains with identical sequence B
ec nomenclature ec 2.7.7.7: DNA-directed DNA polymerase.
pdb deposition date 2002-05-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00476 DNA_pol_A DNA polymerase family A
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.20 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 5' to 3' exonuclease, C-terminal subdomain 1lv5A04
1.20.1060.10 Mainly Alpha Up-down Bundle Taq DNA Polymerase; Chain T, domain 4 Taq DNA Polymerase; Chain T, domain 4 1lv5A02
3.30.70.370 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1lv5A03
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 1lv5A01
1LWEA 4RQ0A 3V9UA 1HYVA 4UBBA 2P5GA 1ZQMA 4G1QA 8ICFA 1WN7A 4F3TA 4RUAA 3PW0A 3PO5A 2BGWA 4K8ZA 5KFYA 5DBCA 1XSNA 5J2DA 3M9MB 4F4YA 4CGFA 5KFWA 3TANA 5C25A 2YHAA 3QNNA 4M3ZA 4J9QA 4CEOA 4O4GA 3MXIA 3MABA 2R8JA 3DOLA 2UVUA 1WSGA 1TKZA 3AO2A 1SKRA 4FJKA 4CFDA 4I2AA 5CYMA 3FYHA 4YR0A 1KFTA 3H40A 2IBKA 4ZHRA 3RTVA 2C2EA 3C2LA 3NE6A 1TV9A 4N56A 4CEEA 7ICLA 4GLXA 3N4MB 3DRPA 1JLAA 4J9KA 4QZAA 4ECXA 2B4JA 5FRNA 4O0IA 8ICKA 4M9NA 5J0OA 1Z3EB 4W5OA 5L1IA 1RDCA 3DOKA 2IOCA 3UXNA 5J0PA 4ED6A 2YKNA 4JLHA 4NCBA 2F8TA 3CM5A 3Q8PB 4DU3A 2D0BA 1ZBLA 4ELVA 2M9NA 4ECTA 1FK9A 2ZTEA 4JK1A 4CHOA 3AU2A 2V4QA 3MFHA 4KI6A 1KVCA 2NRVA 4M3WA 3DLKA 1RXVA 1HRHA 3K57A 5KFLA 2PFPA 3V9SA 2BPFA 3CM6A 3S9HA 4FJHA 4RQ6A 2D5RA 1ZQXA 4ED0A 1X1PA 1ZQRA 1S9FA 1RDBA 4FLVA 4DF4A 5IIMA 4CJFA 1S0MA 2XCPA 5E41A 2C2RA 3L3UA 3ISBA 1ASWA 2QKKA 3SUPA 3P5JA 2HNDA 1BCOA 2B5JA 4FBTA 1ZQJA 3AO1A 3KKSA 4I2CA 3M8QA 8ICHA 2EHGA 2BHNA 2YNHA 4F91B 4KO0A 3VQ6A 2EX3A 3AVBA 4GC6A 2ZE2A 3AVIA 4OVLA 3K5NA 3B6OA 4OJRA 4MQ3A 2KZZA 2QKBA 5L1JA 4KTZA 2VG5A 4ELUA 3FFIA 3JSMA 5KRTA 1RT7A 2ATQA 4WE1A 1BVSA 1K1SA 2BR0A 4AHRA 3KTQA 4J9LA 2RKIA 1NJWA 4QZ8A 3SQ4A 4XIUA 2FBVA 4BGDA 4I2JA 7ICNA 3TQ1A 1JLFA 1BGXT 3VQ4A 2AGQA 5EWFA 5IINA 4QZFA 3V9ZA 1NK8A 4IR1A 3CQ8A 4RQ5A 4CFBA 2KN7A 3RH5A 3OVNA 4H4OA 2JZBB 5KT2A 2FBYA 5KFDA 4KPYA 4BWJA 1CZBA 5IIOA 8ICNA 3O3GA 3ZD8A 2AJQA 3KLHA 4FJ9A 3GQCA 4JV1A 2FMSA 3C5GA 2C28A 1H38A 4OPJA 2J6TA 4I7FA 1XC9A 1Z00A 3SCXA 4EBDA 4L8RB 1T4GA 1FXXA 1ZQTA 5KG6A 2NRWA 5J0WA 4NYNA 4XRHA 8ICZA 5T7BA 4FJ5A 1I39A 1WSJA 1J53A 1X9SA 3IHQB 4W5QA 4CFCA 2RDIA 1HPZA 3MR6A 1ZQHA 1TVAA 1C0TA 4YVZA 1EETA 1L3SA 4RPXA 3MFIA 5C5JA 1N56A 5D4BA 3OS1A 4DOCA 4RNOA 1RCHA 2J6UA 3ZDBA 4F5QA 3KK1A 3HT3A 4PGYA 4ECYA 4BDYA 3HM9A 4O9MA 2HB5A 9ICXA 3PW2A 3B0XA 4P4PA 8ICYA 3IM1A 1Q8IA 4YR2A 3K5OA 9ICNA 2BCVA 1PZNA 4GC7A 2DPJA 3HL8A 2BPGA 3VA3A 3SJJA 1NJXA 3RB3A 5KG2A 1BISA 5CA7A 9ICQA 4HUEA 1MSWD 4CHZA 5DG8A 4KV8A 3D45A 8ICMA 3RAXA 4RW6A 1RT6A 5C24A 8ICBA 5KFXA 3AVHA 4Q5VA 2VANA 4X5VA 4F93B 3C5FA 4KLDA 4PHDA 3NCIA 5KFKA 3V81A 1K1QA 1Y97A 4PA1A 3V6JA 4KLGA 2OPSA 2XY6A 2D0CA 4FM1A 1J54A 1U48A 1RTHA 3T5LA 5J29A 4F8RA 3ZCMA 2IS3A 3M8RA 5J1EA 1XU4A 3HPHA 4QZEA 4FCYA 3ORYA 4KLFA 1ZQAA 5J2IA 1L3TA 1G15A 1IXRA 3MR5A 9ICPA 3TAQA 3CYMA 4QZIA 1YVUA 3QE9Y 3AVAA 1NOZA 2ZJAA 5KFCA 3PY8A 4KLJA 2W9CB 2NUBA 1UAXA 3O4QA 3KLGA 4C8LA 4MFFA 1MC8A 3NGIA 2G8KA 3DLBA 3WNHA 1ZQKA 4KN4A 4DQQA 3OYMA 4FBUA 2F1JA 2XGPA 3WNEA 2RDJA 1HUOA 1BHLA 3THVA 4CF0A 3PV8A 4TUSA 1JLBA 4DWIA 4M3UA 1RZTA 4Z4HA 2GBZA 5J2QA 4ID1A 3OYDA 3NF7A 1QE1A 3PW4A 1GOAA 4DSEA 4IKFA 3N97B 3EY1A 2AQ4A 7ICPA 4B9TA 1NK6A 4KHUA 1A76A 2AGOA 1QLNA 1HMVA 1BPZA 3TAEA 1IKYA 5F9LA 3PX0A 2V4RA 4DU1A 3OYIA 4XA5A 3ASMA 1KVBA 2IHMA 8ICCA 1L5UA 2BCUA 8ICGA 3UPQA 4BXOA 5DKWA 5EWGA 4CF1A 3RRHA 1S77D 5HROA 3TR8A 4I2HA 5J2CA 4RQ1A 4B3OA 2IA6A 3RB4A 3JPNA 1RPLA 4YFKA 1Q9YA 3OS0A 1BPEA 1BPDA 4F4KA 3HVTA 8ICTA 3KJVA 2BQRA 1MU2A 1EXQA 4CGDA 3ZT2A 4ZTFA 4NM1A 3IS9A 4RG8A 1JMSA 5BOMA 3DYAA 3HYFA 4OKKA 1RT1A 4F92B 3EW9A 2XCAA 4IQWA 2W9MA 2YKMA 4BWMA 4UAZA 3NF8A 4C8OA 1RTIA 4FK4A 5KT4A 4KLSA 3V7JA 1U45A 2W9BA 5CZ2A 4QZGA 1ZQNA 3VQCA 4DFMA 2UVWA 4PUOA 3MEEA 3V9XA 3QEVA 4QOZB 7ICVA 1S1XA 2ATLA 4K8XA 4M47A 7ICEA 2ZUCA 4DEZA 5DQGA 4E0DA 1JLEA 1XHXA 3RJJA 2E4LA 1EX4A 3T19A 3BQ1A 4YD1A 1NK0A 1C0MA 3K58A 4CJLA 1RDDA 4JRPA 4KKOA 3AVFA 4CJRA 4E1NA 1N48A 4FJ8A 4CJUA 3ITHA 1A5VA 3MGHA 1IM4A 4LSNA 3CFOA 1CUKA 1VRTA 4I2QA 5C42A 1XS9D 4P4MA 4LY7A 4PY5A 9ICGA 1REVA 1RYSA 1SL0A 4DSLA 3HP9A 3Q8QB 4IQUA 2DY4A 5J2BA 3HJFA 5KFGA 3V1QA 3ZT0A 2A1RA 2BQ3A 2PFQA 3AVGA 4P2HA 3DMJA 3MAQA 3JPRA 2W9AA 4JRQA 1YTUA 4KRFA 4Z6CA 3ZT1A 4DQSA 4CJ3A 4DL5A 1ZQSA 1SKSA 5SWMA 4QWDA 4CJ5A 4RQ8A 4HCBA 3JPTA 3QIOA 4ECUA 4FW2A 3TFSA 4IBNA 3NF6A 4UB5A 4KN7A 4KLHA 2UVVA 4PGQA 5HRRA 1QSLA 4YG2A 5K14A 4E7JA 2YNIA 4HCCA 3GIKA 2BANA 4DTSA 4J9OA 3V6HA 1NKCA 2GV9A 2X78A 2KZMA 7ICUA 4DFPA 2VA2A 2FC0A 1TVRA 5J2FA 3C21A 2V9WA 4JWMA 3AVLA 3LPTA 3ZSOA 3C6TA 4M45A 1T8EA 3EYZA 4FYDA 3LAKA 2YNGA 4ECVA 3C2MA 1B43A 3H8JA 4B9LA 4HHTA 1TK5A 4CHPA 3QETA 1TKDA 4RT3A 1TAUA 4O5CA 4M41A 2OPQA 8ICIA 5DB9A 1QSSA 4LH5A 4QWCA 3ZDDA 3MR2A 2R8GA 3KK3A 1JLCA 4F2SA 5KFPA 2X6NA 5JS2A 4GXJA 2Y1JA 2DTUA 4M9LA 1LW2A 4HYKA 1U9LA 5CP2A 4DLEA 4PPXA 4KB1A 4FO6A 3HW8A 2HHUA 1C1AA 4JV0A 5J2EA 4DF8A 3RB6A 3QEPA 9ICIA 4F5NA 5KT3A 3LALA 4QW9A 3RJFA 2E6MA 3O3FA 4QZBA 2XO7A 1ASUA 3C94A 3V1RA 1IKXA 4DTXA 2AU0A 4O3QA 1C6VA 4CJVA 2F8SA 4EBEA 3K5LA 4I9LA 1GOBA 3HSTB 4CF2A 1ZQPA 4OLBA 4KLIA 1D8YA 3GIIA 2W42A 4CF8A 3OYBA 1EP4A 4EBCA 5DQHA 4I2GA 4PQUA 2JEFA 3MDCA 2YNFA 4FM0A 4MFCA 3V72A 1ZBHA 1NK5A 4RZRA 1KFSA 4W5TA 4M6WA 5J0QA 4KHQA 2WONA 1RT4A 2BCSA 3VQ9A 9ICSA 2R7YA 4NCAA 4CIGA 4KHSA 5DBBA 3Q8SB 5BOLA 4LZDA 3SUQA 4CEQA 3QZ8A 4CESA 4E19A 2VA3A 1MQ3A 3VQ7A 2GWSA 4J9SA 4C8NA 4CGIA 5KG1A 5L9XA 4FLZA 4CERA 5IIKA 4YP3A 1TKTA 3CFRA 5DDYA 4O55A 3V9WA 3M9NB 3AVMA 4CK1A 4G3IA 2YHBA 4UBCA 3I8DA 1CXUA 2P6UA 3JPQA 4F4ZA 3C1ZA 2VWJA 2PI4A 1NJZA 3QERA 3P1GA 3DLEA 4N76A 3NH1A 4O3NA 1WSHA 1EKEA 1S1VA 4TQRA 4EEYA 3ETLA 2G8VA 2D0AA 3L8BA 1TK8A 5KFAA 2VWKA 4AHCA 4JS5A 5J2NA 2JEIA 2O4IA 1XHZA 4F5PA 5KG7A 1KLNA 3H4BA 1JLQA 4B9VA 3KLFA 2Z1JA 4QWEA 1BPXA 3ZT4A 4KFBA 1XI1A 5CR0A 4K4HA 4IRDA 4B8AB 4BXOB 1N6QA 2ZQBA 5KI6A 4E7HA 3DRSA 1FKPA 3ISCA 3K59A 5KT7A 5EU7A 7ICFA 7ICHA 8ICXA 3KD5E 4DSFA 4KLEA 3SNNA 3GV8B 4YMNA 3LP1A 1VRUA 1ZQQA 4DQPA 2H5XA 1KSPA 1UWBA 2FPKA 2OPRA 2JGUA 5DB6A 4UB3A 1NK7A 9ICLA 4O3SA 2E6LA 3D0PA 4UAYA 3ZSQA 3OYHA 4O5EA 5DDMA 4LZGA 5FROA 4CK3A 2IGIA 5DG7A 1IO2A 2JEGA 1RBRA 4IQVA 3S3OA 2DFFA 2WTFA 1HJPA 4OKEA 1BPYA 3OYKA 3JPPA 3Q8MA 1UA1A 1U47A 3QINA 3SI6A 1CEZA 1YTAA 2I5JA 1L3VA 1BQNA 3QIPA 1RTJA 2HHTA 4PH5A 4DL7A 2VA8A 2P51A 2PZSA 3TAFA 3AVCA 4DMNA 2OZMA 2ZUBA 3OGUA 1SKWA 5KFBA 3VA0A 5HHIA 3ZDAA 2ISOA 4F5RA 5KFEA 5KG0A 4TQSA 2FLPA 5JUMA 3L3VA 3OHAA 1T05A 1KLMA 3HPOA 2JLEA 4R8UB 4PHPA 4IG3A 3IAYA 3V7KA 5TZVA 5KFHA 3GILA 2MUTB 4QW8A 4DU4A 8ICOA 1KVAA 4YXJA 2C22A 1LAVA 3KK2A 2FPLA 1BIZA 1DGSA 1S10A 3UIQA 4XQ8A 1A5XA 3NFAA 2R8IA 4KLTA 3NGDA 2LSNA 1TV6A 4QWBA 3RB0A 1KRPA 1VSMA 9ICEA 4AHTA 3SPYA 4EYIB 4Q45A 5HP1A 3V7LA 2ASJA 1XSLA 3V6DA 9ICTA 3LZIA 3NGZA 2XY5A 5F9NA 2G8HA 3OYJA 5KRSA 4PGXA 4DL3A 1QQCA 2IMWP 5CY4A 2ITGA 3JPOA 1RILA 4LVSA 4DFJA 2ASDA 3C2KA 2FMPA 1JX4A 2FMQA 4KB0A 4QAGA 4H8KA 4KI4A 2AQ0A 4HUFA 4KHYA 4I29A 2BQUA 3AO5A 4CHYA 3ZDCA 4M9JA 4PHAA 4XUSA 3KHHA 2AGPA 3L2QA 8ICPA 1L3UA 4CJTA 2C2DA 1RBVA 2KW4A 1KFDA 1LV5A 1DTTA 3V1OA 1JN3A 7ICIA 4K4GA 3LDAA 2Z1GA 4AHSA 3LDSA 1JXBA 4CEBA 5DG9A 4FJLA 4ECZA 1S5JA 1RBSA 3B6PA 3OJSA 4JWNA 3RR7A 8ICUA 3E2EA 3ZSZA 4NXZA 8ICVA 5HNKA 4CIFA 5J0TA 5KFZA 5I42A 9ICJA 2IC3A 9ICOA 1TKXA 1UOCA 1RNHA 4FZYA 4W5RA 1ZBIA 3ZT3A 2G8FA 4DQIA 4YNQA 1F21A 3KIOA 3AU6A 3SUNA 4NM2A 4R64A 2FPMA 5CB1A 4I2EA 3JYTA 2XY8A 5HMMA 5DB8A 2BE2A 4DS5A 4RQ3A 3RMDA 3OHBA 4KITB 4KTQA 2PXIA 9ICWA 7ICMA 1T03A 4Z4FA 4Z4CA 3RJHA 4KLLA 2UVRA 2XRIA 5KG4A 4I27A 1DLOA 1LAWA 4RW8A 3HVRA 1S0OA 5L1KA 1SL2A 4DTPA 3AA3A 1ZQBA 4ED8A 4I2DA 4DTUA 3H8WA 7ICTA 1BIUA 2O4GA 3NBPA 3DLHA 3Q8LA 3OJUA 4ECRA 1S6QA 3LP0A 5J2HA 4J2EA 4ED7A 3T3FA 5HLFA 3EZ5A 4Z4IA 4IFYA 3EWAA 4MEYA 1NOMA 4FK2A 4NLKA 2NRTA 4YXMA 4FM2A 4J9RA 5CYQA 4RW9A 1QTMA 3U3GA 4QZCA 4NYFA 2HHSA 2X6SA 1VSJA 2Y1IA 1WAJA 2I1QA 8ICLA 4O44A 1S0NA 4F2RA 9ICAA 4KLUA 5KTQA 1VSLA 1C1CA 3RRGA 3TAPA 4YR3A 3LZJA 2OWOA 4YQWA 4M6WB 1XSPA 4W5NA 8ICRA 3T5JA 3S3MA 3DLRA 4CEDA 1T7PA 5DGAA 4OKJA 4DSIA 5HBMA 4R63A 2XC9A 3VQAA 5CHGA 5J2JA 4CGHA 3UXPA 5KFNA 1QS4A 1S6PA 4ECSA 4DTNA 3H4DA 3V6KA 4M04A 2F96A 4IRCA 4R66A 3RWUA 3OYCA 4DTJA 2P66A 4FS1A 4B9NA 1JKHA 2HNYA 5J2AA 3GIJA 2P5OA 4RNNA 4CK2A 3C95A 5EOZA 4MFAA 3S3NA 1WNSA 5J0XA 4BE0A 3L2RA 8ICEA 4YN4A 3QEIA 4ECWA 3K75D 1ZJNA 1B22A 3DI6A 4M9HA 4KTWA 1VSDA 4KLQA 1YT3A 4DLGA 3AVJA 7ICOA 1RT2A 4AH9A 2W9CA 4FLUA 3O3HA 1KEJA 5J0RA 2ISPA 1ZQUA 4Y1DA 3LWMA 3OYAA 1WSEA 1HUZA 3BJYA 1WSIA 3PX4A 5KFSA 2LYHA 3PW7A 3SI8A 5L1LA 3RH6A 4FVMA 2ALZA 5KGXA 4LD0A 1AROP 3GDXA 4Y1CA 2PYJA 1ZQFA 3IG1A 2X74A 3G6XA 1Z00B 1QHTA 3U3YA 5HP4A 4ED1A 4Q8EA 5KFJA 4KHWA 2NRZA 4GW6A 2ZTCA 1ZJMA 4KAZA 1FKOA 1ZQEA 1ZYQA 3HK2A 1ZQGA 4Z6FA 1ASVA 9ICHA 1HYSA 3OYNA 4EZ6A 2HVIA 1X2IA 1BQMA 2DFHA 2HHVA 3OS2A 3E01A 3RMAA 4Z0UA 4DOBA 3T1AA 4B9MA 3HWTA 1TL3A 3KKRA 3VQEA 3GFKB 3PO4A 4RQ4A 3L2VA 4AHUA 2ZJ8A 3I0SA 4I9QA 1N5YA 7ICGA 4DG1A 3NHGA 3RJEA 3TARA 3BQ0A 3C6UA 2W8LA 4E1MA 5JS1A 3OSNA 4N5SA 3OSPA 1ZQYA 2DPIA 3M8SA 2P6RA 1RDAA 1RXWA 2A1JA 4RPYA 3C1YA 3ZSRA 1WAFA 3BDPA 1W0HA 3BQTA 4R65A 1TFRA 1JL2A 5DLFA 1SL1A 4I2IA 1O1WA 4IG0A 4J9MA 4C8KA 1J5OA 3KD1E 4HUGA 1LW0A 3VQBA 4OGEA 5J2KA 2ASLA 1HNVA 4ELTA 4MF8A 1QSYA 4B08A 3BQ2A 4LH4A 3TFRA 1K6YA 4NCGA 5DB7A 3DRRA 3G6VA 5IIIA 4BE2A 3QO9A 1BL3A 1BI4A 3QESA 5KG3A 3NTUA 3LP2A 3MDAA 4CJSA 4DL6A 5CJ7A 1D9FA 4QZ9A 1A5WA 4O3PA 3SQ0A 1J9AA 4DSJA 1XO1A 3ULDA 3K4GA 4MFBA 1TAQA 3RAQA 1S97A 2F1IA 4M3TA 3G0ZA 3OYEA 4RW7A 4UQGA 4CFAA 1ZQVA 3WNGA 1KTQA 4FJXA 3OY9A 1D8LA 1U49A 4BDPA 4FZXC 1JLGA 2Z1IA 4CJKA 3MECA 5DK5A 3PUFA 3V4IA 1ZQZA 3L2WA 3C23A 4R5PA 3AV9A 3P83D 4YMMA 1JL1A 1VSKA 2PI5A 4E7KA 5KT6A 4YCXA 4FJJA 1V9PA 7ICRA 1NK9A 1KCFA 4K4IA 3LANA 2BGGA 4MF2A 4AHVA 3CFPA 2Z1HA 4YFUA 4E7LA 8ICAA 3MBYA 2ZJ5A 4J2DA 2FBXA 3SUOA 5KT5A 7ICJA 5J2MA 3HPGA 4J9PA 3AA4A 3RJKA 2PYLA 3VQPA 4RU9A 4NLGA 4FLXA 5FRMA 1NKEA 3SQ1A 4ICLA 2XHBA 5HMLA 3RR8A 4LSLA 3TWHA 4Z4EA 1VSFA 2YV0X 5J0SA 9ICVA 5KG5A 1HQEA 2HW3A 3VQQA 3PR4A 4J9NA 4BE1A 5FDLA 4RT2A 3SYZA 3DLGA 1SUQA 8ICWA 2BCQA 3PX6A 4DFKA 3IRXA 3EPIA 3WNFA 4MEXA 4Z6DA 3VQ8A 2BKEA 4FJIA 2A1SA 4DO9A 1S1TA 4OPKA 3U6FA 5DQIA 9ICMA 4I2PA 1COOA 2BCRA 2R8KA 3NDKA 3RJIA 4I2FA 4M3YA 2XGQA 4Z6EA 1Q9XA 1CLQA 4PHEA 3GIMA 1RTDA 4KREA 1SZPA 2PY5A 3AUOA 3OYLA 4IR9A 1CXQA 2W9BB 1JIHA 4RW4A 5DLGA 5J2GA 3PMNA 4CGGA 2G8WA 1MQ2A 4KLOA 4CEFA 5J2PA 4UB1A 4M0AA 3RH4A 4ZH4A 4CHQA 3L2UA 4NY8A 1TK0A 1UT8A 3PVXA 4IRKA 1TL1A 4UB2A 3H08A 4QZHA 2NRXA 1ZQIA 1VK0A 4O3RA 3UQ2A 2BPCA 3K2PA 1LWFA 3LWLA 1X9WA 4FJ7A 3Q8KA 3RMCA 2HHQA 4ZTJA 1W9HA 1C1BA 2KTQA 3LK9A 4CJEA 4DTOA 3SPZA 1NOYA 4ECQA 9ICKA 1C0UA 4DTRA 3TABA 3MGIA 4F5OA 2MAXA 1RBUA 3ZD9A 1WLJA 1Y88A 5IIJA 5SZTA 1Z26A 2FLNA 3O4NA 4RQ7A 5HRPA 1U4BA 3TI0A 3DM2A 2G8UA 4QCLA 5EWEA 3OYGA 3VQ5A 3ZSXA 2XY7A 2VG6A 1VSHA 4B8CA 2HNZA 4RNMA 3MXMA 7ICSA 4DQRA 3HP6A 1JXLA 3RBDA 3NH2A 4IFVA 3HXMA 1TGOA 3QEXA 4UB4A 3Q8RB 4QWAA 3TAMA 1X9MA 3K5MA 1S9GA 4GMJB 1DTQA 4M42A 4KHNA 1WSFA 3TAGA 2KFZA 3KHRA 1B92A 4FJMA 4JUZA 1ZQWA 4UAWA 3AO4A 4FZZA 9ICFA 2ZTDA 1NJYA 5DBAA 3SZ2A 5HHHA 4Q8FA 2W8KA 5KFQA 2PFOA 4F3OA 4CJPA 5HRSA 1IG9A 2JEJA 1LB2B 3M8PA 3ZSYA 3T5KA 4GVMA 2P1JA 1SV5A 4F4WA 8ICQA 1IKWA 4FS2A 4CE9A 4FK0A 4M2YA 3PMLA 3QEAZ 4CIEA 3LPUA 4O3OA 2B21A 4CF9A 5HRNA 3AO3A 2J6SA 4M9GA 3ZSVA 2HMIA 4ID5A 4J2BA 4FLTA 2Q3SA 1ZQOA 3RMBA 2F1HA 5I3UA 3M9OB 3T5HA 4GXKA 4RPZA 2WOMA 3KLIA 5D46A 4O5KA 3G10A 3AVNA 4AILC 3MR3A 1XWLA 3I0RA 4RUCA 1WCNA 4BDZA 4B9UA 3QZ7A 5DMRA 4BACA 4P4OA 1IH7A 1D9DA 1RYRA 1D5AA 1KDHA 4TUPA 1UA0A 2JZBA 1T3NA 2ZUDA 3G6YA 3H7IA 4I28A 1EXNA 1S9EA 2OA8A 1HJRA 3ISDA 2FBTA 3BGRA 7ICQA 1UT5A 3SQ2A 3MEDA 2KQ2A 2QXFA 2RN2A 3VQDA 5KFUA 2IHNA 1LWCA 1ZQDA 4YD2A 3KHGA 2IDOA 4Q0BA 2B6AA 8ICSA 4EYHB 1ZQLA 9ICRA 4DSKA 4I2BA 4CJ4A 1C7YA 3RJGA 1RT5A 4O0JA 4CEAA 2RPIA 2BDPA 4Q43A 4OGCA 4QZDA 4NLZA 1JXEA 4KLMA 4Z4GA 3VN5A 1DOQA 4Q44A 1HNIA 5DGBA 3H8SA 1ITGA 4F4XA 1ZBFA 1ZQCA 3KLEA 4DL4A 2A1JB 1ZBUA 4N41A 4FJNA 4M3XA 2FLLA 1S1WA 4FJGA 3UQ0A 3KHLA 5KGWA 3PR5B 1WCLA 5KFRA 3QNOA 5KFVA 3NH0A 1VSEA 1IKVA 4E7IA 2RF2A 1RBTA 3A2FA 1BI4B 3EPGA 2I9GA 4JS4A 3PW5A 1HQUA 4CJQA 2ETJA 4J2AA 4ED2A 4E3SA 1HYZA 1B9FA 3GV7B 3NAEA 5KFTA 2G8IA 4C8MA 4R8UA 5KFIA 5KFFA 1BCMA 4N47A 4FLYA 4DL2A 2HHXA 2MUTA 5BPCA 3ZDEA 4CEZA 4F50A 4PWDA 9ICCA 3HX0A 3GV5B 2OPPA 1VSIA 3UXOA 1S0VA 1RT3A 5CWRA 3RBEA 5D49A 1NK4A 4EP4A 1Z25A 3AA2A 4FW1A 4CCHA 4H4MA 4TSXA 3F9KA 2DFEA 4HTUA 1S1UA 5J0YA 4JV2A 3ALYA 5IILA 1BPBA 4HVJA 3LP3A 4CHNA 4FXDA 3SV4A 4DOAA 2KZ3A 4KMUA 4B9SA 4E89A 5KFMA 4IQTA 2R8HA 9ICUA 1GOCA 4DTMA 2ZD1A 3SV3A 3QEWA 4FLWA 4M3RA 3NGYA 3FDSA 3CG7A 2OZSA 2Q0ZX 3MEGA 4CGJA 2HHWA 4GXIA 3LAMA 4YMOA 3PNCA 4CJWA 4NLNA 4ED3A 5CZ1A 3ZSWA 1S76D 5D3GA 4EP5A 1ZETA 2VG7A 4TUQA 3OYFA 2KFNA 5KFOA 3F73A 2OYQA 1NKBA 5J0UA 7ICKA 4IDKA 4RQ2A 1I3AA 2IAJA 4CECA 4O5BA 2PFNA 1B9DA 8ICJA 1A77A 9ICBA 2HVHA 3JPSA 2QK9A 3QEBZ 2GUIA 1CZ9A 3MXJA 3QLHA 3AA5X 4DS4A 4EZ9A 1U04A 3B0YA 3NF9A 3AVKA 1R0AA 4OLAA 3ISNC 4TURA 3HO1A 2DFLA
chains in the Genus database with same CATH superfamily
3H8MA 3TTDA 1ZQMA 4RUAA 5H1SV 1KBUA 2G08A 5HATA 4JK8A 1XSNA 5F8NA 4DV3F 1KBRA 4JI4F 3M9MB 1QQMA 5KFWA 3R8EA 2ITMA 5CXTA 1RTJB 2F76X 2W7PA 4M5NA 4LFCF 2FZKB 4PEOA 4M3ZA 2Z56B 3RYLA 2XVTA 1RCOB 3MMBA 1M90O 1TL1B 2MQMA 4CFDA 2W24A 3H59A 2ZIVA 3SCIE 1NLKL 3G8TA 1TV9A 5HMYA 3KFWX 1T05B 1KLMB 1X3NA 2QO3A 2V34A 4PYDA 2EFGA 4NLVA 4LF5K 1JLAA 4J9KA 1RGVA 1NB2A 5FRNA 1ZRNA 8ICKA 2KVSA 4M9NA 2XZTB 5B8HA 2Q4TA 3DOKA 1WEXA 3ONQA 1TV6B 1B7YB 3IN5A 1TTHB 4DU3A 2D0BA 3IM8A 3D0IE 5GADI 1IUJA 1FK9A 3AARA 4CHOA 2YMMA 4Y65A 2VJVA 2ZZNA 3DLKA 2EKYA 1RXVA 5CZXA 2PFPA 5DM7Q 2HEKA 2MEWA 2V7ZA 2AH5A 4P7TA 4C4TA 3CM6A 4DV7K 3A5OC 1F5SA 1ZQXA 1X1PA 1N0VC 5GTIU 1K9MO 1ZQRA 2V8VA 5H9EK 5AIAA 1IV0A 3D7SB 5IIMA 3VAGA 3EVOA 4IL6U 2E2QA 1HBMB 4DCHA 1ASWA 4AUKA 5D6GA 2OMLA 3HD1A 3ILLA 2HNDA 1MMNA 1RAEB 2DR6A 2ZH6A 4MHVA 3FGUA 3KKSA 1IKWB 4OHZA 3S6EA 4NXMJ 2EHGA 2PAVA 2EX3A 4GC6A 3AVIA 4ZPDA 2J7WA 4MQ3A 2QKBA 4OZLA 2W11A 1BWEA 4KTZA 2VG5A 3HHDA 2F9WA 3JSMA 3LM2A 2DH8A 3TEGA 3MM6B 2ATQA 3MCOA 2FSKA 1K1SA 3KOAA 2FY1A 1YBAA 2NYIA 3TZZA 2RKIA 4BUGA 2O67A 3SQ4A 1WBDA 4BGDA 1UQVA 7ICNA 3J7ZT 4UUWA 1NAQA 1BG3A 1BGXT 3ADAC 2LU2A 3CF5L 1NK8A 4HVZA 5F8GA 4MYTA 2GUPA 2NPFA 2ES6A 3RH5A 2WSEC 1KDNA 1U24A 5AXMA 2UXCF 4DX5A 3TW0A 4CNYA 2M8DB 4QS7A 2W3SA 4QR1A 4KPYA 4YHHJ 3CP8A 4ENOA 4DV0K 1NJIO 3O3GA 1TL7B 3KLHA 4FJ9A 9RUBA 3ATVA 1H74A 3MPWA 1Z00A 5L9NA 4L74A 1DLOB 3CCMS 2B6AB 2QWRA 4NYNA 8ICZA 2WF6A 3IWNC 3PIOL 3A0BU 2XSJB 1J53A 3NBPB 4CFCA 2XULA 2EK1A 5AJ3J 3WX8A 5AFUA 3KLEB 2BUPA 5E2QA 1CI4A 3MC1A 5B0CA 4M7YA 3MFIA 5D4BA 1VCTA 4ZPBA 4QR0A 4OCZA 4RNOA 4DR5K 3G4SS 1X6JA 4BQZA 3HT3A 2GV1A 4K4YA 1TFYA 1OSDA 4AP9A 2D0PA 2HB5A 1J2NA 1LXJA 1D0EA 1OJ4A 3PHEA 1ZTWA 3K1RB 3K5OA 4EI2A 4H5VA 4C1NI 2HHHJ 2AHOB 2BCVA 1PZNA 3OTOK 4C80A 3HL8A 5HQMA 2HBMA 2ZIWB 1PC5A 1SAZA 2MKKA 2A40A 4H0OA 1BISA 2JRSA 1R8CA 2W2OP 5IQQA 2H3QA 3O8MA 4LIRA 1S6PB 2XLJA 4RW6A 3THPA 5C2FA 2NLWA 1RA7A 3C5FA 3NNCA 2HQIA 3VV2B 2GH1A 4PHDA 2ZWPA 3ILOA 5A2QY 3NCIA 3AAQA 5AKLA 4PA1A 2XY6A 2V8HA 2AJFE 1U48A 4H4MB 1RTHA 4HDGA 3T5LA 2B56A 4FVCA 2QG9B 5ETMA 3ICXA 4X62F 4FCYA 2ZKTA 2RHQB 1G15A 4HKQA 5E3PA 5E3CA 3DI6B 1SPBP 3PHTA 3AVAA 1ZM4A 1OY9A 2ZWOA 2ZJAA 1IBKK 2LPEA 4HLBA 2ZBRA 3KJQB 5DM6L 1UAXA 4BC5A 1VQ6N 1WNEA 3WNHA 2LA6A 3GWCA 4NI2B 5EGYA 1HUOA 2M2BA 1FVSA 3PV8A 2NNWA 3TPQA 3OW2R 5J2QA 4ID1A 1QE1A 4DSEA 1FRLA 2EANA 3N97B 1QAJA 3D9BA 4K7QA 4GVBB 4B9TA 1BUXA 4OHYA 1A76A 1RQLA 4DV1F 3UN5A 3I5BA 1NDCA 5ALYA 3M6WA 1ZAVA 3PX0A 3L4PA 2QWMA 3CDBA 2ZXHA 4DU1A 2Z2ZA 3AHPA 4YY3F 3O9SA 3GLJA 1TU0B 4HACA 2J76E 4LBPA 2IHMA 5T7LB 3UR0A 2KE7A 2B0GA 5EWGA 3BF3A 3SK3A 4WFAQ 2J8SA 3RB4A 2VUGA 2FJEB 3SCLE 3AQEA 2XS2A 2ASMA 1BPDA 4ILJA 2R7SA 3N7RC 1N4LA 2BQRA 1QAXA 3MCNA 3PTWA 1BA0A 4URGA 4CGDA 4O4GB 4NM1A 4JAXA 3N28A 3D3BJ 4F92B 3EW9A 4IQWA 2W9MA 2CPZA 5ETSA 1Q46A 5J1NA 3IBCB 4FFDA 4C6AA 1KQSM 3UN2A 3DXKB 2DRBA 5KT4A 2I1RA 1U45A 1KHVA 2W9BA 4GMKA 1ZQNA 4LQ3A 4USTA 1J5OB 3VQCA 3BKTA 1RWNB 3D28A 2ZM6F 3CJ4A 3O2IA 2VIHA 3BGOP 3K9JA 4C11B 2O3DA 1PVRA 1TELA 3V9XA 4QOZB 3CCLN 2CXYA 1S1XA 3BSAA 5DQGA 2XTJP 4E0DA 4RTFD 5AICA 3R5GA 1IVZA 2E4LA 2D8CA 1YBTA 4FYVB 4JV5F 5HOOA 1VQMS 2KSOB 4US9A 3OLAA 4CJLA 1Q82O 1HEKA 4CJRA 2Q3PA 2VFRA 2GS8A 1MNEA 2AEMA 4CJUA 4N7TA 4JK7A 3C6AA 4WKYA 3SBTA 3EGWB 1IR0A 3HSJA 3CD7A 3QU4A 2ZHBA 4I2QA 3F44A 2K4PA 1XERA 1XS9D 4LY7A 1NH7A 3HM8A 3PYDA 9ICGA 3M8YA 3V4IB 4FZVA 1HNWJ 4PY5A 3Q24A 2Q1NA 2QARA 4BRDA 3JSRA 4U6PA 1RYSA 4DSLA 5EX0A 2GHWA 4N8NA 3KWMA 3GU3A 2GAGC 4UT4A 3HJFA 2MHEA 3IKMA 2BQ3A 2GX8A 1S8OA 1LOTB 5B66U 2CVIA 2M8HA 4HI1A 3THXA 3UKRB 3QT5A 3L3CA 4KH5A 4C97A 4JI7J 4P2HA 3JAMU 3M32A 1IXKA 4RBUA 3D2EA 4JRQA 2FJ6A 5F8JA 4IOBA 3JQJA 4LSLB 5CCLA 5K5MA 3FCVA 3CCQS 2EFNA 4Z6CA 3ZT1A 3QYPA 2POKA 1HR0F 2BW2A 5I9EB 4P2FA 5SWMA 4QWDA 4RQ8A 4FL9A 4JI5J 1S6OA 5FDLB 4GKKF 4FW2A 5DDQC 5JTIA 4IBNA 3MM9B 5HAOA 3M7VA 4BRPA 1FCAA 4KN7A 2FZGB 4KJIA 3CO9A 1KP6A 4B3TK 3WKDA 5HRRA 4E7JA 4YG2A 1L8OA 4FF4A 1UTAA 4DTSA 2DBYA 3V6HA 3CQYA 3FKBA 3C65A 4HTJA 2X78A 2KZMA 1S1TB 4I2PB 2APOA 4MJKA 3OBIA 1X9JA 4OPAA 4JWMA 4F4AA 3AVLA 4M45A 3SSRA 2CPHA 3MM5A 4FYDA 4A47A 4JP8A 1N36J 1B43A 4B9LA 4I7FB 4HHTA 1TK5A 4CHPA 1WC1A 4DPOA 4RT3A 1YUWA 4M41A 4X66K 2F8LA 3VERA 2N7YA 5A8WA 1VJQA 3TA0A 1VQ4N 4UOFA 1R3NA 2LQ9A 1V38A 1SXDA 3F0NA 5DETA 3BY5A 2V2VA 3WX4A 5GINA 4M9LA 2YTCA 3WZ0A 4DUZK 2K60A 1CJUB 2Q0UA 3HZEA 5CP2A 4KGVB 3J7YU 3E9PA 3TVZA 1C1AA 4V1Ak 2JC0A 3VTHA 4LF8F 4Q2LA 4DF8A 4WIQA 5KT3A 4QW9A 2XLKA 4IJNA 2YB4A 2E6MA 4Y3CA 3MAHA 3BF1A 4PHTX 3T1YJ 2XWXA 2KK0A 4NLSA 4PXCA 4ZVFA 1IBMJ 2AU0A 3D1HA 3GOIA 4O3QA 4P75A 2FTRA 3K5LA 3HSTB 1VOMA 2EVZA 3ZEUA 5IWAF 4P0QB 1D8YA 1HWIA 3WC2A 2VG6B 2FGOA 5HJXA 2GMJA 2R7TA 2W2PP 4DV3J 2QYGA 4EBCA 3VOVA 1S49A 4IFVB 4UZBA 2MKHA 2YNFA 3R5BA 3CCSS 3E9LA 2PFFB 2CPJA 4RZRA 2PMHA 2WB1C 3NMUA 3J80U 1E3MA 5J0QA 5J1EB 4ZCMA 2R7YA 4NCAA 1FA0A 2A3JA 2Y9UA 2M0NA 5BOLA 5G5GA 1U1RA 4BG9A 2AP6A 4K2JA 3QZ8A 4E19A 2VQFJ 1MQ3A 2JR5A 1WG8A 3JQKA 2H3VA 5L9XA 1I6JA 4CERA 1GLLO 3GYNA 5HMXA 5HMZA 2RAQA 2ZC4A 4AQYF 2EZZA 2JV3A 4YP3A 5E79U 5DDYA 1RLDA 3B9JA 3M9NB 4MDAA 4CK1A 2EWHA 4UBCA 1WHXA 3EZOA 3AFGA 3A8IA 4MIAA 2P6UA 3JPQA 3N7PD 4K5SA 4A8FA 2DQNB 3UCZP 3DLEA 5BXIA 2RJZA 4CLZA 2Z8QA 1WSHA 4FZLA 2ZHOA 4TQRA 2ZIUB 3DOMA 3ETLA 4A4JA 4AHCA 4RBVA 5J2NA 2BYCA 2O4IA 1NHKL 3M05A 3J7YP 1KLNA 1NZBA 2FQQB 1JCEA 1JLQA 4F7VA 3HOSA 4JKAA 3KLFA 4NLRA 3UE5A 1TUVA 1TUWA 5JMVA 4IRDA 4B8AB 4MK8A 3IBFB 2VHGA 2VFSA 5KI6A 2LU1A 4E7HA 3I4HX 3ISCA 7ICHA 2F40A 4PKDB 3PSIA 3VGTA 4I0WA 2NXJA 4Z37A 3KJVB 1HW8A 4KPCA 2G0JA 1ZQQA 2ZH5A 5AQYA 2H5XA 3ETOA 1UWBA 4PL7A 3C14B 4K4XA 4FWPA 8AT1B 2UXDF 9ICLA 2B9YA 3ZSQA 3OYHA 4NE9C 2IGIA 1RZMA 2Y0BB 4D3HA 2JEGA 1GLJO 1MWQA 1OQ3A 2WTFA 4FNIA 5E7OB 1S1WB 3QINA 5J8YA 3SI6A 1CEZA 1VQ7N 2XBPA 2I5JA 1L3VA 1RLCL 3BR8A 2VPWB 1X4DA 4B3SF 1Y4ZB 4DV6J 5A2QO 3A3NB 2FJXA 2HHTA 2G5HB 3Q2SC 5D4OA 3HILA 2GIQA 2B0CA 1WWVA 3ET6A 3R9KA 1NBEB 3HI9A 4ATNA 3OBWA 3N4WA 3MAAB 1Q4RA 4DMNA 2QEXS 2HFNA 5AQXA 1FKAF 3OGUA 2L48A 3VA0A 2ADCA 3O08A 1UWAA 2KHCA 5EUHA 2ERRA 2E2PA 5A0YB 5KFEA 2FLPA 1BY9A 4IUFA 3MM8A 5ALHA 4R8UB 4PHPA 4X4RA 5TZVA 4LSNB 8ICOA 5EX3A 1KVAA 2C22A 2OD4A 3KK2A 3ZZYA 4PWDB 2FPLA 3UIQA 1S10A 2KDOA 4Y2MA 3NFAA 2RP5A 4OZ5A 5B7WA 1RWPB 3SPYA 3CTRA 4USUA 1EAYC 1WOPA 1S5LU 3ED5A 2UUBJ 1F5BA 2KYXA 4CO1A 2W54A 2ASJA 4DZDA 4XH1A 3OV7A 2MYFA 3MOZA 3ALRA 2GNKA 2XY5A 1RWKB 1S1UB 3L4BC 2VKZG 1UHUA 5KRSA 3CB4A 1F44A 3C3LA 2JRZA 3UW1A 5CY4A 3HVWA 3DMJB 4DFJA 2GLEA 2ASDA 2F9DA 2B51A 4OX9K 2FMPA 1FXRA 2D41A 1JX4A 2FMQA 4LBIA 5CD4H 4QAGA 3MURP 3ENQA 4KHYA 4I29A 5GVQA 4IQXA 3VGLA 4CHYA 1YJ9S 2J0WA 4LF7K 2EDUA 5CE3A 2FHJD 4XUSA 1E6VA 1I1GA 3ZFVA 1DQ8A 2CGLA 1PKUA 1L3UA 4USJC 2VQEK 1LV5A 7ICIA 5BPMA 3CCUS 1PIEA 1RE1B 2E7WA 5ETOA 5F3TA 2IDLA 2DNKA 3G2XA 5DG9A 2CQ3A 1FI4A 3N6MA 1JALA 3UVJB 3C6TB 3DRYA 3B6PA 3WKCA 2RB7A 4JWNA 3GBTA 3RR7A 4C0BA 2JC1A 3CCEN 4YDUC 1Q78A 1HBUA 3E2EA 1CS4A 3QICA 2PN6A 4H0YB 3TZXA 1FFSB 4MK9A 2ILYA 1FDNA 9ICOA 1X5OA 4YOTA 4FZYA 4W5RA 1ZBIA 3ZX2A 3MHYA 4I69A 4FWOA 2G8FA 4DQIA 3H42A 2Z2MA 4EHUA 5LSLA 1XK8A 3DOLB 1L7PA 1RDUA 1W2IA 4F0MA 1TKZB 1EJ7L 1ZD3A 4KITB 3TUJC 3I6PA 4UTGA 9ICWA 2MQQA 3IV6A 4ZP7A 1Z4OA 3CJKA 1O13A 1JWWA 2V8PA 2CQ2A 5ETQA 3HVRA 3GDQA 2GHPA 4DV1J 3JQMA 3ENHA 2D3OR 9ATCB 3NY0A 2NXCA 4I2DA 1KOOA 3NOGA 1N0UA 4MIWA 3KXDA 1QZ5A 1S6QA 4JI2J 3LP0A 3D2SA 1LXNA 2ROPA 4CQ1A 1SVDA 1TUGB 3OA9A 4NB4A 4J2EA 4WQ4C 4JYAJ 3T9ZA 1YQHA 3EZ5A 4IFYA 4OX8A 2WRMA 4FXWA 3MUMP 2EW9A 5JLFA 3FGVA 3OVSA 4FM2A 4J9RA 1B0PA 4QZCA 4QYZK 1EP4B 1VSJA 4HAIA 4DN9A 3ONNA 4X4PA 1VSLA 4BRLA 4J37A 2LP4A 3CMAS 5E5NA 5A0LA 3TJ9A 4JI3J 1P90A 3CPWR 3D2QA 1LOUA 3NAHA 4GFJA 1XSPA 5F0XA 3FNNA 4NXNF 3QT8A 1RT4B 3SFGA 2I5HA 3SCJE 2ROGA 4H0VB 1T7PA 3HHLA 4OKJA 4C23A 5IM0A 1S22A 1Y5LB 3PFOA 4Y0FA 4GVEA 3THYA 3VQAA 2JHDA 2RE1A 1BXNA 4CGHA 3R97A 2RE2A 2B5JB 2FVPA 2WFAA 2F96A 3GPAA 4R66A 3RWUA 3OYCA 3RW6A 4TNOA 4B9NA 4KO0B 4IFEA 2E9TA 1JKHA 2BUNA 2YB1A 3GIJA 4ID8A 4NL5A 2QWOA 5DM7L 4RNNA 3C95A 5EOZA 5D0EA 4JV5J 4YB5A 2D1KA 2HSEB 2ZF5O 5JXSA 1WNSA 5J0XA 4CO2A 5LSRA 4ZITA 1ATSA 2YWKA 3L2RA 1B70B 2DGUA 3ZTQA 3A12A 3LTOA 4YDDB 5AQRA 3BGUA 4KTWA 1Q95G 2XHCA 3QWPA 2OP5A 3AVJA 3OR2A 7ICOA 2KVCA 1RUSA 4AH9A 3B8AX 3P8BB 2CPDA 3CWJA 5LT5A 1KEJA 3SJHA 3VAHA 2VYPA 4Y1DA 1O51A 1WACA 1DGKN 3MM7A 5B0BA 4UOGA 3T1HF 5KFSA 1BHNA 3PJXA 5L1LA 3RVCA 3RH6A 4RNFA 1CBKA 3ZC4A 4KC5A 3GDXA 2VOPA 2V69A 1ZQFA 1GTHA 2PYJA 3G6XA 4ED1A 5L8RC 4JD2B 4BBYA 4KHWA 1OW5A 2DEJA 1UPHA 4LR7A 4OIXA 4BRMA 3AN1A 2K7KA 4JI8J 1IJFB 1S59A 3NNHA 1P27B 2A42A 1ZJMA 3WQPA 3AEVA 1HPZB 2CNLB 4KB7A 1FKOA 1FRKA 3BGLA 2E44A 2KNJA 3RZAA 4EZ6A 4GKKJ 1WELA 3SENA 2HHVA 1FDBA 1ZM9A 3E01A 4Z0UA 3WC0A 4IH6A 2BA9A 5CCMA 5AQKA 2YPYA 1HX1A 3I28A 1DFDA 2B7BB 3GFKB 1VHIA 3FMWA 4ED5A 1NGCA 3M6GA 3OD2A 2Y1LB 3CCJS 3NS6A 1RDFA 3TX8A 3L2VA 1WORA 2RIJA 2L41A 4DG1A 3UI3A 3NHGA 3RJEA 3BQ0A 4HT5A 1Q86T 4Z94A 3OSPA 1ZQYA 2F1FA 3M8SA 2P6RA 1VIXA 3I96A 1RXWA 1H73A 2JOQA 4OI1A 3ZSRA 4MH8A 3BDPA 1VRQC 4F25A 4R65A 4B6JA 4QPTA 1JL2A 1O1WA 3TWZA 1SC4B 2MJNA 5J2KA 3WK9A 3BBFA 2IVFB 2ASLA 1HNVA 4CM2A 3UD3P 4MF8A 1QSYA 4LH4A 4P72A 4NCGA 1AUSL 1N5WA 2XMMA 2DHXA 2G2YA 3H1QA 3DRRA 3G6VA 5IIIA 4K4UA 5JJBA 4MDBA 3NTUA 3LP2A 3MDAA 1TMJA 3D2FA 4GO7X 3AY0A 3IR6B 4LF8J 4DL6A 1D9FA 1A5WA 4O3PA 3CJAA 1U8WA 1FNOA 1E6YA 3P4IA 4OJ6A 2GEMA 2U1AA 3SCKE 1UFLA 2BW7A 2PE8A 2F1IA 2QW9A 3G0ZA 1FEHA 4UQGA 1Q0NA 2CWXA 3OY9A 4BDPA 4FZXC 4CJKA 2DCUB 2MKCA 1FFWB 3KLGB 1YJNS 2R18A 3B4DA 5BR8J 3P83D 1VSKA 4E7KA 5KT6A 5LJ5Y 1N34F 4YCXA 1V9PA 7ICRA 4Y6IA 5L46A 4ES1A 3LANA 2GJ2A 4MF2A 4AHVA 4YFUA 3A0HU 2D7SA 3MBYA 3IUCA 2ZJ5A 1QVFR 4EX7A 2FBXA 5KT5A 3K0SA 2G1DA 3OW2M 4YUDA 1IN0A 3VQPA 3HLUA 5FRMA 1XC3A 1WEYA 2XHBA 1B0XA 4L73A 1HNZJ 2I7PA 2OJ3A 2LMRA 1HWKA 2EC0A 3MR7A 3C46A 2PGCA 4F71A 2K06A 3RGIA 4KSEB 4J9NA 1EIYB 3SYZA 5HROB 4ZPCA 3M2VA 4NXMK 3A5MC 4HT7A 3TJAA 2BCQA 1WUDA 1EQ0A 3IRXA 1XMQJ 4LFAK 1NU4A 4CNQA 1OH7A 2A1SA 3HVTB 3DGPB 4OPKA 9ICMA 1BO5O 2R8KA 4CF4A 4OYBA 3ETRA 3DYAB 1FO1A 3TA2A 1FJCA 1UJ4A 1V6HA 2XGQA 2FSNA 2KH9A 4XH4A 1XO0A 1NUEA 1RXOB 4LR8A 1WC3A 2PY5A 4IH5A 2RHFA 4Z7YA 3HD2A 1R59O 4RW8B 2WUSA 5BYRA 6FD1A 3A8EA 2VBZA 5DLGA 1LWXA 3NNAA 2FC8A 4WFAL 1RDWX 1MQ2A 3D0HE 2R7QA 5A6WA 4UB1A 4HI2A 3RH4A 4ZCKA 4NY8A 1DARA 4IRKA 3PVXA 1TL1A 3H08A 4QZHA 1KS2A 2ZH9A 5AXNA 4XDCA 3RSEB 3OPKA 2V2KA 3T41A 4A62A 3K2PA 1LWFA 4NLXA 2H3FA 2QXLA 2MRLA 3RMCA 1W9HA 2V94A 4M63A 4YOUA 2BJ9A 1D8BA 2E9ZA 4CJEA 1NOYA 3ITHB 4DTRA 3TABA 2MAXA 2A3ZA 1Y88A 5SZTA 2VOOA 2G09A 1VRTB 4C7YA 2CA9A 3BO2A 1N32F 2D1CA 3TI0A 5C42B 5JICA 1MWMA 1XNRK 3DDNA 2XY7A 5BPLA 1MA9B 3PSPA 4RNMA 2PEHA 2RRBA 2ZJPQ 4IYQA 3MOJB 2CJAA 3B54A 4RL1A 1OVQA 5I4MA 1YJTA 1PK1B 3Q8RB 3A1YG 5GAGI 4NWBA 2Y0SF 2HZAA 2KFZA 3G6ES 5J1PA 3NRBA 4AM6A 3AO4A 9ICFA 3PM9A 1Q81T 2W8KA 2PFOA 1P8GA 5ALTA 1EQYA 4CJPA 4YS2A 3JXUA 5THWA 3MD1A 2JHEA 2WF5A 4GVMA 1UFKA 4B3MK 4ZVPB 1IKWA 4FS2A 3QMQA 3PMLA 1YJWN 2Q79A 2HG4A 3CO0P 5HVHA 1G4CA 2L3MA 1RP5A 2RHSB 2J6SA 3ZSVA 1DKGD 4CVNE 3RMBA 1KXPA 1RABB 3VHQA 3VQTA 1NGFA 3T5HA 5GMKa 2YNGB 2EBGA 1OSCA 5A8KA 2AX1A 4RPZA 1RBLA 3AVNA 3ZNUA 4AILC 1Q79A 1JI7A 4RUCA 2DK2A 2HK2A 1PSDA 3FFKB 4BACA 4QIWF 2C3YA 2RD5C 3MI7X 2IYIA 3ZTRA 3I5AA 1Z4UA 2CJKA 3F2BA 1KDHA 4TUPA 1C0FA 1N54B 2IVNA 2DHSA 2J7UA 4GO5X 2EPIA 1K8AT 2ZUDA 4JI1F 3G6YA 3H7IA 1HBNB 4P2SA 3B4MA 3GR0A 1EXNA 4NLQA 3KNGA 5ALEA 1UT5A 4JKHA 3SQ2A 3BEXA 2QXFA 5FLXU 1L8LA 2M0GB 4CGZA 3LF0A 4YD2A 2K89A 4LRDA 3IBPA 4NLOA 3ISND 2D6FC 5M2PA 3KLVA 1RCXB 3CCRN 1TQLA 2B6AA 4X64F 3PRBA 1KOHA 2CPRA 5K4LA 9ICRA 3TVKA 4C1NK 1UW4A 2BDPA 4Q43A 4FZNA 4KLMA 3MD3A 3OXLA 3H8SA 3KLEA 1ZBFA 2C2NA 2O1PA 4FJNA 1OY6A 3R6LB 1E4FT 1YI2N 1FIQA 1ZBSA 4CH1A 4PKIA 1KL9A 3G4SN 3SBGA 1EARA 2EI5A 4MYUA 4DPXA 5LMUF 3FZHA 4NWIA 4LT6A 2G2ZA 1XR7A 2QN6B 4YOYA 2EFVA 4C8YA 3T79A 5AZJB 4E7IA 3TA1A 4ER8A 1VLOA 2A1BA 2CZ9A 1BI4B 1FEEA 4OJOA 1OYEA 4DUYF 4JS4A 1OPIA 3L0QA 4ED2A 4E3SA 2UZAA 2ZIWA 4PG8A 2VFVA 1ZRMA 4JKFA 4K0KF 3TTCA 2N4DA 2RT3A 3M6KA 2G8IA 2EQYA 5KFFA 1UFWA 4N47A 3IRUA 4DR7F 4A8XA 1T94A 4US8A 4CEZA 4F50A 2A18A 2Y0SD 9ICCA 3MGJA 3WK6A 4FP9A 1VSIA 1JLGB 3I56N 1S0VA 1H2UX 2QYCA 1QVGM 4NMXA 5I3QA 1TKTB 2QA4S 1R0BG 5CABA 4H4MA 3CD6S 1U8SA 5IC4B 2AKWB 2V63A 3F9KA 1WDTA 2V51B 4EAHD 2AT1B 4HTUA 1MWYA 4Y2VA 3JAMO 3AOBA 2CZ4A 3ALYA 3LP3A 3GMGA 1S1VB 4B9SA 4E89A 2HOEA 1RJJA 3E66A 2L9WA 4JKCA 2ZD1A 3IGNA 4M3RA 2Q6BA 3H2UB 1I94K 4NXNJ 3QU7A 1HNWK 1N33J 2H3IA 2ZXIA 4JI6F 3W62A 4KFBB 4CJWA 2PT0A 3W60A 3WT0A 2JZ5A 2VKRA 1S76D 2N82B 5D3GA 3ZZRA 1ZETA 1Y0HA 1U25A 2ZZTA 1SUQB 4QIWD 4H0TB 3F73A 2OYQA 3A3PB 4A2BA 2FIUA 4RQ2A 2IAJA 3VEVA 3I87A 4JI7K 4GVBA 3LP1B 1MROA 2YX4A 1A77A 2GAHC 3JPSA 3NGKA 1CZ9A 1HUXA 4FO0A 3KKAC 1NM1A 3TUIC 5DRKA 4EENA 4CYUA 3ID6A 2BRLA 4DCPB 2OEHA 4V19J 3U7JA 1SWWA 4UBBA 2AYMA 2V6AA 1KVIA 3NS1A 1HYVA 2P5GA 4JI5K 1T6CA 3H2LA 4G1QA 3S7RA 5LMNK 3TKAA 4RW4B 2AJ1A 5KFYA 3CEDA 3HRGA 5J2DA 4F4YA 3KG1A 2AZ3A 1W2BM 2QFJA 3QIPB 1NGHA 5IT4A 2V0NA 3L7PA 2V5HG 4O4GA 3MXIA 2R8JA 2UVUA 3MN6A 3AO2A 4ZLLA 4FJKA 1ED1A 2YJFA 2YKAA 4I2AA 2GO8A 1KFTA 5LY3A 2C2EA 3NE6A 7ICLA 2P9UB 3DXKA 3N4MB 4IG3B 4ZVOB 2KHDA 3KJNB 2CQBA 4ZDNA 2Z2YB 4RCHA 4B3RK 3QRRA 1DT9A 2O8FB 1Z3EB 1MMDA 5L1IA 1RDCA 1GO3F 4BRHA 3WKAA 2IOCA 5IOLA 1Z2LA 4JLHA 4NCBA 2F8TA 5GAEI 3CM5A 3J7AN 2CNKB 2V4QA 3MFHA 4M3WA 2DGVA 4ZJLA 4RJVA 3K57A 5KFLA 3J80O 5IXUA 4CTAB 3TOQA 2AMCB 3T1YK 1LKZA 1IBMK 2E5LJ 4RQ6A 3KWGA 3OL8A 4ED0A 4XTTA 3WXJA 1S9FA 4DF4A 1VLYA 3PYFA 3NGTA 3OUYB 1NGAA 3JS9A 5G4DA 2E1ZA 3O1LA 2NREA 3SUPA 4TU9A 3P5JA 3JXOA 4JI4K 4DV3K 3C29A 3NOCA 2KT5A 5AI4A 4ZJOA 2ZNYA 2HDOA 1IQZA 1VQ6S 5RUBA 4LFCK 3BO3A 4H5RA 2F8KA 4RKUC 3K5NA 3B6OA 4OJRA 1KONA 1A0OB 4XEIA 4FYXB 5CH7B 3CJ8A 1JQGA 4ILRA 1VBKA 1OVYA 2DR5A 2DR7A 1BVSA 3VZHA 2DIVA 4AHRA 3DRXA 3CCQN 3KTQA 3J81j 5M1PA 4J9LA 2WOMB 2WAQC 4CO5A 1X5TA 1RWUA 3HSCA 4I2JA 2HGMA 3D3CJ 4ES2A 1JLFA 3CCVN 1HPMA 1WJ9A 4A8QA 1NSKL 2UU9F 3SBMA 3UCUP 5EWFA 4IR1A 3CQ8A 4RQ5A 3KUGA 3C15B 2KN7A 2O8EB 5KT2A 2G2OA 4BWJA 1CZBA 3TUPA 1S9EB 3JYTB 2GMLA 4QR2A 4CF3A 3QUTA 2FHJA 3FR0A 2E1RA 2J4RA 2DGSA 4OPJA 4I7FA 1T03B 1HIYA 1KC8O 2MJUA 2MZQA 1T4GA 3R7NB 3N6NA 4CM0A 5KG6A 1YITN 3H5YA 4FJ5A 1RT5B 1I39A 1X9SA 2FF3B 3IHQB 2RDIA 3OTOJ 3ATUA 1ZQHA 3C7NB 1FNXH 1EETA 1VFJA 1RHMB 4DOCA 3CIMA 4L3QA 4P0PB 2XI3A 3ZDBA 3D6HB 5CYQB 4DPUA 3HM9A 3ZETB 4G1PA 3PW2A 3CCLS 2VB6A 4WBFA 1BMQB 3IM1A 3FJ2A 3QFPA 4GIBA 1R8PA 4YR2A 2RF2B 4LFBF 5ADZA 2MLZA 3W3DA 2QIFA 5F2RA 4GC7A 2DPJA 5CD4A 1ZOTA 2HQ3A 3SJJA 3CPWM 4UW9A 3RB3A 3D67A 2VH7A 4O3MA 4WFNL 4CHZA 8ICMA 4LF4J 2V52B 1T9XA 5KFXA 4FF1A 4Q5VA 3FMBA 3VEXA 2R42A 4DHYA 4KLDA 2CJBA 3IG8A 2LEAA 4CRXA 4X4UA 4KLGA 1PK3A 4RPFA 1OPZA 2M7SA 4IC9A 2P9CA 1HI0P 5J29A 4FVUA 2RU3A 2IS3A 3QNMA 5J1EA 2RMLA 4X65F 4QZEA 3ORYA 4ZOHC 4U95A 1ZQAA 4OYIA 4LF6F 9ICPA 3TAQA 1NNLA 4OZJA 3M30A 3QE9Y 1FERA 3DV9A 1URNA 3MMAB 3CXCR 4ED4A 2NUBA 4CZMA 2P9GA 2MB0B 3BREA 2IVOA 3O4QA 4C8LA 3DLJA 1MC8A 1B3TA 4AD6A 2NUHA 4PRFA 4KN4A 3M2UB 3F2KA 4FBUA 2F1JA 2UUBK 2XGPA 1DGJA 2G9OA 2FD2A 1KR4A 4ZVEA 4TUSA 4WK3A 3H20A 3BSOA 4DWIA 2ZGYA 3NF7A 4ILGB 5CZVA 4AYBC 2YMPA 1PAUB 3AAWB 3EY1A 1H0HB 3SAHA 1NK6A 2LM1A 4PXDA 4G6VB 1AFIA 2AGOA 3L9ZA 1BPZA 3KDOA 1VQPN 2X1BA 2YMQA 1RAAB 2V4RA 3AJ2A 4XA5A 4C4WA 3OR1B 4Y2XA 3ASMA 1HYSB 2BCUA 8ICGA 4QS9A 1VQ4S 4CF1A 3GG0A 1S77D 4RQ1A 4B3OA 4DV4F 1R6YA 1P8ZA 1RPLA 2XI9A 2GMHA 2YCHA 4I67A 3OS0A 2GQQA 2LECA 1RQ0A 4DCOB 3PKYA 2HI0A 3KJVA 4IO1A 1IG6A 3ZT2A 3LDLA 4ZTFA 1JMSA 2GC8A 2KD1A 3HYFA 4OKKA 4X62K 2DY9A 1Q3UA 4NZ6A 3OXFA 1F1BB 2R2RA 3GR1A 4OV6A 5CZ2A 3WQTA 1CC8A 4IG0B 1U2RA 2I38A 3KVGA 3WIVA 3TEHB 3NG8A 2C42A 3MEEA 1NO8A 4ISFA 2ATLA 4M47A 4A8MP 3RJJA 3MAAA 5FLXY 4U9RA 2HBRB 2BJ3A 2FJDB 3F2DA 3CDWA 1NK0A 2RVJA 4BCAA 5A0YA 1VDVA 4JRPA 5ALWA 1IV8A 4KGXB 4EGLA 1IBLJ 4DV1K 2FC9A 4ZLJA 2HIQA 1A5VA 1GX5A 4A5BA 2W7OA 4LSNA 1Q1KA 4RW7B 5AQJA 3P49B 2VBXA 2CYYA 3IP4B 2YQ1A 2YX8A 3P5BP 5AKHA 4JYAK 1Q18A 4IH7A 4DR6F 3HCXA 2NYVA 1W26A 1TUYA 2IVYA 1FXDA 4UATA 1PO6A 5DZ6A 3Q8QB 4KH4A 2I6XA 2FE9A 3O9QA 5KFGA 1NDLA 1YRXA 3RW7A 2A1RA 1VLBA 4B1UB 4BR7A 4B3TJ 2H4YB 4BJQA 2EWSA 3AVGA 3DMJA 1QVFM 1J5EF 4ICLB 5DDPC 3JPRA 1YTUA 1MLAA 2QE5A 4KRFA 1RT7B 1QAYA 3LUYA 5GTHU 3LYSA 4K0KJ 4DL5A 3DHWC 5SUHA 4HCBA 4LF2A 4ECUA 3NF6A 2XYHB 4X4TA 1FW6A 4UB5A 5ETVA 2ZM6K 1S6UA 3DLGB 5AK3A 1S4EA 1MW7A 2DNRA 2UVVA 4PGQA 1K8KB 1T9TA 2L9NA 3Q2TC 4U8VA 4CDGA 3UMBA 1NKCA 3O4WA 4WJBA 2M70A 3G82A 4WFZA 3SAGA 4J03A 4JV5K 1TVRA 5J2FA 3QRQA 3S1TA 2NR0A 1NH8A 4DUZJ 3UVJA 2DGXA 3C6TA 3LAKA 2O8BB 3WHIA 4ECVA 1NGBA 1WUAA 3W5YA 2HSTA 3H8JA 4CZGA 4RQMA 3OPXA 2QLWA 2UP1A 1TAUA 1URJA 3M6ZA 2JMGA 8ICIA 2ODGA 5DB9A 1N8RO 1QSSA 2CJQA 5AXKA 3ZDDA 1NRKA 3HKZF 2R8GA 1JLCA 4OI6A 3KK3A 5AQOA 1ZA2B 5KFPA 4C0OC 1U1MA 1VQ9N 3OFHA 1NWKA 3CC7N 1NGJA 3U1MA 4HYKA 4I64A 5ALZA 4DLEA 5KNIA 4PPXA 2KJ8A 4XK8C 5U47A 4JV0A 1L3KA 4M5GA 1ULRA 5ALOA 4FE3A 5AKXA 2BEFA 1KQGB 2BMBA 3FBBA 4F5NA 4HHUA 2IY5B 2B3TB 4G65A 4IDHA 2E5IA 3VQSA 2DH9A 4GKJF 1COKA 3C94A 4JI8K 1WKLA 1GX6A 3PRVA 3J8AA 3WK8A 3N79A 4CJVA 1HR0K 2HFZA 1X4CA 2YWWA 1AW0A 1SIWB 3DM2B 1S3XA 2CQDA 5HI7A 2H54B 4GKKK 2DGQA 1NDKA 1T3OA 2RU9A 5AQSA 1PVQA 1RU1A 3DWLA 4CF8A 3OYBA 4DV0F 1EP4A 4CLPA 5DQHA 3ZX0A 4OJ3A 1M5PC 2DWQA 3V81B 2FZCB 4A61A 4CZCA 4X2BA 1S9GB 1C0GA 3EUNA 1YDLA 2WW4A 4KHQA 4K5RA 2P9LB 2WONA 4C98A 1RT4A 3W63A 1FDAA 3VQ9A 3IAM9 1HNXF 4CIGA 3MN9A 3MX5A 2MZ1A 5DBBA 3DDHA 2NQPA 3BSCA 2O5DA 3D66A 5E84A 4M1KA 4LZDA 2R2UA 1YRTA 4PL8A 4W90B 1LVHA 3HULA 2ZJQQ 3SUQA 2ZOFA 2W3RA 2ZJPL 4LRAA 2GWSA 3VCDA 2MY8A 4Y28C 2LBOA 4FLZA 5IIKA 4JHDA 2KJ5A 3G9CA 4ZVTB 1OWXA 3K5PA 5JVGQ 1ZQ1C 3IO1A 4O55A 5DDOC 3AVMA 2YHBA 4B1ZA 3VEWA 1SB3C 3I9V9 1CXUA 4LF8K 4F4ZA 3C1ZA 3DXBA 2UUCF 2VWJA 1NJZA 3QFWA 1AUDA 3L4QA 4Q2MA 1MWKA 3NH1A 4DKWA 1OO0B 4YOVA 3X1LB 1SJ1A 1F3VA 2BJ7A 4ZJQA 5BRFA 2G8VA 2D0AA 4DXLA 2BKPA 4YN3B 1BC6A 1X3MA 4JS5A 3TYTA 1V4TA 3H4BA 2NXUA 5IT0A 5DDRC 3QAEA 5BR8K 1TE2A 3ZT4A 3UMCA 3H7HB 4QIFA 2OO4A 1H1VA 3LH2S 3HZ6A 1Y5IB 3BGRB 3VR1A 3MCMA 3KFUF 3CJQA 1VMBA 4KBIA 2DCLA 3K59A 7ICFA 5ALDA 3HKZD 8ICXA 1QUPA 1A6SA 3AJ1A 4KLEA 4YMNA 1XR5A 1Y3JA 4ZVGA 4ZLPA 2P9IA 2NXNA 3JB9k 4G9BA 2DHAA 1KSPA 2KXHA 3I55S 2FPKA 2OPRA 3FAHA 3R1LA 2E6LA 1KQQA 3D0PA 3OTQA 2DB1A 4C3MA 3R5CA 1IBKF 2QI2A 1HKAA 3CMQA 3S3OA 1YJRA 2DFFA 3SLCA 3JPPA 1PBUA 1TZ0A 1YTAA 2V2ZA 3EGVA 3PDNA 3MMCB 1NNDA 4AQYK 1BQNA 4IEEA 4EHTA 4CD3A 5AQQA 2VA8A 1IKVB 4C0ZA 1NPPA 3JSYA 2P51A 1NSPA 5LL6d 5AE2A 2BV3A 1SKWA 1LFWA 2E7VA 5HHIA 3CD0A 3F41A 4F5RA 1QQ5A 5KG0A 3UB5A 4UOCA 2IA0A 3CDEA 4IOXA 3T69A 4KMOB 2PDAA 2W40A 5HN0A 3CQXA 3V7KA 5KFHA 3SQGB 1QCKA 1RFQA 3P6YC 4OX9J 1A5XA 1G3OA 1NMEB 2P6SA 3NGDA 2LSNA 2FI1A 2YKPA 1QQ7A 3PIPQ 4QWBA 1REVB 1KRPA 1VSMA 4LF7J 3DXMA 4Q45A 2F4VF 5HP1A 3VF0B 3AQFA 2QB0B 4QPXA 5FP0A 3V6DA 2ZH3A 1HARA 5F9NA 3GYGA 4FF2A 4CZIA 2OHFA 3N0VA 1HWLA 4Y2YA 3GCXP 4DL3A 1H7WA 1V5VA 1U2VA 4LFBJ 4HH1A 4LVSA 1GXUA 1FWPA 1IR1A 1JCGA 4YOWA 1RBAA 2KN4A 3UMGA 4E8UA 4HUFA 3SQOP 1SQGA 1IWGA 2DNGA 5ALPA 8ICPA 1LK5A 3QSYB 4JBCA 4FWSA 2C2DA 1KFDA 3NVZA 1V3ZA 1N5XA 3PEHA 3M5RA 3LDAA 1U7LA 4IDKB 1OXJA 3LDSA 4NO7A 3CPEA 4CO0A 2X3DA 4X4SA 3WEEB 4CEBA 4ZMMA 2BM0A 3ILIA 1Q7YO 4X65J 3FBFA 3IA0A 2WB4A 1NU0A 2H3GX 4LF6J 2JX2A 5AI8A 3QUQA 8ICVA 4Q7AA 1X9XA 4CIFA 4LVOP 3W65A 9ICJA 2IC3A 1Y10A 4PQAA 1RNHA 3W66A 2JLGA 2KVIA 1APSA 5FLXO 1X31C 3SUNA 3MMBB 2VJ5A 2FPMA 5CB1A 1KD1O 2XY8A 1F0MA 3D6JA 2W2NP 3OHBA 1U2FA 2ESEA 3EKSA 2ZIVB 3W8PA 1IJJA 4BRIA 1U0HA 1Z1ZA 7ICMA 1HQ2A 3RJHA 5F8IA 4MKYA 4I27A 4RW8A 3KUHA 4PG5A 3BEGB 2XM3A 1JLAB 4DTPA 1X60A 3H8WA 7ICTA 1BIUA 3DLHA 3V5RA 3Q8LA 1LK7A 3OJUA 2J9EA 3IWLA 4PR6A 2P9NA 3OTEA 3DOKB 4UASA 3Q7BA 3P96A 1TL5A 5A8RA 2XNRA 4FOIA 3ETMA 3CDUA 3EWAA 5LM7E 3MCAB 1XNQJ 1GXLA 4NYFA 4NLBA 4M5JA 1FK9B 2Y1IA 2HFSA 2I1QA 2FPHX 4O44A 3DLKB 1U26A 2Z7JA 4L6V3 2YQ0A 5GAHU 1WTBA 4FDFA 4WXOA 2D3ZA 2FB0A 4NLDA 4YR3A 4Y2CA 2OWOA 5F1XA 3MCPA 4M6WB 4LVNP 2WC9A 8ATCB 3T5JA 3OFEA 3FE1A 1T95A 2KFYA 5AHXA 5DGAA 2KXNB 3J81Y 2ROEA 5CHCB 5HBMA 4R63A 1RHJB 2HRUA 2CXEA 2XC9A 5CHGA 3UR3C 2XNQA 5KFNA 5G0RB 3H4DA 2F77X 3CJ2A 2GGPA 3EDQB 1UEVA 4IRCA 3AMZA 2GELA 2F5GA 5J2AA 1P1TA 3EEQA 5ALKA 4EEKA 4CK2A 2FHOB 4H5WA 2VG5B 3A5NC 2OM6A 5A6PA 3JSMB 3PG9A 4CNZA 1Q53A 5EX5A 2J7KA 4O4RA 2A2DA 7FDRA 3TACB 2DTJA 4USVA 2KJ9A 1KVJA 3M8WA 8ICEA 3QEIA 2RKIB 3K75D 3GFXA 1VSDA 4KLQA 1YT3A 2XHWA 4DLGA 3LVVA 7AT1B 2W9CA 5EY4A 4FLUA 3H0LB 3MEKA 4DR6J 3O3HA 1OH6A 2ISPA 1ZQUA 1M0SA 3OYAA 3TP2A 5ELZA 4UY85 2K4EA 1N6QB 2KV2A 3FZKA 5ETTA 1LCUA 2VODA 4FVMA 2KMDA 2ALZA 3L6QA 3CMES 3IG1A 1ILYA 1G2EA 1Z00B 1M90T 5HP4A 1DRGA 2A10A 2MQ8A 2NRZA 1J5EJ 4GW6A 4UQTA 4RUBA 3NMRA 4NXNK 1SJQA 4P10A 5F3ZA 2MGZA 2MMYA 2H51B 2ZIXA 2CPXA 3HK2A 4U7UD 3OBYA 3F53A 3BS5B 1PYOB 4Z6FA 4EO6A 5IFMA 1HBNA 3OYNA 1U1QA 3W8GA 1BQMA 4OQJA 2ZDPA 3H5UA 2DFHA 5GAHP 3OS2A 4USWA 4XH5A 3RMAA 1TAMA 2IM2A 1M5KC 3GJRB 3BPDA 4RQ4A 4J5OA 4BHQA 2WFBA 4I9QA 3I0SA 3HX9A 1N5YA 3CJBA 3IRWP 3C6UA 2DXDA 3HHLD 2XO6A 3MK6A 1YSJA 4N5SA 2KKZA 4UUXA 4TY8A 2DPIA 1VYAA 4CH0S 4ICAA 2BBEA 4CLTA 4EFAC 2BE7D 4PG7A 5MLCV 1TFRA 2OAUA 4I2IA 4D3GA 1K9MT 4N8OA 3KD1E 4HUGA 1WHWA 3VQBA 4GRSA 2KP7A 5GIOA 1GLBG 2DGWA 4OYWA 3IFRA 4NPOA 1F3FA 3W5ZA 3T1HK 1D4XA 1UEUA 1YJUA 2QWLA 2CKWA 3QO9A 3UDCA 1BL3A 1RTHB 1BI4A 3QESA 2R2TA 4DFDA 3B78A 3KKFA 2YVSA 4F3QA 1Y7PA 4UY8O 3AA9A 1KQKA 3DAWA 3SQ0A 3F56A 4ZP9A 1QJHA 4DSJA 1XO1A 3K4GA 4MFBA 3GTYX 4GKJJ 1AZSB 1TAQA 2KICA 1S97A 1HI8A 1IQTA 1SQFA 2AJ0A 3Q8UA 2KHQA 3OYEA 3R9PA 3QQCD 1SH2A 1KTQA 2OI2A 3ENAA 4WYBA 2BXJA 2DBBA 1FD2A 1JLGA 4USHA 2R7RA 2Z1IA 3MECA 1NHVA 4AL6A 3SDEA 1ZQZA 3CXCM 4R5PA 3AV9A 2C3OA 4YMMA 2QA4N 3QUBA 1K5OA 2B4VA 5FPDA 3CD6N 3AODA 4K4IA 1AQ6A 2W1BA 1YJWS 3CW2C 2Z1HA 4E7LA 5J2QB 5AQIA 2WF9A 4Y2RA 1QE1B 4LFAJ 1N52B 2IOFK 1NEEA 1SQEA 5J2MA 3AB2B 1V97A 4LF9F 3AA4A 2E5LK 5E26A 4FLXA 1NJIT 2AD9A 3SQ1A 2VGNA 3AT1B 1N88A 5AE1A 2E5GA 4K4TA 4Z4EA 4FWNA 2YWFA 1VSFA 5J0SA 3GL1A 2EKNA 2P5VA 9ICVA 1V4SA 5M1NA 2M4MA 5HMWA 2IVPA 2HW3A 1Q7LB 2MKSA 3H2VE 4I6YA 2ZJRL 1S7IA 1U0SA 1U6ZA 1NCLA 2F9TA 1CSJA 3PFEA 5LJWA 5HQLA 5I42B 5AM0A 1SUQA 8ICWA 3ULEB 3PX6A 1TKXB 2KT2A 4MEXA 3A8KA 3PYGA 4Z6DA 2GVDB 2BKEA 3L7UA 3R2CJ 3QPIA 2NRRA 4FJIA 4BRAA 3ZZUA 4DO9A 4CT8A 3G86A 2GTDA 5GAGU 3A3OB 1UW9A 3PNIA 3Q7CA 1U6BA 2BCRA 1Z1BA 2BE2B 2RH3A 2FVQA 2HBLA 3FCWA 4EFHA 3RJIA 2WHOA 4I2FA 2Y1RI 1CLQA 4OI0A 1J2VA 1RTDA 4KREA 2W6LA 2A6AA 3CCRS 3AUOA 3CJ9A 3CHWA 1M1KO 3WXIA 1CJTA 3OYLA 4K4ZA 3EVWA 2R7OA 2W9BB 1RAHB 1Q5YA 4J90A 3HHKA 4RW4A 5J2GA 3PMNA 1QM9A 4QIVA 4F67A 4E2FB 3S41A 2VQEF 2YMLA 1FTRA 1FJGJ 1O0PA 3UCGA 3KBBA 1YI2S 3L2UA 1A9NB 1N34K 1VR6A 1TK0A 2UUWA 2JH3A 3EM1A 1JXVA 4OD0A 1XNRJ 4UB2A 3BF4A 2HGNA 2PMZC 2QMWA 3AXMA 5CHIA 3UQ2A 2WMMA 1V9OA 3FZ2A 1JJHA 5CRXA 4X4NA 2LXFA 3LWLA 1BOTO 2HHQA 3T6BA 3M6VA 1C1BA 4FN5A 3LK9A 1NGGA 4AF1A 3SPZA 5CYJA 1C1CB 4ECQA 9ICKA 1C0UA 4MMOA 1WLJA 4CW7B 3UNYA 2CDQA 4I2QB 3O4NA 5JRTA 2CAJA 4RQ7A 2VBYA 2DEIA 5JVHQ 5AFUH 3BKUA 4R79A 3OTDA 2HSZA 2QARB 3VQ5A 1UVKA 2J9DA 2RS2A 4B8CA 2HNZA 7ICSA 1WG5A 2EXUA 3NVWA 4MK7A 2YJEA 3NVKA 1XTZA 1RA6A 3HP6A 3I56S 1TP7A 3ZTOA 4B3MJ 2DD8S 4P9SA 1BUPA 3VWSA 1TGOA 2HOFA 2HNYB 1OYDA 5AM1A 4UB4A 4CTAA 1C20A 3THXB 4QWAA 4USIA 3DU6A 4GMJB 1S4FA 1YKWA 2HYIB 1Z05A 4KHNA 3D2EB 3LPYA 4BRQA 1U1LA 4FJMA 4R25A 3EXCX 1EZZB 1WG4A 2ZTDA 1NJYA 2V67A 5CA5A 3PJWA 4M7XA 3D2NA 1IG9A 4X4QA 2JEJA 4LF4K 2BJ1A 3P38A 4UF4A 3FK4A 3M8PA 4ZCLA 5GAGP 4DR3J 3S6JA 1GXTA 3QJJA 3EUB2 2IYGA 1RT2B 1WSVA 3H6EA 3S01A 3BB5A 4M2YA 4F02A 1S79A 1LNQA 3IM9A 4KAIA 3PCOB 1NZ8A 1VQON 4QNLA 1DURA 5HRNA 3MCSA 3AO3A 3UKUA 2HMIA 2O01C 2F4VJ 3C66A 4ID5A 4FLTA 2Q3SA 4CO3A 5I3UA 4PXEA 5EOYA 2FXUA 3M9OB 3MM5B 5AQWA 1EB0A 4FF3A 1T9UA 1JROA 2WOMA 3KLIA 4O5KA 1M1GA 1X4GA 3VEOA 2O66A 2CGJA 5ETNA 5DMRA 5AQPA 3HFVA 5EE9A 1D9AA 3DJCA 3R8YA 1VQLN 2RILA 2DNLA 3CSKA 4DR2J 4ZA1A 4EU0A 1UA0A 1Z6RA 1T3NA 4WFBQ 2JH7A 2JDJA 1XMOF 2NCKL 1S9EA 1KAYA 3VENA 2Y9HA 2FBTA 7ICQA 3PEJA 4P2MA 3MEDA 3OLBA 4ZPAA 2IRUA 2E88A 3VQDA 1CC7A 2GIFA 4WQ5C 4PZNA 1OH5A 4JOUA 2IDOA 3DC2A 5ETPA 1FD8A 4I2BA 1RT5A 1FRMA 4ZVSB 4CEAA 4URSA 3RRKA 2RPIA 1XQSC 2QRRA 1BWVA 1Q82T 4QZDA 4NLZA 3UD5A 2QSWA 3VN5A 1DOQA 1HNIA 1ITGA 4F4XA 3GU0A 1HLUA 2A1JB 1ZBUA 3ZEUB 1EX8A 4PXBA 2CQ4A 4IOCQ 1YXQA 2FLLA 3VAJA 4FJGA 3UQ0A 3EZUA 1VI7A 3QNOA 3VGUA 1N63A 1SV0A 3CETA 2J0XA 2RF2A 2MZTA 3FSXA 3A2FA 2PMZF 5LXYA 4G1IA 2I9GA 1DEJA 4LMZA 4CJQA 2ETJA 4LJXA 4J2AA 4NZ0A 2F8HA 2WSCC 5ALFA 1XBWA 3NAEA 5KFTA 4PPDA 2N3LA 4C8MA 2O8CA 1SH0A 4DL2A 2E1FA 4CZJA 2HHXA 2MUTA 5BPCA 3ZDEA 1WD6A 3CJSA 2P8IA 4YB6A 1Y9OA 2ACMA 3EMTA 4I6AA 1I94J 4RU2A 2XWYA 4GY2B 2CG4A 3M1VA 4O23A 3AJDA 5D49A 4CD1A 4UW2A 3SEIA 2W25A 5E33A 3AA2A 4FW1A 4CCHA 3QJPA 2QLJB 4WCEQ 3E51A 4WYWA 2FGCA 4DCJB 1ATRA 3DLEB 1IBLK 2YHWA 5IILA 4X64K 4FXDA 3SV4A 4DOAA 3PZPA 2GJFA 2P6TA 4UB6U 4QIEA 5KFMA 4IQTA 2K4HA 4JKGA 1OY8A 3DOMB 9ICUA 1H72C 2ZJQL 2QL5B 3NGYA 3FDSA 3MMAA 5J8YC 2CNOB 2Q0ZX 3MEGA 1JLQB 4DPTA 1F9FA 3KLFB 4YMOA 2HBKA 3VC8A 1BDGA 3MMVA 5CZ1A 5JVGL 1Z19A 3CCVS 2EEYA 4EP5A 5LMNJ 3GP9A 2ADBA 2VG7A 5LMUK 4E98A 2A1AA 1NKBA 5J0UA 3WDOA 3D0GE 3CIPA 4OJ1A 2PFNA 3NRWA 2P9SA 3L4IA 2HVHA 2ABYA 4JI0J 2YX7A 2CH5A 4DS4A 2QX0A 3VALA 1Y5NB 2YWEA 3NF9A 1Y00A 4M5IA 4K0KK 2XB2D 4TURA 3HO1A 2DFLA 1WOQA 4RQ0A 4F04B 3H0PA 4AE5A 2W6KA 3NGUA 1WN7A 1YITS 3M3ZA 1XIQA 4F3TA 3PW0A 1BA1A 3PO5A 1T9WA 2BGWA 1WWHA 4K8ZA 1FRIA 2LYVA 3MPUB 2JWKA 2I5JB 1SV4A 2IRXA 5J2PB 4CGFA 1RHRB 3TANA 5KPRA 5H1SQ 1X4FA 1UL3A 5C25A 4JMUA 1VJ5A 2W43A 4B3RJ 3QNNA 3ICLA 4CEOA 3ET6B 1CZAN 3MABA 3TRGA 1WSGA 4HTIA 4ITSA 2A19A 5L38A 3FQLA 5CYMA 2OLWA 4DX8H 2VF3A 3H40A 2RS8A 2C1EB 4ZHRA 3RTVA 3C2LA 1R8AA 1CRXA 4CEEA 3KJFB 4GLXA 3IP0A 3LDNA 4P71A 3EDRB 3OTCA 3DRPA 2QGFB 2B6GA 4ECXA 3KK2B 2DHHA 4OJLA 2PMZD 3NVVA 2BRKA 2L9DA 4JI6K 2E2OA 4W5OA 3UXNA 3UE2A 4ED6A 2WW8A 2YKNA 1FT8A 3Q8PB 5CAAA 1ZBLA 4ELVA 2M9NA 4OFZA 4JI4J 4ECTA 1O8BA 2ZTEA 4JK1A 2Z57B 3W9HA 2HZVA 3AU2A 2KM8C 4CBXA 4KI6A 2F3JA 1VBYA 4LFCJ 1YVFA 4A8KA 2ZOMA 4A8EA 1F9EB 3M4XA 1AXQA 1UVMA 2KLAA 1X5SA 1K47A 3TAMB 3V9SA 2BPFA 1SI9A 1R8HA 1URRA 2QWPA 1DTQB 3S9HA 2D5RA 3AGKA 3D7EO 1RDBA 4FLVA 2NZCA 1PG5B 4CJFA 1S0MA 2ZH2A 2ASYA 3L09A 4TLRA 4P52A 2C2RA 2O8DB 3L3UA 3PIPL 2QKKA 4LF1A 1O6XA 4YHHF 2HZCA 1XQIA 4FBTA 1ZQJA 3AO1A 2V4JA 1QVGR 4I2CA 8ICHA 2DF4B 2MZRA 2YNHA 4F91B 3MN5A 5BR9A 4I6WA 3W61A 2ZOGA 1I3OB 4BRKA 5L1JA 4ELUA 1UPPA 1RISA 3FFIA 3IGVA 4HR2A 4MT1A 5KRTA 3AOAA 2KM8B 1RT7A 4WE1A 1P9YA 5AJ3F 1WHVA 3I4PA 1HBUB 1CS4B 4XIUA 2FBVA 4QBUA 4N77A 3BYRA 4NRTA 1VQPS 4A8OA 4BROA 5AKKA 1T6DA 3NVYA 4FWKA 1K8KA 2YHYA 2D9PA 2QC3A 4NLTA 4H4OA 1UJ5A 3OVNA 3U4LA 1MA7A 2FBYA 5KFDA 4ALZA 1Q16B 2HHHF 5L1MA 1JRPA 8ICNA 3AD7C 2XICA 2RQKA 2O8BA 2DNQA 2FMSA 3C5GA 2C28A 3JTOA 4DU8A 2J6TA 4NLYA 3CJKB 4LF9J 3SCXA 4EBDA 2D3UA 4L8RB 2OXOA 5H9FK 1ZQTA 4ZP8A 2NRWA 5J0WA 2QT7A 3QNWB 4XRHA 5FPNA 5T7BA 2G4BA 1WSJA 4W5QA 4P74A 4CLYA 3H5SA 1S6QB 2UUTA 1TVAA 1C0TA 4YVZA 1L3SA 3AY9A 4LRBA 4WYLA 5C5JA 3OS1A 4ILHA 2QLFB 3W9IA 1HLWA 3P45B 2J6UA 4F5QA 3KK1A 4X84A 1W2BR 1B0VA 3N5BA 1WUUA 3TVYA 2MU2A 4P4PA 2N7CA 2UXCJ 1ACMB 2Q1LA 3T9NA 3M7DA 3RUBL 4EK2A 2R7VA 2AYGA 4KE5A 2A0FB 4I6MB 5HK4A 4A8WA 3I8BA 2BPGA 1HQUB 3VA3A 4USAA 2EFQA 5KG2A 3E3XA 5CA7A 5LJ3Y 3IFEA 1NGIA 3D45A 4BC3A 3AM9A 3THYB 4K59A 3RAXA 2UU9K 1RT6A 8ICBA 4H4KA 4NA2A 2OPPB 2VANA 1Q5VA 2BZ2A 4RBTA 2NZ4A 1RT3B 2LEBA 2JXJA 5KFKA 3HF5A 2KIWA 3V81A 3V6JA 1MN7A 1FWLA 2ATCB 1K73O 2QFIA 5GMDA 5K8MA 2GVZB