1LV5A

Crystal structure of the closed conformation of bacillus dna polymerase i fragment bound to dna and dctp
Total Genus 190
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
190
sequence length
580
structure length
580
Chain Sequence
AKMAFTLADRVTEEMLADKAALVVEVVEENYHAAPIVGIAVVNEHGRFFLRPETALADPQFVAWLGDETKKKSMFDSKRAAVALKWKGIELCGVSFDLLLAAYLLDPAQGVDDVAAAAKMKQYEAVRPDEAVYGKGAKRAVPDEPVLAEHLVRKAAAIWELERPFLDELRRNEQDRLLVELEQPLSSILAEMEFAGVKVDTKRLEQMGKELAEQLGTVEQRIYELAGQEFNINSPKQLGVILFEKLQLPVLKKTKTGYSTSADVLEKLAPYHEIVENILHYRQLGKLQSTYIEGLLKVVRPDTKKVHTIFNQALTQTGRLSSTEPNLQNIPIRLEEGRKIRQAFVPSESDWLIFAADYSQIELRVLAHIAEDDNLMEAFRRDLDIHTKTAMDIFQVSEDEVTPNMRRQAKAVNFGIVYGISDYGLAQNLNISRKEAAEFIERYFESFPGVKRYMENIVQEAKQKGYVTTLLHRRRYLPDITSRNFNVRSFAERMAMNTPIQGSAADIIKKAMIDLNARLKEERLQAHLLLQVHDELILEAPKEEMERLCRLVPEVMEQAVTLRVPLKVDYHYGSTWYDAK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Processive DNA synthesis observed in a polymerase crystal suggests a mechanism for the prevention of frameshift mutations
pubmed doi rcsb
source organism Geobacillus stearothermophilus
molecule tags Transferase/dna
molecule keywords 5'-D(*GP*GP*AP*TP*CP*AP*GP*CP*GP*A)-3'
total genus 190
structure length 580
sequence length 580
chains with identical sequence B
ec nomenclature ec 2.7.7.7: DNA-directed DNA polymerase.
pdb deposition date 2002-05-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00476 DNA_pol_A DNA polymerase family A
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.20 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 5' to 3' exonuclease, C-terminal subdomain 1lv5A04
1.20.1060.10 Mainly Alpha Up-down Bundle Taq DNA Polymerase; Chain T, domain 4 Taq DNA Polymerase; Chain T, domain 4 1lv5A02
3.30.70.370 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1lv5A03
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 1lv5A01
3RJFA 1ZQAA 3QEWA 3C2KA 2FPMA 5DQIA 1C0TA 5KFLA 3KTQA 2KZMA 3CFOA 4I2JA 4GVMA 5KFSA 1WSJA 5KGWA 2J6SA 1XHZA 4HCCA 4F91B 3U3YA 2KFNA 4ELUA 2W8LA 4E7LA 1HUOA 5E41A 2W9BA 3IAYA 4F5OA 4I9LA 2WTFA 1RTJA 4I2PA 4B9UA 2M9NA 3ETLA 3VQAA 4FLXA 4RQ5A 2HVIA 4OVLA 4IQVA 4QW9A 3OYNA 3QIPA 3DLHA 3G6XA 2YKNA 5JS2A 1NKEA 1DGSA 4W5OA 5DMRA 3SQ4A 1NK7A 3OYFA 3L3VA 1S0VA 4KKOA 2F8SA 2C2RA 1HRHA 1I39A 3HVTA 5DKWA 4DTRA 2OWOA 1TV6A 9ICPA 5J29A 2MAXA 3UIQA 3GIMA 4NCGA 4CEZA 2MUTB 4M9NA 5HRRA 1U47A 2C28A 3V6JA 4XIUA 1J9AA 4GMJB 3AA4A 1X1PA 3NGDA 1HNIA 1NK8A 4L8RB 1D8LA 4WE1A 1TK0A 3HWTA 4BE0A 9ICRA 5KG6A 1C1BA 1HJRA 1ZQZA 1U45A 1S76D 2BE2A 3DRPA 3RMAA 4KLUA 3TAGA 1HYSA 2BCVA 4CIEA 1S9FA 4NCAA 3ZSXA 4FLTA 1FKPA 1GOAA 2BPGA 1NJYA 4YVZA 4QW8A 4FJ8A 3FDSA 1A76A 4DTPA 2PFPA 4OPJA 4EYIB 3JSMA 4QOZB 4RPZA 3M9NB 4K8ZA 5HNKA 4IQTA 4F93B 2FMPA 2DFHA 2RN2A 4B9MA 3N97B 5CZ2A 1U4BA 4CIFA 2OYQA 1ZQOA 4CJTA 5HHIA 3H4BA 4IQUA 2BDPA 5KFKA 1TAUA 1RT6A 1Q9YA 3BQTA 4JV2A 3WNEA 3TFRA 5HBMA 4MF8A 5FRNA 3OS1A 1COOA 2VA8A 4PY5A 3AVLA 1JL2A 4LY7A 5DG8A 1XI1A 1BPBA 1VSJA 3ZSRA 2IBKA 3DYAA 4DTUA 2XCPA 1SUQA 1SV5A 4ZHRA 2YNFA 5F9NA 4R8UA 4DFKA 1RZTA 3JPSA 4M9HA 5C24A 2R7YA 7ICHA 1U49A 4M9LA 4QWAA 4QWCA 4FJNA 2PI4A 5KT2A 4GXKA 4J2EA 4ECTA 4M04A 3JPNA 2AGOA 1B43A 2ZUDA 4E0DA 2JGUA 2XY7A 3SZ2A 1Z26A 5KFFA 4QZ9A 4EP4A 1L3SA 3RB0A 3BDPA 1IXRA 2PFOA 4YD1A 4EEYA 4F4XA 4R64A 2KN7A 5L1JA 3HL8A 3C6UA 4P4PA 5DLGA 3UPQA 4DSLA 3G6VA 4LH5A 1FXXA 2W9MA 1KFDA 4IFVA 4CHOA 3NH2A 1XU4A 2BPFA 1C6VA 4KHUA 4GXJA 4NLKA 1T3NA 2X6SA 4DTSA 3MDAA 1NK5A 1BPDA 1VRTA 4Q8EA 1S77D 4CJ4A 3NGYA 3C1ZA 2AQ0A 2DPJA 4ELVA 2IS3A 3C23A 1LAVA 1ZBFA 1TK8A 3ZDCA 4M0AA 3K5LA 4M6WB 4DL2A 9ICQA 2FBXA 4NLZA 2YV0X 4DLGA 3C5FA 2P5GA 3RJJA 1C1CA 5KFNA 3ASMA 4FLYA 1AROP 1D9DA 3EW9A 3L2UA 4CGHA 1RTDA 3ZT0A 5KFWA 4B9LA 5L1KA 3PUFA 4F5PA 3EY1A 5DBAA 3LWMA 5J2QA 4CHPA 5L9XA 3L2VA 2NRVA 4NCBA 8ICSA 4J2AA 1HMVA 8ICJA 4DSFA 4BXOB 8ICGA 1HPZA 3ZSVA 4DTJA 3L2QA 2BPCA 3ZSOA 3C2MA 4DTMA 1ZQGA 2OPPA 1SL2A 1J5OA 2FPLA 3G6YA 3QINA 3JPTA 1IM4A 2YHBA 4W5TA 1KVCA 8ICRA 2W9AA 4FK0A 3AA3A 3VQBA 8ICBA 2EHGA 1ZQFA 3LP2A 4P4OA 4IBNA 3U6FA 2ZTCA 3KLGA 4UB1A 3Q8MA 3RJKA 7ICFA 4KREA 9ICNA 4DL4A 3VQ6A 3MFIA 2HW3A 3KK2A 4FJGA 8ICAA 1RT1A 3OYBA 5KRTA 2X6NA 3AVGA 1MC8A 1O1WA 2EX3A 3V6DA 1KDHA 1ZQUA 4YXJA 2R8KA 4NM1A 2OPQA 2A1JB 2NUBA 9ICHA 5DB7A 4ID5A 2DPIA 3V1QA 4PH5A 4N5SA 4M3RA 3DLBA 2XGQA 3MDCA 4F50A 4RQ0A 2IC3A 5J0YA 1IH7A 2A1JA 3HP9A 4OLBA 4TUQA 1WSFA 3HVRA 3LZJA 1TKTA 4I27A 1ZQRA 3TABA 3RJGA 1CXUA 1RT7A 3OSPA 3OHAA 4XUSA 2YNIA 4RZRA 3T5JA 1ZQSA 3V7LA 2HB5A 7ICEA 4RQ6A 1TAQA 2BQUA 4I2FA 3KLIA 3M9OB 1VSIA 4MFBA 3NGIA 4Q44A 4DWIA 3PO5A 5EU7A 3G0ZA 4LZGA 9ICVA 5DG7A 1Z00B 4IR1A 1MSWD 4MFCA 4UB4A 4KN4A 2UVRA 4PA1A 3SQ1A 8ICIA 3ISCA 3VN5A 1BPEA 1VSDA 5HROA 5J0OA 1SKWA 3KLHA 4C8OA 2KW4A 5KFCA 1S6QA 1MQ3A 3BJYA 4DU3A 3DOLA 4AHUA 1KFTA 1Q8IA 5KG3A 3OJSA 3O3HA 2RDIA 3NAEA 2D0BA 2Z1GA 2ASLA 2KTQA 3V1RA 4I2EA 4CJWA 4FJMA 1ZQHA 1TV9A 3QEIA 2P6UA 3RR8A 1WSHA 1TFRA 2UVUA 1RBTA 4JWNA 4QZDA 1ZQJA 4RUCA 7ICIA 4O3QA 4PGQA 4H8KA 4BE2A 5KFTA 3HW8A 1W9HA 3RAXA 4DSKA 1NOZA 1N5YA 2VA2A 1JLAA 5FRMA 4F8RA 1ZQNA 2YKMA 5J2CA 1BPYA 4JV1A 4J2DA 4KTQA 4DOCA 8ICOA 1G15A 3S3OA 3V4IA 4O5KA 5IIIA 3TAMA 2RKIA 2FLLA 2BCSA 4ECWA 1NK4A 8ICFA 2YNHA 2NRTA 4JRPA 4GC6A 1QHTA 5KG1A 4O3PA 3VQ5A 3RMBA 4KHWA 2RDJA 1IKVA 1K6YA 4CGFA 1XSLA 4Y1CA 4O3RA 4FK4A 4AHCA 1TKXA 2OZSA 4UAWA 4DLEA 4J9LA 1ZQMA 5D46A 3I0SA 4RQ1A 8ICNA 2F1HA 5JS1A 5SZTA 4ECYA 3HSTB 4KLFA 4CF0A 2C22A 3MXIA 3B0XA 4NLGA 2IAJA 4O3NA 3RTVA 3NGZA 3BQ1A 1JX4A 5J2KA 4RUAA 1HJPA 4P4MA 5KG2A 1RBVA 3PW5A 4LSLA 4M3TA 1CUKA 1XO1A 2B4JA 1BCMA 3HO1A 4IRKA 4LZDA 1QLNA 2I1QA 2PZSA 3RRGA 4YG2A 1CEZA 4H4MA 1CLQA 1U48A 1T05A 4BE1A 1R0AA 1EETA 4RT2A 3V9ZA 4LVSA 1VSHA 3L3UA 3Q8PB 5F9LA 4E7KA 4R65A 5IIMA 5C42A 4Z4FA 1S5JA 4BACA 5KT7A 4F3TA 2P5OA 3QEPA 2JEFA 4RPXA 1B92A 3C21A 1IG9A 3AA2A 4J2BA 4YR0A 5L1IA 4FM1A 2HHVA 4CF1A 4B9SA 4HUFA 4FS2A 4DL6A 2ZUCA 4KRFA 4KLTA 4NYFA 3TFSA 1XS9D 1PZNA 4MFAA 4FS1A 4NXZA 4CJUA 5CYQA 2WOMA 2VA3A 3OGUA 5KFIA 1L5UA 4CHQA 4DTOA 3S3MA 4XRHA 4KLGA 4ELTA 4BDPA 5KFPA 4KLDA 2FMSA 1UOCA 4B3OA 3M8PA 3D0PA 3GILA 4DSJA 2BCUA 1YVUA 4DOAA 3QNOA 3ZT4A 5HMLA 4Z6DA 4F5QA 4DS5A 3LDSA 1ASUA 9ICAA 7ICRA 4CJRA 4Z4EA 4QWBA 3EPIA 8ICYA 5KFJA 4PQUA 9ICOA 3RH5A 4IDKA 4BGDA 3OYKA 4F4KA 3VA3A 2R8IA 4DL3A 4QZHA 3ZSZA 4PHAA 1EP4A 4NM2A 3ORYA 1ZETA 3C94A 3OYMA 1RBSA 2KZZA 3SUNA 3BQ2A 3GDXA 4O55A 5CYMA 4CHYA 2KFZA 5KT3A 3CFRA 4RU9A 3GIKA 3VQ8A 1EXNA 1XSNA 5CY4A 3KHGA 4IG3A 3F9KA 1BPZA 4XQ8A 2BQ3A 4PHDA 3PW7A 1ZQTA 2BCRA 3SUQA 4YMNA 4JS4A 3K4GA 4YQWA 3ZSQA 4O4GA 3RJHA 1NJXA 3JYTA 3GQCA 3AVJA 4O44A 4DTXA 9ICSA 3MR3A 5CZ1A 4EZ6A 5J2GA 5I42A 4M47A 3ZD9A 3V9UA 1XC9A 4QZ8A 5DGAA 3GIIA 3VQDA 2B6AA 5T7BA 2GWSA 4RW4A 5KI6A 3E2EA 1YT3A 3SV4A 3RJEA 4YMOA 9ICCA 2XHBA 3OYIA 2BGWA 1ZQBA 1RDBA 1ZYQA 1XSPA 1NOYA 3KJVA 3ZDDA 3EYZA 4RW8A 1NK6A 3KHLA 4I29A 4I2DA 2PXIA 3AVKA 9ICKA 2QKBA 1ZQEA 2ALZA 1VSKA 5CP2A 4O5CA 1NKCA 3OYDA 5HMMA 1LAWA 3NDKA 1S97A 4CE9A 1WSEA 4TQSA 1BISA 1J54A 2MUTA 4B9NA 4MQ3A 4GLXA 1S10A 1I3AA 2BHNA 4Q45A 4W5RA 3ULDA 4KB1A 4UB3A 3H8SA 5BPCA 4NY8A 3H8JA 3KD5E 3UXPA 5HRNA 1TL3A 2BKEA 2GV9A 4ED6A 3GV8B 2I5JA 4Q0BA 4KI4A 4DFPA 5HHHA 3HYFA 4JLHA 4Z6CA 3RBDA 1RTIA 2P6RA 4C8LA 3L8BA 4DG1A 4AH9A 3SUOA 2W8KA 1LW2A 4OKEA 4M42A 1HQUA 2J6UA 1A5XA 1EKEA 3AVAA 1A77A 1S0MA 3TAEA 1NK9A 5KG0A 4OKJA 4QZCA 4B08A 5J0SA 4BDZA 4O5BA 3RRHA 4IG0A 4KITB 3QEAZ 4ECQA 4ED7A 2LYHA 3LPTA 5L1LA 4Z4CA 3RB6A 3QZ7A 2XO7A 1JXEA 2FLPA 1HYVA 3AV9A 3MECA 4J9NA 1T4GA 4RNNA 3VA0A 4I2GA 4OPKA 3Q8RB 1ITGA 3V9XA 1VSMA 1U9LA 3H8WA 2ZJ8A 4FJKA 3HJFA 2F1JA 2VG5A 4H4OA 3E01A 3MGIA 4C8MA 2V4RA 4CIGA 4Z6FA 4F4WA 4CK2A 8ICKA 3C5GA 5DB6A 3LWLA 3V7JA 3KK3A 1SL0A 3B0YA 5J2EA 1ZQKA 4PPXA 4M41A 8ICUA 3PVXA 4R8UB 4CK1A 4HVJA 4RW9A 5CA7A 1HYZA 4Z4GA 3L2WA 2XGPA 1RDAA 4CGIA 4X5VA 4E7IA 4IRCA 2HNYA 7ICQA 4W5NA 2JEIA 1ZQCA 4RQ4A 3AO5A 3WNFA 8ICLA 5K14A 3TARA 4FO6A 5D49A 1TL1A 4O3OA 3AVMA 4O5EA 8ICHA 3A2FA 1RDDA 1YTUA 4BWMA 1L3TA 3CM6A 3TAQA 2OPRA 4O3SA 3PV8A 1BL3A 3VQ4A 3IG1A 1S9GA 5CR0A 2B21A 2IOCA 8ICWA 3NTUA 1A5VA 1Y97A 4BWJA 2XY8A 1S1TA 3F73A 4E1NA 3JPQA 3DRRA 3NFAA 1Q9XA 3ZSWA 5J2MA 1T7PA 4LSNA 2DFLA 1JLGA 1JLBA 5FROA 2DTUA 4GC7A 1LWFA 3JPPA 1CXQA 1JXBA 5EWGA 3RH4A 4RW7A 4J9MA 2FLNA 2E4LA 1RNHA 1S9EA 2Z1IA 1JIHA 4KLSA 4Q8FA 4YXMA 4FJLA 4FJ9A 4KN7A 3PX4A 4OLAA 1RBRA 5DK5A 4KLEA 1ZQWA 2XC9A 3MEDA 4CGJA 4M3ZA 1L3UA 4DU4A 1LW0A 3QO9A 4OJRA 1SL1A 4Y1DA 5DB8A 3NF9A 3U3GA 9ICWA 3LPUA 3PX0A 1BGXT 3PMLA 3H7IA 9ICUA 2ZQBA 3VQCA 3MEEA 5SWMA 4KO0A 1C0MA 3OHBA 4QWDA 3VQ7A 4YMMA 5C5JA 1RBUA 4ECXA 2IHNA 3QNNA 5KFQA 4I7FA 4DO9A 4M2YA 3DM2A 4M9JA 3ZDAA 4MEYA 3NCIA 5KFGA 4ID1A 2ZUBA 1X9MA 3AVNA 3MXMA 4O0IA 4KPYA 1KTQA 1S1XA 3SJJA 2HMIA 4W5QA 4PWDA 1XWLA 1ASWA 4R66A 3LANA 3K5NA 2HHWA 3IM1A 5J2FA 1B9FA 2A1SA 3BGRA 3OS0A 3SI6A 4CJEA 4FVMA 2H5XA 4N56A 1DOQA 4ED0A 4PUOA 2PFNA 2BQRA 5J2DA 4FBUA 4E19A 2G8FA 1B22A 9ICFA 3Q8QB 3VQPA 1V9PA 5KFBA 4DSEA 1K1QA 5BOMA 4F4ZA 5J0UA 3UQ0A 4O9MA 4CGDA 4CHZA 1JMSA 5IIKA 4CK3A 4CHNA 2PYLA 4RNOA 4CJVA 1Z25A 4E3SA 4JK1A 1BHLA 3PX6A 4QZIA 2OPSA 3UXOA 1JL1A 4PHEA 7ICSA 5KFEA 1KVBA 3IHQB 1ZQQA 5IIJA 4I2AA 4FLWA 1EX4A 5CJ7A 4R5PA 1QTMA 2XY5A 3MR5A 4JUZA 4F5RA 3MBYA 4IRDA 3OS2A 4J9RA 2IHMA 3O4NA 4YFUA 3RB3A 5KFXA 1BIZA 1XHXA 4KI6A 2HNDA 1WLJA 4KMUA 2R8HA 7ICNA 5DQHA 4EBDA 3L2RA 3CYMA 4RQ8A 9ICBA 3PR5B 1QQCA 4FJIA 3AVCA 3JPRA 4P2HA 4FJ5A 4EP5A 2JEJA 3ISBA 4MFFA 4CESA 3HM9A 2AU0A 1ASVA 2OA8A 4EYHB 3T3FA 4JWMA 1REVA 5TZVA 4CJLA 5J2BA 4Z0UA 1NJWA 4TUPA 2PY5A 3HT3A 3H40A 3ISNC 4DL5A 4OKKA 1N6QA 1GOCA 5KFAA 2DFFA 2ISPA 4XA5A 3ISDA 1HNVA 2IA6A 4KHSA 3QLHA 4MEXA 4YR3A 4KLMA 5JUMA 3MAQA 3AVHA 3AUOA 4IKFA 4KFBA 4KB0A 1DLOA 4DQIA 1F21A 1WSIA 3RH6A 1WN7A 4TSXA 3CG7A 2IGIA 1WCLA 4CJ3A 4UAZA 5J0RA 2KQ2A 4Q5VA 4ECVA 5KFZA 1CZ9A 3TI0A 5KFVA 3G10A 4PHPA 4K4GA 2BGGA 2ASJA 5BOLA 2X78A 3P5JA 4AHTA 3NF6A 4I2QA 5J0WA 5KG5A 1Z3EB 1BQNA 3T5HA 2ZD1A 3SYZA 1JLCA 4I28A 3HPOA 4KLLA 5DBCA 4PGYA 1ZJNA 4RNMA 1NK0A 4AILC 1RXVA 4M45A 3NHGA 5KRSA 2ZTEA 1RT2A 4EBEA 3PMNA 2JZBB 4UAYA 5KG7A 1RYRA 4KV8A 4J9QA 5FDLA 3O4QA 4FZYA 3KD1E 2OZMA 3KHRA 1ZQIA 2LSNA 1GOBA 3H08A 4OGCA 4FYDA 2F1IA 3NF7A 3DMJA 2W9BB 3SNNA 4RQ2A 3SUPA 2ZE2A 4RQ7A 4ZTFA 4QZFA 8ICMA 3OYAA 5J2HA 3ZT1A 5HRPA 4M3UA 1LV5A 4RT3A 4TUSA 5IIOA 5KFHA 3KLFA 3B6OA 4E89A 4GW6A 1WNSA 2BANA 1ZQPA 4CJKA 4R63A 4TURA 5IINA 3BQ0A 3QERA 1NOMA 2C2DA 1TVRA 2HVHA 3C1YA 3S3NA 5J0QA 2HHQA 4YP3A 2G8UA 4LH4A 9ICXA 3NF8A 4FM2A 4F5NA 3RMDA 4CJFA 3M8QA 4DS4A 8ICPA 4LD0A 2ZJAA 4FJXA 5D3GA 4DF8A 4O0JA 3DLGA 2P1JA 4K8XA 3NH0A 4FLUA 3HK2A 1NJZA 4C8KA 4B9VA 4QCLA 1MU2A 1ZBHA 2JLEA 4CF9A 2HHTA 4UQGA 1UT5A 1IKYA 3IRXA 4DTNA 2Y1IA 4B8CA 4QWEA 4PGXA 8ICQA 2FMQA 2AGQA 3V9WA 2JEGA 2V9WA 1C0UA 3V1OA 5KT6A 4YR2A 1KRPA 5CHGA 3RAQA 4QZAA 3SI8A 3C2LA 3V6HA 1RYSA 2AJQA 1VSLA 4FK2A 7ICVA 3QE9Y 1WSGA 1KFSA 2W42A 1BI4A 3OYHA 3SPZA 2HHUA 3ZDEA 7ICOA 5KFUA 4KHQA 3N4MB 4M3XA 2ITGA 3K58A 1JLEA 4FJHA 1BQMA 2IMWP 4GXIA 3VQ9A 3LDAA 4ED1A 3KIOA 5DG9A 3V72A 3GFKB 9ICIA 1EXQA 4J9SA 4BXOA 4F3OA 5HP4A 3AU2A 8ICVA 3DOKA 1RDCA 4HTUA 4YFKA 4IFYA 2PFQA 3HP6A 5J2PA 4ECUA 3Q8LA 4CGGA 1TKDA 4M3WA 1BCOA 4CEQA 4FXDA 2GUIA 3AO3A 3SV3A 4CJPA 1T03A 7ICMA 3IS9A 5KFYA 1ZJMA 3SCXA 3FYHA 2QXFA 1RCHA 3WNGA 3GV5B 3AO4A 4K4IA 4ED2A 2WONA 5KGXA 1N48A 4YD2A 3TAPA 3NE6A 4E1MA 2VANA 2AGPA 1SZPA 1HUZA 4CECA 3V6KA 1RILA 4AHRA 9ICTA 1J53A 9ICEA 2NRWA 3KKRA 2P51A 3PW4A 5KFMA 2FBTA 2UVVA 4IQWA 4M3YA 3P1GA 1IKXA 3PW0A 4I9QA 2VWKA 5DB9A 5KTQA 4YCXA 1RT5A 4J9KA 1UAXA 2G8HA 1QS4A 3K2PA 5KG4A 1D8YA 2KZ3A 7ICKA 3OYLA 1H38A 3Q8KA 1S1WA 4G1QA 1RT3A 4F4YA 2I9GA 1QSLA 3LP3A 3MABA 1BI4B 3O3GA 3NBPA 3MFHA 3M9MB 1S0OA 4J9PA 7ICPA 2XRIA 2ATLA 1C1AA 1QSYA 2ASDA 3V7KA 4BDYA 3V9SA 1L3VA 5HLFA 1UWBA 4ED3A 3GIJA 4DQPA 3P83D 3QESA 4RQ3A 3UXNA 1SKSA 5HRSA 1TKZA 4F2SA 1FK9A 4FM0A 2E6MA 3AVIA 3AVFA 5KT5A 4FZXC 4FCYA 9ICGA 4E7HA 1ZBIA 4KHYA 2IDOA 5KFOA 5KFRA 1NKBA 1LB2B 3LP0A 4IR9A 4ED8A 1JXLA 8ICEA 3TAFA 3QEBZ 3QEXA 9ICLA 3AO2A 2FBYA 1KLMA 3ZCMA 4UB5A 2NRXA 4JRQA 3JPOA 4K4HA 4C8NA 3ZDBA 4UB2A 2C2EA 4DSIA 2QK9A 2DFEA 2J6TA 2G8IA 3WNHA 3DLEA 4MF2A 1ZBLA 4HYKA 2O4IA 3UQ2A 3PR4A 4N47A 4DQQA 4EBCA 1HQEA 3TWHA 3DI6A 3LP1A 4FLVA 3DLKA 8ICXA 4G3IA 3ZT3A 1S6PA 3RJIA 3QIOA 3LAMA 1BVSA 3RB4A 5HP1A 4Z6EA 8ICTA 4QAGA 1W0HA 4CFBA 4DEZA 3KK1A 1ZQDA 1QE1A 4J9OA 3ZSYA 2Z1JA 4FJ7A 4QZEA 4I2IA 7ICTA 1JLQA 1ZQXA 2E6LA 5DQGA 4ZTJA 4CJSA 1LWCA 3K57A 5J2IA 5J0PA 1KEJA 3HPHA 3QETA 5DDMA 2G8WA 2A1RA 3AA5X 4RG8A 4I2BA 4HHTA 4I2HA 4CFCA 3T5LA 1TGOA 4CEAA 2G8KA 4UBBA 4KLOA 4HUEA 3M8SA 2QKKA 5KT4A 1Z00A 1SKRA 1B9DA 2R8JA 1IO2A 4OGEA 4Z4IA 4KAZA 3D45A 4ZH4A 1K1SA 3KHHA 1WAJA 5DDYA 4DFMA 3CQ8A 4NYNA 3V81A 4QZGA 1S0NA 1TK5A 4YNQA 3K75D 2ZTDA 3SQ2A 1ZQVA 8ICZA 4FW1A 2NRZA 4ECRA 3ZD8A 1D9FA 2PI5A 1CZBA 1UT8A 2VG6A 3T1AA 1BIUA 3HXMA 1UA0A 3Q8SB 3M8RA 3EPGA 3AVBA 3THVA 5EWFA 3CFPA 1JKHA 1VSFA 1VRUA 1YTAA 1U04A 3VQQA 3PO4A 3RR7A 4FBTA 4M6WA 2BCQA 5J0TA 2W9CB 3RBEA 3SPYA 5DGBA 2P66A 7ICJA 2JZBA 4DFJA 4DOBA 4TQRA 1S1UA 1WAFA 3OYEA 4ECZA 1X9SA 2UVWA 3LZIA 1DTQA 2AQ4A 2XCAA 3I0RA 3EZ5A 2W9CA 4DL7A 1T8EA 2RPIA 4AHSA 3LAKA 4NLNA 2ISOA 7ICUA 4CEEA 4FLZA 4I2CA 3RMCA 3ITHA 4M9GA 4HUGA 4CEDA 3TANA 3SQ0A 2DY4A 1S1VA 3T5KA 3DRSA 3HX0A 3C95A 3NH1A 4KTZA 2HHSA 1VK0A 3DLRA 4HCBA 3T19A 4CEFA 4B9TA 7ICGA 3ZT2A 2B5JA 4KLHA 3KLEA 3KKSA 2FC0A 2ATQA 3MR2A 2ETJA 3K5OA 5I3UA 3AO1A 2Q3SA 3K5MA 2V4QA 5EWEA 1TVAA 4YN4A 5DBBA 4UBCA 4DQRA 4N76A 3CM5A 5J2NA 4KLIA 1KVAA 4AHVA 1RTHA 4Z4HA 5CWRA 4DMNA 4F2RA 4CERA 3O3FA 4RW6A 3OYGA 3LALA 1KLNA 4Q43A 3C6TA 1FKOA 5D4BA 3EWAA 3QZ8A 3K59A 9ICJA 2GBZA 1Y88A 4JS5A 1ZQYA 1KSPA 2XY6A 2D0CA 4ECSA 4CF2A 4CCHA 3H4DA 8ICCA 4CJQA 2D0AA 1X9WA 1ZQLA 1BPXA 3AU6A 1RT4A 2Q0ZX 1A5WA 1VSEA 2YNGA 3LK9A 4CEOA 3MXJA 3TR8A 3I8DA 4CEBA 4DF4A 4KLJA 4FW2A 4E7JA 1KCFA 2D5RA 3OJUA 4RPYA 2YHAA 1ZBUA 3VQEA 1MQ2A 1DTTA 4DU1A 4F92B 5J0XA 4KLQA 1D5AA 3MGHA 3B6PA 4ICLA 3RWUA 3MR6A 1RPLA 4FJJA 1C7YA 4EZ9A 1JLFA 7ICLA 9ICMA 3OYJA 3PNCA 5J1EA 2F96A 2FPKA 2FBVA 4CF8A 3PY8A 2X74A 4CFAA 3MEGA 4KTWA 3OY9A 1UA1A 1WCNA 2F8TA 1X2IA 5J2AA 3GV7B 4FZZA 4N41A 3PW2A 5CB1A 1RXWA 3OYCA 2VG7A 5IILA 1LWEA 4JV0A 1N56A 2Z1HA 3QEVA 4QZBA 5KFDA 4B8AB 2R8GA 2O4GA 5C25A 3OSNA 4KHNA 5EOZA 1JN3A 3TQ1A 2HHXA 2HNZA 3FFIA 2RF2A 4DQSA 3OVNA 2VWJA 5J2JA 4CJ5A 3ALYA 2ZJ5A 2BR0A 4CFDA 2Y1JA 5DLFA 3HPGA 1QSSA 3S9HA 2PYJA 2G8VA 1IKWA
chains in the Genus database with same CATH superfamily
3ILJA 2HNZB 1ZQAA 4FWNA 4KH5A 3QEWA 4BCAA 1R3NA 2VUGA 3D0HE 4IG0B 1URRA 5KFLA 3HSGA 4GVMA 1YIJS 1T3VA 4HCCA 4ELUA 4PQAA 3AXMA 4I2PA 2RNEA 3MMVA 2RQCA 4CH0S 3ZZRA 3DRXA 1C0UB 2V5HG 1NKEA 3ADAC 1C1BB 1GLDG 4OI2A 1ZC6A 2F8SA 4NEZA 3J7YI 2L08A 1U1QA 5HSPA 2DNKA 1TV6A 2W24A 2ZITA 3AB4B 1BWEA 5J29A 1TVRB 3R2CJ 1YRXA 3UIQA 2NV3A 3GIMA 1F2HA 4WE1B 4BY9C 2C28A 3V6JA 4XIUA 1D8ZA 3P38A 1HQ2A 5M2PA 1XMQK 1J9AA 2DIUA 4GMJB 2GNKA 3AA4A 5L1MA 3NGDA 1JROA 1C20A 2ASMA 3I4PA 3T9NA 4ZVFA 2E2PA 3FBEA 1TK0A 9ICRA 5KG6A 2L9WA 5F0WA 4UY8T 4MAKA 4TVAB 4M1KA 2NLWA 2BJ1A 1S76D 3MZIA 1VLOA 3DXSX 1QQOA 4NE9C 1CJKB 3QT5A 4KLUA 1U0HA 4CIEA 5JRTA 4NCAA 4LF5F 1YVNA 1SIWB 4ISFA 2L9DA 3ZZOA 3FDSA 3O8WA 4NXNJ 4DTPA 4X66J 4A47A 4OPJA 3DLKB 2XG8A 4DUYK 1HKCA 1U2VA 2FXUA 2C1EB 1ZXOA 2D6FC 5ETKA 2F4FA 5HNKA 3QDKA 3BSNA 4IQTA 4U67L 3NVMA 3J7AP 1ZAWA 4JHDA 3CI5A 4OHWA 1U4BA 3MEKA 5HHIA 2B8QA 4QOTA 1RWWB 1T95A 2HOEA 1WACA 1PVRA 1TAUA 1LKZA 2DH8A 3OVAA 2ZEJA 1Q8BA 1GXLA 3AY0A 3P8BB 5AZJB 4MF8A 5FRNA 2YNHB 5HMYA 4CT8A 4PY5A 4X65F 3AVLA 3EVOA 4DR4J 3QMLA 4FKXA 2QO3A 2I9SA 2YX7A 2COLA 4ZJOA 4P52A 3CCSN 2IBKA 3WQTA 3DYAA 2MJUA 2OSQA 1XNQJ 2K7JA 2KHQA 4ZHRA 1LNQA 4WXWA 2YWKA 3TJ9A 8ATCB 4CBUA 4NI2B 2HOFA 4U7CA 2XMWA 4M9HA 2K4EA 7ICHA 3QAUA 2VF3A 3AD8C 2NCKL 2CPYA 3UR3C 1F44A 2AGOA 2QWLA 4C0ZA 2VC1A 5AI4A 1FDAA 4CLUA 4E0DA 3SZ2A 2ZHOA 2PKEA 2P9PA 3TADC 2CQ4A 4P9SA 4MKVA 5AQWA 5D0GA 3RB0A 4B1UB 1GLJO 3AAPA 2X7IA 2ZIXA 1CJUA 4KBOA 3SENA 2KN7A 3HL8A 2P9KB 2W01A 3H6EA 4DSLA 2W9MA 3K89A 4J7CA 1YAGA 3IG8A 2BV3A 4CHOA 2KT2A 2VDHA 2X6SA 4BC3A 3P49B 4CM2A 4CJ4A 2WVFA 3NGYA 2AQ0A 3GFYA 2DPJA 2MSNA 3CJBA 4YB6A 2E29A 1TK8A 3ZDCA 4M0AA 3PJ9A 5AI9A 3EGWB 5T14A 4JHDB 2YV0X 2DEIA 3I1YA 4GY2B 3ASMA 1D9DA 2QLBB 3EW9A 4O8KA 3L2UA 3KLIB 1RTDA 2IVNA 5AQUA 1KHWA 4B9LA 3PUFA 3HFKA 4QZVB 2IVMA 4CO1A 5DBAA 3D68A 3RJMB 3RZAA 4CHPA 2AX1A 2YTUA 3H8YA 2CGJA 2NRVA 3U1LA 3OUYA 4J2AA 4DSFA 1XMQF 1HPZA 3VTHA 3H45C 4YS2A 4DTJA 1VQ8S 2BPCA 2B4VA 2OPPA 1SL2A 3DOLB 1KR4A 4NI2A 2FPLA 3QINA 3T1YK 1VQMN 1KVCA 4ATNA 1D0EA 4JI8K 3DCAA 4KR0B 1D09B 4OJPA 4JKCA 4QIVA 3ULEA 4FK0A 4FFDA 4HDHA 3MEGB 1HBUA 4NLWA 2RQKA 4CE6A 2H3FA 1FVSA 1FXRA 3OVBA 4MN4C 3KLGA 4UB1A 1V6HA 1KEKA 3NL0A 1HD1A 2KU7A 2XSFA 4L73A 4OYBA 3PRVA 4FXWA 1RU1A 4MKAA 3VGSA 4FJGA 4YN3B 4EHTA 3KDOA 3OYBA 5KRTA 2X6NA 3JS6A 4LQ3A 1BC6A 4KB7A 3MPDA 3CDWA 3FFKB 3R5JB 3DDIA 2NUBA 4C7QA 2DPIA 4ILHA 1IV0A 4FZMA 2HCFA 1QE1B 2IC3A 5J0YA 2VDIA 1EKRA 4LF2A 4AQYJ 4TUQA 2QA4N 1WSFA 4IOAL 2CJYB 5LY3A 3TABA 2YQ3A 3RRKA 2OCEA 1RT7A 5IS2A 2VCPA 4JI2K 5EHHA 4K7QA 2NQPA 3BREA 3GL1A 1Y7PA 3A8IA 4P2MA 2GVDB 3KNAA 5ALIA 1DZ5A 1ECWA 1LOTB 3KLIA 2K1RA 2PEBA 3M9OB 1QDUB 3AXKA 4MFBA 1AUDA 3NGIA 3AHPA 4K2JA 5EU7A 4QIFA 4UW9A 9ICVA 4IR1A 3GYGA 2FJWA 2A6OA 4PA1A 4ZPCA 2VHGA 1FIQA 3M6UA 1SC4B 1VSDA 3R9PA 2LP4A 2V7YA 2MGZB 3JB9k 2UU9K 3J7ZO 2OPPB 3DOLA 1KFTA 1Q8IA 2RB7A 2YMQA 5AXLA 3O3HA 1YJTA 2F4VF 2RDIA 4URGA 5AKZA 3NAEA 2QL7B 2D0BA 2DRAA 2KTQA 3KZXA 4K41A 3AGKA 4P0QB 2KB2A 1JB0C 3QEIA 1IVZA 3KLGB 1RBTA 1U09A 4RUCA 4A62A 4O3QA 3PSPA 3FZLA 4PGQA 1X8DA 4GV9A 4BE2A 4CZCA 3HW8A 1W9HA 3RAXA 3TUJC 3VETA 4DSKA 5BRDA 2JJ4D 3PSFA 3DDKA 1V85A 4G65A 2Y0BB 4DR3F 2YKMA 4JV1A 2GMJA 4J2DA 4EGLA 1CULB 1G15A 4PPZA 5IIIA 4HWIA 4MDBA 2W2PP 4DU7A 4ECWA 2WVCA 3WXJA 8ICFA 4H0PA 3FUYA 1LKYA 4Q2LA 4JRPA 4R5PB 4H0YB 5KG1A 4KHWA 2DF4B 3CF5Q 1Z1BA 4H0XB 3KUGA 3VC8A 1X3MA 8RUCA 4A57A 4Y1CA 4FK4A 2OZSA 1HI8A 1IBKJ 3OBWA 2MKJA 3CJ5A 4J9LA 3U27A 2ESEA 2X3GA 2DHXA 1QAIA 3FJ2A 5D46A 1RFQA 1KQQA 2WC9A 4X66F 5FPDA 4KLFA 1S6OA 4DR6K 3D2QA 1ZH5A 2Q0UA 2C22A 4CF0A 2GVDA 3B0XA 5GAGU 2OLWA 3W61A 3NGZA 3QIDA 3T1YF 1GX6A 1JX4A 3FGUA 2BANB 5FDLB 4F26A 2FJVA 2HBLA 3GG4A 5M1NA 3PW5A 4M3TA 1FO1A 3M32B 4NA1A 1TR0A 1KBRA 5BR8J 5HK4A 1TL1B 3T41A 4MYTA 4JI1K 4B02A 1FRKA 1CEZA 2VG6B 1U48A 4I6YA 1T05A 4JKGA 1R0AA 4BE1A 3MM8A 1HNXJ 4RT2A 4JI6J 3L3UA 1H2UX 3ZZYA 1IJEB 3MCPA 4BC5A 2B3TB 2W7PA 4ED4A 4A46A 2G2ZA 2WAQD 4Z4FA 4ID8A 5KT7A 2IBOA 2E7VA 2OPRB 3QEPA 2P5OA 1L7MA 1IG9A 3IM9A 2F4VJ 5CRXA 1M5PC 5HN0A 2E2NA 4YR0A 1SPBP 2RKIB 4FM1A 5KL1B 2HHVA 4CF1A 4B9SA 3M7DA 1GT8A 4RKUC 4JI2F 5D77A 3O9TA 1YJWN 1XS9D 1AFIA 3NS6A 5A2QO 1V3SA 1Q8KA 2WOMA 3A8JA 3RW7A 2DITA 2ILZA 4BS2A 3CCVN 5IWAJ 1RTZA 3S3MA 4XRHA 1PIEA 4IO1A 2BW2A 4ZP7A 2FMSA 3NRZA 1UOCA 2DR5A 5CD4H 3CCSS 1F2GA 3GILA 5AICA 1NSQA 1GLCG 3AAQA 3VEOA 3QNOA 3ZT4A 4DS5A 4F5QA 5JLHA 2BRKA 4WFZA 4AL5A 3I55S 4CJRA 2UU9F 3EKSA 5KFJA 2F5GA 2VD3A 5BPLA 4PQUA 3ONNA 4IDKA 4PL8A 5AK6A 3TZWA 4DV2K 2W7OA 1VQSA 4DL3A 4FDFA 2BDUA 2H3ZA 1B4FA 1ZETA 3EZOA 2EG2A 3C94A 5F41A 4BRHA 3HI9A 2K7KA 2XI2A 1FF2A 3CFRA 5JVHL 1F1BB 4PG7A 3VQ8A 1E4FT 5H1SQ 1XSNA 3TVZA 3F9KA 1BPZA 1WKLA 4PHDA 1ZQTA 3AJ1A 3SUQA 4OLOA 5A2QU 4JBCA 2DXDA 3OR1B 1FDDA 4WCEQ 4O4GA 2O8FA 3GONA 2CNKB 3JYTA 3M2VB 4C48A 3O4WA 3EX7B 4DTXA 3CJKA 5CZ1A 4DKWA 4DR3J 3F44A 2PAVA 5J2GA 5JU5A 4IOBA 3FE1A 4KKOB 1XC9A 4A61A 1QJHA 2KJ5A 3VQDA 2WAQF 1LXNA 5T7BA 4DV4F 2GWSA 1TUYA 4RW8B 3E2EA 4C80A 4PG4A 3DV9A 4USVA 3SSRA 1HWJA 3SSSA 2BGWA 1HEKA 4KGVB 3L9ZA 1X7VA 1NOYA 3IGVA 1RCXB 3OVSA 3KHLA 4I2DA 5HROB 3T1HJ 3PYFA 9ICKA 3D54A 3O1LA 4DR1J 2DR8A 5KOWA 4C97A 5I42B 2E5SA 3CCZA 1W2BM 1X9XA 3J80O 3CGIA 5CP2A 3S1TA 2DHHA 2QL5B 2EFVA 1VJQA 5B0DA 4F67A 3C65A 2DHAA 4QJFB 1KD1O 1J54A 2MUTA 1WHWA 1IXKA 1S72S 5BYSA 5IT4A 3JS9A 4Q45A 3W63A 4W5RA 2ZIVB 2ZF5O 4KB1A 3M8WA 2XLJA 4KV8B 2VJVA 2YY6A 1VMBA 2CQPA 2DGUA 3KD5E 3UXPA 2AHOB 2PT0A 3PIOL 2DY1A 1Y10A 2NR0A 3BKFA 4TYBA 1N36K 2BE2B 3MOZA 2I5JA 4KI4A 3HYFA 3RBDA 1RTIA 3KWGA 3IO1A 2G0IA 3L8BA 2FSJA 2E5GA 5ALPA 2W8KA 3KMSA 1MWZA 4K0KF 2KHVA 4M5DB 4I6MB 3G82A 3QU9A 3AVAA 1DARA 2DNMA 1QCKA 4B08A 5HMZA 3RRHA 4IG0A 1X4FA 3DLJA 4ENOA 1K73T 3FRZA 3D6FB 4XDCA 4USTA 3BF4A 4KHMA 3GR0A 2ZFHA 1K0TA 4B3MJ 2MKSA 4J9NA 4WQ5A 3RFAA 2NPFA 1U1OA 3IBWA 4DR2K 1Y00A 4HACB 1U1RA 3WUHA 3DI6B 3T79A 2NZCA 1VQNN 4FJKA 3HJFA 2VG5A 2ZH5A 1DY3A 2JH1A 4C8MA 5DZ6A 3BS5A 3THPA 2BRLA 4AYBD 4Z6FA 4F4WA 1HBOA 5DB6A 1YI2N 1NLVA 2G2YA 3PVXA 2I1RA 1CZAN 2UZAA 1QUPA 5CA7A 1VQPS 4Z4GA 3MEEB 4BGAA 2DNYA 2A5XA 4CGIA 4X5VA 3HD2A 4BRQA 3WK6A 2JEIA 4F3MA 2QLFB 4LFCF 4AM6A 3CXCM 4OX9F 4O3OA 3AVMA 4XO0A 3FNNA 4QU6A 3IFRA 4O3SA 3PV8A 1BL3A 5M1FA 1Z6RA 3VQ4A 3H0LB 5CR0A 2KVCA 2RT3A 1IBLK 8ICWA 3UN3A 3NTUA 3H2LA 6AT1B 1Y97A 1RTIB 1S1TA 3F73A 1KS2A 5FJ4A 2D74B 3ZSWA 3X3UA 4LSNA 2F8MA 4HHUA 2CQ1A 4M5DA 4X64J 5M2UA 5FROA 1FHTA 1S59A 2LEBA 3RH4A 3HFVA 4J9MA 2ZH6A 2ALYB 5DDQC 5CZXA 5T7LA 2RRBA 4G1PA 4KPCA 4LF6J 2ZHAA 3P4UB 1VQ5N 4Q8FA 1BUPA 4FJ9A 3PX4A 4B3TK 1RBRA 3N0VA 3FRYA 4PKIA 5DK5A 4KLEA 3ZNJ1 2XC9A 2YB1A 2HRTA 2MKHA 1YJNS 4LC9B 3QUCA 5ALNA 2PO4A 5LJ3Y 1UEUA 5E3CA 3U3GA 4ZN3A 2JWKA 3UNGC 3VQCA 2BOAA 2LDIA 3QWPA 2RP5A 1SXLA 2EG1A 3DM2B 1YHQN 3VQ7A 1UW9A 1HBOB 4FN5A 5HQ8A 5C5JA 3UO0A 1NGFA 3R7SB 2R7RA 2IHNA 4IO9Q 4I7FA 3ZDAA 5KFGA 2RS2A 3AVNA 1NM1A 2K3KA 1KTQA 1S1XA 4IOCQ 2HMIA 1VHXA 2V2KA 5C12A 4FNIA 2DGOA 1X4HA 2A1SA 5AFUA 3SI6A 4CJEA 2GQQA 4Y2QA 1U6FA 3S01A 2BQRA 1B22A 9ICFA 1V9PA 4DSEA 2H3QA 1K1QA 3MX5A 5J0UA 3UQ0A 4FYXB 1WC6A 2CRLA 2HRYA 3D1OA 2A40A 1JMSA 2GX9A 1RZMA 1B99A 1B70B 4LRCA 1Z25A 2IIHA 4E3SA 4R0EA 2J9EA 2UXDJ 2FF6A 4C1NI 3I76A 3R9KA 5KFEA 4P2XA 2KV2A 2FHJD 3TO8A 4RNHA 1FJGJ 2ZJPL 4TYAA 2DGQA 5EE9A 4I2AA 4FLWA 2DR9A 3UI3A 3GJSB 4BQZA 3O4NA 3GZFA 4YFUA 2CQHA 3RB3A 5KFXA 2YBVA 4TNOA 5AI0A 2KIWA 3BH7B 3QFWA 2HNDA 1N8RO 1RDUA 3J7YP 7ICNA 4RQ8A 3PR5B 2R9LA 3AVCA 3CIZA 1IQZA 4EP5A 5H9FJ 3IBPA 3ISBA 2GJFA 1Y9OA 1L3KA 2ZIWA 3HM9A 4EYHB 3T3FA 1B7FA 2OM6A 4JWMA 1REVA 4CJLA 3PHEA 4Z0UA 2XMMA 2PY5A 2VC0A 2W43A 1UQVA 4OYIA 1ICEB 2G1HA 1VI7A 3L95X 3SBGA 5B08A 1N6QA 4HAIA 1FERA 3SMPA 5B5EU 1L8LA 3DGPB 4DHYA 3GE9A 5GTIU 4XA5A 2IA6A 5C0YA 1N33J 2KMDA 2IRUA 2ZJRL 3HVAA 2PGCA 4XEIA 1N32F 2GHPA 2CDRB 3AVHA 4KFBA 1KQKA 2ZNYA 1F21A 3CG7A 2IGIA 2P2CB 1CS4B 4Y2TA 4NLDA 4UAZA 4QQBA 9RUBA 4Q5VA 2VBZA 4ECVA 2PN6A 2V4JB 3QAEA 3C7NA 3CC4N 4NYPA 5KFVA 4Q2MA 1XMOK 2F76X 2AT1B 2ASJA 3RSEB 1PVPA 5CYJA 1EWQA 4I2QA 5J0WA 3DRSB 3THWA 3T5HA 1K9MO 1VJWA 3L7OA 4TU7A 2FPHX 4RNMA 4USIA 4J9UE 3GMGA 3WK5A 3MK6A 4NASA 3MECB 2GMHA 4UAYA 1ZQ1C 2YQ0A 1GMUA 2NYVA 2OZMA 1QAYA 4PKGA 4OGCA 4FYDA 1GLLO 2VQFK 1N62A 1HBNB 3CJRA 2ZHBA 4WQ4C 3D2EA 5E2QA 3FM9A 4ZTFA 3OFGA 1MW7A 4YB1P 2OMOA 1B3TA 1OMSA 4M3UA 1LV5A 4C6AA 4OI6A 4GO7X 5AJ3J 5IIOA 4CNQA 3KLFA 1A9NB 3VAHA 4E89A 3GFHA 4LUBA 2V34A 2C2DA 3WIUA 1TVRA 2E1YA 3F56A 2HBJA 3MAAB 5E33A 4LF7J 5J0QA 3L4QA 4YOTA 4LFCK 1KQSR 1SAZA 4L76A 2V6AA 3QT8A 4FM2A 4OX9K 4CJFA 3M8QA 4DS4A 1SI9A 1GLBG 3P3DA 3FZKA 1FKPB 2HQGA 3DLGA 5IV4A 2FB0A 3Q83A 3NH0A 3HK2A 4B9VA 2M52A 3GU0A 4I0WA 1WF0A 4DV1K 2BKOA 3PSIA 2CDQA 4CF9A 3SIPB 2JC0A 4JNEA 2CJ9A 2YKOA 1IKYA 1JLEB 1HNWF 2CUYA 1VBKA 3CCUS 4M5GA 1R8BA 3UE2A 3W9HA 3V9WA 1C0UA 4DJBA 3SI8A 3C2LA 3M4XA 3PEHA 2VPZB 4WFAL 2HOQA 3DJCA 7ICVA 4OYPA 4ZPTR 1L7PA 2W42A 1BI4A 1DQAA 3IRWP 1E6YB 3QFUA 5LMNJ 4FYWB 2R18A 3N7PD 5K14B 2ITGA 2FLOA 3K8WA 4FJHA 3IFEA 2ASOA 4GXIA 5AHXA 5RUBA 3W7BA 3GIRA 2HZVA 4XDDA 5B0EA 1RAIB 5DG9A 3V72A 3WDOA 3GFKB 3JXOA 4Y3CA 5AZJA 3KVGA 2GMLA 3ENWA 2V8PA 3DOKA 3BBFA 2NXUA 4OJHA 5C24B 3D67A 5JVGQ 1T11A 4IKAA 3A8KA 2ZM6J 4NLSA 4Z7YA 3SEOA 3QJJA 4CEQA 3MWBA 2CNNB 1JK9B 2GUIA 3AO3A 4ACOA 3F2DA 2LBOA 4J5OA 4NOHA 1H98A 1U2CA 3NS5A 3B9JA 3FYHA 1SXDA 1RCHA 2K4HA 3BYPA 4A59A 3AO4A 5KGXA 1K8AO 5AKYA 3OQ2A 3ZO7A 4E1MA 1RJJA 4MKBA 5ALHA 2CQCA 4MLEA 4DV5F 5A6PA 2Y8WA 1IM6A 3WBZA 3KOAA 3IGNA 8AT1B 5IXUA 4AHRA 4C7YA 2HAFA 2P9UB 9ICEA 3KKRA 2P51A 4ZLJA 1PK1A 1DRZA 4QIWC 4S0MA 5DO2A 2W3RA 1AYEA 1WNEA 4IQWA 3P1GA 1IKXA 1BA0A 3PW0A 2PA8D 4XTTA 4URSA 2E8OA 4YCXA 1NGDA 4J9KA 1UAXA 2G8HA 1QS4A 1HW8A 4ICAA 4CLPA 3N6LA 1D8YA 3IR5B 3K5PA 2VBXA 3OYLA 1ROFA 1D3WA 1GK8A 1RT3A 4DV7K 4CYUB 2I9GA 2D1KA 1BI4B 1U25A 2FJEB 3VERA 4EFHA 2IM1A 4LF8J 3GU3A 2ZH7A 2EWSA 2O8DA 2DUYA 3UCGA 2XSJA 4IFYB 4RJVA 2D9OA 1QSYA 4G9BA 4BDYA 3V9SA 3NBPB 3CPWM 2A41A 2YQEA 5L8RC 4J90A 2JGAA 4RQ3A 2RDDA 4OL8A 2A2DA 1VAZA 1SKSA 2Q2RA 3N79A 3VF2A 3B54A 5KT5A 4FCYA 5AKXA 2HNYB 9ICGA 3ATVA 1NB7A 3NAHA 1ZBIA 5KFRA 1LB2B 2KL8A 4Y00A 4IR9A 4ED8A 1SC3B 8ICEA 3ZTQA 4W90B 5ETQA 3AO2A 2EI5A 3A5LC 4LMZA 2J9DE 1CJVA 2KH9A 4JRQA 3JPOA 3ZDBA 1N32K 4UB2A 3V4IB 1V97A 3HJVA 2J6TA 2XZTB 3QWUA 4LF6F 3FZFA 3DLEA 3GE1A 5AQQA 3MCMA 1ZBLA 4KH1B 3WKCA 2B7CB 3U26A 1N5YB 3UQ2A 2H1YA 1XERA 3P5BP 4GMKA 2KXFA 3CCES 2M8HA 2FUG9 5FLXY 2O8FB 3FEZA 2WB1C 8ICXA 2KG1A 3I28A 3RJIA 1VC6A 4LF5K 3LAMA 3AJDA 4CGZA 5M1QA 5HP1A 2FDNA 3ITHB 2EKYA 2ZD1B 4IH6A 4EO6A 4CFBA 1B0XA 4DEZA 3WEEA 2VFSA 3KK1A 5AZIB 1QE1A 4I2IA 7ICTA 5AQFA 2RIJA 2E6LA 3AD7C 3VOVA 5AQYA 1R31A 1OPZA 5DDMA 3M2RA 2G8WA 1Y3KA 2A1RA 4OZLA 2EC2A 4EELA 4I2BA 3DHWC 2N4CA 3KMQA 4HTJA 4DR6F 3HHDA 1MROA 4R25A 3M1VB 4KLOA 3HHLB 1X4AA 4HHHA 3M8SA 1C0FA 5KT4A 2QKKA 1Z00A 3KHHA 2P6TA 1YTYA 5DDYA 4DFMA 1ATSA 5IZHA 3TU5A 4UY8O 4F9OA 4YNQA 3MM9B 3H3NO 3W5ZA 3P31A 4OMFG 1RQ0A 3TJAA 2NNWA 3HXMA 1IQTA 4DZ6A 3M8RA 3GR1A 2VOPA 3THVA 4C98A 2OD4A 1S9EB 2VJ4A 1JLGB 2HVDA 5D4NA 4Q7AA 3RR7A 3RBEA 4RQMA 4NA2A 4JD2B 2X1BA 2ZH3A 4DOBA 3CCTA 1JJCB 1JUDA 2R7WA 3CE8A 1WAFA 3QGGA 2I6WA 1X9SA 2IAJB 1DTQA 5ETSA 1RP5A 3I0RA 3D2FB 2W9CA 4P7TA 4DL7A 3MWPA 1S1VB 3ONQA 4WZMA 1WEYA 4NLNA 4Y2CA 1UVKA 4CEDA 3SQ0A 5IT0A 1DK2A 2DGTA 1SKUB 2QWNA 2YNFB 1UFWA 5F0UA 3SAFA 1VK0A 1N0VC 2HWIA 3TTCA 4B9TA 4YB5A 2IFXA 3MMAA 3EICA 3KLEA 1C1CB 1IBMK 2CJAA 3NCRA 3K5OA 3AO1A 2KYXA 3E66A 1OH7A 3K5MA 1W97L 4N76A 3ELHA 2QW9A 4IQXA 4HT7A 3N6NA 4B9QA 3THXA 4JI0F 1RTHA 2GQ2A 5CWRA 4U8YA 3CRXA 4DMNA 2GWJA 4DR1F 1J2NA 4DX5A 2P9PB 3O3FA 3ILOA 4RW6A 4PWWA 3OYGA 4PG5A 3LALA 1KLNA 3LPEA 3TA1A 2OH2A 2YHWA 4BLGA 1ZQYA 3M3ZA 2D0CA 5IT9O 2RILA 1RT4A 1ZOLA 2ZUAA 2IA0A 3CPWR 3HKZD 4ZP8A 1YX2A 2Z8QA 4DV5K 4CF4A 4KH0B 4JYAF 1NGIA 4DR2F 2YTCA 4E7JA 3OLBA 1KCFA 1OS5A 2LA4A 1WF2A 1OKJA 4FPBA 2FY1A 2ZBCA 4LQ9A 3W65A 1J2MA 4DV4K 4F92B 3R27A 2UUBF 3MN5A 2RQMA 4Z94A 1WC4A 3B6PA 4ICLA 2IDLA 4CLWA 1T03B 4FF3A 2O6KA 2B5JB 3VGTA 3RWUA 4PG8A 2IOFK 3CUNA 3W9IA 2J0SD 1HWUA 2QRRA 1C7YA 4EZ9A 1XO0A 1FJGF 1JLFA 7ICLA 3L7PA 3E9PA 2ASPA 3I4HX 4WQ5C 1HKGA 5HLFB 3BP8A 1F9FA 2FBVA 4CF8A 1BQXA 3LL3A 2OHDA 5E7OB 1RHUB 4B1XB 2EZZA 1WCNA 5J2AA 1HKBA 5E3RA 1SJ1A 4UY85 1HARA 3K1RB 3H7HB 3TP2A 1S99A 3J81U 2IIRA 3QYYA 2K4IA 4A8EA 1N56A 2SXLA 3QEVA 5IM0A 1YJ9S 1OYEA 1WD6A 5B8HA 2AJ1A 2YWEA 2R8GA 2JFDA 5C25A 4KHNA 4UAUA 2ABYA 1JN3A 1MA9B 2HHXA 4LFBJ 4QPTA 3D2WA 4HI2A 5BPMA 4CJ5A 3ALYA 2BR0A 1NNEA 4OHXA 2CZVC 1W2IA 3KJFB 3QJLA 2G8VA 1IKWA 1V5VA 3TUZC 2VQEF 3CSKA 4X4PA 1NBEB 2FPMA 4XH1A 4LF8F 1LW2B 1R89A 2J0XA 3CFOA 3KTQA 2KZMA 4DU8A 4I2JA 3CCLS 2Q1NA 1WSJA 5J1PA 2J6SA 3FCVA 1UZDA 1YJUA 2M9KA 2W8LA 2IC3B 4UF4A 4E7LA 1HUOA 2I7NA 1BLUA 3U9DA 1SZHA 2WTFA 1RTJA 2BMBA 5ALTA 1QQNA 4USKA 4RQ5A 2GIRA 3HVTB 4IQVA 2EVZA 4QW9A 3O9SA 1JCFA 2PA3A 5EOYA 1DLOB 4DXLA 3TEHB 2GZOA 1KW4A 3TKAA 3L0QA 3CMES 1VDHA 3MM5B 4AUKA 3KKAA 5C2CA 2VFTA 5IC4B 4B1VA 1NK7A 3SQ4A 1S0VA 2C2RA 1UW4A 2B8PA 2DGSA 2H4WB 1I39A 3OR2B 1NGBA 4QIWF 2A2CA 4CEZA 3LH2S 1P8ZA 3CO9A 2JRZA 4M5KA 4PYAA 3CXCR 5HRRA 4YOWA 4YY3K 5FP0A 2JWNA 1X1PA 2DH7A 3IXQA 2OTLS 5GADU 4CO0A 4CZGA 4BE0A 1C1BA 1HJRA 1ZQZA 1HD0A 4EU0A 1U45A 5ALSA 3DRPA 1YITN 3TAGA 1TV6B 3EDRB 2XS2A 4LREA 3T1YJ 3IG1B 1S9FA 1SQFA 3IDWA 2HEKA 3FR0A 4K4UA 4FLTA 1NJYA 4FJ8A 5SUHA 1A76A 2NRHA 2LQJA 2PFPA 1KHVA 3JSMA 1DGKN 4QOZB 4A2AA 3G71S 4B3RJ 2LQ9A 1HL6A 4F93B 1Q7LB 2FMPA 2GX8A 2OXOA 4A4JA 2DFHA 2RN2A 1NGEA 2LQBA 3Q23A 2Q3PA 1ZQOA 4CJTA 2OYQA 4WYBA 2KM8C 2QMWA 2BDPA 2PIIA 5KFKA 4Y2YA 3CJ8A 3R1LA 2VH7A 2WB4A 5KPRA 4KX5A 3BQTA 4DCJB 1FTRA 2MZJA 3WNEA 4USWA 2PMWA 3TFRA 2WMMA 2YJEA 1S49A 2IY5B 1SQGA 2EW9A 2ZH1A 3OS1A 1ZAXA 3THWB 4DX8H 4PXDA 1E4GT 3SBTA 5HBMB 1BPBA 3NVVA 4NWBA 3ZSRA 5IC6B 4LFAK 4DTUA 3UD3P 1SV5A 3IA0A 4CRXA 4CH7A 1RZTA 1QVGR 5IV3A 3JPSA 2OYYA 3GYXB 5E26A 2PSZA 1FEZA 5KT2A 1GXUA 4J2EA 2EC0A 4DV6J 4KSEB 1KC8O 1JKHB 3MM7B 2JZ5A 4RLEA 4KMOB 2JGUA 1HIWA 5ETOA 4BG9A 1FE4A 4O3MA 4K0KJ 2XTJP 1L3SA 2VFVA 1Q5YA 2MY7A 1FXDA 1KD1T 3VGMA 1T3QA 5M1KA 4HVZA 3T6BA 3OL7A 2ZWHA 4F4XA 3WC2A 3C6UA 1WOSA 4P4PA 4W98A 2W2NP 2UXBF 3G6VA 1NGAA 1FXXA 4V1Ak 4LH5A 1TL7A 2A3JA 5E3PA 3HMJG 1XU4A 3UDCA 2BPFA 1DRGA 1PG5B 1X4CA 2AEJA 2H5JB 3C46A 2NSBA 2M7SA 3MCOA 1ILYA 2YXLA 4GXJA 4NLKA 1T3NA 1W7WA 1ZPWX 2N82B 2LMRA 3MDAA 2VASA 4B3SJ 1B4SA 1DURA 1U26A 4QYRA 5G4DA 4YDDB 1VGYA 3EGVA 4NLZA 4A5AA 2M0GB 2IRYA 3RJJA 1F0XA 3T1HF 3TADA 5KFNA 1QVGM 4FLYA 2MZSA 4CGHA 4L74A 2YJFA 1ZM9A 1RBAA 4B1YB 3NS7B 2KE7A 1WEZA 1I51B 3FQKA 1G7CB 3LWMA 3CCEN 5L9XA 3VWSA 3E1YA 3NRWA 1XN9A 4RNFA 3ENOA 2V2QA 5ALRA 2EFOA 8ICGA 1UWBB 4F3QA 4IWVA 2M2BA 3S6JA 2FC9A 2RU3A 3ZSVA 4MJKA 4DTMA 3EGNA 3ICLA 1J5OA 3O0FA 3G6YA 3U1NA 3FSXA 2MPUA 1IM4A 4K25A 4W5TA 4DOZA 2Q6BA 1KN5A 2JFKA 3LP2A 4KHPK 2HBQB 4A48A 4DR5F 3A1YG 3U6FA 2E5LF 4G1QB 3Q8MA 3V6DB 2DKXA 2QZ8A 1VQ4N 2HS3A 9ICNA 4DL4A 4XH4A 3VQ6A 3EXYA 2GGPB 8ICAA 1RT1A 3TVKA 2Y3YA 1NXIA 1MC8A 4US9A 1S6PB 3GLJA 1KDHA 4Y2SA 3M6ZA 4CO3A 1ZQUA 4H0OA 4FWOA 1H1VA 2A1JB 4LR9A 2QEXS 5DB7A 4ID5A 2LYBA 4PH5A 4N5SA 2ADCA 4M3RA 3DLBA 4KX3A 3MDCA 4OYZA 1HNWK 1VR6A 4WIIA 1IH7A 1IR2A 5GAEU 4R0JA 4OLBA 3A8EA 2HMIB 2LQ5A 5AR0A 3HVRA 3A0HU 5C2FA 3G8TA 1XMOF 1T6DA 3BSAA 5HO4A 3OSPA 2OUGA 4OYWA 3OHAA 2E8AA 2DPNA 1ZQSA 4LFAF 3V7LA 2HB5A 7ICEA 3D66A 4ZVRB 4RQ6A 2UUCK 1TAQA 2KHOA 3CIPA 1WOOA 2POKA 4DWIA 3AT1B 2BZFA 2Y8YA 1RQLA 2HURA 3A3PB 4LZGA 3G0ZA 1F60B 3CMQA 3G2XA 3HDSA 4ZVEA 3TW0A 4DCOB 3DDHA 5GMDA 2FVPA 3UVJB 2EAPA 3ISND 2BA9A 3N9UC 4PRFA 2F3JA 1BPEA 2BH1A 3VGKA 5HROA 3DMJB 3I96A 3MPWA 3KLHA 1S6QA 4KIAA 4K50A 4PABA 1VQ6N 2XSJB 4DU3A 1J5OB 4B1WB 1R27B 1I5OB 1VRQC 2ZC3A 2VFUA 2PMZC 4TKTA 1Q79A 4EX6A 2I6XA 4JV5F 4H5TA 1TV9A 5GAEI 2UVUA 4ZPVR 2PDAA 3IMXA 5FPMA 3NVZA 2MZTA 2V8HA 1SS6A 1EO1A 1YJRA 4X65J 2X1GA 2VA2A 5AK5A 5D0EA 5J2CA 1BPYA 8ICOA 3V4IA 5GADP 3J80Y 3TAMA 3FLCO 3MGVA 2XICA 1BWVA 1NK4A 4MYUA 3K1ZA 2WBRA 2Z0GA 4GC6A 1Q78A 3RMBA 2B0CA 1IKVA 5I9EB 4BROA 4AHCA 1JLQB 4UAWA 2RHFA 4DLEA 2G4BA 4C23A 3C16B 3I0SA 3CW2C 2BM1A 2MSTA 3DXMB 2OI2A 5GVQA 5ETVA 5HQMA 4NLGA 3C15B 4LSLB 2BOPA 3RTVA 2BM0A 1WUAA 4C7ZA 3BQ1A 2MGZA 4RW9B 1SB6A 4P4MA 3AEVA 2KT3A 2EFGA 3W60A 2UP1A 3GG1A 1XO1A 2E5LK 3FBCA 1DT9A 4LZDA 1QLNA 2I1QA 3IM8A 2ZZTA 1DFDA 4DL0C 4PXCA 4H4MA 2EFNA 2U1AA 1S9GB 4B3TF 2B0GA 4LR7A 1EETA 1ZD3A 2JLFA 4LVSA 1VSHA 3HBTA 3Q8PB 2HAIA 2EH9A 1B0VA 4R65A 2FVSA 3AY9A 3M2UA 1OXJA 2D41A 2NZTA 4NL9A 2UXBK 1UTAA 1DHMA 2W54A 3M32A 1HWLA 4LF4J 2BW7A 1CULA 1RGIA 4WFBL 3NVKA 3AA2A 4RUHA 4B17A 4J2BA 5L1IA 2FHJA 3L4BC 3CJ3A 3QT7A 4A2BA 3VEYA 2JH3A 5AM5A 2ZUCA 4KRFA 4NYFA 3G25A 1PZNA 3AM9A 1WTBA 1Y0HA 3A12A 2W04A 1QQ7A 3OGUA 1TUVA 3JTNA 4JKBA 1L5UA 2AYEA 4WU2A 1NGCA 5AKIA 3MPVA 1CC8A 4KLGA 4U7UK 2IM0A 3QIPB 1QUVA 3B78A 5KFPA 4KLDA 1N5QA 5HQLA 4CZLA 3M8PA 4DSJA 3DU6A 3N5FA 2D9PA 3IR7B 4HEA9 1GLFO 1NZPA 1ASUA 7ICRA 3C15A 3ULHA 2HWTA 1GTEA 2R8IA 4PHAA 1RE1B 3O9QA 3ORYA 3E0FA 3LP0B 1EIYB 3BSOA 2KZZA 3SUNA 4O55A 5CYMA 2JLGA 1XUPO 4DR5K 3FCHA 1ZS6A 2RVJA 3ZETA 1HYSB 5KT3A 5AKHA 2HPUA 4OJ6A 4RU9A 3G9CA 3TX0A 2FSKA 3R7NB 3OTEA 4XQ8A 2BQ3A 3PW7A 3GCXP 3H5SA 2BCRA 2Q31A 3THYB 4DFDA 4FYVB 1IBMF 4YQWA 5K20B 2WHEA 2OPSB 2Q66A 2MRLA 3ZSQA 4DUTA 2Y0SF 4LT6A 1NJXA 3O9RA 1T9UA 1J6ZA 3NLCA 3CCMS 4IH5A 3VR1A 3MR3A 3CC7S 3HLUA 1SWVA 2WBMA 4M47A 3ZD9A 2E1PA 3V9UA 4XH5A 2X1AA 2MB0B 4HHJA 1L7OA 1REGX 2ZBIA 2OP5A 5KI6A 4FF2A 4AD6A 1K8AT 4JI5F 1YT3A 3RJEA 5BREA 3WQPA 4CZKA 3RAMA 2KJ8A 3DAWA 1MN9A 1ZQBA 1RDBA 1Q95G 2KSOB 2ZUGA 4M63A 3TRGA 3KJVA 4MO4A 1FRJA 4CZHA 3I5AA 4I29A 1UEKA 1RWVB 2PXIA 5A8WB 3AVKA 3LGMA 1WOPA 1LWCB 3M8PB 1I3OB 3HILA 1EZZB 1UCVA 4IDKB 3GFZA 2ALZA 1TUWA 1FFWB 2K8GA 2CVEA 4LVOP 3LGNA 3OYDA 2P9NA 1FTCA 4CZFA 5HMMA 1LAWA 2V2ZA 2J9DA 1WSEA 2I2YA 1NI3A 2FJ6A 4C8ZA 5LSLA 2BJ8A 3HZGA 2Z2ZA 4UB3A 5BPCA 4NY8A 2FYXA 2PMZD 4OYOA 1XQSC 1UPHA 1T9WA 3VZIA 3H8JA 3LVVA 3TEGA 1TL3A 3HD1A 3ZC4A 2UUBK 2GV9A 3R97A 3KD3A 3OTDA 4ED6A 5HOOA 1Y4ZB 4WP9A 1JJHA 4JLHA 4X4NA 2MKYA 2LA6A 4BBYA 2P6RA 2DHGA 4FPIA 4AH9A 1FX2A 4DR7K 4HR2A 1YZ7A 4DV3K 3KKFA 2W2OP 3MMJA 1A5XA 1EKEA 3D6HB 1SV4A 1HR0F 3MM6B 4QS8A 3TAEA 1NK9A 1TUUA 5KG0A 4QZCA 2BABA 2B4UA 2OEMA 1NSKL 4KITB 3BBBA 1RQNA 2CRXA 2AZ1A 1R59O 5LMUF 4ED7A 5L1LA 2D7SA 3HKZF 2HF3A 4Z4CA 5FIIA 3KJQB 3SFUA 3H3OB 3QU7A 2CPDA 2M4MA 1WB9A 3G87A 5K9FA 4DUZJ 1VQLS 3CCJS 3KG1A 2NUHA 5M1PA 1RT7B 3Q8RB 4QJVA 1ITGA 1VSMA 1FJGK 1BNOA 1U9LA 2ZJ8A 4OX7A 2F1JA 2E2QA 4H4OA 3E01A 4K4TA 4CK2A 2E1RA 3CQYA 4ZPAA 5K8NA 8ICUA 4R8UB 4CK1A 1T94A 1UWAA 4HACA 2VJUA 1RDAA 1CLFA 4MK7A 3KK1B 1JWWA 2HNYA 2C3YA 2I8EA 4ISGA 1TL1A 1HI0P 4O5EA 4JI4J 1YTUA 1L3TA 3TAQA 2RS8A 2J7KA 1MROB 2DJWA 3IG1A 4JKGB 1R0AB 2ADBA 2B43A 2IOCA 5ALOA 3D28A 2XVTA 2IM2A 3G82B 1ZA1B 1FXLA 1OO0B 2GAHC 1UVJA 4F25A 2IM3A 3TSPA 2XY8A 3R2DJ 2M3DA 1KQFB 3NFAA 2YWWA 1ZD2P 3MN9A 2R4FA 3OL9A 4ZVHA 2BYCA 5F2RA 1ZD4A 3FEYB 3CC2S 3F41A 2P9KA 4GC7A 1LWFA 3JPPA 1JXBA 4DX6A 4RW7A 2LEPA 1Q86O 2Z57B 1S9EA 3MMBA 1AT1B 2IYGA 2Z1IA 3TA0A 1JIHA 4KLSA 4XPCA 1LW0B 1LKYB 3GBTA 2CXYA 3DYAB 2FQQB 4DPOA 4FJLA 1FW6A 2H5EA 3FSYA 2Y0SC 3D2SA 2BJEA 2VICA 4FYYB 3B8HA 4CGJA 4M3ZA 3J8AA 4DU4A 4Y1DA 3D2FA 3AQPA 3HHLA 3PYDA 4IDHA 3NF9A 5AIBA 3VHQA 4U7BA 9ICWA 3K8VA 4RO0A 1FVQA 2IJNA 3CCRN 2DISA 1Z05A 3CHWA 3B4DA 3MEEA 1XMQJ 5SWMA 1C0MA 3W2VB 4K5RA 3BPSP 3OHBA 4QWDA 4BRMA 2BJ7A 4DV6F 1RBUA 4ECXA 2V67A 5KAKA 3VF4A 5KFQA 3QNNA 2VQFJ 1SB3C 1P1TA 2N1RA 1WTFA 4X4QA 5ETTA 2J76E 3EXCX 4M9JA 1CJUB 3NCIA 5CE3A 4ID1A 1XNQF 4NZ0A 1X9MA 2CQBA 2NXCA 3MXMA 3N5BA 2RHSB 3H1VX 4W5QA 4PWDA 1XWLA 1F5AA 3LANA 2JXJA 2Z30B 3G4SS 1YK9A 1MN7A 3IM1A 2KJVA 3B82A 4FVMA 4WU3A 1RK8A 4NLCA 4E19A 4DV0K 1W7AA 4OCZA 3N01A 2DNLA 5KFBA 5DDOC 2P9IA 1HR0K 3QNWB 3MUMP 2F7TA 1TKTB 4CGDA 3HOTA 4CHZA 2QYGA 4CK3A 3Q24A 1T9XA 4CHNA 2PYLA 2UXCK 3THXB 3R1HA 2V51B 3I87A 2OIHA 4JK1A 2OPQB 4UT4A 4OHZA 4QZIA 3H5XA 4BRKA 3CJ4A 3CWJA 4P74A 3UXOA 1JL1A 4PHEA 3IHQB 3P4IA 3MMCB 3Q7CA 5CJ7A 1RKJA 5TKYA 1QTMA 2A3ZA 4PL7A 2XY5A 1TYQB 3ETOA 4NXMJ 1GO3F 1H7WA 1YF5L 1YWXA 1BIZA 3SFGA 1XHXA 2O8BB 2YMPA 4KMUA 2W4CA 4ITSA 4BX9C 1X4EA 9ICBA 2NREA 4ZPDA 4FJIA 5EY4A 1HNZF 2CADA 5AFUH 3VMFB 4K4SA 2JEJA 3D1QA 5C2GA 4EMDA 3CDUA 2RD5C 2Q0RA 3VESA 4CESA 2AU0A 1ASVA 2OA8A 5TISU 2LU1A 2F8KA 1YJ9N 5J2BA 5A8RA 4JI7J 1EQ0A 1NJWA 3HSDA 5ALQA 4P0PA 5D0HA 5AKEA 3QLHB 2C2NA 1IV8A 1IN0A 3M1YA 3ISNC 1XNRK 2NYHA 4MFBB 1L8OA 3HT0A 1M1KT 2A19A 4OKKA 4I4BA 1GOCA 3MWTA 4GFJA 3OD2A 1S72N 2KP7A 4YOUA 3ETMA 3I82A 2DFFA 2C3UA 3E9LA 1UFLA 1JLFB 1H73A 1HNVA 4MEXA 2ZH2A 4WFBQ 4ES1A 4KLMA 1LWEB 5JUMA 1BY9A 3AUOA 3QRPA 1DBDA 2DB1A 2R2RA 4DQIA 2VWBA 3RH6A 4TSXA 1N88A 5L38A 3TZXA 1FA0A 4CJ3A 2KQ2A 4FZNA 3DOMB 5AM2A 5KFZA 3WX8A 1CZ9A 2O67A 5A0YA 1YKWA 3DLEB 4K4GA 2CAJA 1OQ3A 3JXUA 1KTVA 3EWGA 1YUWA 5G5GA 3NF6A 3BZQA 2HGMA 4IYQA 3UDEA 1Z3EB 1BQNA 4RCHA 3F5EA 1JLCA 3HPOA 2W7AA 2HI0A 3SMVA 2CJXB 3R9LA 4KLLA 5DBCA 1IKWB 2K1RB 4AILC 4C0OC 1RXVA 4M45A 1C4CA 4H4KC 4ZDNA 4RTFD 4LFBF 4EBEA 1PYOB 2JZBB 2CNLB 1NGGA 2J5AA 2JVOA 3C3LA 3O4QA 4FZYA 3KD1E 3C2PA 3KHRA 1ZQIA 2ZJQQ 2LSNA 2FVQA 3MR7A 2JV3A 4RWWA 1QTNB 3LYSA 5ETMA 1U1KA 1BHNA 3SNNA 2G08A 3OW2M 4IL6U 2ZE2A 4MTPA 5LXRA 4RQ7A 3OYAA 4AE5A 4ZP9A 2QLWA 4WBFA 3K0SA 3NVWA 2LXIA 4PHTX 2A1AA 2OFGX 1WNSA 3IRUA 4R63A 5IINA 1NOMA 4NLRA 2HVHA 3L4PA 5AQTA 2E8PA 1NEEA 4YHHF 2L9NA 2DH9A 1FRMA 5IFMA 9ICXA 4KFBB 3NF8A 2YWHA 1CJKA 3MURP 2WTUA 3A5MC 4A8OA 2QE5A 4ANDA 8ICPA 4LD0A 2BZ2A 3MI7X 4FJXA 2E5JA 3HCXA 4UOGA 4DF8A 4O0JA 5KQ8A 4K8XA 3ZTSA 2YX8A 4QCLA 1LCUA 2EQYA 5F8GA 4K4ZA 1ZRNA 5ALMA 1FD8A 4GKKJ 1NPKA 3QBWA 4BRIA 4C1NK 3KOOA 1WBBA 1VRTB 3D6TB 4AQYK 1BOTO 1KVKA 4B3TJ 2HG4A 4JI5J 5H9EK 4B8CA 4Y34A 1VFJA 8ICQA 5LSRA 3IP0A 2AGQA 3JAMY 3V1OA 5KT6A 4CD3A 3G8QA 3RBXA 2N3LA 1VSLA 2KKVA 3IN5A 2EKNA 1H2TZ 3QE9Y 1RT5B 1WSGA 5AI6A 2HFSA 3SPZA 1ITPA 1FJEB 3B6BA 1RWUA 2KRRA 7ICOA 5E5NA 5KFUA 4KHQA 1TZ0A 3MC1A 3TJ8A 2F65A 1N0UA 4F36A 1PK3A 1IUJA 1JLEA 4GKJK 4ZPWR 3VQ9A 1T9TA 4JKHA 1S3XA 3KIOA 2D3O1 1RHMB 2CPEA 1K0VA 4J9SA 4EWTA 4BGBA 4BXOA 2ZOMA 8ICVA 5EE1A 3JQKA 5J2PA 4ZKAA 1VQPN 4PZVA 1ESVA 4CGGA 4OV1A 1HKAA 3FFIB 3FAHA 3AARA 1BCOA 3DRRB 1IBKK 1T3OA 1NPPA 3OXGA 5D0RA 4FXDA 4FWQA 3BH6B 3UW1A 1HPMA 4QBUA 2FI1A 1VISA 2CQ3A 1E6VA 2NUUG 1ZJMA 2AEMA 3JSMB 5FPNA 2WF5A 1HNZJ 3FZMA 2HGLA 4FF4A 3LM2A 3CJQA 1BU6O 2LKZA 1S5ZA 3WXIA 3HX9A 2JHDA 2KK0A 3PKYA 4MH8A 2WCXA 2R7TA 1N48A 3NE6A 1KN6A 2VKQA 4OV6A 3VF0B 3V6KA 4A8QA 1HHQA 2H3EB 2QMUB 4UTGA 9ICTA 4O4RA 2QA2A 3T9ZA 3VQTA 1RWNB 2HSEB 2R2TA 3F2CA 3CJ9A 3PW4A 5KFMA 2FBTA 1TL5A 1S1TB 2UVVA 1RG6A 5ALKA 4M3YA 3CERA 3RBZA 1RAOA 1B0PA 2C2MB 3ZZPA 1UCNA 1UEVA 4UZCA 2JWLA 4X62J 1MMDA 3AOBA 2N7CA 4E2FB 2UUAK 1PAEX 1ZM3A 5BYRA 4F7VA 5KPZA 2OSRA 1S57A 2ZKTA 3Q8KA 4X62F 1S1WA 5J1EB 2QYCA 4CP5A 4CVNE 3O3GA 1OWXA 3M9MB 2FZCB 1S0OA 2V2VA 4I2PB 7ICPA 5AQGA 2XRIA 1C1AA 5K5MA 1NB2A 4X4OA 4JI3F 4FOEA 5M1OA 1K9MT 5HLFA 3I56S 3D3BJ 3QESA 3BGFA 3UXNA 2O1PA 4F2SA 1FK9A 5KNIA 2EPIA 3P45B 4I1TA 4FM0A 3NWGA 2ZNZA 3AVIA 2V68A 1NH8A 4E7HA 3L3CA 3HRDD 4DG1B 3FZ2A 4NMLA 2OGUA 2E9ZA 2B4PA 1ZRMA 3LP0A 4RPFA 3D7SB 4OPAA 1Q46A 2FBYA 4ZVGA 4Y2AA 2YX4A 4C8NA 2C2EA 3PNIA 3VAJA 1DJ0A 2O4IA 2ZIVA 3CJKB 4H5RA 4YOYA 4L72B 1QQMA 1NRKA 3S8SA 2K89A 1YGYA 1NUEA 1HQEA 4TU8A 3TWHA 2DY9A 5HMWA 1UVIA 2P8IA 3FC9A 4TLQA 3DLKA 1X31C 4U8VA 4CT9A 3MPYA 2F8LA 1S6PA 2HS0A 4KHPF 3QIOA 3RB4A 4WYWA 4Z6EA 4A8KA 2A42A 2C42A 2CA9A 2NLXA 4QAGA 5A2QY 3ZSYA 1ZBTA 4CDGA 1ZQXA 4UB6U 2CPJA 5DQGA 2MA1A 3LDOA 1LK7A 3AA5X 3ZTRA 4NZ6A 5F3ZA 3NS1A 3MUVP 4I2HA 4CFCA 4DV4J 1X9JA 1S7IA 4ANCA 4LF7K 3UCUP 2QFIA 2GAGC 2WVBA 3IC1A 3F9MA 2ZJQL 4ZH4A 2EANA 1UPMB 4L3NA 4BVOA 4AXIA 4NYNA 4DBQA 4ZJQA 1VQKN 3R6LB 1TK5A 2V9KA 3K75D 5ETRA 4ZPBA 1ZQVA 8ICZA 3HFZB 2NRZA 2CJBA 4ECRA 3KLFB 4LVNP 3ZD8A 1W2BR 3WK4A 3QSIA 4B6JA 1VRUB 2V0NA 3FMBA 3O08A 3D1HA 4ES2A 2YX6A 1VDVA 3T1AA 4WIQA 4FPRA 2CWXA 3RU0A 4YB7A 3EPGA 5D6GA 3AVBA 2CGKA 1FKOB 5AQLA 1YTAA 3VQQA 1FE0A 3CJSA 4JKAA 3PO4A 4FBTA 4GV6A 4M6WA 3WK7A 5J0TA 3CTRA 4PZOA 2P66A 3IV6A 1YRTA 4RR5A 1S1UA 3OYEA 2MKKA 4ECZA 2AQ4A 5D78A 2XCAA 3EZ5A 2RPIA 3LQVA 3ZEUA 3CC7N 3CCWA 4PG6A 2ISOA 7ICUA 4CO4A 4CEEA 2AF6A 1YIJN 4I2CA 3ITHA 2GEMA 1F5CA 4BRDA 2DY4A 5E3QA 3H98A 2R7QA 1T9YA 3DRSA 3EZUA 1M5OC 5AK3A 2J4RA 3C95A 3ETRA 3JTPA 3NH1A 2H3IA 4CEFA 3SQIA 1FDNA 3ZT2A 2LCWA 2YPYA 3CJ7A 2ATQA 7FD1A 1HBMB 2WSEC 3CDBA 3DN9A 5AQRA 5LMUK 1XBWA 2VYPA 2O3DA 4JI8J 4JKDA 5EWEA 5DBBA 2VGMA 2VPXB 2D3OR 3CM5A 5J2NA 2ZIXB 1RKIA 4UOHA 1KONA 2EZXA 1EHWA 4ILGB 2ZBQA 1GMWD 2QTDA 4KAIA 2XI3A 1OH8A 2OMLA 3C6TA 3K59A 1R7IA 5CYQB 3Q2SC 1RHRB 3ATUA 1YG0A 1IJFB 1GMWA 3MM8B 4BRFA 2AJ0A 2I7PA 2GO9A 4EUVA 4ECSA 3H4DA 1VCTA 2D0AA 1D4XA 4IEEA 1ZQLA 4CZMA 1BPXA 1HWIA 3AU6A 4QR1A 1MWKA 1OY8A 1ZA2B 3K17A 4B3OB 2D3DA 1CQNA 4OQJA 4B3RK 1F5BA 2YNGA 1OSDA 4UASA 3HHLD 3MXJA 4RW4B 1VJ5A 3QJPA 1WWVA 3TTFA 5DZ7A 4FW2A 3MDQA 2D5RA 3OJUA 3M2UB 1YI2S 2GTDA 2QM1A 4OO1J 3JSBA 1MQ2A 4CTAB 5MLCQ 4KH6A 2B9WA 3U02A 1D5AA 3SR6A 4LIWA 2KEYA 1SQEA 3OYJA 3CD5A 1RBLA 2WFBA 2FPKA 2JL9A 3DLLL 2CZ4A 2VG7B 4DV2F 5GTHU 3G6EN 4KTWA 4IJAA 2F8TA 1X2IA 3GV7B 4FZZA 5HL7L 1U6ZA 4N41A 2LECA 3M30A 2CH5A 3TUIC 1SCJB 3VALA 2M88A 1VBYA 3IWNC 1SWWA 3DXKB 3VEZA 2HNDB 2HQFA 1WDDA 5BXIA 5CABA 4JV0A 2QA4G 3R8EA 5KFDA 2GO8A 2MLYA 3NOCA 4B8AB 2O4GA 3ZTPA 1NWKA 2OKQA 2HNZA 2W03A 4ZJLA 4FF1A 2RF2A 4DQSA 3H0RB 1F5SA 4Z2XA 3NGUA 2C2KB 3CD6N 3HPGA 4PWDB 4DHVA 2PYJA 2ACYA 3AOAA 3RJFA 4GKKF 2OTLN 3NY0A 2VQFF 1IG6A 1A7GE 4P73A 2F63A 1FJ7A 2J8SA 2P9IB 4Y65A 5AKJA 4P0QA 4X64K 3U3YA 2KFNA 1D1UA 4K8RA 2W9BA 4F5OA 4I9LA 3BEGB 3D3CJ 4B9UA 2M9NA 4KY3A 2QI2A 3ETLA 4FLXA 1WHVA 1RT2B 1XNQK 2QT7A 3W0LA 2YCHA 3NGRA 4OVLA 3QIPA 2CZ9A 3DLHA 2YKNA 5JS2A 1DGSA 1A0OB 3SQOP 4UZBA 4J37A 1N33F 3OYFA 3L3VA 4KKOA 3D6JA 2XLKA 4RX6A 1HRHA 4DTRA 5DKWA 2OWOA 3OFHA 9ICPA 4NJ8A 2A10A 3J7A1 1Q1KA 3H25A 2A6AA 4JB8B 4NCGA 3RSEA 2XQCA 4OJLA 4LF9K 1VIXA 2MUTB 2X51A 2VQEK 4O0NA 4CZEA 4K59A 1LOUA 1HNIA 1NK8A 3WXKA 1T44A 4WE1A 3G96A 4MIBA 4PKDB 2GW8A 3VEVA 2BE2A 2HSZA 3HHLC 1QY7A 2KSOA 3KJVB 1HYSA 2BCVA 1A6LA 3BM7A 1J5EK 2BPGA 4QW8A 1KQSM 2G1DA 3ALRA 3HZEA 4DV0F 4EYIB 1MU2B 1FI4A 1O03A 1M1HA 4OZJA 3BY5A 5B0CA 3KDNA 3O1WA 4RPZA 4AF1A 3M9NB 2P9NB 4K8ZA 3EN9A 1CVJA 1M90T 4X84A 4X4VA 4UUWA 1QVFM 3VEWA 4B9MA 1RXOB 1EWRA 1K73O 3N97B 3AL0B 5CZ2A 4E1JA 1QZ6A 3PIPL 2L48A 3H4BA 4IQUA 1O51A 1RT6A 3UKRB 2LYVA 3DOMA 4JV2A 4JI0K 3ZNUA 1E3MA 3WXLA 1LQ9A 2YX1A 4CWBA 1P6TA 3D6MB 2QARB 3Q8YA 5F8IA 1COOA 2VA8A 4OJ1A 5DG8A 5KAIU 3BGLA 1XI1A 5AQMA 4V19J 4QR2A 3VAGA 3H90A 5AQIA 2XCPA 1YBTA 5AQPA 2E1EA 5IQ6A 2YNFA 1RI7A 5I3UB 2E66A 3SAGA 1U49A 4M9LA 4QWAA 4H5NA 4QWCA 4DV3F 4GXKA 4ZVUB 1JI7A 1UJ6A 5ADXH 2FJDB 4KRWA 3E9OA 4CF5A 1B43A 2WF8A 1GFWB 3MMAB 2J7UA 2O66A 3IS9B 2ZUDA 2ZE2B 5F3TA 2XY7A 5F8JA 1Z26A 2WBNA 3GOIA 3GZ7A 1SZ2A 4YHHJ 1WYGA 1FRHA 2C3PA 4CF3A 2WONB 2DO0A 3BDPA 1IXRA 3LDLA 2R7XA 2NZ4A 4YD1A 2GVZA 2DCUB 5L1JA 2DBBA 3EZWA 5DLGA 2W4PA 4USHA 1KFDA 1U2RA 2FJAB 4IFVA 1PKUA 1MN8A 1RHJB 2DCLA 2ODGA 1FO4A 3VENA 1C6VA 4LSNB 3I56N 2W6LA 2MQOA 4N77A 3BN7A 2RRAA 4DTSA 1NK5A 4Q8EA 4QR0A 2U2FA 3KUHA 2QJ3A 3UN5A 4X64F 4ELVA 4WCEL 2P9LA 5FPEA 1XMOJ 1LAVA 4K42A 1ZBFA 2CXEA 3K5LA 4W92B 2OEJA 2FBXA 9ICQA 2LYAA 4JD2A 1P9QC 4DLGA 3C5FA 2P5GA 1H74A 5EUHA 4A8SA 1AROP 1Z2LA 1TU0B 2J7WA 3ZT0A 4GNIA 1B0TA 5A8KB 5KFWA 4OZ3A 3EY1A 2UV8A 4UUXA 2GIFA 1AB8A 2Q4TA 1S8OA 3EMTA 2PFUA 1RTDB 3VVTA 3N4WA 2VZ9A 5D4OA 4NCBA 8ICSA 1HMVA 5F8MA 3KWIA 3NG8A 3IBFB 5AE1A 4I7FB 1TE2A 4ZA1A 4TY8B 3C2MA 3GJTB 1ZQGA 2OJ3A 3O3LA 5HJXA 2YKAA 2YKQ