4B9NA

Structure of the high fidelity dna polymerase i correctly bypassing the oxidative formamidopyrimidine-da dna lesion.
Total Genus 208
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
208
sequence length
581
structure length
581
Chain Sequence
TAKMAFTLADRVTEEMLADKAALVVEVVEENYHDAPIVGIAVVNEHGRFFLRPETALADPQFVAWLGDETKKKSMFDSKRAAVALKWKGIELCGVSFDLLLAAYLLDPAQGVDDVAAAAKMKQYEAVRPDEAVYGKGAKRAVPDEPVLAEHLVRKAAAIWALERPFLDELRRNEQDRLLVELEQPLSSILAEMEFAGVKVDTKRLEQMGEELAEQLRTVEQRIYELAGQEFNINSPKQLGVILFEKLQLPVLKKSKTGYSTSADVLEKLAPYHEIVENILHYRQLGKLQSTYIEGLLKVVRPDTKKVHTIFNQALTQTGRLSSTEPNLQNIPIRLEEGRKIRQAFVPSESDWLIFAADYSQIELRVLAHIAEDDNLMEAFRRDLDIHTKTAMDIFQVSEDEVTPNMRRQAKAVNFGIVYGISDYGLAQNLNISRKEAAEFIERYFESFPGVKRYMENIVQEAKQKGYVTTLLHRRRYLPDITSRNFNVRSFAERMAMNTPIQGSAADIIKKAMIDLNARLKEERLQARLLLQVHDELILEAPKEEMERLCRLVPEVMEQAVTLRVPLKVDYHYGSTWYDAK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase/dna
molecule keywords DNA POLYMERASE
publication title Unexpected Non-Hoogsteen-Based Mutagenicity Mechanism of Fapy-DNA Lesions.
pubmed doi rcsb
source organism Geobacillus stearothermophilus
total genus 208
structure length 581
sequence length 581
ec nomenclature ec 2.7.7.7: DNA-directed DNA polymerase.
pdb deposition date 2012-09-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00476 DNA_pol_A DNA polymerase family A
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.20 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 5' to 3' exonuclease, C-terminal subdomain 4b9nA04
1.20.1060.10 Mainly Alpha Up-down Bundle Taq DNA Polymerase; Chain T, domain 4 Taq DNA Polymerase; Chain T, domain 4 4b9nA02
3.30.70.370 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 4b9nA03
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 4b9nA01
1RBUA 5DDYA 3ZSZA 4M3ZA 4JS4A 1T8EA 3SI6A 1REVA 3V6KA 4I9LA 3AVGA 5DBCA 2DPJA 4IFYA 4R5PA 1WAFA 3AVIA 4JLHA 5L9XA 1NOYA 3H4BA 4EP5A 1BPYA 4CIFA 1KCFA 4FJKA 2GV9A 1ZYQA 2HHTA 3NGYA 2NRWA 3QERA 2ATQA 4MF8A 2ZQBA 2Y1JA 2XY5A 3OYAA 1RPLA 4Q44A 1C6VA 4FJNA 2HNZA 2P6UA 4DU1A 3Q8QB 1D5AA 4Z4IA 4NLNA 5DG8A 1IH7A 4RW7A 1RNHA 1UAXA 5KI6A 4CECA 1JKHA 3CFRA 1HYZA 5BOLA 4KLEA 4BE1A 3MFIA 3GIKA 3AA2A 3ZDBA 2ASLA 4CEFA 4I2IA 4CHYA 2FC0A 3SQ1A 2DY4A 4I2AA 3RJJA 4CJ5A 4J9LA 3K75D 8ICHA 5KRSA 1HRHA 4DFKA 5F9NA 5L1LA 3VQ8A 4I2GA 4RPZA 5IIOA 1X2IA 1BPEA 4NXZA 2A1RA 3ZDCA 1HJPA 4F93B 4LZGA 1RT1A 2ETJA 5CZ2A 4CHNA 1CLQA 4CIGA 3GDXA 3V7LA 4I2PA 4CJKA 4CJWA 4HVJA 3O3FA 5FRNA 4RT3A 3OYLA 4FBUA 2HHUA 3B0XA 8ICGA 4KHWA 4M9LA 4FXDA 3O3HA 5KFMA 3O4NA 2J6UA 2J6SA 1Q9XA 4DLGA 4H4OA 8ICEA 1LW2A 2PFPA 4LSNA 4FLZA 3SNNA 3A2FA 3NGZA 1JXBA 4GXIA 4DSFA 3NBPA 3V81A 1S1VA 1N5YA 4CGGA 3HL8A 1C1BA 1VRUA 3AA5X 3RB0A 1N56A 3F73A 3RJHA 5KFIA 3GFKB 4ZHRA 1JLGA 2BQ3A 2XY8A 4BACA 1SV5A 4M9HA 3C95A 4DTRA 2GBZA 4O55A 1WAJA 2AU0A 2E6LA 5KFJA 1I39A 5KFLA 7ICTA 9ICFA 3KKRA 4PQUA 4BXOA 4FJIA 3DRSA 5KFKA 4BDPA 4NCBA 2BGGA 4QW9A 1SL2A 3VQ7A 1RXWA 4QZAA 1S97A 2C28A 4I27A 2C2RA 4JK1A 4AH9A 3MEGA 2B6AA 4ECTA 5J2EA 1GOBA 4DL6A 9ICWA 3C1ZA 4NLZA 4AHVA 3HPHA 2R8JA 9ICMA 3PW4A 1C0MA 4KRFA 5HROA 8ICBA 1WLJA 3G6YA 1MC8A 4RQ1A 1ZQQA 2P5OA 5JUMA 1L3TA 1BIZA 4CF1A 7ICSA 4MFCA 5IILA 4DMNA 3S3MA 1LV5A 1TFRA 8ICAA 2Z1IA 3RMAA 5KTQA 4ECUA 3IAYA 3EZ5A 4P2HA 3AO4A 2HHQA 3LK9A 4R63A 1ZBIA 4KLIA 4GXKA 3T5KA 1MQ3A 3CM5A 5FDLA 1ZBUA 1JLBA 3HO1A 1D8YA 4KREA 3L2UA 4I28A 3VQ4A 2HNDA 4MEXA 4DFPA 4FZYA 1BQNA 3WNGA 4Q5VA 1VSKA 1WSIA 4F4ZA 5DK5A 3OSNA 1S1WA 4Z6EA 3MDCA 4O9MA 4I2CA 2EX3A 4NYNA 3BQ0A 2HNYA 3SQ0A 3MBYA 3KK2A 3TAGA 3EPGA 3VQAA 1C0TA 1XO1A 2PYJA 3RWUA 4H8KA 3OYHA 4QCLA 2MUTB 1KVBA 3HP9A 4ED0A 4KTWA 4X5VA 4KTQA 4KB1A 3QEVA 1LWFA 4FLWA 4DO9A 2XCPA 2BQUA 3Q8KA 3QIPA 2BKEA 3WNFA 1NJXA 2FMPA 2F8TA 3RB3A 7ICHA 3ZD8A 2ISPA 2IHNA 1KDHA 4K8ZA 5HHIA 7ICFA 4IQVA 4JRPA 4FK2A 3M8PA 4KMUA 4NYFA 1JN3A 1YTAA 4O3RA 4UAZA 3Q8SB 3LWLA 1WCNA 4YR2A 3PUFA 4BDZA 4ELTA 4CGDA 4CJEA 1VSFA 1SZPA 3C94A 2IOCA 3P5JA 4KHYA 1ZQHA 4YVZA 3NCIA 1SKSA 8ICLA 1TL3A 1JL1A 2BANA 4CK2A 4FJMA 3NGIA 3MXJA 5KT2A 3RAQA 1EETA 4TQRA 3KLGA 4KLJA 5DKWA 2IHMA 4DOBA 3QINA 2ATLA 2VWKA 4TQSA 5KG2A 4W5OA 4YR0A 1BPBA 5KFXA 4KTZA 1IKWA 4FJLA 1S1XA 3EY1A 4LZDA 3KD1E 4CEQA 1U45A 4M9JA 4IDKA 3KD5E 2KN7A 1ZQRA 1Q8IA 3PW7A 4AHSA 3QESA 5FROA 4C8NA 5EWFA 1U04A 4M41A 4EP4A 1B9DA 1NOMA 2JEFA 4F8RA 4JRQA 1X9SA 5EOZA 2NUBA 4FLUA 4DFJA 3GIMA 4B9NA 4P4OA 2H5XA 4DL2A 4F3OA 1KFTA 1S0OA 1MU2A 3BQTA 2D5RA 3DM2A 3NTUA 2B5JA 3RMDA 4CGFA 4DEZA 4XRHA 3PMLA 8ICYA 2VA2A 1CZBA 2PFOA 2V9WA 2KZMA 1VSLA 3C1YA 5KFGA 4RPXA 1NK6A 3RAXA 1DOQA 2QKKA 4ED6A 5SZTA 4FW1A 1K6YA 4HTUA 4DOCA 3M8SA 1XWLA 4DTJA 2FMSA 3BDPA 4E0DA 1WNSA 3PMNA 3LP2A 9ICHA 5C5JA 1JL2A 3KHRA 5L1IA 2RDJA 4QZGA 5DB6A 5KFWA 3DOLA 3SYZA 1BCOA 3OYKA 5KFAA 4KFBA 3TFRA 1Z3EB 2W8KA 3NFAA 1TVAA 3KTQA 4E7HA 1TVRA 4DS5A 4DL3A 2OA8A 2W42A 5D46A 1W9HA 1QTMA 4RQ2A 2BDPA 4CHOA 4CESA 4ECRA 3RH5A 2XCAA 4YD2A 2LSNA 1FK9A 1G15A 5KFCA 3RMCA 3QLHA 5C25A 2KFNA 4E7KA 4CJUA 3MR3A 3C6UA 3QIOA 2FPMA 5HRNA 3LZJA 1UOCA 4RNNA 1VSJA 4DL5A 2ASDA 5KFOA 9ICVA 3ZT1A 2Q0ZX 3MXMA 1BQMA 4YMMA 4DF8A 1NJYA 2FPKA 1SUQA 4PGYA 4MFAA 1ZQJA 3CM6A 1NK0A 5HMLA 2I1QA 3KLEA 2XY7A 4KLDA 3GV5B 4F4WA 1U9LA 3K2PA 1RCHA 4F5PA 1B92A 5HMMA 2R8IA 4C8LA 3IM1A 4CJPA 5CP2A 3LP1A 5DB8A 4GC7A 3RJKA 1XHXA 4FJ8A 5KFQA 1RXVA 2BCQA 4EEYA 4AHUA 4FJGA 2XGPA 1RDCA 3KK3A 4EBDA 1BHLA 3VQ9A 1CXQA 2RDIA 1V9PA 3SCXA 3OYBA 3GILA 3MDAA 3H8JA 4R8UA 3V1OA 3BJYA 4JS5A 2I9GA 5IIJA 4ECWA 4MFBA 9ICSA 4WE1A 1NK5A 1EKEA 1ZBFA 3MR6A 3UXPA 4KITB 4IRKA 8ICJA 3TABA 1BIUA 5KG7A 1L3SA 2OPPA 4ELVA 4OKJA 2C22A 3C5GA 5SWMA 3NAEA 3OYCA 4QWBA 4ELUA 2FBYA 2W9MA 4N41A 3MXIA 3NGDA 1D9FA 1TV9A 4R64A 4QZEA 4G1QA 4DL7A 3OYJA 3LP0A 4KLHA 1NK9A 1IG9A 3SQ2A 4RQ6A 4B9MA 4CFDA 4E7LA 3OS0A 3C23A 2X78A 3ISDA 3VQQA 4I2BA 3T1AA 2HHXA 4XIUA 3G0ZA 3KK1A 4QZBA 4Y1DA 5J2BA 4BE2A 3LALA 5I42A 8ICPA 3RR8A 3NH1A 5KFUA 4YXJA 3C2MA 4DG1A 1O1WA 4NLGA 4RU9A 1S77D 3KHLA 3KKSA 2ASJA 3AVMA 4O4GA 3GIIA 3V6HA 1QS4A 5KT5A 4W5QA 3ORYA 2EHGA 1TKXA 2DFHA 5DDMA 4E7JA 1U49A 5DBAA 3FDSA 4ID5A 3HK2A 2P5GA 3VQPA 2KZZA 1KFSA 4PGXA 9ICLA 1YVUA 3RRHA 5KT3A 4CFCA 1ZQCA 4I7FA 9ICCA 3G10A 2NRXA 3QZ8A 1NK8A 2B21A 1MSWD 2XGQA 5KFRA 3QEWA 1S76D 1RT4A 1Q9YA 3AO5A 4RW4A 4Q8FA 4J9KA 2BPFA 2YNIA 4O0IA 3PX0A 3KLFA 1JLCA 3AO2A 1F21A 2ZTCA 2AQ4A 4QZIA 4DSIA 4QZHA 3K5MA 2FMQA 4FS1A 4F2RA 2DFLA 1L3VA 5KRTA 4YD1A 4KLSA 1LAVA 4DF4A 2GWSA 2MAXA 3HM9A 1JXLA 1J5OA 4YR3A 1U48A 3HPGA 4KLTA 3ISCA 3OGUA 2IAJA 3HJFA 4FCYA 4MF2A 5CYMA 4IG3A 5J0PA 4BWJA 2BCRA 3PR4A 5KG1A 1SL1A 4Z6FA 2FPLA 2OZSA 3RH4A 4F5NA 4DU3A 2FBTA 4KHSA 4RT2A 4JV1A 2ITGA 5HRSA 3AU6A 2R8HA 4M6WB 5KT4A 4DSLA 4J9NA 2PI4A 4CJVA 1DTTA 8ICWA 1GOAA 4IG0A 7ICKA 1HQUA 1HYSA 5J2DA 2GUIA 4M45A 4J9PA 3CFOA 1IKVA 5BPCA 1S6QA 3RH6A 2E6MA 1NKBA 4Z4FA 1BI4B 2F1HA 4QW8A 3JYTA 1C1CA 1KTQA 3MR5A 1X9WA 3S3OA 1RBSA 3HSTB 4TSXA 4YN4A 4I29A 4KAZA 3M9NB 4KN7A 1ZQMA 7ICOA 5IINA 4RQ3A 1BCMA 3L3VA 1T3NA 1RTHA 5HHHA 5FRMA 5KFNA 3SUPA 5DGAA 4UB2A 5DQGA 1VSEA 1RDBA 5HP4A 3FYHA 4OJRA 5J0RA 4YXMA 1TKZA 3Q8LA 9ICPA 4KLGA 4FS2A 3HP6A 4IR9A 4DTMA 2FBVA 3RJFA 5C42A 3VQEA 1J54A 4CJLA 4FJXA 2Z1JA 4Z0UA 4DQIA 2R8KA 2YKMA 3DLEA 2MUTA 4DTSA 4RQ0A 3I0SA 5KFYA 1ZQIA 4KHQA 3ZSQA 4F5QA 1KVAA 4YQWA 4OLBA 3QETA 2G8VA 3PO5A 3AA3A 4RZRA 2M9NA 2DPIA 1Y88A 3VQDA 4GLXA 3V6JA 3OSPA 4Q43A 4B8AB 4CEOA 3OY9A 8ICXA 1WSJA 3AU2A 3PNCA 3TQ1A 4QZ9A 4UB5A 4B9LA 1YT3A 3TAPA 4F4XA 2FLLA 4F3TA 3ZSYA 3QEPA 4P4MA 1ASWA 2KFZA 1A5VA 2Q3SA 4RW8A 2V4QA 3RJGA 2OPQA 3L2QA 1ZETA 3V1QA 8ICQA 3LP3A 4CERA 1RT3A 4UQGA 1RILA 3T5HA 2BGWA 5J2QA 1ZQPA 2ZUBA 8ICTA 1JMSA 1H38A 4CIEA 4GMJB 3LPTA 3N4MB 4I2DA 4MQ3A 4ED2A 3JPRA 2OPSA 4CHPA 4M3WA 2Z1GA 4CEDA 1ZQFA 5J0QA 3OYMA 4KLQA 2A1SA 1TK8A 4TUSA 9ICQA 5EWEA 4DQSA 4QOZB 3TAQA 4NCGA 2ISOA 4PHEA 3NF7A 1QHTA 8ICZA 3T5LA 1ZQZA 1XS9D 4M42A 5E41A 4FO6A 2HHVA 2VA3A 1RTIA 1U47A 4KI4A 5J2KA 1ZJNA 2JGUA 4DLEA 4BGDA 5EU7A 3MGIA 2F96A 2OPRA 5D49A 1TL1A 1ZQLA 3UPQA 4N5SA 3QEXA 1NJZA 3AV9A 4KLFA 3JPSA 4ECZA 4FYDA 4DS4A 2QKBA 2HW3A 1IXRA 5D4BA 4DSKA 4E1NA 1TKTA 3OVNA 4NM2A 4ECVA 1XSNA 2O4GA 4CEZA 4ICLA 5DBBA 4XUSA 5J0OA 3B6OA 3PR5B 4KO0A 2XO7A 3GQCA 1XU4A 4CEBA 3DYAA 7ICUA 4RPYA 4IQUA 4G3IA 4HCBA 3ZCMA 4FJ5A 4O3PA 4ZH4A 4KLMA 2ZUDA 3B6PA 1S6PA 3LPUA 4CEEA 3OYIA 3H7IA 3PY8A 4AHCA 3VN5A 4B9VA 2OWOA 4XQ8A 5J29A 1RDAA 1J9AA 4ZTFA 1NJWA 4Z4CA 1JXEA 4ECYA 2I5JA 1SKRA 4Z4HA 3Q8MA 3C6TA 4DSJA 2WOMA 4KHNA 4CEAA 1R0AA 1B9FA 4E1MA 5J0YA 4UB1A 9ICBA 4Z6CA 2XC9A 4NCAA 5J2GA 3JPNA 2YNFA 3GV7B 2YNHA 4E3SA 2VANA 2AGOA 2JZBB 1BPXA 3DLRA 3DI6A 1RTJA 4FJ7A 9ICXA 4KKOA 5DB7A 1JLEA 2G8KA 2DTUA 2PFQA 4CF2A 2J6TA 1B43A 3RBEA 2B4JA 1RDDA 3NHGA 5J2AA 5KG0A 4TURA 3Q8PB 4PH5A 2W9BB 5J2MA 2YNGA 4DQPA 1QSLA 1ZQDA 4GVMA 3DMJA 2UVVA 5J2CA 1S9EA 4DTOA 3ZT2A 4KV8A 2ZUCA 2AGQA 5DMRA 3M8QA 4HUEA 4K4IA 4LVSA 4M3XA 1JLAA 3IG1A 4FM1A 1B22A 3ZSRA 4B9UA 4CHZA 1EXQA 3G6XA 3UQ2A 4AHRA 1QQCA 2ALZA 4W5TA 5J2JA 4E7IA 4BWMA 4KLOA 4J9QA 3VQ6A 3L3UA 5J0XA 4EYIB 5KFFA 4P4PA 5KG3A 9ICEA 1FKOA 1Z25A 3P83D 4J2EA 1ZQXA 2P51A 3KJVA 5F9LA 4LH4A 4F5RA 4FBTA 4Z6DA 3KHHA 2AGPA 5J0UA 2VWJA 3RMBA 3I0RA 4Q0BA 1CXUA 4CE9A 4MEYA 1RTDA 8ICMA 5C24A 1BISA 4IQTA 3DOKA 2HB5A 4FLYA 1JIHA 4FLXA 3ETLA 3N97B 9ICNA 3MAQA 2P1JA 3CG7A 8ICIA 1DGSA 7ICVA 4N76A 4FK4A 3Q8RB 4DL4A 3DLHA 9ICAA 3NF9A 2G8HA 3NE6A 3FFIA 3MFHA 3RB4A 4R65A 4RUCA 4B08A 4QZFA 5BOMA 3L2RA 2XHBA 4RNOA 4ECQA 8ICFA 2BPGA 1QSSA 1S5JA 4DTUA 3QZ7A 4KHUA 3UXOA 5KFDA 4FM2A 3ZT4A 4J9OA 3T19A 4CGIA 2YKNA 4N56A 3ZSXA 4FK0A 1S9GA 3ZT0A 7ICEA 2YHBA 3MABA 3K5OA 4KLLA 1S0NA 3AVFA 3PX6A 3HWTA 3ZT3A 3NF8A 3SUQA 8ICRA 3EW9A 5IIMA 1BL3A 2BCUA 1SL0A 1A76A 1LW0A 4W5NA 3GV8B 3V9ZA 5DQIA 2JEIA 3JPTA 4HCCA 1AROP 1HQEA 4M0AA 1LB2B 4PHAA 1NKCA 4DWIA 3H4DA 1ZQTA 4NM1A 3RB6A 4M3RA 1XI1A 5HRRA 1NOZA 5JS2A 1IKYA 1C0UA 4CCHA 3U6FA 3V1RA 3TWHA 4LY7A 2PXIA 4FVMA 4OKKA 4QWEA 3OS1A 3T3FA 1ZQWA 4IR1A 3QE9Y 3K5NA 1HPZA 1WSGA 3SUOA 3HXMA 4OKEA 4CJTA 1RZTA 2F1JA 5DLGA 3QNOA 4ED7A 1UWBA 3QEBZ 1N6QA 1MQ2A 4AILC 5CR0A 2X6NA 3ITHA 2YV0X 4UBBA 4C8KA 4AHTA 3MEDA 4ECSA 4QAGA 4UAYA 1UA0A 4M6WA 3BQ2A 3TI0A 4I2JA 5DLFA 4OGEA 3KIOA 4YMNA 4ED3A 5TZVA 4RQ8A 3M9MB 3PW2A 4O5EA 4M3UA 3OJSA 5L1KA 2W8LA 4PA1A 4RG8A 1T4GA 2VA8A 1WN7A 4OPJA 3S9HA 3PO4A 4EZ9A 2RKIA 5KT7A 2LYHA 3IRXA 5J0WA 4YMOA 3U3YA 1BI4A 4Q8EA 3HYFA 3ZD9A 4IRCA 4RW9A 4NLKA 1ITGA 9ICGA 4QWAA 3L2VA 4I2EA 1RBVA 2DFEA 1J53A 3VA3A 4ZTJA 4F4KA 4IKFA 2OYQA 1TK5A 5KFTA 4RQ7A 4Y1CA 2ZJ8A 5CB1A 2G8FA 3ZDDA 2C2EA 2D0AA 2RN2A 4OGCA 1QSYA 4M2YA 1RT5A 3V9SA 2F8SA 4JUZA 4CGJA 3BQ1A 2XRIA 1EX4A 3K59A 3TR8A 1NK4A 1A5WA 4EYHB 1U4BA 8ICVA 3NH0A 3V4IA 1TAQA 3HX0A 2KZ3A 1A5XA 4EZ6A 4M47A 4GC6A 2W9CB 5KFEA 1CEZA 3K5LA 2DFFA 1XSLA 4I9QA 3C2KA 3ISBA 2PYLA 4K8XA 1K1SA 2NRVA 3NDKA 2HMIA 3M8RA 3OYNA 3LAKA 3OYGA 4RNMA 3H8WA 2ZTEA 4FLVA 3OYFA 3ZSWA 5JS1A 1Z00B 2A1JB 2FBXA 4YFKA 3U3GA 4CFBA 5CYQA 1RYSA 3KLHA 5KG5A 4QWCA 3SZ2A 5KFBA 4KB0A 5DB9A 4CJSA 4YP3A 4CFAA 1A77A 1RT6A 8ICOA 3LAMA 3LANA 4DTNA 2Z1HA 2C2DA 5J0TA 4PGQA 3O4QA 2JEGA 1K1QA 3PVXA 3LDAA 2FLNA 2PI5A 5J2NA 2IBKA 3EYZA 4UB4A 3SJJA 5DG9A 2O4IA 3D0PA 2JLEA 3IS9A 4H4MA 4M3TA 5T7BA 3V72A 2BHNA 4NY8A 2VG5A 4CGHA 1HYVA 3C5FA 4F5OA 3MEEA 3QEAZ 3V9WA 8ICSA 3QEIA 1KSPA 1I3AA 2YHAA 4PUOA 2PFNA 3AUOA 4IFVA 3AVNA 1KLNA 1UA1A 2XY6A 4DTPA 1EP4A 3K57A 2X6SA 2IC3A 4MFFA 4CJ4A 3C21A 9ICRA 5CHGA 2PZSA 2UVWA 1ZQUA 2VG6A 5I3UA 4DQQA 3ALYA 2R8GA 3OHBA 4B9SA 1WCLA 4DSEA 2ZTDA 2IGIA 3SI8A 4F50A 5L1JA 8ICKA 5KT6A 1W0HA 2E4LA 1CZ9A 1WSFA 4O5KA 9ICJA 5CA7A 3ZDAA 3SUNA 5J2FA 3H40A 3RTVA 4J2DA 1BPDA 3PW0A 3TANA 1TV6A 4FZZA 1D9DA 9ICIA 2IA6A 4FM0A 5IIIA 9ICOA 3DRRA 4KPYA 3HT3A 4QZCA 4LH5A 2IDOA 4YG2A 1XHZA 4Z4GA 1RYRA 3CYMA 4ED1A 3UQ0A 1N48A 2BCSA 2HHWA 5HLFA 4BXOB 4B3OA 1RT2A 5DQHA 4RUAA 2QXFA 7ICMA 3WNEA 1RBRA 3MGHA 4CF9A 3GIJA 3V9XA 3ASMA 4I2HA 1NK7A 4DQRA 4KLUA 3AVLA 3HVTA 1VSDA 3ZDEA 3L8BA 2RPIA 2G8UA 1Z26A 4LSLA 4FLTA 1S0VA 3HVRA 4O5BA 5J2PA 3OS2A 1XSPA 7ICIA 2JEJA 4QZDA 2VG7A 1SKWA 5KG6A 3HPOA 3THVA 3VA0A 4CHQA 1ZBLA 2HHSA 2JZBA 3C2LA 3V7KA 5DG7A 1KRPA 1T03A 1ZQNA 4M04A 4I2QA 3V7JA 3JPQA 4O44A 1TGOA 2QK9A 4GXJA 1ZQOA 3AO1A 4JWMA 9ICTA 1JLQA 5KGXA 3V6DA 1UT5A 2W9BA 1VRTA 3VQBA 8ICCA 5CJ7A 2BR0A 1IO2A 1DTQA 3H08A 1ZQKA 7ICNA 3F9KA 3ZSOA 5HP1A 4DOAA 2D0CA 5DGBA 1BPZA 4Z4EA 2D0BA 3D45A 1WSHA 1S9FA 4PPXA 2F1IA 4EBEA 4JV0A 1S0MA 4PHDA 1BVSA 1COOA 2V4RA 2NRTA 4ID1A 3L2WA 1ZQSA 2IS3A 3AVBA 4PHPA 1S10A 1CUKA 4PWDA 1D8LA 1TKDA 3VQCA 2W9AA 3SPZA 1ZQVA 3EPIA 1KVCA 3MR2A 2KQ2A 1L5UA 3PV8A 4OLAA 3SV4A 7ICRA 1ZQGA 3T5JA 1KFDA 4CK1A 3QO9A 4HUFA 3AVKA 5KFVA 5EWGA 4UB3A 4OVLA 2KTQA 2X74A 3H8SA 2AJQA 3PX4A 2NRZA 5KFHA 1Y97A 4K4HA 7ICQA 3NH2A 3IHQB 1EXNA 2BPCA 7ICLA 2KW4A 4O0JA 3WNHA 1YTUA 3ULDA 4M9GA 4K4GA 3AVJA 3O3GA 2R7YA 3SQ4A 4C8MA 4FW2A 3AVCA 5J2HA 7ICJA 3K58A 3I8DA 1T05A 4EBCA 5KFZA 5J0SA 4E89A 3JSMA 4CF8A 4CJQA 3JPPA 4F4YA 4C8OA 2HVIA 5K14A 1ZQBA 4M3YA 4BDYA 1JX4A 3UIQA 3AVAA 3RR7A 4F2SA 1X9MA 3G6VA 1RBTA 4DFMA 1NKEA 3AVHA 4OPKA 4O3NA 4RQ4A 4PY5A 1WSEA 4GW6A 5D3GA 4ED8A 5KG4A 5KFSA 4HYKA 1HJRA 5CY4A 4J9SA 4L8RB 1S1TA 1IKXA 2AQ0A 1HMVA 4FJ9A 3MECA 4F91B 3CQ8A 4J2AA 3P1GA 2ZJAA 3RBDA 3ZSVA 4RW6A 2P6RA 1HUZA 1VSMA 4CJRA 3V9UA 1ASUA 8ICNA 1VSIA 3TAEA 3HW8A 1ZQAA 1HNVA 3E2EA 1HUOA 1LWCA 3B0YA 3UXNA 4JWNA 2IMWP 4IRDA 3E01A 1X1PA 4DU4A 1ZJMA 2WTFA 8ICUA 2RF2A 3AO3A 5CZ1A 2G8WA 3DRPA 4JV2A 3M9OB 3AA4A 5IIKA 7ICGA 3KLIA 4O3SA 1PZNA 4BE0A 1QLNA 3OJUA 5CWRA 3SPYA 1RT7A 7ICPA 1TK0A 5HNKA 3TAMA 3EWAA 4M9NA 4LD0A 3BGRA 4DTXA 2OZMA 4YFUA 1LAWA 4IBNA 3LWMA 3RRGA 5KGWA 1IM4A 2PY5A 2ZD1A 4IQWA 4UAWA 2ZJ5A 4CK3A 4RQ5A 1HNIA 5HRPA 1KEJA 2BQRA 4B8CA 4CJ3A 4ECXA 2ZE2A 4XA5A 3KHGA 2UVUA 3DLGA 1C1AA 1JLFA 4FZXC 3SV3A 5J1EA 2UVRA 5KFPA 2HVHA 4I2FA 1ZQYA 3CFPA 1VK0A 4TUPA 1TAUA 3OYDA 4F92B 3LDSA 3NF6A 4R66A 2Y1IA 4J9MA 1C7YA 2FLPA 2BE2A 1GOCA 4UBCA 1QE1A 3DLKA 1ZQEA 3LZIA 4CJFA 3S3NA 1S1UA 4E19A 4QWDA 1BGXT 3OHAA 5HBMA 3QNNA 1LWEA 1KLMA 3RJIA 1ASVA 4KN4A 3VQ5A 9ICKA 4J2BA 4W5RA 1FXXA 4HUGA 3PW5A 4O5CA 4FJJA 4YCXA 1ZBHA 3OYEA 4O3OA 3JPOA 4YNQA 2W9CA 1L3UA 2G8IA 3RJEA 1UT8A 4Q45A 3TAFA 1DLOA 3TARA 3TFSA 4J9RA 1FKPA 4B9TA 4FJHA 4N47A 4HHTA 9ICUA 4KI6A 4QZ8A 4O3QA 2WONA 2P66A 4CF0A 1Z00A 2A1JA 4R8UB 1T7PA 5J2IA 3K4GA 3ISNC 3DLBA 1XC9A 2BCVA 1VSHA 4TUQA
chains in the Genus database with same CATH superfamily
5C2FA 1I1GA 3ZSZA 4U7CA 4M3ZA 3BKUA 2DJWA 3HHEA 4JS4A 1REVA 3V6KA 1XR6A 3AVGA 1CQMA 4R5PA 5J1EB 3CCRS 4FO0A 3AVIA 4WFNL 4ENOA 2G13A 4FJKA 2GV9A 3NGYA 3IBWA 4F0KA 4X2BA 3QERA 1L8OA 2ATQA 2ZQBA 3NAIA 3KUHA 2UXBF 4Y2CA 1R31A 3DN9A 2DNZA 3OYAA 3TW0A 4Q44A 1C6VA 4H0XB 2P6UA 4DR4F 2KU7A 4K4XA 3OTOF 3M32A 3IFRA 2IM2A 3N4QA 1AT1B 4NLNA 4Z4IA 1LWEB 5AXMA 3LP0B 4CECA 3AQOA 3IV6A 2WB4A 2V5HG 5M1OA 1GXLA 1Z19A 4WJBA 4BE1A 1X31C 3RG6A 3GIKA 3AA2A 2ASLA 3RGIA 4CHYA 1RWUA 3KK1B 2DY4A 4I2AA 1SJQA 3RJJA 4CJ5A 2IVMA 1QH9A 3GBTA 3VQ8A 3QWPA 3UDEA 2OHDA 1FJGJ 2YHWA 5AKZA 1ZBSA 4O4GB 2FVPA 4MK9A 2DGWA 5ALUA 4NXZA 5B0FA 4G1PA 4LZGA 4KR0B 2GHPA 1RAIB 4OI3A 2EBEA 1VYAA 2QLTA 1TKXB 2J9DA 4ID5B 4HVJA 3M2UA 5FRNA 3WX8A 3OYLA 4C8YA 4PZNA 3UMGA 3T1YK 3QDKA 4KHWA 2V8GA 4L3KA 4ZVTB 2DHXA 4HVZA 3O4NA 2J6UA 5IQQA 3EDQB 3SNNA 3TA1A 2AMCB 2C2MB 1JXBA 4GXIA 5C12A 3NBPA 1S1VA 1GNKA 1N5YA 3M6KA 3RB0A 3W64A 1PGZA 3F73A 3TADC 5KFIA 3GFKB 2M7SA 4LBHA 2XY8A 4M9HA 3C95A 4DTRA 3ZYYX 2EWHA 2R7TA 2DPNA 2DNPA 1WAJA 4LVNP 4P7TA 2W4DA 2AU0A 2E6LA 5KFJA 2W2MP 3PDNA 1FJCA 3IMXA 3FSXA 4I67A 4O8UA 1AYEA 1RLDA 2GIRA 4FJIA 2HOEA 4NCBA 1N0UA 5IQ6A 5CYMB 1VQPS 4DCCA 1YDLA 1Q86O 3FSIA 4K2XA 1FERA 3MEGA 3CD0A 2B6AA 5J2EA 3AA8A 2E5SA 4U96A 5G0RB 2NRHA 4C1NI 2GVZB 2R8JA 3DEEA 4FPAA 4KRFA 1RLCL 8ICBA 2ZH3A 3LGMA 3KFUF 1HQUB 5AJ3J 1OSCA 5I4MA 3UNGC 4H4OB 1LW2B 3ILLA 1LV5A 1TFRA 2YWGA 2DITA 1J97A 2HOIA 4P2HA 2Q0RA 3UD4P 4CJ7A 3V81B 2EEYA 2KYZA 1WG4A 2YBVA 4HKQA 3JTNA 5EOYA 3HSJA 1ZBUA 3VEYA 3F53A 2CYYA 4KREA 1JXVA 4CLTA 2P9UB 2X1FA 4FWRA 2HNDA 4MEXA 1BQNA 2YQEA 4JKBA 4F4ZA 2HBYB 5BYSA 3QWUA 3AAQA 3GFHA 3BV8A 4MK7A 4X64K 2ZEJA 2HNYA 4OX7A 2DRBA 1F1BB 2HCFA 1IVZA 4AQYJ 3Q23A 3BP8A 1C0TA 5KQ8A 4JI8F 4AE5A 4ZIWA 3QUTA 2XQCA 1EZZB 5BPMA 3Q0AA 2GLEA 2CJXB 2OTJN 2L9NA 3SCLE 4DDFA 1JRPA 4KB1A 2W2PP 4LREA 5CCMA 1RAJA 4FLWA 1TELA 2CPZA 4IH5A 3FFKB 2FMPA 1RQ0A 4OJOA 3RB3A 3ZD8A 3CHWA 5AI8A 3R9LA 1KDHA 2E8MA 4K8ZA 4BRCA 3VVTA 2XZDB 5HHIA 4DV5J 3M30B 1HKBA 2FJXA 3MTJA 2L3MA 1BNPA 1U7LA 3M8PA 4TLRA 5AXKA 4YOTA 3O6WA 4O3RA 3Q8SB 3CT9A 1T9YA 3PUFA 4RUBA 5IV3A 4M5KA 1VSFA 1SB3C 3C94A 3F41A 3RAMA 1XN9A 2IOCA 4BR0A 3MUTP 1F5BA 1ZQHA 4YVZA 3NCIA 1SKSA 2RRNA 4K8RA 8ICLA 3RBXA 1JL1A 1S1WB 4CK2A 3MXJA 1EETA 5DKWA 4DOBA 2KJ5A 1Z4OA 1VDVA 5KG2A 3AB2B 4W5OA 2VGNA 3BSOA 5KFXA 1TR0A 4KTZA 3PKMA 5ETVA 1DEJA 3BZKA 4C4WA 1UAWA 2AD9A 4RTFD 2E2NA 3EY1A 4LZDA 2B9WA 8AT1B 4WFAL 5A2QO 2KN7A 1Q8IA 3PW7A 2JGAA 1QUPA 5ETMA 4AHSA 1RJJA 5EWFA 2W3SA 4F8RA 5EOZA 2NUBA 2IRXA 2RQ4A 4K4YA 4FLUA 3GIMA 4B9NA 2IBOA 2H5XA 3I33A 2RE2A 1CJUA 2H65B 2GWJA 4PHTX 3NTUA 2IPOB 4AM7A 2XMUA 3RMDA 4CGFA 4DEZA 2PT0A 3OVAA 1RKIA 1CZBA 3JAMU 3RYLA 2DGZA 2C3YA 1Q8LA 2Z56B 2KZMA 4C7ZA 3WC2A 3C1YA 2H5IB 4RPXA 1JJ2R 5FPMA 5LOQA 2HS0A 2OSRA 4WP9A 4FW1A 4DOCA 1SH0A 1M90O 3G96A 3LP2A 4GY2B 1NO8A 2P9EA 2GX8A 3HVWA 1PJ6A 2GC8A 1BCOA 3CO0P 2XHWA 5KFAA 1Z3EB 3KTQA 1TVRA 3CCMS 3D0GE 4IDKB 2Q3PA 3RH5A 1ZXOA 2ZJPQ 1Q53A 5KFCA 3RMCA 1RQNA 4JKEA 5G4DA 4ZVGA 4CJUA 2MTLA 4ZP9A 4C11B 4BCAA 3H42A 3I5CA 4UW9A 2CGJA 1QY7A 5JTIA 5HRNA 3NVZA 3OVSA 2DISA 4DL5A 4XDCA 2P9SA 4DV4F 5KFOA 3M1VA 1M1HA 4YMMA 4HR2A 2Q79A 2FPKA 1L7OA 4PGYA 5U47A 3CMAN 4MFAA 4A8QA 3NS7B 5HMLA 2I1QA 3KLEA 2XY7A 4KLDA 5C10A 1OIAA 4DR7F 2OEHA 1YG0A 3D2WA 4F5PA 3AB4B 4ZPBA 1QQ7A 3IM1A 2IJNA 3AH6A 4Y6IA 4H4KC 3LP1A 5EN1A 2MMYA 2XS2A 3UWTA 1N0VC 4A8OA 1RXVA 3DMJB 1FJGF 1I5OB 3L0QA 3NRWA 1RDCA 1NZPA 4KFBB 3CDBA 3D6MB 3AJ2A 3MM6A 1CXQA 2DR8A 3MDAA 1O5JA 3IG1B 1FWKA 2DHAA 1KAXA 4MFBA 2IJFA 4JKDA 4Y2VA 1NK5A 3C3LA 5C25B 1M5SA 2GMHA 2X3DA 1VQMN 3MTKA 2AW0A 4B17A 5LY3A 2RJZA 2CA9A 4QIGA 1FKOB 3R9PA 2EAMA 1KQSR 5BRHA 3MMCA 2OPPA 3F44A 2UV8A 2XMJA 1D0EA 4QWBA 1SUQB 2H3FA 4HACA 4HTJA 5EX3A 2W9MA 2LEPA 2FYXA 4N41A 5B0EA 4J5OA 3MXIA 1DXSA 1OYDA 4DL7A 2HLUA 4KLHA 2E20A 4RQ6A 3PRDA 4JKHA 3C23A 1U2RA 4KHPK 2J7UA 2Z30B 1M5OC 4PKIA 3T1AA 2E1CA 2JVOA 4Y1DA 1T9VA 5T14A 1KVKA 4BE2A 2QC3A 2CVIA 2P9LB 4XH1A 2W54A 4YXJA 4DG1A 1O1WA 4NLGA 3KHLA 2E9ZA 4NRUA 2MQQA 2LDYA 1MMNA 5CQGA 3GIIA 4C4SA 4HL9A 2E8PA 3OFEA 3ORYA 3VMFB 2KOBA 5DDMA 4NLDA 4WYLA 5EX0A 2RRBA 4P9SA 3DLLQ 1RWVB 1YVUA 3RRHA 4Z37A 4JAXA 1PKUA 3G10A 2R7SA 1HD0A 2P9IA 1NK8A 3TVZA 4K4TA 1S76D 1U0HB 3AO5A 1RXOB 4RW4A 1VBKA 3HVAA 2BPFA 3W8PA 2YNIA 3CMEN 1JLCA 1T9XA 3R7BB 3ZC4A 4MKBA 3K5MA 4JI2K 2LVWA 5HMWA 4YD1A 2FQQB 2W7AA 4BC5A 1NU4A 3DV9A 3VVUA 5AZJB 3S8SA 4YR3A 3D7SB 1H1VA 3OGUA 2NYHA 2M8DB 4A8XA 1TYQB 3KXDA 2JJ4D 3QX7A 5ALVA 5L38A 3TZYA 3SBTA 3AQPA 2VOOA 4IG3A 3DWLA 1N6QB 1J2MA 3BSCA 2Y1LB 3ITHB 1SL1A 1RISA 2OZSA 3C28A 1FIQA 4CLSA 5A6WA 1OXJA 1DHMA 3MEDB 3O1BA 4XH4A 4JV1A 2GVDA 4QPTA 1VQ7S 2R8HA 2AWZA 3KVGA 1X4DA 2RS8A 1K9MT 3WXMB 1DTTA 1X6IA 8ICWA 1W7WA 2DUYA 5AXLA 3ZZTA 2DB1A 1ED1A 2VQEK 1QAYA 4M45A 2LBOA 3R5JB 4PL1A 1ZD2P 3IRXB 1OKJA 4PWWA 4DV1J 4Y2RA 3SK3A 5ETNA 5ALJA 5HQLA 2HFSA 3JYTA 2KHVA 2KT5A 3K0JA 4C2MA 1R8AA 1KTQA 3MHYA 4QPXA 1MWKA 1NDLA 2J8SA 4I6AA 5AKKA 1PYTA 4AL5A 4F71A 4TSXA 4KAZA 4DV7F 2VKRA 1N88A 3KNAA 3MN9A 2BOPA 4ILHA 1BCMA 4C4RA 1T3NA 4FNIA 3CCES 1T44A 5L9NA 4C7QA 3SUPA 5DGAA 4RUHA 1IIPA 4GVBA 2DGSA 5F8HA 4OJRA 5J0RA 2RLTA 4YXMA 2LMIA 2HHHJ 3M5RA 3AQEA 9ICPA 3V2UC 3CCWA 1BO5O 3RJFA 3CF5Q 5C42A 2KM8C 2DVIA 4DKWA 4NXMJ 3CMQA 5JVHL 1RG6A 1U1PA 4A8FA 4MTPA 3AFGA 4DR3J 2Z1JA 1NSKL 4DQIA 2HPUA 3H1VX 2MUTA 4RQ0A 5CYJA 5KFYA 5CYQB 5FPEA 4OLBA 1S6QB 1YVFA 1G4CA 3UCGA 4C0OC 1HEKA 1Y88A 2DPIA 4ZPAA 4GLXA 1NGIA 2JH3A 3MWPA 1HA1A 1WWVA 4MK8A 8ICXA 1SJ1A 4URGA 3BR8A 4CO4A 1C1CB 4QZ9A 4UB5A 3WK7A 1ZRMA 4F4XA 1A7GE 1UWAA 2FLLA 2MLZA 3ZSYA 1O13A 8ATCB 4A2BA 4ZCMA 2JHDA 2L08A 4OLPA 4YOXA 2OPQA 3L2QA 4CYUA 4K25A 1ZETA 1RTHB 3C65A 3JS9A 3ULEB 1RAFB 4PJ0U 4B02A 4OYMA 3T5HA 4DXLA 1ZQPA 2CH6A 1Y64A 2D3ZA 1H38A 4CIEA 2E5HA 4X84A 1X40A 3IKMA 4U6PA 3LPTA 1W2BR 3J81Y 3BF1A 4PQAA 4US9A 1DQ9A 4M3WA 5AI4A 3CPWR 4Y2IA 2VPZB 1ZQFA 2QWOA 2IIRA 2ZIUB 2EFNA 2WAQD 3U1LA 1YITN 2LU1A 1YZ7A 1SZHA 2ZM6K 1VHXA 5EWEA 4DQSA 4QOZB 3EZOA 3HTVA 3PRBA 4NCGA 1KOOA 4USJC 1ICEB 1QHTA 3DLJA 2XYHB 1TL5A 4M63A 4OJ5A 1XR7A 2WVFA 4UT4A 2VA3A 3SAHA 1U47A 2G1HA 1HL6A 4BGDA 2LEAA 2BYCA 3CCSS 1IUJA 1RCXB 2Y0SF 2F96A 1XNQJ 5D49A 2F7TA 4AXIA 2IM3A 1TL1A 3SENA 1ZQLA 2MA1A 3MN7A 3R6GB 4WXWA 5CD4H 1SV4A 2DY1A 1DK3A 4KLFA 4ECZA 5C0YA 1JUDA 2DWQA 3WKEA 3TJ9A 1IBLK 5HANA 1IXRA 2HW3A 1X5PA 2Z8QA 4DSKA 1TV6B 4E1NA 4C4TA 4HTLA 3OVNA 2QB0A 2AYMA 4NM2A 2M5YA 1XSNA 2I5HA 5GTHU 2F4VF 1X6JA 1LEOA 1E6YB 2IIHA 3PR5B 3B6OA 1XU4A 3O9UA 2QL5B 5AQHA 3DYAA 4V19J 4M5JA 1NHKL 7ICUA 3D6RA 2P6SA 4MO4A 5HLFB 4G3IA 1RBOB 2MKYA 1HARA 1NJIO 4A46A 3ZCMA 1DARA 2ILZA 3B6PA 1S6PA 4DV0F 1SCJB 2DNLA 1YTYA 2WW8A 2JRZA 4KT0C 2O8FB 2G0CA 3VN5A 3UNYA 2E1MC 1RDAA 4ZTFA 1B4FA 1JXEA 4ECYA 4LSLB 1KHWA 2G06A 4USIA 5G5HA 4KHNA 1TU0B 4OYZA 4CEAA 3AD9C 4JHDA 5J2PB 2CQIA 3BYPA 5HR6A 3BKFA 1D4XA 4NCAA 2YNFA 3EE3A 4OJ1A 2F4FA 4E3SA 2AGOA 3DLRA 3MDQA 3UD3P 3KZIU 2KXHA 4BR5A 2A2CA 4KC5A 1T03B 3QUBA 9ICXA 2HKEA 5DB7A 3DXSX 1WKJA 5BR8F 2G8KA 1HBOB 2PFQA 3PSPA 3I8BA 2PA8D 4CF2A 3B4DA 1MROB 2IM0A 2B4JA 3RBEA 1RDDA 3VEWA 1JLQB 1UKUA 2EZZA 5J2MA 4KO0B 3J80O 5JLHA 1X9JA 2APOA 2Y3YA 2DXEA 2HURA 3IM9A 1FX4A 4A47A 2Q2RA 4DTOA 2HAFA 3CQYA 4PR6A 3NOGA 2AGQA 3FZLA 1H72C 2G9OA 4M3XA 1YBTA 3QJLA 3ZNJ1 1A6LA 3ENHA 2UXDK 3CDWA 4PWDB 4I0WA 4B9UA 1FRJA 5EVZA 4CHZA 1S72N 1N5VA 1EXQA 3I87A 3G6XA 3WEEA 3BM7A 1MWMA 3O9RA 4KLOA 2D4WA 3SQOP 1QUVA 3R7SB 3VQ6A 4S0MA 3KDOA 4X4UA 2NSCA 3O1WA 3CEDA 1X42A 5H1SV 2GMLA 3L3UA 2ZJRL 4BG9A 5J0XA 3CJ4A 5KG3A 9ICEA 2I0XA 3THXA 3P83D 1DFDA 2P51A 5F9LA 4LH4A 3QRPA 4F5RA 4FBTA 2YNHB 3BS5A 1SGGA 1UVKA 3FC4A 4NEYA 5AZIB 1RTJB 2KSOB 2FJEB 4IQTA 2HB5A 4FLYA 5B08A 4FLXA 3MAQA 1XMBA 2P1JA 3CC4N 3MK6A 1DGSA 3B4MA 3H5YA 4LFCF 2WB1D 1E6VB 3BGUA 2DH9A 4B3RF 2YNGB 2G8HA 3FFIA 3IMQJ 3MFHA 3RB4A 2MPUA 1GX6A 3L2RA 1U2VA 1Q18A 1LXNA 1G6BA 1S59A 2BPGA 2HFOA 4KY3A 3N4WA 1S5JA 3QZ7A 3W2WB 2NREA 1FRHA 3OFGA 2HWHA 5KL1B 2HBQB 4BRPA 1NGFA 3T19A 3QFWA 4NJ8A 3PSIA 4QS9A 4URQU 4CGIA 3W5YA 3PLAA 4G6VB 4OYIA 4N56A 1NI3A 1LCUA 1TUYA 4ER8A 1PUZA 1SWVA 2FTRA 2IDEA 3MABA 1HR0J 1RM6C 4X4OA 4QJVA 3NVYA 2MKSA 3NF8A 1YZ6A 2BCUA 3TO8A 2O5DA 5GAEI 2K60A 5DQIA 2JEIA 1XMQJ 3E9PA 2KFYA 4ZPTR 2OELA 2YHXA 3CJTA 1LB2B 2CVEA 1NKCA 4DWIA 3H4DA 4ILMA 2YH0A 4FYXB 1PG5B 1ZQTA 2CPXA 4NM1A 1Q7LB 5HRRA 1PK3A 5JS2A 1IKYA 4PL8A 1C0UA 3LM2A 4CCHA 3TSPA 3QAUA 4LY7A 2PXIA 1LWCB 2EC0A 1EHWA 3T3FA 1ZQWA 4WZMA 3QE9Y 2FC9A 4KYZA 3VAHA 3OTEA 4ED7A 4ISEA 4Q2MA 1VOMA 4FWKA 4CLFA 4AILC 1FTRA 3RZAA 2FC8A 2YV0X 4C8KA 2VFVA 4AHTA 4YHHK 4QAGA 4DR3F 3TI0A 3HZ6A 4NB4A 3CCJN 5FPDA 3KIOA 5DM6L 1S9GB 3PW2A 3IR5B 5ALYA 2FIUA 5K20B 1IJFB 4FF2A 3ENOA 2GOLA 1T4GA 2VA8A 5LMNK 5BN8A 5AKYA 4BY9C 4EZ9A 1I3OB 1UW4A 1OPZA 3UD5A 3PSTA 1VR6A 5HVHA 4DV6K 2AP6A 2AEJA 3KWMA 2JV3A 4KRWA 3U3YA 4OV1A 4DUTA 2I1RA 4IS7A 1FNMA 5HMZA 4RW9A 4GKJJ 2Z0GA 3W2VA 3VERA 3L2VA 1RBVA 3VA3A 4ZTJA 4FF4A 1M5HA 4F4KA 3FGUA 1VFJA 4NLTA 2QXLA 1TK5A 3BBBA 2YB4A 1SPBP 3BPSP 3G6ES 4ZVRB 1JALA 2D0AA 1HPZB 1BWEA 4CGJA 3K59A 3HCXA 3SDEA 1NK4A 4TNOA 1WC4A 4RPFA 4KGXB 4EYHB 3NH0A 2KZ3A 3ENAA 3B9JA 3A8KA 2W9CB 3QNWB 3D3BJ 5KFEA 2A3JA 4CF4A 3K5LA 3H0LB 2BUPA 2DFFA 3ISBA 1DLOB 1NBWA 1K1SA 4CLZA 5ALQA 2VBZA 3QSYB 2YQ3A 2HMIA 3M8RA 3OYNA 3FZ2A 4RNMA 5H2FU 2HVEA 3OYFA 4OYOA 4FN5A 4NI2A 2ALYB 3NVKA 5H9EK 1NDCA 2MHEA 4DX8H 2MY7A 5KL8B 3SZ2A 1URJA 5KFBA 1KC8T 5DB9A 3CIMA 3CJQA 4DUYK 4IFYB 4G9ZA 3VAIA 5M1QA 3LAMA 3NGSA 3WT0A 3DXKA 2OANA 3CJ9A 2C2DA 5J0TA 3O4QA 3MI7X 4LF2A 2YWFA 4TU7A 5H9FK 2OAUA 3KMSA 2IBKA 3D2FA 2FI1A 2HNZB 3MCSA 2PFDA 2CN1A 3GL1A 4C6AA 3VAKA 4NPOA 4WYBA 5T7BA 3LDNA 4B3TF 5K8PA 1HHQA 1HYVA 3LOUA 4OI4A 3MEEA 4CLUA 4GKKK 2AYBA 2XBPA 4A8SA 3QEIA 2LU2A 2NO5A 1I3AA 4CZFA 4H5WA 3A8JA 2GELA 2HBZB 1Q82T 4EGLA 4DR1K 3AVNA 2HZVA 3WK8A 3CP8A 2XHCA 1UA1A 2XY6A 3V5RA 2QLBB 2LDIA 3DNCA 1GFWB 1EP4A 4LF1A 3UB5A 5CHGA 2PZSA 5I3UA 5AM4A 4CLPA 2Q31A 4D3HA 4KH0B 4PXBA 1RAAB 1GQEA 2IYIA 2O8EB 3AMZA 3O08A 1T9TA 2BE9B 3P6YC 4UASA 4PYAA 1W0HA 1S6OA 5E79U 1ZM2A 4O5KA 3EE9A 5CA7A 5J2FA 2WHEA 3RTVA 2EZYA 4M7XA 4UUXA 1FWPA 3SSQA 3PG9A 4PCQA 4XEIA 2W6KA 2IA6A 3AXKA 1RBLA 2ZNYA 5IIIA 9ICOA 2F1FA 4MIAA 1LQ9A 4PXDA 4CZGA 3HT3A 1WG8A 2IDOA 3QT7A 1XHZA 5AKLA 3GDQA 4PUOB 3CYMA 3UQ0A 2HQFA 2HHWA 3NS6A 1R27B 4ZVFA 4PQUB 4BXOB 3T1YJ 1RGIA 1RT2A 1HJOA 3W8GA 5DQHA 3DCAA 2MQ8A 3VF0B 1APSA 4R0JA 1RBRA 3CJBA 4JMUA 3GIJA 4Q7AA 5ITHA 4CP5A 4HI2A 1NK7A 4DQRA 2DNGA 4KLUA 3GG4A 1IR0A 4FF1A 1NM2A 1KKXA 2XSJB 4LF6F 4M95A 4UY8O 2V51B 3HVRA 4A8MP 1XR5A 1J6ZA 4O5BA 5E0OA 3OS2A 3RJMB 3WK5A 1SKWA 2GAHC 2MKHA 4OJHA 4B1XB 1U0SA 3VA0A 2HHSA 2JZBA 3C2LA 4YOVA 1KRPA 4A8WA 4M04A 2ZBIA 2A3ZA 4LFBF 3QRRA 4JKGA 4RJVA 2IVFB 1M1GA 1QQ6A 1RFQA 4GXJA 3VAJA 2G2OA 2QL7B 5ALOA 5KGXA 3AY9A 2W9BA 2XZWA 1T0TV 2HOFA 2ZOMA 3DRRB 5CJ7A 4K2JA 3WQPA 3D2NA 2VPXB 3ZSOA 5HP1A 2R7RA 3PHEA 5DGBA 1BPZA 3D2EA 4Z4EA 4IOBA 2D0BA 2NYIA 2WRMA 1U02A 1YVNA 2RS2A 2LXFA 4HEA9 2H3GX 5KNIA 1S0MA 2J9DE 4OZNA 4USMA 2D1KA 1YJTA 3MGVA 1TL7A 1ZQSA 3IM8A 3J7YU 1TKDA 4B1ZA 2W9AA 4OZ2A 3BEXA 3PIPL 1YX2A 3ICLA 4KGMA 1KVCA 2KQ2A 3ZETA 3PV8A 4BS2A 7ICRA 2MZRA 2PMHA 3T5JA 4UB3A 5AQVA 3H8SA 3MUVP 2YQ1A 1YRTA 3NRBA 1TTHB 3FZHA 4P75A 4DV2K 3IR6B 1S3XA 4KHRA 3DGPA 2FF3B 5JU5A 3POTA 1Y97A 4K4HA 5AK5A 4PKDB 4B3MK 3IHQB 1ELOA 1LWFB 2ZXIA 2BPCA 4JI6K 3FRYA 1VBXA 3Q7CA 2XSFA 3O3GA 4C8MA 4O44B 1D8ZA 1H2TZ 4USUA 1KVIA 1VIXA 3BEGB 2FSKA 1FD8A 1NWKA 4QR1A 3GZFA 2EVZA 1N36F 4X64J 4BUGA 4PAAA 3D68A 1T05A 3I8DA 4OYAA 5AQIA 1DK2A 5KFZA 1DTQB 2HOQA 1OUQA 3JSMA 3A5NC 1ITPA 1FFUA 2JMGA 4WTOB 1UJ5A 3SXLA 2UUBK 2QA4N 4NZ6A 3RR7A 2B7BB 2MJUA 2DNRA 1WEZA 3QU7A 3J81U 1NKEA 1TMMA 3UKUA 4OPKA 1RADB 3KLGB 5SUHA 2NYVA 1SS6A 3OXLA 4RQ4A 3HHLC 2YTUA 1BWVA 2C2OB 1WSEA 4IQMA 2A40A 4TLQA 1GXUA 2E1PA 3UI3A 3HFVA 4OZ1A 5L39A 4CRJA 3J81j 1KTVA 9RUBA 2F7VA 1HJRA 4ZPDA 1WJ9A 4BC3A 4J9SA 4WCEL 2M52A 2AQ0A 5AI5A 5A0YB 3TZWA 3K17A 3M2VB 4F91B 3CQ8A 3TNVA 4DHVA 4RW6A 3AAPA 4ACOA 1SIWB 3W61A 3V9UA 1ASUA 3HOSA 3FR0A 2H4YB 1VSIA 4W90B 4X62K 1MWZA 3H20A 1ZQAA 3I5BA 2XICA 4HHUA 3E2EA 4DV3F 3GYGA 3B0YA 4CI0B 2IMWP 4L75A 3BS9A 1ZJMA 3J7A1 4DU4A 2AZ3A 1JWWA 8ICUA 3AO3A 2O6KA 5CZ1A 1CJVA 3W9HA 1HFEL 2WBNA 2H4WB 2OD4A 4UOHA 4O3SA 1PZNA 3AOAA 1KQFB 1SQEA 5LSLA 1P8GA 5AE2A 3G8QA 3C15A 4WP3A 3PZPA 2LXIA 3P38A 1TK0A 2P9PA 3TAMA 4M9NA 3DOLB 3HBTA 3C66A 3CJKA 1LAWA 2O8CB 3GFZA 4WK1A 2WBRA 2I8EA 3IRUA 4V19X 1IM4A 3GYXB 4JKCA 4BVPA 5A8WA 5KOWA 5AIAA 1DURA 2V69A 2BQRA 4CJ3A 4LQ9A 4QBUA 1GLFO 5D8HB 2UVUA 1C1AA 2D3DA 4LF7F 2UVRA 3MECB 1M1KO 1BUPA 3MX2A 3QICA 1ZQYA 4AT1B 2OJ3A 1P90A 2MGZA 5CABA 2RHFA 3OYDA 6FD1A 3FLCO 4X65F 2KG0A 1FVQA 2UP1A 3MM9A 2U1AA 1QE1A 1SKUB 4CJFA 3S3NA 2Q36A 5D0HA 4H0TB 3OHAA 5HBMA 4LF8K 1KLMA 3RUBL 1ASVA 3LH2S 2FVQA 4KN4A 2V68A 3VQ5A 1Q78A 3DRPB 3PW5A 5GAEP 4FJJA 1NNEA 1ZBHA 2VYPA 3OYEA 2OTJS 1WC5A 4FZLA 3RJEA 4Q45A 5AK4A 3W3SA 2Z57B 3MM7B 3N01A 5IXUA 1VLYA 3S41A 3NVWA 3UN2A 4O3QA 2ZD1B 3GSDA 4NYOA 5A6PA 1YI2N 1Z00A 4R8UB 3K4GA 4Y2QA 3DLBA 4LJXA 1PVQA 2MJNA 5E3QA 2BCVA 4QU7A 1VSHA 2ZE2B 1RBUA 1ZM4A 4DCHA 1T8EA 3M2RA 3TADA 4L6V3 4WE1B 2W03A 4ALZA 1JLFB 3HKZC 2HMPA 1WAFA 4JLHA 3R2CJ 4ZP8A 4L74A 1RHUB 1YHQN 1HKCA 2YKAA 2NRWA 2Y1JA 1HWIA 3WXIA 2XY5A 1R43A 2LMRA 2A3VA 1RPLA 3DLKB 1B99A 4KB7A 5L46A 3AL0B 3Q8UA 1FD2A 1FRLA 5T7LB 2KRRA 4RW7A 2HGLA 1VJ5A 3C16B 1LKYB 1NPKA 4KLEA 2CQ3A 3QJJA 3VQTA 1U1RA 3ZDBA 5DM7Q 4EELA 4I2IA 3SQ1A 1SXLA 4TU9A 3VZHA 5I42B 2XULA 4ZVHA 4M7YA 4ETZA 5F9NA 3OR1A 1M5VC 1ATNA 3VTHA 3TU5A 1X2IA 3PYDA 4IYQA 5JMVA 4JEPA 1Y3KA 3U02A 3PYFA 2A1RA 1HJPA 2YXLA 4F93B 2KG5A 3L4QA 4I2PA 4CJKA 1V3ZA 2RD5C 2OI2A 4JI7K 4IZ9A 1NH8A 4RU2A 3IP4B 4LBPA 4RT3A 3KWGA 2HHUA 2E5LF 3B0XA 8ICGA 4QYZJ 4KHPJ 2NUUG 4M5HA 4FXDA 1QTNB 4I7FB 3O3HA 2CWKA 5IT9O 5RUBA 3I28A 4DLGA 2LQBA 4QR2A 1RT4B 4LSNA 3F0NA 3FNNA 2FY8A 3L7UA 2DNYA 3KLFB 1C1BA 1VQ4S 3AA5X 4TXSA 2DNHA 1S79A 4ZHRA 1JLGA 3L4BC 2GFFA 3SEIA 5HR7A 4RQNA 3VEOA 4O55A 5FLXO 1OYEA 4DUZF 3OPXA 5FJ4A 2CUYA 5KFLA 9ICFA 2DGVA 3KKRA 4LR9A 5D4OA 1JK9B 3N7PD 2AH5A 3U8XA 5ALXA 3QGPA 2BGGA 4QW9A 1SL2A 4MN4C 3RU0A 3VQ7A 1RXWA 5HL7Q 3ZNUA 2C28A 4JK1A 2WTUA 4PG8A 2B4VA 3CMAS 5HATA 1OY6A 2QMUB 2F77X 1SC1B 4AL7A 4ZPVR 3EUB2 3X3UA 4FF3A 2ROGA 5BPLA 3NEKA 1HYSB 5JUMA 2V8DA 1L3TA 2PMZF 4CF1A 2MKCA 4PWUA 5IILA 4P74A 3JXUA 2Z1IA 4OX9F 3IAYA 2CQGA 3AO4A 1U1NA 1KNZA 4A57A 4RWTA 1CQNA 5AKJA 3NBPB 1N5YB 3WXKA 2KHCA 3NY0A 2VJ5A 3AJDA 4KLIA 2DNOA 3LL3A 4GXKA 1DAXA 5L1MA 1F2GA 1HKAA 3CM5A 5FDLA 3E9LA 4H03B 2F9TA 1G1XA 4HLBA 2ZKUA 3P8BB 1XC3A 3L2UA 4I28A 4JOUA 1VQMS 2CJKA 3MURP 3SMSA 4U7BA 2R42A 4WFBL 1KAYA 4Q5VA 2VQEJ 3CD5A 1WSIA 5F41A 5DK5A 3EMTA 3K8VA 4F72A 3OSNA 1GO3F 2P2CB 4Z6EA 3ULHA 5J1PA 4O9MA 4I2CA 2EX3A 4NYNA 3ISZA 5ADXH 1MLAA 4FWSA 1IBKF 2KIWA 3MBYA 3ONQA 3KK2A 1ZTWA 3VQAA 5F8GA 4IEIA 1XO1A 4FL9A 2FVSA 2QM1A 1R6YA 3DLEB 1Q86T 3I0SB 5DZ7A 4ED0A 3SCKE 3VGVA 3FZFA 2BKOA 4WBFA 1RP5A 2DBBA 3QBCA 1BY9A 3WK6A 3R6LB 2BQUA 1HBUA 2QX0A 3WNFA 2VJVA 1VQNN 2ISPA 2N7YA 5GAHI 1WUUA 3VV2B 4ID8A 7ICFA 3JQKA 1YJNN 1DQAA 1RWXB 4RW8B 2QTWA 1HW9A 4DL0C 1JN3A 1X0FA 1YTAA 4UAZA 1HLUA 3LWLA 3UDLA 1FEEA 4CGDA 3L4IA 1RT3B 3P5JA 5J2QB 2BVZA 2FDNA 3TZXA 4BROA 4BQZA 4KHYA 2D9OA 3FZBA 4NLXA 1DQ8A 4A61A 2J7KA 2BANA 3ID8A 1D9AA 3HRGA 2JWNA 3KYLA 3WIVA 1WEXA 2ZUAA 3WU2U 5KT2A 4ZCIA 4KLJA 3QINA 2VWKA 4H5VA 3CMES 3BQ7A 1BPBA 3DDKA 1C0TB 2ROEA 1IKWA 2IY5B 3D1HA 3HHNB 4FJLA 5HQ8A 1S1XA 3MPVA 2ROPA 4GVEA 2ZBPA 5AICA 1NLVA 3KD5E 5F8MA 2EZXA 3PACA 4JKFA 5AQGA 4C8NA 4M41A 1NOMA 1X9SA 4DFJA 4P72A 1MU2A 2D5RA 4AYBD 1AQ6A 5B7WA 2O8DA 4MO5A 3AA9A 2XTJP 1WC6A 2OPRB 3TP2A 8ICYA 4WKRA 2V2KA 2FJ6A 2PFOA 2PGCA 2W01A 2W4PA 2EQYA 1MMLA 5AQQA 4KX5A 5KFGA 3DRXA 1NK6A 3UE5A 4UB6U 1DOQA 3K1ZA 2ZM6J 4CF3A 3ENVA 4HTUA 4WTYA 3O1LA 2GCFA 1KONA 2DNMA 4EIAA 5M1NA 4M63C 3ZTRA 5IFMA 4AL6A 1WNSA 1Y3JA 1N54B 4DX7A 3KHRA 2F8HA 3D28A 3GFXA 1EETB 3SYZA 2BV3A 2BRLA 3CJAA 3NFAA 1TVAA 2QA1A 4JI4K 5B0DA 3BUZB 5AK6A 5D46A 4UOGA 1WC0A 4RQ2A 4CHOA 1U8SA 4CESA 5A8KA 1Q0NA 4YD2A 1FK9A 1UEKA 1G15A 1FHTA 2IOFA 1VQLN 1IBLJ 1Q81O 5J1NA 3TUZC 5GINA 3L5KA 4J37A 2WHOA 5GADU 1RB0A 2P6TA 2B7CB 1WKKA 1EKSA 3BSAA 2N4DA 3GPAA 2ASDA 3G4SS 9ICVA 3ZT1A 3CGIA 1FWLA 4CLKA 4DF8A 1TQLA 2ASMA 2KN4A 3DI6B 2QWRA 2XMTA 4AP9A 1IM6A 1QVFM 1JLEB 1H2UX 3N6NA 4FZVA 4H54A 1LXJA 1U9LA 1RCHA 1B92A 5HMMA 4C8LA 2WVEA 1QVFR 3VR1A 3UKRA 3WBZA 1S7IA 2RHQB 4GC7A 1VQON 5F3XB 3A1YG 3OXFA 2QO3A 2O8BB 4EEYA 4AHUA 2W4CA 2VV5A 2CKWA 2XGPA 3D6TB 3LPYA 1XNRF 1HNXF 1K8AO 4EBDA 2E29A 2QA4G 4B3SF 2D3O1 1SJRA 1V9PA 1TVRB 5BRDA 2YX8A 3H8JA 3TQEA 5A2QY 1JLAB 1M90T 3TSUA 1U6ZA 3BJYA 2Q97A 4UAVA 3H2LA 2I9GA 1HBNA 1VAZA 1HUXA 1HNZK 4WKYA 3UXPA 3ILJA 3CE8A 2DNKA 1YJ9S 5AQZA 2XO6A 3R5AA 3D6JA 3TABA 1UVLA 3CD6S 4JI5F 4F25A 4JI3F 2VICA 3KJVB 4OKJA 3M1VB 5MAOA 2VIXA 3NAEA 1K73O 2PDAA 5IT4A 3I0RB 3OYCA 1WI8A 4ELUA 2G1DA 1VS3A 5C24B 4D3GA 3NGDA 4KX3A 2UXDJ 3LP0A 2A6MA 1N63A 1IG9A 1NGCA 3OS0A 2FE9A 2X78A 4YB1P 4BRGA 2Z2MA 4I2BA 1X4CA 3SEOA 1X66A 2HHXA 1HNWK 4XIUA 2CRXA 4CM2A 3KK1A 3G0ZA 4DV1K 5KFUA 3QGHA 2GX9A 2R4FA 3MM6B 2FVRA 4RU9A 3KKSA 4O4GA 3AVMA 3V6HA 4UW2A 1YKWA 2GIFA 3EO3A 1RHMB 4FYVB 4KH4A 2VQFK 2AHOB 3QBWA 1E4GT 4KH6A 4MKVA 3RF9A 2YKNB 1Q4RA 1I6JA 4JI2F 3CC2N 1TKXA 2DFHA 5AI6A 4ID5A 4ZITA 1IBMF 3HK2A 3E66A 4USHA 3U26A 4ETXA 4PGXA 4PL7A 5HO4A 1BC6A 3JTPA 3KKAC 3N28A 5KT3A 3GCWP 4CFCA 3MMCB 1ZQCA 4HT5A 3QZ8A 1HW8A 2YN4A 2B21A 3KZXA 3H98A 5EGYA 3QEWA 4HACB 4Q8FA 2W24A 3JS6A 3U4LA 3NGRA 3QNMA 1FO1A 3AO2A 2ZITA 2ZTCA 1DGKN 4KSEB 2OGUA 2FMQA 4FS1A 4F2RA 2DFLA 2RUSA 5KRTA 1LAVA 1UCVA 2MSTA 2MAXA 1U48A 1PYSB 2VQEF 5AQTA 4KLTA 4ANEA 5GMEA 4F04B 3TJ8A 2NXJA 2LQ9A 3MWBA 3US5A 2A18A 4FCYA 1A0PA 4MF2A 3O44A 1UWBB 5CYMA 1BOTO 2F5GA 4DR4K 4BWJA 3PR4A 3AOCA 1URRA 1T9WA 4Z6FA 3OTOK 2FPLA 4KAIA 3AU6A 1VJWA 4DSLA 1PJ5A 2DIVA 4J9NA 5G0RA 2NRRA 2ZGYA 5HN0A 1VLBA 4F7VA 1P27B 4B6JA 5GAGI 4IG0A 7ICKA 1HQUA 2A2DA 1PSDA 5JICA 3IUCA 4J9PA 3J7Z5 3C0BA 2P9IB 2QLWA 3NAHA 1VGYA 4CW7B 2E6MA 1NKBA 3VETA 1VQ5S 1S99A 4RW4B 2RH3A 1BI4B 2AF6A 4QW8A 3MR5A 2QA2A 3BBCA 3GJRB 1JNRB 5GVQA 4YHHJ 3FUYA 3H1QA 4IJNA 3M9NB 3QGIA 1S72S 5IINA 3P96A 3CJ1A 4RQ3A 4OJLA 2JFKA 3VHQA 2P9UA 2LKYA 3NCRA 2UU9F 3MMJA 2UYTA 4H5TA 2AYEA 5LMNJ 4IKAA 1SWWA 2HZCA 4CBWA 1YK9A 3O5TB 1OPIA 4DV6J 3K0SA 2YWKA 4KLGA 3HP6A 4IR9A 7AT1B 1OSDA 2CPFA 3VQEA 1J54A 4OHXA 3RW7A 2EG2A 4YY3F 1KBUA 2H3IA 1ZAVA 3L09A 3GIRA 4Y2JA 1DTTB 2A42A 1RDRA 1D8BA 4WU3A 2R8KA 2DO4A 2PO4A 2YKMA 4PYDA 3CXCR 2DGTA 1IWGA 2KP7A 1ZQIA 1VLOA 4YQWA 2ZZMA 3PO5A 3AA3A 4Z7YA 1X3NA 1WC1A 3VQDA 1EQMA 2B0GA 2W25A 4Q43A 2Q6BA 3GP9A 4WFAQ 3A5LC 4B8AB 3OY9A 4WIQA 1EWQA 1RT6B 1OH7A 2MQOA 3TQ1A 3KFWX 3M30A 3SIPB 3TAPA 1TP7A 4F3TA 3RFAA 2JH1A 1A5VA 5J2NB 1XUPO 2Q4TA 3RJGA 1WOOA 4MJKA 4ES2A 2N3LA 3LDPA 3IS9B 8ICQA 4H4MB 3TWZA 2F8LA 1U1QA 2DY9A 2ZUBA 5H9EJ 3GZ7A 4TVAB 2GJIA 3PSFA 3N4MB 2E1YA 2EDUA 1EQ0A 1GAOA 1TUWA 2DGXA 3RRKA 1GT8A 4DUYJ 3EL2A 1X5TA 1BLUA 4I64A 2P9CA 4WQ5C 2AP1A 2Z1GA 4IFVB 2B0CA 3S6JA 5J0QA 3OYMA 2DL0A 5D6GA 4KLQA 2HSZA 4ILJA 1TK8A 3L7PA 1Q5VA 5H9FJ 1EB0A 5M1KA 2PC6A 2NSBA 1GLEG 3NF7A 2VG6B 1BDGA 2JL9A 2XYGB 4EO6A 3T5LA 1ZQZA 4OLOA 2ZNZA 1SZ2A 2BACA 4EUVA 2L9WA 5EU7A 2VC0A 2WVCA 3AAWB 4PPZA 3D0IE 3M8YA 2X3GA 1H74A 3OTBA 4X4VA 3UPQA 1NJZA 4DR1J 4DR5F 1FE4A 3AV9A 3CCJS 3WC0A 4QYRA 1RAGB 4FYDA 4DS4A 2QKBA 3CCRN 2ZOGA 1FTCA 1RKJA 2B3TB 3CF5L 3G8TA 1TKTA 3R1XA 1IG8A 3MAHA 1QVGR 3I5AA 2O4GA 4CEZA 2OEJA 1MN7A 1NPRA 1Q79A 1SC4B 4ZVEA 3LQVA 5GAHP 1U09A 5D0EA 2CQPA 4P71A 5ETSA 4WU2A 2HQ3A 4FJ5A 2RVJA 1WBBA 4OFZA 3UDVA 4EHUA 4CEEA 1DRZA 3H7IA 2Y0SC 2K2PA 3PY8A 5IT0A 1EIYB 1COKA 3HVTB 1UEVA 4XQ8A 5EUHA 1NNLA 1J9AA 2WF5A 2BJ7A 1M0SA 4KE5A 3D7EO 4P0QA 4Z4HA 3KBBA 3Q8MA 3C6TA 4DSJA 2BM0A 4KQZA 4C11A 1T02A 3NGTA 2KVIA 1VISA 4JP8A 4BGBA 5F0WA 5J0YA 4E1MA 4UB1A 9ICBA 2AJ0A 2OO4A 1Q95G 2XC9A 2DGOA 3ZI4A 3A3NB 2RDDA 4USVA 1PCAA 1BPXA 3MCAB 4FJ7A 1IBCB 3J7ZO 4P0PB 2LKZA 1V4SA 1S49A 1N32F 1I94F 2C2ZB 4K0KF 2J6TA 4CTAB 2YI1A 1B43A 3NHGA 3TVKA 5KG0A 3Q8PB 1R8CA 2KK0A 2F8KA 1QSLA 4USTA 1ZQDA 3DYAB 3DMJA 2XVTA 4ES3A 2E5JA 4FWLA 2BA9A 3S6EA 1Y5NB 3ZZOA 2AEMA 4IOCQ 2YMMA 2M0NA 2XMWA 1AB8A 1S6PB 3IDWA 3IG1A 2QARB 2Y8YA 4JD2A 5BPNA 3UQ2A 3A4TA 2O67A 1QQCA 2ALZA 4W5TA 1V4TA 4ISFA 1FT8A 4J9QA 1NJIT 5GTIU 4DR6K 2K4IA 1FKOA 3E3XA 2J0SD 3MWTA 3OFFA 4IFEA 2P5VA 3PEJA 4F3QA 2VONA 2UXCF 4MH8A 1KWMA 3A8YA 3CIZA 1C4AA 4Z6DA 5K9FA 5J0UA 4ZJQA 3H25A 1YBAA 4MKYA 2VASA 1N33F 2GGPA 3DC2A 2IJRA 2RU3A 3GG1A 3ETLA 3QSIA 4Y2XA 1GLCG 2YB1A 3KD3A 1X5SA 4FK4A 4K4VA 3DLHA 5J2MB 3NE6A 2A6AA 3J7AP 4QZFA 4ZN3A 4FZNA 1UPHA 1WWUA 2F40A 3DHXA 2OIHA 3L9ZA 1YRUA 4DV4K 8ICFA 2DRAA 5ALWA 1QSSA 4DV2J 2AX1A 2FB0A 1BA1A 3K2YA 4NMLA 1RBAA 4A4JA 2K8GA 4R25A 4B3MJ 1LVHA 1Y00A 3ZT4A 4J9OA 4WF9Q 4JI6J 2K4PA 3B6BA 4DR7K 1Q16B 3QMLA 4C98A 2BUNA 7ICEA 3K5OA 1GEHA 1S0NA 3UVJB 3PX6A 2QZ8A 4OI1A 8ICRA 2V67A 2ZH6A 5IIMA 1BL3A 2HBMA 4Y2YA 2VWBA 3B54A 2QGFB 3BR9A 1S1TB 1IKXB 1U0HA 3JPTA 2J5AA 2KLAA 2UUBJ 4NOHA 2V8PA 3G25A 1OVYA 1R3NA 3W66A 4E8UA 2I7NA 2V94A 4EX7A 4CH1A 1P8ZA 3J80Y 1GLAG 4JK8A 3O9TA 4FVMA 3E01B 4QS8A 3U7JA 1S48A 2RF2B 1TYQA 3HXMA 1U2VB 4CDIA 5ALZA 1YIJS 2F1JA 3PNIA 5DLGA 4DCOB 1F9EB 3QEBZ 1B0VA 1N6QA 4OYPA 3H2UB 3WQUA 3ITHA 3A0HU 1RT7B 4DPXA 3MEDA 3MPWA 3GB0A 3BQ2A 5DLFA 2VBXA 1UPMB 2E7WA 4YMNA 2DO0A 3M9MB 1RGVA 3OJSA 4X62J 2ZGZA 4RG8A 5JVHQ 1WN7A 3S9HA 5AKHA 4P7VA 2RQ5A 3IRXA 5K8NA 3ZFVA 5J0WA 3DLGB 2EFOA 5M2RA 4ISGA 2UV8G 4Q8EA 3ZD9A 4IRCA 2V63A 3JTOA 2CPHA 9ICGA 1O51A 2DFEA 1W26A 1VI7A 4NLRA 2HG4A 4LF9F 1C0UB 1ULRA 1VQYA 2QEXS 4IKFA 1WDDA 5KFTA 1S1UB 4JYAF 3T9NA 2G8FA 2C2EA 1BA0A 4DFDA 2OKQA 3NL0A 3D3CJ 2X7IA 3OV7A 4DUYF 1OVQA 8ICVA 3MM8B 3I55N 1AZSA 3OL9A 1CEZA 3EJMA 1W25A 1XSLA 4I9QA 3NOCA 2PYLA 4K8XA 4C3KA 2NRVA 1FKPB 1D1UA 4M5GA 2AT1B 3CCTA 4L72B 4M8LA 2ZTEA 4ZVPB 4FLVA 4BVOA 5A2QU 3ZSWA 3ZX3A 2PKEA 3M6ZA 3TJAA 4Y2MA 4JKAA 2A1JB 4YFKA 3U3GA 1X4FA 5CYQA 2YCHA 2DRDA 3E58A 1NHUA 1PC4A 2FGOA 3H45C 3EVOA 5KG5A 4YDXA 4C7YA 4LF8J 5ALRA 3QU2A 1SAZA 4GKKF 2Q0UA 4YP3A 3MAAB 4N7TA 1FDNA 2O1PA 4CFAA 3EGVA 1CJKA 2BW2A 4LFAF 3ILIA 1F5CA 2M3DA 3UR0A 3KJFB 4DR1F 3H5SA 3CCMN 3VGUA 2HRYA 4O8KA 5DS7A 4LF4K 1K1QA 1KL9A 5C2CA 4CE6A 2QW9A 2PI5A 3IFEA 2JC0A 2IDLA 4LRCA 3HHLD 2ZBCA 3SJJA 4XPCA 3HSGA 5GAGP 3LA0A 2A19A 3HSCA 2JLEA 2OP5A 2V8HA 1G3OA 4M3TA 4BG8A 3V72A 4IOAQ 3OPKA 2E8AA 1UHUA 3NLCA 3GR1A 1S5LU 2CJ9A 1RU2A 5LMUF 3ICXA 3DU5A 4TY8B 4EWTA 1KSPA 4UOFA 2YHAA 3R3TA 2ABYA 3AUOA 4Y34A 1T11A 1KLNA 2FUG9 4LVOP 4DV7K 2AJ1A 3Q24A 3G87A 5D78A 1MNEA 2X6SA 2XLKA 3KK7A 4MFFA 4RX6A 1HI1A 3MM5A 1JQGA 5DETA 1ZQUA 1GXTA 1NSQA 3OHBA 3CDEA 1WCLA 4DSEA 2ZTDA 2HFVA 3OQ2A 2LM4A 2E5IA 2EI5A 2G09A 3C6AA 2CNLB 3DXKB 4PG6A 1WHXA 8ICKA 4NV0A 4JI1F 5KT6A 2CQ2A 4EK2A 1B7YB 5HQMA 5KPZA 1WSFA 5THWA 4YEAA 3N9UC 3SUNA 3QUCA 1X4AA 3EKUA 3SD7A 3IBCB 4ZOSA 2UUAJ 2EFVA 1ZZNA 4PZOA 1VRUB 1YRXA 4J2DA 1TV6A 3TANA 3MMBA 1DZ5A 4MDBA 2YMPA 4FZZA 4LR8A 1SV5B 4FM0A 3QUQA 2GQ2A 3WKBA 5EX5A 3MEEB 4YORA 1N8RO 1TZ0A 2JVRA 2OMLA 3H8YA 2ZH8A 4JI7J 4CNZA 2X51A 4ED1A 3KNGA 5HLFA 2CNNB 1SBRA 3DRSB 3HULA 2R7WA 4RUAA 4ZLPA 3CULA 3WNEA 4CF9A 2R2RA 3KLVA 4I2HA 4USKA 3SR6A 2O8FA 2WK4A 2RHKA 2CG8A 3HDSA 3I76A 1CSJA 3ZDEA 3L8BA 1U1MA 2G8UA 3IA0A 5I3UB 3TR5A 1WUDA 2ZDPA 1NGHA 3KG1A 3TUIC 1Z26A 1IN0A 4LSLA 3S01A 1CPZA 5HROB 5KAKA 3HFKA 4OHZA 3G71N 3VGTA 4BC9A 5J2PA 1XSPA 2JEJA 5IZHA 3N5FA 1EARA 2KH9A 1W2IA 5HMYA 4CHQA 1HD1A 3EZUA 5MLCV 2ZIVB 2RB7A 1T03A 2GJFA 5LL6d 3HX9A 4FZMA 3JPQA 4NLYA 1E4FT 4CVNE 3U27A 4DPOA 3HHLA 1RABB 3D6FB 4JWMA 1JLQA 3V6DA 3NMRA 2LA6A 8ICCA 5HVFA 1IO2A 2QMXA 1WB9A 2P8IA 3HKZD 7ICNA 2W6LA 5LL6Z 4DV2F 3PJWA 2UUCJ 2RSQA 1BU6O 2M9KA 4DQ8A 3AJ1A 4NXNF 4B3MF 1RT2B 3P45B 3GSIA 4PHDA 4JI6F 3T1HF 1ECWA 1COOA 2V4RA 2NRTA 3DRYA 4PHPA 2GHWA 3ETRA 5AT1B 4PWDA 3E8OA 3VQCA 2G07A 3P5BP 5K8OA 3G8SA 1WF2A 2V52B 1L5UA 1J5EJ 3D54A 2QJ3A 3H6EA 1RU1A 3B8AX 2F4VK 3AVKA 2GO7A 2ERRA 2DNQA 2QTDA 2AJQA 1U6BA 2ITMA 1WSRA 1FFGB 5F8LA 1UVJA 3MMAA 3JB9k 4JNEA 3F5EA 2KVCA 3R6MA 4BRAA 4KBIA 3NH2A 2H54B 1N5TA 1VQ7N 1YTUA 3ULDA 4TKTA 3QIPB 4GV3A 2KSOA 3MCMA 4UY8T 1R6VA 2CAJA 4NE9C 1KD1O 4FW2A 4LQ3A 1X7VA 3MCOA 1E6VA 1JJ2M 3W5XA 7ICJA 2RILA 4P2SA 2OEMA 3R5BA 3CCVS 3DDHA 2CRLA 4CF8A 1LOTB 4YMEA 2NR0A 5K14A 2O01C 1ZQBA 1WTBA 4M3YA 2MZQA 4F0MA 3N6LA 3H8MA 5J8YC 3UIQA 4NLSA 2DCUB 3FM9A 3W2WA 3ELHA 1TL3B 1T9UA 3D2QA 3AVHA 1XMOF 4DOZA 2E3TA 3RW6A 3CJ7A 3EE8A 3ZETB 3CCEN 3VEZA 4PY5A 3QIDA 3AQFA 4YDDB 1ZM3A 3O6QA 1S7HA 5BN9A 5D3GA 1WOPA 2WC9A 4NASA 2QN6B 1B7FA 5DM6Q 2CDRB 5KFSA 4HYKA 3VTIA 4DR2K 3POTB 4L8RB 4NEZA 4LSZB 4A5BA 5BXIA 4FJ9A 4J2AA 2V34A 1GTHA 2V2ZA 2ZJAA 4PG4A 1AUDA 3W62A 3RBDA 4IL6U 1VSMA 4CJRA 4US8A 5B5EU 3D2SA 3CJRA 5ALTA 2NPIA 2P9GA 3DM2B 1S22A 2NV3A 1PBUA 1LWCA 2NS1B 5EE9A 1CJTA 3M7VA 3JSMB 1NGAA 3AM9A 1NZBA 3GFYA 4OI0A 3L6QA 3EDRB 3W5ZA 3DAWA 2G8WA 4JV2A 3TOQA 3R8EA 5BJRA 4BE0A 1V3SA 5CWRA 3R8YA 1RWOB 7ICPA 2E7XA 1NGBA 4MYTA 2Y8WA 1PJ7A 5HNKA 2V4JB 3UKUB 1WYGA 3PKYA 4DTXA 4YFUA 4MIWA 4IBNA 3LWMA 3RRGA 5KGWA 3BGLA 5A8RA 2PY5A 3OR2A 4B3RK 1P1TA 4UAWA 2ZJ5A 4NLBA 1KEJA 4B8CA 4F67A 3K9JA 3ET6A 4WPAA 2BTFA 3QLHB 1KQSM 4FZXC 1ILYA 5KFPA 1MN9A 4BRMA 2RAQA 4RW6B 4C8ZA 5AE1A 2DH7A 1NSAA 1JI7A 2OM6A 2R2TA 2FLPA 2HFNA 4UBCA 1BQMB 4WK3A 1ZQEA 3LZIA 1HHTP 4NLUA 2JRSA 1CRXA 2K8BB 1BGXT 5KAIU 2WSFC 2NXCA 4DPTA 3KOOA 3QNNA 3THYB 4JI4J 3RJIA 1H73A 5ELZA 9ICKA 1GLLO 4NO7A 4W5RA 2Z2YB 1FXXA 2BZ2A 2IHR1 4QYZK 3QFUA 3JPOA 5AFUA 2W9CA 3MPDA 4ES1A 1UT8A 1DLOA 4DPYA 4UOCA 3A0IX 5IWAJ 2J7WA 3CB4A 3BN4A 2C3OA 4N47A 4HHTA 2HBJA 5AI0A 4XTTA 3KK3B 1SB6A 2C3PA 4QZ8A 5CA5A 3MX5A 1T7PA 4EFAC 1YJNS 2KHOA 5A8WB 4CBXA 3ISNC 4QZVB 1XC9A 3KZBA 4ZIVA 5DDYA 4XPEA 3HSDA 4I9LA 3GE1A 3ZEUB 5AJ3F 5DBCA 4IFYA 1R8HA 3J7AN 1NOYA 3H4BA 4EP5A 1BPYA 4W4MA 3VALA 1ZYQA 3DDNA 2MZTA 3ZZYA 4MF8A 1WTFA 3WK9A 4Z2XA 4YB5A 3OW2R 2O66A 6FDRA 1QE1B 4FJNA 2HNZA 2EXUA 2VIHA 2WFAA 5EE3A 4DU1A 1ATRA 3WDOA 1M1KT 5AQMA 3EVWA 4A5AA 2ZG6A 2FJVA 4G1QB 3AT1B 1RNHA 1UAXA 1JKHA 3CJ3A 2YH1A 5BOLA 5ADZA 1B0TA 1HNZJ 2FLOA 4CEFA 1MWYA 1QAXA 2FC0A 1VJQA 2ZWPA 3K75D 8ICHA 1HBMB 5KRSA 2JWKA 1UETA 4DFKA 5AQXA 4I2GA 3ADAC 3D4JA 4AFFA 5GIPA 1V85A 4RPZA 2IRUA 2VOPA 1B64A 3LF0A 4RKUC 4DX5A 2I6WA 4FXVA 1K0TA 3ZDCA 4AQYF 1RT1A 2BH1A 3TEHB 3M2RB 4CHNA 1CLQA 3VF4A 3GDXA 2A6OA 4Y2UA 1TFWA 4JB3A 3NS5A 2O8EA 4FBUA 2V2VA 3A5MC 5LT5A 3H2VE 2PIIA 1V38A 2KXNB 2MKIA 4Y2SA 2AZ1A 2H48B 2H3EB 4WP8A 3IGVA 5KFMA 1NRKA 2J6SA 1HNWJ 5HVGA 3GCXP 8ICEA 4OJ3A 2HI0A 1SXDA 2PFPA 2XLIA 3VGMA 2CGLA 2JXJA 3A2FA 4DV5F 3NGZA 2YX7A 3CRXA 4L73A 1PAEX 4EU0A 2DBYA 1UZHA 1UP1A 1Z2ZA 1I51B 4PG5A 4IO9Q 1N56A 1K47A 3J80U 2VQFJ 2HK2A 2BQ3A 4BACA 4GIBA 4BLGA 1Z05A 2GQCA 3VZIA 3O5BA 1M5KC 2RNEA 2EG1A 2OTLS 3I9ZA 3A3OB 1J5OB 1Z4UA 1VQLS 2K3KA 7ICTA 4P73A 4K50A 3G82B 4JB8B 4PQUA 4BXOA 2FD2A 4G9BA 2ZFHA 1PK1B 2QYCA 3OR1B 2MXYA 4QZAA 1S97A 4I27A 1N5QA 1MN8A 3ZZ0A 4ECTA 4CZIA 2OFHX 1AW0A 4CNYA 2WB1C 1GOBA 4NLZA 3DDIA 2XSJA 4MLHA 1KQQA 4I2PB 3HPHA 2YMQA 4XAKA 1C0MA 4NA1A 2MLXA 3KHYA 4ZLLA 3NASA 1WLJA 3G6YA 4AF1A 3QT8A 2IA0A 1ZQQA 5ETRA 1RZMA 5AQNA 2EPIA 2HBKA 5GIOA 2EWSA 4OCZA 1IKVB 3IGNA 4F0HA 4MFCA 1VQOS 1N61A 3S3MA 1MMDA 1UJ4A 3RMAA 1RI7A 5KTQA 4ECUA 1VQ9N 2LECA 2QB1A 4C23A 2HHQA 3ZTPA 2UXBJ 2CQHA 4R63A 4DR4J 3TACB 5DM7L 1KOHA 2B4UA 2FJAB 1ZBIA 3OTOJ 2BMBA 1JLGB 2C3MA 1KS2A 3UW1A 3T5KA 1MQ3A 3NMUA 1FVSA 4ZMMA 1JLBA 3HO1A 1ZXIA 3P4IA 2B43A 4CZJA 2MQMA 1KW4A 1W2BM 1CG2A 3SAGA 4BC7A 4JK9A 3WNGA 1VSKA 1X4GA 4CT9A 3L4PA 3PHTA 2IVNA 1DY3A 2GJ2A 3FBBA 2PMZC 3CPWM 3MDCA 5CRXA 2IOHA 3PXGa