4B9NA

Structure of the high fidelity dna polymerase i correctly bypassing the oxidative formamidopyrimidine-da dna lesion.
Total Genus 208
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
208
sequence length
581
structure length
581
Chain Sequence
TAKMAFTLADRVTEEMLADKAALVVEVVEENYHDAPIVGIAVVNEHGRFFLRPETALADPQFVAWLGDETKKKSMFDSKRAAVALKWKGIELCGVSFDLLLAAYLLDPAQGVDDVAAAAKMKQYEAVRPDEAVYGKGAKRAVPDEPVLAEHLVRKAAAIWALERPFLDELRRNEQDRLLVELEQPLSSILAEMEFAGVKVDTKRLEQMGEELAEQLRTVEQRIYELAGQEFNINSPKQLGVILFEKLQLPVLKKSKTGYSTSADVLEKLAPYHEIVENILHYRQLGKLQSTYIEGLLKVVRPDTKKVHTIFNQALTQTGRLSSTEPNLQNIPIRLEEGRKIRQAFVPSESDWLIFAADYSQIELRVLAHIAEDDNLMEAFRRDLDIHTKTAMDIFQVSEDEVTPNMRRQAKAVNFGIVYGISDYGLAQNLNISRKEAAEFIERYFESFPGVKRYMENIVQEAKQKGYVTTLLHRRRYLPDITSRNFNVRSFAERMAMNTPIQGSAADIIKKAMIDLNARLKEERLQARLLLQVHDELILEAPKEEMERLCRLVPEVMEQAVTLRVPLKVDYHYGSTWYDAK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Unexpected Non-Hoogsteen-Based Mutagenicity Mechanism of Fapy-DNA Lesions.
pubmed doi rcsb
source organism Geobacillus stearothermophilus
molecule tags Transferase/dna
molecule keywords DNA POLYMERASE
total genus 208
structure length 581
sequence length 581
ec nomenclature ec 2.7.7.7: DNA-directed DNA polymerase.
pdb deposition date 2012-09-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00476 DNA_pol_A DNA polymerase family A
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.20 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 5' to 3' exonuclease, C-terminal subdomain 4b9nA04
1.20.1060.10 Mainly Alpha Up-down Bundle Taq DNA Polymerase; Chain T, domain 4 Taq DNA Polymerase; Chain T, domain 4 4b9nA02
3.30.70.370 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 4b9nA03
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 4b9nA01
5CZ1A 4AHSA 5J2CA 4RT2A 4F5PA 4FLVA 5KFIA 2XY8A 3K2PA 4C8NA 3OJUA 3C21A 4RU9A 5HP4A 2FC0A 4CGFA 4QCLA 3NF8A 1HUOA 5IIIA 1NJZA 3AU6A 1S9GA 4CJVA 4J9LA 1UOCA 3ITHA 1WAFA 5L1IA 3SUOA 3KHHA 4FVMA 2ISOA 3VQAA 4KITB 4M3UA 5L1JA 2M9NA 1N56A 8ICLA 5J2QA 3TR8A 3T5HA 3LP1A 4UQGA 4KLEA 3DLGA 5DB9A 4J9RA 7ICHA 2HHVA 2PFOA 3ZDCA 4F91B 4KLFA 5CY4A 2QKKA 4KLJA 1ZBIA 3ULDA 8ICRA 4PY5A 4KLTA 3UIQA 2FPKA 2XCPA 2DFFA 5DQHA 1ZJMA 3D0PA 4DSFA 3S3MA 3L8BA 1JLQA 1S1TA 4O5CA 3RRGA 8ICTA 1KTQA 4RQ8A 4JS4A 2WOMA 3AO1A 5CB1A 4K8ZA 3JPSA 4B3OA 3QZ8A 1BCOA 4RNOA 9ICGA 5J2HA 4O5BA 4DSIA 4KN7A 4KI4A 1XHXA 1ZQCA 1YTUA 5HHIA 4KAZA 4CEOA 1YVUA 4F4WA 4UAYA 2DFHA 3QINA 1RT1A 3G0ZA 1Q8IA 3OYCA 1NK6A 1T3NA 4PHEA 4MQ3A 3UXPA 4MF2A 7ICUA 3ZD9A 4JUZA 1LWEA 4FJ7A 2X78A 3RB3A 1HQEA 4CGHA 2VA8A 2D0BA 3V9ZA 3PVXA 1BPDA 1WSEA 4TSXA 1VRTA 2YV0X 4FJMA 4NLKA 1ASUA 1IKVA 2FLPA 3PX0A 1IKWA 1L3UA 3S3OA 3RH4A 3U3GA 1CUKA 2BQRA 4ID1A 2ZJ8A 3MGIA 3DYAA 4IFYA 4J9SA 2ATLA 1ZQNA 4NCAA 3EZ5A 3SPYA 3T19A 1RTIA 1Y88A 5J0UA 1IM4A 1ZQJA 2FBXA 4EBEA 4QW9A 3TANA 1N48A 3UPQA 5J2IA 3NCIA 3NF9A 4R66A 3H4DA 1D8LA 4ECSA 1B43A 3GDXA 2A1JB 1RTJA 4RG8A 2W8KA 4DTMA 2ZQBA 1RXVA 5IIJA 3EWAA 4FJ8A 4FXDA 2ZUBA 4YXJA 5CJ7A 4FLWA 3L2WA 1S1UA 4FYDA 3KKSA 4F93B 4NYFA 1CZBA 5EU7A 4DOAA 4IRCA 1RILA 5JUMA 4R65A 3SUPA 4Y1CA 4NM2A 1TKZA 4MEXA 3LP0A 4OKEA 1KSPA 3V6HA 2DPJA 4QAGA 4E3SA 3SJJA 4CGIA 1HJRA 4PHPA 5KRSA 2LSNA 3ZT4A 4NYNA 1KFSA 1RYSA 4X5VA 1REVA 2AGPA 2QKBA 5HHHA 2ZJAA 2JEIA 1BHLA 1WSGA 2J6SA 4DL2A 4UB4A 5KFVA 3TAEA 3PR4A 4LH4A 3MAQA 5HRRA 1KVAA 1S1WA 4FZZA 3THVA 4KLDA 2UVVA 8ICUA 1SKRA 2Z1IA 3QIOA 1RT7A 5KFKA 3N97B 3DOLA 5C25A 4FLZA 3AVCA 3G6XA 1DOQA 2ZUCA 7ICKA 1HYZA 4K4GA 4FJ9A 2F1IA 1S76D 5HBMA 3CM6A 1ZQKA 8ICNA 1TK0A 5J1EA 5J29A 1NK0A 4AHTA 4J9MA 3L3VA 1ZETA 1MQ3A 3HVTA 1NK5A 1XO1A 3AVIA 4RW7A 1D8YA 5F9LA 2XGPA 4W5RA 3OSNA 1WSHA 1ASWA 3RAQA 4QZ9A 2YKNA 3K58A 1U48A 4LVSA 3K5NA 1WSFA 3SI6A 4AH9A 1QQCA 5EOZA 1MSWD 3ZDEA 4JLHA 4P4OA 2JEFA 4W5NA 7ICIA 3RH6A 2VWJA 3M8SA 4ED1A 1KLMA 2B21A 2ZJ5A 4QWBA 1CXQA 3NF7A 4R5PA 4RQ5A 4F5OA 3VQPA 5D49A 2XGQA 1L3SA 3GV5B 2R7YA 4FK0A 4YR0A 4M9NA 4Z4EA 3EPGA 4CK1A 3AO4A 3I8DA 3QEWA 4NXZA 4DOCA 3KK1A 4PUOA 1WCLA 4IQVA 1U04A 4DTUA 4I2IA 2VANA 2Z1JA 2BCQA 3A2FA 3AVFA 3LWLA 3HK2A 1LAVA 3KLIA 1TL1A 4KRFA 3AA4A 2KFZA 2Z1HA 3QEXA 3D45A 2VG7A 1KVBA 4B08A 3RWUA 2G8WA 3AVKA 4M3WA 3V6KA 4BWJA 5HNKA 1ZQSA 2UVRA 2NUBA 3PO4A 3PW5A 1ZQLA 1RPLA 4JV1A 1L3VA 2UVUA 1QSLA 1RDBA 1C6VA 1JMSA 1KVCA 1TVAA 2PFNA 2W8LA 4J9QA 4YMOA 5KG3A 2JGUA 2FMSA 7ICMA 3VQBA 5KRTA 3RB4A 2C2RA 4ZHRA 3LALA 8ICHA 2ISPA 4B9UA 1YTAA 2OZSA 1RTHA 2KW4A 4CK2A 4I2HA 1BI4B 4FO6A 5J2JA 9ICMA 4N5SA 3SQ4A 3GQCA 3TFSA 4CEZA 2O4IA 1JXBA 1DTTA 2Y1JA 4IQWA 4MEYA 2VG6A 9ICFA 4QZ8A 5HRPA 3ZSOA 1Z26A 3ZSRA 1N5YA 3TARA 5DBAA 3LWMA 4FLUA 4QZHA 3ZT2A 1JLCA 4GXJA 1FKPA 4E7IA 4PGQA 3LK9A 4DLGA 4CJPA 4FJJA 9ICAA 4AHVA 1BQMA 3ZDBA 4C8MA 7ICRA 1SUQA 5KFLA 1JKHA 3LP2A 4CHPA 3QEIA 4YQWA 4RNNA 4LH5A 2ZTDA 3ISDA 1TFRA 2C22A 1FKOA 1JLBA 4UBCA 4UB5A 3RAXA 1O1WA 3DRRA 1Z25A 3M9MB 4ZTFA 1JX4A 2MUTA 2V4RA 2Q0ZX 5KI6A 3C94A 3OYHA 4ECTA 2KZMA 1RTDA 2IC3A 4B8AB 2R8KA 5IINA 4I28A 2HNZA 1L5UA 4M3TA 4O5EA 4FK4A 4B9TA 4MF8A 4F5QA 4YP3A 7ICJA 3ISCA 3ORYA 2B4JA 4YR2A 2BGWA 4FZXC 4RQ0A 4M3ZA 4MFFA 4ZTJA 3UQ0A 1S0VA 1ZJNA 1U49A 4NLNA 5KT7A 4DL5A 3RMDA 2IOCA 3PW7A 7ICEA 5DGBA 1D9DA 1CXUA 2IHMA 1Q9XA 7ICLA 4CGJA 4ED8A 1Z3EB 3AO2A 3QNNA 3KK2A 3NBPA 2BPCA 4OKKA 1JLAA 3OS1A 4KFBA 4H8KA 4I9QA 4PHDA 4M0AA 2B5JA 1BQNA 4GXKA 1ZQZA 4I2AA 4XRHA 3C5GA 4CERA 4KHNA 4Z4FA 2ASDA 2FLNA 1KFDA 3C1ZA 1TK5A 4FJXA 2JEJA 4DEZA 1C1BA 2PI5A 3U6FA 3G6VA 1PZNA 4HHTA 4KN4A 1W0HA 4DSLA 3EPIA 1A5VA 1KRPA 4EZ9A 4KHSA 4DOBA 4IQUA 1J9AA 4CEQA 5DQGA 3ISBA 4QZGA 2EX3A 5DBBA 2VA3A 4CJ4A 1JXLA 4IRKA 4KPYA 1SKSA 1LAWA 4Q0BA 4DSJA 1ZQQA 3H40A 4ICLA 1JN3A 4DQPA 1QE1A 1N6QA 5C5JA 4MFAA 1XI1A 2BDPA 2LYHA 1SKWA 4YVZA 4IR1A 4E7JA 4CEAA 1LB2B 2KQ2A 4I2PA 2X6SA 4O5KA 2KZ3A 5F9NA 2IA6A 1DTQA 2C28A 1ZQYA 4DL3A 3RR8A 4OKJA 1LW0A 1FK9A 4UB3A 4XUSA 4ECRA 2YKMA 5DG8A 4CHOA 1BCMA 3LAKA 1I3AA 4RQ4A 3C95A 4RPZA 2YNFA 4BDZA 3JYTA 1ZQAA 4KHUA 3HP9A 4F92B 1TGOA 9ICXA 8ICBA 3DLEA 5J0YA 4E1MA 1AROP 5SWMA 2F1HA 2XC9A 1TK8A 4IBNA 3MDCA 3TABA 1SL2A 4B8CA 1K1SA 4F2SA 2G8HA 9ICIA 2GBZA 4PQUA 1Z00A 4JK1A 4F50A 4F3OA 1LW2A 4QZEA 2QXFA 3PV8A 5E41A 1VRUA 3JPQA 2ZE2A 3C23A 1XU4A 2FPMA 1EXQA 1BPYA 4N76A 3NGDA 2FBTA 3NTUA 5J2GA 4M42A 3C2LA 3CFRA 4O55A 3VQQA 2FMQA 5CHGA 2HB5A 4I2CA 2YHAA 1TV6A 1TVRA 9ICKA 5DBCA 2Y1IA 2ASJA 1JXEA 5KGXA 5J0QA 4GC6A 3RB6A 3MGHA 4F5RA 3JPPA 2ZUDA 3NDKA 4PWDA 5J2BA 8ICZA 4NCGA 2XY7A 5SZTA 3JPTA 4CJWA 3IRXA 3DRSA 1XC9A 4PA1A 5DQIA 3QESA 3V7JA 2HHWA 4CHYA 1ZQTA 1RDAA 2HNYA 3MDAA 3OYIA 3LP3A 1TKDA 2XHBA 1XSNA 3N4MB 8ICKA 3V1QA 4ECYA 3FDSA 3ZSYA 2ITGA 1QLNA 5HMLA 5CA7A 7ICFA 4JRPA 5J2MA 4KHYA 7ICSA 3KTQA 1S1XA 3AUOA 4FK2A 3PX4A 4I2JA 1ZQOA 3AVGA 4RUCA 4FS1A 1EP4A 3ASMA 4OVLA 3VA0A 1SL0A 3LDAA 4J2DA 2BE2A 3MBYA 2HHSA 1IO2A 9ICCA 5KFNA 3OYAA 4FJKA 1B9DA 4JV0A 1ASVA 1SL1A 2XY5A 1WSIA 4UAZA 3KLGA 1SZPA 1F21A 3MABA 3PR5B 2KTQA 3RTVA 5D3GA 2G8UA 4FS2A 1NOMA 2KFNA 1X2IA 9ICSA 4I9LA 2DFLA 2AGQA 8ICYA 4CFCA 4DS4A 1CLQA 3SUNA 3AV9A 1T8EA 1KFTA 1ZQUA 4J9PA 3TAQA 2FMPA 3SI8A 4DTRA 4ED3A 4ECVA 3UXOA 1TAUA 4Q43A 1ZBUA 3AO3A 2RN2A 5CYMA 2ASLA 5DB7A 5DK5A 2BCSA 4O3OA 4M3YA 1QHTA 4DQSA 4B9LA 4CEBA 4EP5A 5L1LA 4Q8FA 4O3PA 5J2EA 1ZQGA 3AVAA 4Z4HA 4RQ7A 4R63A 8ICIA 3CM5A 3L2RA 4LZGA 3RMCA 4M9JA 5KG1A 2KZZA 3IG1A 5J2AA 2GUIA 2FPLA 5J0XA 1I39A 4YN4A 5DLFA 5FRMA 2A1SA 5KFCA 4GVMA 4Q44A 4QWEA 1ZQMA 7ICVA 2QK9A 2F96A 5I3UA 4CCHA 4R8UA 4EBDA 1ZQIA 2R8GA 2BCRA 4OGEA 1D5AA 1LV5A 1VSFA 4RUAA 4JRQA 4LD0A 5FROA 4CJSA 1U47A 3V1RA 4M9HA 3IAYA 4HVJA 3AVHA 3HX0A 4YMMA 2AQ0A 3TAFA 1MU2A 2GV9A 4ECUA 3K75D 4ELTA 4OPJA 3HO1A 2ZTCA 8ICGA 4GLXA 1S0MA 4FBUA 3B0YA 3OVNA 2XO7A 4RW4A 1A77A 5KG4A 2P1JA 1S0OA 1ZYQA 3RJFA 4BWMA 1CEZA 3O4QA 3HM9A 2C2EA 3B6PA 4FCYA 1NK4A 4M9GA 3PW2A 3SPZA 5KG6A 5I42A 3MR6A 3RJIA 8ICQA 9ICRA 5FDLA 1ZBLA 3AA3A 1JLGA 5J0RA 3QETA 1UWBA 3CQ8A 2OPQA 2XCAA 2AGOA 5DMRA 4CF0A 4PPXA 4Q5VA 2RKIA 4TUSA 5KFJA 3AVLA 2C2DA 3ZSZA 4DTJA 4C8OA 4FJNA 5HROA 3H8SA 4RW6A 1JL2A 2BANA 4IR9A 3TAMA 2NRXA 3QIPA 1K6YA 4I2BA 3V9XA 4GW6A 4CF8A 1X9MA 1C7YA 4YMNA 4F2RA 1ZQEA 2IAJA 5KT2A 1LWCA 2F8SA 1RDDA 1X9WA 2YNIA 3V6DA 4I2FA 5KFQA 3NH2A 7ICQA 2V9WA 4P4PA 5KT4A 1TV9A 4XIUA 2MAXA 5KFSA 1BPEA 4BE0A 1Y97A 4CJRA 4FLTA 4BDYA 3OGUA 2DFEA 4M45A 3M8PA 4O3RA 1UT5A 3OY9A 2J6TA 3C2KA 2W42A 8ICSA 1VSDA 3OSPA 1WNSA 2JZBA 4K4IA 2W9MA 4ELUA 1RBSA 1S1VA 4BGDA 5DKWA 2E6MA 5L1KA 4CJ5A 4KKOA 3SQ1A 4O44A 1A76A 1RZTA 3MEDA 4PGXA 1GOCA 1NK8A 3DOKA 1K1QA 5KFFA 4CJKA 3O3GA 1VSIA 4CF9A 4QOZB 9ICVA 2I5JA 4LZDA 2BHNA 1GOAA 3AU2A 2XY6A 1NJXA 5DDYA 4JV2A 4KLIA 3SQ2A 5HP1A 3M8QA 4YNQA 3PUFA 2G8KA 2BCVA 3M9NB 5TZVA 4JWMA 1Z00B 4KLSA 4DFJA 1RXWA 2AQ4A 3Q8MA 3NGZA 4ECXA 4AHCA 3VQDA 4OJRA 2RPIA 4NLGA 3BJYA 4YFUA 3ALYA 1S5JA 3HPOA 5BPCA 2OWOA 3MXJA 1JIHA 8ICMA 3Q8LA 4DLEA 5BOMA 4DQRA 5IIMA 3MR5A 4O3SA 4P2HA 3IS9A 3MFIA 3S9HA 4EP4A 3NHGA 3SV4A 1UT8A 2DY4A 4DWIA 4E7LA 3L2UA 3RJHA 3SYZA 4BE1A 4J9OA 3ISNC 2YHBA 1S9EA 3KKRA 2PY5A 3LPUA 1U45A 3P1GA 4W5TA 3T5KA 3ETLA 4IKFA 5J2DA 3NFAA 4FW2A 3K5LA 1ZQPA 4RPXA 4G3IA 4JWNA 4YD2A 8ICWA 5KFWA 1IKYA 2BQUA 3BDPA 4CJ3A 3RJGA 1FXXA 4TUQA 3OJSA 3M8RA 3NH1A 4ED0A 3SCXA 3HYFA 1SV5A 3V72A 4FM0A 4KO0A 4YR3A 3C1YA 4DO9A 1NJWA 3S3NA 4CJUA 3HXMA 3IM1A 5IIKA 5KTQA 3T5LA 5L9XA 4DL6A 4B9SA 4CIEA 3DRPA 4GXIA 4E1NA 2IGIA 1U9LA 3VQ4A 2Q3SA 4QWDA 2PZSA 3K4GA 5CZ2A 2G8IA 1MQ2A 4DU4A 8ICPA 2R8HA 1X9SA 4L8RB 1RNHA 1VK0A 3PMLA 4CGDA 5HRSA 3LAMA 4CFDA 4DU3A 3EYZA 5BOLA 2YNHA 2OPPA 3H7IA 3H8JA 5KFMA 1JLFA 3I0SA 2YNGA 4I29A 1BPZA 3OYDA 3ZSQA 2NRTA 4KHWA 3HL8A 3BQ1A 3RJKA 4MFCA 2FBYA 3LZIA 1YT3A 3G6YA 5HLFA 8ICEA 2W9CB 4Z0UA 3C6TA 3QZ7A 5KT3A 4QZFA 4FLXA 1XHZA 1BL3A 4PHAA 4DF4A 4Q8EA 3V9SA 1COOA 1ZQVA 1S0NA 4BDPA 1EX4A 4Z6CA 4K4HA 7ICOA 3VQEA 4DSEA 9ICQA 3KHLA 1QTMA 4KTZA 3H08A 1NK9A 1C0MA 5KFUA 3TAGA 4N56A 1U4BA 2NRZA 4NY8A 4FJHA 1KEJA 3OYFA 3Q8RB 4TURA 8ICFA 2UVWA 1BGXT 4KMUA 2P66A 3KIOA 1UAXA 2JLEA 1RDCA 7ICGA 4Q45A 1V9PA 4E19A 2HNDA 5D4BA 1XS9D 1BIUA 3DLHA 3B6OA 1ZQWA 1XSLA 3AVNA 3NGIA 1S6QA 3VA3A 4KV8A 3EY1A 4CJEA 3AVMA 2R8JA 3GILA 4TQSA 4RW8A 1L3TA 3I0RA 1TKXA 4YXMA 1S6PA 3VQ8A 3OYJA 5KFGA 4B9MA 3OYEA 4KB0A 4KB1A 5J2FA 2HHTA 3ZD8A 3HPGA 3K57A 4AILC 2W9BA 4BXOB 4KTQA 4O3NA 5JS2A 4I2EA 1ZQDA 5J2KA 2RDJA 1BVSA 5CWRA 9ICOA 3DMJA 3GFKB 3MR3A 3RMAA 5KG0A 2F8TA 1A5WA 4CFAA 4F5NA 1RT6A 4P4MA 1XSPA 7ICPA 1HYVA 1JL1A 3QLHA 1XWLA 2OPRA 4EYIB 2BR0A 1EETA 1EXNA 2ATQA 1TKTA 4CJQA 5D46A 2A1JA 3JPOA 4IG3A 5KG5A 2P6UA 5KT5A 5C42A 2PYLA 2BCUA 4Z4CA 3PO5A 4LY7A 3JPNA 1R0AA 3AVBA 9ICUA 1DGSA 4UBBA 2OPSA 4CEEA 4DTPA 1J53A 3DLKA 8ICCA 3OYGA 4HCBA 2BPGA 4F4ZA 3KK3A 4KLMA 4M3RA 5DGAA 3CFPA 4RT3A 4LSNA 2RF2A 4M3XA 9ICEA 3KHRA 4RNMA 4FM1A 4DFMA 5CR0A 1VSLA 9ICNA 2KN7A 3OYNA 2JZBB 3V6JA 5KFOA 1RT5A 3MR2A 1ZQXA 3TQ1A 1RYRA 2IDOA 4DU1A 1IG9A 2HHXA 4EZ6A 4KLOA 1ZQFA 3KLHA 2P5OA 5DDMA 3ZDAA 2BQ3A 3CG7A 3ZT1A 4CIFA 4O3QA 4CF2A 3PMNA 4UB2A 4UAWA 4KLHA 3HP6A 1B9FA 1ZQBA 4DQIA 3HVRA 3QEAZ 5KFAA 4Y1DA 2ETJA 2IMWP 4CEDA 1J5OA 3SNNA 4HYKA 1S77D 2X74A 3NE6A 4EBCA 1HNVA 3RH5A 4WE1A 2VWKA 4H4OA 1NK7A 3HT3A 2Z1GA 3LPTA 5DB8A 3KD1E 5KT6A 4XA5A 3WNFA 3UQ2A 3ZCMA 3WNEA 5T7BA 4B9VA 1HRHA 3KHGA 4CE9A 3TWHA 1VSJA 1QSSA 4IFVA 4CJTA 2RDIA 4DMNA 8ICJA 4CJLA 3F9KA 2B6AA 3NH0A 1CZ9A 4MFBA 3SUQA 4FJ5A 3K59A 4DFKA 5J0OA 3WNHA 1RCHA 2NRWA 1T03A 5KFBA 1B22A 1ZQHA 3KJVA 3MECA 3E01A 3RRHA 4M9LA 2D0CA 3GIIA 3P5JA 3QEPA 3PY8A 1X1PA 3NF6A 3EW9A 4RW9A 1C0TA 4FJIA 4E7HA 4W5OA 2IBKA 2PFQA 5DG9A 3ZT3A 3K5MA 2A1RA 5DB6A 4J9NA 4PH5A 3Q8SB 2HVIA 1NOZA 4BACA 4QWCA 2IHNA 3GV7B 1VSEA 4J2EA 1HUZA 2PYJA 3TAPA 2OZMA 4O4GA 1J54A 2HVHA 9ICHA 1IH7A 4KLGA 4O0IA 3ZSXA 4QWAA 2DTUA 3OS2A 1T7PA 1ZBFA 4GMJB 1H38A 5EWEA 4BXOA 3LZJA 1DLOA 3JSMA 3H4BA 4I2DA 4GC7A 4O9MA 4CGGA 2P51A 2WTFA 2BKEA 3WNGA 5IILA 4RPYA 4TUPA 4F4YA 3OYKA 4IQTA 4ED2A 8ICVA 4C8KA 4DS5A 1RBVA 3HPHA 4TQRA 5KFXA 3DM2A 3RBDA 9ICWA 7ICNA 1RBRA 1RBTA 4F8RA 3L2QA 1GOBA 4DG1A 4YD1A 3G10A 8ICXA 3KD5E 2OA8A 4DTSA 2VG5A 2P5GA 3HJFA 4IDKA 4ED7A 1WN7A 4NM1A 1KDHA 2X6NA 4I27A 4AHRA 3V9UA 1UA1A 3DLRA 3MXIA 4EEYA 2J6UA 1HNIA 3VQ9A 3MEGA 3T3FA 4CHQA 4F4XA 4M6WA 4DSKA 1NOYA 4FLYA 5HMMA 4RQ1A 4UB1A 3QNOA 1NKEA 4CK3A 4IG0A 4J2AA 1IKXA 4NLZA 4KI6A 3DI6A 1C1CA 1RBUA 1EKEA 5KG7A 5J2PA 2XRIA 4IRDA 4DTXA 3MXMA 2G8FA 2H5XA 4KLLA 2VA2A 1C1AA 4EYHB 4M6WB 3RBEA 4ELVA 3UXNA 3V81A 2O4GA 3H8WA 4DL4A 5EWFA 2BPFA 2PI4A 4HUEA 4J2BA 1VSMA 4CHNA 3C2MA 4RQ2A 3KLFA 5C24A 1UA0A 2WONA 3O4NA 1D9FA 3O3HA 1ZQRA 3C6UA 4CFBA 4XQ8A 4HUFA 4CF1A 3MEEA 3FFIA 1B92A 1C0UA 3IHQB 4QZBA 5KFHA 1WAJA 4F4KA 4YG2A 4CHZA 1KLNA 4KLUA 4FJGA 2F1JA 3CYMA 3K5OA 3O3FA 1BIZA 4OPKA 8ICOA 4CECA 4KREA 2R8IA 2IS3A 3V7LA 4F3TA 1QS4A 4HUGA 2PFPA 1MC8A 1LWFA 1HYSA 1IXRA 4ID5A 4QW8A 3Q8PB 1W9HA 1NJYA 2HMIA 2AU0A 1TL3A 5DLGA 4Z4IA 4M2YA 4KHQA 3OYBA 4AHUA 4CESA 5KFDA 7ICTA 4YCXA 4PGYA 3OHBA 1BISA 4JS5A 5J0SA 3DLBA 3FYHA 3BQTA 2HHQA 9ICPA 3JPRA 4HTUA 1A5XA 4DFPA 3VQ6A 2NRVA 2DPIA 2PXIA 3OYLA 4FZYA 2W9BB 3QO9A 3SZ2A 2I1QA 3Q8KA 3HSTB 2FLLA 3B0XA 4G1QA 2AJQA 2D5RA 3MFHA 3SV3A 3T1AA 3VQCA 5KFEA 2E4LA 4FW1A 4E89A 3LDSA 2E6LA 3HWTA 3C5FA 1QSYA 1ITGA 2FBVA 4Z6DA 3VQ7A 4W5QA 4R64A 3V1OA 4QZDA 1HPZA 9ICJA 5EWGA 1WLJA 3QEBZ 3GIMA 5KFPA 9ICLA 4K8XA 3NAEA 3VN5A 3F73A 2JEGA 4FJLA 5J0TA 1BPBA 4ZH4A 4H4MA 3V9WA 3BQ2A 4R8UB 3AA5X 4FM2A 3QEVA 1NKBA 5J0WA 3PNCA 5KFTA 1S9FA 1JLEA 4Z6EA 1T05A 4BE2A 3AVJA 4DF8A 3M9OB 4LSLA 4E0DA 4ECWA 2BGGA 3RR7A 3E2EA 4KTWA 4OLAA 4ED6A 3L2VA 3GIJA 1BPXA 3OYMA 1VSHA 1HMVA 5J0PA 3BGRA 4ECZA 4DQQA 1WCNA 1KCFA 3AO5A 3V7KA 3GV8B 4N41A 3OHAA 3RJEA 2G8VA 3ZDDA 5KFZA 4DTNA 5FRNA 2D0AA 4I2QA 3V4IA 3GIKA 3TI0A 4RQ3A 2HW3A 2W9CA 4QZCA 1S97A 3BQ0A 3TFRA 1S10A 4RQ6A 4Z6FA 1G15A 8ICAA 1Q9YA 1RT4A 2ZTEA 4FBTA 5KFYA 3ZSVA 1HQUA 3LANA 4OGCA 5J2NA 4N47A 3RJJA 3NGYA 5KGWA 4M04A 4ECQA 3ZSWA 2GWSA 4YFKA 3QE9Y 5CP2A 1HJPA 4E7KA 4OLBA 2V4QA 2MUTB 3KLEA 4I2GA 4RZRA 1WSJA 4M47A 4I7FA 4QZIA 4J9KA 4DL7A 4O0JA 1RT2A 1RT3A 4QZAA 4CIGA 5JS1A 2EHGA 5CYQA 3HW8A 2W9AA 3SQ0A 1ZBHA 5DG7A 3PW0A 3CFOA 5IIOA 2OYQA 1NKCA 3OS0A 3AA2A 3PW4A 4KLQA 3T5JA 3PX6A 4CJFA 2P6RA 1VSKA 4DTOA 5KFRA 3Q8QB 9ICBA 5K14A 3RMBA 3P83D 4HCCA 3L3UA 3RB0A 4M41A 1TAQA 4NCBA 2I9GA 3U3YA 4Z4GA 3VQ5A 3ZT0A 2ZD1A 3QERA 2ALZA 4B9NA 4C8LA 5HRNA 4CEFA 1T4GA 9ICTA 1BI4A 2HHUA 5KG2A
chains in the Genus database with same CATH superfamily
1MA7A 5BYQA 4KV8B 2OLWA 4NLQA 4RT2A 1VJ5A 4FLVA 3K2PA 1MMLA 3GYNA 3CIZA 2W7PA 1Z1VA 4CGFA 4BRHA 1HUOA 5IIIA 1NJZA 2H48B 3IFRA 4EHUA 4A62A 2QMXA 4DU7A 2K4IA 1MWZA 1HIYA 2CJXB 4FO0A 4DUZJ 4LF4J 5L1IA 1Q95G 2R2RA 1RAFB 4JBCA 3KHHA 2K7JA 5ADZA 4MKBA 4USVA 1REGX 4RJVA 5L1JA 3PCOB 2DR8A 3T5HA 3LP1A 1NZBA 5LOQA 4MO4A 2DNKA 1HBMB 3C2PA 4F91B 4DV0F 3W60A 4LREA 3WX8A 2QKKA 3UCGA 1ZBIA 4PY5A 4ED4A 2EC2A 2Q1NA 2FPKA 2DFFA 4WK1A 2RB7A 3C65A 4OV1A 1KHVA 5DQHA 3D0PA 4DSFA 1K8KA 4H5TA 5F1XA 2F44A 1FWKA 2I7NA 1S1TA 8ICTA 4MYUA 3DFEA 2LA6A 9ICGA 3MMVA 2EWHA 4DSIA 4KN7A 4K7QA 1ZQCA 5HHIA 3CJKB 1U26A 2E5LF 2YWHA 2QXLA 5AKKA 3DXMA 1RT1A 2QLTA 2J9EA 1T3NA 5CABA 4OHYA 4MQ3A 2MQ8A 4LRBA 2YXLA 3ZX3A 3EXCX 3IRUA 4MF2A 4Y28C 4ATNA 7ICUA 2WBRA 3QYYA 4EO8A 1RLDA 1LWEA 2MZSA 4A8OA 2GCFA 2D0BA 2QFIA 1VI7A 4HACB 1BPDA 2CYYA 2AMCB 2GIQA 1BG3A 4KY3A 1ZBTA 1IKVA 2F9DA 3CUNA 1YJNN 1U8SA 4FKXA 2UXBK 1CUKA 1HR0J 1CC8A 1NGAA 2PFDA 3MMAB 4NCAA 3T19A 1Y88A 4PG8A 1UVKA 1ZQJA 2KD1A 2UUAJ 3TZXA 2WHOA 5JXSA 1ZA2B 3UPQA 4TYBA 3DLGB 3NCIA 4R66A 4KO0B 3H3NO 1B43A 3GDXA 3BKTA 2HFUA 2CGJA 5T7LA 4EIAA 2MKHA 4GKKJ 2FUG9 4B9QA 1AQ6A 4FLWA 1S1UA 4FYDA 2V8HA 3KKSA 4ZVUB 4NYFA 1CZBA 2HBJA 1ZPWX 5JUMA 4R65A 1TKZA 2E1AA 4OKEA 4Y2AA 1H3DA 2A3ZA 3C14B 5ETOA 1F2HA 2QA4N 3EE3A 3KWGA 4J37A 2DHXA 3SJJA 3ZO7A 1HJRA 3I8BA 4TKTA 3P4UB 3IRXB 3VVUA 3S8SA 5KRSA 4P52A 3ZT4A 1RYSA 1REVA 1A9NB 2VL1A 2QWRA 3CCQS 1BHLA 1WSGA 4DI6A 4ZCKA 5AXNA 2WONB 4BG8A 4DL2A 5BRHA 2F8EX 3N5FA 2YH0A 2QEXS 4UB4A 2J7WA 3SK3A 4RUBA 2ZKTA 5HRRA 4FZZA 3THVA 1IM6A 2ZJRQ 3I5CA 3BO3A 4E8UA 2E88A 2V6AA 1T03B 4KLDA 8ICUA 1RHMB 1BO5O 2FHJD 3N97B 2U2FA 2ERRA 1M90O 3DOLA 3AVCA 3MCAB 4FPIA 2I5JB 7ICKA 4FJ9A 1S76D 1UPPA 4RW8B 3CM6A 3VF6A 2PA8D 2F4VJ 8ICNA 4PQUB 4EX7A 4AHTA 2ZOFA 3T69A 4DR2K 1SV0A 2XTJP 4ZK7M 3NS5A 1LWEB 1MQ3A 3HVTA 5B09A 4WYLA 1VBKA 1D8YA 3C28A 1ZPVA 5F9LA 4FE3A 2XGPA 5FLXO 2A10A 3K58A 1U6BA 2PO4A 1FDBA 2BE9B 1H74A 3SI6A 1HNXJ 3L7UA 4AH9A 3E3XA 1WOOA 2ZD1B 3AN1A 4TLQA 3CJ9A 5CD4A 3TZYA 4P4OA 2V8GA 4P10A 4FWLA 1ITPA 1HNZF 3M8SA 2P9EA 4ED1A 3QSYB 3H7HB 4Q0BB 3BREA 3EL2A 2LKYA 1LFPA 4UTGA 4W4MA 2P9NA 5D49A 3F2CA 3QBCA 1IXKA 1H7WA 3GV5B 3A8JA 4WIQA 1YVFA 4FK0A 1B64A 4M9NA 4RQNA 4LFBK 1SZ2A 4M5DA 4QPTA 1OWXA 2YNGB 5ETMA 2KVSA 1RKIA 3THXA 1LAVA 4PYDA 2XMVA 3EKUA 1RA6A 1ZS6A 1XMOK 3AA4A 2DGUA 4C9DA 3D45A 3RWUA 3AVKA 4H0PA 2DRBA 4BWJA 2E20A 2UVRA 3PO4A 4X62K 1ZQLA 3CPWM 3AJ2A 1Q81O 4C97A 1FNOA 2AZ3A 1RDBA 1C6VA 2MKCA 1JMSA 1WJ9A 1TVAA 2PFNA 2UUBF 2W8LA 5LJ5Y 2XYHB 3C16A 4OYIA 4IYQA 2JGUA 4ZHRA 2DT9A 3EICA 4I2HA 3HKZF 1KVJA 1BI4B 4WFBQ 4FO6A 5J2JA 4NA2A 3SQ4A 2B5JB 1HI8A 3QT5A 1O08A 3THXB 4IQWA 4MEYA 5A0LA 4QZ8A 4LVNP 5EN1A 2EBEA 2QTWA 3IBFB 4LF8J 2P35A 4A8FA 4CO3A 3VAIA 5DBAA 2FC8A 2BRKA 2KSOB 1CBKA 4DFDA 1JLCA 4N8OA 1HI0P 4E7IA 4JB8B 3OL7A 2Y3YA 4JK9A 3R8YA 3I76A 2EZZA 2W7AA 5J8YA 1JKHA 1X0FA 3QEIA 3CCSN 3KKAC 2GWKA 2C22A 1FKOA 1JLBA 4YY3F 2K3KA 3RAXA 1RTDB 2Y0SF 4OHZA 3M9MB 4ZTFA 3MX2A 3L7OA 2E7VA 2FXUA 5ALWA 1WD6A 4LFBJ 1X6IA 2FZKB 1X0PA 2VDIA 4DHYA 4OJ1A 4I67A 2B51A 2R7UA 2Q0ZX 1RDRA 4ECTA 2YQEA 2GO7A 4IH7A 1IBCB 4A47A 4OZ1A 4BRCA 2HNZA 5H1SQ 2I5HA 1DARA 1RAGB 4MF8A 4YP3A 2B4JA 3ORYA 1O0PA 4YR2A 4M3ZA 4MFFA 3MEDB 4ZTJA 1S0VA 1ZJNA 1U49A 5AI9A 2YX7A 2QMUB 4K0KJ 3GYXB 1VMBA 1R8PA 3ENOA 4PYAA 1HBNB 1D9DA 3CETA 3KNAA 1J5EK 2AD9A 5IQQA 4ED8A 1S8OA 3VCDA 3AO2A 2F4VF 4CRXA 4XO0A 3KMSA 5D3GB 1HI1A 1U1NA 4DZDA 3UR3C 1X9JA 4IO9Q 4ZCLA 2BPCA 4OKKA 3EXYA 1JLAA 1L3KA 3HTVA 4M0AA 4J9VA 5HAOA 4GXKA 2BDUA 2D0PA 1ZQZA 2WUSA 1SQGA 4I2AA 4Z4FA 1BUXA 2Q1LA 1WORA 3BB5A 1KFDA 4O3MA 2W03A 3CD0A 2NLXA 3VGTA 4M63A 1HARA 2EG2A 1ZAVA 1Q7LB 2PI5A 5DDRC 1WBDA 3KHYA 5JMNA 1ELOA 3U6FA 2JWNA 3N6LA 4JI8K 2E8AA 3EPIA 4EZ9A 3AFGA 2AXTU 3OR1B 2FVSA 1YI2S 1WC4A 4OPAA 5DQGA 4C2MA 2EX3A 2OAUA 4FWMA 4P0PB 2VA3A 4JMUA 2FSJA 2WVCA 3ID8A 2HG4A 2CAJA 1LAWA 4GVLA 3WK6A 4YDDB 4WPAA 3OV7A 2VQFJ 3R5GA 1Q8BA 1S3XA 1QE1A 5AI4A 4CLYA 4IFYB 3DNCA 4BG9A 4AE5A 2LYHA 4IR1A 1CJVB 4E7JA 4CEAA 1LB2B 3NLCA 2IOHA 2AJ2A 4DR1F 1JJ2M 3LDOA 3NBPB 5DM6L 3I9V9 4CW7B 1JNZB 3RR8A 4YY3J 2GJFA 2YKMA 3HX9A 1I3AA 2W55A 2HQGA 1SZHA 4JK8A 4RPZA 1YQHA 1PG5B 4B1WB 2DNOA 2M8HA 4K4WA 3HP9A 1PSDA 2VD3A 3TKAA 5J0YA 4YMEA 4AL7A 4A46A 1ZXIA 2ACMA 3CB4A 2F1HA 4ZVOB 2W4PA 3MDCA 3UFCX 4FNHA 1SL2A 4R79A 1UJ4A 2GEMA 4J5OA 2C3UA 2R2UA 2OTLN 2JNJA 2G8HA 9ICIA 2IM0A 2VPYB 1G6BA 3KWMA 4TYAA 4JKBA 1IBLF 2XZDB 4I6YA 2O8DA 2NZ4A 1S1TB 2V4JA 4QZEA 3MWBA 4HL9A 4NXMF 3UO0A 3PV8A 5ALEA 1B4SA 5FJ4A 3T1YK 2KI2A 3NGTA 3PG9A 3PEHA 1GMWA 3UKUA 4LBHA 1XO0A 1RAAB 3MWPA 4P74A 2V0NA 4EK2A 2Y1IA 2ASJA 3O2IA 3D2EA 1YXQA 2XMAA 2RILA 3RB6A 1NDCA 4A8QA 3HKZD 2ZUDA 5AQMA 2LYBA 3DLEB 3NDKA 3UN3A 4LF7F 3M2RA 5L46A 3MMBA 1YBTA 5GMDA 3Q86A 2G2OA 1K8AO 4ACOA 2YKOA 2A2CA 5AQSA 4AYBC 3DXKB 5DQIA 1S1VB 2KM8C 2G2YA 4P0PA 1JJ4A 3W8PA 2HNYA 1T94A 2YQ0A 4BR4A 2V8DA 4CZEA 4Q2MA 3A3PB 3ZSYA 2HHPA 2AYBA 3OFHA 2H5JB 1QLNA 3AJDA 4CLSA 2HHHK 5HMLA 5CA7A 4JRPA 5J2MA 2E3TA 2AYEA 5AZIB 1BQXA 1S1XA 1RP5A 2Z7JA 2WW4A 1ZD5A 5H9EJ 4YOTA 1Q7YT 1J2MA 3G82A 3MR7A 4AD6A 3VA0A 1YJRA 1OYEA 4J2DA 3MBYA 4OZ3A 2VWBA 5LSOA 2AEJA 2KJ9A 2W3RA 2Z2ZA 1JJHA 3VZHA 1BA1A 2LQJA 2PBDA 2A42A 4JV0A 1WC3A 2I6XA 2CQHA 2ADCA 3KZIU 2OXOA 3H45C 3KK1B 1F21A 2YKNB 1VRTB 3PNIA 1WOSA 4IOAL 4MJKA 2KFNA 1X2IA 2DIVA 9ICSA 1NDLA 2BOAA 3H6EA 3CC4N 4USJC 2RSQA 1FJEB 4F0MA 1WHYA 3DHWC 1GLAG 1KFTA 3WKAA 5DM7L 2P9IB 3CC2S 4KHPJ 1TAUA 5KAKA 4F0HA 3BO2A 1UP1A 5CYMA 4Y2MA 4M3YA 5AK6A 4U9RA 2XMMA 3PRVA 5K20B 2N4DA 5ADXA 2VB6A 1J6ZA 4EP5A 5L1LA 3F44A 2ZIVB 4O23A 2FDNA 3HHNB 1HBOB 4CLUA 2BVZA 2R3VA 3ZTPA 7FD1A 2ZHAA 2QT7A 2B6AB 1F3VA 4UZCA 1NGDA 4LUBA 3VAHA 4CNQA 5J0XA 4M8LA 1I39A 4JI8F 5DLFA 1O51A 2DGXA 5F3ZA 2J0QD 4QWEA 7ICVA 2F96A 1NHUA 4CCHA 1NGEA 4FWOA 4R8UA 5BYSA 1QZ6A 2HQIA 5C42B 3TTCA 2WAQD 2W43A 3NGKA 1KHWA 1J97A 3PM9A 3GL1A 3CJBA 3V1RA 2YVSA 5M1FA 1HKGA 4HVJA 3J81j 4JOUA 4ELTA 4OPJA 2E5IA 4GLXA 1S0MA 3B0YA 1B3TA 1HWLA 2P1JA 5FLXY 3RJFA 4BWMA 4RQMA 3CCLN 4JD2A 3O4QA 2YTCA 4K4SA 1HA1A 1NK4A 1NMNA 3ZLJA 5C2FA 1WOQA 1K73O 1SJRA 4A5BA 3RJIA 2CA9A 2WMMA 4Y2VA 4MFBB 2YY3A 8ICQA 9ICRA 5FDLA 3MM9A 1OXJA 4EENA 2B9YA 3UDLA 8ATCB 3QETA 1UWBA 3MGJA 2IRUA 5IM0A 2M0NA 4PPXA 2PKEA 4Q5VA 4TUSA 4CI6A 3K5PA 4DTJA 1CC7A 4X66J 2ZF5O 3GR0A 2GFFA 1MG7A 3G8TA 1BY9A 4PUOB 1K6YA 3GYGA 4I2BA 5LMUK 1ZM2A 1SIJA 4I7FB 1C7YA 2KHDA 2NXUA 4YMNA 1UVNA 1WF1A 2IAJA 1LWCA 5LM7E 4DB3A 2P9NB 2LBOA 3OTOK 3VETA 3NH2A 1GT8A 2R7WA 4P4PA 5KT4A 2ZH9A 2ZIUA 1JWWA 2MKIA 2XIDA 4PG7A 2HF3A 4V1Ak 2IVOA 2CQ0A 3EUB2 4O3RA 4QYZJ 2K06A 3OY9A 2ZJQL 2W42A 3TA0A 4GV6A 1SIWB 3OSPA 1ZRNA 2UV8A 1RT5B 5AI6A 4G65A 1BNOA 3ZI4A 4ELUA 3TX8A 1LOTB 5E3PA 4KKOA 1URRA 4LSLB 3TPQA 1OH6A 2G0IA 1NK8A 1K1QA 1P1TA 4CJKA 2GGPA 4NEZA 2DWQA 3DLJA 3NASA 2I5JA 2OELA 3W5XA 3WXIA 1GOAA 1AB8A 1E6VB 3LUYA 4U8YA 2Q3PA 1WWHA 2XY6A 2IHR1 4KLIA 5HP1A 2OPSB 2VGNA 3VOVA 5TZVA 3GLJA 1V9OA 4DHVA 3F9MA 2F4VK 4Q2LA 2VBXA 4KLSA 2DH7A 1CS4A 2VICA 3BYPA 4IOXA 1S6OA 4OJRA 4XPEA 2EANA 2UZAA 1KEKA 2GIRA 5EGYA 1JIHA 3B4MA 2JH7A 3TR5A 5IIMA 4P2HA 1NPPA 1L7PA 4C3MA 3BEGB 3IS9A 2DR7A 5K8PA 1JLCB 4EP4A 3QFHA 3R1HA 2AV5A 4BE1A 4CH1A 3ISNC 2DGTA 3SQGA 3KKRA 2I38A 1RYUA 2R18A 1RACB 2L08A 4JYAK 2BV3A 3NFAA 3K5LA 1XUPO 1ZQPA 2YHWA 2DNZA 2ZG6A 3ATUA 4PXEA 4JWNA 1U24A 2AP6A 3NVMA 5KFWA 1YKWA 3K2YA 1FXXA 5HL7Q 2DHSA 1RB0A 3OJSA 3KVGA 4YN3B 3M8RA 5BN8A 2D0OA 2D3ZA 3HYFA 2I9SA 5AXKA 4UZBA 1SV5A 2XNQA 4KO0A 4YR3A 3C16B 3I5BA 1OW5A 5IIKA 5KTQA 4MMOA 5H9EK 4B9SA 4CIEA 3DRPA 3O5BA 2DNRA 5B5EU 2KVQE 3IAS9 1J5EF 2Q3SA 3AY0A 2G8IA 3M6UA 4DU4A 4JYAF 4OX7A 1X9SA 1IBKK 3R7BB 4L8RB 1VK0A 3NGRA 4ZOSA 5EHHA 1OJ4A 2ZEJA 1YF5L 4JEPA 2NYVA 3MUMP 4RU2A 1D1UA 2XHCA 3KLEB 3PJXA 3N4QA 4FPRA 2UUCJ 4BGAA 4Z2XA 2AJ4A 5E79U 3HDSA 1JLAB 2IM1A 2VQEJ 1NGIA 3ZSQA 4P6QA 2WF8A 2UUBK 1MMNA 3HL8A 1WKLA 4PXCA 1ZQ1C 1N52B 1KOOA 3QBWA 3N7PD 4MFCA 3CJKA 3G6YA 1YITN 3PSPA 3VQSA 1X4EA 4XEIA 2W9CB 4NXMK 4Z0UA 3C6TA 3UE2A 1OYDA 2GQCA 4K0KF 3V9SA 1ZQVA 1SAZA 1EX4A 1OH5A 4Z6CA 4NV0A 3KD3A 4K4HA 4ZPTR 4DSEA 9ICQA 3KHLA 1QTMA 2A18A 2YY6A 3MOZA 4FWRA 1NK9A 3JSYA 3TAGA 3PIOL 5HR6A 1X5SA 1U4BA 4FJHA 3RRKA 1Q79A 2BH1A 3CF5Q 2UVWA 3M6ZA 3LM2A 1TMMA 4DR7K 2JSXA 4JI5K 1OPIA 2KXHA 1ZTWA 1UAXA 3SFGA 2HHHF 4WF9L 4EMDA 3CMES 1V9PA 3I5AA 5AQJA 4G1QB 2C3PA 5D4BA 3F56A 1IQTA 3SSRA 3GCXP 2K7KA 1VISA 4OI2A 2DGWA 1L8OA 3EZUA 2G2ZA 4RBUA 1XSLA 3AVNA 3NWRA 3IV6A 4RNHA 3L0QA 1GLFO 2Q6BA 5M1QA 4YXMA 2NSBA 5KFGA 2Q36A 4QYZK 3R2DJ 4KB0A 1SUQB 1N5QA 3K57A 3HPGA 1KAYA 2W9BA 1DTTB 1UFKA 2WHEA 2HS0A 5JS2A 3W5ZA 1ZQDA 1ZXOA 2G13A 5CYMB 3CC2N 4RW4B 1L7MA 1A5WA 4F5NA 1Q8LA 2NXEA 4K5SA 2P9IA 1X66A 4H54A 1H72C 1L6NA 3U4LA 2F3JA 4EYIB 1EETA 1EXNA 5BPNA 4CJQA 1TKTA 1VR6A 4DJBA 3ZYYX 4KMOB 4WTYA 2VFTA 4TY8B 1FDDA 1K9MT 4NE9C 1WWUA 5B7WA 5E3QA 2IAJB 2VBWA 3AVBA 2DO4A 1DGSA 3QIPB 2OPSA 1RHKB 4NI2A 1UZDA 4QIWF 2OEHA 8ICCA 1E6VA 4MK9A 2BPGA 2VF3A 3KK3A 2O8EB 3ISZA 3MCSA 4M3RA 4P72A 2ZWPA 3HZGA 3IBCB 1V3ZA 2RF2A 1H98A 4HKQA 4AL6A 4M3XA 4IFVB 4RNMA 3PSFA 4DFMA 2ZH2A 2E5SA 2FHJA 3CJAA 3QT6A 2LYAA 3OYNA 5AKJA 5ALDA 4RLEA 3V6JA 1RT5A 4CQ1A 3R6GB 3TQ1A 3MR2A 2BJ1A 1NM2A 2MSTA 2HHXA 3C15B 4RUHA 2XG8A 2P5OA 1C20A 4XH5A 2BQ3A 4J03A 3NCPA 4PJ0U 4YDXA 4MIBA 1G2EA 1ZM9A 1CJTB 3BS9A 2AZ1A 4CF2A 4FXVA 4KLHA 3PLAA 2VCPA 3BH6B 1B9FA 4DQIA 3HVRA 2WVFA 2YMQA 5IXUA 4MAKA 1MU2B 2IMWP 1ZTTA 4CEDA 1YJVA 1FVQA 1CJUB 4JKGB 1DAXA 3MEGB 3NE6A 1HNVA 3FCHA 3RH5A 4WE1A 1QQ7A 2VWKA 3MMBB 3IWXA 4H4OA 2ASMA 2CZ9A 3Q8YA 4TLRA 3LPTA 4X65J 5DB8A 2POKA 4AT1B 2OTJN 4XA5A 4UB8U 2LECA 3UQ2A 4RW7B 3KUGA 4DR7F 5T7BA 1CPZA 2J9DA 1HRHA 3DLLL 2XMTA 1H6KX 4P71A 3W2WB 1KOHA 2HRYA 2XQCA 1XTZA 3FEXB 1FX4A 2OHFA 4CJLA 3QSIA 2B6AA 2W01A 2EAOA 3PYDA 3SUQA 3CMQA 5ALMA 3IG8A 3K59A 3DM2B 3QX7A 1MA9B 4ID8A 3LGHA 1HNZK 4LC9B 5KFBA 3RRHA 2OTLS 1X1PA 1GLCG 4QU7A 4FJIA 4E7HA 4W5OA 2PFQA 5DG9A 2VOOA 3PRDA 1CQNA 3A8KA 4J9NA 3ONNA 1PIEA 2VJVA 5C2GA 3Q8SB 5E3RA 4DV3K 2P9KB 4WXWA 2JWLA 1VSEA 1X4AA 1YJ7A 5KAFU 3TAPA 3A1YG 2OZMA 4O4GA 3MAHA 1WDDA 2J9DE 5F3TA 1YJWS 2DTUA 4BC5A 1WOPA 1T7PA 4GMJB 4QBUA 4BXOA 4MTPA 4O9MA 2C2OB 4OJOA 2HK3A 1KQQA 1U2RA 3MUVP 1RXOB 2BKEA 3WNGA 1Y3JA 2MKSA 3M7DA 4RPYA 4F4YA 2FHMA 5DZ6A 3CJ5A 8ICVA 1RTIB 2Q97A 2OM6A 1RBVA 1LQ9A 1OY6A 9ICWA 3I31A 3KLFB 3L3CA 2KM8B 3KD5E 5ETNA 4PXBA 2MQNA 2IJNA 3ZZYA 3R1XA 4IDKA 4NM1A 3J7AP 2MLYA 2X6NA 4H03B 2Y0SC 3TA2A 4XH4A 1UA1A 2BE7D 3DLRA 4EEYA 2M0GB 1X3MA 4TNOA 2J0XA 2OMLA 2H3IA 3PACA 3OTEA 2LQ8A 2V8VA 4IDHA 2W2QP 3T3FA 2ZH6A 4USIA 2JVOA 1VQ6S 4RQ1A 3H98A 2QMWA 5IT0A 4LSNB 2RE2A 2YB1A 4GVEA 2KEYA 2AHOB 1NGJA 2QJ3A 2LEBA 1C1CA 1EKEA 5KG7A 2JWKA 2KRBA 2EK6A 2ROGA 3HRDD 4WFNQ 4HH1A 2DEIA 4O44B 3UXNA 3H8WA 4DL4A 3ATVA 4RKUC 2CNNB 3QWUA 4J2BA 2D6FC 3C2MA 4DG1B 3DHXA 2YX1A 4C98A 2DR5A 2XMKA 1N88A 1RCXB 2W2OP 1ATNA 3KJQB 1D9FA 3C6UA 4CF3A 2YWGA 3I0SB 3DDIA 1N5TA 5B0CA 4AXIA 3Q24A 4KBIA 4CF1A 3MEEA 3U8XA 3KK3B 2O8EA 4YB5A 4QZBA 2HRTA 4DR4K 2P9SA 2RDDA 1N63A 2RQ4A 2CWKA 4FYVB 4FJGA 3U1MA 3LGNA 5AI5A 3NRWA 1TL7A 4DU8A 1BXNA 3DRXA 2YNIB 1XNQF 2VDHA 3RAMA 4DR3F 6FD1A 1KKXA 4F3TA 3ETOA 4ERDA 1IVZA 3K17A 1FKAF 4RL1A 2DHGA 4UW2A 1HYSA 4CD3A 3A4TA 1IKYB 1Q5VA 2NZCA 2HMIA 4C1NK 2KK0A 2XB2D 5F0UA 1TP7A 3VV2B 2M3DA 1WHWA 1DK3A 2IVMA 1FXRA 2JR5A 3KWIA 4HTUA 1CQMA 2CADA 5HSPA 2PXIA 4ZJQA 3SZ2A 2I1QA 1B0VA 3F2KA 2CQCA 1RGVA 2P9GA 2D5RA 2BYCA 3MFHA 3HHKA 3T1AA 4G6VB 5KFEA 2E4LA 3SBTA 4E89A 1FXDA 1J5EJ 1HIWA 1Q86O 4Z6DA 3TZZA 3OR1A 4R64A 1C0UB 4QZDA 3BEXA 3V1OA 3KJFB 4F71A 4DV7K 5EWGA 2QLFB 2WVEA 4NO7A 4WKRA 3CQXA 5CR4A 4K8XA 4E98A 3DRRB 2JEGA 4FJLA 3ILIA 2CXEA 2JH3A 4H4MA 1Y0HA 1HWUA 3Q8VA 2CDQA 2XHWA 1KQSR 1NKBA 5KFTA 4UASA 3H1QA 4LSLA 1AA1B 2XWYA 4F04B 3R5BA 3E2EA 4OLAA 4ED6A 2GQ2A 1BPXA 4QS8A 4B3TF 2XYGB 4OYBA 2FJDB 1V85A 4V19S 2G1DA 5J0PA 3OQ2A 2N4CA 4ECZA 4DQQA 3MF5A 5AM0A 3JTOA 3QJLA 1NNEA 2DGSA 3RJEA 3U7JA 2G8VA 4PWUA 2ZHBA 2D0AA 3HFKA 3V4IA 2UXDF 1CJTA 1S97A 1ATRA 4KRWA 3BQ0A 4F72A 2ZXIA 3TFRA 1B0XA 4Z6FA 1RT4A 3DDNA 3ZSVA 3N28A 2CFXA 5LJWA 2MGZA 1CG2A 4CI0B 1BHNA 4LQ3A 2FVQA 2RHKA 2ZOMA 4NXMJ 2GWSA 1HJPA 5GAHP 2QGFB 4FZMA 4OLBA 2V4QA 2EZXA 4BY9C 4I2GA 3W61A 1RGIA 1SC1B 3D2FA 3AOAA 4DL7A 1RT3A 1M1HA 4HTIA 3TQEA 1W25A 5J1NA 2EHGA 3HW8A 2YH1A 1O8BA 4X4UA 3I33A 3PSTA 3CFOA 1RWKB 3OS0A 4NZ6A 4KLQA 1TAMA 1AUSL 2KHVA 2WAQC 3Q8QB 3CMEN 4OO1J 4EFAC 3DRYA 2ALYB 3TUJC 4AM7A 3AODA 3MC1A 3RB0A 3C7NA 4Y0FA 1OH8A 3CXCM 1REVB 3U3YA 4PL2A 2VYPA 5AQIA 1DJ0A 2FDRA 4AFFA 3VQ5A 5G0RB 3GE1A 2WF9A 3OL9A 1XR6A 4B9NA 4C8LA 5ETLA 1N0VC 1BI4A 5CZ1A 2Z57B 5TKWA 4F5PA 2NLWA 3W9HA 4ZPBA 2JLFA 4D3HA 1G99A 4C8NA 4DPWA 1F5CA 3C21A 3ENQA 1MN8A 3NXZA 1N34F 1VHFA 2DTJA 8AT1B 3U1LA 3TVZA 4HH0A 4J9LA 2PMZC 3HI0A 2CQ1A 1VLYA 1NB7A 4ZCMA 2V68A 5EUHA 2W2MP 4PKDB 3EZOA 2PAVA 2GO8A 3A3OB 1N56A 2HIQA 4KLEA 5AM3A 3HVAA 3AQPA 3HHLC 1F9HA 5IS2A 2HHVA 2MXYA 3MECB 2PFOA 3ZDCA 2BKOA 4DR7J 2MLXA 1B7YB 4S0MA 2OEJA 4BJQA 3VF0B 2E7WA 4KLTA 1WEXA 2BA9A 3W0LA 3W62A 3UR0A 5CXTA 1RCOB 3J7YP 3VAJA 5DM6Q 2E8NA 3NCRA 3S3MA 1NCLA 5ETRA 1JLQA 1GX6A 5BR9A 5AFUA 2DIUA 2AYMA 2X51A 1KTQA 4RQ8A 5CB1A 3THYB 4K8ZA 2HBYB 3H25A 3CJ4A 4RNOA 4O5BA 3OD2A 2Y0BB 3TZWA 1XHXA 1L7NA 4LF7J 5AE3A 3WT0A 3QINA 3I32A 1Q8IA 3OYCA 2VPWB 1A6SA 4URQU 2Z4PA 4PZNA 2MYFA 2WCXA 3PIOQ 4OCZA 3ZD9A 3C29A 4JUZA 2IY5B 2C2MB 3CGIA 2XM3A 1SQFA 2MSNA 1HQEA 2VA8A 3THYA 3V9ZA 2DEJA 5AQXA 4FJMA 1RG6A 1ASUA 3PX0A 2FSNA 3OVAA 2WF6A 3WIUA 2JVRA 1S7IA 4KHPK 3DYAA 3BR9A 4J9SA 5J2MB 2HQFA 2E1EA 2AA4A 4QR2A 3LO3A 5LMNF 1N5WA 3TANA 1N48A 5C12A 1QVGM 1D8LA 4ECSA 3FRZA 4DTMA 5B66U 1S5ZA 1TKTB 2H9ZA 2UU9F 1FJGF 3EWAA 4FJ8A 2ZUBA 2E7XA 3DU6A 5CJ7A 5KQ8A 2RH3A 3L2WA 3MM9B 1PYSB 1RT6B 3GU0A 1RILA 3G4SN 1IBLK 4CNZA 3KBBA 5C7PA 2AJ0A 5ETKA 3HM8A 3F53A 3D6MB 2W25A 2DPJA 2AKWB 2BX6A 1TKZB 4CGIA 1F3FA 4IEIA 1SWWA 1U1MA 3IS9B 5J1EB 2XMWA 5D78A 3IG1B 1ILYA 2EXUA 4OX9K 2CQPA 3CCSS 1WUAA 5KFVA 4ZLPA 1BWEA 3MAQA 4FKYA 1S1WA 1QQOA 3HHEA 2CPXA 4QZVB 1I94J 3ZZTA 2Z1IA 4XDCA 3CDUA 3QIOA 1RT7A 4KJIA 4B3MF 1OSCA 4O5FA 3IA0A 4FLZA 1WKKA 1DOQA 4UAUA 4NL5A 3QAUA 3SFUA 4ILHA 2OH2A 2F1IA 4A5AA 4LRAA 4X64F 3CCUS 4DV4J 3TADC 2JOQA 2GJIA 2YKAA 5J1EA 5D77A 3AD8C 3W2WA 3FSIA 3K1RB 3L3VA 4F7VA 2HOEA 5D0HA 3OSNA 1ASWA 4QZ9A 1HQ2A 1U48A 1FERA 4LVSA 2EK1A 3LOUA 2K4HA 4B17A 1RT1B 5DZ7A 1MSWD 2MU2A 4Z37A 4K43A 4J7CA 1OO0B 3T41A 1IJFB 1FX2A 1LW0B 1SQEA 3ZTRA 4QWBA 1CXQA 3NF7A 1FFSB 4JI7K 3PIPQ 4RQ5A 4ZP6A 4NZ7A 2OIHA 4UOCA 1IBKJ 5IT9O 4YR0A 3QGGA 3THWA 4ICLB 1ZOLA 4PUOA 1V5VA 3A0IX 3A0BU 4LR7A 4DTUA 3WQTA 2Z1JA 1G1XA 3LWLA 4QIVA 3KLIA 2F40A 2RHQB 3R97A 3WC0A 2Z1HA 3IFEA 3J7A1 4C4WA 4B08A 1KVBA 4C11B 4DR5K 2IBOA 1PJ5A 1R0AB 1RTHB 5B0DA 5HNKA 1ZQSA 4ES2A 1JCGA 2ESEA 1KQSM 4L3KA 3DRPB 1L3VA 2UVUA 1QSLA 3F41A 3ZEUA 3X3UA 2HQ3A 3I55N 3M2UA 1GLLO 1WBBA 3R5JB 1WSVA 2MGZB 3KOAA 4KGXB 1SV5B 4B3RJ 2ISPA 3KJNB 3FKBA 3PIPL 1VGYA 3OR2A 2GVDA 3H5UA 2DPNA 1VIOA 4UT4A 1XMOJ 3GQCA 1PVQA 1DHMA 5DRKA 5A2QY 2UUAF 3P45B 3GB0A 2ZZMA 3ZETB 1NGGA 1UFWA 2AF6A 2GOLA 1GX5A 1F5AA 2RS2A 1FA0A 4C4TA 2VG6A 1EWQA 2FJVA 3WDOA 4JI8J 5HRPA 3QO9B 5ALHA 2CPDA 1JJ2R 1Z26A 4FWKA 3TARA 4K4YA 4QZHA 4MDBA 1FKPA 3LYSA 4DLGA 4M63C 1FRLA 3N6MA 2A2DA 4MKVA 1XIQA 3IGVA 4PZVA 5MLCQ 2Y0SD 2IVPA 2KIVA 4K42A 4WQ5A 3CC4S 3LP2A 4RNNA 2ZTDA 2DY9A 3ISDA 3LVWA 2IJRA 1GLEG 2HEKA 1ZC6A 4UBCA 2YI1A 5AM2A 4UB5A 3BDEA 4KX5A 2EQYA 1Z25A 3MX5A 1VBYA 5A8KB 4K4VA 3CDEA 1A0OB 5HP1B 2HMPA 1BQMB 3KXDA 3M4XA 1UKUA 1C2PA 4B8AB 4B1YB 3CPEA 5IINA 1PCAA 3SSQA 2FZCB 4FK4A 2QTDA 3WKBA 4B9TA 3DKDA 1H73A 3GJRB 3CCLS 3H2UB 2P9UA 4FZXC 2APOA 2GA7A 3H5YA 4NLNA 1HBOA 2GELA 2LMIA 5ALZA 3NEKA 3PW7A 3TEHB 1EARA 2L9NA 2IHMA 3M6GA 1C4CA 7ICLA 1H0HB 4DPXA 2ZJPQ 2GVZB 2HBZB 2OTJS 5BR8J 1P27B 3NBPA 1JXVA 3R1LA 3K0JA 3GJQB 5T14A 3TRGA 4L74A 4FOEA 4KFBA 3M8ZA 4CF4A 3BPSP 4PHDA 2KKHA 4RBTA 2H1YA 1M6YA 2IIHA 4H4KC 3C5GA 4KHNA 2ASDA 3C1ZA 1Z2LA 2ACYA 3W3DA 1NGBA 3IN5A 3HHLD 3R9LA 3UMGA 2CWXA 4FJXA 4DEZA 1FDAA 5F0WA 2DH9A 2YWKA 2DKOB 5HROB 3NL0A 4HTLA 5ALTA 4LF8K 4HHTA 3PYEA 4IEEA 1S12A 4JAXA 1YRUA 2VG5B 2XI2A 1AZSA 4KHSA 2O01C 4DOBA 2WSEC 4JI6K 1J9AA 1FNXH 4CT9A 4A8WA 1O03A 2JHEA 1UEKA 4KPYA 3UDVA 2UXCJ 4Q0BA 4WCEL 3T1HJ 4JN4A 1ZQQA 4RTFD 5IT9Y 2UU9K 1FJGK 4ICLA 5K8OA 5CQGA 1IR2A 1N6QA 5KPRA 2CPHA 4LBIA 4DUTA 1V97A 3I4PA 1X4BA 4YVZA 5EXWA 2MRLA 2GAHC 4NL9A 4I2PA 2H3QA 2HNYB 2IA6A 4ANCA 2OD6A 4JK7A 2RU3A 4WQ4C 3BGUA 1Y5NB 4OKJA 1VYAA 1LW0A 3WUHA 3EMTA 2R42A 1Y5LB 1BCMA 3H8YA 1N5VA 3FCWA 5G5GA 3MXHP 2A6AA 3L6QA 5LJVA 4X65K 2DITA 3DLEA 2OFGX 5A8WB 5F8LA 5SWMA 2XC9A 2GNKA 2IRXA 4KAIA 3TABA 4B8CA 3SCKE 1LK7A 4JK1A 1FF2A 1NUEA 5F8JA 3FBCA 1LW2A 2HSEB 5A0YB 1ICEB 3KJVB 3A8YA 3HCXA 2QXFA 1QJHA 5E41A 2ZE2A 2FPMA 1EJ7L 4N76A 1JUDA 5BR8F 3HBTA 4CLLA 2GHPA 2H51B 1TV6A 2Q0UA 1M1GA 3LP2B 1N33K 1JB0C 1JXEA 2O8CB 3CJ2A 4GC6A 2FSKA 1RABB 3MGHA 4L75A 3M32B 4DCCA 3HSGA 3SEIA 3JPPA 4DV4K 1XQSC 3D28A 4IO1A 5J2BA 8ICZA 5GIOA 4LIRA 4NCGA 4FF3A 1XC9A 4DPTA 1IV0A 3UPFA 4B6JA 4DXLA 5B8HA 3P5TL 5BPMA 3J81Y 4ZIVA 3AGKA 5AM1A 3HRGA 3LP3A 1TKDA 2UXDK 3G86A 1CJVA 4ECYA 3UN5A 2UV8G 2CNOB 7ICFA 4KHYA 3TX0A 2MB0B 3AUOA 2DCLA 1R0CB 3D68A 2UXDJ 3PX4A 2HAIA 1HHSA 2MHEA 3H0PA 1YITS 1EP4A 3G71N 4Y2KA 3MPVA 3WK8A 5C10A 3LDAA 3BY5A 1ZRMA 1HNZJ 4F9OA 4NXNF 1E4GT 9ICCA 2EC0A 1JNRB 3NVWA 4FJKA 4CM2A 3D0IE 5FPDA 2XY5A 3QNMA 4UAZA 3KLGA 2BEFA 3PR5B 5D3GA 5IQ6A 2G8UA 4FS2A 3JTPA 3THWB 4WF9Q 1CJUA 1CJKA 2AGQA 3U9DA 4LF6J 1VQ6N 2IRYA 8ICYA 3IWLA 1CLQA 1N34K 3AV9A 4AQYF 1WDTA 2WF5A 3I87A 3TAQA 3SI8A 4DTRA 3UXOA 2FPHX 3AO3A 4N77A 3J7Z5 2Y1LB 2PD1A 5M1NA 4AF1A 4FPAA 5DB7A 5DK5A 3SAGA 1SV0C 1H1VA 4J91A 4LFAJ 3IO1A 4LJXA 4U7UD 1QHTA 4BRMA 2KP7A 1RWMB 4B9LA 2QI2A 4Q8FA 4Y2JA 5J2EA 1MN7A 3I55S 2KNJA 8ICIA 4BR0A 1VIXA 1PKUA 1VQLS 2HOQA 3BGRB 4DR5F 3R2CJ 2YHXA 4M7YA 5J2AA 2V8PA 4WK3A 3T1YF 3VEWA 2O5DA 4CBXA 1JKHB 4B1UB 2H4WB 3FAHA 3I9ZA 3QU7A 5A8KA 2B43A 1ZQMA 3O6QA 2LA4A 4HT5A 3OXFA 1QQ6A 2X7IA 4WYWA 1NBWA 2BCRA 1BOTO 4P0QA 3BF1A 4JRQA 3TUIC 1YJWN 1FKOB 3CD5A 4MKYA 1AFJA 2YPYA 4FWQA 2O3DA 1GXTA 3AVHA 1GEHA 3HX0A 2CGKA 2GV9A 4ECUA 1B70B 3U02A 2BRLA 2DGOA 2VFUA 2ZTCA 3CWJA 2O8FA 3NKYA 2V69A 4CZMA 4NXNK 4ANDA 4DV4F 4B3RF 4C8YA 4TXSA 3HM9A 3QRRA 2B8QA 2C2EA 2E5GA 3D54A 4ZHRB 3CDBA 1TL5A 4OX9J 2FY8A 3O4WA 3V2UC 3C7NB 4RW6B 3WZ0A 4TVAB 3MR6A 1SJQA 2GMJA 2BJDA 2ZBQA 5I9EB 2K4EA 4P73A 4C1NI 2GC8A 5A2QU 2OPQA 3PEJA 3HLUA 4DV7J 4DUZF 4LF4F 2CXYA 5DMRA 3CCUN 1KVKA 1YX2A 3KYLA 3D6RA 3C66A 2R2TA 4BGBA 2C2DA 1GXUA 1N8RT 4FJNA 5JU5A 4RW6A 1JL2A 2BANA 4IR9A 1C1BB 1VQ8N 4M5DB 4GW6A 3FC4A 3KFUF 1X9MA 3D2FB 5KT2A 4X4SA 1RDDA 2AX0A 3R5DA 2YHYA 4IOCQ 3W3SA 3V6DA 1KC8O 1IQZA 1D9AA 5D4PA 4XIUA 2MAXA 5FD1A 5KL1B 5KFSA 4OX6A 4I56A 1BPEA 2E2PA 4BE0A 4CJRA 3F5AA 3OGUA 2DFEA 1ZD2P 2JC0A 3M8PA 4JI4K 2JLGA 1R3NA 1ATSA 1UT5A 3C15A 2MZ1A 2VKRA 2QW9A 3CCQN 3CJ1A 4K41A 1HNWJ 4C7YA 4M7XA 1QVFR 5AE1A 5CA5A 4K4IA 2GW8A 3SR6A 2OCEA 1Q46A 1RBSA 1YVNA 5DKWA 3U1NA 3SQ1A 3KUEA 2J4RA 1RZTA 3MEDA 2VQEF 1FIQA 3VGMA 3DOKA 4U8VA 2ZJPL 1VSIA 3K7RA 3M2RB 2QA4S 4ZVEA 9ICVA 1PK1A 5CEHA 4CVNE 2BHNA 2EPIA 3HFVA 5LJ3Y 1NJXA 2FJ6A 3SQ2A 3M8QA 5AKXA 4YNQA 2I0XA 3PUFA 3MM5A 3E9OA 4G9ZA 2BCVA 3CDAA 1COKA 2PGCA 3HT0A 5AQQA 2KU7A 3OXLA 3ZC4A 3HKZC 3Q8MA 5B0FA 4ISFA 4ZVSB 1QDUB 2ZBRA 3NGZA 4ECXA 4AHCA 2RPIA 2ES6A 4K2JA 3BJYA 1WELA 2HFSA 3E1YA 3EVOA 3ALYA 1OUQA 5E3AA 2B9XA 5BPCA 2OWOA 2V4JB 4DLEA 2QLJB 3MR5A 3EDQB 4DX8H 3MFIA 3VWSA 3NHGA 1JK9B 3E58A 4E7LA 3L2UA 3P39A 2QB0B 1YSJA 3C14A 1S9EA 2HRUA 1SB6A 3P1GA 1SB3C 1VS3A 2DBBA 4FW2A 3B82A 4DUYK 1R6VA 3AA8A 2RS8A 5AQHA 2Q6CA 4G3IA 5JRTA 1R8CA 3BDPA 5JTIA 4CJ3A 4OZ0A 2J7KA 2KHCA 1PK3A 4X62J 1Z05A 3OA9A 3FJ2A 4LF5K 5BN9A 3NH1A 2K3IA 3OTCA 1ZBSA 2Z2MA 1DRZA 2VH7A 4ZN3A 2E1PA 1NJWA 3HXMA 5AR0A 4WYBA 1SCJB 2YJFA 4H0TB 5HJYA 2GH1A 3MMAA 3OTQA 4EX6A 4NLWA 4E1NA 2KIWA 2VIXA 1Y10A 2YX4A 4DV1J 5CZ2A 2QEXN 1X4FA 1X4HA 3PMLA 1PBUA 2BJ9A 3EYZA 2G0AA 1WEYA 2OPPA 3H7IA 3H8JA 4CF5A 2YNGA 3I0SA 2G08A 2CPJA 2R7OA 2F63A 5D4NA 1NAQA 3QUQA 2OO4A 3OYDA 2ATCB 5C24B 3JXOA 4BCAA 4PG5A 4BX9C 3W2VA 1SJ3P 3UMBA 1YT3A 4C7ZA 4ZS6A 1HQEB 3FK4A 1VC0A 1TQLA 1W7WA 1MDUB 3N7SC 3QZ7A 4A59A 4FLXA 3SAHA 2VONA 4PHAA 4DF4A 4Q8EA 4ZDNA 2XYPB 3DI6B 1D3WA 3QT8A 1S0NA 1QQMA 2OMOA 4LBPA 4H5RA 4KTZA 1UCVA 1JLFB 1R31A 4URSA 3MAAB 2NRZA 4NY8A 1OPZA 1RWUA 1KEJA 2YNHB 3OYFA 3QYPA 4TURA 2DNHA 2V34A 3D2SA 1BGXT 4KMUA 3KIOA 1U7LA 3WQPA 1Z6RA 4WIIA 4RX6A 2VODA 4AL5A 2GAGC 2SXLA 4IDKB 2Q2RA 1URNA 2BTFA 1BIUA 2BMBA 9ATCB 3ENVA 1QHAA 2RE1A 4LR9A 3AL0B 3MURP 3NGIA 5ALVA 2FVRA 1S6QA 4UW9A 4KV8A 2KG1A 1DEJA 2HOIA 2R8JA 2LM1A 1DTQB 2R7VA 3G8SA 3QNWB 2HKEA 1S6PA 3ETMA 4ALZA 3VF4A 1M90T 5IC4B 2XBPA 3AGRA 3LF0A 1KL9A 2XS2A 4NYPA 5F8IA 3PXGa 2VHGA 3PRBA 2HHTA 3CE8A 1YHQS 4AILC 3WK9A 1T9WA 4I2EA 4QIWD 3QU4A 2HBKA 5J2KA 1NMEB 3RW7A 5CWRA 9ICOA 3DMJA 3UKRB 3RMAA 5KG0A 3AY9A 4CGZA 4DCHA 4R25A 3MM7B 4NB4A 3VEYA 2DNNA 3TJ8A 2DGQA 4TU7A 1FRXA 4I6WA 2ATQA 3WKCA 2A1JA 3JPOA 5KG5A 3UNGC 1Z1BA 2P6UA 5KT5A 5C42A 2PYLA 2BCUA 2CZVC 1S49A 1TUYA 3OR2B 3PO5A 4M1KA 4MLHA 4LT6A 4YORA 4K0KK 3A12A 4NRUA 1GMUA 4CEEA 3DLKA 3OUYA 3ULHA 3RG6A 4F4ZA 5CD4H 3UDEA 2KT2A 4RT3A 4PKGA 1QTNB 2LPEA 2GGPB 2ZGYA 2RRBA 2V67A 4CP5A 2CQGA 2G06A 4FM1A 1S6QB 4ZJLA 2YMPA 4OJ5A 3FBBA 2ZIVA 2QM1A 4DV2J 1VQKS 2PMHA 5DDOC 4BRDA 3FZ2A 1RYRA 2IDOA 1IN0A 2H3EB 1S4EA 4KLOA 3D7EO 5LL6Z 3DXBA 3ZT1A 4O3QA 3CIPA 3HSDA 4H5WA 4QR0A 1SI9A 1XC3A 5GADP 1IUJA 1Y64A 4IG0B 4UB2A 1UVLA 2V9KA 5F0XA 2IMOA 3D1OA 1ZQBA 3IR7B 1M1KT 3Q8UA 5GADU 3SNNA 3OXGA 2H3FA 3C3LA 2Y9UA 4EBCA 2XLIA 2M7SA 3EN9A 1NK7A 4PAAA 2Z1GA 3IRWP 4IOAQ 3WXKA 2N1RA 5KT6A 2AJFE 2E2QA 4LRDA 3NAHA 2ASOA 3IC1A 3D1HA 4DR4F 4WZQA 1KN6A 3SD7A 3MN6A 3CO0P 4CLWA 2ABYA 3TWHA 1QSSA 4IFVA 2VJ5A 1R59O 3G96A 1E6YB 4DMNA 3F9KA 3G82B 2YBVA 4TU9A 4MFBA 1CZ9A 5E33A 4QIWC 4IC9A 4LF9J 2DKZA 2OPRB 2NRWA 2BKNA 1X5TA 5HMWA 1T03A 3FR0A 5AJ3J 3UB5A 2L3MA 3MECA 1TUGB 3E01A 2D0CA 3GIIA 2JJ4D 2UXCK 2KICA 3LH2S 5F8NA 3EE8A 4AYBF 4RW9A 2HBLA 4Z7YA 3R7NB 3I28A 3FLCO 1U1OA 5JVGQ 3G8QA 3VVTA 2D3OR 4UOHA 2J8AA 3H2VE 4JI6J 3A5NC 1KD1O 2IVNA 5J8YC 4BACA 3SEOA 4CYUB 3M2UB 2IHNA 4GIBA 1M0SA 4O4GB 4H0XB 4J2EA 3M2VB 5GAGI 2HVHA 4LRFA 2CQBA 1S6UA 3NP5A 2LXUA 3T9NA 4HHUA 2QWPA 5CHCB 3OS2A 4DX6A 1H38A 5EWEA 2DHHA 3GOIA 2W2PP 4I2DA 3MTKA 4F67A 2WTFA 4MK7A 4BR7A 3L9ZA 2CJYB 2HMIB 4ZLJA 4LRCA 5IILA 1URJA 3I56N 3FRYA 2RAQA 3BS5A 3VAFA 2DXEA 3TJAA 3HPHA 3KZXA 2F9WA 3DM2A 3RBDA 1RBRA 1RBTA 4IH5A 1Z2ZA 3ONQA 1NG9A 2COLA 2R4FA 3SENA 1E3MA 2GLEA 2QZ8A 4AQYK 3UCZP 1KLMB 1RI7A 1XJWB 3RBXA 1UCNA 4CZHA 2QX0A 2P5GA 3HJFA 2WB1F 2QKQA 3NNAA 3VGUA 1WN7A 2IFXA 1QUVA 2NSCA 4UAVA 1MROA 4B1VA 3KG1A 3HF5A 2IVFB 3BP8A 3DV9A 3MXIA 2DKXA 5ETQA 1WB9A 5D0GA 2J6UA 1RJJA 3VQ9A 3MEGA 2MMYA 3O1WA 3VAGA 2W2NP 4CHQA 4MDAA 2ZHOA 1NOYA 2VIHA 2B9WA 5HMMA 2LEPA 4HR2A 1NKEA 4CK3A 5HBMB 1BA0A 1TYQA 1HMVB 4NLZA 3DI6A 5BPLA 2MJUA 3GBTA 3KK2B 4IRDA 4DTXA 2G8FA 2H5XA 1NPKA 1Y11A 2HPUA 3RBEA 3DGVA 3V81A 3I6PA 2O4GA 2WBMA 5EWFA 2BPFA 3W2VB 2PI4A 3O8MA 3WXMB 4HUEA 1VSMA 3O9UA 2ZDOA 5C24A 3JXUA 5FPEA 2XSJA 3KFWX 3M8PB 1ZQRA 4ZN1A 3F2DA 1V38A 4HUFA 3B8HA 3IHQB 5KFHA 1WAJA 5KPTA 1S9GB 4CHZA 1N32F 4BR9A 2F1JA 3LP1B 4FVUA 3CYMA 3LPYA 2B9EA 4OPKA 8ICOA 4DL0C 1T05B 1DLOB 2KH9A 5AZJB 3OTDA 2IS3A 5AFUH 3V7LA 1QS4A 1N0UA 2CQ3A 1BUPA 3WIVA 1NSAA 4WFZA 1IXRA 2JHDA 3KZBA 4QW8A 1W9HA 3H5SA 5DLGA 1MMDA 1BD6A 4M2YA 3OYBA 1U02A 4UUWA 4USMA 4CESA 2HIYA 4YCXA 3SCLE 2QIFA 4M5GA 1EX8A 4JS5A 3M6VA 1WHXA 4YS2A 5J0SA 5GAGU 1TVRB 1A5XA 1W7AA 1KQKA 2KVIA 4L6V3 4JKEA 2W9BB 2FJWA 1NNLA 1EAYC 3HSTB 2H5IB 4QPXA 4USAA 3B0XA 1X9XA 4ZVHA 1C0GA 2AJQA 1M5KC 3JS6A 3SV3A 1Q5YA 3VQCA 2E1YA 2E6LA 1NGHA 3GSDA 2FBVA 4GO7X 1HPZA 4NJ8A 9ICJA 1W2BR 1B0PA 1SJFA 1WLJA 2ZNZA 3QEBZ 3GIMA 3IM8A 4OYAA 1BWFO 3VN5A 2ILYA 3ILLA 3CULA 5J0TA 4EEKA 4U7BA 3TADA 1XNRK 3V9WA 4NMLA 2AEFA 2EG1A 4FM2A 1TUWA 3QEVA 5LMUF 3RSEA 3US5A 4CO5A 1PYOB 3VTIA 1Q7YO 1S9FA 5AZJA 1JLEA 2P9CA 1T05A 4OLPA 3AVJA 4DF8A 4JNEA 2BGGA 5HVFA 1BQNB 4EAHD 1WG8A 1O6XA 4NMXA 4I1TA 1VQ5N 3L2VA 3GIJA 2QLWA 3MEEB 2C2KB 3BPDA 4AUKA 4LR8A 2ASPA 4BRNA 2G0JA 1RT4B 2DYAA 2RT3A 1YJNS 2ZBIA 3V7KA 3F5EA 1T02A 1VQPN 3OHAA 1U0HB 3VPZA 3NRZA 4BLGA 3ZDDA 4OI4A 5KFZA 1D8ZA 1M5VC 4DTNA 5FRNA 4USHA 3GIKA 3D66A 2HW3A 2W9CA 2BJEA 4RQ6A 8ICAA 1EO1A 4EO6A 4OYXA 2HQCA 4FBTA 1UW9A 3OTOF 3PKMA 2F7TA 5J2NA 2NXNA 2N82B 2PSZA 1YI2N 1F6TA 1N34J 3HZEA 4FFDA 3MM8A 3ZSWA 5CP2A 2EFVA 3QFUA 4UUXA 1HPMA 3KLEA 1WWVA 2ZZTA 1NJIO 3QDKA 2FLOA 2HVZA 1WSJA 3IXQA 4M47A 4I7FA 3P3DA 4H4MB 2D3DA 3IG5A 4LSZB 2QARA 2AJ1A 2HGMA 3MPWA 3QGHA 4DV6J 4Y2CA 1HKBA 1RT2A 1JLGB 5KNIA 5HK4A 5EE9A 3VEOA 3L3FX 4H0OA 4JI4J 4G9BA 3GFZA 3SQ0A 2ZM6F 2ZJQQ 1WSRA 1ZBHA 5DG7A 7AT1B 5GIPA 2K1RA 3PW0A 3HOSA 5IIOA 1X5PA 4NI2B 5C2DA 2OYQA 2QN6B 1G7CB 5AKLA 5ETVA 1AW0A 1RAHB 5IM0B 5J1PA 3PX6A 1VSKA 3R9KA 4H4KA 3J81O 2GTDA 3DCAA 5K14A 2VQFF 3DLLQ 3GZFA 4HCCA 2RQKA 1UETA 1WF2A 4K4UA 3KG4A 4QS9A 4LJMA 2G1HA 1TAQA 5K8NA 2GIFA 4WTOB 4Z4GA 4W92B 2J0WA 1IBLJ 2ALZA 1RT2B 2H5EA 1N36K 2QARB 9ICTA 4USTA 5LY3A 3W7BA 5KG2A 2ZM6K 3H0MB 3NOGA 3RVCA 1KS2A 2XY8A 3HVTB 5AJ3F 5AK5A 3OJUA 4ZPWR 5GAHU 5AI8A 4RU9A 2FC0A 1KONA 3PDNA 4QCLA 1XMQK 3NF8A 1LXNA 2EFGA 3VAMA 1UOCA 2ZH7A 2P9KA 3R7SB 2CPIA 3SUOA 1DFDA 4FVMA 2ISOA 1LNQA 4KITB 4BBYA 3R3LA 2XSJB 3DOLB 4BRPA 4M3UA 3UVJA 1XNRF 2RQ5A 1CS4B 3TO8A 5J2QA 3TR8A 1U6ZA 2O8CA 3I96A 1X3NA 3AOCA 1TMJA 3DLGA 3E8OA 5DB9A 4J9RA 7ICHA 2HCFA 4PPZA 3QICA 3ED5A 4QQBA 3D2NA 2PMZD 3V81B 3MCPA 4M5NA 2XI3A 4KLJA 1EKSA 1KDNA 1LEOA 3C6UB 2D3O1 3UIQA 1P9YA 3CRXA 2XCPA 2JMGA 3JAMY 1ZJMA 2XI9A 1YZ6A 3FM9A 2Q31A 1YZ7A 3JSBA 3MTJA 1Q82O 1PAUB 3AO1A 2X1AA 3TVKA 1BCOA 5J2HA 3IDHA 1I5OB 1FRIA 1YTUA 3L5KA 4KAZA 3QUTA 1YVUA 1WC5A 2DFHA 2DVIA 2QWNA 5M1KA 2OEKA 4PHEA 3UXPA 4H5NA 3J7ZT 4FJ7A 3I82A 6FDRA 2X78A 1R7IA 3RB3A 4X64K 4UOFA 2ROPA 5HATA 4CGHA 2IDLA 2WOMB 4U96A 3O3LA 4X84A 1S99A 3WEEB 3PVXA 2AH5A 1VRTA 2HAFA 2YV0X 1Q8KA 4NLKA 2FLPA 1IKWA 4N7TA 1EB0A 1L3UA 3RH4A 4EU0A 2XMUA 2BQRA 4ID1A 5AQYA 3P8BB 3MGIA 2ZH5A 2ATLA 5DDQC 1ZQNA 3EZ5A 3SPYA 2Y9TA 2CJQA 2F8LA 5H1SV 5J0UA 4PKIA 2E29A 4GKKK 2HFOA 1I1GA 5F8MA 2PC6A 4QW9A 3OW2M 1VDVA 5J2IA 5EX0A 1UAWA 4DV5K 2QA4G 5G4DA 1EP4B 4BRGA 3NF9A 4OX8A 3R27A 1FEZA 2G5IB 1RTJA 2P9LA 1KAXA 3DU5A 2IOFA 1D0EA 4EHTA 3O1LA 4NWBA 1RXVA 4U6PA 2ZITA 1QQNA 2OHDA 3I1YA 4FYYB 4F93B 1KWMA 5EU7A 4IRCA 3M30A 3SUPA 1VJQA 4K4XA 4WQ4A 4MEXA 1KSPA 3AH6A 3V6HA 4LFCK 3CW2C 2JH1A 1C4AA 4LF2A 4PHPA 4IJAA 5GAGP 2VFSA 2MDAA 4PR6A 3FUYA 1HNXK 2LSNA 1KFSA 4X5VA 1UPMB 3FEYB 1XERA 5HHHA 2LKZA 3QRQA 2GVZA 4DX5A 4A61A 1NMDA 4USWA 4NLCA 1C0TB 4CLTA 3VGLA 3TAEA 1X6JA 3PR4A 3GFXA 2V63A 2NZTA 4BC3A 2UVVA 3ZTQA 1MN9A 1FE4A 5KFKA 3BSOA 3CD6S 3JQMA 1VQ4N 2ZUCA 1AYEA 5BXIA 4K4GA 5HBMA 1ZQKA 2EKNA 1BU6O 1TK0A 5J29A 1NK0A 3QUBA 5KPZA 3HVWA 5EE0A 3BGFA 1ZETA 4RW7A 3AVIA 4OQJA 3IBPA 3CEDA 4LFAF 3TUPA 1GK8A 2UUCF 2DGZA 2V51B 4W5RA 2UXBF 1WSHA 1NHVA 4KE5A 3IP4B 2JFKA 1YRXA 2R7RA 2F76X 3HULA 1WSFA 3L09A 3T6BA 3NVYA 1QQCA 5EOZA 3K8VA 3ZDEA 4JLHA 2XVTA 3CJQA 1ECWA 2YKMB 3ADAC 2F8MA 2KYZA 1KLMA 1DK2A 2B21A 4R5PA 3W65A 4F5OA 5MLCV 2LDIA 4A4JA 4HI2A 3VQPA 1D09B 2XGQA 1A0PA 3MAAA 2R7YA 4LQ9A 2ZIXB 1YBUA 4CK1A 3AO4A 3IKMA 3E9LA 3QEWA 4NXZA 1GNKA 3KK1A 5IWAK 4ZP7A 2VANA 2XZWA 3FBFA 3JQKA 1T9UA 2UXCF 4NRTA 2Z2YB 3M8YA 3JQJA 1TL1A 4KRFA 4O4RA 3QEXA 2VG7A 4LF6K 4DV5J 2G8WA 4M3WA 1VLOA 5EE1A 3CF5L 1UQVA 3V6KA 4CO2A 2RF2B 3A8EA 2CPFA 4JV1A 2Z8QA 3ITHB 3M1VB 5EDWA 2LDYA 4HTJA 1X5OA 5I3QA 3TOQA 1KVCA 2EW9A 2HLTA 4CYUA 5EOYA 3RZAA 5JLHA 4J9QA 4YMOA 5KG3A