4B9NA

Structure of the high fidelity dna polymerase i correctly bypassing the oxidative formamidopyrimidine-da dna lesion.
Total Genus 208
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
208
sequence length
581
structure length
581
Chain Sequence
TAKMAFTLADRVTEEMLADKAALVVEVVEENYHDAPIVGIAVVNEHGRFFLRPETALADPQFVAWLGDETKKKSMFDSKRAAVALKWKGIELCGVSFDLLLAAYLLDPAQGVDDVAAAAKMKQYEAVRPDEAVYGKGAKRAVPDEPVLAEHLVRKAAAIWALERPFLDELRRNEQDRLLVELEQPLSSILAEMEFAGVKVDTKRLEQMGEELAEQLRTVEQRIYELAGQEFNINSPKQLGVILFEKLQLPVLKKSKTGYSTSADVLEKLAPYHEIVENILHYRQLGKLQSTYIEGLLKVVRPDTKKVHTIFNQALTQTGRLSSTEPNLQNIPIRLEEGRKIRQAFVPSESDWLIFAADYSQIELRVLAHIAEDDNLMEAFRRDLDIHTKTAMDIFQVSEDEVTPNMRRQAKAVNFGIVYGISDYGLAQNLNISRKEAAEFIERYFESFPGVKRYMENIVQEAKQKGYVTTLLHRRRYLPDITSRNFNVRSFAERMAMNTPIQGSAADIIKKAMIDLNARLKEERLQARLLLQVHDELILEAPKEEMERLCRLVPEVMEQAVTLRVPLKVDYHYGSTWYDAK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DNA POLYMERASE
publication title Unexpected Non-Hoogsteen-Based Mutagenicity Mechanism of Fapy-DNA Lesions.
pubmed doi rcsb
source organism Geobacillus stearothermophilus
molecule tags Transferase/dna
total genus 208
structure length 581
sequence length 581
ec nomenclature ec 2.7.7.7: DNA-directed DNA polymerase.
pdb deposition date 2012-09-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00476 DNA_pol_A DNA polymerase family A
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.20 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 5' to 3' exonuclease, C-terminal subdomain 4b9nA04
1.20.1060.10 Mainly Alpha Up-down Bundle Taq DNA Polymerase; Chain T, domain 4 Taq DNA Polymerase; Chain T, domain 4 4b9nA02
3.30.70.370 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 4b9nA03
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 4b9nA01
4M2YA 4C8KA 4R65A 4GVMA 5FRMA 2HHSA 2DFLA 1ZQDA 2W9BB 1JL2A 3SQ0A 1D9DA 4YD2A 4QCLA 1WNSA 2GV9A 2G8IA 3KHGA 1UAXA 3C94A 1B9DA 3VA3A 1ZQMA 4CJ4A 3ISNC 4I28A 4RW6A 2DY4A 5IIIA 4ED3A 1XI1A 2W8LA 1BCMA 1ZQQA 4E19A 1ITGA 3GV8B 3SZ2A 5HP4A 1NK7A 1ZQEA 4N47A 1YVUA 4OGEA 5DDMA 2HHVA 2WONA 4UBBA 2JEJA 4ECWA 1QSSA 5IIKA 3KTQA 3RB6A 4KHWA 1BI4B 4M42A 3BJYA 1ASVA 3EW9A 4ED0A 3TANA 4E0DA 1CZ9A 4O5EA 4CIEA 4KLOA 1JXLA 3MR6A 7ICQA 1WN7A 3QO9A 1CUKA 2BCVA 4OLAA 4ECZA 1PZNA 4GXJA 3RJKA 4Q43A 1RILA 3V72A 2YHAA 4J2BA 3LZJA 4NM1A 3PO4A 4TURA 3AU6A 3RRHA 4DWIA 4ED7A 3PO5A 4QW9A 1JXEA 5KT4A 1ZQOA 4IR9A 2HB5A 2BDPA 5HRSA 1ZQTA 4XA5A 2UVVA 3QNNA 4FBUA 3SPZA 2C22A 4HVJA 3VQQA 5IIOA 4O0IA 3AVJA 1BGXT 3HK2A 4Q44A 1ZQLA 1ZQGA 3QZ7A 2GUIA 1VSJA 1Z3EB 3NH2A 4DOCA 9ICNA 5D4BA 2I1QA 4DL7A 5KFLA 3IAYA 5DB9A 3Q8RB 4J9LA 3SQ1A 1HJPA 2JEIA 5J2FA 3DLHA 4IRCA 1XU4A 3SQ4A 1QHTA 2Q3SA 5CA7A 4P4PA 1WLJA 3MDCA 1ZYQA 2P5OA 3FDSA 4FJ7A 9ICOA 1RBUA 3SNNA 3HP9A 3L2QA 2HVHA 3RB4A 5HMMA 2IA6A 4J2AA 4EYIB 5D46A 4RQ8A 3UXNA 2ASLA 4HUEA 4LZDA 3RTVA 5KFEA 3DRPA 3NDKA 5BPCA 4B8AB 4J9SA 4CK1A 4B9TA 5KFYA 5KFGA 4FCYA 5KG5A 4QWBA 8ICLA 2ASDA 1A5VA 3L2WA 1S1TA 4I7FA 1RTIA 1IG9A 3TI0A 1LW0A 3V6HA 3PMLA 1NKEA 3QESA 1Z00B 3QEVA 1BHLA 2ZJ5A 2V4RA 4LH4A 3AV9A 2XCPA 4M04A 5HRNA 4KLFA 3ISDA 2P1JA 5KFSA 4CFCA 4CHNA 2ETJA 1KFTA 2FPMA 1BPEA 4JRPA 2W8KA 2ZTEA 4KHQA 2FLLA 4JV2A 5F9LA 3MFHA 2QKBA 1JIHA 4CJLA 4UB5A 5DK5A 1ZBHA 3TAEA 4DL6A 4UAZA 3ZD9A 4RG8A 4JV0A 5E41A 4F5PA 4CJWA 4FS1A 5DB8A 3RH4A 1SKSA 4BGDA 2XY5A 2WOMA 3IRXA 4QZBA 2NUBA 3U3YA 3S3MA 5J0TA 3JPTA 2RPIA 8ICQA 3KHHA 4R63A 3OYLA 1SKRA 3LAKA 2G8UA 1JX4A 3C6UA 1KFDA 7ICEA 5J2AA 2BGGA 3PW7A 3RAXA 4IKFA 1VSLA 3PX6A 9ICRA 5CYQA 1DTTA 2FMQA 4KB0A 2MAXA 4JS4A 8ICRA 2XY6A 3V1QA 3RR8A 3Q8SB 3TAPA 4QW8A 1KFSA 3OSNA 8ICBA 1DOQA 1NK6A 4YXMA 4BWMA 2ZE2A 1KRPA 3LWMA 1NK8A 4CCHA 3C6TA 1RT1A 3H8WA 4R8UA 4F5NA 8ICWA 3ZT4A 3NGDA 1RT6A 2KZ3A 2PFOA 4QZCA 4QZ8A 3KHRA 4DS5A 4YMMA 1JXBA 3B6PA 2VANA 5J29A 3SQ2A 4F3OA 3V6DA 3RB0A 1S5JA 3ZT2A 2Z1HA 3QEAZ 1TK0A 1RYSA 3LP0A 4RZRA 2PYJA 1LWCA 3TAQA 4GC7A 9ICXA 3QE9Y 5DDYA 4ZTFA 4DL4A 2PFQA 4CF9A 4RPXA 4KN4A 2RKIA 4FJHA 4AHCA 3RR7A 4RW4A 2PXIA 1KDHA 4KLDA 2F96A 3JSMA 4YVZA 1S9FA 1BQMA 1B43A 3MXIA 4P4MA 4IQTA 1QQCA 4MEYA 3HJFA 4FLZA 5FRNA 9ICBA 4CEDA 1JLAA 5KRTA 4JWMA 1IKXA 3SV3A 3GV7B 3KKRA 2V4QA 1TV6A 5KFXA 2QXFA 2XC9A 2R8JA 3LK9A 1XSLA 5TZVA 3OY9A 4I2BA 4QZIA 3IS9A 7ICPA 1ZQJA 3ZSXA 4TQSA 4LSNA 4EBCA 1C0UA 3BQ0A 3FYHA 4ED8A 4K4IA 1RTJA 3LPUA 4CEZA 3OGUA 1VSEA 4J2EA 2GWSA 4ED2A 4W5TA 5HRPA 1UOCA 3ZT3A 2A1JB 3DI6A 1EXQA 1A77A 4L8RB 3MGHA 4W5OA 1S97A 3LPTA 4KLGA 2HHXA 3MR2A 1VK0A 4N41A 1T05A 3UPQA 4CGDA 5J0QA 4RQ5A 4CIGA 3DM2A 1WSHA 4RW9A 4AHRA 4B9MA 5DBBA 3M8PA 4FW2A 2PFNA 1T8EA 4IRDA 3OYIA 1NJWA 2OPRA 3NH1A 5J2HA 3B0YA 4E3SA 3NBPA 9ICFA 1RDCA 1JL1A 5J0SA 4TUQA 3QINA 1Z25A 3WNFA 4RNOA 4KLQA 1DLOA 1HNIA 2B6AA 1S9EA 4EP4A 4CHYA 1NOZA 2ZJ8A 4B08A 9ICPA 4FXDA 4FM1A 4M6WA 3IM1A 2QKKA 2B5JA 1UA1A 5IIJA 3Q8PB 5JUMA 4EYHB 3OVNA 3NAEA 4BXOA 3LANA 1CXQA 4K8ZA 2XCAA 4I2CA 3DLBA 3QERA 3A2FA 2YNIA 4AHTA 3DMJA 3QEIA 7ICGA 1H38A 1X2IA 4CGIA 4DSEA 2HHUA 3H40A 3L8BA 1QSYA 4FK4A 3DRRA 3ZDDA 3KK3A 4LD0A 4LSLA 3VA0A 3AUOA 2HVIA 5KFBA 4XRHA 4I2EA 2HNDA 3EPIA 2FMSA 1TVAA 1HPZA 4F2SA 1J53A 3SI8A 3JPPA 5C24A 4FM0A 1B22A 3H4DA 4K4HA 3O3HA 4DMNA 3DOKA 4F4YA 1QLNA 1SZPA 4ED1A 5L1IA 2IDOA 4PGYA 8ICIA 9ICIA 1B92A 2KZMA 4CESA 3RMDA 4Z0UA 4ZHRA 1UT5A 5EWGA 4FYDA 5HBMA 2LYHA 5DB6A 4ECQA 4KMUA 3KLFA 4KTQA 4KITB 1JLEA 1FXXA 1BPZA 1MSWD 4FJ5A 4YFUA 3ZDEA 3V7JA 4KHUA 2FPKA 4N76A 4R64A 3G10A 4NLNA 4DFMA 8ICYA 7ICHA 5DQIA 1NK5A 4MFCA 1T4GA 4CEEA 4Y1DA 4KFBA 3QETA 1LAVA 2DFFA 1KCFA 1KEJA 9ICWA 4H4OA 2IHNA 3RWUA 4FJXA 1C1BA 3MR3A 3RJHA 4RU9A 1S6QA 9ICLA 3O3GA 4XIUA 1DTQA 2XY7A 4DOAA 3AVNA 4ECSA 9ICAA 1F21A 3GDXA 3V6KA 2G8HA 1REVA 3MECA 4O3OA 3RJGA 1ZQXA 4M41A 3AVIA 1UA0A 2C2DA 9ICTA 2BQRA 3QIOA 1IH7A 4RUCA 4F93B 3AO1A 4YCXA 4YXJA 4J9OA 9ICQA 4M3TA 2IC3A 3KHLA 4CEOA 4R66A 4CHOA 3UIQA 1WCLA 5L1LA 3PX0A 4NYFA 3M8RA 3SPYA 2H5XA 3M9NB 4LVSA 2AQ4A 2XO7A 4OPKA 3ZDCA 1LB2B 3Q8LA 2IMWP 4RNNA 1J5OA 1KVAA 4RNMA 1WSJA 3S9HA 1C0MA 1WSGA 2J6TA 3MGIA 1CXUA 3T19A 3ZSZA 1TAUA 2DPJA 3P1GA 8ICJA 2AQ0A 2P5GA 1V9PA 3RJIA 3KLGA 1ZQPA 4DTRA 2D0BA 1ZQRA 2AGPA 3G6VA 4E7KA 4DTPA 3C95A 1RTDA 1BCOA 4DFJA 4GLXA 2VG6A 4BDZA 3K75D 4W5RA 3SUPA 4PHAA 3TARA 3N4MB 2ATLA 4R8UB 3VQ9A 5KTQA 3PW0A 4RPZA 5CYMA 3SCXA 2PY5A 4CJVA 5I3UA 4E7HA 2Y1IA 5DLGA 3LP3A 1RYRA 5J2DA 1U4BA 2P6UA 4HTUA 4B9VA 1FKPA 4UBCA 3QEBZ 2DPIA 3VQ7A 4QZ9A 4CJFA 1SL1A 2P6RA 2YKMA 1NKCA 1VRTA 1S1UA 1T03A 1LWEA 4DTMA 2VWJA 1JMSA 1J54A 2BGWA 4ZTJA 4PH5A 4NXZA 4NLZA 1X9WA 1EP4A 4J2DA 4FJLA 1K6YA 1GOAA 2ISOA 3WNGA 5CHGA 5CY4A 4FK2A 5L1KA 3SJJA 1SKWA 3AVFA 2JGUA 4CERA 4YMOA 4O3RA 3T3FA 1X9SA 4RT2A 3LDAA 1L3VA 1WCNA 2IHMA 4KLLA 1TL1A 1ZQAA 4PGXA 3Q8KA 3JPNA 2FBVA 5DQGA 3T5HA 4RQ6A 2ZJAA 1U9LA 4IR1A 1G15A 2D0AA 3H8JA 2D5RA 4KB1A 1RBSA 3WNHA 1I39A 2FBTA 4YNQA 2OZMA 3SYZA 2YKNA 4QZGA 2ASJA 1RDDA 3OS2A 4CK2A 1RNHA 1W0HA 4DU1A 4J9PA 2BCUA 2DFHA 4OJRA 3QIPA 5EU7A 2IAJA 7ICRA 2HNYA 1KLNA 5IILA 4EP5A 1Y97A 3EYZA 4DQPA 1S1XA 1ZJMA 7ICOA 5KGWA 4M0AA 2VG7A 4NYNA 2OZSA 4LY7A 5HHHA 5KFUA 1TGOA 4EZ9A 3PX4A 5KG7A 2UVRA 3AO2A 5KFMA 2O4GA 2JZBA 2HHWA 3AA4A 4I27A 1IKWA 3PW2A 1IM4A 4P4OA 3OS1A 3ULDA 4FJGA 5F9NA 2EX3A 5J2MA 3VQ5A 4YQWA 1VRUA 3H08A 1KLMA 4ED6A 5C42A 3K5MA 3SUQA 4IFVA 2F8TA 1U04A 4DFPA 1QSLA 1NK9A 5HROA 1VSHA 3LP2A 4KHYA 4HCCA 4MQ3A 4QWAA 7ICIA 3JPRA 2FBXA 4BXOB 2R8HA 2G8WA 1U45A 1NOYA 1KTQA 4KHNA 5DKWA 5J0UA 4Z4HA 4FJ8A 2XGQA 4HUFA 3C2KA 4PPXA 1XO1A 4B9LA 3WNEA 3ZDAA 4ID1A 4K8XA 3O4NA 4NCBA 5DB7A 4UB4A 3ZSYA 5IIMA 3N97B 3T5LA 1S1VA 1ZBUA 3RRGA 1UT8A 3C2MA 3RAQA 1D8YA 4PA1A 1ZQWA 1XHXA 3KK1A 4DQQA 3TWHA 4IDKA 4O9MA 1JLQA 4DF4A 4CIFA 2C2RA 1HRHA 7ICKA 1RZTA 3T1AA 3VQ8A 8ICGA 3OYHA 1TKZA 1RXWA 3HPHA 3KLIA 4FO6A 3EY1A 2OPPA 1WSIA 2KN7A 4AHVA 5HRRA 5DBAA 4M3RA 3PNCA 4I9LA 3K5OA 4KTZA 3P5JA 1HYSA 2AJQA 3BQ1A 2BCRA 3NE6A 3AVHA 2IOCA 2YNHA 5DBCA 2Y1JA 1S0NA 4DU4A 1IKYA 1ZBIA 2BHNA 1X9MA 4M3UA 5J2BA 1MC8A 2NRWA 4I2DA 5T7BA 5KFFA 4KLIA 3RJJA 1HYVA 3PVXA 8ICEA 3C1YA 1EKEA 4F92B 5DG9A 3MR5A 3C5FA 1TK8A 3OYGA 1N56A 9ICCA 2X6SA 4DTSA 3V1OA 3T5JA 4MF8A 4CFAA 1HUOA 3BQ2A 3ZT1A 4Z6EA 7ICSA 1YTAA 3AA5X 4OKKA 8ICAA 3OSPA 3C5GA 2W9CA 2VA2A 1BL3A 1JKHA 4YR0A 3OYBA 1ZQYA 4DEZA 5EWFA 1JLFA 2I9GA 5BOMA 3L2UA 3LP1A 4GC6A 3T5KA 7ICVA 3ZSWA 5J2PA 3VQBA 1YTUA 3NGZA 1DGSA 4C8NA 2FLNA 1SUQA 3VQEA 1Q9XA 4GXIA 3I0RA 4B3OA 4F5RA 1IKVA 4UAYA 3QEXA 3GFKB 2UVUA 3V9SA 5KG3A 1RDAA 5CWRA 1N6QA 3H7IA 4PHDA 4Q8FA 1LW2A 1N5YA 1RT3A 4CK3A 4PUOA 4YG2A 4I9QA 3PR5B 4UQGA 2VA8A 4QZHA 4F5QA 3OHAA 2ZUDA 4CEFA 3KD1E 5J2CA 3VQPA 4O5KA 2DTUA 2HW3A 3HPGA 3AVAA 3ASMA 2C28A 2BQUA 4Z6CA 4F5OA 3NF7A 4O3QA 4JK1A 1RBRA 4J9QA 8ICKA 3L2VA 4PHPA 1ASWA 3AVKA 4CJ3A 3TABA 2W42A 3DLKA 2IGIA 3RJFA 4E89A 3SUNA 5KFRA 3V7KA 3AVCA 4W5NA 5FROA 1C6VA 3VQAA 3OYDA 4E1NA 1NJYA 3CM6A 1XSNA 3ZDBA 4KTWA 4O44A 1BPDA 1R0AA 5K14A 4MFAA 4KV8A 7ICMA 5KI6A 4I2GA 3EPGA 1Z00A 1RBVA 3AU2A 4I2PA 4HHTA 2Z1JA 3Q8QB 1NJXA 9ICKA 5J0YA 4CGFA 3JYTA 3HT3A 4M3XA 5KG6A 1LWFA 3MABA 3E2EA 7ICLA 3V9UA 1QE1A 2R8GA 4Z4FA 3LALA 1S76D 1W9HA 1NKBA 1TV9A 3F9KA 3ETLA 1RTHA 3G6YA 7ICTA 4FLYA 5DG7A 4CJUA 4PY5A 4I2FA 1ZQVA 4XQ8A 1Z26A 4FLWA 8ICCA 8ICSA 2HMIA 4LH5A 2LSNA 4O4GA 4FM2A 5J0XA 1CLQA 5L1JA 1NJZA 1BIZA 3RH6A 3KLEA 4DLEA 3ZD8A 3CQ8A 5KFTA 2P66A 9ICJA 3KIOA 4CF2A 4IQVA 4AILC 8ICPA 3OYFA 1BIUA 1O1WA 5KFAA 5CZ2A 1T3NA 3BDPA 3OYNA 3EWAA 3HM9A 4YN4A 3MAQA 9ICMA 4KAZA 2FPLA 5KFIA 2VG5A 5DLFA 1JLBA 3C2LA 5KFHA 4B8CA 2W9AA 5KFJA 3RMCA 2OYQA 5KGXA 4Z4GA 2NRVA 3TR8A 1A76A 3GV5B 2RN2A 2V9WA 4CE9A 4DTJA 3M8SA 3OYKA 1VSKA 4BDPA 5KT7A 1Q9YA 5J0OA 3LWLA 2UVWA 4ECUA 2J6SA 1MQ2A 1I3AA 4YFKA 5FDLA 1S10A 1D9FA 5CJ7A 2JZBB 4NLGA 3FFIA 4DLGA 5KG0A 4DSFA 4CHQA 9ICHA 2BCSA 1HQUA 3CG7A 4KLHA 3GIIA 4O3PA 4B9SA 4IRKA 1RT7A 4CFBA 1RPLA 4BACA 1QTMA 4M3WA 4DSIA 1S9GA 2X74A 2BCQA 2A1RA 3QNOA 4O5CA 4CGHA 1XC9A 7ICNA 3SV4A 3V4IA 5J2NA 2FMPA 9ICEA 3VQCA 4DO9A 4CJEA 2HHQA 3HVTA 8ICXA 5HHIA 3ZSOA 4FW1A 3PR4A 3HWTA 4I2QA 1NK0A 5CR0A 3OS0A 4KRFA 4TUPA 8ICOA 4ID5A 1BVSA 3DYAA 2YNGA 5HLFA 1AROP 1BPXA 2JEGA 2XGPA 4O55A 3B0XA 1ZQUA 1LV5A 5EWEA 2ATQA 4C8MA 3U6FA 7ICJA 1HNVA 3KLHA 1HMVA 1K1SA 3V81A 2XY8A 5KG2A 2ZTDA 5KFVA 4KI6A 5J0RA 2OPQA 4DU3A 2BANA 2P51A 4NM2A 3SI6A 3MEGA 3HVRA 4F8RA 4ECVA 8ICFA 2M9NA 4DL5A 5D49A 1VSIA 2DFEA 3LAMA 1Y88A 4NCAA 4YR2A 4CHPA 2A1JA 5SZTA 3CM5A 1KVCA 2NRTA 2HNZA 4CF8A 5HNKA 4Y1CA 8ICMA 2KZZA 3ALYA 2Q0ZX 4JUZA 3JPSA 2E6LA 4F4ZA 9ICVA 4EBDA 2B21A 4DL2A 9ICUA 1JLGA 2BPCA 4P2HA 4DSLA 1MU2A 1NK4A 7ICUA 3CYMA 2FLPA 1S0VA 3RBDA 4DQIA 4CFDA 4Q0BA 4KLSA 4NCGA 5KG4A 4QAGA 5KRSA 3PUFA 2E4LA 3VQDA 4UB3A 5DQHA 3HSTB 1S0OA 4F91B 3THVA 1ZQIA 4O5BA 4UAWA 1TVRA 5J2JA 4ECTA 1S77D 4CJQA 4I2JA 2YNFA 3AVLA 5HP1A 5KFNA 4M45A 4CJKA 5HMLA 2W9CB 2BE2A 2ZD1A 4RW8A 4JWNA 4IBNA 1A5XA 1J9AA 1ZQBA 4FLTA 2ALZA 3NF6A 2W9MA 3RMBA 5BOLA 5KT5A 3AA2A 1ZETA 4OVLA 3NGIA 3MBYA 2OA8A 1HYZA 4I2IA 4Z6FA 1L3UA 1X1PA 8ICTA 2J6UA 4KKOA 4MFFA 1ZQNA 3C21A 4KLUA 4IFYA 3M9OB 3NF8A 1RT5A 3GQCA 2XHBA 3MFIA 2A1SA 3VQ6A 3AVBA 4FJKA 4FK0A 3Q8MA 1XS9D 4JRQA 4KLMA 4XUSA 2X78A 3HL8A 4QZAA 4RW7A 3TQ1A 2MUTA 1GOCA 1RCHA 4DF8A 2KQ2A 5SWMA 5KFDA 3PW4A 1C1CA 1GOBA 4LZGA 4TSXA 3DOLA 3P83D 1L5UA 4QZEA 3E01A 3K5NA 2R8KA 2RDJA 1UWBA 3OYCA 2NRXA 4QZFA 4RQ3A 2BR0A 3QZ8A 3PMNA 3VQ4A 3L3VA 2OPSA 3DRSA 2GBZA 3LDSA 4G1QA 4ELUA 5KFOA 1ZQKA 1WSEA 2KFNA 1EX4A 4HCBA 2PI4A 1RXVA 4FLVA 3NTUA 3MEDA 3V7LA 4H8KA 2FC0A 3DLEA 4Z6DA 3UXOA 2XRIA 1TFRA 4FZXC 3V6JA 1RT2A 4KO0A 4ZH4A 5J2EA 3DLGA 4M6WB 3UXPA 4G3IA 4OGCA 5J2GA 1C7YA 4M3ZA 3CFOA 4RQ2A 1RDBA 3ZSQA 3G6XA 3TFSA 4KI4A 4CGJA 3DLRA 4RQ7A 4RPYA 4OKEA 4DS4A 3V9XA 3OYMA 3JPQA 2Z1GA 4I2AA 3ZSRA 3MXJA 3KKSA 1TKDA 3K57A 5CB1A 4K4GA 3S3OA 5KFKA 1RBTA 2AGOA 2G8KA 2WTFA 1QS4A 1FKOA 4OPJA 4KPYA 4DTOA 4Z4IA 1U49A 1TKXA 4PHEA 4B9UA 1VSMA 4ECXA 3K2PA 1WAFA 5KFZA 4W5QA 1MQ3A 3OYJA 4KLJA 1HUZA 3AA3A 3RBEA 3HYFA 4O3SA 3V9WA 2E6MA 3L2RA 4IQUA 1K1QA 2HHTA 4IG0A 3CFPA 1WAJA 1JN3A 4YP3A 4HUGA 4J9MA 3ORYA 3F73A 4QWEA 3ITHA 5DGBA 2W9BA 3M9MB 1LAWA 5C25A 2JEFA 4JS5A 5J1EA 4ELTA 1U48A 4BWJA 4M9GA 3HPOA 2F1JA 4J9KA 3HP6A 4CJTA 3CFRA 3NGYA 3QEPA 2ITGA 2KFZA 1XSPA 4CF0A 3IHQB 5C5JA 4PGQA 4O3NA 2IBKA 4HYKA 4O0JA 2RF2A 3L3UA 5KFCA 1SL2A 4TUSA 4E1MA 1BI4A 4ICLA 5KG1A 4RQ1A 5KFPA 3JPOA 1S6PA 1ASUA 4KLEA 3NCIA 4IG3A 3TAGA 5CP2A 4YD1A 4DSJA 1VSFA 3K5LA 4RQ4A 3ZCMA 9ICSA 2BPFA 4QWDA 4FLXA 1TL3A 1U47A 3HO1A 1N48A 1KSPA 4KN7A 1COOA 2ZUBA 4F4WA 3KD5E 3AVGA 2NRZA 2ISPA 3ISBA 4EZ6A 4FVMA 4BE1A 4I29A 1ZJNA 4F4XA 3BGRA 4OKJA 4QZDA 3D0PA 4DTXA 4DL3A 5DMRA 4NY8A 2BQ3A 4PQUA 3OJUA 4WE1A 5KT2A 5EOZA 9ICGA 4ECRA 3K59A 4R5PA 2PFPA 5KFWA 1T7PA 3C1ZA 4FJNA 4Z4EA 2PZSA 1VSDA 2I5JA 4BE2A 2ZTCA 2ZQBA 1ZBLA 4OLBA 3OJSA 4FZZA 2C2EA 3GIJA 3NH0A 4JV1A 1WSFA 2FBYA 4DQRA 4Z4CA 2EHGA 2PI5A 3KJVA 4KLTA 2R8IA 4CEQA 3MEEA 3I8DA 1IO2A 1ZBFA 5DG8A 2YV0X 1EETA 7ICFA 4FLUA 4CHZA 4FBTA 4M9LA 2O4IA 4UB2A 2F1HA 3ZT0A 2PYLA 3OHBA 4DQSA 5JS1A 8ICVA 4FJ9A 4DTNA 5J0PA 5DGAA 1TKTA 1D5AA 4M47A 1FK9A 3RB3A 3OYAA 3RJEA 8ICNA 4RQ0A 2G8FA 4CECA 3H4BA 1ZQZA 3K4GA 3GIKA 2BPGA 3O3FA 8ICZA 4CEBA 4DFKA 2AU0A 1NOMA 1RT4A 1L3TA 4CF1A 4ECYA 4FZYA 5KT6A 2VA3A 4X5VA 3K58A 2JLEA 2KTQA 4ELVA 1C0TA 2YHBA 4CJPA 4M9JA 4MEXA 4AHSA 4QOZB 2B4JA 5L9XA 3D45A 1ZQFA 3O4QA 2VWKA 2IS3A 1B9FA 4F3TA 8ICHA 4Q45A 4N5SA 4KREA 3GIMA 1BPYA 3BQTA 4UB1A 3NF9A 4MF2A 4C8LA 1EXNA 3SUOA 3ZSVA 4BDYA 3HX0A 4E7IA 3PV8A 4GMJB 4F50A 3HXMA 5J2IA 4GXKA 3KK2A 4J9NA 2AGQA 3V1RA 4QWCA 4BE0A 1SV5A 1BQNA 3IG1A 2KW4A 4FJIA 3TAFA 1SL0A 4PWDA 4DOBA 3AVMA 3B6OA 5CZ1A 2MUTB 3NHGA 2QK9A 1L3SA 4FS2A 3G0ZA 4Q8EA 4M9NA 3S3NA 4F4KA 3H8SA 1ZQHA 2BKEA 2Z1IA 3NFAA 1HJRA 2X6NA 4J9RA 1TAQA 1JLCA 3C23A 4F2RA 3PY8A 5J2KA 4MFBA 4RUAA 3U3GA 4CEAA 5I42A 1YT3A 3TAMA 5J2QA 2ZUCA 4H4MA 4Q5VA 1IXRA 2OWOA 3AO5A 1XHZA 1Q8IA 4N56A 4EEYA 4E7JA 4DSKA 4IQWA 4RT3A 2F1IA 1BPBA 3VN5A 3UQ2A 2RDIA 4M9HA 3EZ5A 5D3GA 4NLKA 3QEWA 1HQEA 4TQRA 1XWLA 4FJMA 1BISA 3AO3A 4GW6A 3OYEA 4DG1A 4YMNA 3M8QA 1S1WA 3GILA 5KFQA 3UQ0A 5IINA 1A5WA 1D8LA 4C8OA 3TFRA 4CJRA 4AH9A 2G8VA 5JS2A 1TK5A 4DTUA 3QLHA 3MDAA 4KHSA 4E7LA 3V9ZA 4AHUA 1C1AA 4CGGA 3RMAA 3I0SA 1CZBA 2D0CA 4CJSA 4FJJA 3RH5A 4B9NA 5KT3A 2R7YA 3AO4A 4CJ5A 4YR3A 1S0MA 8ICUA 1CEZA 3HW8A 1KVBA 3MXMA 1ZQSA 5J0WA 4EBEA 1ZQCA 4JLHA 3LZIA 4I2HA 2F8SA 3PW5A 4M3YA 3ISCA
chains in the Genus database with same CATH superfamily
3N6NA 4CZFA 3CMAS 3HVWA 4LFBK 1A6LA 4NL5A 2WF9A 1ZQDA 2YNHB 3C8YA 2W9BB 1VJ5A 1XN9A 1D9DA 3DCAA 2M9KA 3SQ0A 1WNSA 1OQ3A 2G8IA 5J8YC 1B9DA 3CXCM 1NAQA 4CJ4A 4LR9A 3GYNA 2DY4A 2LBOA 4V19J 3S8SA 4B1ZA 2W8LA 2E8OA 2IM0A 1BCMA 3SZ2A 5HP4A 1ZQEA 4HT7A 5ALXA 1NZ8A 4OGEA 4ECWA 2KRBA 1BI4B 3CCEN 3BJYA 5LMNJ 2K60A 3TANA 3G6ES 4ZVPB 4KLOA 4IG3B 1JXLA 3MR6A 1X7VA 1GQEA 1S5LU 1NGAA 1CUKA 4K7QA 2CPJA 4ECZA 2EFQA 2APOA 2B9XA 2GCFA 1JKHB 4ISGA 4A4JA 1CRXA 2CGJA 4KPCA 3TUPA 5LL6Z 1RHQB 3LZJA 5JTIA 3PO4A 3AU6A 4PKHA 2CG4A 3E1YA 2ES6A 4ALZA 4DV7F 4UARA 3D0HE 2HB5A 2BDPA 5HRSA 1ZQTA 4Y2YA 4QYRA 3QNNA 2QARA 4FBUA 5C2DA 4CGZA 3SPZA 5D0RA 2GWKA 3HHLD 1WC6A 2IJFA 3CEDA 4QU7A 1U25A 2GUIA 4J7CA 3GTYX 2YX1A 3KJNB 2NYVA 4DOCA 9ICNA 5D4BA 2I1QA 4WYBA 5KFLA 1WUDA 2LDIA 3IDWA 2VFVA 5LXYA 2FVQA 4C0ZA 1WKKA 2BVZA 1NZAA 1P9YA 4NPOA 3PYGA 4H0TB 2ACYA 4PKIA 4L73A 5M2UA 1MA7A 2F3NA 2DXFA 1G6BA 3DLHA 4Q7AA 1NNDA 1XU4A 4MLHA 2IPOB 2EK6A 1H3DA 1QHTA 1VMBA 1NZPA 1JMTA 5ALZA 1WLJA 4U67Q 4JI8K 2KN4A 2NSBA 1RKIA 5AICA 1XR5A 1VC0A 3L2QA 3RB4A 1NPPA 1TTHB 3F5AA 5D46A 1F6TA 2RT3A 4BVPA 2ASLA 4OX9J 2WSEC 3RTVA 4DJBA 1FCAA 5BPMA 1FK9B 3NDKA 4CF4A 2IM3A 5BPCA 2K06A 2W25A 4LQ3A 4J9SA 4B8AB 5KG5A 4QWBA 8ICLA 2ASDA 3OL9A 4B1VA 3L2WA 1S1TA 3BH7B 3N01A 3CC2N 2KXHA 2FE9A 2X1AA 3TSUA 2JSXA 1X4DA 2WF8A 2RP5A 4WFNQ 5EUHA 4H03B 4NJ8A 4LH4A 2XCPA 2AHOB 2W03A 4JI4J 5HRNA 2ODGA 4DCOB 1FJEB 2P1JA 3C19A 3SSRA 1IG6A 4GO5X 4G1IA 2WHEA 1SJ3P 4JRPA 4LFBF 3FUYA 4B3MF 4KHQA 4JV2A 5ALWA 4DV2J 2BRKA 2BX6A 3HKZF 4DV5J 3JQKA 3T9ZA 1NRKA 3QJJA 2ASPA 4UB5A 1T3OA 5DK5A 2B0CA 3FCVA 3U7JA 1ZQ1C 3TAEA 4QS7A 1XNRK 3J80U 5E41A 3CCUS 1SKSA 2XY5A 2CH5A 2E5IA 3TTCA 2ZDOA 3U3YA 4WF9Q 3S3MA 3P8BB 3JPTA 2A0FB 1Z6RA 4JI6F 4R63A 2RU3A 2PDAA 2P9LB 2MDAA 2G8UA 7ICEA 2R2RA 1V85A 2BGGA 3PW7A 2VGMA 1VSLA 3PX6A 1DTTA 3CCWA 3O1WA 2ZXIA 1M1GA 1NMEB 3HHLB 4JS4A 3VESA 1ZC6A 4MT1A 4B3RF 3RR8A 2RJZA 2DNMA 4USIA 4C0BA 3AJDA 3OSNA 2XZTB 3VCDA 2EBEA 1TFYA 3LWMA 1NK8A 4CCHA 4QIEA 4Z2XA 3EXCX 1PJ5A 5IXUA 4R8UA 2OJ3A 1Q79A 3MN9A 1K8KB 3PNIA 5BYSA 5I42B 4DS5A 2HCFA 1URJA 2E1PA 3H59A 1N5TA 5GAEP 3UE5A 4F02A 1SZ2A 5HI7A 5HL7L 1TK0A 2G0CA 1NCLA 2PYJA 2ZM6J 2UXCJ 3BY5A 3QE9Y 3BS9A 5AIAA 2DHAA 4ZTFA 4J9VA 4IUFA 2PFQA 2V67A 3I5BA 3V4IB 2RKIA 5J2NB 1U09A 4AHCA 2PXIA 1KDHA 1TYQA 3NL0A 2Z2ZA 4YVZA 2VYPA 1WHYA 2YCHA 1G3OA 1LXNA 1FDNA 2WVFA 2ZHAA 1BLUA 1UW4A 1QQCA 4CBUA 2E5LK 3HJFA 4FLZA 1VDVA 5FRNA 9ICBA 1JLAA 2ZH5A 3SV3A 1PBUA 4JV5J 1RP5A 3GFXA 1JI7A 2QXFA 2R8JA 2YMPA 3A0IX 3GDQA 2BM1A 1WEZA 1R89A 1P27B 4I2BA 3OY9A 3K1RB 2H3IA 7ICPA 1ZQJA 4A47A 4TLQA 4TU7A 3M2RB 4AQYJ 5ADXH 2LI6A 3FYHA 4K4IA 3D6HB 4LVOP 2ZWOA 3IWLA 3RBZA 1K44A 4IKAA 1GX6A 4BG9A 1QH9A 4OYZA 1VSEA 4J2EA 2GWSA 4PG5A 3WKEA 2YPZA 2XS2A 4DX8H 4W5TA 1CBKA 5HRPA 5GINA 1I3OB 5F8IA 1QAYA 3RYLA 2A1JB 1EXQA 1A77A 3MGHA 5KL1B 1XNRF 2HNZB 4AYBF 2B9WA 2HHXA 1VK0A 1HNXK 3GG4A 4N41A 4CLUA 4ZPDA 1VQ5N 4CGDA 2C3PA 1LK5A 4CW7B 3G82B 2BJ3A 3C6AA 2UUCK 2DGZA 2W01A 3DM2A 4RW9A 4AHRA 3TNVA 4ERDA 3I4PA 4ZVUB 1T8EA 2E2NA 1GEHA 3TADA 1WNEA 1DQ9A 2F44A 2OPRA 2J9CA 3EE3A 5FPMA 3NBPA 5J0SA 4TUQA 3NMRA 5ALYA 1Z25A 4CH0S 1YHQS 2ZJQL 1TVRB 5D4OA 3CJKA 2B6AA 3VGKA 3F0NA 4CHYA 4C98A 2ZJ8A 4PXDA 9ICPA 3BR8A 1KHVA 5HP1B 4OZNA 2M0GB 3MTKA 4NOHA 5ALOA 5CAAA 4IEIA 1KVKA 4RTFD 2RILA 3IKMA 1HEKA 4BXOA 3LANA 3H2LA 2XCAA 3DLBA 1K0TA 1B3TA 3A2FA 4TU8A 2YNIA 4OI2A 1T9XA 3HKZC 2FHOB 1E6YA 4DOZA 1VQNN 4DR4F 3QEIA 4K5SA 4C3KA 1SV0A 1H38A 2EZYA 1VQON 1EQ0A 2O67A 3GCXP 1QAXA 1XNSA 2QFIA 4D3HA 3DRRA 4LJMA 1Q95G 2JOQA 4OJ1A 1PCAA 1ED1A 2HNDA 4WWSA 2N82B 3OR2A 1TVAA 1BU6O 5HMWA 2GO7A 3SI8A 4NLVA 4EK2A 2E5LF 1UWBB 4OJ6A 4FM0A 3O0FA 1B22A 4K4HA 3ET6B 5E3AA 1HNWJ 3OT9A 4DMNA 3TZXA 5DM6Q 5FLXY 2E29A 5KOXA 4ANEA 2OI2A 5L1IA 2CWKA 4NLSA 1Z19A 3MM7A 5A2QO 2OPSB 3PHEA 1B92A 2KZMA 1N5QA 4CESA 2LQBA 4Z0UA 2GVDB 3WX8A 1NSQA 4FYDA 1U26A 2P9IA 2V4JA 2X3GA 1FE0A 5ETPA 4KITB 1J5EF 1MSWD 2PIIA 4YFUA 4DR5F 4DXLA 4R64A 5BJRA 4NLNA 8ICYA 4I7FB 1LW0B 4HAIA 4Y1DA 4KFBA 4M5LA 4NWIA 3MR3A 3RJHA 3CE8A 1FKAF 3NRZA 4HT5A 3A5NC 4LMZA 2GWJA 1DTQA 2XY7A 3AQPA 4FWRA 4ECSA 4NI2B 9ICAA 3CJ1A 2QLFB 4P9SA 2VASA 3DXKA 3MECA 4ZIWA 3AVIA 4JI2K 3CDUA 2C2DA 5D77A 5EY4A 5FP0A 4ZOSA 2DRDA 4JB8B 4F93B 5CQGA 4YCXA 3THTA 2OFHX 1Z1BA 2J0SD 1L7PA 1YJWN 3KHLA 1ZAVA 3OTOJ 4R66A 4CHOA 1RSCA 1S57A 1XK8A 2OUGA 5AQRA 3VTHA 3RBXA 2B43A 4OO1J 1ZRMA 3M9NB 2Q1LA 4G6VB 2AQ4A 2VPXB 3ZDCA 4OI0A 4BRLA 1J5OA 2J6TA 3IR5B 5HQMA 8ICJA 2L9DA 4DTRA 1QVGM 1W2BM 4CLTA 4BC3A 2BACA 1N2XA 4JYAJ 3Q2SC 3EN9A 1BCOA 3OW2R 1TAMA 5C25B 4GLXA 3AA9A 4W5RA 2YN4A 3WC0A 4DV3J 1P8GA 4BRKA 4PHAA 3N4MB 3VQ9A 5GADP 4AYBC 4C8YA 4NZ7A 2PY5A 4CJVA 2MKHA 3JS6A 3TUJC 2Z30B 4FE3A 2NSCA 1RYRA 1KC8T 4WXWA 1U4BA 3GZ7A 5A8RA 1WG1A 1RG6A 3GP9A 3GG0A 3PKYA 2DNKA 2GIFA 2B51A 3TZWA 3MF5A 3L3CA 3I56S 1NKCA 1S1UA 2MLXA 4P2MA 4X64K 1LWEA 4DTMA 4EHUA 4PPDA 4PKDB 3VPZA 1J54A 1KL9A 3VQSA 3KFUF 2I7NA 4NXZA 3P39A 4A61A 2CNLB 3ONQA 4A2AA 3I76A 4J2DA 4FJLA 2JH3A 4NXMJ 1GOAA 1X40A 1HR0K 4LFAK 2LQ8A 2CPDA 3D54A 2ZJRL 8ATCB 2QZ8A 4J91A 4CERA 3I9V9 1X9SA 4DV0J 1L3VA 2ZVSA 3HBTA 2O8EB 4OZJA 1GTEA 4PQUB 5AQJA 3MGVA 4PRFA 2VQEJ 2WW4A 2GX9A 4XPEA 5KQDA 1YGYA 4YB7A 4IR1A 2ZIWA 2GTDA 2D0AA 3H8JA 4YMEA 2D5RA 3ZFVA 1IG8A 3KJVB 1I39A 4YNQA 1QVFM 1YRUA 4UUWA 4DZ6A 4Y2UA 5A0LA 2MQ8A 3NGSA 1K9MO 2DFHA 4Y2XA 5D8HB 5GAHP 1EQMA 4WP8A 3H0MB 2XBPA 3ZX2A 5CH7B 1YIJN 3EYZA 4DQPA 1S1XA 5KGWA 2H5JB 5KFUA 2JX2A 2WAQD 4X65K 4EZ9A 4P0PB 6AT1B 3E58A 5KFMA 2P9SB 5DRKA 1R27B 3AA4A 4I27A 3GIRA 2LM4A 3ULDA 1Q8BA 4UZBA 2DVIA 3GFZA 4JNEA 1L7OA 3RUBL 2A2DA 4M7YA 4LRBA 1CS4A 3M6XA 2W7OA 3CJ3A 4AL7A 1N36J 1QSLA 4UOGA 2EEYA 1NK9A 1YRXA 3ZZUA 1ZAWA 5HROA 1CJKB 1R8PA 2FBXA 2LYBA 5LMUK 4RWWA 1NOYA 3M2VB 2V8PA 4KHNA 4Y2SA 5DKWA 4I6AA 2E20A 3CJBA 4Z4HA 3KK2B 4RBUA 3EWGA 5A76A 3RZAA 1XO1A 4B9LA 2RNEA 3WNEA 2NCKL 4K4UA 3ZDAA 4ID1A 1HI1A 4K8XA 4NCBA 5DB7A 2Z2LA 3ZSYA 5IIMA 4RBTA 5I3PA 3N97B 1FD8A 3KK3B 3RRGA 3CCVS 3C2MA 4YDDB 3KK1A 1EB0A 4O9MA 4H0YB 3AD7C 3I87A 7ICKA 5AJ3J 1RZTA 1OXJA 4LFAF 3JSYA 4A62A 2H65B 2OPPA 5ETLA 1R8CA 3L6QA 5HRRA 2L9NA 5DBAA 4J5OA 3LQVA 2FHKA 3UCGA 3WIUA 2ILZA 4OQJA 1MN8A 3K5OA 3PEHA 2AIRB 3W2WB 2AJQA 3NE6A 2XLKA 4YDUC 1TUGB 2YNHA 3NS6A 2MGZA 1X9MA 1L6NA 3VALA 3BB5A 2NRWA 3NGTA 3RJJA 4LF5K 1HYVA 3PVXA 8ICEA 1DAXA 4X4RA 2YXLA 2YKOA 2HAFA 2FIUA 3W9IA 2A6MA 5AQKA 2WFBA 1SJ4P 5CA5A 1S6QB 1BWEA 3MR5A 2HHPA 1KOHA 4RNHA 3BZCA 5DZ7A 1AT1B 1FJGJ 3I28A 5G5GA 3V1OA 4MF8A 1P9QC 3GBTA 4O4RA 3ZT1A 4DR6F 5AXMA 1R59O 1Q81O 1REVB 3CC4N 3HRGA 3NS1A 5MLCQ 2RMLA 3UPFA 5ALGA 3AQFA 1JKHA 4X65F 4DR2J 2J0QD 3EE8A 4YR0A 4H4KA 3LGNA 2R7SA 5EWFA 4FNHA 1FDDA 5BOMA 4WZMA 1TMJA 2ITMA 1NWKA 3L2UA 3T5KA 2IVFB 2ZWPA 4P2FA 3TQEA 1WC0A 2FVPA 1DGSA 2WHOA 4FPIA 2FLNA 2A3VA 1Q9XA 1N34K 3BSAA 3C28A 2XYHB 4UAYA 3QEXA 3ZZPA 3GFKB 1N6QA 1LW2A 5B0DA 2Y9HA 1RT3A 3UDLA 4XO0A 5AR0A 1OW5A 5BRDA 4FVUA 2LXFA 4UQGA 4DV6J 1M6YA 4QZHA 4KHRA 2RDDA 2W54A 2JC0A 3VQPA 4A8KA 2DTUA 3B4DA 3AVAA 1DHMA 4F71A 4O3QA 2FJEB 4A8FA 4BRGA 2BW2A 1RBRA 4DV1F 5CYMB 2DITA 1YIJS 3TABA 3VWSA 2UXDJ 1XEZA 1A7GE 3NGUA 4W5NA 2QYGA 3VQAA 2FHJD 3CM6A 1XSNA 4KTWA 4O44A 5A2QU 4XH5A 3GL1A 1R0AA 4BRDA 3SEIA 2GC8A 3I5AA 3QBCA 4KV8A 3EEQA 4I2GA 1WHVA 3UFCX 3QO9B 1JJ4A 1NJXA 2V2VA 9ICKA 3HT3A 4IFEA 2HF4A 1EJ7L 2Q36A 1B0TA 4AXJA 3V9UA 2W3SA 1QE1A 1CSJA 4Z4FA 1ATSA 5TISU 2KD1A 1W9HA 5T41A 3AY9A 3VOVA 5IM0B 3S6EA 3NY0A 3BEGB 4LFCJ 3TJ8A 1TV9A 3EGWB 4HDHA 3TA2A 1RTHA 3VVUA 2PE8A 4CJUA 4DHYA 2DGWA 1Z26A 2I6WA 4GKKJ 4LF5F 2HMIA 3QFHA 4LF6K 4P73A 2HMXA 2LSNA 1HPMA 1CLQA 4MYUA 2YY6A 2LHTA 3ZD8A 1S79A 1VHFA 4USTA 5KFTA 2P66A 4CF2A 2P9LA 1VBZA 4IQVA 2AW0A 3LYSA 4FPRA 3UD3P 2FC8A 2IA0A 2XEXA 1O1WA 2HQDA 1T3NA 3BDPA 4Q2MA 4OJGA 2A6OA 3MAQA 4OV1A 3FRYA 5KFIA 4XH4A 4MKBA 3K0JA 3C2LA 5KFHA 2HFVA 5F2RA 4B8CA 3QU7A 2W9AA 3J80Y 3PSTA 2GA7A 2NRVA 3IG8A 4JI0F 1UZHA 1A76A 3GV5B 2RN2A 2C2OB 2V9WA 3BREA 4QIVA 3NKYA 6FD1A 1N34F 4E2FB 2E5HA 2K7KA 1HKBA 2XIDA 3U1MA 4J8FA 2RQ5A 5CJ7A 1SQEA 1YITN 3UCUP 1WEYA 2FTRA 2QA4N 4DUYK 3AT1B 2CQCA 3BS5B 1YJ9S 4Y2IA 4MIAA 1RPLA 3A5OC 4IDHA 2BCQA 2CIMA 2YTUA 5CABA 3QNOA 2GQ2A 4IFVB 2XM3A 3V4IA 5ALRA 5J2NA 9ICEA 2FJDB 3LP2B 8ICXA 2UV8G 5HHIA 2PMZF 4B3SJ 1IBLK 3PR4A 3HWTA 4I2QA 5B09A 8ICOA 1Z1VA 4DV4F 3EZWA 1WDDA 1V3RA 4WJ3B 1BVSA 3I4HX 1LEOA 5J1NA 3MMJA 1XMOF 1Q1KA 4RBVA 4DR3J 1RABB 2JEGA 2OEJA 2JMGA 2ZH9A 4CTAB 5GIPA 3UDVA 1LV5A 3Q7BA 2R18A 1T9VA 1TR0A 3KLHA 3NRWA 3V81A 4ILHA 4PXCA 4F36A 1UEVA 4X66J 1JLQB 1U1NA 4DU3A 3HVRA 3C46A 3LDPA 4F8RA 4ECVA 4MH8A 1TKZB 1X4EA 3UWTA 8ICFA 2YTCA 1IXKA 2ZF5O 3D6RA 1FD2A 2HHHF 2A1JA 5SZTA 1YSJA 3VTIA 3TZZA 5ALEA 1MG7A 3E9PA 1R0CB 1M90T 2HNZA 5A0YB 1F5SA 4LF8F 4Y1CA 8ICMA 4LF6F 4DHVA 1RFQA 3JPSA 2ZHBA 4KHPK 3FZBA 9ICVA 4X2BA 1HWLA 3WXKA 2B21A 9ICUA 1JLGA 2OP5A 2F8LA 1IKYB 2D3DA 3C14A 3MD3A 2ADCA 3A0BU 4ZPWR 2IVMA 4F7VA 1MROB 1VQ9N 4ZA1A 3G4SN 2CUYA 5AQNA 2J9EA 1WG4A 1R31A 4GIBA 3VQDA 4K43A 3OTQA 3D2FB 4F91B 3THVA 1TVRA 1KP6A 2XZDB 3UCZP 4F3QA 4CJQA 4OHXA 1DFDA 3OL6A 3Q8YA 4KX5A 4HACA 5HP1A 3AVLA 4CJKA 5ETRA 4BR5A 5ALUA 2JVOA 2W9CB 1PIEA 2HZAA 5M1QA 1A5XA 2ALZA 2W9MA 1JLFB 5BOLA 2LM1A 1LFPA 3K8WA 3OPXA 2EBGA 1QCKA 1D3WA 3UD5A 3MHYA 4DUYF 1L3UA 1X1PA 8ICTA 2W4DA 4MFFA 3M9OB 2CJ9A 2QI2A 4JK7A 1IKVB 3MFIA 4C6AA 2G2ZA 1Y11A 2MB0B 7FDRA 5AM2A 3W66A 3DI6B 4IOCL 1FO1A 4RW7A 3TQ1A 1S3XA 4WTOB 4DF8A 1KAZA 1RCHA 5KFDA 1AYEA 2XMWA 4LF4K 1MA9B 3ID6A 2F77X 2RDJA 4UZCA 3C0BA 1UWBA 2WB4A 4QZFA 2PA3A 1K47A 3QZ8A 5DETA 2GFFA 1RGIA 1N33K 2OPSA 1H72C 4KSEB 5AKGA 1HLWA 2GVDA 4A2BA 5KFOA 2KFNA 3ZTQA 4YHHF 3MD1A 5HANA 1RXVA 4FLVA 2YBVA 2GQCA 4NXNF 1HNIB 2XHCA 2XWXA 2W2PP 5K14B 4XDDA 2KVCA 3V6JA 4KO0A 1H1VA 2OTLN 3QB0A 4M6WB 1YI2N 3WUHA 3H1QA 4ZLJA 4WFAL 1F0MA 2IMOA 2B5JB 3JYTB 1C7YA 1X5PA 4G9BA 3CFOA 3H20A 4IOAQ 3ZSQA 2VBWA 3G6XA 1ZTWA 2LQ9A 3BYPA 4CGJA 4DS4A 3V9XA 3OYMA 1VLBA 1Y7PA 1YBUA 4I2AA 4OYXA 1S22A 1X60A 4F0HA 1M0SA 5JVHQ 4C3MA 5KFKA 4DBQA 3TEGA 2I2YA 2PMZC 2OEKA 1IR2A 2MKCA 2WVCA 1QS4A 1FKOA 4DR1J 2ZC3A 4M8LA 4WJBA 1OY9A 5AI0A 5IT0A 4XTTA 4C4SA 5M1NA 4NLCA 3W5ZA 1WAFA 2LA4A 4PWUA 2KVIA 5ETMA 2BE7D 1HPZB 1R6YA 1OQ6A 3OYJA 4KLJA 1UJ5A 3AA3A 2K4PA 2H48B 4C1NI 5JJBA 5AM0A 3ZTRA 2NYIA 2HWTA 4JK9A 1VQMN 4IQUA 5AQMA 2HLTA 3M6GA 1TL5A 2KK0A 4QWEA 3ITHA 2QWMA 1LAWA 5C25A 4X62K 1FVQA 2JEFA 3HI0A 4BWJA 4M9GA 5ETVA 4MKAA 4WF9L 1KW4A 3HPOA 1Z2LA 4J9KA 3HP6A 2ZH6A 3QEPA 4NRUA 3P3DA 4C1NK 2YB4A 3IHQB 5C5JA 2IBKA 4L74A 2RF2A 4BX9C 5KFCA 2IY5B 1SL2A 4TUSA 3Q22A 2K8GA 3NCRA 2U2FA 4E1MA 4KB7A 3D4JA 3EICA 1RM6C 5KG1A 4LF4F 2WW8A 4RQ1A 3O08A 1RT7B 1BOTO 4CBWA 1IQZA 5AXKA 3NCIA 3PLAA 2M0NA 2RAQA 2C3YA 2GHVC 2JWLA 4MK8A 4YD1A 1X4CA 4KIAA 3K5LA 4RQ4A 3BR9A 3OFHA 2HSEB 2KVQE 3H8YA 3HVTB 1N33F 2BPFA 4QWDA 4JKBA 4FLXA 3AM9A 1TL3A 3BBFA 3NLCA 2HSTA 1N8RT 3JSBA 1EAYC 4KN7A 3HHKA 1DJ0A 1N32K 4UY8O 3KD5E 2AV5A 2ISPA 1RWVB 3ISBA 2C2ZB 4KGVB 4EZ6A 4K4ZA 4I29A 2B4VA 4F4XA 3BGRA 1VC5A 2P9PA 2E1FA 4QZDA 3D0PA 1HHSA 5E33A 1FRHA 3UW1A 1B64A 5DMRA 4IZ9A 4PQUA 1Z4UA 1WSRA 2MKSA 3MM8A 2PFPA 2BYCA 5KFWA 1HNZK 2V8DA 3DOMB 2O3DA 2ZQBA 2OPQB 4OLBA 3DXMA 3OJSA 3UB5A 2C2EA 1Q7YT 4JV1A 3MEGB 2RH3A 3KG4A 3UKUB 3KJVA 3IG5A 1EKSA 3VF2A 1YVNA 3L0QA 5CHIA 2SXLA 4ZJQA 4Y2QA 2AJ2A 4JHDB 4B3TF 4UB2A 2F1HA 2VU5A 2CQHA 3O9SA 1HHTP 1WOQA 2EAPA 2PYLA 1KN5A 4OYAA 4DQSA 4NLTA 2V9KA 4FJ9A 4DTNA 3MM9A 3BKFA 4GVBA 2Q4TA 3R1HA 3NMAA 1D5AA 2MZTA 1FKPB 3MX5A 1Y5LB 3H6EA 1WJ9A 4JKGA 2PO4A 3RJEA 4YB1P 4CECA 1FWKA 2YKMB 4NCGB 2G9OA 3N7RC 8ICZA 4ILRA 1W97L 1T03B 1NOMA 1RT4A 4B1WB 2VA3A 1UAWA 1S7HA 4M5NA 3MMBA 3VEYA 3K58A 2JLEA 4X4NA 4ELVA 3MUMP 1C20A 2VBYA 4MEXA 2YNFB 5B0CA 3UE2A 2VIHA 4QOZB 2B4JA 4LF9J 4ZPTR 3BYRA 2LYAA 5ALMA 2UZAA 2D41A 1KHWA 4M5HA 2KHOA 4ZVQB 1VQ8S 2EWSA 2E7XA 4RUHA 4KREA 4QIWD 5A6PA 2A2CA 3MM5B 3LTOA 4ZLLA 4YOTA 1NGIA 4C8LA 2OIHA 1EXNA 2YKPA 1C4CA 4E7IA 1OO0B 3GFHA 3FBEA 3HXMA 2RLTA 5J2IA 3AOCA 3KK2A 1HJOA 4WCEL 3HD2A 1RT5B 3LA0A 3L4QA 3KWIA 1HARA 5LJVA 2UUBK 4QWCA 3IG1A 2CA9A 5H9FK 4DOBA 4LBIA 3DLLQ 3B6OA 2IIHA 2JR5A 2QK9A 2QA2A 1L3SA 3QT7A 5AI4A 3FBCA 2ASMA 2NUHA 3ZNUA 4Q8EA 3S3NA 1FJCA 4H0OA 4CJ7A 5T7LB 1SWVA 1RAOA 2Z1IA 3NFAA 1J2VA 2IBOA 5BN9A 5J8YA 1AQ6A 5ETTA 1A6SA 3ICXA 5HR7A 3RGIA 2K8BB 4MFBA 3A5MC 1AA1B 1OS5A 2BJ1A 1PYOB 4F3MA 1YT3A 5J2QA 1Q8LA 2GJ2A 3J7ZO 3PIOL 2Y9UA 2ZUCA 3C16B 1IXRA 1HNZF 2OWOA 3T1YF 2UU9F 1XHZA 4UQTA 4NLPA 2J7KA 5G5HA 4EEYA 4E7JA 4DN0A 2QXLA 1EZZB 1V9OA 3R5CA 2O5DA 1RT2B 2F1IA 5C42B 1BPBA 5AE2A 1BA0A 3EZ5A 5DZ6A 3UVJA 2RS2A 3RSEB 4JI1J 5DM6L 3QEWA 4X4QA 1HQEA 1ZRNA 3AO3A 2DHHA 4KH0B 2WFAA 1NSPA 5FJ4A 4USWA 2GVZB 4C7QA 1SZHA 2F4VK 2MLYA 3HHDA 3D68A 1SC3B 2EG1A 1JNRB 2B7CB 4C8OA 4JAXA 2CQ3A 3MAAB 4AH9A 2HS3A 4USKA 3R7SB 4USUA 1NHUA 1TKXB 3QX7A 1CVJA 2KV2A 1VQ7S 3A1YG 4BBYA 1C1AA 1DQAA 1CZBA 3N5FA 4BCAA 4Y65A 3TA0A 3OTDA 1YTYA 4FJJA 5IT9O 2R7YA 2DR6A 3UM9A 3KLIB 2MQOA 3FEYB 5F8NA 8ICUA 3BM7A 3HW8A 3MXMA 2C3OA 1ZQSA 5F8JA 1BUPA 4WBFA 3TWZA 2EFVA 3B6BA 2H54B 3WK7A 2C2MB 3PW5A 5LMNK 3ISCA 1HYSB 3WKAA 4M2YA 2LQJA 2K3IA 1UWAA 4GVMA 5FRMA 2HHSA 3A8YA 4C11A 3OV7A 3AAQA 1AUSL 1RI7A 4DZDA 2V63A 3KHGA 3MI7X 3FC4A 1ZQMA 4KBOA 3UMGA 4EAHD 3ISNC 4I28A 1K0VA 4ED3A 1ZQQA 3LM9A 4C4WA 1YJNN 1Q78A 1GMVA 5DDMA 2HHVA 1N88A 2WONA 1S12A 1VIXA 3POTA 3PSIA 1V97A 5IIKA 2EFPA 2HI0A 3BUZB 4KHWA 4ICLB 4I64A 1ASVA 3H7HB 3W64A 1HI0P 4CIEA 4OI3A 4Z94A 3SAHA 3A8EA 3CDBA 7ICQA 1F1BB 1RU2A 3QO9A 3OUYA 2BCVA 2P6TA 1WKLA 3RJKA 4Q43A 1SWWA 2WCXA 1RILA 2QO3A 3IGVA 2QMUB 1EKRA 3PO5A 2JFKA 4IR9A 3LP1B 4XA5A 3VEWA 3GZFA 1MNEA 1R8HA 3MX2A 3O1BA 5AKZA 5IIOA 4O0IA 5F0UA 3AN1A 2E2QA 1GMWA 3UN2A 4FKXA 5M2PA 1SGGA 5A2QY 3VETA 3OFGA 3JTNA 1WEXA 3CD5A 3IAYA 3T7ZA 1F3FA 3ATUA 2I5JB 4OX9K 4Y00A 3THXA 2JRZA 1PG5B 2YHWA 1EWQA 8RUCA 4RL1A 2IM2A 2RHQB 3PM9A 1OH8A 4OV6A 3CCLN 5C0YA 4ZLNA 4NEYA 2F4VF 4IRCA 3MEEB 2IRYA 1VJQA 3PSPA 3MMAB 5ALDA 4ES3A 4JI4K 2DRAA 1RBUA 1SJQA 3IAS9 3QPIA 2Z8QA 4K5RA 2B56A 3E0FA 4FOEA 1IV8A 1RDRA 1KXPA 1TKTB 4DV2K 2GELA 4DV5K 4LZDA 3W3SA 1LNQA 2L48A 4M5JA 4PPZA 3HTVA 1U2VA 4FCYA 2E88A 1RTIA 4FWKA 1IG9A 3V6HA 3PMLA 1GK8A 3QESA 2YB1A 3QEVA 4C8ZA 2ZJ5A 2DNYA 2VQFF 3AV9A 4M04A 4NLBA 1S59A 4LQ9A 4KLFA 5HJXA 2VFTA 2CZ9A 3ISDA 1LWFB 4P74A 4CHNA 2RE1A 5TKWA 3BS5A 1BPEA 2FLLA 2L08A 2VPZB 1EO1A 2W2OP 3AQEA 3HSJA 1JIHA 4URSA 3CJ0A 5EOYA 4RG8A 9RUBA 2OD6A 4F5PA 4CJWA 4FS1A 1Y3KA 2JWKA 3G87A 3ILIA 3CC7N 5K8MA 1RWXB 4O4GB 4KX3A 2RPIA 8ICQA 4X4TA 3KHHA 4YB5A 3OYLA 3OR1B 5M1OA 1JX4A 1KFDA 1URRA 2CQ0A 4CTAA 5J2AA 4Y28C 4IKFA 2QRRA 3K89A 5HL7Q 4KB0A 3H5UA 4K25A 3NAHA 2P5VA 3BGLA 3CCMS 2B6GA 2G5IB 2G09A 3Q8SB 4OYPA 5KPRA 2CADA 1FNXH 2ZM6K 5B0BA 5D6GA 1Q3UA 3OFFA 4CVNE 2WF5A 2ZUAA 3DGVA 3WEEA 3J7A1 2KHVA 4CM0A 2M2BA 2QG9B 2L41A 2CXEA 1YJUA 2XLIA 4GV9A 1RT6A 1T9TA 2MY7A 5M2RA 3KOOA 3VENA 4YMMA 4RWXA 3TAMB 2F8MA 3B6PA 2VANA 5J29A 4H4MB 2H3GX 5HJYA 2Q6CA 3N9UC 2XNQA 2KKVA 2OXOA 3ZT2A 3QEAZ 2YWKA 1HQUB 1S4EA 1TU0B 4RZRA 4JV5K 1ITPA 5HMXA 1NGEA 4BC4A 3TAQA 1RA6A 4C80A 4DL4A 4CF9A 4RPXA 4IH6A 2ZOMA 4WXOA 4AQYK 2H3ZA 3D2FA 3ZZYA 3LM2A 4J03A 3JSMA 2AX0A 3FC9A 2XI2A 1B43A 4RX6A 3WT0A 4YOEA 2KG1A 1JCFA 1UJ6A 1HBOA 1WC1A 4CEDA 4RWTA 3GV7B 1TV6A 1FA0A 3HFVA 2UUWA 3C3LA 5KFXA 1OUQA 1RAJA 3TOQA 3W3DA 3IS9A 2YKAA 3ZSXA 4UOCA 3JAMO 1Q46A 4TQSA 4EBCA 3I8BA 4ZIVA 2CGLA 2YMLA 1S7IA 2BANB 5BR8J 5L38A 4ED8A 2D1CA 2NXNA 3LPUA 5DM7L 3OGUA 4RLEA 4ED2A 4ZLPA 1NUEA 3WXMB 4K4VA 3I55S 3QSYB 1L8OA 3LO3A 1X3NA 3DI6A 3AODA 3P6YC 2ZJQQ 2JDJA 4Y34A 2VD3A 2DGOA 1I1GA 3SQOP 4DUTA 2CKWA 1FIQA 4H0XB 1T05A 4ZVGA 2MPUA 3UPQA 2RQCA 5J0QA 4G1PA 3NVMA 1Z4NA 3QBXA 4RQ5A 4CIGA 4AXIA 1HWUA 3G8SA 3D1QA 5DBBA 1S72N 2PFNA 4CO1A 4IRDA 5IT4A 3QT6A 1FESA 3OYIA 1NDPA 2PC6A 3MCMA 3TP2A 3J7YI 4E3SA 1WF0A 1RDCA 1V6HA 3QINA 3WNFA 4FZNA 1S6OA 1HNIA 4H0VB 1MWQA 3CERA 1FW6A 4EMDA 4FXDA 3ICLA 4CO2A 3R9PA 4FM1A 4M6WA 2QKKA 1VQPN 4USMA 3F56A 2B5JA 1XMQF 1UA1A 3Q8PB 5JUMA 4EYHB 3H2VE 4L72B 1XERA 5AK5A 4ENOA 3VGLA 5ADZA 2O8DA 3BKUA 4GRSA 3WX4A 2HQCA 4JEPA 5CHCB 3BQ7A 3QUCA 4M5GA 2CWXA 3DMJA 4RQMA 3VHQA 2ZH4A 4KKOB 2N7CA 2QARB 4IFYB 3HSDA 2KE7A 4BC5A 2QEXS 3H40A 4P52A 3GPAA 3L8BA 2Z0GA 2A5XA 4FK4A 3UNYA 3BO4A 3EVWA 4BR0A 2V50A 3VA0A 4LSLA 3AUOA 2GGPB 5E79U 1VQLN 4I2EA 4H0PA 3EPIA 3ALRA 4NLQA 5FPEA 1FRLA 3ZX3A 1HPZA 2Q0RA 3DOLB 3CULA 2WB1F 4BQZA 3JPPA 3I96A 4DPYA 2O66A 4B1YB 3O3HA 1UPMB 3JB9k 1K9MT 1YJTA 1QLNA 2H4YB 4OX6A 3OLAA 5I9EB 4ED1A 4F25A 3Q8VA 4PGYA 2UXBF 4CZLA 4PJ0U 3DRSB 5EWGA 2XHWA 5IT9U 4ECQA 3E51A 2XMVA 3KLFA 2RHKA 1YG0A 2CGKA 2HAIA 5ALTA 2Q97A 1SQKA 1BPZA 4MYTA 2HBYB 3DLEB 1JNZB 4Z7CA 4N76A 1S1TB 2WMMA 3R7BB 3PRDA 2MZQA 1WF1A 4LBPA 3EUNA 1AFIA 5IZHA 2O8CB 2HOFA 2C42A 3HDSA 5F0WA 1GXTA 2GJIA 2DFFA 1KEJA 1FXRA 3RWUA 2IHNA 3QUBA 4DR7F 2GMHA 5A8WA 4I67A 1Q86O 1AFJA 3OTOK 9ICLA 1X4HA 4XIUA 2X7IA 2NNWA 4CYUA 4DOAA 2GAGC 1SIZA 5THWA 3GDXA 4P7VA 2G8HA 4M41A 1Q7LB 4DV7J 4XPCA 2CJBA 2E44A 3S7RA 2IYIA 5EE0A 3CD0A 4P71A 2DO0A 3KVGA 1IH7A 2QLBB 1QQMA 4JYAK 3UDEA 1RQLA 1FX2A 4CEOA 2ZEJA 2Q31A 4NYFA 2XMTA 1Q5YA 3AJ2A 2V8VA 3MN6A 8AT1B 4CLWA 4LVSA 4CNYA 3O8MA 1KONA 3F2KA 4BC9A 1NEEA 3Q8LA 4RNMA 3DOMA 3MGIA 3R8YA 1VCTA 1ZD3A 2DIVA 3P1GA 2P5GA 2V6AA 2XMUA 3KLGA 2D0BA 1U1RA 1CC7A 4ID8A 4E7KA 2D0OA 3C95A 1M1KO 3UKUA 3CMEN 3A8JA 5GAHI 1JUDA 2HF3A 2UYTA 1B0XA 2VG6A 3LPEA 4K50A 4OX7A 1N54B 3KDOA 3LDQA 4R8UB 3PW0A 4RPZA 4N7TA 2Y1IA 4ZPCA 5AQHA 3DHXA 1SXDA 2M70A 2HURA 1QZ5A 5J2DA 2P6UA 4NXMK 2ZJRQ 4X4PA 2XO6A 2DD8S 4EIAA 5L46A 5LSRA 2I0XA 1FKPA 3WKCA 2DPIA 2HKEA 1S6PB 4DU7A 4CJFA 2R9LA 4DV0K 4LFBJ 5HMZA 4F0MA 3M30A 3W61A 4B3MJ 2P6RA 2YKMA 3FQKA 2RKIB 1T03A 2J9DA 3ZTSA 1TYQB 2VWJA 2EKNA 1N62A 1Q81T 4ZTJA 2W43A 1OKJA 4NLZA 2F3JA 2RB7A 5LXRA 1MMNA 5LL6d 1K6YA 2ZKUA 4O23A 2ISOA 3MCSA 2LCWA 5L1KA 3ONNA 4QR1A 4ED5A 2WRMA 4JI6J 4YMOA 4O3RA 3Q89A 2PFUA 3LH2S 3T3FA 1WCNA 4O0NA 4KLLA 1TL1A 1JJ2R 4WE1B 4R5PB 4PGXA 3JPNA 2FBVA 5DQGA 2VFSA 2YQ0A 2CJAA 4W90B 4I4BA 4RQ6A 4PEOA 1G15A 2LEBA 4B3RJ 1PAUB 1TE2A 5LY3A 2DH9A 4X4SA 1XNQF 3H3NO 4OHYA 3OTCA 2RRAA 2G2OA 1TFWA 4QZGA 1RDDA 4CK2A 1LFWA 1RNHA 1W0HA 2EXUA 3FBFA 3CCSS 2BCUA 4OJRA 2J8SA 9ATCB 5BYQA 7ICRA 3R9LA 1P1LA 2HNYA 1KLNA 4EP5A 3FCHA 4YDUA 3DM2B 2FSNA 3J7AP 1SKUB 4AL5A 4NYNA 4LY7A 1TGOA 4ISEA 4UASA 2C1EB 1I6JA 5E7OB 2UVRA 2OPRB 2RQMA 2Y9TA 2XB2D 1JCEA 3CUNA 2HHWA 3NBPB 3C16A 3PW2A 1IM4A 4P4OA 4UY85 3CJKB 5J2MA 3VQ5A 4YQWA 2O01C 4NLOA 1NMDA 3TUZC 1EWRA 1RTZA 1KQSR 5C42A 4K4XA 4ZP7A 2ZWHA 4WQ5C 4DFPA 3RSEA 3KUGA 4QWAA 7ICIA 3Q7CA 4BXOB 4WFZA 5AJ3K 4LRAA 1N4LA 2G8WA 1U45A 5GAGU 1NDKA 1UPPA 3T79A 4MDBA 3H5SA 1QZ6A 1KTQA 2GVZA 2MTLA 2G0IA 4UAUA 2DNQA 3DGPB 4AM6A 2QYCA 1WD6A 4AE5A 4FJ8A 4PPXA 3GCWP 3LUYA 3WK9A 3O4NA 5EVZA 2VV5A 3DRRB 2AP1A 3T5LA 4JI3F 1UT8A 3RAQA 1D8YA 2MZSA 3HJVA 2DXEA 4DQQA 2HNDB 1KAXA 3HOSA 3OR2B 2OTJS 4NEZA 2X51A 1UMJA 5LT5A 3T1HF 3CJQA 4JOUA 3KLIA 1GLDG 4CZEA 4FO6A 4LT6A 2MJNA 2EZXA 1MWYA 1WSIA 4WIIA 3U02A 2KN7A 2D3ZA 2EW9A 4AHVA 2MKIA 3DRYA 3MM7B 3HSZA 2J5AA 5AKEA 2KVSA 1FJGK 2B9YA 1U2CA 1HYSA 2FUG9 2Z2YB 3BQ1A 2XYGB 2BCRA 2V4JB 2P9IB 2KHDA 5GMEA 1IBKF 3NS7B 4RUBA 4QR2A 2Y1JA 4DU4A 2MHNA 4I6WA 2FXUA 2G06A 4AF1A 4DR2K 4I2DA 4BRIA 3GSDA 3FM9A 3ZXWA 5T7BA 5KFFA 5F8HA 4KLIA 2VKRA 1FVSA 5D3GB 4F92B 5DG9A 2RVJA 1VFJA 3AD8C 1E6VB 3OYGA 1WORA 5B0AA 9ICCA 4F67A 5F3XB 3FGUA 3PZPA 1ELOA 2V8HA 4CFAA 1HUOA 3DXKB 3NVYA 7ICSA 1YTAA 4QS9A 3AA5X 3PACA 3OSPA 2FJXA 3KZBA 4A46A 4DR4J 4NV0A 2VA2A 2KKHA 1WBDA 3QUTA 3EX7B 2M7SA 3FAHA 1PVPA 1CQMA 3DLJA 4DV6K 3OYBA 3THYB 4DEZA 3SFUA 3NVKA 2JJ4D 1OSCA 4JI5F 1D8ZA 3MUTP 3QBWA 3LP1A 2MQPA 7ICVA 3I0SB 2L5YA 3VQBA 5GIOA 3NGZA 1YTUA 3VVTA 4C8NA 3O9TA 4PG4A 2GW8A 4KH1B 3R5DA 2E5LJ 2KG0A 5F1XA 5CCMA 3ED5A 2UVUA 3T9NA 2P2CB 2UXDK 3OD2A 1Z1ZA 5ALHA 2I7PA 4DUZK 1S8OA 1BXNA 1J5OB 5FD1A 3KLVA 4ZCIA 4CK3A 1NJIO 3J7Z5 4YG2A 3OHAA 3AA8A 4WFYA 1W7WA 3QRQA 2OCEA 4PWWA 1PK1B 3KD1E 5J2CA 3M1VA 3HHEA 3ASMA 1J5EJ 4OHWA 4TY8B 1T0TV 3SMVA 4DR5J 1X5SA 3MMAA 4RW6B 8ICKA 3L2VA 3SQIA 1X31C 2IGIA 2GLEA 4JMUA 5MLCV 1C6VA 2MRLA 2IDEA 5D4PA 1NH7A 2QWPA 2QIFA 4TU9A 3VF0B 1RDUA 3Q8UA 1IWGA 4MFAA 4GKKK 5B5EU 1ZM4A 3TACB 3ELHA 1D0EA 1R43A 7ICMA 5KI6A 2P9EA 3BF1A 4I2PA 2JHEA 4DB3A 5M1KA 1UVMA 4CGFA 2N3OA 3S1TA 5KG6A 1LWFA 3MABA 3E2EA 3U1NA 4JP8A 2XS5A 2R8GA 4FWMA 4PCQA 3CPWR 2KYZA 3K0SA 3FMWA 2KNJA 1B99A 3ETLA 1SH2A 1H2UX 2HVEA 1T44A 2ZIUA 4FLWA 4CLSA 5HN0A 1ICEB 3D2QA 1GT8A 4YY3F 3PRVA 2FC9A 4O4GA 5L1JA 1NJZA 4NRTA 3VZIA 3WIVA 3KLEA 1U0HA 3JQJA 3TTFA 3BS7A 2VICA 1RKJA 1HBMB 2CQ1A 3GMGA 1HI8A 2F8EX 3OYFA 3UKRA 1ATRA 4HKQA 1COKA 4O3MA 5CZ2A 3PJ9A 4CH1A 2YX7A 2M88A 2IVNA 4TLRA 4RCHA 3WXLA 3VZHA 3C65A 4U7UK 2GIRA 3NRBA 4L75A 3ID8A 3H25A 4UB6U 5KFJA 3RMCA 2OYQA 2ZDPA 3P4IA 2DL0A 2VJUA 2P9NA 1D8BA 2UUAK 3PFEA 1VSKA 4BDPA 5KT7A 1Q9YA 2DGXA 2LA6A 4B3SK 5E3QA 4ECUA 2UXDF 4OLPA 4DUZF 1XMBA 4OYMA 4F0KA 3FFIA 1PYTA 4RQNA 4DR3K 1HQUA 3CG7A 2I1RA 2A1AA 2D4WA 4ZK7M 1RUSA 4IRKA 4CFBA 5BN8A 1FWPA 2G0AA 4CRXA 4DSIA 3I9ZA 3QFPA 5AQGA 4M3WA 1ZPWX 1VQ6N 4O5CA 1XC9A 2PFFB 2ZFHA 1FRXA 2RRDA 3D5MA 3VQCA 4DO9A 5HROB 4X66K 4M1KA 3VGUA 3E9LA 4DI6A 3I5CA 3ZSOA 1H6KX 3T6BA 1NK0A 4WZQA 2AA4A 1YRTA 4ID5A 4CZJA 1RHMB 4PKGA 3IRWP 1AROP 2JRSA 1VQ4N 1KQFB 2XGPA 3HI9A 3CETA 3BGFA 5AK3A 4DCJB 5EN1A 3K17A 1ZQUA 3CO9A 2M4MA 3A3OB 3U6FA 2KKZA 2CJQA 4IQMA 3ZTPA 1BQXA 4HVZA 3KK1B 2KICA 5KG2A 4QYZJ 5KFVA 4KI6A 2DKOB 2BANA 5EXWA 3QMQA 2W11A 2COLA 2QMWA 1YBAA 1VSIA 4UF4A 1VLYA 3LAMA 2OPPB 3DNCA 2Y8WA 2VH7A 5EX0A 3M8ZA 1KVCA 2KU7A 2DO4A 4CF8A 5HNKA 4I6YA 1SAZA 3AFGA 3W5YA 2FVRA 3V6DB 3TJ9A 4F4ZA 2KI2A 4EBDA 2MQNA 4DL2A 2BPCA 2MGZB 1NK4A 2FZKB 2JLGA 4CP5A 2W04A 1URNA 3IR6B 3VCBA 4BROA 4KGMA 1LWCB 2FLPA 2QLTA 2JV3A 3RBDA 3ZI4A 4K41A 4KLSA 1R3NA 1U7LA 2XSJB 5KRSA 1SV4A 4UB3A 2E1EA 3HSTB 1S0OA 1ZQIA 5AZIA 3NVVA 1KKXA 4ECTA 1S77D 4KR0B 1BNPA 1IR0A 4M45A 4IOCQ 2MQMA 2V94A 1IKXB 5HMLA 1T9UA 2HBZB 1YUWA 3ZZRA 2PT0A 1RAHB 2UUAF 3J8AA 1K73O 4NZ0A 2VGNA 1KTVA 4UY8T 2RIJA 1YKWA 3KUHA 3MPYA 1ZQBA 1FT8A 3R5BA 1J9AA 4FLTA 3SFGA 3AA2A 4OVLA 3R7NB 1BY9A 1NB2A 3MBYA 1HYZA 2EI5A 4Z6FA 4CI0B 4JKAA 4KKOA 4IFYA 1ZQNA 2ZZMA 3BBBA 5AKXA 3VQ6A 4LFAJ 1TMMA 4WKYA 1N6QB 3Q8MA 1LW2B 1RT3B 4JRQA 2DGUA 2GGPA 2QWOA 3DN9A 1GOCA 2KM8B 5SWMA 2BKPA 2VOPA 3DOLA 4WFAQ 3OYCA 2NRXA 1QAIA 2F40A 3QWPA 1GTHA 3CF5Q 3DWLA 3WQPA 2HQFA 1ZBSA 3PMNA 1P90A 4OJOA 2KHQA 2G0JA 3DRSA 2GBZA 2I9SA 2HFZA 4HTLA 3D2EA 4ELUA 5AQOA 1FX4A 3WDOA 1P8ZA 3IMQJ 4JI7F 3V7LA 5D0GA 1Q4RA 3IGNA 1OH7A 2DCUB 4O44B 3DLEA 3TA1A 2D8CA 3CCQS 1R0AB 4K8RA 2AEFA 3FSXA 4KV8B 4DR6J 3K8VA 5J2EA 2V34A 1PC5A 1F2HA 4G3IA 2O8CA 4DR1K 1X9XA 4OGCA 2RD5C 4M3ZA 4RQ2A 4ZJLA 4X65J 1HBUA 1VQSA 4C3LA 4KI4A 4PXEA 1ZS6A 5KL8B 1CJTB 5C12A 4RQ7A 1QE1B 3F44A 3S6JA 4RPYA 5AQXA 4OKEA 3L4PA 3KUEA 3SAFA 2DUYA 3ZSRA 5IT9Y 3MXJA 1RA7A 1RTHB 1JXVA 4BS2A 3EGNA 2IM1A 2XNRA 4K2XA 5TKYA 5IWAK 2E7VA 2MEWA 3G8TA 2XS7A 3G71S 2HMIB 4YB6A 2WB1D 3CCJN 2CVIA 4FFDA 4PHEA 4U95A 1FE4A 3VAIA 3OQ2A 3K2PA 5HMYA 3LDLA 1LOTB 2CQ4A 1E4FT 4EGLA 2Y0SD 1CJVA 4W5QA 1HUZA 1ZA1B 5F0XA 3TRGA 5C24B 3HFZB 5E2QA 2BTFA 2CXYA 2Q66A 5BPNA 4NLDA 3NNCA 1CZAN 3V9WA 1HX1A 2E6MA 4MKVA 5KOWA 4IG0A 4DV1J 2K8AA 4CM2A 3O5TB 5HVGA 1ZTTA 2WVEA 2OMOA 4J9MA 1Y5NB 2V0NA 4OZ1A 2Q2RA 4A8EA 5DGBA 3M9MB 4FWOA 3SMPA 3N79A 5J1EA 2QWQA 3PHTA 3J7ZT 4CJTA 2Z58B 3H5XA 2KFZA 1OSDA 3BF4A 5FLXO 2H1YA 1XSPA 2CDQA 5A8KA 4O0JA 4DCPB 1ESVA 1BNOA 7FD1A 3KWGA 5AM3A 3D6TB 4Y6IA 3BPDA 3CP8A 5KFPA 2M5YA 3JPOA 1H7WA 1S6PA 2GJFA 2NXJA 3ULEA 3HILA 4KLEA 2RS8A 3CCES 1AXQA 3CHWA 4DSJA 3OXFA 2GS8A 1VSFA 5AKKA 1WHXA 4JI8F 5IV3A 3ZCMA 1SJFA 4YUDA 1C0FA 4I2QB 3WXIA 4LF5J 4ZVOB 1QHAA 1UFKA 2FHMA 1COOA 4F4WA 3DU6A 1T02A 2IC3B 3F41A 3NXZA 3VEOA 2QL7B 5F41A 4PHTX 5D4NA 4DTXA 3L7UA 1HA1A 1X9JA 4EEKA 5L39A 4WE1A 2QX0A 4LF7K 1SC4B 4KBIA 3CJCA 4R5PA 3ZETA 1T7PA 3KLHB 3C1ZA 4Z4EA 1WYGA 3V81B 1T9WA 3TEHB 4MIWA 2PZSA 1G4CA 1VSDA 1ZBLA 5HQLA 3CJ8A 2DRBA 2Y0BB 5H9EJ 4WK3A 4JI0J 2BZFA 4YS2A 4CEQA 3I8DA 1IO2A 3O6QA 3GLJA 1EETA 4FZLA 4CHZA 3V5RA 4FBTA 5IWAF 1N34J 3ZT0A 2FVSA 2YWWA 5JS1A 2XMMA 1PUZA 2YWGA 3GU3A 2YY3A 1HBNB 2HIYA 3THWA 1JLGB 1RE1B 1DBDA 3C14B 1RGVA 2QSFA 3RB3A 3O80A 2W6KA 4LJXA 2KO1A 3QJPA 3LGMA 8ICNA 5AQIA 2ZXHA 1SXEA 2HWIA 4GFJA 1IBMK 3F9MA 1VRTB 3MGJA 1DY3A 5EDWA 4CEBA 4DFKA 2AU0A 1L3TA 4CF1A 4ECYA 2HBRB 5KT6A 4WCEQ 2BBEA 4Y2TA 3CC2S 2KTQA 2MQLA 2HOEA 1C0TA 4QS8A 2YHBA 3QT8A 3FBBA 4AHSA 4DV4J 1SH3A 4HACB 3NUQA 3DDIA 1ZQFA 3EGZA 1O0PA 1XMOJ 5JRTA 3AMZA 3KJQB 2IS3A 1RHJB 4U6PA 1B9FA 1UKUA 4A59A 4OYOA 2B4UA 3M1YA 8ICHA 4Q45A 4D3GA 1SQFA 1GLEG 1HWIA 1BPYA 3BQTA 3WBZA 4UB1A 4CBXA 1FTCA 4MF2A 1SJ1A 2KJWA 1WELA 3PV8A 1O13A 3DGPA 1N60A 4IQXA 4BR7A 3WQUA 1IN0A 2D9PA 1DARA 4CLLA 4J9NA 2AGQA 1SJRA 1AB8A 2ZH7A 4BE0A 1SV5A 1BQNA 3PIOQ 2KW4A 1RJJA 4FJIA 2YKNB 3TAFA 3EKSA 5HAOA 2CQIA 2E3TA 4PWDA 2Q3PA 2HHHJ 3AVMA 4RW7B 1PK3A 3NHGA 4YEAA 2QLWA 4NA1A 4FS2A 2IAJB 3TX0A 4M9NA 4XDCA 4LF8J 2EPIA 4UTGA 5HATA 3R6MA 4LF6J 1IWAA 3AL0B 1S49A 1HJRA 1H74A 4J9RA 3BH6B 4UT4A 4JI1K 5K5MA 3C23A 3GOIA 5C15A 2MMYA 3GONA 1SVDA 2LECA 3PDNA 2M52A 4LF7F 2EKYA 2DB1A 3AO5A 2WK4A 1BE4A 3BKTA 3TUIC 4N56A 3W9HA 4M5KA 5F8GA 1F9FA 3J7YP 4KO0B 3VN5A 5CR4A 3QU9A 2O6KA 5D3GA 4U9RA 2PMWA 5H1SQ 1E6VA 2G5HB 3GJRB 3JAMY 1BISA 1HNXF 4M63C 3OYEA 4JK8A 2YJEA 3SK3A 4Y0WA 3AB2B 3M8QA 2UUCF 4O8KA 4CWBA 4NA2A 5KFQA 3CQXA 1OWXA 3R6LB 2A40A 4N8NA 4DUYJ 1A5WA 2E1CA 2RUSA 1IBMF 5HOOA 3THYA 1TK5A 3TU5A 1XQIA 2HEKA 3FGVA 3PYDA 3KMQA 4AL6A 1FKOB 3GWCA 2R7TA 4WTYA 5I3QA 4PG7A 4NYOA 3UD4P 4FNIA 1G1XA 2J7UA 4CF3A 1K8AO 3CCRN 3I0SA 1VHXA 3W0LA 3RU0A 3R2DJ 4CJSA 4JBCA 1V5VA 4YR3A 3ZO7A 1S0MA 3R8EA 1KVBA 3CCTA 3NGKA 1P1TA 5J0WA 4JLHA 3LZIA 4I2HA 3HHLC 2F8SA 2QLXA 2BRLA 3NMUA 4PZVA 4C8KA 2GH1A 1PK1A 4R65A 2JZ5A 3ITHB 1JL2A 4YD2A 4YHHJ 4QCLA 1PVQA 2GV9A 3E3XA 4CLPA 3QU4A 4TY8A 1UAXA 3VA3A 4HTJA 1VQ5S 4NXNJ 2ZG6A 2MKJA 4RW6A 1H2TZ 2ILYA 3GV8B 1NK7A 4J90A 2RF2B 4AT1B 3Q83A 1YVUA 2DPNA 5GAEU 2VJ4A 4UBBA 2JEJA 3DDKA 3KTQA 3RB6A 1U8WA 2ZH3A 4LBHA 1APSA 2IIRA 3EW9A 4E0DA 2OSRA 4CRJA 1CZ9A 3SENA 3R27A 3NVWA 2HMPA 4A8XA 1WN7A 4OLAA 4FOIA 1PZNA 1PC4A 3SDEB 4GXJA 2K4HA 1TL3B 2QL9B 3GR0A 2NRHA 1R7IA 1VJWA 1T11A 1U8SA 2IRUA 4TURA 5HSPA 3CXCR 4DWIA 4ED7A 4QW9A 5KT4A 1ZQOA 3IXQA 4YDXA 3HM8A 3BGRB 2P9PB 1P7DA 4IS7A 3CO0P 5FPNA 4UW2A 2VZ9A 2C22A 2WF7A 3I0RB 1BGXT 3HK2A 3C15A 3D3CJ 2FJAB 1VQNS 1Z3EB 4HHHA 3NH2A 3MM8B 1X42A 4LIRA 1VQOS 1CLFA 4DL7A 5DDQC 4ISFA 1E4GT 4L3KA 3DXMB 4BGAA 4F26A 2OAUA 5B66U 1HBMA 2JEIA 4X4UA 2FY8A 4L3NA 1WTBA 4I6MB 4MAKA 1M5PC 4JI2F 3AOBA 3SQ4A 3BO2A 4BC7A 5CA7A 4P4PA 1ZYQA 2FD2A 4FJ7A 4NLWA 4M94A 1WDTA 3HP9A 3DLKB 4A57A 5HMMA 4MJKA 2IA6A 3MM9B 2FI1A 4J2AA 2X3DA 4GVBB 4FKYA 4HUEA 4P0QA 3ZZ0A 2D3O1 3NNHA 2MLZA 3B4MA 4JKGB 4CK1A 1ZM2A 5KFYA 5KFGA 2IOHA 4ZOHC 3D28A 3TVYA 4J9UE 3ZC4A 2K1RA 1NKEA 3M4XA 1HWJA 1BHLA 1RT4B 2V4RA 4BRHA 3VGSA 1R0BG 1EQYA 1OVYA 2ZH8A 1WKJA 2ZBQA 1N33J 3MMBB 3UN3A 1H73A 2ERRA 4NLRA 2AKWB 4TN2A 5EE3A 2FPMA 4ZITA 2EVZA 2R7RA 2ZTEA 3QXGA 1F9EB 5F9LA 3BF3A 4EX7A 2AT1B 1VQKN 4FSVA 5DO2A 4F04B 2QKBA 2NXCA 4TY9A 1EX8A 4UAZA 3ZD9A 2HGNA 4JV0A 5DB8A 3RH4A 3PG9A 4BGDA 2WOMA 2IRXA 4OYBA 3IRXA 2NUBA 1Z2ZA 2X1BA 3ENHA 1XTZA 2XVTA 5J0TA 3Q0AA 5ALVA 3TKAA 1LVHA 3C6UA 2E66A 1YJWS 5E3CA 2ABYA 4W4MA 3IG1B 3ZEUA 1KBRA 3RAXA 3EZOA 4X64F 5AHXA 5AFUH 1W2IA 2CDRB 2AMCB 2DHGA 1RBAA 2XMJA 4B3TJ 1RBOB 2V51B 3AGRA 2MU2A 4QW8A 1KFSA 2JNJA 8ICBA 3CJ7A 2EAMA 1DOQA 3EE9A 1HR0F 3MCPA 4YXMA 2YKQA 2YQ1A 5B7WA 2BJ8A 3C6TA 3M32B 1N5SA 4F4AA 4E1JA 1M5OC 3H8WA 3ETOA 1FDAA 2VC0A 8ICWA 3ZT4A 3CJ5A 1LKZA 4MFBB 2KZ3A 3U27A 2PFOA 4QZCA 4FPAA