4B9NA

Structure of the high fidelity dna polymerase i correctly bypassing the oxidative formamidopyrimidine-da dna lesion.
Total Genus 208
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
208
sequence length
581
structure length
581
Chain Sequence
b'TAKMAFTLADRVTEEMLADKAALVVEVVEENYHDAPIVGIAVVNEHGRFFLRPETALADPQFVAWLGDETKKKSMFDSKRAAVALKWKGIELCGVSFDLLLAAYLLDPAQGVDDVAAAAKMKQYEAVRPDEAVYGKGAKRAVPDEPVLAEHLVRKAAAIWALERPFLDELRRNEQDRLLVELEQPLSSILAEMEFAGVKVDTKRLEQMGEELAEQLRTVEQRIYELAGQEFNINSPKQLGVILFEKLQLPVLKKSKTGYSTSADVLEKLAPYHEIVENILHYRQLGKLQSTYIEGLLKVVRPDTKKVHTIFNQALTQTGRLSSTEPNLQNIPIRLEEGRKIRQAFVPSESDWLIFAADYSQIELRVLAHIAEDDNLMEAFRRDLDIHTKTAMDIFQVSEDEVTPNMRRQAKAVNFGIVYGISDYGLAQNLNISRKEAAEFIERYFESFPGVKRYMENIVQEAKQKGYVTTLLHRRRYLPDITSRNFNVRSFAERMAMNTPIQGSAADIIKKAMIDLNARLKEERLQARLLLQVHDELILEAPKEEMERLCRLVPEVMEQAVTLRVPLKVDYHYGSTWYDAK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DNA POLYMERASE
publication title Unexpected Non-Hoogsteen-Based Mutagenicity Mechanism of Fapy-DNA Lesions.
pubmed doi rcsb
source organism Geobacillus stearothermophilus
molecule tags Transferase/dna
total genus 208
structure length 581
sequence length 581
ec nomenclature ec 2.7.7.7: DNA-directed DNA polymerase.
pdb deposition date 2012-09-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00476 DNA_pol_A DNA polymerase family A
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.20 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 5' to 3' exonuclease, C-terminal subdomain 4b9nA04
1.20.1060.10 Mainly Alpha Up-down Bundle Taq DNA Polymerase; Chain T, domain 4 Taq DNA Polymerase; Chain T, domain 4 4b9nA02
3.30.70.370 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 4b9nA03
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 4b9nA01
3V81A 5KG7A 4FJGA 3QEBZ 2PI5A 1I3AA 1QTMA 5KGXA 4J9SA 5IIMA 2C28A 3L8BA 3KKSA 5KFIA 4MFFA 3KK1A 3MFHA 3JPSA 4PGXA 1S77D 1JL1A 4CIFA 1S5JA 2VG7A 2UVWA 3SCXA 2XGPA 1X2IA 3C21A 3L2QA 1EETA 2W9BA 2HHSA 4QWAA 9ICLA 2PXIA 1V9PA 4KTWA 4RNNA 4FXDA 4RQ5A 4IKFA 5J2JA 1S1TA 4KLJA 3RJJA 3PMNA 1K6YA 3M8SA 1HNIA 3KK2A 1S0NA 4N5SA 3NGDA 4DS5A 1BIUA 1HYSA 4O5BA 4CHYA 4CEFA 3ZDEA 1YVUA 4AILC 3VQBA 3K59A 4QZDA 2KZZA 3WNGA 4QZ8A 1RT6A 4YG2A 4GMJB 5CZ1A 1ZQSA 3OYAA 4E0DA 1D5AA 9ICEA 5J0UA 2V4RA 5KT6A 3QO9A 3PY8A 7ICIA 2UVUA 7ICOA 3O3GA 3H40A 1RT3A 3QE9Y 3MXJA 4YVZA 4TSXA 3VQDA 2XO7A 7ICUA 2M9NA 1ASWA 1N6QA 3KLIA 2KN7A 3KD5E 4DL2A 1SZPA 2G8KA 3FDSA 5C25A 5CA7A 4CJRA 3Q8QB 1S6PA 1MQ3A 4DWIA 2A1JB 1EKEA 4OVLA 4JV0A 4KHWA 1CLQA 4ELUA 1YT3A 2C2DA 5KFXA 3PO4A 2Y1IA 2YNGA 4F5RA 1EP4A 1RT1A 4MF2A 3MR2A 1ZQPA 4F4YA 3RH6A 3L2WA 1D9FA 1QS4A 3ISBA 1ZQAA 2UVRA 4N56A 4E7JA 2R8HA 4UB1A 4H4MA 3OYDA 4WE1A 4P4PA 2R8IA 3N97B 2RPIA 4W5NA 1ZYQA 3C94A 4B9TA 3NF9A 2IDOA 3SQ1A 3VQ4A 3VN5A 1T05A 3SYZA 5KG1A 3ZCMA 4M9LA 2C2EA 4PHDA 3C95A 2W8KA 5J0QA 1TK8A 1ZQZA 5KG4A 2AGQA 1TKDA 3PUFA 2BCUA 5KFWA 1LV5A 2C2RA 1QSSA 1RXVA 3ZD9A 4DQIA 3AV9A 4K8ZA 9ICCA 1MQ2A 4Q8EA 3AVLA 5KFTA 3RJFA 4I9LA 1MC8A 4QW8A 3T19A 4CFDA 4OGEA 3OYHA 1Z00A 1H38A 1RBTA 4ED3A 4IR9A 4FK0A 4K4HA 1L3VA 2ZUBA 2G8IA 3HP6A 3KHGA 1IG9A 1BQNA 2BKEA 1NKEA 3NCIA 3QNOA 4DTJA 8ICZA 3MXMA 4DF8A 4LH5A 5HRNA 4RW9A 4G3IA 2W8LA 1Z00B 4GXKA 1J54A 4YN4A 1NK8A 4Z4CA 3MEDA 1TAUA 3SQ4A 5KG6A 2PFNA 1MSWD 3JPPA 5KFUA 3LP0A 3KHHA 1ZETA 4AHCA 8ICSA 1KEJA 5CHGA 1GOAA 3AU2A 4FW1A 4DL4A 5D4BA 2JLEA 7ICLA 3PX6A 3C6UA 3PW5A 3HXMA 2IOCA 3OVNA 2FLLA 4QWEA 4I7FA 2PY5A 4IDKA 1NJXA 4NLZA 5I42A 3BJYA 1RTHA 4F4WA 4CIEA 3GIKA 3ZT1A 3L2RA 4UBBA 5DDMA 1ITGA 2E4LA 3SUPA 2KQ2A 3K4GA 2PYJA 1U9LA 4Z6DA 2F96A 1ZBLA 3TARA 5DB8A 2ALZA 4NLNA 3DRPA 1G15A 4EBDA 1D9DA 5BOLA 4CK3A 1SKWA 4CEZA 4NYNA 4TQSA 2R8GA 1JLEA 5KFOA 3QEXA 5KFMA 4M6WA 4MF8A 1KDHA 3L3UA 5C5JA 1GOBA 1XS9D 1ZQEA 4FJXA 5CWRA 2ASJA 1WNSA 1JLFA 4FM2A 3HJFA 5BPCA 2P66A 3OJUA 3D45A 4DL3A 4RU9A 3RB0A 2FMPA 2AJQA 7ICFA 1N48A 4M6WB 4CGIA 5KFEA 3V7KA 1TK0A 1JKHA 2RDIA 1VSFA 5IILA 4JRPA 4DTSA 3GFKB 3FYHA 2QKKA 1A76A 4RNMA 3PW0A 1RTJA 3UQ2A 3HPHA 1LW0A 3ISDA 3EYZA 2JGUA 3DLRA 3RMAA 3LALA 2R7YA 2IMWP 4FVMA 4DFJA 3CM6A 2NRVA 5JUMA 1BPYA 1BPEA 1ZQRA 3PX0A 1HPZA 8ICQA 3BQ2A 4UB2A 5L1KA 4CHPA 8ICWA 4RUCA 3MR5A 5IIIA 4YFKA 2HB5A 1BPDA 4M9GA 2ZUCA 4I2GA 3F9KA 3DLGA 2BDPA 4UAWA 3MAQA 3KHRA 7ICTA 1ZQIA 3CFOA 4I2JA 4DTPA 2XRIA 4KHUA 4DL6A 2F8SA 3C2LA 3V7LA 4DLGA 3MDCA 4LH4A 1NJZA 1KVCA 3AO5A 1RPLA 2ZTCA 1UA0A 1NJWA 1ZQYA 5IINA 2VG5A 4FLXA 4CJ3A 2Z1JA 3HO1A 4FZYA 4KHNA 1ZQLA 3UIQA 3I0SA 3HPOA 3I8DA 1DTTA 3IG1A 2IHNA 1DLOA 2KFZA 3AVGA 1HJPA 4YR3A 5J0XA 8ICMA 4W5RA 4E1NA 5CYMA 1JXLA 1LAVA 1YTAA 3C1ZA 4F93B 4ECZA 4DS4A 3ZSYA 4HTUA 1SKRA 2ZQBA 1T8EA 2OPRA 2Q0ZX 4B9UA 3ZDBA 4ZTJA 4M3RA 3RBEA 4CGDA 1ZQFA 2JZBA 3KD1E 4DFMA 4KLGA 8ICAA 1R0AA 3OSNA 3VA0A 4X5VA 4YFUA 2BANA 3U6FA 3K2PA 3RMCA 3MEGA 3OYLA 4B9SA 1VSMA 3AO1A 1HMVA 4CFBA 3U3GA 1KVBA 3V6HA 3L2VA 4XUSA 2EX3A 1ZQXA 5J2PA 1ZQCA 3AUOA 4FJLA 4ID1A 4F5OA 1ZJNA 3V72A 1BI4A 3ZDAA 3QEPA 3ITHA 4CF9A 3KLGA 4IQUA 1Z25A 5JS2A 4KRFA 3RJHA 4G1QA 3MECA 3Q8LA 4B08A 1QE1A 2BCSA 2ITGA 2WTFA 3BGRA 2IS3A 1BI4B 4ECYA 4KLQA 4M47A 5J1EA 2QXFA 1KCFA 4IQTA 4M9JA 3VQPA 2ATLA 3ZT3A 4O5CA 5KFQA 3N4MB 3H8SA 4Y1DA 1SUQA 1BCOA 2PZSA 4DFKA 5KT2A 3C2MA 1U45A 4DSFA 5HMLA 1TV9A 3ISNC 4YMOA 3A2FA 4KLUA 3OS2A 4KPYA 1EXNA 5KFCA 1ASUA 4QOZB 4IQWA 3OYMA 1X9SA 4E7HA 4DG1A 5KG0A 5C42A 3RJIA 3JYTA 5J2GA 4O55A 4ECVA 2EHGA 2FBXA 3Q8MA 2BPGA 4UAZA 3VQQA 4QWDA 4CJWA 2W9CA 3SI6A 4J9RA 3Q8RB 2W9MA 4QZBA 3RMBA 1U04A 2BHNA 8ICLA 3OYGA 4TURA 3HX0A 4KHYA 1JX4A 5TZVA 5C24A 4EBEA 5JS1A 3L3VA 4KN7A 2FBYA 2W9CB 2FLPA 4IG0A 2J6SA 4J9OA 1WN7A 4JS4A 2YNFA 1EXQA 2P51A 1ZBFA 4KLMA 3GIMA 4M3YA 3K58A 3LK9A 5KFSA 2KTQA 4HYKA 5KFLA 1RCHA 4ED1A 4KV8A 1NK9A 4Q5VA 2ETJA 3V9UA 4M3XA 3CFRA 3RH4A 4OLAA 4EEYA 2IHMA 5J29A 2X6SA 2ZD1A 3QERA 4IQVA 4CJUA 2NRWA 1J5OA 3PR5B 2JEJA 5F9LA 4BWJA 4FJ7A 5J0PA 4RQ8A 3K5MA 4AHRA 2ZTEA 1KSPA 1F21A 4N76A 1KVAA 1TK5A 3LWLA 3NH2A 2OPPA 9ICTA 4F5QA 4B9MA 4CEOA 1B9DA 4I2FA 5SZTA 4ICLA 2X6NA 3LZJA 1QSYA 1A5VA 3TAMA 1BPXA 4NLKA 3V9XA 4KB1A 2NRTA 3EW9A 1RNHA 4ED6A 4EZ6A 4I29A 7ICRA 3VQ9A 3LZIA 3ASMA 3RAQA 4O0JA 3G6YA 4IFVA 1A77A 5J0YA 5KT7A 3THVA 5J0WA 3VQEA 2KZ3A 2HHQA 1IM4A 4FJKA 7ICQA 3SPYA 1TKZA 1S0VA 1L3SA 4QZFA 4I2CA 4B8AB 4Z0UA 3ETLA 4FZXC 1O1WA 3KKRA 5DG7A 1BHLA 4YCXA 1NK6A 1XO1A 4I28A 1HYZA 1ASVA 4NCAA 4M9HA 2OWOA 3HW8A 2O4IA 3IRXA 4J2AA 3ZDCA 4FM1A 4CEAA 1WCNA 3OYBA 4KTZA 3T3FA 4CJEA 4AHSA 4J9QA 5HMMA 1C0MA 4UAYA 8ICFA 1D8LA 3M8PA 3WNEA 1HNVA 1SV5A 4RQ3A 5KFZA 3UXOA 4DL5A 3RRGA 4EP5A 4O3NA 4ZTFA 1AROP 4YMMA 3MGIA 1ZJMA 2VA2A 4O5EA 4FK4A 3AVBA 4JK1A 4RQ0A 2JEGA 2ZE2A 5KFRA 2A1JA 3TAEA 3ZT0A 2F1HA 4I2AA 2P5GA 4J9PA 3QIPA 3ZSZA 3NDKA 5J2MA 4Z4HA 1XSNA 3EPGA 3LPUA 4AHTA 4QZHA 3NTUA 3TANA 2HNYA 4RT3A 1S9FA 4J2EA 3QIOA 4I9QA 1S76D 1ZQOA 2YKMA 5J0RA 3LAKA 8ICPA 3LDAA 4CF1A 2XGQA 3AVIA 3OSPA 1N56A 4Z6CA 3MDAA 5J2BA 3O3FA 4CJFA 1S9EA 9ICOA 4FLWA 3HYFA 4Z4GA 2GV9A 4J9NA 1NKBA 1CZBA 3SV4A 3MR3A 2HVIA 8ICIA 3AVCA 2G8FA 4AHVA 3ZT4A 4M41A 5SWMA 1S9GA 4CE9A 2DFLA 3JPOA 4DTUA 2ISPA 4W5QA 1ZQGA 3T1AA 4DO9A 4F3TA 2WONA 5DQIA 3LP3A 5HROA 4YD1A 1NOZA 1MU2A 4DSJA 1WAFA 3G6VA 4HUGA 3TWHA 5KFNA 4Z4FA 4DTOA 2OZMA 1IO2A 2PFQA 3VQCA 1KTQA 4H4OA 3ZSWA 4HCBA 4YNQA 3WNFA 2NRZA 3EPIA 2FLNA 3RTVA 4FLZA 3NF8A 3OYFA 4FJIA 2HHWA 1WSJA 4CJQA 3OJSA 4ELVA 4HUEA 4CEDA 5I3UA 4BDZA 2AQ4A 1UT8A 2UVVA 3JPRA 4YXJA 4KLEA 2IBKA 2I1QA 3TAQA 1T3NA 8ICYA 1IKXA 1JLAA 3KLFA 4K4GA 4PUOA 3AA3A 2RN2A 1S97A 4CECA 1ZQBA 4CJKA 1B22A 1TL3A 3PNCA 9ICSA 1WSEA 4FW2A 4J2BA 3RR8A 1QSLA 5L9XA 5KT5A 2FMSA 3B0XA 3K75D 1U4BA 4OKEA 3SJJA 5DB9A 2B5JA 4O5KA 4FO6A 4CCHA 4C8MA 5HRSA 5DQHA 4CGHA 4JV2A 5EWFA 4I2DA 2HHVA 1TVAA 1RYRA 2BGGA 3NGYA 4CIGA 8ICNA 5KFBA 2BE2A 1L3UA 4KLSA 2OZSA 3QZ8A 1VSJA 1RTDA 4KI4A 1NKCA 2HVHA 2DFFA 1A5XA 3RBDA 3DI6A 1UOCA 4LSNA 4M0AA 3RR7A 4ECTA 3EY1A 1WSFA 4M45A 5DB7A 4QZAA 3OS0A 9ICXA 3VQ8A 4CJVA 2HNDA 2I5JA 3QZ7A 9ICFA 1LWCA 4J2DA 1XSPA 4OPJA 2KZMA 1J9AA 3RJGA 4BXOA 2P5OA 5DG9A 1VSEA 3DLKA 2P1JA 2JEFA 4DU1A 2ZJ8A 4KKOA 4UQGA 4KO0A 1NJYA 4YMNA 5DQGA 1HQUA 2V9WA 4PHEA 3V6KA 3C5FA 4BXOB 4F4XA 4MFBA 1CXQA 4R65A 1Z3EB 4M3UA 2F8TA 1RBRA 4O3PA 4GLXA 3K57A 2XY5A 1FK9A 4XA5A 1B43A 3PW4A 4PY5A 3CM5A 8ICCA 4PQUA 4RQ2A 4HCCA 4M2YA 4CGGA 3T5JA 5FRNA 2QK9A 4PHPA 2BCQA 3PVXA 2JEIA 3LWMA 4O3RA 1CXUA 3V7JA 4QAGA 3PW2A 2B4JA 1Z26A 3M9NB 2W42A 3PX4A 3E2EA 5E41A 2V4QA 4DTXA 3H8JA 4BWMA 5DBCA 8ICHA 3RB6A 2HNZA 1ZQJA 3L2UA 1ZQTA 4CF2A 2HHTA 4TUPA 4NCGA 4JWNA 3GV5B 1TV6A 5DG8A 1X9MA 3G6XA 1C1BA 5KFGA 4KAZA 3O4QA 3UXPA 1ZBUA 5CJ7A 4M9NA 3OHAA 3NBPA 3V9ZA 1NK4A 4EZ9A 1QQCA 3V6DA 5HHIA 4PH5A 1TL1A 2BCVA 1RDAA 3UXNA 1U47A 4QZIA 5HRRA 2XCAA 1RBSA 1JLQA 4O44A 4GC7A 4RW7A 4RG8A 8ICTA 1BISA 2ATQA 5J0OA 3ZSXA 3GILA 3BQ0A 4ECWA 1VSHA 5FROA 5DK5A 4HHTA 3V1QA 1B92A 4KFBA 4F8RA 4KN4A 1FKPA 3SI8A 4I27A 5HLFA 4B3OA 3JPNA 3QESA 3C2KA 3CFPA 4JS5A 3ZSOA 4O3SA 4RT2A 1RDDA 8ICRA 1BQMA 1VSKA 7ICPA 4ECQA 4CJLA 1SL0A 4MQ3A 4EP4A 2G8WA 4GW6A 3TABA 1HJRA 4IG3A 4RPYA 5CYQA 1D8YA 2F1IA 3SZ2A 4I2BA 4HVJA 4TUSA 3SV3A 3QEVA 9ICPA 3LP1A 2PI4A 3G0ZA 3RJEA 5KFAA 1BCMA 1ZBHA 1W9HA 9ICVA 1X9WA 3C5GA 2I9GA 2GUIA 4P4OA 3JSMA 3ZSVA 4F92B 5J2DA 5KFHA 2G8UA 4BE2A 2ISOA 4Q45A 3RH5A 3K5NA 4CFCA 3AVHA 3V9SA 4R8UB 1TVRA 2NRXA 4ECSA 5BOMA 4R66A 1PZNA 1DTQA 4FLTA 1I39A 3OYJA 1SKSA 2BPFA 4ED0A 2G8HA 1IKVA 4ED8A 2F1JA 3ZSQA 9ICJA 4QW9A 3MBYA 4PPXA 1EX4A 5KG2A 3S3OA 4NLGA 2J6TA 4BGDA 1S0MA 2VWKA 4O3OA 4C8NA 4DTMA 9ICNA 4KLFA 4DQSA 2Y1JA 3AVAA 4RPZA 4YR0A 4CJ4A 7ICSA 1U49A 2X78A 4CHQA 1C1CA 4OLBA 4LVSA 1HUOA 5D49A 1S0OA 3AVFA 4CERA 3OGUA 4Q8FA 3KLEA 5FRMA 2DFEA 3NGZA 4NXZA 4RZRA 7ICNA 4DSLA 4FJMA 3BQTA 3AA4A 3GV7B 4KMUA 2ZUDA 2D0AA 4C8KA 3AVJA 3HPGA 5L1LA 5HRPA 3DYAA 4Z4EA 4FS1A 4CK2A 1QLNA 1S1VA 3M8RA 1KLMA 2OPSA 3TQ1A 5KRTA 2LSNA 2DTUA 1WSIA 3DLHA 3CYMA 3E01A 4EYIB 1JXEA 2R8KA 3M9MB 3QETA 3EWAA 4FJJA 3DRSA 3QLHA 4F3OA 1VRUA 4ID5A 4O0IA 4DOCA 1JN3A 3HL8A 4RW6A 4RNOA 2YNHA 1BPBA 2C22A 4LD0A 5DB6A 1ZQVA 4Q0BA 2MAXA 5KRSA 3MFIA 1BIZA 2KFNA 4AHUA 3AO2A 3H7IA 1JLCA 3RJKA 1HQEA 3HM9A 1XU4A 8ICEA 4CK1A 4NYFA 4OPKA 9ICIA 4P2HA 1TGOA 2HHUA 4DTNA 4RPXA 4F4ZA 3AVNA 4DOAA 1XC9A 2IGIA 1VSDA 3NAEA 4CF8A 4RQ4A 3LAMA 2ZTDA 1COOA 7ICHA 3IS9A 4Q43A 3P1GA 1LWEA 4PGYA 5J2QA 9ICUA 5KI6A 1UWBA 5KFPA 2J6UA 3C6TA 7ICVA 4CJ5A 4FJNA 1JXBA 3H08A 3RMDA 3NH0A 4B8CA 4LZDA 2HMIA 1RBVA 8ICUA 4KLOA 1RDBA 5EWGA 1FXXA 2W9AA 3P83D 4DU3A 1DGSA 2PFPA 4RUAA 5CZ2A 5KFYA 4I2IA 2QKBA 1LAWA 4DMNA 3TI0A 3B6OA 4E89A 4RQ7A 4CJSA 4GC6A 3G10A 4HUFA 4DFPA 2GBZA 1LWFA 2VG6A 4FM0A 2X74A 3ORYA 1JMSA 2FPLA 1N5YA 4PWDA 2W9BB 1WSHA 2AGOA 5KGWA 2DPJA 3H4BA 4FLUA 4DL7A 2PFOA 3HT3A 2Z1IA 5EOZA 4CHNA 4KHQA 4JV1A 3MGHA 9ICWA 4CEBA 4KI6A 3TFRA 3H8WA 3D0PA 1CZ9A 4NCBA 4CJPA 1L3TA 1RT5A 4J9LA 3V6JA 1NK5A 1ZQWA 2P6UA 5F9NA 5K14A 4QCLA 1NOMA 1ZQQA 1CUKA 1Y88A 4J9KA 2Z1GA 3O3HA 3SNNA 3SPZA 1WAJA 4ZH4A 3AO3A 2HW3A 1BVSA 4Z6EA 4MFAA 4B9VA 4YP3A 3NHGA 4FJHA 1REVA 4C8OA 5KFDA 9ICMA 1TFRA 4CF0A 1XI1A 5J0TA 5KT4A 2ASLA 2YHAA 1X1PA 2XC9A 2DPIA 1ZQKA 3LP2A 2LYHA 3PO5A 2FC0A 2P6RA 9ICKA 4KLHA 2VWJA 4PA1A 4OGCA 3SQ0A 1S1UA 5DBAA 5KG3A 1KLNA 9ICHA 4CGFA 2XY8A 4B9LA 2YV0X 2DY4A 1BGXT 3AU6A 3OY9A 5KTQA 2FPKA 3JPTA 4ED7A 5T7BA 4F5NA 3VQ6A 3C1YA 3AO4A 5J2NA 3F73A 5J2AA 2PYLA 4DTRA 8ICJA 3OYNA 3Q8PB 4O4GA 4JLHA 4XRHA 3ZD8A 3SUNA 4KHSA 3HK2A 1B9FA 4OKJA 4E3SA 4KREA 4R64A 4YXMA 1KFSA 1QHTA 5HNKA 3ZSRA 1DOQA 4E19A 1UA1A 1IH7A 4R5PA 3IHQB 4BACA 3QNNA 4XQ8A 4E7IA 4TQRA 9ICQA 1Q9XA 4W5TA 3DM2A 5KG5A 3KK3A 3DRRA 4LZGA 3VQAA 4KTQA 3TR8A 5DBBA 4Q44A 1S1XA 4F50A 5J2IA 1XSLA 2XY7A 1JL2A 4XIUA 5EWEA 3P5JA 1ZQNA 3FFIA 4W5OA 1ZQDA 1XWLA 2BR0A 3I0RA 1BPZA 3CQ8A 2WOMA 5DLGA 2GWSA 3UQ0A 5CR0A 1HRHA 3LDSA 1CEZA 4FBUA 9ICBA 1LB2B 4UBCA 4O3QA 4DU4A 1WLJA 2E6LA 4H8KA 3TAPA 3PMLA 4PGQA 4QZ9A 1WCLA 2VA3A 2E6MA 3VA3A 4QZEA 3EZ5A 4IBNA 3PR4A 1C1AA 4EYHB 4LY7A 4RQ1A 4FJ9A 1WSGA 2A1SA 3S3MA 3RWUA 3TAGA 3TFSA 4N47A 3ISCA 3VQ7A 5IIKA 4KLDA 4Z6FA 1UAXA 2RF2A 5KFJA 1T7PA 4NM1A 3T5LA 4QWCA 3NH1A 4MEYA 5J2FA 4ECRA 2KW4A 2FPMA 4AH9A 3C23A 2NUBA 9ICAA 8ICGA 4FJ5A 4FJ8A 2YNIA 4E7KA 2VA8A 3GIIA 3QEWA 2Q3SA 2YHBA 4M3WA 5EU7A 4O9MA 3DOKA 1TKTA 5CY4A 5KFVA 4JWMA 4FBTA 4IRDA 3U3YA 2BPCA 3DLEA 4UB3A 2ZJAA 5J2EA 3CG7A 2XY6A 2HHXA 4DQRA 1T4GA 5L1IA 1W0HA 1A5WA 1KFTA 4NY8A 4E7LA 5KFFA 2AU0A 1RT7A 2BCRA 3NFAA 5DDYA 3AA5X 4CEEA 1LW2A 3K5OA 1VK0A 3OYCA 4YD2A 3QEIA 3BDPA 1C6VA 3Q8KA 4FS2A 4DSKA 3ZT2A 3O4NA 2BQUA 2OA8A 2MUTA 2AQ0A 1NK7A 4F91B 2DFHA 3OHBA 1YTUA 1TKXA 4F2RA 4GXIA 5IIOA 4FLYA 4CHZA 8ICVA 2XCPA 5J0SA 4FK2A 2O4GA 2MUTB 4DEZA 4M42A 3HP9A 4RW4A 4DSIA 3HVRA 4E1MA 4C8LA 8ICXA 3MXIA 1RT2A 3S9HA 3KHLA 1C7YA 3KIOA 2OYQA 2FMQA 3NF6A 5KT3A 1RZTA 3NGIA 5J2CA 3LANA 3PW7A 4PHAA 4LSLA 1S10A 3HWTA 2BQRA 1RT4A 1NOYA 2IA6A 3S3NA 4EBCA 3UPQA 4RQ6A 5DMRA 4I2HA 4B9NA 4Y1CA 4QZCA 4FLVA 4K8XA 1K1QA 1L5UA 1S1WA 3LPTA 2A1RA 4IRKA 4L8RB 4IR1A 4FYDA 4ED2A 2BQ3A 2G8VA 8ICOA 3DLBA 3V4IA 2ASDA 7ICJA 3DMJA 2D0CA 4IRCA 1ZQMA 1VSLA 2D0BA 4CFAA 7ICGA 5DGBA 1IKWA 2ZJ5A 1RYSA 3DOLA 1RBUA 3RB3A 4CJTA 3ZDDA 4N41A 5CP2A 3GV8B 4MFCA 5J2HA 3HSTB 2FBTA 2AGPA 1IXRA 5HP1A 1Q9YA 4OJRA 4M3ZA 3WNHA 3KTQA 5J2KA 1GOCA 2VANA 1ZQHA 1T03A 3SUOA 4Z4IA 4DQQA 3M8QA 4KLLA 3HVTA 4NM2A 4BE1A 3GDXA 3V1OA 1RXWA 4BE0A 5CB1A 4CHOA 4R8UA 4UB5A 4I2QA 4CEQA 5D3GA 3MABA 4M3TA 2JZBB 4CGJA 3TAFA 5L1JA 4F4KA 4GVMA 3V1RA 4DF4A 4DOBA 1UT5A 3AA2A 2B21A 1KRPA 4P4MA 1BL3A 4DQPA 3OYKA 4OKKA 4F2SA 1JIHA 3IM1A 3AVMA 2FBVA 3RAXA 4QWBA 3B0YA 4ZHRA 3K5LA 5DLFA 5KFKA 2R8JA 3RB4A 9ICRA 4CESA 5DGAA 1J53A 1TAQA 8ICBA 3MEEA 3ALYA 1NK0A 3PV8A 3SUQA 5D46A 4YQWA 4KB0A 2BGWA 1S6QA 1C0UA 4R63A 3AVKA 4MEXA 3OYEA 4JRQA 8ICKA 1IKYA 4TUQA 1HUZA 7ICEA 4RW8A 4ECXA 4DLEA 4KLIA 4M04A 2IC3A 1XHXA 3OS1A 3NE6A 4I2EA 1U48A 2H5XA 4YR2A 7ICMA 2OPQA 3QEAZ 5HBMA 4GXJA 1SL2A 1RTIA 3OYIA 2Z1HA 4J9MA 4ELTA 1JLGA 3QINA 5HP4A 4F5PA 4JUZA 4KITB 1XHZA 1K1SA 4K4IA 4FCYA 4BDYA 3BQ1A 4UB4A 3T5KA 4ECUA 4QZGA 1HYVA 3GQCA 4BDPA 3B6PA 1ZQUA 3MR6A 3H4DA 1Y97A 2YKNA 2B6AA 1KFDA 4FZZA 3ULDA 2RDJA 4DSEA 7ICKA 1JLBA 1C0TA 3GIJA 3Q8SB 5IIJA 3KLHA 4KLTA 3VQ5A 9ICGA 2XHBA 4IFYA 2D5RA 5FDLA 4I2PA 3KJVA 1VRTA 1VSIA 3NF7A 1FKOA 3V9WA 1SL1A 1RILA 3IAYA 3SQ2A 3JPQA 1ZBIA 2RKIA 3RRHA 3M9OB 1Q8IA 1RDCA 5HHHA 3T5HA 2IAJA 5DKWA
chains in the Genus database with same CATH superfamily
4FJGA 3QEBZ 4NXNJ 1FKOB 2HQIA 4ZVPB 1QTMA 4ZCKA 5IIMA 2C28A 2MQLA 4B1ZA 4M95A 3TACB 4KIAA 3JPSA 1IR1A 2BZ2A 2I1RA 2QSFA 4CIFA 4KT0C 4DKWA 3V81B 3SCXA 3I31A 3LA0A 2A3ZA 2HHSA 3CCES 2P9NA 3OR1A 3KK1B 3DXKB 2RS2A 2DKOB 1TFWA 1N52B 5AQQA 3R3TA 2VJ5A 1H7WA 4IEEA 5EE1A 4DS5A 4O5BA 1CQNA 1TL4A 1YVUA 4DR7K 1F5CA 5LM7E 3QT8A 5DS7A 3DDIA 4QOTA 4ZP8A 4Z94A 1RT6A 4BRDA 5CZ1A 3TYTA 3KK2B 2ZKTA 5KPTA 2O8BB 3FBCA 5D4PA 3RW7A 2FC8A 4C0BA 3D4JA 7ICIA 3N5BA 3UDLA 3O3GA 2LYVA 2N1RA 4WFNQ 1RT3A 3CO9A 5AQSA 5GAGI 3FLCO 2LP4A 3KZIU 1DT9A 7ICUA 1UEVA 2RU9A 3PFEA 1WTFA 3QO9B 3T6BA 4F71A 1PJ6A 3O9UA 4ZOHC 4FPBA 1XQIA 1VQ7S 1H98A 2A42A 1RHUB 2AA4A 1SZPA 2EK1A 5GAHI 2RRNA 3ZEUA 2HIYA 2YI1A 2D3OR 2ZE2B 3RBZA 2BA9A 1N6QB 1SJQA 1DURA 1RAAB 4L6V3 3KLIB 4KHWA 1OQ3A 1YT3A 2C2DA 5KFXA 2Y1IA 2WVEA 4F5RA 3OL9A 2P9PA 1RT1A 4P0PB 1F0XA 4F4YA 5I9EB 1NPRA 4NASA 1ZQAA 1OPZA 2HQCA 3OYDA 4KQZA 2ZOGA 1ZYQA 3NF9A 3O6WA 3D5MA 1SJ3P 1GLLO 5KG1A 1FEEA 3NEKA 3E0FA 2LM4A 2RQCA 5AKXA 2GWJA 1TK8A 3GFZA 1TKDA 2WRMA 3CJKB 2C3OA 5KFWA 1M1KO 2C2RA 3TVZA 3MEKA 4KH4A 1RXVA 4DQIA 3VF6A 1EWQA 2B4UA 2XB2D 1NRKA 3IMQJ 4Q8EA 2QLJB 2OSQA 3ILOA 4KYZA 4CO2A 4I9LA 3HSZA 1FFSB 4CZLA 3T19A 2ZZTA 2ZBIA 1JJHA 4FK0A 4DUYF 3D6HB 4DX7A 1U24A 4R79A 4DTJA 4BROA 3W5YA 1HIWA 3UVJA 2DITA 4QIWC 2W8LA 1Z00B 4RJVA 4NE9C 4OZ3A 5F2RA 3IAM9 2E5LJ 4IOCQ 4Z4CA 1TAUA 4MDAA 3SQ4A 3EMTA 1Q5VA 1H3DA 1HQ2A 1MSWD 3DDHA 3LP0A 4AM6A 1L7MA 2BACA 3JB9k 3QXGA 1UCVA 4RW9B 5CHGA 1M5SA 1GOAA 4MK9A 1GMVA 4FW1A 3WXLA 3QUTA 5D4BA 3FGUA 4EU0A 4Y2RA 3ZXWA 1Y10A 2JLEA 4FKYA 2QWNA 7ICLA 3HXMA 1O6XA 1T3QA 3OVNA 1IJFB 1VGYA 3TVYA 2YX4A 2K8BB 3SCLE 1JXVA 1SB6A 1FRLA 4QWEA 2PY5A 2ZM6J 1NJXA 4I6MB 5I42A 1N8RO 1RTHA 2NSBA 2H3FA 2GAHC 5C10A 3C6UB 3J7ZO 3OL8A 1MWZA 2VBXA 3SUPA 2K4IA 1NNLA 2E1FA 2GHVC 1U9LA 3PKYA 2DHHA 4Y2JA 2WBNA 3CJTA 3FC9A 5B8HA 4K4TA 1TUVA 1G15A 3TQEA 2XMWA 1NBWA 4K0KJ 4NX9A 1JLEA 2N82B 2ABYA 4MK7A 4LF1A 3L3UA 1Z2LA 4CZKA 4CLZA 1NHUA 4UF4A 4JKGA 2B6GA 3OBIA 2CGLA 1RQNA 2KLAA 3D45A 4RU9A 2FMPA 3CCZA 2AJQA 4HHJA 4JHDB 1LWCB 2OANA 2RDIA 3SR6A 4DTSA 2GS8A 3AH6A 3EEQA 1A76A 3CIZA 4PPDA 4AXJA 2RDDA 2J9EA 3IA0A 3O6QA 2FVSA 1YI2N 3ISDA 2EFNA 1S6UA 2O8CB 1ZTWA 2WK4A 3HZEA 5E3AA 3JS6A 2R7YA 2RHKA 2IMWP 2ZBQA 2ZDPA 4DFJA 3CM6A 2NRVA 2IBOA 5B0AA 4B17A 4FNIA 3PEHA 4UB2A 4B9QA 5L1KA 1UL3A 4PRFA 4KH5A 5ETSA 3THXB 4U7UD 4IOCL 5IIIA 4G65A 2HB5A 5LT5A 1BPDA 4DUYK 3BS5A 4I2GA 1Y7PA 2B9XA 1L6NA 4DR4J 2L48A 1E3MA 4IO9Q 4YOUA 2KKPA 3M8WA 1Z19A 2C2OB 2AEFA 3VEZA 4C0OC 2MA1A 5FLXO 4E2FB 4I67A 2QV6A 2B9EA 4C0ZA 2KD1A 2ZTCA 4QYZK 2FXUA 1UA0A 1ZQYA 5IINA 5ADZA 3UCUP 2VG5A 4FLXA 3MMAB 1OS5A 3UQSA 2DEJA 3P38A 3I8DA 1Q81T 2GFFA 1DTTA 4ZOSA 3FJ2A 2UXBF 3WXIA 3CQYA 2KFZA 2K3IA 3T69A 1Z05A 4M5DB 4YR3A 4W5RA 4E1NA 2BYCA 3BEGB 1I1GA 5CYMA 4BLGA 1LAVA 2GTDA 4K5RA 1HKGA 3M1YA 4F93B 3AD8C 4F7VA 5ALFA 1DLOB 3KG0A 2JRZA 3S6EA 2ZQBA 1YJ9N 4BC4A 2OYYA 3TEHB 3ZDBA 3RUBL 3BN4A 4CGDA 1DHMA 3W5ZA 2HF4A 3KD1E 1RAGB 2IM0A 2J7KA 3J80Y 1LKYA 4AF1A 4Y2KA 1XO0A 1IVZA 8ICAA 3JAMO 4DV4J 4B1WB 1FKPB 3CJBA 1VC5A 4X5VA 4YFUA 4DCCA 1S6OA 3NASA 1HMVA 2HMXA 3ZTRA 3MD1A 1UQVA 3I56N 3BH7B 2XNRA 2DHSA 1PSDA 4DHVA 3CTRA 1S57A 3DC2A 2W4PA 1OY9A 4ID1A 3QGGA 5CYQB 3V72A 1BI4A 2B0CA 2LQBA 3ITHA 3KLGA 4CF9A 4PZOA 3QEPA 2K1RA 1Z25A 3AODA 3RJHA 4G1QA 3G4SS 2CNNB 5A8KA 4B08A 5J2PB 2BCSA 3D1QA 5C12A 1MN8A 2IYGA 2J9CA 3Q83A 5HQLA 3BGRA 2IS3A 1FJCA 3W7BA 4ZJQA 4M47A 5D77A 4LF6F 1KCFA 2DGXA 2FJBB 4NZ0A 4O5CA 3DHXA 1QE1B 4NEYA 3U8XA 8ATCB 2E20A 3VAKA 3EJMA 3IBPA 1F2HA 5CZXA 2OP5A 3HHLD 2PKEA 4B3SJ 1B3TA 3OT9A 3BKUA 2KDOA 5HMLA 1TV9A 3A2FA 3OS2A 1NNEA 1EXNA 5KFCA 4L75A 2MQNA 4IO9L 3OYMA 5AQNA 1A9NB 4FWLA 1SBRA 2CPZA 1RWKB 4LIWA 4UT4A 3JYTA 3Q0AA 1WWHA 3QBCA 4O55A 4ECVA 2V8VA 1IKVB 4UAZA 4CJWA 2KSOB 4J9RA 3Q8RB 1RKIA 1W26A 2XMJA 1U04A 1FTCA 1VQLN 4TURA 2W3RA 1EQMA 5TZVA 2A19A 3WXKA 2ZEJA 4PYDA 4KN7A 2W9CB 2LPEA 4IG0A 2J6SA 2DY9A 4JS4A 2YNFA 4YUDA 1ZBFA 3BZKA 4L3KA 1S7HA 5C15A 5C24B 3LK9A 5H9EK 4ZITA 3WK8A 3EXYA 3Q8YA 4DPTA 3T9ZA 2AMCB 3FZFA 2ETJA 3V9UA 3RH4A 5J29A 4J5OA 3DYAB 2UXBK 1J97A 2NRWA 2JEJA 5AM3A 5F9LA 4UARA 3KUEA 4ES3A 5AM4A 3UO0A 5F0WA 2AV5A 3R97A 4WIQA 4XAKA 2R2UA 4BBYA 4PKDB 3AA8A 2VONA 1Q3UA 3K1ZA 3M1VA 1NPKA 4FP9A 1XTZA 5HVHA 2DNMA 1HBNB 1HHQA 2HFVA 5LMUJ 2AKWB 1IQTA 3MTKA 1PVRA 1MDUB 3FZKA 1U2CA 4QR0A 2VPWB 4CLFA 3O5BA 5HL7Q 1KBRA 2CPRA 2X6NA 5AKJA 2YNHB 3TAMA 1FNMA 1BPXA 3J81O 1URJA 3V9XA 4Q0BB 4UY8T 2EZZA 2HSTA 1MWQA 3ZETA 1HQEB 3CVKA 3FSYA 3LZIA 3ASMA 4LF9J 3DEEA 3WK7A 2GGPA 1JMTA 1BO5O 1S72N 5J0WA 3OVAA 5K8NA 2CZ9A 2ZBRA 3WQPA 3MCMA 3VOVA 3VF0B 1TKZA 3D1HA 4OLPA 4B8AB 2D6FC 2WMMA 3O8MA 4IFVB 2W2NP 2V8HA 1NZBA 1VQSA 1MWYA 3AD9C 2G08A 2QB0B 1OH8A 4LF6K 4QYRA 2MHNA 4M9HA 2G2ZA 3SFGA 3JSBA 1O51A 3HW8A 4FN5A 2O4IA 4J2AA 4PWWA 5AJ3F 4CEAA 1A7GE 2HZCA 3OYBA 3PSIA 4OYZA 3T3FA 4CJEA 4AHSA 5JVHL 2GVDA 1CVJA 1PK1A 1RDUA 2R7WA 2FGCA 3MR7A 4ZK7M 4UAYA 4WBFA 4JOUA 2ZIWB 3NAIA 1AROP 5IT9Y 3EGVA 4PWDB 2GX9A 2JEGA 3MM5B 3NVYA 3MZIA 1SC3B 2A1JA 4TU9A 1SV5B 3MCOA 4Z4HA 5ALDA 1Q18A 4JKAA 4AHTA 4QZHA 1TR0A 3TANA 4J2EA 4RT3A 2PSZA 2BM1A 5DZ6A 3H2VE 2YX8A 2LKYA 4KBOA 2MQPA 3AFGA 3LDAA 3AVIA 5K14B 3W9JA 1HARA 4OPHA 2VH7A 3O3FA 3VHQA 1S9EA 2QGFB 4FLWA 1Q78A 3A0IX 4P2SA 2GV9A 3MMCA 1WF1A 1ED1A 1Q7YO 3MR3A 2HVIA 3J7Z5 2K4HA 8ICIA 1P9YA 3AVCA 2G8FA 5IQ6A 2GJIA 3CGIA 1SJRA 3BF3A 1VQ6N 4WFXA 2E1MC 3HSCA 1TU0B 3JPOA 2HK3A 2ISPA 2P9IA 4W5QA 4F02A 1Z2ZA 4DO9A 1WEZA 3ZX3A 1HWIA 1RI7A 2V8PA 3UR0A 3ZI4A 2KHCA 4N77A 1MU2A 1NOZA 4DSJA 1WAFA 3G6VA 3TWHA 5AI9A 2OZMA 3GONA 4DPXA 1BWFO 2UUBJ 4QPXA 3GOIA 1KTQA 3BGLA 4DPWA 4Y2VA 3VETA 3C14B 2F7VA 4PXDA 4YNQA 4JI1J 3ICXA 3RTVA 2IRYA 4DOZA 2DVIA 4DN9A 5HOOA 4FJIA 3VESA 2HHWA 3GMGA 2CIMA 1PAUB 3OJSA 4ELVA 4HUEA 2ROPA 1BD6A 5I3UA 5CEHA 1IN0A 1CC7A 1RAEB 2OEKA 5HN0A 2W11A 4H0OA 2UVVA 3JPRA 4LRFA 4NLXA 3HHLB 1YDLA 3D6FB 3G82A 4OX9F 3VCBA 2XMUA 2WTUA 2NYHA 4IYQA 1FFVA 3D2QA 2Y3YA 4CECA 2AP6A 4AT1B 5AJ3K 3MPVA 3PNCA 3N0VA 9ICSA 1L7OA 4CI6A 1QSLA 4WQ5C 5L9XA 2GLEA 2FMSA 3QJJA 4OKEA 2D74B 5DB9A 3H5SA 5A76A 4FO6A 2BTFA 4DR3J 2QW9A 2E8PA 3FSIA 5ITHA 4JV2A 5EWFA 4PZNA 1NHKL 2DHXA 3NGYA 1XNRJ 4CIGA 3G71N 2CXYA 4LBPA 2OZSA 3QZ8A 2UUCF 2EK6A 1A5XA 3CCMN 1UOCA 3H0PA 4LSNA 4E1JA 1VQPN 3EY1A 4M45A 1R31A 5DB7A 3OS0A 4JV5J 3VEOA 2I5JA 3IR7B 3QZ7A 2WW4A 1XSPA 4DV4F 2KZMA 1J9AA 4BXOA 5AKKA 2F40A 1ZAXA 2DNOA 3H1QA 2JEFA 4PG7A 4UQGA 4KO0A 4P0QB 3HHLC 4L72B 4B3RJ 1HWLA 1HQUA 2ZJPQ 3F44A 3C5FA 1FRHA 4F4XA 3Q24A 2R18A 1CXQA 4R65A 3G2XA 2EI5A 3DOKB 1TKTB 1RBRA 3N7PD 2Q66A 2LBOA 3CCEN 2DISA 3PW4A 3AQPA 3ATUA 3CJQA 3FGVA 1N5SA 3AY9A 3T41A 2CQGA 5H9FJ 1FRMA 1R27B 4PHPA 3NGTA 2JEIA 1D09B 4X4UA 4GVLA 1XMOJ 3D2EA 1Z26A 5AQOA 4DTXA 5AZIA 3GFHA 2QM1A 4CZHA 1ZQTA 1U2VB 2E9RX 3ZZOA 4JWNA 3GV5B 3C7NA 5DG8A 1XMBA 4PJ0U 3JSYA 1NB2A 1WEXA 5KFGA 4KAZA 3UXPA 1ZBUA 1CRXA 4Y2MA 3I1YA 4JKCA 3V9ZA 3THYA 4KHMA 2FJAB 3KG1A 4RW4B 2BCVA 4WYWA 2X1AA 1E6VA 1OWXA 3W8PA 4QZIA 1TYQB 3LO3A 3WZ0A 4OX9K 1Q95G 3U9ZA 1WOSA 2ATQA 1NLVA 3RSEB 2J9DA 3GILA 5HVFA 4ECWA 1VSHA 2QARA 2P8IA 4Q2MA 2ZHBA 1MWMA 4MLHA 1DQAA 4XEIA 4MAKA 2KJVA 4KN4A 2WB4A 3J7YP 3CFPA 4EGLA 4MHVA 1NJIO 1NGJA 4JS5A 1UP1A 4RT2A 1RU1A 7ICPA 1SL0A 1PVQA 4CYUB 4GW6A 4CDGA 3TABA 5HLFB 5DRKA 1HJRA 3IDHA 3F0NA 2UUCK 3IN5A 1NCLA 2G5IB 1D8YA 4U95A 3PACA 4JK7A 4M5GA 1T0TV 4KHPF 4TUSA 3UI3A 4TY8B 2DTJA 4IG3B 2JH1A 4BC7A 4DV4K 4FWRA 1H6KX 2F5GA 2VQFJ 5U47A 1B0XA 1BCMA 1ZBHA 1OSDA 1X9WA 4ZMMA 2QFIA 3NCQA 3Q23A 1Z1VA 1WG8A 5J2DA 5KFHA 1VI7A 1FRKA 3SK3A 3FCHA 2MZRA 5L8RC 2E66A 3NWRA 5M1KA 3K5NA 2G0CA 4JI6F 4R8UB 4ECSA 3CF5Q 5BOMA 4I2QB 4P74A 3JSMB 1DTQA 2P6TA 5AZJA 3M32A 1SKSA 2KJ8A 1VQYA 4ED0A 3L7OA 3OVBA 3NVVA 3FRYA 3KMSA 3NNHA 4L76A 4PPXA 1EX4A 4A2AA 1WC6A 4Y2YA 5GAEI 2WFBA 4BGDA 1OJ4A 2Y9HA 9ICNA 2CQDA 1R6VA 1U6ZA 2LMIA 4ZHRB 1SC6A 3AVAA 1CJKA 1HA1A 2X78A 4CHQA 3AHPA 3SCJE 2KU7A 4OLBA 1L8LA 3THWB 2UUTA 5D49A 1S0OA 1YZ6A 4CERA 3OGUA 2B9WA 4K2JA 4FWNA 2DFEA 3HILA 1X6JA 4H03B 3HVAA 3AA4A 1NXIA 2KG0A 2D0AA 1DBDA 2V8DA 2EH9A 5GAGP 5HRPA 3RG6A 4V19J 3AQFA 5LOQA 3K2YA 1K0VA 3FQKA 4F72A 2EFGA 4GO5X 1KLMA 1TL7A 2Z0GA 1Q4RA 1YLXA 2IVYA 3TQ1A 5GAHP 2RQKA 3CYMA 4K8RA 1LWXA 1X4GA 1X7VA 1S1VB 1JXEA 2R8KA 2OLWA 2HS3A 3JQJA 4ZVEA 3M2RB 5HBMB 5CR4A 3QETA 3DRSA 3MM7A 3CIMA 2G4BA 4R0JA 5AI8A 3HL8A 4RW6A 2C22A 2AJ4A 1XC3A 2MAXA 3C15B 3MFIA 2R9LA 4AHUA 3GYXB 1JLCA 4EAHD 1XU4A 8ICEA 4CK1A 2W7PA 4OPKA 4P2HA 2XTJP 4NYZA 3B78A 3IO1A 3R7SB 4DTNA 3U9DA 3JQMA 1XC9A 3R5CA 2VJ4A 4JBCA 4KHPK 4WKYA 2RHQB 2ZTDA 1GXTA 4ITSA 4H0PA 1V9OA 7ICHA 3IS9A 4Q43A 1WORA 1QAJA 5F3ZA 4PGYA 2JWKA 2F8MA 5J2QA 1G6BA 5KI6A 1UWBA 1RYUA 2W24A 3N6MA 1JXBA 4JI1F 3OTBA 3RMDA 5JU5A 8ICUA 4KLOA 2CQBA 2W9AA 3IMXA 3TW0A 4JI6K 4OHZA 1M90T 3C6TB 3D0HE 5CYJA 3ICLA 2J7WA 2CPDA 1VS3A 3IXQA 4U6PA 2VG7B 3G10A 4HUFA 4RNHA 2X74A 2GMLA 3CCQS 4M63A 5KGWA 3HT3A 1NZPA 1E6YA 3BSCA 3DV9A 2Q1LA 5M1QA 4KHQA 2F8HA 2VDHA 3GR0A 2JWNA 3KHYA 4CT8A 3U26A 3NNAA 2YKPA 4ZVHA 3VGSA 2LA6A 1Y88A 4J9KA 1T3OA 5K4LA 3SPZA 2DRDA 5AXMA 3K9KA 4P7VA 3T79A 4B9VA 5B0DA 1KAYA 1XI1A 2ASLA 1HBMB 2XC9A 3CC7S 3LP2A 3PO5A 5K8OA 2P6RA 9ICKA 4PL7A 4KLHA 1B4SA 4JKDA 2B8PA 3JS9A 2P9UA 1KLNA 2XY8A 3AU6A 5BYQA 1H1VA 3WEEA 4LVNP 4ED7A 2H3ZA 2M4MA 2JOQA 5T7BA 4BREA 3G4SN 5J2NA 2XIDA 5J2AA 1HBUA 2XSFA 3CB4A 4ZJOA 2WSCC 5F8HA 3DU5A 4KAIA 4ZVOB 3SUNA 4H4MB 4YOEA 1VK3A 2R2RA 1KFSA 3CT9A 5BPNA 1UA1A 3J80O 4R5PA 4NI2B 4LFBF 4C8YA 4IQXA 1Q9XA 1N62A 4BR0A 4BUGA 4W5TA 5GTIU 3DM2A 3MPYA 4A5BA 4LREA 4IUFA 3TR8A 4JI1K 3PSPA 4Q44A 4CW7B 1LQ9A 3OFEA 3RRKA 1XSLA 1JL2A 2XS5A 4XIUA 3VEVA 1ZQNA 1YJNS 1CJVA 4BCAA 2YWEA 1C0FA 1U8SA 1NGHA 2F4VJ 1KXPA 2LM1A 4K4UA 2GOLA 2FJ6A 2KJ9A 3AN1A 1S1XB 2D7SA 2KRBA 2ZXIA 3EZUA 4RWTA 3GB0A 3VGTA 2VZ9A 3CDEA 3D9BA 3IR6B 3NOGA 1IG8A 2OTLS 1WLJA 3HX9A 3IGNA 2HLUA 3FSXA 2HKEA 1JRPA 4CH0S 3TAPA 3PMLA 5GTHU 1WF2A 2XHCA 1T9VA 4QZEA 3MEDB 3KG4A 3PR4A 3M8YA 4X4QA 4EYHB 1FRJA 4LY7A 4WYLA 2ZVIA 2ZOMA 4FJ9A 1WSGA 2A1SA 3RF9A 4WIIA 7FD1A 2V7ZA 3RWUA 2NO5A 1QUPA 3NL0A 3TAGA 4N47A 2W2QP 3ISCA 2MRLA 5IIKA 2MJUA 4MYUA 3CMAS 4AD6A 4QWCA 1KAZA 4MEYA 2DGVA 3Q89A 4AH9A 1GLAG 4YHHJ 2YNIA 2PBDA 5LY3A 2APOA 2YHBA 1BOTO 1NGBA 1NNDA 4W98A 1JQGA 5EU7A 2E2NA 1GMUA 5KFVA 3BO3A 5CY4A 3AQEA 4JWMA 1RA7A 3GFYA 3BZQA 3LM2A 1OH6A 4IRDA 3GIRA 2BPCA 3B82A 1ZA2B 4UB3A 3CG7A 2X3GA 3VZIA 4LFCJ 2JXJA 4R25A 5D0GA 3W5XA 4F26A 2AU0A 1RT7A 3VGLA 4KX3A 3NFAA 4P2MA 5FJ4A 4YD2A 3DLEB 3SAGA 1C6VA 2HHHF 3MUMP 1IBCB 1FVQA 1JLFB 3PCOB 3EWGA 1YUWA 4YOTA 3O4NA 1MWKA 4DV6J 1VQ9N 4F91B 3IWNC 5AK4A 4JEPA 5TKWA 2IJFA 2HFSA 1T9YA 3VC8A 3CCSS 3H45C 5J0SA 1JI7A 2MGZB 2IFXA 1YF5L 3MX5A 4HTLA 3MXHP 1BE4A 4N8NA 3HP9A 4L3QA 2EC0A 1NUEA 3HVRA 1U1OA 8ICXA 3ULEA 1DK3A 4USVA 3WIUA 2HBMA 2UV8G 4NLVA 3OTQA 2DGTA 3KKFA 5HI7A 1VHXA 3NGIA 3LANA 2DCUB 1WUDA 4ES2A 3O80A 1RT2B 3MPUB 2JDJA 3R8YA 2UU9J 1HPZB 3G6ES 4B9NA 1XR7A 1NU4A 2HS0A 4P2FA 3LPTA 2A1RA 3DLJA 4Y2AA 4IR1A 4ED2A 5HMXA 4RTFD 3BO4A 4LSLB 4NLRA 3DMJA 2D0CA 4YDDB 2ZJRQ 2FHOB 4IRCA 4LF7F 3HZGA 4AL7A 1RZMA 5DGBA 2CJ9A 4CJTA 3RB3A 1FEZA 4NLDA 3ZNUA 3GV8B 4MFCA 2GIQA 1GQEA 3QJPA 2E1YA 2Z30B 5ALMA 4G9BA 3PZPA 2AGPA 3I0SB 2QC3A 4FYVB 1G3OA 3I87A 1Q9YA 2O8DB 5F8JA 3TSUA 3CJRA 3BM7A 4OJRA 2D4WA 4M3ZA 1CJTB 3Q7CA 1Q7LB 2JHEA 5J2KA 4FXVA 1GOCA 1VJWA 2GJFA 5IT9O 1ZQHA 4NYOA 1RQLA 3DCAA 1F44A 4DQQA 3KKAA 4BE1A 4LBHA 1SH2A 4ZVFA 1BU6O 2KYXA 3I5BA 1AZSB 4QZVB 2VFVA 1T03B 2D3DA 1Q81O 1YZ7A 1ZM9A 2JMGA 5L1JA 4GVMA 3V1RA 4OJ6A 1UT5A 2CJAA 3AA2A 4J90A 3MEGB 4M5KA 2O6KA 1BL3A 4RKUC 3B54A 3OYKA 4OKKA 4F2SA 3R1XA 1JIHA 4IXCA 2RRBA 1WACA 1XEZA 2HHHK 2BRKA 3B0YA 4Y65A 1KKXA 5ALIA 3RB4A 1VMBA 2Y0BB 3M30A 3VPZA 4RWXA 3E1YA 2Y0SF 5AKIA 3EM1A 4IS7A 1IBLF 3MEEA 3QNMA 4PXCA 3PV8A 4KB0A 2ZG6A 1C0UA 1SJ4P 3AVKA 4MEXA 4ZVUB 4WFAQ 4A8SA 3OYEA 4JRQA 1QQ6A 3SENA 4TUQA 4D3GA 2KO1A 2R7QA 4RW8A 4G1PA 4M04A 3C6AA 1YAGA 1XHXA 2MTLA 3KK7A 3NE6A 3FFKB 3MWPA 2ZJRL 1IKYB 2WSFC 4OYPA 1APSA 5C42B 4FYYB 2ZZMA 3CO0P 1RTIA 2QJ3A 3OYIA 4ZVTB 1IBKJ 3SBMA 4J9MA 1JLGA 5HP4A 4C97A 4JUZA 5EVZA 1J5EJ 2R7TA 2BJ9A 3T1HF 4KITB 3HJEA 1HWUA 2EFVA 4BY9C 1MMNA 3BQ1A 4UB4A 1BA0A 4LF7K 4ECUA 1K8AO 3D7EO 2IOFA 3H1VX 1OKJA 5TKYA 1T02A 2GIRA 2I5HA 4P2XA 4FZZA 2RDJA 3HSGA 3F2DA 1WDDA 3BR8A 1JLBA 3CJ3A 4TU8A 1C0TA 1ROFA 2LFVA 3Q8SB 2AYMA 4KLTA 3BSOA 9ICGA 5AFUA 4ILHA 2LDIA 5FDLA 3C16B 4QIVA 1VBXA 2FVRA 5G0RA 3R5JB 1SL1A 2D3UA 4DV7F 5LXYA 4F0KA 3JPQA 4BJQA 3GG0A 5HMWA 2RKIA 4WQ4C 5HHHA 4JD2B 2PA3A 2IAJA 4DBQA 3KJVB 3IG8A 2U1AA 4C80A 4UB6U 3GWCA 2ASMA 5F8NA 2FHKA 3L8BA 4UOFA 5KFIA 4MFFA 5GVQA 2NZCA 5SUHA 2BKPA 5AFUH 1S77D 2R7XA 3QDKA 1X2IA 3L2QA 1UVLA 4LRAA 1EETA 4FZVA 4ZDNA 1X5TA 3L4IA 2W9BA 1U1KA 4QWAA 2FQQB 4ZPBA 2OELA 1V9PA 4MK8A 4FPIA 1Q53A 4LF8J 5CCLA 3IP0A 4I6AA 5J2JA 3GZFA 1S1TA 1SQFA 1KP6A 3RJJA 2GJ2A 4DPYA 3H5YA 3PG9A 4A8QA 3TJAA 3OR1B 2P9NB 1HNIA 4YMEA 4WFAL 3NGDA 1BIUA 4DPOA 1WNEA 4CHYA 3CPWR 2CPFA 4AILC 3VQBA 3G8QA 4IDHA 5JJBA 1X4DA 2D3ZA 4UY8O 3ZTQA 3WNGA 1IBLK 1KVJA 2BW2A 1ZQSA 3OYAA 4E0DA 1D5AA 9ICEA 2V4RA 3NOCA 5KT6A 4M5IA 1F9EB 2R4FA 3EKSA 4JK9A 3WKCA 4J9UE 3TP2A 2QLFB 5GIPA 4CZIA 4EFAC 1RT6B 3QE9Y 4KRWA 2G1HA 4U8YA 1YJUA 4YVZA 4TSXA 4NLCA 3EN9A 4A5AA 4QNLA 4A2BA 2KM8B 4PHTX 5FLXU 3FCVA 4DL2A 2G8KA 1RT3B 1D8ZA 1MA7A 3NRZA 4FKXA 2HRYA 1VOMA 4CJRA 1FDDA 5C2FA 1S6PA 3E51A 1M1KT 4AL5A 4OD0A 3T1HK 4OVLA 5ETLA 4WF9Q 4EEKA 3C29A 3MR2A 1ZQPA 1WJ9A 3HDSA 1E4GT 2HNYB 2V51B 3ZEUB 3ILJA 1QS4A 3ISBA 1N34F 2UVRA 1KHVA 1VC0A 3B8HA 4N56A 4LF5J 1HLUA 1FE0A 2ZBPA 5DM7Q 4WJ3B 3N6NA 4LFCF 4FF3A 2R8IA 3DGVA 3CJ9A 3N97B 3VQSA 3BZCA 3C94A 4B9TA 5L9NA 2IDOA 3VN5A 1Q3VA 2R7RA 5ALVA 3JXOA 3A8YA 2Q6CA 2C2EA 4PHDA 5LSRA 2H48B 2CZ4A 2W8KA 5J0QA 5IM0A 4EX7A 1ZQZA 4ED4A 2IA0A 4DV7K 1CJUB 1LV5A 2NV3A 5BXIA 3FR0A 2IM1A 3AV9A 4K8ZA 3TSPA 1S4EA 3IWLA 1MQ2A 5KFTA 2G09A 4QW8A 2NS1B 4GVBB 1W2BR 5LJVA 1YGYA 3OYHA 3O0FA 1FJEB 2R2TA 2IMOA 2KM8C 3OHRA 2G8IA 5HROB 3KHGA 1IG9A 1YRUA 4RCHA 1SWVA 2BKEA 5AQJA 2EZXA 3QNOA 2BRLA 2ZIVB 5ALTA 3SSRA 2VKRA 4OYOA 3MXMA 4LH5A 4NXMJ 1U1LA 1L8OA 2LXUA 2E1ZA 4GXKA 4YN4A 4AP9A 3C8YA 4HTIA 4Y2TA 5KG6A 4X62F 1ZETA 2ZC3A 4AHCA 8ICSA 4OX7A 1KEJA 3UVJB 2UU9F 5EXWA 1KQSR 1LXNA 3AU2A 4DL4A 1NBEB 3NS6A 3H20A 3UMGA 3PX6A 2IRXA 4B02A 1GAOA 4OI6A 1IKXB 1JLAB 2FLLA 3DJCA 4M94A 2MKHA 2D1KA 4ACOA 2WB1F 1LFWA 1WEYA 5A8RB 1UEUA 4CNQA 1P1LA 3VVTA 4F4WA 2HRUA 2KICA 2K8GA 3ZT1A 3L2RA 2WHEA 2KJ5A 4HHHA 3FMBA 3PFOA 5AM5A 2V2VA 3K4GA 2O8EA 1RAJA 1OW5A 2F96A 5LXRA 2B5JB 4WF9L 4L73A 5I42B 2ALZA 2DNNA 4NLNA 3KMQA 2QWRA 1G4CA 1D9DA 1UHUA 5F1XA 4H0XB 1UTAA 4TQSA 2AYBA 1VBKA 2RQ4A 5KFOA 3QEXA 3M2VA 3K8WA 5KFMA 3SDEB 2BE2B 1GOBA 1XS9D 1ILYA 1I5OB 2ASJA 4RU2A 4A46A 3GZ7A 3HJFA 1WNSA 4BGAA 1M1HA 3FCWA 4FM2A 1ELOA 4DL3A 1JLEB 4CRJA 7ICFA 1BQXA 5EHHA 1PGZA 1N34K 3V7KA 1TK0A 1JKHA 4KHRA 2H3IA 3D6JA 2F9JA 2QKKA 4NB4A 4LFCK 3ONNA 4X64J 4RNMA 1S59A 5F0UA 4UZCA 1RTJA 4M5NA 3HPHA 3H0MB 2N7YA 2B7BB 1LW0A 2J0WA 3M2UA 3P4UB 4OJPA 5ETQA 1QAIA 3RMAA 3J81U 2KVIA 1QD1A 1Z4UA 3HFKA 2O8FB 4JB3A 2HSZA 3CCQN 1WC3A 4W92B 1BPYA 3HI0A 3UKUA 3DNCA 1BPEA 2AX1A 1ZQRA 5G4DA 1N5WA 5GAEP 2BH1A 4CHPA 3MR5A 3OLAA 3H0RB 3PSFA 2F8KA 3GL1A 4CTAA 3D54A 3H8MA 4QU6A 3F9KA 3QX7A 1U1NA 4IO1A 2KVSA 3MAQA 2A2DA 1RJJA 4DX8H 1XERA 1PK3A 3CDUA 1ZZFA 3CFOA 4I2JA 4DTPA 2XRIA 1AB8A 2DH7A 5HMYA 2E29A 4LMZA 4YDXA 1U09A 3MK6A 3R8EA 3AO5A 4X62K 4UOCA 4M1KA 5F0XA 2UU9K 4Y2IA 4K41A 4KHNA 1RDFA 3HPOA 1C4CA 3SEOA 1RHMB 2MJNA 4BC2A 2QTWA 3CC7N 3RJMB 4JYAJ 2A1BA 3ZZZA 4CBWA 2HLTA 5J0XA 8ICMA 2VG5B 1LXJA 4QS9A 1JXLA 4DXLA 2KT5A 3TTDA 5KQ8A 3BB5A 1DTTB 1JLQB 4OZLA 1GLFO 4DS4A 1Y64A 4RW7B 2DH9A 1SKRA 3MN9A 3HD1A 4FVCA 3W0LA 2WBRA 3OW2M 2HSEB 2XWYA 3JXUA 4ZTJA 1NSAA 4M3RA 2V0NA 5CYMB 3RBEA 4CZMA 2JZBA 3N28A 4A61A 4B3OB 1R0AA 3AOCA 3H5XA 2P9KB 1WKLA 1HX1A 3ULHA 3AO1A 2DGSA 4CFBA 3CQXA 3U3GA 4I6YA 3V6HA 1WSVA 3L2VA 1O08A 2J8AA 1ZQXA 4JI7J 2B4PA 2ZVSA 1LKYB 2KK0A 5M1OA 2BKOA 4QPTA 4FJLA 1ZJNA 3CD7A 1HMVB 4IQUA 4KRFA 4CO0A 4XPEA 2EAPA 1MNEA 5TISU 3Q8LA 3ENOA 4NA1A 4RL1A 1S22A 2ITGA 4FYXB 1FE4A 3SJHA 1BI4B 1CS4A 3H98A 3PRDA 4KLQA 2K1RB 5HAOA 4H0VB 4G1QB 4M9JA 1Z1ZA 3UW1A 3VQPA 2KKHA 5KFQA 2VHGA 3N4MB 4Y1DA 1SUQA 1BCOA 3TR5A 2BUNA 3QWUA 2CADA 2PZSA 4DFKA 5KT2A 4CF3A 3ZYYX 1V85A 5G5HA 2FGOA 2DIVA 3OUYB 4IQWA 3VAFA 3HKZF 2OTLN 3I55N 4DG1A 2BUPA 2R7UA 4DMZA 5J2GA 2UZAA 4CH7A 2ZHOA 3IUCA 2EHGA 5BN8A 2BPGA 2VJVA 3D1OA 4QWDA 1CQMA 2W9MA 4QZBA 5A0YB 3K89A 2UYTA 2MZQA 2K89A 2GMJA 4AFFA 3JYTB 3DGPB 3ILIA 4V1Ak 4EX6A 3L3VA 1G99A 1C1CB 4J9OA 3IM8A 3CMAN 2HVZA 1RWWB 2ZH6A 4C6AA 4M3YA 2JRSA 3EVOA 3K58A 1ZD5A 4UY85 5GMDA 4KV8A 5F8MA 4WU2A 2FSNA 4EEYA 3K0JA 1V97A 3C2PA 1QHAA 2YNFB 4MO5A 1C20A 2F8EX 2MU2A 1ZD4A 1N32J 4FJ7A 2HOEA 3S7RA 3K5MA 1P27B 2ZTEA 1F21A 2FDRA 2V69A 3MGVA 4DV1J 2Y8WA 2HBJA 1TP7A 4LF5F 4K7QA 5CHIA 2HHPA 2CWKA 3R6MA 4BGBA 5E3QA 3WKAA 1SGGA 4FWKA 2BMBA 3MUTP 2I0XA 2RD5C 3M1VB 3AMZA 2CPHA 2H65B 3LGHA 2FSJA 3EW9A 3DXKA 3OR2A 4WK1A 4I29A 4BR9A 4YDUC 3G6YA 3CCSN 1A77A 3TAMB 5KT7A 3THVA 3EGWB 3SSSA 1IM4A 2LQ9A 3ZETB 1S0VA 3NGUA 1SS6A 3KUGA 1LKZA 2GQ2A 2G07A 1O1WA 1TE2A 2YJEA 3R1LA 4P9SA 2JHDA 3TZZA 5DG7A 4UQTA 1NGFA 2F44A 4C3KA 3ZX0A 1BHLA 4YCXA 1NK6A 4NXMF 1XO1A 2H4YB 5FIIA 3QRPA 3G6EN 2F3NA 2IDEA 5B0GA 4DR7J 2HMIB 1DKGD 2RRAA 2AHOB 1QQ5A 3MGJA 2PN6A 1WCNA 3J7AN 1X4FA 2QA2A 3UKRB 5DM6Q 4J9QA 5EE3A 3U02A 3E58A 2ZH3A 4P71A 1C0MA 2MLXA 1UKUA 8ICFA 3M8PA 4CD3A 2NXNA 1KDNA 3UXOA 4EP5A 2B51A 6FD1A 3MGIA 1HBOB 2K4EA 2GVDB 4RQ0A 2VGNA 1PK1B 1OQ6A 2ZE2A 3TAEA 3GG1A 2BKNA 4I2AA 1URNA 2WW8A 3DLLL 2MYFA 4J9PA 3AA9A 3QIPA 3V2UC 5J2MA 3NDKA 1M90O 1XSNA 3LPUA 1N33F 5ALPA 4FPAA 3QIOA 3IRWP 1X6IA 1S4FA 1RT5B 2GQCA 2KFYA 1N56A 4Z6CA 2Z2YB 2YKOA 4H5VA 5J2BA 4CJFA 4CNZA 1YX2A 2W54A 1YBTA 2HVDA 2A3VA 2ZH9A 1PC4A 3MI7X 3CJKA 3G8SA 4ZVSB 1REVB 1NKBA 1CZBA 4ISEA 3SV4A 3GJRB 3M7VA 1O03A 5L38A 4AHVA 3ELHA 1RAIB 5A2QU 2JC1A 5GADI 4CE9A 2DFLA 2HOFA 3MMCB 1MMDA 4LF5K 5IV3A 3ATVA 4K50A 2QX0A 4NRTA 2WONA 4F36A 4C3LA 2QFJA 2GMHA 3TUJC 3CNQP 1S48A 1KQGB 1WELA 3WUHA 4DTOA 3I56S 2PFQA 2EFOA 1EO1A 2E5IA 2CGKA 3P5TL 2ZC4A 3ZSWA 4FZMA 2CQ4A 1PO6A 2YMPA 4O4GB 2FLNA 1MU2B 3NF8A 5T7LB 1RLCL 4CJQA 3EVMA 2V2ZA 4CEDA 2AQ4A 3MCPA 4OI2A 3WC2A 1ZD3A 3A0BU 2MKKA 1NI3A 4ZP9A 2IBKA 4ZPAA 1T3NA 2UV8A 5DM6L 3R7NB 3K9JA 3KLFA 2CXEA 1NSQA 1AA1B 5I3UB 4NXMK 3WIVA 3MPDA 4FL9A 2KKVA 3KK3B 4PUOA 1K47A 5AXNA 2QIFA 2RN2A 2EDUA 2D9OA 3DXMB 3AAQA 5BRFA 3W3SA 1WSEA 2Q2RA 2D0PA 3QU4A 3RR8A 3NG8A 2JV3A 4O5KA 3WDOA 4CP5A 4JYAF 3NMAA 5AR0A 3IV6A 2HHVA 2GVZB 1RYRA 5HJYA 3W8GA 2BDUA 3MN7A 4ILGB 2K3KA 5AK6A 5HR6A 1VSJA 1RTDA 3QBWA 2UXCF 3QAEA 3DI6A 2FLOA 4M0AA 3RR7A 4ECTA 4QZAA 1N33K 2XHWA 4JHDA 3VQ8A 4CJVA 5AI0A 5C2GA 4GMKA 3SMZA 1LWCA 4J2DA 4OPJA 1RWNB 1FXRA 4KC5A 2P5OA 1PAEX 4EELA 1QQ7A 2ZWPA 4DU1A 2FHMA 4WTYA 3CWJA 2I5JB 4YMNA 2LCWA 4PHEA 3V6KA 2K8CB 2OSRA 4BXOB 4OV1A 1NZAA 3HOTA 3MCAB 2AH5A 3O1WA 1HIYA 4D3HA 1COKA 2AX0A 4EI2A 3Q2SC 4KO0B 1MROB 3K57A 1R8CA 1FK9A 1HQUB 4KGXB 1VIOA 4NA3A 4PY5A 8ICCA 4RQ2A 3BS9A 4OI0A 3H8YA 4M2YA 3RZAA 3BKTA 3T5JA 3SBTA 2HGMA 3PLAA 2NXJA 5IXUA 3DDKA 3CJCA 3QU5A 2AJ0A 3D28A 4HKQA 3L3CA 1NGCA 3CJ0A 1HHTP 1B7FA 3E2EA 1SH0A 2BX6A 3H8JA 3RB6A 4NA2A 1PBAA 3MAAB 3UFCX 4OZ1A 3S41A 1ZQJA 4F04B 3LDNA 3NCRA 4CF2A 3D2EB 4DUYJ 1Z4NA 4NCGA 2DNHA 4PKHA 3TZWA 1HEKA 4H5NA 2LLZA 1NJIT 5AZIB 2W6LA 2WF5A 4M9NA 5AI4A 2CRLA 1SV0C 1NK4A 4EZ9A 1XR6A 1QQCA 1NH8A 2M70A 4ZP7A 4PH5A 2HG4A 1RDAA 2OMLA 4M5DA 3UXNA 4QYZJ 4GFJA 1DJ0A 5E7OB 1U47A 5ETOA 3SEIA 2EXUA 3WT0A 2XCAA 4PCQA 1F3VA 4KGMA 3THYB 3WQUA 4XH1A 4YS2A 4GC7A 4FYWB 4RG8A 8ICTA 1GLDG 3ZFVA 5AK3A 4WCEQ 2YX1A 3OQ2A 1R8AA 2W7OA 4KFBA 5CHCB 1FKPA 1AFJA 4ZLLA 2WAQF 3C2KA 1UZHA 2CPYA 4USMA 4JYAK 3ZSOA 3JQKA 2EBGA 1S5LU 8ICRA 1VSKA 1GTHA 3MAHA 5AKHA 1D9AA 4B1VA 1YJVA 4ILMA 5B0BA 4IC9A 3ZZRA 4UATA 5CYQA 5ALHA 1JCGA 1F9HA 3W3DA 2Z56B 2C2KB 4JI0J 2E3TA 2A18A 3THPA 3C46A 3R2DJ 3SV3A 1MA9B 1HI1A 3LP1A 3C65A 1UCNA 1AXQA 5KFAA 3DU6A 1FDBA 5CXTA 1ZPWX 1YJRA 3D7SB 1DGJA 3ZSVA 3M8QB 3HVTB 3N4WA 4FWPA 5C2DA 5A6PA 1HR0F 4JKBA 2ISOA 4Q45A 4ZPCA 4CFCA 3V9SA 1EARA 4FWOA 4ILLA 1XMQF 2KP7A 1TVRA 2NRXA 5L1MA 7FDRA 1VQ6S 2IOFK 4R66A 3UWTA 4CLKA 2E88A 1PG5B 2YX6A 3M6ZA 3GE9A 2F8LA 2BPFA 3I5CA 2G8HA 2DXFA 4HR2A 1IKVA 2KSOA 3M3ZA 2I2YA 3KYLA 4QW9A 2I8EA 5M1PA 5KG2A 1DTQB 4NLGA 1V4TA 2AEJA 1S0MA 1T9TA 2KHDA 4F4AA 4KLFA 4YR0A 4OX6A 1HKBA 7ICSA 2P9GA 3K17A 2M2BA 1RG6A 1HUOA 3AVFA 2L9WA 3BS7A 5FRMA 3NGZA 1EHWA 1VRQC 4FJMA 1OVQA 2ZUDA 2COLA 4C8KA 4O5FA 1HKCA 4ANEA 3HPGA 2CNKB 3DYAA 2QWMA 3FEYB 3BSNA 2QKQA 2B43A 4BR2A 1SIJA 3M8RA 3WHIA 1FWPA 5H9EJ 3CCLN 1UW4A 2J7UA 4OL8A 2Z2LA 1URRA 5KRTA 2LSNA 2ZKUA 4NL9C 1U7LA 3E01A 1GEHA 2UXBJ 2DNPA 4X4TA 1HBNA 1TL7B 3OTOF 3M9MB 2CPEA 2OPQB 3CJ1A 2ITMA 2IOHA 4ZJLA 2PMZC 1VRUA 4ID5A 2M7SA 4DOCA 4H54A 4RNOA 2YNHA 5CABA 1R89A 2GH1A 4WFYA 4Q0BA 2M88A 5BPLA 1F3FA 3AO2A 4CIOA 1OY6A 4CO3A 2CZVC 3BPDA 3RJKA 1O13A 1HQEA 3MM7B 4WKRA 3WKDA 4K4WA 3AVNA 2IGIA 2LQJA 1SB3C 4A8WA 4CF8A 3LAMA 3RGIA 4C4WA 4LJMA 1COOA 3L3FX 3VAGA 1KR4A 4IFYB 4OHXA 3CI5A 4I2PB 2PC6A 4QU7A 1OSCA 1HUXA 4AYBF 1VHFA 2W7AA 2QB0A 2XS2A 5KFPA 4DR1F 2HWIA 4CJ5A 4FJNA 2QMUB 4B8CA 1JJCB 1O0PA 2HQFA 2E7XA 4LZDA 1V5IB 3AGRA 5D8HB 3VAMA 1HR0K 1X42A 4YB1P 2BJ7A 2BM0A 4DU3A 5J2QB 1UWBB 3HFVA 3KWIA 4A8MP 4LF6J 4F9OA 4RUAA 1B70B 5CZ2A 1XMQK 2OAUA 5KFYA 4I2IA 1LAWA 1C2PA 3TI0A 2ZIWA 1YRTA 2YHYA 3B6OA 2G5HB 4CJSA 4DFPA 4L74A 3ZZUA 4GO7X 2XMAA 4PWDA 2DEIA 1WSHA 3VEXA 3MM5A 1VQMN 1JJ4A 3H4BA 2ZJQQ 2BJ8A 3A8EA 3H90A 2Z1IA 1FJGF 4CE6A 2WF6A 2XMMA 3CULA 1V4SA 3K8VA 9ICWA 4BVPA 1IV8A 5LJ3Y 4CJPA 5EGYA 2HBYB 1HYSB 4OFZA 2ZH4A 3MF5A 5I3QA 1RUSA 1ZQWA 5F9NA 5K14A 1YIJN 4QCLA 5DETA 5ALQA 1KW4A 3X3UA 3IBFB 1ZQQA 1CUKA 1XR5A 3O3HA 3NCPA 4OJLA 4DR5F 2LYAA 4Z6EA 4PKGA 2AF6A 1KN5A 3QUCA 2Q31A 3FZHA 4CI0B 4ZVRB 1ESVA 4PG6A 4FJHA 5KFDA 9ICMA 1TFRA 5J0TA 5KT4A 2RUSA 1ZQKA 2LYHA 2VWJA 4PYAA 2Q1NA 2AW0A 4OGCA 4WQ5A 4BRFA 5DBAA 4RUBA 2KXNB 7AT1B 2XSJA 4BRNA 2D69A 3OTOK 1BGXT 5M1NA 5AQUA 2H3VA 1U25A 1NGGA 2FPKA 3JPTA 3PYGA 1EAYC 3QFWA 3C1YA 5J8YC 2B0GA 4WP8A 1N36F 2XNQA 1KAXA 2H51B 2YNGB 1EP4B 3SCKE 3OYNA 3CERA 3QYPA 3WEEB 5IT9U 4JLHA 3CMQA 3SBGA 1AUSL 4A8YA 1Z1BA 5J2NB 4KHSA 3TNVA 1SV4A 2QRRA 1HWKA 3DOMB 2P5VA 3HOSA 4E3SA 5JVGQ 4FF1A 3U1LA 1FTRA 3ZSRA 3GE1A 4I1TA 4UTGA 1T05B 4USIA 1IH7A 4DUZF 4PXEA 3IHQB 3EL2A 2KN4A 4XQ8A 4NWIA 4JAXA 4E7IA 4TQRA 9ICQA 1NSPA 2VQEJ 4KSEB 3OPKA 1IBMJ 2ASYA 4BRHA 4CRXA 3DRRA 1NGIA 2PMZF 1U02A 4UW9A 3EDRB 4R5PB 1X9XA 5E3CA 3LQVA 4OHVA 1LK7A 3PYEA 5EWEA 3F2BA 3BGFA 1F1BB 1U2RA 3PYFA 3MDFA 1ZQDA 1XWLA 3I9V9 4HT7A 3DM2B 5JLFA 1S3XA 3CQ8A 4NLWA 3G25A 2KVQE 5CD4A 2HQGA 2VU5A 3LDPA 4LF4J 5A8WA 5ETRA 5AJ3J 1HRHA 3LDSA 1D8BA 1CEZA 2W2OP 3CCJS 3R9KA 1UJ4A 2HS4A 1IR0A 1CJVB 5AQXA 2JLGA 2E6LA 1OXJA 2LA4A 2DKZA 4PGQA 4QZ9A 4RX6A 3IFEA 2CH6A 1BA1A 1B0PA 1FJGK 4EFHA 4CF5A 4BC5A 4WFNL 4Y28C 4ANDA 1AQ6A 2NXEA 1PUZA 2K7KA 4IKAA 5AQZA 4H0TB 3S3MA 3QUQA 1FT8A 5CD4H 5B09A 4RUHA 3F5TA 1KC8O 2QXLA 1UAXA 5MAOA 1OPIA 2RF2A 2VBWA 3KOAA 2Z4PA 3DN9A 1HI8A 3T5LA 1S79A 5J2FA 4ECRA 5FPNA 2FPMA 3C23A 2NUBA 1WOQA 9ICAA 3F2KA 4E7KA 2VA8A 2OMOA 1NMDA 1YBUA 2EQYA 2HEKA 3A0HU 3AD7C 2OTJS 3DOKA 1TKTA 2V6AA 4JI0F 3R9LA 2F9WA 4KMOB 4FBTA 1ICEB 2PEBA 3M4XA 3WBZA 3WK9A 2YNIB 4EK2A 2XY6A 2HHXA 2RVJA 3HF5A 3DRPB 1T4GA 5D0HA 1M5VC 5HO4A 3KFUF 2E1RA 5KFFA 3CNHA 3D0GE 3AA5X 4FSVA 4CEEA 1LW2A 3K5OA 1VK0A 3OYCA 2JX2A 3CCRS 4WK3A 3LVWA 4Z37A 1J6ZA 3Q8KA 5JVGL 5EOYA 1FIQA 4E8UA 4LBIA 5ALNA 2N7CA 1RT7B 4Y2QA 3MM9B 1NK7A 2HZAA 1NMEB 2JC0A 1U0SA 3VF4A 1D3WA 4F2RA 1YVFA 4CZEA 4ZA1A 3VQTA 8ICVA 3N9UC 4OYIA 1Q8KA 1BNPA 2O4GA 4DEZA 3GDQA 1WHVA 4RW4A 2WHOA 4DUZK 4UAUA 1G1XA 4FE3A 3NGSA 3MXIA 1HLWA 3D2FB 3S9HA 1FI4A 3SXLA 2A6MA 4C23A 3L4PA 4MKBA 3KIOA 3W9HA 2OYQA 5KT3A 2IJNA 1RZTA 5J2CA 2HAFA 2RUGA 3AJ2A 1A6LA 4BRMA 3SQGB 4PHAA 1S10A 2P9SA 4DX5A 2BQRA 1RT4A 1NDKA 3RSEA 3S3NA 3AXKA 5MLCV 4RQ6A 4CVNE 3US5A 4BRQA 4I2HA 1BC6A 3O4WA 4QZCA 2LYBA 4X66J 4ZN1A 1L5UA 4OX9J 4L8RB 4IRKA 1FF2A 3BF4A 1DRZA 2BQ3A 4F25A 3KNGA 4BRPA 5ETPA 1RGVA 3NMUA 2B8QA 4GKKF 7ICGA 1RLDA 1IKWA 4CYUA 1YJ7A 4PABA 5IS2A 4OYWA 4N41A 5CP2A 4CGZA 1NDPA 3HSTB 2NR0A 1MG7A 1VAZA 3RBXA 1IXRA 2W3SA 4Y2SA 1GLBG 2A6OA 4DV2J 3IG1B 2UUCJ 3D66A 1E4FT 4TN2A 2G0JA 2AXTU 5IZHA 5DDOC 2NO4A 2KI2A 2O67A 4QIGA 3SUOA 1Y5NB 2CH5A 4QIWF 3V1OA 1RXWA 1XNQF 5CB1A 1G2EA 2EAMA 1NDLA 2OPRB 2ALYB 4NLQA 4R8UA 4BRCA 4LSZB 4UB5A 3QUBA 4JI0K 4I2QA 3VGMA 3H5UA 1MN7A 3MABA 2Q43A 1VCTA 1FFUA 2CQIA 5KAFU 4F4KA 5BRHA 2BANB 1C4AA 2B21A 5B08A 3R1HA 4P4MA 2YMLA 4DQPA 3O3LA 1TELA 3GJTB 3ET6B 4V19X 1ZA1B 3AVMA 2RE2A 3UN5A 2ESEA 3RAXA 4ZS6A 3AOBA 4KGZB 2OI2A 4QR2A 3Q8VA 4ZHRA 4BG8A 4DR2F 3NS1A 5KFKA 4EUVA 3UMBA 3MURP 3MECB 3FEZA 3L09A 3QGHA 3QT6A 1S49A 4CESA 5DGAA 4FF2A 5CCMA 3QYYA 4M5JA 2VPYB 4YQWA 2KIWA 2BGWA 3AB2B 5J1EB 2WFAA 4US9A 1S5ZA 3T1YF 1K8AT 3NAHA 2U2FA 1RTZA 1SKUB 5KAIU 2L08A 9ATCB 4K4YA 4PEOA 4YB7A 4K4XA 5B0EA 3QGPA 4DLEA 2GHWA 3QJLA 4FO0A 4DX6A 3O44A 1C0UB 5AXLA 3EVWA 2MSSA 4LF2A 3VENA 1IUJA 1HD1A 4QBUA 3FVYA 4MIWA 3DDNA 2IVMA 2QL5B 3MCSA 5HBMA 4RW8B 4CWBA 3LDQA 1EKRA 3PHTA 4C98A 2Z1HA 4OJ1A 2E7VA 2P6SA 3VAJA 3PEJA 3M1FA 1B99A 3C15A 4GKKK 1HYVA 5JMVA 1JLGB 2HCFA 1QCKA 2CJBA 4Q2LA 1ZQUA 3UNYA 1J2MA 1RGIA 2YKNA 1X31C 2D0OA 1T11A 2AYGA 5IT4A 7ICKA 3DRYA 4OZ5A 2I7PA 3KLHA 3VQ5A 2AWZA 3A13A 4CZFA 4HDHA 1VRTA 3VZHA 1VSIA 2CQCA 5IQQA 3V9WA 1BNOA 4JP8A 5GADP 2QO3A 1N61A 3I6PA 1JLBB 3FAHA 1XBWA 5E3RA 4KHPJ 3RRHA 3M9OB 1RDCA 4CF4A 5FDLB 1C0GA 2NRHA 4WP9A 1XNQK 2PI5A 2CFXA 4X84A 2EWHA 5G0RB 3T6JA 3HVWA 2DCLA 1RU2A 2RKIB 5AHXA 2RHFA 3MFHA 3AY0A 4PGXA 1JL1A 1S5JA 2VG7A 4ICLB 2M9KA 5ETKA 2IDLA 3C21A 4KH0B 3CMES 3SAHA 2RB7A 2VQEF 1IBMF 3IG5A 2BEFA 4JI6J 4CM2A 4KTWA 4RNNA 2A5XA 3E66A 2KT3A 4FXDA 3KFWX 2X51A 4IKFA 2DGOA 4DU8A 1EETB 3PTWA 4DDFA 2YHWA 1JB0C 1VQ9S 4IOAQ 1QVGR 4DR2K 2M3DA 5ALXA 1S0NA 5H2FU 4CEFA 4C7YA 4LF4F 1KNZA 2KZZA 2CDRB 2KRRA 3NXZA 4QZ8A 3O9QA 3CCTA 2OD6A 1FEHA 3T1YK 5AQTA 2RP5A 4LJXA 1T94A 1WI8A 3IRXB 3PJ9A 2UVUA 1HBMA 2JVRA 3H40A 3MM8A 3D3CJ 1V6HA 3MD3A 4HACA 3GU3A 2E9ZA 3HFZB 3TA0A 3UE5A 3VQDA 1FFGB 2DNKA 3OL7A 3ISND 5JMNA 3BH6B 2HWTA 1HNVB 1YKWA 3GJSB 1RWMB 3FDSA 1NAQA 2WSEC 4IFEA 1PIEA 5C25A 4TKTA 3A1YG 3RYLA 2DNLA 2MEWA 4BG9A 2HAIA 2DHGA 1MQ3A 4WYBA 1EKEA 2CYYA 2MZJA 2MKYA 2ZXHA 5K8MA 4ELUA 5ELZA 3PO4A 3LGMA 1OYDA 3SMVA 4KR0B 3RH6A 2RIJA 3CCVS 4USUA 1D9FA 2H54B 1I51B 4NLTA 4E7JA 2F4FA 4UB1A 2F9TA 4H4MA 4ERDA 2ACMA 2HFZA 4WE1A 2QB1A 3NVMA 4W5NA 1QVFR 2VIHA 1SQEA 1VHIA 3MMBA 3SQ1A 3TTCA 3W64A 5HL7L 4A8KA 3SYZA 4M9LA 5D0RA 3GU0A 2GHPA 2I6WA 3GJQB 3KZXA 1IV0A 2AGQA 2HBRB 3CC4N 3PUFA 1RCOB 2G06A 1YK9A 4NO7A 3BKFA 5AQIA 4LFAF 2MQOA 1GX5A 3ONQA 5D6GA 1QSSA 3R5DA 3O9TA 2HF3A 3ZD9A 4CO4A 5E5NA 1P8ZA 2YPYA 1S9GB 3PHEA 3QICA 1VQNS 4QIFA 3RJFA 1J27A 1MC8A 2E5HA 3UDVA 3VEWA 2PMHA 2QSWA 4OGEA 2LHTA 1RBTA 4K4HA 1L3VA 1ZM2A 2EPIA 2OEMA 2ZUBA 2Z2ZA 2XLJA 3HP6A 3KNAA 1BQNA 2BW7A 3ZTOA 3AL0B 3DAWA 1NKEA 2NREA 4OZNA 2IPOB 4DF8A 2VQEK 1IBMK 4G3IA 4H4OB 1J54A 3O8WA 1NK8A 1RSCA 3MEDA 4A57A 2XI3A 3W2VB 4P52A 2PFNA 3ISZA 3JPPA 3RU0A 4V19S 4X66F 2BV3A 5EX0A 2RHSB 2MB0B 5EX3A 2QWQA 3VVUA 5A0LA 4LF4K 2BBEA 3B8AX 1IXKA 5LMNJ 2CQ0A 5JTIA 2IOCA 3R27A 1F5BA 1HNWF 4I7FA 1IIPA 4IDKA 2ADBA 1K9MO 4NLZA 4AQYF 2LI6A 2EEYA 1TL3B 4H4KC 5DDMA 1X8DA 2P9EA 2W4DA 3HHEA 2ZH8A 2KQ2A 2PFFB 1NDCA 3D2NA 2YPZA 3GTYX 3TARA 1UETA 4XK8C 5DB8A 3TU5A 4Y6IA 4DV2F 3R5BA 5L46A 4CK3A 5BOLA 2IJRA 4ZPWR 2L5YA 1EX8A 2H5IB 4NYNA 2DL0A 3A5OC 1YTYA 3I8BA 5K5MA 4M6WA 4OZ0A 3NY0A 1KDHA 1F60B