1LV5A

Crystal structure of the closed conformation of bacillus dna polymerase i fragment bound to dna and dctp
Total Genus 190
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
190
sequence length
580
structure length
580
Chain Sequence
AKMAFTLADRVTEEMLADKAALVVEVVEENYHAAPIVGIAVVNEHGRFFLRPETALADPQFVAWLGDETKKKSMFDSKRAAVALKWKGIELCGVSFDLLLAAYLLDPAQGVDDVAAAAKMKQYEAVRPDEAVYGKGAKRAVPDEPVLAEHLVRKAAAIWELERPFLDELRRNEQDRLLVELEQPLSSILAEMEFAGVKVDTKRLEQMGKELAEQLGTVEQRIYELAGQEFNINSPKQLGVILFEKLQLPVLKKTKTGYSTSADVLEKLAPYHEIVENILHYRQLGKLQSTYIEGLLKVVRPDTKKVHTIFNQALTQTGRLSSTEPNLQNIPIRLEEGRKIRQAFVPSESDWLIFAADYSQIELRVLAHIAEDDNLMEAFRRDLDIHTKTAMDIFQVSEDEVTPNMRRQAKAVNFGIVYGISDYGLAQNLNISRKEAAEFIERYFESFPGVKRYMENIVQEAKQKGYVTTLLHRRRYLPDITSRNFNVRSFAERMAMNTPIQGSAADIIKKAMIDLNARLKEERLQAHLLLQVHDELILEAPKEEMERLCRLVPEVMEQAVTLRVPLKVDYHYGSTWYDAK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Processive DNA synthesis observed in a polymerase crystal suggests a mechanism for the prevention of frameshift mutations
pubmed doi rcsb
source organism Geobacillus stearothermophilus
molecule tags Transferase/dna
molecule keywords 5'-D(*GP*GP*AP*TP*CP*AP*GP*CP*GP*A)-3'
total genus 190
structure length 580
sequence length 580
chains with identical sequence B
ec nomenclature ec 2.7.7.7: DNA-directed DNA polymerase.
pdb deposition date 2002-05-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00476 DNA_pol_A DNA polymerase family A
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.20 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 5' to 3' exonuclease, C-terminal subdomain 1lv5A04
1.20.1060.10 Mainly Alpha Up-down Bundle Taq DNA Polymerase; Chain T, domain 4 Taq DNA Polymerase; Chain T, domain 4 1lv5A02
3.30.70.370 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1lv5A03
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 1lv5A01
3MXIA 5T7BA 4Q43A 3EPIA 1RDBA 1ZQNA 5KFJA 1HNIA 8ICEA 3HVTA 1X9SA 4RQ7A 3GDXA 4YMMA 4NYFA 8ICTA 4DSFA 5DQGA 1RZTA 4CF9A 4AHRA 1XHZA 4B9NA 3MR2A 4QZIA 4PPXA 3F9KA 3MECA 3VQ6A 4TUPA 1TKZA 4F5OA 4EZ9A 8ICFA 3TQ1A 4HYKA 4DTUA 3V6DA 1NKEA 4BXOA 4DTXA 8ICIA 4RPZA 4DQPA 3ZDAA 5CYQA 4ECXA 1ZBLA 7ICOA 2UVRA 4JRQA 4Q0BA 1LB2B 3ZSQA 4PHEA 4OLAA 4RQ1A 5DBCA 5KRSA 3TAGA 3E2EA 2NRVA 2Y1IA 1F21A 1A77A 2YKMA 1ZQCA 1HYVA 3V72A 2BCQA 5C24A 4MFFA 3G0ZA 5KFGA 1QE1A 3S3MA 2KW4A 4KI6A 4J2EA 4HHTA 2C2EA 1ZQOA 9ICSA 7ICGA 4TQSA 5HP1A 4AHTA 3LALA 4FVMA 3TARA 4HCCA 2QK9A 1S0NA 3H4DA 4DQRA 1ZQHA 3OJUA 2DFLA 4KHQA 5SWMA 5KT6A 2BCRA 1KLNA 1KFTA 3RMDA 4FJ9A 7ICVA 1N5YA 2JLEA 4MF2A 1EP4A 1L3SA 5KG4A 4CJPA 3AV9A 2JEIA 3TAFA 1NK6A 4CEQA 4I2BA 4DMNA 3O4NA 4RQ3A 1JN3A 4RPYA 3C1ZA 1Y97A 1JL1A 2G8IA 3VQCA 1BVSA 4QZCA 1ZJNA 4QAGA 3IM1A 4O44A 9ICQA 1C1CA 4UB3A 4JV2A 3TAQA 4FLTA 3WNFA 3QEPA 3RRHA 1JLGA 3QEXA 4C8MA 3ZDEA 4IRDA 3GIIA 1ZYQA 3JPQA 4YR0A 2KTQA 2F8SA 4F3TA 1W0HA 1LW2A 4UB1A 4KLTA 1RTIA 1S6QA 2PFQA 4ECSA 4DS5A 4XQ8A 4RQ8A 1BGXT 3HYFA 3NF8A 3RBDA 1VSDA 3DRRA 2KFNA 3OYDA 3NH2A 4UAYA 3VQBA 2BQUA 2AQ4A 1TFRA 2BANA 3H4BA 1NKCA 5J0WA 3MR5A 3DI6A 4ECRA 3SUOA 4R66A 5J0OA 3JPPA 4QCLA 4LD0A 1BPXA 4CEEA 4HUGA 5KG6A 2FPMA 4DS4A 4ZHRA 3GIJA 4L8RB 5DLGA 5KFDA 5HHIA 9ICFA 2F1JA 4P4PA 2HMIA 4M41A 5J0XA 4CGGA 4KAZA 1WLJA 4RNNA 4ECQA 1BCMA 4DFPA 3DOLA 2W9CA 3SYZA 4ED3A 4CK2A 4F4WA 3C21A 2Z1HA 2Z1GA 3RJEA 7ICHA 1N48A 2GBZA 4ED1A 4E7HA 3RBEA 1S10A 3S3OA 3ZDBA 3V1OA 4OPKA 3M9OB 5DLFA 1ZQVA 1HQEA 1BPEA 4E1NA 3SQ0A 2PY5A 3G6VA 1SKSA 1XSPA 4HTUA 4EBDA 3RH4A 4AHCA 1A76A 3P1GA 1ZQJA 1REVA 2ITGA 1Z25A 2HB5A 4FZXC 1QLNA 4PWDA 3EYZA 3MFIA 1S1UA 3CQ8A 2BCVA 3RR7A 5HROA 4PQUA 4FJHA 2QXFA 5J0PA 5HRRA 4BGDA 2AU0A 4MF8A 1LAVA 1T05A 1BHLA 4KRFA 4ECZA 3A2FA 3TAEA 4RG8A 5DG9A 3NFAA 5KFZA 1JLEA 4RUAA 2P1JA 3LAMA 3OYBA 4F4YA 4NCBA 2YNFA 3Q8MA 3T5KA 2AGPA 4HCBA 4DTOA 3KD5E 1O1WA 4IQUA 2JGUA 3KLHA 2HHXA 2BR0A 3CFPA 1BPBA 3M8PA 4IFVA 5KFUA 2Z1IA 4C8OA 3T3FA 1VSJA 4DF8A 1TAUA 4J9PA 3GILA 2DFEA 1BQMA 4JRPA 4FLYA 1N6QA 3KIOA 1ZQDA 5DKWA 4ELVA 5J0QA 2HHVA 2GUIA 3M9MB 5DK5A 1WSFA 2ASDA 1UOCA 5DB9A 3HPOA 4J9RA 5J2QA 1X9WA 1L5UA 4Z4HA 3UIQA 5KRTA 4B9TA 5CYMA 4N41A 3VA0A 5I42A 5DBBA 4OLBA 5KFYA 2G8UA 2BQRA 4OKEA 1MU2A 1JXEA 1Z26A 3MGIA 2R8IA 7ICNA 4ECTA 3CYMA 3NTUA 4E19A 7ICQA 3QEWA 4DL7A 3TR8A 2MUTA 3OS1A 3E01A 5CB1A 2NRXA 4CJ3A 5BOMA 1ZQXA 2JZBB 3V7LA 2OA8A 3TAPA 3IRXA 5KT3A 4I29A 8ICMA 2PXIA 5HBMA 5KG7A 8ICYA 1RYSA 3DRPA 2NRWA 1MQ2A 5L1LA 7ICUA 1RNHA 2W8LA 3HP9A 3S9HA 5J2FA 4KV8A 3NE6A 4RUCA 3RB4A 3JPOA 4K4IA 4FS2A 2R8JA 5K14A 5J0TA 4JS4A 3UQ0A 4M42A 1BL3A 9ICJA 4LSLA 3S3NA 4Q8EA 3H40A 2R8GA 5KFBA 4FO6A 1LW0A 3ULDA 4Q44A 4UB4A 3ITHA 3RRGA 3KLGA 4UBCA 8ICGA 2B6AA 4YR2A 3OYGA 2BE2A 3ETLA 4CHOA 1BI4B 4FW1A 5CZ2A 3Q8LA 3AA3A 4O5CA 4OGCA 4DL3A 3LWMA 4AHUA 1NOZA 3AVHA 2C2DA 3MXMA 3N4MB 3ISNC 1ZQSA 4N56A 1WCNA 2I1QA 1BQNA 4DTRA 1RBSA 4ZTJA 5KG5A 1GOBA 5KFMA 4I28A 4BE1A 4FZZA 4I9LA 2WTFA 3OYNA 4BWMA 8ICBA 2PYJA 4FLZA 4M3RA 2OZSA 2Y1JA 3RB0A 2BGGA 3DOKA 4Y1DA 1LWEA 4NCAA 4GXJA 1HNVA 1KFDA 7ICPA 3V6KA 3MFHA 1S76D 2YNIA 5KT4A 4AHSA 4OGEA 4GC7A 3MXJA 3AVLA 7ICRA 4NLZA 1KFSA 4EYHB 8ICWA 3V9ZA 4FJLA 4OKKA 3ASMA 1ZQZA 3NHGA 4KHSA 2PI5A 2FLPA 2NUBA 3CM6A 4DSKA 2D5RA 9ICLA 4PHDA 1X2IA 4YD1A 3LZIA 5EWEA 3T1AA 4KHUA 4YR3A 5KFPA 2IDOA 3RMBA 2A1JB 1KVCA 7ICFA 4M9NA 4KHYA 3NGYA 1B9FA 3KHGA 4QOZB 1B9DA 2EX3A 3SNNA 3QNOA 5KFOA 1G15A 4EBEA 4EZ6A 4ED0A 7ICJA 4O5BA 3UQ2A 3V1QA 2W42A 2FPKA 1C7YA 5DQIA 5KFTA 4EYIB 1K1QA 1WSIA 3EY1A 5DG8A 3NCIA 4NLKA 4FLXA 2W9CB 4O3RA 5D3GA 2FMPA 4QZGA 5IIKA 4F5QA 4DLEA 3V1RA 4UAZA 5JS2A 2ZD1A 5KI6A 4Z6EA 3ZSZA 3NDKA 2V4QA 2JZBA 4CEFA 2RN2A 4MFAA 3FYHA 8ICHA 4M04A 3RH6A 4F4XA 2P5GA 1L3TA 4M9JA 4I2HA 1JKHA 1EXQA 1TK0A 3RJGA 3AVKA 4ED6A 8ICAA 2P6RA 1TGOA 1BI4A 4YMOA 2XO7A 4W5QA 1AROP 5L1IA 3EPGA 3WNHA 2XCAA 4KLHA 5DB7A 4IR9A 5EWFA 4Z4CA 2ASJA 4JK1A 2P5OA 4KI4A 3KLEA 2OYQA 5KG2A 3LDAA 5KFKA 3T5LA 2MAXA 1D9FA 1WAJA 5J0SA 2W9AA 3TFSA 4RQ2A 4BWJA 2JEFA 3BQ1A 4BE2A 3HM9A 1NK0A 1XI1A 2EHGA 3VQPA 4CGFA 5IIMA 2W9BA 2W8KA 3QEIA 2ATLA 8ICVA 4IQTA 3G6YA 1XS9D 3SPYA 4UAWA 4M9GA 3RMAA 1FXXA 8ICZA 2BHNA 1S9FA 3IHQB 2ZTEA 3VQ8A 3LP1A 4PA1A 3ZT0A 4CHNA 3KHHA 1A5WA 4DOAA 4FJGA 4NY8A 3ZT1A 5KGWA 1Z3EB 4FXDA 4GXIA 4DWIA 3ZT3A 3VQQA 1VSFA 4PGYA 2HNYA 3DLHA 3LP0A 1IKWA 3PNCA 5FRMA 1ZQLA 2ETJA 5J2MA 1ZQPA 4CK1A 4CIEA 3NF9A 1BPDA 3T5HA 1SL0A 1ASVA 4RNMA 4KREA 5HNKA 4PGXA 3V7KA 3LPUA 3FDSA 4KLEA 3KD1E 2F8TA 3OHAA 4CGDA 3DLGA 2AGOA 2VA2A 1ZQIA 1ZQTA 3Q8KA 4CJ4A 4KLIA 3ZT4A 1TKTA 1U45A 1ZQQA 5IINA 1RDDA 4MEYA 1RTDA 1ZQBA 3AVNA 4NCGA 4FJJA 3WNGA 2WOMA 4J9LA 4IKFA 2HVHA 3VQ7A 5HP4A 4CJQA 4DTPA 1ASWA 9ICEA 1LV5A 4YNQA 2DPJA 4EP5A 7ICEA 3VN5A 2X74A 2IA6A 4DFJA 3LAKA 1NOMA 1Q9XA 4UBBA 1U4BA 4ID5A 4CJTA 1XHXA 3H8WA 4FJ8A 4E3SA 4KB1A 4W5RA 4F92B 1MC8A 4BXOB 5C42A 1VSHA 4DSLA 1RBUA 4O3OA 4FK4A 4YFUA 4CESA 1NOYA 3LP2A 5J2AA 4FM0A 1QQCA 2QKBA 3GQCA 1RBTA 4DU4A 4RW9A 3CFOA 4I2CA 3O3GA 3SI8A 3TANA 3HSTB 3L2RA 3C95A 4BACA 4BE0A 1U47A 4HUFA 4FLUA 4FJXA 1IKYA 2PYLA 4CEZA 2FLLA 3DLKA 5J2GA 4N76A 5HLFA 1Z00B 1T03A 3THVA 3T5JA 2PI4A 2ATQA 3KKRA 3AVJA 3PX6A 2ZJ8A 5DDYA 2R8KA 4FBTA 3VQ4A 4CERA 4UQGA 5DMRA 2R8HA 3C5GA 4PUOA 3PO5A 4BDZA 1RBVA 1S0MA 4KN4A 3VQAA 2OPPA 4IG0A 1XWLA 2OWOA 1DTTA 4UB2A 1D8LA 3H7IA 4M9HA 2G8WA 4J9OA 5KFHA 5DG7A 5FROA 2XY7A 4RW4A 3V9UA 5KG1A 3QLHA 3UXOA 4PGQA 4R8UA 4CF2A 4O3QA 4E0DA 1ZBFA 4FK2A 3NH0A 4CJVA 3D0PA 4HVJA 1VSLA 1QTMA 8ICJA 3OYKA 9ICKA 5CJ7A 5SZTA 3AA2A 4CJSA 3O3FA 4F93B 3HVRA 3QINA 4JV1A 3DM2A 2FMSA 3HL8A 4CEDA 3L2QA 4J9MA 2VA8A 3ZSYA 2XY5A 1EKEA 1NK4A 2X6SA 9ICVA 2HHUA 1JX4A 1IH7A 2NRTA 1IXRA 2W9MA 8ICQA 4RW6A 4KMUA 4DQIA 3L2VA 3AO4A 2PFOA 1KCFA 1JMSA 4O4GA 1C6VA 2F1HA 4PHPA 3SQ1A 3O3HA 1ZQGA 4RW7A 3SZ2A 1HJRA 3SQ4A 4PY5A 3AVGA 2BPCA 1YT3A 4QWBA 3OYEA 4P2HA 1TVRA 3NF6A 4ED7A 4G3IA 4C8KA 4CEOA 3ZDDA 4IDKA 1SL2A 4NXZA 3AO3A 3V7JA 1KSPA 3OGUA 4IRKA 4IBNA 3JSMA 2YV0X 2YKNA 1RTJA 1BCOA 1Q9YA 3IS9A 4KO0A 1JXLA 4R64A 3VQDA 3OHBA 8ICOA 7ICLA 3QZ7A 5KFXA 3KLFA 3MEGA 3KK1A 3OS2A 2V4RA 1A5VA 4O55A 8ICCA 2PFNA 4B08A 4MQ3A 5J2IA 4MEXA 3Q8RB 2DFFA 2I5JA 4QZ8A 1JLAA 4OVLA 5HRPA 1Z00A 1C0TA 1U04A 1XC9A 8ICUA 2G8FA 1ITGA 1NK5A 3PUFA 9ICTA 3MGHA 4ED8A 3SUNA 2BPFA 1SL1A 1VSIA 4ELUA 2G8HA 2XC9A 3KHLA 4TSXA 5KFIA 4XRHA 3LWLA 3OYMA 5JS1A 3C2LA 4ECVA 4I2IA 1JL2A 4K4GA 3QERA 4M3UA 5KFLA 3PV8A 1ZQFA 2YHBA 1ZBUA 2DFHA 4LSNA 5KT5A 3F73A 2DTUA 1T7PA 2ZTCA 3AVCA 1GOAA 4AH9A 2PFPA 4J9SA 2XRIA 2B21A 3AVBA 4ECWA 2AGQA 4FYDA 4KLLA 2ZTDA 3VA3A 1J9AA 3OYJA 4DQQA 2P51A 4H4OA 4CHYA 5E41A 3K59A 1S9EA 1BIZA 4KITB 8ICNA 4E89A 3CFRA 3P83D 4M3WA 4DSEA 4YQWA 1VRUA 3L8BA 3L2WA 3PW4A 1KTQA 4FM1A 4RPXA 2XY8A 4TURA 4KLMA 1QS4A 2HHTA 3PR5B 5J2HA 4CECA 2W9BB 4I2JA 5EWGA 2J6UA 4FCYA 2IBKA 3AU6A 1RT7A 4YCXA 3HT3A 1IKXA 1UT8A 4X5VA 4CHPA 3QIPA 4QWDA 2ZJ5A 4DL6A 4J2DA 3FFIA 5KT2A 4GLXA 2F96A 5DDMA 4E1MA 3H08A 3JPNA 4M47A 1ZQYA 2GWSA 3ISBA 1TAQA 4N5SA 2D0BA 3SI6A 4DTNA 1LWCA 3RB6A 1HYSA 1K6YA 1S97A 1GOCA 1B22A 1RXWA 3PR4A 4KLOA 2V9WA 1J5OA 3K2PA 4J2AA 1BISA 2XCPA 4Z6DA 9ICMA 5HMMA 5J1EA 1U49A 2UVVA 5CZ1A 1LWFA 3SPZA 4YN4A 4CJFA 3EWAA 4RQ0A 3V9SA 4B9VA 4B8CA 5HRSA 2OPSA 3AVIA 4DTMA 4P4OA 1RXVA 1T3NA 1S9GA 3H8SA 3DLEA 1WSJA 4CEBA 3C23A 2KZ3A 3ZSVA 4ICLA 3KLIA 4C8LA 7ICSA 2DPIA 5EU7A 1WCLA 3V6JA 4CIFA 4ELTA 4RQ4A 1HYZA 5CA7A 5KFSA 2HVIA 4FLWA 3H8JA 2R7YA 1ZQMA 4FJIA 4RU9A 4Q8FA 4PHAA 4OPJA 2BDPA 4J9QA 2JEGA 4Z4GA 1RT2A 4KKOA 3Q8PB 4Z4IA 1D9DA 3GIMA 1NK9A 2BPGA 4M9LA 4W5OA 1TKDA 2A1RA 1NKBA 5KFNA 3JPRA 5J0YA 2IHNA 3JPSA 1J54A 1RT5A 4DL2A 4CJLA 2FBVA 4CHZA 4I27A 4KLGA 1QHTA 4IRCA 3JPTA 5HMLA 2X78A 5FRNA 4M6WB 3K5OA 2HNDA 3G6XA 4BDYA 3M8SA 1W9HA 4F91B 1K1SA 4FM2A 3RB3A 4NLGA 1SUQA 2RPIA 4OJRA 2OPQA 4QZFA 4IFYA 3ZSRA 3MDAA 4YFKA 2IOCA 1TK5A 3U6FA 4DFMA 1IM4A 3WNEA 5J2EA 4CGJA 1BPZA 2XGQA 4B9SA 1C1AA 3NH1A 3V6HA 3PW2A 2E6LA 3I0SA 2LSNA 1ZQEA 3AVFA 2XGPA 3BQ2A 7ICMA 1EETA 4KLFA 1R0AA 4O3NA 4ECYA 3UXPA 1JLCA 1FKPA 4H8KA 1LAWA 4DL5A 3TABA 2ZUDA 1COOA 1SV5A 3UPQA 2C22A 3PO4A 3RWUA 3AO5A 4ECUA 1TK8A 3C1YA 2GV9A 3Q8SB 2ISPA 4RT2A 4F4KA 2FPLA 3MEEA 3SUQA 4XA5A 4JWMA 3CM5A 2FMQA 3K57A 4F8RA 4KHWA 3RH5A 5J2KA 4TUQA 3P5JA 3KK3A 4LH5A 4F4ZA 4HUEA 3B6PA 4YD2A 2F1IA 3SUPA 1NK7A 2BCSA 5BOLA 4Z4FA 1KLMA 1QSLA 1CXQA 4CJUA 1RDAA 1JIHA 3V4IA 3SQ2A 4H4MA 2YNGA 2ISOA 1X1PA 2HHSA 1NJWA 4CGHA 5KFRA 3RJFA 3Q8QB 4CE9A 3L3UA 4AHVA 4I2DA 4FJMA 1UA0A 1TV9A 4DL4A 8ICRA 4KB0A 1SKRA 5KT7A 2AJQA 3HPGA 2ZE2A 1EXNA 3OSNA 4P4MA 3NGZA 5HHHA 4FJ7A 1ZETA 1D8YA 4KHNA 3GV5B 9ICWA 4B9MA 4CFDA 4XIUA 3K4GA 3ORYA 5KFAA 4C8NA 5TZVA 1KRPA 9ICGA 1ZQUA 4E7LA 5DGAA 3C6TA 3K75D 3V9XA 4GW6A 4M3YA 3ISDA 4Y1CA 1FK9A 1S1XA 3N97B 4EP4A 3MR3A 4JV0A 4EBCA 2G8KA 3G10A 4CF0A 4FS1A 3IAYA 2QKKA 3C94A 1ZQAA 4CJEA 2B4JA 2D0AA 2NRZA 5L1KA 4O3SA 1TL3A 2FBXA 2MUTB 1CEZA 4FW2A 1C0UA 4KTQA 1B92A 4O3PA 4O5KA 4I9QA 3OJSA 4N47A 3BQTA 1H38A 5F9NA 1HJPA 4O0IA 2HHQA 3PY8A 1WN7A 4QZBA 4CJKA 4IR1A 5EOZA 4F2RA 4KLDA 2KZMA 1V9PA 5KFQA 3I0RA 4QZAA 2IMWP 3NBPA 4RQ5A 2G8VA 3AVAA 2P6UA 3PVXA 4JUZA 4DSIA 2C28A 1BIUA 3LDSA 4J2BA 4QZDA 2IS3A 1L3UA 1QSYA 1S1TA 3KKSA 8ICPA 5JUMA 3SV4A 5KGXA 2O4GA 1NJXA 4YMNA 3KTQA 3LANA 1S6PA 3ZT2A 2I9GA 4FJNA 3QE9Y 3TI0A 1IKVA 2ZQBA 4DO9A 5F9LA 1WSGA 9ICCA 1YVUA 9ICAA 5CHGA 4JLHA 5IILA 2KN7A 4YG2A 3M8RA 3L2UA 2ZUBA 4J9KA 4EEYA 5J2DA 4CCHA 4JWNA 4Z4EA 1ZQRA 4B8AB 4K8XA 1RT1A 4RZRA 4CGIA 4KLSA 3ZD9A 3ZSOA 3ISCA 1RTHA 1DGSA 1TVAA 4FLVA 1ZQKA 3QNNA 3ALYA 1TKXA 3RTVA 3U3GA 3RMCA 3SV3A 3JYTA 3C6UA 2P66A 3V81A 2HW3A 3B0YA 3GV8B 4DQSA 2BGWA 1RCHA 1RT4A 4DFKA 4DTJA 4BDPA 3K5MA 4FK0A 3LP3A 4UB5A 4R5PA 2FBYA 5KFWA 4B9LA 3TFRA 3HJFA 4DG1A 4DEZA 5KTQA 4YP3A 1SZPA 4F5NA 2A1JA 9ICHA 1NK8A 1L3VA 4QZEA 5DQHA 4ED2A 4DSJA 4ZTFA 4FZYA 1XSLA 5KFEA 4M0AA 1JLQA 4E7KA 2Q3SA 3I8DA 3EW9A 2Z1JA 1KVBA 1ZBIA 2HHWA 1UT5A 4CJ5A 4QZ9A 4B3OA 3M9NB 2RKIA 3K5LA 1C1BA 3UXNA 7ICIA 4LVSA 4F2SA 2H5XA 2IHMA 5FDLA 4DLGA 4LZGA 1Y88A 1TL1A 3MEDA 4O9MA 4MFCA 2Q0ZX 4NYNA 9ICPA 1D5AA 4M6WA 2X6NA 3NAEA 2ZJAA 2VG6A 3B6OA 4Q45A 1RPLA 3PW0A 1I39A 1VRTA 5CY4A 3DLRA 4XUSA 1S5JA 3AO1A 4Z0UA 5KG0A 1S0OA 4NM2A 1MQ3A 4M3TA 2KZZA 5BPCA 4G1QA 3KK2A 3MR6A 4DU3A 4GVMA 2BKEA 2FC0A 1Q8IA 4YXMA 1B43A 5KFFA 1J53A 3AUOA 4IG3A 2E6MA 1S77D 1S0VA 1CZ9A 4JS5A 4DU1A 1RILA 4CIGA 4AILC 7ICKA 1HMVA 1KVAA 3M8QA 2M9NA 4CF1A 3HO1A 4R8UB 4M3ZA 4TQRA 3OYIA 2XY6A 4CFAA 3VQEA 3OYCA 1RYRA 2J6SA 4F3OA 4DOBA 4ZH4A 1WNSA 2DY4A 2C2RA 2E4LA 3QIOA 3OY9A 3AU2A 4GMJB 2VWKA 4I7FA 5CWRA 3EZ5A 4NM1A 2ASLA 2UVUA 3C2KA 3DLBA 5D49A 1S1WA 3AA4A 3ZD8A 3V9WA 1CXUA 3ZDCA 4KPYA 7ICTA 4YXJA 5J29A 4I2GA 1VSMA 5J2PA 3U3YA 5I3UA 5J2CA 4KTWA 3LPTA 3B0XA 3BQ0A 4YVZA 3HP6A 2O4IA 3D45A 9ICBA 4PH5A 3SCXA 4CFCA 1HQUA 5IIOA 3MABA 1DOQA 4Z6CA 3K58A 3HW8A 1CZBA 5L9XA 3IG1A 3T19A 4R63A 1C0MA 1VK0A 3HK2A 2KFZA 5J2NA 1WSEA 2BQ3A 5DGBA 2VA3A 9ICUA 2OZMA 5IIIA 2FBTA 3LK9A 2VG7A 4E7IA 9ICRA 3QZ8A 5J2BA 3RAQA 4M45A 4KLQA 1I3AA 4KFBA 3AO2A 3QEBZ 4OKJA 3MDCA 1IO2A 3NGDA 1YTAA 1N56A 4M2YA 3BJYA 4K4HA 1U48A 3KJVA 5DBAA 5J0RA 9ICNA 3MBYA 2A1SA 2YNHA 4I2QA 1IG9A 3GV7B 4Z6FA 3AVMA 1TV6A 2B5JA 2ALZA 3HXMA 3PW5A 3NGIA 2PZSA 1DLOA 3DMJA 8ICLA 9ICXA 2VG5A 4Q5VA 2VANA 1XSNA 4F5PA 9ICIA 4MFBA 2D0CA 2JEJA 4IQVA 3RJKA 4W5TA 2BCUA 1JLFA 3QO9A 4F5RA 5KFVA 2HNZA 8ICKA 1HUZA 4DTSA 3SJJA 8ICSA 3PX0A 3OYHA 1ASUA 4K8ZA 1S1VA 2IGIA 1XU4A 3LZJA 1JLBA 2IAJA 1RT6A 3MAQA 4W5NA 4CJWA 4QWEA 4I2FA 1CUKA 3L3VA 3GIKA 3RJHA 3ZSWA 4CFBA 1RT3A 2J6TA 1HRHA 4FJ5A 4RQ6A 4E7JA 4CEAA 1T8EA 3O4QA 1PZNA 2XHBA 3RJJA 3TWHA 2AQ0A 2LYHA 4B9UA 3OS0A 4NLNA 8ICXA 5DB6A 5DB8A 4J9NA 4I2AA 1KDHA 5CP2A 1NJZA 1X9MA 3QESA 3RJIA 2OPRA 2ZUCA 1UWBA 4I2PA 4QWCA 5HRNA 1WAFA 4RT3A 4TUSA 1SKWA 5D4BA 4QW8A 4RW8A 3VQ5A 5D46A 4F50A 3K5NA 4QW9A 3PMNA 3C5FA 3OYFA 1YTUA 1JXBA 3GFKB 4QZHA 4KLUA 1RDCA 3OSPA 2RDJA 1EX4A 5KG3A 4O0JA 4QWAA 3DYAA 3TAMA 3PMLA 1NJYA 3HX0A 3DRSA 3RAXA 1A5XA 3HPHA 1UAXA 2FLNA 3AA5X 3C2MA 4R65A 4M3XA 5CR0A 4I2EA 5C25A 3ZCMA 4O5EA 1CLQA 1QSSA 1VSKA 4GC6A 3OVNA 1BPYA 3PX4A 4CF8A 3QETA 1KEJA 1WSHA 4KTZA 1T4GA 4KLJA 1ZQWA 2UVWA 1RBRA 4CK3A 4DF4A 3NF7A 4LH4A 3QEAZ 2VWJA 1U9LA 4LY7A 1HPZA 4FBUA 3HWTA 4KN7A 1FKOA 3PW7A 3CG7A 3VQ9A 4DOCA 4RNOA 5IIJA 4ID1A 1ZJMA 1DTQA 4CJRA 5L1JA 3OYLA 5C5JA 2IC3A 4WE1A 2WONA 4GXKA 5KFCA 1VSEA 1HUOA 3RR8A 3BGRA 9ICOA 1XO1A 4IQWA 2RF2A 3BDPA 4CHQA 3OYAA 2KQ2A 2RDIA 4LZDA 3KHRA 1UA1A 1MSWD 2YHAA 3ZSXA 1ZBHA 5J0UA 5J2JA 3QEVA 4FJKA
chains in the Genus database with same CATH superfamily
4Q43A 2BTFA 3EPIA 5KFJA 1HNIA 5CCMA 4ZK7M 5EDWA 4P9SA 1X9SA 3FZKA 2H3VA 1FKPB 1UEVA 3QU7A 5IXUA 1PC4A 4GVBB 1YK9A 1XHZA 4B9NA 2O8BA 3MECA 3VQ6A 2H3QA 3MGVA 2J8SA 4IYQA 3GFXA 4F5OA 3HHLB 5ADXH 1EQMA 2HSTA 3R6LB 3D54A 1OYEA 3T1YF 5AQQA 5L38A 4DTXA 3IFEA 2NV3A 3ZDAA 4GKJK 1R0AB 3ATVA 5CYQA 4ECXA 1TL3B 3NCPA 4IKAA 2P9SB 2XYGB 1ZBLA 7ICOA 1X0FA 4NXNK 2UVRA 5ALNA 4Q0BA 3JAMO 3MWTA 4JHDB 4PHEA 1V3RA 3W64A 4OLAA 4ZPDA 5KRSA 3QMLA 1ATSA 2YKMA 2ODGA 4PWDB 1PSDA 1M5VC 1QE1A 4Y0FA 1LW0B 4J2EA 4I68A 4HHTA 5JRTA 7ICGA 5J2PB 3E8OA 2E8MA 2NXUA 5AT1B 4TQSA 1PYSB 2WMMA 4AHTA 3H5XA 4CWBA 1GLJO 4J8FA 3DRYA 3NVWA 2NPFA 4PHTX 1S0NA 3TX8A 4DQRA 3Q7CA 2XI2A 2YX7A 3OLBA 2U2FA 1D0EA 1VQKN 3MZIA 5KT6A 2BCRA 1KLNA 4M5KA 1KFTA 5IZHA 4WFBL 5H9EK 3CCWA 4MF2A 2DKOB 3IBCB 1NK6A 3C16B 3O4NA 4RQ3A 4RPYA 3EICA 2R7VA 3JS9A 4DV2K 1Y97A 5LMNK 5HVFA 4EX6A 1JL1A 2G8IA 1BVSA 1FI4A 4O44A 3VF4A 1C1CA 4OJ6A 4CTAA 2WB1C 4CI0B 4O4GB 4A8YA 4FLTA 2B9EA 2W4DA 3T7ZA 4CO2A 4C8MA 5A0LA 2B3TB 4F3TA 2F4FA 3W62A 2E8AA 4KLTA 1T6CA 5CH7B 4IFVB 2GIFA 3KJQB 2VGNA 2OEMA 3NF8A 1N36K 2RQ4A 5BN8A 2YQEA 4UAYA 4OI1A 3CJSA 3W2WB 1DXSA 2HHHJ 4AM7A 2BANA 1NKCA 5EX0A 3DI6A 4IOCQ 4KHPJ 1R8CA 4ECRA 2H4YB 3SUOA 4F0HA 4K0KK 1BPXA 4BRFA 2KRRA 4ZVGA 3HVAA 3PFOA 3IAM9 4JAXA 2EH9A 3FK4A 2A1AA 2HBLA 4EFAC 3L4PA 5DLGA 2A41A 2VOOA 2M70A 3GJTB 3L7PA 3R5CA 3W5XA 5J0XA 4FZMA 1KR4A 4ECQA 4FP9A 4JI2K 3DOLA 2W9CA 3SYZA 1HIYA 2VJ4A 4B1VA 2DNQA 3HT0A 3BBCA 2Z1GA 1FD8A 4UB8U 2K4HA 2W1BA 1N48A 4ED1A 1BA0A 4E7HA 2WCXA 1X7VA 3QPIA 2CWXA 1J6ZA 3ZTRA 3MMVA 4QIEA 1ZQVA 1HQEA 4ZPWR 2YHYA 3CDBA 1BPEA 4Y2SA 5LSLA 1RISA 2R4FA 3SQ0A 4O23A 1TL4A 1EKSA 1HUXA 2DH7A 1A76A 3PRVA 2IOFA 1VQPN 3P1GA 4Y2YA 2CPYA 3VF0B 4DUZJ 4FZXC 4HTIA 1UJ5A 1UKUA 5AKXA 1FTRA 1WEZA 5HROA 1FEHA 1TFWA 2N4DA 2WSFC 2AU0A 5HP1B 1LAVA 3TJ8A 1AT1B 1Q46A 1BLUA 4LFCK 1XMBA 4UZCA 1TL7B 3LGHA 4RG8A 5IT9O 1RAAB 4LF5J 4JI8K 2XVTA 2GVDB 4JYAK 5DG9A 1S9EB 2DR7A 2AT1B 2F2AB 1N33F 2P1JA 3IM8A 3LAMA 2RP5A 1ZD3A 3UKUA 4CF5A 4F4YA 4LF4F 4NCBA 1KVKA 2YNFA 4K2JA 3ZZTA 1KAXA 8ATCB 2XS7A 3IS9B 4JKGB 4UOFA 5DS7A 3KLHA 4FXVA 2DBBA 3T3FA 4DF8A 4RBVA 2DFEA 1KQKA 3NCQA 3O44A 3MCOA 3PCOB 3QYPA 4J7CA 3E9OA 2I7NA 2MZ1A 1W25A 2RUSA 4KE5A 5J0QA 4URQU 2GUIA 4L6V3 5KOXA 2VFRA 3CNHA 5TKYA 3K8WA 4ES1A 2ZE2B 2MKYA 5DB9A 4ZN1A 4JV5K 2EFVA 1L5UA 4Z4HA 2O8CB 5AKIA 4EX7A 1IQZA 2NLWA 3VAMA 3UIQA 2C2NA 3KJFB 5BYQA 3MGIA 1MMDA 1F9EB 4C0ZA 2WB4A 2CZ4A 3W63A 4E19A 2OAUA 3AD9C 3QEWA 5CB1A 2L48A 2HBRB 2V4JB 2V52B 2ALYB 5E84A 5T41A 3V7LA 2WBNA 2OA8A 1CJUA 4I29A 5HBMA 1P9YA 1OSCA 1RYSA 3F5TA 3MX5A 1FEEA 4IEEA 3VGMA 3CD7A 3DRPA 4KGMA 2QB1A 4BRNA 2N7YA 7ICUA 5AI6A 2POKA 4UY85 4RUCA 3TZZA 1IBKK 3ZX2A 2R8JA 3A3OB 1S6PB 4JS4A 1RABB 5T14A 3CJTA 9ICJA 1BL3A 5CD4A 3OL9A 3H40A 2D41A 3ULDA 3GJRB 5CAAA 2E5IA 2Y8WA 2VJUA 8ICGA 3GCWP 2B6AA 2QB0A 3T9NA 3NRBA 2Q31A 4YR2A 4ETZA 1S7HA 2AJFE 3NS6A 3EE8A 3QLHB 1H7WA 3EM1A 1BI4B 4FW1A 4BC7A 4O5CA 2KH9A 3UDCA 3AAQA 4CZMA 4AHUA 1RWOB 2C2DA 1V85A 3N4MB 3ISNC 3B6BA 2W03A 3E0FA 1VHIA 1WWHA 2I1QA 3BF3A 3OFHA 4OMFG 3OFEA 2JRZA 3QT8A 1H72C 2WTFA 3HSDA 2E5JA 4NLSA 2J7UA 4M3RA 4IO8A 2OELA 4NCAA 1LWEA 4Y1DA 2W54A 1HNVA 5HMZA 1VBKA 5KL1B 7ICPA 4XAKA 2FZCB 3MFHA 3BZCA 1NHKL 4HACA 1O13A 1HNXK 4GC7A 4C4WA 2VFSA 4ZPBA 1WB9A 4WP3A 2DITA 2JH7A 3QUCA 3ASMA 1ZQZA 4DV0K 5CD4H 5I9EB 5FPEA 1R0CB 1SQFA 3FE1A 1PUZA 2D5RA 1WJ9A 3QO9B 3G6ES 3SQGB 4LRAA 2DNOA 4ED5A 2OXOA 3P8BB 2ROEA 4YD1A 5EWEA 3BGUA 1JQGA 3CCVN 2A1JB 7ICFA 3M1YA 1X66A 2ASOA 3NGYA 1B9FA 2EX3A 5GIPA 2V63A 3QNOA 5B0BA 1BHNA 1WOPA 1X4CA 2H54B 4HL9A 2PMWA 2W2PP 3A5MC 2BKNA 5G4DA 1C7YA 1XUPO 4H0VB 5DQIA 1CULA 5KFTA 5EUHA 2LKYA 4URSA 4NLKA 4IFEA 4O3RA 3IO1A 2AXTU 3BDEA 5IIKA 3MOZA 2WONB 2RHSB 4LR9A 3V1RA 5LSOA 5GIOA 5JS2A 2ZD1A 4Z6EA 3ZSZA 2E2NA 2V4QA 2JZBA 3A8YA 4CEFA 1OPZA 1FX2A 2ZH9A 1R8BA 1RT3B 5ALJA 8ICHA 4OX7A 3ITHB 1L3TA 5I3PA 1BY9A 5D77A 3L95X 4K4UA 2BYCA 4KH0B 1CBKA 4CLYA 2HHHK 1ZAVA 4AL5A 3AVKA 3SEOA 5A8KB 2VUGA 1TGOA 4K0KJ 3O6QA 4ZP8A 1AROP 2VF3A 1RA6A 1M90T 4Z4CA 1FVSA 3ZZPA 1NPPA 2FJBB 3FEXB 3LDAA 1MWQA 2EC0A 1HKGA 4C7YA 5J0SA 3CDEA 3ZI4A 1VK3A 3KLGB 1DTTB 4DV1J 3J7A1 2F77X 3BQ1A 4ISEA 3HHDA 4BE2A 1R0BG 1ZD5A 1ZTWA 5K8MA 3HM9A 4EIAA 1YJWS 3EVOA 4DV4F 3VQPA 4CGFA 5IIMA 2W9BA 1WG5A 3UI3A 2AHOB 2ATLA 3LA0A 3UD3P 5E79U 2K2PA 3Q8YA 1EX8A 5KQ8A 3RMAA 2EFPA 1UW4A 5MLCQ 5M1QA 4J9VA 3KHHA 3UDEA 3ZT1A 3H0MB 4DWIA 1F3VA 3ZT3A 3FFIB 1KONA 4BREA 1IKWA 2V2QA 2ZJQL 3W5ZA 1XR6A 1X42A 4WPAA 1FKAF 4DUZK 1WHYA 1ZQPA 4NEZA 3D7EO 3CCTA 3ISND 4CM0A 1UHUA 1PO6A 2V51B 3DOMB 3NF9A 1BPDA 5L46A 3T5HA 4RNMA 4KREA 1VQ4S 3LPUA 5M2UA 1PYOB 1BQXA 1FNOA 4JI8F 3BREA 4KLEA 3QRPA 3CC4S 4JI3K 3PTWA 2AGOA 5HN0A 2VA2A 1ZQIA 1ZQTA 2RHKA 2ACMA 1AFJA 3Q8VA 4U9RA 1TUUA 4K59A 3CD6N 1TKTA 3UNGC 5IINA 4GKKF 4WF9Q 2LQ5A 2LU1A 3WNGA 4J9LA 4IL6U 2HVHA 2YX6A 3CJ1A 1XMQJ 2UP1A 2DPJA 2KD1A 2RT3A 2WK4A 4DKWA 2GX8A 2ILZA 2X74A 4DV4K 2IA6A 2MEWA 1IV8A 4DFJA 1RQ0A 3LAKA 4UBBA 3JXUA 3PIPQ 4H5VA 5AI9A 3H8WA 1H7XA 3PFEA 4YS2A 4YN3B 2LECA 4IOAQ 4OI2A 4E3SA 1XMQF 4KB7A 1MC8A 2NS1B 4BXOB 4NA1A 5C42A 1VSHA 3C0BA 4CESA 3MMCA 3UKRB 4C1NI 2HRTA 1NOYA 1CG2A 2GIRA 2VOPA 2XO6A 3Q8UA 4RW9A 4I2CA 2G08A 3HSTB 3HTVA 3L2RA 2EPIA 4US9A 2YPZA 4BACA 2E44A 3ADAC 2B7CB 1IKYA 3EVWA 4CEZA 3DLKA 4JYAF 2Z58B 3BN4A 3K1RB 2IM1A 5GAEI 2HWIA 4N76A 1GMWD 2ZDPA 1C0TB 2PI4A 2VU5A 2UU9K 3W2WA 3KKRA 1QVGM 5AQMA 3RW6A 2R8KA 3BGLA 1XR7A 3DI6B 5JICA 2FJEB 4DPUA 2R8HA 3FRYA 3MEDB 2V0NA 3UQSA 4YORA 3BH6B 4HHUA 1UWBB 2R2RA 5AR0A 4KN4A 1XWLA 1QVGR 2QTDA 4UTGA 4U7CA 2Z2ZA 4J9OA 5KFHA 5DG7A 3CCMN 3MUMP 3V9UA 3QUTA 1NMDA 2VKQA 1VLOA 1TYQB 4O3QA 1ZBFA 3D0PA 1W7WA 4HVJA 2HDOA 2XEXA 3AHPA 1NGCA 1VSLA 1QTMA 9ICKA 4RO0A 4GKJF 4CJSA 3O3FA 1HBNA 1JLCB 3S7RA 3HVRA 2MQ8A 2LBOA 4JI2F 3HL8A 5M1NA 2DBYA 1UPPA 2ZH2A 3O9UA 4BR7A 1B0PA 2XY5A 1EKEA 5CCLA 1RTIB 3M30A 2NRTA 4JI0J 2AEJA 1IXRA 4KMUA 3VETA 3L2VA 3AO4A 1VQSA 1KCFA 2G9OA 1SQEA 3TA1A 5AE1A 2JWNA 4CZJA 4OFZA 3E3XA 2A6AA 5B66U 4FZLA 4CLTA 3SZ2A 1HJRA 1AQ6A 2YH1A 4PY5A 2BPCA 2AYMA 5M1PA 4QWBA 1ZZFA 3OYEA 3F5EA 4P2HA 3SCJE 3EL2A 1N36F 3QSIA 1DT9A 5F0WA 1X3MA 3CJKA 4CEOA 4DV7J 2FVSA 1KSPA 3JSMA 3QGPA 2KM8C 3IS9A 4BLGA 3LVWA 4P74A 4S0MA 4DN9A 3QZ7A 4CLFA 1GTEA 2Q1LA 3PACA 2WW8A 4CLKA 4J5OA 3O1BA 1GO3F 4LFBF 2FVPA 4B08A 3D2SA 3ZXWA 3Q8RB 2DFFA 3DLLQ 2APOA 1N34J 5HRPA 1Z00A 1U04A 2QG9B 3C15B 8ICUA 2G8FA 2ZBIA 5F41A 4RX6A 3FMBA 3C6HA 3PUFA 1Q7YT 1Z4UA 4ZCIA 2CPDA 1VSIA 3TUIC 2WB1D 3LWLA 5JS1A 3C2LA 2MQLA 4ECVA 1TUGB 4ZVHA 2LI6A 3BR8A 2YHBA 3RSEA 2DFHA 1NXIA 4XO0A 5C7PA 5KT5A 3I4HX 5GADU 2F44A 2NYVA 2A2DA 4FN5A 1PBAA 1SUQB 3AVCA 4DUYF 1GOAA 2FJVA 3OPXA 4J9SA 5ETOA 5B09A 3KMSA 2OHDA 1J9AA 2IIHA 4OYWA 2ZIWB 1BWFO 2P51A 2WW4A 4DB3A 3WIUA 2QFIA 2A10A 3VZIA 5AQOA 1PKUA 4NLDA 5H1SV 3P83D 4F71A 3DDKA 2YY3A 1KTQA 3OL7A 1LOUA 1NSAA 4NXNF 1SJRA 4TURA 1QS4A 2HHTA 1GXLA 2XS2A 4CECA 3R9LA 2QARA 3NGSA 1TTHB 4DR6F 4NYZA 4QIFA 2JC0A 4Y2JA 5K8OA 2RNEA 2IBKA 3L0QA 2CN1A 4OLPA 4USMA 2P9PA 4NXMF 1JLEB 4TNOA 4YCXA 2Z57B 1IKXA 2QO3A 4DV1K 4X5VA 4CHPA 1VQ7N 3QIPA 4YOWA 2W2NP 4QWDA 2ZJ5A 3BS5A 3FC4A 2WFBA 2P9EA 1RDUA 5AZJA 1EARA 2EFOA 1LEOA 1K8AT 1T9UA 3H08A 2JVOA 2GWSA 3LTOA 2XQCA 3L3CA 4N5SA 1RE1B 4YB6A 3TYTA 1Y3KA 2D0BA 3SI6A 3CO9A 4DTNA 3MM7B 1B22A 1X9XA 3H46O 2V9WA 4QIWC 2XCPA 3U26A 4Z6DA 2C2KB 1U49A 5L39A 4LFBK 2M5YA 4NLPA 3EWAA 2DY9A 4H5TA 2QA4S 4KGKA 1S9GA 4ZS6A 1KW4A 5ETLA 5DDPC 1SV4A 1N4LA 4JP8A 4RUHA 1KD1O 2GIQA 5KPZA 3R5AA 1C1BB 2DRDA 2CXYA 2D3ZA 2ZHAA 5EU7A 1P8ZA 2I38A 1FJGF 2R7OA 4ELTA 4NRUA 4WE1B 3B8AX 1H73A 1N5WA 4FLWA 1FFWB 4RU9A 4X84A 1NEEA 1FXLA 3MEKA 4G9ZA 2V2ZA 3TTFA 2LQ9A 4DHYA 4ZVRB 4KKOA 1HARA 1D9DA 1JLAB 5CHCB 2XI9A 1MDUB 1PYTA 2COLA 1U1KA 3VAKA 4W5OA 4ILRA 3CIZA 2KG5A 3D66A 3HD2A 5KFNA 3JPRA 3HVWA 2N1RA 1HWLA 3HMJG 3JPSA 5GADP 1MROB 4DL2A 4CJLA 1RCXB 3T1HK 3A4TA 3M2UB 1F2GA 3NKYA 3I82A 4DX6A 4H4KA 1D9AA 4FWSA 3G6XA 1M1HA 4YEAA 2CQ4A 3HBTA 3RB3A 4NLGA 1UP1A 4JI2J 2MQMA 1U1PA 4DCOB 2P9GA 2B0CA 2NXCA 2UUWA 2PBDA 1S72N 3U6FA 1IM4A 3WNEA 1BPZA 3J81Y 2G13A 2UUTA 3EWGA 1C1AA 2R7QA 3TA0A 4ZVSB 3N7SC 4JKHA 5M1FA 1ZQEA 1FDDA 2MRLA 2P35A 1GNKA 4KLFA 3D68A 3G4SN 1AFIA 1LAWA 3PHTA 4GVLA 1Y00A 4OO1J 1Z6RA 2W24A 4JKBA 1Q8KA 3G8QA 3UWTA 3LL3A 2MQOA 1U1OA 2GV9A 3MDFA 2FPLA 3MEEA 2OTJN 2QC3A 3QFPA 2F65A 2FMQA 2E9ZA 5HROB 1WWUA 4X2BA 3P5JA 3KK3A 4CD3A 3ULEA 3QNMA 4HT7A 4HUEA 3B6PA 2F1IA 4TYAA 2BCSA 2DB1A 1XEZA 1S7IA 2QRRA 1XTZA 1ZBTA 3QNWB 4AF1A 1JIHA 4OZJA 1S6OA 2DK2A 4JYAJ 2ISOA 2LEPA 1X1PA 4YY3J 4K43A 2DNZA 4CGHA 3QGIA 1RLCL 4JI5F 2P9IB 1DGJA 3L3UA 3TACB 2DH9A 2Z2YB 2P9LA 1BNPA 5DO2A 1OQ6A 3UVJB 2OI2A 2LXFA 4WCEQ 1UA0A 2VCPA 3WX8A 3I31A 4KB0A 1HI8A 2OTLN 2AJQA 3HPGA 2Z30B 1V38A 3CPWM 3OSNA 4P4MA 3CULA 1ZXOA 2G0CA 4ZA1A 4CDIA 2KN4A 2GGPB 4QS8A 3MHYA 4CO1A 1FCAA 4ERDA 4KHNA 2V6AA 3ORYA 4FSVA 3JTOA 2RB7A 1ATNA 2CPIA 4ID8A 3OXGA 4DG1B 4KH1B 1KRPA 1ZQUA 2QSFA 3HJEA 2M4MA 5CYJA 3JAMU 3G96A 2HLUA 2YBVA 3MX2A 1I3OB 5GAEP 1S1XA 3N97B 2ZKTA 3M6UA 2G1HA 4CF0A 2YMLA 3MPVA 3CUNA 3HILA 4JI7J 5IM0A 3C94A 2B4JA 3F2DA 4Y0WA 3IMQJ 4OYPA 1E4GT 4O3SA 2LDIA 3DJCA 4FW2A 1VLYA 3C14B 1RTZA 3CNQP 4O5KA 4I9QA 3OJSA 3OD2A 1DGKN 2HHQA 2C3MA 4OX9K 2PFDA 5HBMB 4NASA 3QT6A 2W7AA 4TN2A 5D8HB 5C42B 5EOZA 2RQMA 4KLDA 2JDJA 2RS8A 3I0RA 3H90A 3PZPA 2G8VA 3PVXA 1YJ9S 4JUZA 5ETRA 1BIUA 4QZDA 4N8NA 3VZHA 5AM1A 3M3ZA 1R31A 2OPQB 2CQBA 4QS7A 2FDRA 1S1TA 5ALRA 2W4CA 1NJXA 1AW0A 4YMNA 1M1KO 3LANA 4HAIA 1S6PA 4BR9A 2XWXA 3QE9Y 2X1AA 1VRQC 4R0EA 5GVQA 3CVKA 3EVMA 1WSGA 1Y11A 4PL8A 3PIOL 3CCLS 9ICAA 5BR8F 5CHGA 3ZEUA 3J7ZO 3DLGB 1N32J 4B1XB 4CCHA 4Z4EA 1ZQRA 4EENA 1ED1A 2FJ6A 1H6KX 4I64A 4A8OA 1Q3VA 3OTOK 1KXPA 2X1FA 3ENOA 2R7SA 3K17A 3FUYA 4BGAA 1ZQKA 2DXFA 4KJIA 4YDDB 4ICAA 1HNWF 1BUXA 2HOEA 1SVDA 1NGHA 4NLOA 3SV3A 3C6UA 3V81A 5IT0A 2GMLA 3B0YA 2BGWA 2RU9A 2ZUAA 2IJFA 5CEHA 4KMOB 4USUA 4DFKA 4BDPA 1EAYC 3LP3A 4R5PA 2FBYA 4WYBA 4NCGB 1B70B 2UUBJ 2YWWA 1BXNA 2CDQA 2GS8A 1SZPA 2RLTA 1T9YA 3NGKA 2J9CA 3ATUA 1SC1B 5LL6d 3BKUA 1XNRF 4ED2A 4MK7A 5ALVA 4FZYA 3L5KA 1TL7A 3HM8A 1X5SA 2J9EA 1IBMK 4K4TA 4RCHA 3OXFA 4NI2B 4BGBA 2Z1JA 1ZBIA 3PM9A 3VGTA 2DO0A 4X4TA 1J2MA 4QZ9A 4QZVB 3M9NB 1QAIA 4DR2F 1Q3UA 7ICIA 4LVSA 4TLQA 2HRYA 4F2SA 3KLHB 4LZGA 1Y88A 1Y5IB 2GVZB 4PUOB 3H7HB 3ZZRA 3IP4B 9ICPA 1NHUA 4K4WA 3OL6A 2KIVA 4M6WA 1QQOA 3H2UB 3QU9A 1NNDA 2KG0A 3SFGA 3TKAA 4Q45A 3PW0A 2V94A 1I39A 1HNXF 5CY4A 5B5EU 2KXHA 1S99A 1OY6A 1DKGD 2N7CA 1CRXA 1TU0B 4NM2A 2W01A 2V5HG 2ZM6J 4M3TA 3OR2A 3R8YA 3JQKA 3HD1A 4PL7A 1X4EA 4KRWA 4G1QA 5LJWA 2ZIUB 3KK2A 1QH9A 4BVOA 3TRGA 2KXFA 3CJ2A 4GVMA 5CYMB 1R89A 3M32B 1PK1A 2QWOA 1J53A 1JWWA 3H42A 3AUOA 4O0NA 3UCZP 3RYLA 4YB1P 1CZ9A 4YOXA 4CIGA 2XLKA 3POTB 3MWPA 5B0CA 4LF5F 1HMVA 3H2VE 1KVAA 2A40A 2M9NA 4CF1A 2V4JA 3IBPA 3HO1A 4R8UB 4TQRA 1RYRA 4DOBA 2E1AA 4ZH4A 4L73A 3KUGA 3MN6A 3QIOA 5ALZA 4GV9A 4GMJB 2B4VA 2Q3PA 3QMQA 4I7FA 4CYUB 5CWRA 4ED4A 1LOTB 3ELHA 3WXMB 2KVQE 1NSQA 1GMWA 2DEIA 2ASLA 1IBCB 2UVUA 2XTJP 2E2PA 3MPYA 2PFFB 5D49A 1S1WA 1BD6A 1U24A 2DR8A 4AYBC 2IVNA 2E8OA 2I2YA 2D4WA 3R5JB 2RRNA 2KT2A 4HI2A 1RHQB 2O01C 2YMPA 3EJMA 5AQJA 4G1PA 1VSMA 2G09A 2GH1A 4C4TA 2E9RX 3D67A 3SBMA 1O8BA 1WG8A 3D0HE 1NHVA 4ZPAA 2OD4A 4X64J 1MG7A 4PH5A 1U2VA 5M1KA 3A1YG 3V4IB 1TUVA 5IIOA 4Z6CA 5LMUJ 4BUGA 3K58A 3CIMA 2ZBPA 1AUDA 3M8ZA 3C28A 3HK2A 5J2NA 1WSEA 2BQ3A 4DOZA 2VA3A 9ICUA 3OPKA 3LK9A 2CQ3A 2W2OP 1HHQA 5GMKa 4MO4A 3I55N 3QEBZ 3Q86A 3R27A 4O8UA 3DGVA 2IMOA 4NRTA 3MDCA 3PNIA 1L7OA 4M2YA 2VYPA 2OEJA 2A1SA 3G82B 4LF8J 4Z6FA 1QVFM 2CPHA 2R42A 5FPMA 4KT0C 3N4QA 2K8BB 2C3PA 3IR7B 1DLOA 4JI6K 3DMJA 2RKIB 9ICXA 2AYBA 4Q5VA 4ZOSA 2P9NA 2VANA 5G0RB 2RUGA 4F5PA 5GTHU 3J80U 2D0CA 1URJA 3KZIU 4LFAJ 5AKYA 2JEJA 3BO3A 3RJKA 3VOVA 4W5TA 1JLFA 4DX8H 4F5RA 2PT0A 3TPQA 2E66A 1J5EJ 1CS4B 1HUZA 4F25A 1VJ5A 3OYHA 5AFUA 4C1NK 1I6JA 5AQHA 5F3XB 1XU4A 1S4EA 1JLBA 2IAJA 3MAQA 4LFAF 2NLXA 1K44A 5HQ8A 1EQ0A 3MTKA 1FFUA 2EFQA 2CUYA 5BYRA 2G2YA 1XIQA 2FZKB 4LT6A 3L3VA 3RJHA 3CCES 4Y65A 2FB0A 1PZNA 3TWHA 2UU9J 3KHYA 2LYHA 1UJ6A 4B9UA 5DB8A 2E1MC 2O8FB 3DOLB 4J9NA 4Q0BB 1WF0A 4ZCKA 3HRGA 3ID8A 1X9MA 1HBUA 3D1OA 2OPRA 3O2IA 4QWCA 1T0TV 1Q4RA 3PIOQ 2O8EA 3KMQA 2KVIA 5D4BA 2KKPA 2YNIB 4RW8A 2QGFB 1IBKJ 1WHVA 2KMDA 4DU7A 2OH2A 2OJ3A 5AJ3J 1YTUA 5J1EB 4Z2XA 1RDCA 4O0JA 2RDJA 5KG3A 1PCAA 3CIPA 3FBEA 3PMLA 1NJYA 4KX5A 2ERRA 3DRSA 3RAXA 2OPSB 2E5LJ 1NBWA 3HPHA 4RNFA 1YHQN 3AA5X 3IGVA 4M3XA 1T9WA 5KAIU 2ACYA 2PA3A 1T11A 1JMTA 4FKYA 2RE1A 1HYSB 2I7PA 4O5EA 5DM6Q 1HBNB 4NZ6A 3D2NA 1UCNA 5AQSA 1ACMB 4FF2A 2M8DB 4MIBA 1BPYA 3PRDA 4RW7B 4KTZA 4KLJA 1ZQWA 3D6JA 4OZ5A 2UVWA 3Q2TC 1G7CB 4CK3A 3QEAZ 2W4PA 3HWTA 3M30B 4DV5J 3EE9A 3HX9A 4ZLPA 3N28A 1GEHA 1FKOA 5BXIA 3N7RC 2QV6A 3CG7A 2WSEC 3ICLA 1FA0A 3MMAB 4RNOA 2KYZA 3G8TA 1ZJMA 1DTQA 4CJRA 2DKZA 3WHIA 3N0VA 1TL1B 3G71N 3VERA 2FXUA 3MM5B 3HFKA 2Y1LB 1Y5NB 1I94J 2RF2A 3C19A 4WJ3B 4CHQA 3AXKA 1VRTB 2KQ2A 3I96A 4ZP7A 4LVNP 1S1VB 3ZZOA 4LZDA 3KHRA 1UA1A 1NGJA 1GQEA 2BA9A 4FJKA 3MXIA 4ZIWA 5T7BA 2G0IA 1RDBA 1ZQNA 1DAXA 4CO3A 8ICEA 4WQ4C 2D69A 1NH7A 4GVEA 3CD0A 3WC2A 2A19A 8ICTA 2G2OA 2VDIA 1IWAA 1S57A 4AHRA 3N5FA 1T44A 2RH3A 2XMWA 1AZSB 1OY8A 4OHZA 4FWMA 5JLHA 5LL6Z 1LK7A 2KFYA 1FIQA 4EZ9A 4UW2A 4K42A 3TQ1A 4CZFA 1OYDA 1CI4A 2MLZA 4BXOA 4QJFB 5HLFB 3H1QA 4RPZA 1RDFA 4NX9A 3MM9B 1Y10A 2LU2A 1MWKA 1YRUA 2Y1RI 3VEYA 4B3TF 2IY5B 2R7XA 1IN0A 3H5UA 1XMOF 1K8AO 4JRQA 1Q82O 2NXNA 1LB2B 3ZSQA 1HKCA 4RQ1A 3IXQA 3KOAA 3E2EA 1SJFA 3V72A 2HQDA 2EAPA 1M5PC 5C24A 3M2RB 1TUWA 1FJEB 3P4IA 1M5OC 2KW4A 2GJ2A 1ZQOA 9ICSA 5AK4A 3O4WA 1ZA1B 3ICXA 3PYEA 1IR0A 3LALA 1MN7A 4LIWA 4FVMA 3TARA 3H4DA 1L7PA 3OJUA 3F44A 2K4PA 1CJVA 2PMZD 1H2UX 3ZTPA 3QSYB 2ZVIA 3J7Z5 4L76A 1HFEL 1EP4A 4URGA 2JHDA 5KG4A 4CJPA 2JEIA 3ZEUB 2HRUA 5I3UB 1B0TA 1JN3A 2CNNB 4NPOA 4MO5A 2DHSA 4CT9A 4X65F 3VQCA 1ZM4A 2HAFA 3IM1A 3QFHA 3J7AN 2OFGX 1N62A 2VL1A 5E3CA 3TAQA 2E8PA 4CLLA 3QEPA 4ICLB 2Q79A 3UD4P 2F8SA 2JVRA 2IRXA 4UB1A 4C97A 2IJNA 3CJCA 1YJ7A 1MMLA 2QW9A 1RTIA 3P96A 1S6QA 2PFQA 2BJ1A 3A8IA 3OR1A 1M90O 7AT1B 4NL9A 1OO0B 3LPYA 2GMJA 4JKCA 3RBDA 3EGZA 3FCWA 1VSDA 3SDEA 2KFNA 2GQQA 3NH2A 2RIJA 3ZTQA 2B56A 3KVGA 3OYDA 5DDOC 1GH8A 2AQ4A 1FF2A 1QCKA 4R66A 1S3XA 3JPPA 4QCLA 5IV4A 2UUBF 2O8CA 2BJEA 4CEEA 5KG6A 2FPMA 2V7ZA 4ZHRA 2F3NA 3GIJA 4JI3F 1HNWK 5HHIA 3C15A 4Z94A 3DU5A 4P4PA 2EK6A 5ITHA 4CGGA 3FRZA 4UUXA 3WK4A 2ZIVB 2YCHA 3ETRA 2AF6A 4V19X 1A0PA 1KKXA 4F4WA 4DR7J 2Z1HA 3OTEA 4QPXA 3QGHA 7ICHA 1KEKA 3CW2C 5F8HA 2H48B 3I0SB 2L9WA 1S10A 2YPYA 3S3OA 2LYVA 3ZDBA 1UFLA 4OPKA 4K2XA 1FO1A 3J81O 4LBPA 4JI6F 2OCEA 2GX9A 4E1NA 4IQMA 4CLWA 4WYWA 1YAGA 1SKSA 3RBZA 4FWLA 2ZIWA 4PZVA 1W2IA 1FWPA 2ZIUA 1LVHA 4Y28C 1WTFA 4JHDA 1OPIA 1REVA 4AM6A 1Z25A 1RAGB 4DR1J 2KU7A 3RW7A 3CQ8A 2BCVA 1X4DA 2E7VA 3KDOA 4LFCJ 2YKOA 4G1IA 4LF5K 3IC1A 3QXGA 2VH7A 3AODA 1HNVB 2Q1NA 3A2FA 3QFWA 3AOBA 4M8LA 3GE1A 2M0GB 3VEZA 4HKQA 1IKXB 2V8DA 2E9TA 1RHRB 4YHHK 4H5RA 3Q8MA 3T5KA 5AK6A 1M5HA 4HCBA 2JSXA 1DBDA 2OEKA 1V4TA 5EHHA 1VC5A 2HHXA 2BR0A 4IFVA 3VAJA 4CM2A 5ALIA 4C8OA 3AT1B 4USKA 1TAUA 5KPTA 3CCUS 4FLYA 2HURA 3ED5A 1VBYA 2HK2A 1ZOLA 3VAGA 2NYIA 3LH2S 2HHVA 3BGFA 1TUYA 1FD2A 3IWNC 2WAQC 1OWXA 2ASDA 5J2QA 1GXUA 2HQFA 5KRTA 3HOTA 4B9TA 4JV5J 2MMYA 3QBCA 2K4EA 1NO8A 1GTHA 2DNHA 2MZRA 5KFYA 2G8UA 2BQRA 1Z2LA 2E7XA 3ENAA 4CZCA 3NNCA 3QJPA 1Z26A 2N82B 4ECTA 1OH8A 3GP9A 3NTUA 1S49A 6AT1B 4DV7K 3ILLA 1F60B 1XMOJ 3OS1A 4C4RA 1C4CA 3AXMA 2HBMA 2LFVA 2A18A 4HLBA 4CJ3A 2CPZA 2GEMA 1ZQXA 4F36A 2YHWA 3TAPA 3KKAC 1Y0HA 3TOQA 2DD8S 1HQ2A 2PXIA 3CEDA 5KG7A 2VQEJ 4LQ3A 2HBQB 1NZBA 3IR6B 3UO0A 5F1XA 2NRWA 2E20A 1MQ2A 4FYVB 3QYYA 4C4SA 3NMAA 1KDNA 2W8LA 2OHFA 3S9HA 2RMLA 2JC1A 1RGIA 3NE6A 3RB4A 2C2MB 4K4IA 5JTIA 2HBJA 1VYAA 4FE3A 3UQ0A 2ZD1B 5HI7A 2DR9A 4LSLA 2F8HA 3MCAB 2ZH7A 1QQ6A 4X4SA 2ZBCA 4Q44A 4MKBA 2CADA 3T41A 3M6GA 3OYGA 2BE2A 1SB3C 1S12A 2P9SA 5I3QA 4NLYA 2IM0A 1HD0A 2PN6A 5CZ2A 3AA3A 1SAZA 3M2UA 2O67A 5JU5A 3P3DA 3AVHA 4B3TK 3N4WA 1QE1B 4N56A 2KI2A 3QICA 4ZP6A 5KL8B 4ZTJA 5BN9A 2QWMA 1GOBA 5KFMA 4I28A 1YSJA 4BE1A 1RUSA 4NLWA 3VHQA 3I5AA 1SH0A 5GAEU 3OYNA 3QUQA 1N32K 1KHWA 4A8FA 4DR4J 4D3HA 2KEYA 2ZH3A 3RB0A 2BGGA 3TSQA 3DOKA 3M8PB 3MOJB 2IRUA 1KFDA 3IV6A 2ES6A 2FGCA 1TMJA 5DDRC 2A6OA 2YNIA 1SWVA 2W11A 5KT4A 4P2SA 2ASYA 2BE7D 8RUCA 4BRPA 3MXJA 3MTJA 4BQZA 1B7YB 2QZ8A 4B3RJ 1KFSA 8ICWA 4FJLA 4OKKA 1PK3A 1K9MO 4BQLA 4KHSA 2XMJA 3CPWR 2PI5A 3ENHA 1L8LA 3ILOA 3DAWA 2BACA 4QNLA 2G1DA 2ZZNA 4I2QB 9ICLA 4I1TA 4W98A 3T1AA 1GX5A 3UVJA 2DNLA 2B51A 3CJ4A 2MZJA 2HQCA 1KVCA 4M9NA 4KHYA 2R18A 4ILGB 3KHGA 1GFWB 1D09B 5KFOA 4BCAA 4EZ6A 5A0YB 4ED0A 2BH1A 7ICJA 3VMFB 4ZVQB 2BXJA 2Q97A 1K1QA 2ZFHA 3EY1A 4F04B 5DG8A 2CJYB 4NLUA 1SQGA 3CSKA 3NCIA 4MLEA 2QKQA 5D3GA 2FMPA 3CMEN 3MN7A 1GLEG 3O5TB 4JI5K 4W4MA 4MFAA 4M04A 3RH6A 3H5YA 2E5LF 1T3QA 3T9ZA 3UMCA 4B3SF 4I2HA 4NXMK 4ED6A 4H03B 8ICAA 3O9SA 1O6XA 3R1LA 1BI4A 2XO7A 5L1IA 4AQYK 3D6FB 3AARA 2YQ1A 1NM2A 3CQXA 2EZZA 2ASJA 3IMXA 4KI4A 1QAJA 2YTCA 3T5LA 1WAJA 2W9AA 4RQ2A 5E2QA 1MWZA 5GINA 1HWJA 3W65A 1IBLJ 1Z19A 4DR7K 1Z1ZA 2BOPA 2W8KA 3CCVS 3VC8A 4IQTA 4EO8A 1G99A 1DEJA 5H1SQ 1FXXA 1YIJN 2BHNA 2MY7A 4PA1A 2V8VA 4CHNA 4DOAA 4FXDA 2BM1A 4ISFA 4AL7A 3U1NA 1ZTTA 1VSFA 4PGYA 3DLHA 5AKEA 2E8NA 3PNCA 3EGVA 5CRXA 1ZAXA 2KRBA 3F41A 5CQGA 1K0TA 2K7JA 1ZQLA 2GJFA 4HDHA 5J2MA 2W7PA 4PZNA 4P7TA 4JI3J 3O6WA 4CIEA 4P0PA 4I56A 2Y0BB 4PGXA 2BOAA 1T95A 3MPDA 3KD1E 4CGDA 2XMAA 1DRZA 3S01A 1KQSM 3KUEA 1R43A 4CZHA 2ADCA 5FLXO 4CJ4A 2G2ZA 2UZAA 2ZJRL 2F9TA 4KLIA 2JLGA 2KO1A 4MEYA 1HNIB 1RQNA 3AVNA 4IKFA 4FOIA 4X66K 2ZVSA 1HWKA 2WTUA 2FLOA 2MGZA 3VQ7A 2W40A 5C2GA 3MM7A 1ASWA 9ICEA 1RHKB 5L8RC 2CQCA 3D2FA 4A2AA 4DCHA 4M5DA 4UY8T 1NOMA 4ID5A 4PWUA 1CJUB 1C0FA 2D3O1 1DRGA 2KG1A 2CQ2A 1SPBP 2A42A 1CC7A 1QD1A 2XZDB 4DSLA 4O3OA 4A4JA 4YFUA 3FZBA 3W9HA 5CYQB 4CLPA 5AQNA 4ZVUB 2LLZA 3H20A 1T94A 2FI1A 1RBTA 4M5IA 4DU4A 3CFOA 3VGVA 2O8BB 3SI8A 1NBEB 4PKDB 1U47A 2DY1A 4M5LA 4HUFA 1FT8A 4FLUA 4PXCA 2PYLA 3NXZA 2FLLA 4TVAB 3E51A 2FE9A 1AA1B 3AVJA 2MQNA 2ZJ8A 1VQOS 5HJYA 3ZNUA 1L8OA 3VQ4A 1V97A 2J9DA 3K0SA 3C5GA 4L75A 1RSCA 1RAFB 3DN9A 2V8GA 3T6BA 1FDNA 1TZ0A 4BDZA 3QT7A 4LUBA 1S0MA 3SK3A 1REGX 2OPPA 3L7UA 1VBXA 1R8PA 4IG0A 1MW7A 5AQYA 5C2CA 3HKZF 2M7SA 4JB8B 2B6AB 3DFEA 1DTTA 4BG9A 1D8LA 3H7IA 3WBZA 1NDPA 3WXJA 3WX4A 1LFWA 2HNYB 2XY7A 4CH0S 3A0IX 1RAIB 4RW4A 5F8MA 1KP6A 5KG1A 3QLHA 4BS2A 3UXOA 4PGQA 4R8UA 1COKA 4C98A 4NLQA 4PQAA 4FK2A 3NH0A 2YN4A 4CJVA 3ZZYA 2DHGA 5C25B 1WDDA 2I8EA 5CJ7A 3AA2A 1U1LA 4EI2A 4ISGA 3CJBA 1APSA 3MN5A 3DM2A 4CEDA 2WUSA 4IJAA 2ZJPQ 3L2QA 3ZSYA 2KE7A 2D3DA 2XMVA 2QLFB 3DRSB 3T6JA 2HHUA 1HKAA 3QIDA 1JLQB 2M88A 1LWCB 2CZ9A 1V6HA 2DUYA 3B9JA 2PFOA 1YWXA 1EQYA 4OD0A 1JMSA 4O4GA 2F1HA 3UD5A 4PHPA 4LF6J 4X4RA 3FEZA 5ALQA 4IJNA 4RW7A 3VPZA 3AVGA 3RUBL 1NNEA 2F4VF 2IC3B 2GAGC 3TVYA 1TVRA 4JD2B 3OTOF 5CE3A 4ED7A 2XLJA 4C8KA 2UUCF 2OGUA 2HWHA 3UE2A 2E29A 4FWKA 2A3VA 3V7JA 4IRKA 4FNHA 1R27B 5CABA 1Q9YA 5HOOA 2H3GX 4OYXA 2V67A 3OHBA 1GT8A 2RSQA 2KHCA 3SCIE 3WC0A 3MEGA 3KK1A 3E58A 1VAZA 2DEJA 1JJ2R 3OS2A 2V2KA 3G82A 2V4RA 3CCJN 4WFXA 4KYZA 3J7YU 4GFJA 8ICCA 2GHWA 4AXIA 2J4RA 1E6YB 4AQYF 4MEXA 3HCXA 1I94K 4QZ8A 2DGSA 4OVLA 2VWBA 1IBMJ 1XC9A 2FVQA 4WKRA 1ITGA 2P9NB 1NK5A 3SUNA 3MGHA 4ELUA 2D74B 1YZ6A 4DUZF 2K1RB 4MT1A 4RW9B 2CAJA 2HZCA 3MECB 2E1RA 2EK1A 3QERA 5KFLA 4NOHA 5F3TA 1RK8A 1SC3B 4LSNA 5I42B 1XN9A 2Q66A 3SAHA 2EBEA 3F73A 2HZVA 4RWTA 1CQNA 4O4RA 3C8YA 2J5AA 3W61A 2UUAJ 4M7YA 2B21A 3K9JA 1Q7LB 3L09A 4CW7B 1SKUB 4ILMA 4J9UE 1N0VC 5E41A 1YBTA 2FC9A 4I67A 2RQ5A 1RHJB 3ENWA 3TW0A 1SXLA 1X31C 8ICNA 1FTCA 4E89A 2XM3A 1T6DA 4DSEA 3L8BA 4DR5F 3PW4A 5D0GA 2D8CA 5AQVA 3HJVA 5J2HA 1VBZA 1ZS6A 3NOCA 3ZZ0A 1VQ8N 2F9JA 2J6UA 2V8PA 4OYZA 4X65K 2HHHF 3GSDA 1SIZA 4BR4A 3UKUB 1X5OA 1L7NA 3WK7A 2EAOA 4J2DA 2DGVA 2EVZA 4GLXA 1VQLS 3LO3A 5DDMA 4E1MA 1JROA 1ZQYA 1HBUB 3ISBA 4P71A 2LXUA 1JCFA 3D1HA 4OZNA 3Q83A 1K6YA 1S97A 2UXCK 3MMBA 1RXWA 2B9WA 4KLOA 2BABA 3T69A 1UPMB 1BISA 5C2DA 4LMZA 1EB0A 1TKXB 1S72S 4ILHA 2NUHA 2GWKA 3V9SA 2KKZA 5IC4B 4B8CA 2K60A 1T3NA 3VTHA 2VBZA 2QL9B 2QA2A 2CNLB 4CEBA 2KZ3A 1VQPS 3OQ2A 1UFWA 4IDKB 3A5OC 4W90B 4FNIA 4C8LA 5AE2A 3UMGA 2P2CB 3F2BA 2OTJS 4QU7A 1RTJB 1UVNA 3RGIA 4I6YA 3SIPB 3MR7A 1DZ5A 1S1XB 5KFSA 5LJ3Y 4W92B 3CC2S 3H8JA 2XBPA 1ULRA 4ZN3A 2B4OA 2E5GA 3DRXA 4PHAA 2NSCA 1UZHA 2BDPA 4J9QA 3MM8A 4GKKK 1GLCG 2MZTA 1RT2A 3K8VA 4OL8A 3Q8PB 2ZWHA 4LF1A 4PL1A 3MMCB 3TSUA 3UKRA 3MUTP 2NNWA 3HFVA 3MGJA 1WBBA 5AK5A 3TJ9A 1WC0A 2IHNA 2R7RA 2J0SD 2EEYA 4JI1J 4I27A 4KLGA 3HI0A 3WDOA 4C80A 2WHEA 4IZ9A 2X78A 4M6WB 3K5OA 5KAKA 4PL2A 1N32F 1F9FA 2HNDA 3M8SA 3OVBA 4F91B 1Q86O 3SMVA 2FDNA 1SUQA 2RPIA 4OJRA 4FF3A 3PSIA 2HVZA 4QZFA 4IFYA 2GQCA 4ANCA 3MDAA 2IOCA 5ALEA 2J0XA 3TVKA 3CD5A 3MCMA 4OX6A 4KR0B 1H3DA 2FHJA 1K9MT 4LF9F 3IG8A 4BX9C 2E6LA 3I0SA 1VIXA 2IRYA 2LSNA 3ILIA 1D3WA 2XGPA 3QUBA 4FPBA 4ECYA 3UXPA 1JLCA 4IWVA 2ZITA 4CYUA 4DL5A 1ZAWA 3TABA 2ZUDA 3RJMB 4DPXA 2OO4A 3UPQA 2C22A 3PO4A 1Q53A 3AO5A 4ECUA 2G07A 1VLBA 1URNA 4P2XA 2CKWA 3Q8SB 4MKAA 4RT2A 4F4KA 4DR1K 2HEKA 3SUQA 1DQ8A 2O8DB 1CPZA 4JWMA 1D8ZA 3MD1A 2KIWA 1QVFR 4KHWA 2PSZA 5J2KA 1IWGA 1UL3A 2JZ5A 2HQ3A 4UQTA 1UVLA 3WU2U 4YOUA 3VEOA 3A5NC 4YD2A 1NK7A 1D8BA 1RAHB 4HT5A 2ZBRA 2X3DA 1IUJA 3PYFA 5AJ3K 3V4IA 1RDAA 3SQ2A 2A0FB 3NGRA 4JK9A 2YTUA 4B3MK 4DV4J 4BC9A 2IVOA 4AHVA 4CF4A 1IBLF 3I5CA 1CULB 4F4AA 3U02A 3PXGa 4NZ0A 1SKRA 1NGIA 3V81B 5JVGL 5KT7A 2LA4A 2V7YA 3L4IA 2WRMA 1WBDA 5HHHA 4NI2A 2AD9A 1CZAN 4FJ7A 3HZEA 5A2QO 1ZETA 1OH5A 4DR6K 2B5JB 3GV5B 5D4PA 4XIUA 3K4GA 3ENVA 5KFAA 4C8NA 3LM9A 3GFYA 2G4BA 4MN4C 3C6TA 1Q5VA 3V9XA 4GW6A 1X4GA 3I5BA 2PEHA 2E2QA 3FVYA 1YJUA 3ZC4A 4FZVA 1X6IA 2MYFA 3CC7S 3E9PA 2QTWA 4HVZA 3G9CA 1J97A 4ZP9A 4FPRA 4DDFA 4NZ7A 4LF4K 2KYXA 3IR5B 3VENA 4CJEA 2CH6A 2NRZA 1CEZA 4JKEA 1H2TZ 5K20B 4KTQA 3WT0A 4O3PA 3FQKA 5AQWA 3JSYA 2JNJA 3IBWA 5F9NA 4O0IA 2V9KA 4CGZA 3KLEB 2JHEA 5HATA 1U0HA 2KZMA 2F9WA 1HWUA 4KQZA 2VFUA 3AVAA 1X6JA 2QYCA 4DV3K 2ITMA 3H0PA 5F0XA 3O3LA 3LDSA 4J2BA 2ZIXB 2IS3A 3WEEB 4DPTA 4KV8B 2F63A 4KHMA 2QWPA 1QSYA 3KKSA 5KGXA 2MDAA 2XMKA 3KTQA 3VEVA 4A46A 2OPRB 4AFFA 3ZT2A 2XICA 3PJWA 4UASA 3MEEB 1Z1VA 5F9LA 3BSCA 1XNSA 3M32A 1RT7B 2J0QD 1YVUA 3TR5A 1WG4A 2B7BB 3P49B 4OQJA 4Y3CA 1SWWA 4AYBF 5IILA 3MAAB 2ZIVA 3ENQA 3C16A 4O3MA 4JI0K 4YG2A 3L2UA 3EUB2 4J9KA 5J2DA 2BM0A 2QARB 3BPDA 4K8XA 3WK8A 1HI1A 3S6JA 4RZRA 3ZD9A 5IT9Y 4KSEB 4ZVOB 3D0IE 3ISCA 1RTHA 4FLVA 3O80A 1WI6A 3OTOJ 3RMCA 3JYTA 3HF5A 1K8KB 1FERA 2UUBK 3GV8B 3GSIA 1C2PA 1REVB 2P9CA 4H0PA 3CMAN 4DTJA 5JVGQ 1U1MA 1XJWB 4UB5A 4C3LA 4ZJOA 2ESEA 5AHXA 1SJ4P 2AMCB 1SIWB 2VBYA 4DEZA 5KTQA 4K7QA 4DG1A 3Q24A 2FF6A 1FRJA 1DTQB 2CJXB 3H8MA 2QLXA 1L3VA 4QZEA 5F0UA 5EVZA 3FQLA 1KL9A 3GYNA 2B9YA 2FD2A 4M0AA 1JLQA 3S6EA 2CPFA 1NPKA 4E7KA 2Q3SA 3EUNA 3EW9A 4C8YA 1P90A 2YQ0A 1KVBA 1UT5A 1RWNB 3AAWB 4U67Q 2RKIA 4OHVA 4C7ZA 2BX6A 1C1BA 2WBRA 4QS9A 3SAGA 3CT9A 2YX1A 2JR5A 2QLTA 2IHMA 5FDLA 3R2CJ 3C14A 2NZTA 4CLSA 5B0FA 1JLFB 4NYNA 3CCMS 2HS3A 4TY8A 1E4FT 4DR3F 1TP7A 3W8PA 1D5AA 4OX8A 4ATNA 1HHSA 1I51B 2WHOA 3UFCX 2ZJAA 2EW9A 3FZHA 1VRTA 1C0GA 3OTCA 4XUSA 3GIRA 4WBFA 5D3GB 2XNRA 3A12A 3FBCA 4Y2MA 4HWIA 2KVSA 1WOSA 4DU3A 1WHXA 2BKEA 2GNKA 1EETB 3P5TL 3M05A 2Q36A 4IG3A 4V19S 1S77D 2PO4A 1SQKA 2XMTA 5DZ7A 4AILC 1SV5B 4PEOA 3GLJA 3A8EA 1DK2A 3OHRA 4AQYJ 5EY4A 2V50A 4M3ZA 3CC4N 3ZLJA 3CJ8A 4BG8A 2XI3A 4IOXA 1IBMF 1WNSA 4FO0A 2C2RA 2DXEA 2XYPB 4WQ5C 5L1MA 5AKJA 4X62K 4JN4A 3JAMY 1SIJA 2R2SA 4KHPF 3EZ5A 2HFOA 4BY9C 2CGJA 1BO5O 4PG4A 3DLBA 5K14B 2LDYA 3AA4A 3ZD8A 1IBKF 5IQQA 1VIOA 3V9WA 2FSKA 4X4NA 2DNGA 2ZGZA 2OTLS 5C24B 1KOOA 4FYWB 1BQMB 3HOSA 7ICTA 2YKQA 4YXJA 1SZHA 2VIXA 4I2GA 1VS3A 1U8SA 5I3UA 4H5NA 3U3YA 5HVGA 3GG0A 3B0XA 2O4IA 3TADC 3U1MA 4AUKA 9ICBA 4CFCA 3CDAA 4IO9Q 3MABA 1DOQA 4Y34A 1MA9B 3KG1A 3MXHP 1C0MA 2KFZA 5IWAJ 3HULA 1BQNB 5DGBA 2ZNZA 2AP6A 4YB7A 2RRDA 2GV1A 9ICRA 4OYMA 3QZ8A 2F40A 3M2VA 1KQFB 3RAQA 4M45A 5ADXA 4KFBA 1FWKA 4YHHJ 3CCQS 1IO2A 1X0PA 4I2QA 1IG9A 2GGPA 3GV7B 3CF5Q 2WVDA 3AVMA 1TV6A 2WOMB 2ALZA 2R7WA 2IJRA 4L3KA 4ZKAA 4NA3A 3PW5A 3NGIA 5U47A 3R6GB 4QQBA 4I0WA 4ACOA 3D2FB 8ICLA 2VG5A 4PWWA 4WIQA 1OUQA 1CJTA 2GCFA 4DR3J 3FSIA 2YY6A 1SV0A 3OR2B 5HL7Q 1WD6A 2F8KA 4IQVA 2X1BA 2LXIA 4MYUA 4O5FA 4Q2MA 8ICKA 2P6TA 4PYAA 1ZZNA 4NL9C 3THYA 3PX0A 2GO9A 4NL5A 4US8A 2QLBB 4LR8A 3POTA 3LZJA 4IOAL 5D0HA 4W5NA 3IDHA 1AZSA 4CJWA 5ADZA 1W97L 4QWEA 5MAOA 3GIKA 2YKPA 2XNQA 3OTBA 4K0KF 3L4QA 4NLRA 5EOYA 4E7JA 1T8EA 2YHXA 2XHBA 2AQ0A 2HHPA 2L08A 3G6EN 2E5SA 3SJHA 2I9SA 4IS7A 4NLNA 2KHQA 5DB6A 4PR6A 3DXKA 1HBOA 4I6MA 2Q6BA 3GYXB 4WXWA 5A8WA 4K8RA 1JK9B 3QESA 3RJIA 2V34A 2ZUCA 1LWEB 3LQVA 5HRNA 1WAFA 3C65A 4TUSA 3H2LA 3VAIA 2D1KA 3NWRA 3VQ5A 4MJKA 9ATCB 3PMNA 2OEHA 3C5FA 3OV7A 4DV3J 2ZJPL 3GFKB 3BS5B 4IFYB 3DYAA 3C3LA 3TQEA 1QTNB 2GHVC 1L7MA 3S8SA 1N8RT 5J8YA 2ASMA 5FPNA 5GMDA 2Z2MA 2CQ0A 1UAXA 2DGWA 3C2MA 4R65A 5AQFA 5CR0A 1X4BA 5J2NB 2UXCF 1NB7A 4EGLA 5ALOA 3T1YJ 3KJNB 3OUYB 5D0EA 4Y2TA 2PA8D 5AXMA 3DM2B 3PX4A 2WF9A 2LMRA 3GU0A 1JJ2M 4LFCF 4NV0A 4GMKA 1N60A 3VGUA 3I4PA 4ETXA 3KFUF 4M5JA 4LY7A 1HPZA 4FBUA 5ALHA 2FJDB 4DR1F 1NGEA 3HHLC 7FDRA 3L3FX 4KN7A 3X1LB 3EZWA 4BC5A 2AZ3A 3ONQA 1PJ6A 4H0XB 2KDOA 3JSMB 4DOCA 2PC6A 1Q81O 2KV2A 1I1GA 1KLMB 2KP7A 4F0KA 3OYLA 4MFBB 3C46A 4C11B 4WE1A 1BC6A 2WONA 4UARA 4JD2A 4GXKA 3BB5A 4OLOA 4QYRA 2VKRA 4A61A 1HUOA 3VEXA 2GO8A 4P0PB 4LF8F 1KVIA 2CQGA 3BGRA 3IWLA 1XNQK 1ZC6A 3BDPA 4BC3A 1F9HA 1VISA 1L6NA 1FEZA 3FEYB 1F5AA 1MSWD 2MSSA 1VC6A 2UXBJ 2YHAA 3ZSXA 4OV1A 4WFYA 5J0UA 3U9ZA 1AXQA 3IRXB 1QUPA 3W1YC 3ZO7A 1FDBA 2YX4A 2I5JB 3HVTA 2HFZA 1CS4A 4V1Ak 4M94A 5ALYA 4GIBA 4BRAA 4RQ7A 3GDXA 5GADI 4YMMA 3CERA 2GOLA 2CQHA 4DSFA 2F5GA 3L9ZA 5DQGA 3TTDA 4CF9A 3DLLL 3KWGA 4QZIA 3LOUA 4PPXA 3JXOA 1V5IB 4FWRA 2QEXN 3MWBA 8ICFA 5DM7L 3MDQA 5DDQC 3V6DA 8ICIA 4QIGA 3ONNA 4I7FB 4JI5J 2MLYA 2MKHA 4NO7A 2EZXA 3EXYA 5AZIA 1AB8A 1C0UB 3M8QB 2AW0A 1RYUA 3OVSA 5C2FA 3AQPA 4DR5K 5E0OA 2JOQA 3CQYA 2NRVA 1F21A 2YQ3A 4WTOB 2O8EB 3DLJA 1S48A 5KFGA 2VD3A 3S3MA 4ZVEA 1ZRNA 5L9NA 5A2QU 4JK7A 3ZETB 2OLWA 3SXLA 3KK3B 3WEEA 2FHKA 4HCCA 4EO6A 2QK9A 4N8OA 4DV0J 1ZQHA 4CT8A 1O5JA 2O6KA 1SI9A 3R7SB 2DFLA 5SWMA 3BSAA 4FJ9A 7ICVA 4PJ0U 1FKOB 2BRLA 2PMZF 1L3SA 2CG4A 3DGPA 3MAAA 1FNMA 3NOGA 4C3MA 4CEQA 4DMNA 3H3NO 2P5VA 2CGKA 1VQLN 1LWFB 4PZOA 2ZKUA 3I56N 1NUEA 3PSFA 1ZJNA 1WTBA 4QAGA 4NYOA 1JCGA 2Z7JA 3MAHA 4UB3A 4I6AA 4JV2A 3QT5A 4DBQA 4JKAA 2R9LA 3DDHA 5D78A 1P6TA 2K06A 2YWKA 3PEHA 4DR2K 1JLGA 4JNEA 1R6VA 3QEXA 3ZDEA 4IRDA 3GIIA 1ZYQA 2DTJA 3MMAA 2PIIA 2IFXA 2KTQA 2VPXB 1W0HA 1VGYA 3OA9A 1RWKB 3D6MB 1KVJA 4ECSA 4DS5A 4XQ8A 1M1GA 4RQ8A 1U7LA 1YJ9N 1BGXT 4QJVA 2E88A 2ZGYA 3HYFA 2DISA 1HKBA 5AQIA 3GZ7A 1IR1A 3GWCA 2OYYA 2NR0A 4CO0A 5F8NA 1G2EA 2NO5A 3H4BA 1WC3A 4GNIA 5B0GA 3PKYA 3D6RA 4JK8A 3NNAA 4K4ZA 4ALZA 5J0OA 1U09A 1X5TA 2CVIA 1RCOB 2PMHA 3SR6A 4HUGA 3O9RA 4DS4A 4L8RB 4DV5F 5KFDA 4CBUA 2F1JA 1JKHB 3NBPB 2OANA 1BCMA 4DFPA 3KG4A 4Y2KA 5LMUF 1LK5A 1HNWJ 2P9UB 2J7KA 3K1ZA 4CK2A 5EX3A 3VGSA 3C21A 3GONA 3DDNA 4DFDA 4XPEA 3QX7A 3RJEA 2GBZA 2HCFA 2H3FA 5DLFA 3MM9A 3L6QA 1ZA2B 3I56S 3G6VA 1CSJA 1XSPA 4HTUA 4EBDA 2EI5A 4AHCA 1JNRB 2I5HA 3Q89A 5HR6A 2HOQA 2ITGA 2PFUA 3BP8A 2KM8B 2F8EX 3EYZA 4A62A 3MFIA 1S1UA 2CQ1A 4WQ5A 3RR7A 5EGYA 5C12A 2RS2A 1YJNS 4FJHA 5HRRA 3ULEB 2XIDA 2VQEF 3NVZA 2FC8A 1YITS 1NSPA 3GMGA 3R97A 1T05A 2BW7A 1BHLA 4KRFA 2A2CA 4NWIA 1Q18A 3LM2A 5ETPA 5EE1A 3DCAA 3TAEA 1UZDA 2HSEB 4BRHA 3Q22A 3K2YA 4F02A 5KFZ