2K8BB

Solution structure of plaa family ubiquitin binding domain (pfuc) cis isomer in complex with ubiquitin
Total Genus 16
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
16
sequence length
80
structure length
80
Chain Sequence
ANQQTSGKVLYEGKEFDYVFSIDVNEGGPSYKLPYNTSDDPWLTAYNFLQKNDLNPMFLDQVAKFIIDNTKGQMLGLGNP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural Basis for Ubiquitin Recognition by a Novel Domain from Human Phospholipase A2-activating Protein.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Protein binding
molecule keywords Ubiquitin
total genus 16
structure length 80
sequence length 80
ec nomenclature
pdb deposition date 2008-09-04
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.410 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 DNA polymerase; domain 1 2k8bB00
2K8BB 3PSPA 3L3FX 2K8CB 3PSTA 2K89A 2K8AA
chains in the Genus database with same CATH superfamily
2VIXA 1V38A 3ETLA 5EE0A 1SL1A 1RXVA 5IIMA 3N7SC 3ZD9A 4YR0A 4NLBA 5ALZA 7ICNA 5AKYA 4Y2TA 2AJQA 4ELVA 1L5UA 1ZD4A 4J9SA 3AM9A 4XA5A 1NKEA 1ZQBA 3PO5A 1TE2A 1LVHA 1NJYA 3ISBA 2P66A 1XSPA 1A77A 5AKGA 9ICHA 3JPPA 2GOLA 1JI7A 2R8KA 4BJQA 2KFZA 2LHTA 5D49A 7ICIA 5J2CA 1ZQSA 3K1RB 3UPQA 1NZBA 2MSNA 8ICKA 2XGQA 3RH4A 4CE6A 3PO4A 4M0AA 1VJ5A 4O3PA 3SI8A 2BCVA 2O6KA 1AROP 3Q8PB 2CN1A 3GFKB 7ICKA 1T3QA 4O0IA 3QUBA 2Y1JA 2LYAA 4Z6CA 3LDAA 2YMQA 2A19A 3UMCA 2NRXA 3NGDA 2ZIVB 3RJKA 3L5KA 9ICXA 2JMGA 5EE9A 5CRXA 3T5JA 5AM5A 4I28A 3EWAA 3RBEA 4YR3A 2FLPA 2DFLA 2IHNA 5ALDA 3OPXA 5J0PA 3RB3A 5J2GA 1JALA 1KFDA 3V7KA 8ICWA 2AGQA 1N56A 3F53A 1N5XA 1FEZA 3IV6A 5AM3A 1XO1A 2YMLA 3MC1A 2XGPA 7ICMA 3BS5A 1KSPA 2JRZA 2ALZA 3HWTA 2E1FA 1QLNA 3TARA 4IRKA 3QEBZ 3WK9A 3TQ1A 1L8LA 4QZGA 4UB5A 2EQYA 1L3SA 3TADC 4KX3A 2KSOA 1SKRA 1ZQWA 1TVAA 2FMSA 1J2NA 4PHAA 2WF6A 3PMLA 4B9NA 1S0VA 5ALUA 2W55A 4O5EA 4UB4A 4KN4A 4KX5A 5J2BA 4Q8FA 5KFUA 3QYPA 4RNNA 5KFSA 3SD7A 2KIWA 2GLEA 3U26A 2BQUA 1QSLA 1UQVA 2ZXHA 1ZQYA 2RRDA 4MF2A 4P4MA 3C2LA 3I76A 5J2FA 2VKQA 4CF5A 8ICUA 2IOFA 3EUB2 5HMLA 4KMUA 2G09A 5KT7A 4NV0A 1L8OA 4IR9A 2KKPA 3QU9A 4NLCA 4KTQA 4IS7A 1NZPA 4P4OA 4GXJA 4UQGA 3ZI4A 3PSPA 2P35A 1RPLA 4F4YA 5AM4A 7ICQA 3FM9A 2ASLA 3LVWA 1ZETA 1JXLA 5DDYA 2I9GA 5L1MA 5B5EU 3SAHA 2GWSA 4KN7A 4I29A 3LK9A 3JPOA 3H0LB 1PK1B 5ALJA 5HMMA 4C7ZA 1ZQIA 2V4QA 3MGIA 2ZTDA 1UHUA 4GXKA 2MU2A 2BKEA 3CYMA 1KW4A 2QKQA 3WKBA 1RQNA 1FO4A 3K1ZA 3C5FA 1URJA 4UAYA 4F5OA 3G6VA 3BQ0A 5DG9A 2XI9A 2ZXIA 4NLNA 1CRXA 1B22A 4KLUA 4C8LA 3GIKA 2IHMA 1QQ7A 2QLTA 1S5LU 2M0NA 3OJSA 1SWWA 4YXJA 5J29A 4UATA 1S10A 1SV0C 3HP6A 3M6KA 1K5OA 3IG8A 5AK3A 3QU2A 2H5XA 1JX4A 1XSLA 3ZDBA 9ICLA 4ECZA 5CJ7A 1X9SA 1J97A 3H40A 4GLXA 4DS4A 4M9NA 2HVIA 2JV3A 2VJ4A 3ORYA 2ZUBA 1NK7A 7ICPA 1ZQUA 3UXNA 1UT8A 3N28A 3ICXA 4DWIA 2AXTU 1C20A 2BDPA 3ISDA 3TFRA 3NS1A 8ICAA 5KG2A 2H3ZA 1N63A 4ED8A 2DKXA 4C8KA 2NV3A 1UPHA 5DGBA 5ALIA 5JRTA 1WUDA 1L3UA 1Q8KA 5AKZA 3H4DA 3NVWA 1T8EA 4B9TA 9ICPA 5ALOA 4DL5A 1WYGA 1RM6C 2NYVA 4F2SA 1D8LA 5KAIU 4EZ9A 1NNLA 5KFIA 3UMGA 1SWVA 1SXDA 4F2RA 3BJYA 1ZQFA 4F91B 4LVSA 3ZDCA 4PZOA 4F8RA 1QSSA 1ZXIA 2KFNA 3NRWA 3WK7A 2A1JB 3GV5B 4O9MA 2W54A 2UVRA 2B0CA 4DL6A 2EZXA 4RNMA 3WK5A 4NJ8A 3V7LA 4OD0A 3GIJA 4F5QA 2PKEA 1BGXT 2BPCA 4J9KA 4M04A 3QUTA 1U49A 1DOQA 5JTIA 3JPRA 2G5HB 4OJLA 4OJ5A 4MEXA 4BX9C 2UVUA 2UVVA 5J2AA 2F77X 4YMMA 5AIAA 2KJ5A 2Z7JA 3M9NB 5ALMA 3MR5A 3UM9A 3WKEA 3H8JA 3RFAA 4QIWF 4QW9A 2ESEA 3HJEA 2JGAA 4KMOB 2B6GA 1MQ3A 4KLLA 5J2IA 1ZJNA 1LKYB 1X9XA 1ZD3A 4GIBA 2KE7A 3AEVA 1XWLA 1BPBA 5F9NA 1LV5A 5KFCA 1NKCA 5EWFA 3LWLA 1F44A 9ICOA 3B0XA 4I2CA 2OCEA 1L7NA 1UCVA 4YMNA 2KVSA 5HHIA 4CNQA 4C8MA 1T3NA 2BDUA 2K4EA 3BQ7A 3IG5A 2WAQC 1SXEA 5KFGA 4TQSA 4Z6EA 2F8KA 1NJWA 2VA8A 1Z1BA 5KFPA 4R66A 1ZQHA 2R8HA 8ICZA 1NK0A 3KD3A 4C8NA 4P0PB 4J9MA 5J0XA 1QCKA 5J2KA 3RJEA 1HUZA 2CRXA 4UB1A 2NRZA 2LM4A 4KITB 1MC8A 4C4RA 4FO6A 4F4KA 1N48A 4DSKA 2FI1A 3RB6A 2A1JA 3SENA 4NWIA 2PFOA 1OW5A 2FLNA 4C8OA 5A0LA 3Q8QB 1RXWA 1XSNA 4Y2XA 3H8WA 1P7DA 1D9FA 4ECRA 4UAWA 3LYSA 3V7JA 3F5AA 4I2EA 2C2DA 2KHQA 1TKDA 2KEYA 2H3IA 4BGDA 1SKWA 4QNLA 4JV2A 2XVTA 4MF8A 1T7PA 4BDPA 4FBUA 5KFJA 3M8RA 1PK3A 2MAXA 4M6WB 3GILA 4YFKA 4RQ0A 5KG3A 4DFKA 5KFRA 2PXIA 4JMUA 3EYZA 4DSEA 4UBCA 4QZAA 2V4RA 1T4GA 1PVQA 1BPEA 1ZQAA 4EBEA 2G08A 3DEEA 4B9VA 1KEJA 2LBOA 2E8OA 5ALHA 9ICTA 2P6RA 3OHAA 3RRGA 1IV8A 4UASA 4DSJA 3NUQA 3WU2U 3ZDDA 5T14A 1Y88A 3Q8MA 3F2CA 4O5KA 2HVHA 2XIDA 4DQRA 4CF3A 5JU5A 4O5CA 3TAQA 5J0SA 4QWCA 3SYZA 1VLBA 4BWJA 1RYSA 2DBYA 1KQQA 5AM2A 1ZQPA 3V72A 5CHGA 5AI5A 4K4HA 2WHEA 5AKJA 4I2IA 5ALTA 4Y2PA 2ZIWA 2Y0SF 3JPTA 1B43A 1XC9A 2LKYA 1U4BA 5FP0A 4QZIA 2KVCA 4YD1A 4ZH4A 1QQ6A 5IIKA 2W8LA 4F5NA 1O08A 3AU2A 3MFIA 3SV3A 5D4BA 3KHGA 4KLGA 3D2SA 2PMZF 4Q8EA 9ICKA 5AI0A 4I2HA 4LJXA 4QIWC 4GC6A 4DL2A 2HHSA 3J81j 2G5IB 3M6ZA 5KL1B 3BQTA 2KN7A 3BQ1A 1MN8A 2OXOA 3FC4A 8ICCA 3M8SA 3IDWA 2QARB 8ICYA 2FPLA 1JN3A 4QZDA 2AQ4A 2OYYA 4M2YA 3T79A 4PHPA 4BXOA 4Y2RA 2F1JA 2JZBA 1NK9A 5KFQA 2V9WA 2J6UA 1Q46A 2R18A 4JUZA 1N60A 2WF8A 1ZQVA 4TUPA 2KD1A 1TK0A 2PMZC 1FIQA 4LZGA 1X6JA 2I5HA 3WK8A 1WWUA 2H3VA 4Z6DA 3AL0B 3QZ7A 3UXOA 5KFDA 1SB3C 1X40A 1TV9A 5AK5A 5L1KA 3B9JA 3SAGA 4QZHA 1ZQOA 5J8YA 2L5YA 5K4LA 4FZMA 4UB3A 2KHVA 3MGHA 3Q8RB 5BOLA 4IRDA 9ICRA 2YMMA 1PVPA 2LPEA 2HHXA 1FFUA 4ECXA 5IIOA 2NO4A 5DG7A 2H3FA 3PMNA 2RDJA 4IR1A 2KOBA 4OJOA 3WKCA 1PZNA 4USAA 4O3QA 5AHXA 3PX4A 3QNMA 2DGZA 3IN5A 3CW2C 8ICSA 5ALNA 1B0XA 1XS9D 3RB4A 2MUTA 1S0NA 4DFJA 3Q8KA 3TFSA 2M9NA 1SZPA 2HCFA 5HR6A 2E3TA 2HHWA 1RQLA 3T5LA 1SV0A 2F44A 2ZG6A 3QU7A 5KT5A 2YY6A 1TAQA 4NXZA 2FDRA 3G6XA 4DFPA 5DB9A 1NK4A 7ICGA 2EANA 8ICOA 4RNOA 9ICAA 4I2BA 2EAMA 3SAFA 3L3FX 2E8NA 3HW8A 3NVVA 3SZ2A 4R64A 3M9OB 2NRWA 1F0MA 3GDXA 2WF9A 4QZFA 2HDOA 5CWRA 1RYUA 1ZJMA 2JHDA 4ED2A 5ALKA 5EE3A 4UARA 2RQ5A 4DF4A 1Z4OA 1PUZA 3F5EA 4K4IA 3NVZA 3MGVA 3M9MB 2LMRA 3C28A 2FE9A 2ZIUA 4RPYA 5HR7A 1ZQGA 3TANA 1COKA 8ICPA 2YB4A 1TK8A 5KFMA 3NRZA 2Y0SC 5AI9A 4QZCA 2DPJA 2W3SA 1S97A 2OM6A 7ICFA 5KFHA 4IC9A 4DS5A 4DOCA 1LB2B 8ICRA 4PZNA 2KSOB 3PR4A 4AP9A 2DQNB 4DEZA 3RJGA 2JH7A 3RBDA 1SIJA 4B9SA 4EENA 3BDPA 2HHVA 2ZUCA 5L1LA 1BPDA 4LZDA 5AKEA 1BNOA 5ALLA 4QWAA 1L7MA 4RUAA 2YB1A 2VANA 3ONNA 3OTQA 5DBCA 2IOFK 5AICA 2HHUA 4Q43A 4DFDA 2DUYA 5J0TA 1AQ6A 3QX7A 4RQMA 4JWMA 5KG0A 4YQWA 4MEYA 7ICVA 1X2IA 3PW0A 2BCRA 4J9OA 2W3RA 4F4XA 3E0FA 8ICMA 4FFDA 2ISPA 3KKAC 3RH6A 3PX0A 1KBUA 4JWNA 2Q4TA 8ICQA 1HJPA 1S77D 4NL9A 4PGQA 2AU0A 4DL4A 4QZBA 4KLHA 1DK2A 5KFKA 2ZIXB 2BGWA 3E58A 4KLQA 1D8YA 4M9JA 4KLIA 1DXSA 2C22A 2Y9UA 5D46A 5L1JA 5EWEA 2W9CA 2KV2A 8ICGA 1U47A 2P6UA 2KG5A 2D3DA 4RT3A 4KLDA 3R9KA 4ZOHC 4A8EA 2R8IA 5ALRA 2PFQA 1YZ7A 1ZQXA 5BPCA 5IIJA 3RAXA 2JXJA 4RZRA 2KJ8A 9ICQA 1UA0A 4EZ6A 3IM1A 4DSLA 3OSPA 3GQCA 3KHRA 2MUTB 1RYRA 5DQGA 2EAOA 5AK4A 4G9BA 5ALXA 3D2NA 1CUKA 2J6SA 4ECSA 1N2XA 4B9UA 5DLFA 4B9MA 5KFVA 3QUCA 4XQ8A 1BNPA 3KZXA 5AK6A 3SMVA 4EELA 2WAQF 4F3OA 2F1IA 4P4PA 3GV7B 4DFMA 1Q3VA 3NTUA 2K8BB 7ICHA 3F2BA 4CCHA 1TAUA 3AQFA 5J0OA 1L3TA 7ICEA 1L3VA 1JRPA 4DL3A 8ICNA 4OJ6A 3SV4A 3OHBA 1KFSA 4US8A 1L7PA 2KKVA 4EBCA 5ALQA 1J2MA 2AGOA 5AKKA 2FPKA 7ICOA 4ECVA 3TAPA 2W43A 4FE3A 5KFTA 3ZDAA 5AM0A 3SEIA 4PHEA 2K4PA 3THVA 1FFVA 1ZQ1C 2GO7A 4I2FA 5AIBA 4O3RA 3ZDEA 2WB1F 1A76A 2R8GA 1XU4A 4I2GA 2I1QA 4NY8A 4UAVA 3T5HA 4XUSA 4YVZA 4ICAA 1ZQZA 2ZJ8A 4JV1A 2ZIUB 3PW2A 4B6JA 4P0PA 4PPXA 2XY7A 2XY5A 3RF9A 2KZZA 4RQ7A 2FMPA 4QWDA 1C7YA 4KLSA 2KTQA 3FYHA 2AGPA 1IG6A 2EZYA 4UAZA 3MFHA 5DDMA 3GIMA 2MRLA 3CP8A 3TADA 2HW3A 5KAFU 7ICTA 2WB1C 3NVYA 1Z3EB 1ZQEA 5AKLA 3ALRA 3MR6A 3ED5A 5KL8B 2GH1A 1DGJA 1O03A 1D8BA 5F9LA 5J2EA 2AHOB 3MR2A 4NLGA 2EH9A 1LKYA 5C0YA 3PSFA 2C28A 5ALPA 4MFCA 1U9LA 1KLNA 4F5RA 2R8JA 4KLEA 2H3QA 2RHFA 2F1HA 2KK0A 2DWQA 3H0RB 4R8UB 4MFAA 2E1EA 4UB8U 5KT2A 4X5VA 2DPIA 3SQIA 2NRTA 3DV9A 5CP2A 4TUSA 2AH5A 2B21A 4TUQA 2KP7A 4KLOA 1QSYA 2HBLA 3UQ0A 2CPRA 4C4SA 5KFFA 3T5KA 2W11A 3PSIA 9ICJA 5J2JA 9ICSA 2G07A 5KFXA 1ZQMA 1ZQNA 2D6FC 1X9MA 1Z1VA 1NOMA 2BZFA 3QZ8A 1COOA 1S0OA 2KZ3A 2EAPA 1N5WA 2PI5A 5GTHU 5AI6A 4TQRA 9ICGA 2YN4A 2K4HA 2MA1A 4C4TA 1JROA 5F3XB 1MA7A 2WFAA 4IQUA 2HMXA 5KT3A 5DG8A 5J0UA 3MDAA 3C2MA 1DRGA 4AYBC 1EXNA 7ICSA 4RPZA 1X42A 4DQQA 5BOMA 2G0AA 3Q8SB 2FJ6A 4Y2QA 4K4GA 9ICVA 3HKZC 3NASA 3C5GA 3IRUA 3JPNA 3PZPA 2HOQA 2QARA 2QB1A 2XICA 4GXIA 4RU9A 1ZD2P 2Y1IA 2ZIVA 1ZQKA 2BQ3A 2KICA 3F2DA 2BR0A 4P2HA 1X6IA 4NM1A 1TFRA 3RB0A 4O3OA 2E5SA 4YCXA 1NI3A 3H8MA 4AYBF 4US9A 5CA7A 4GC7A 3O0FA 4YG2A 2QB0B 4ED1A 4QWEA 3RJIA 2BCSA 5KFEA 1HIWA 5J2DA 2ZJ5A 1KRPA 4DQIA 1N61A 4KLJA 3OJUA 4FS1A 3TI0A 3BZKA 3LVVA 4EX6A 3PW5A 3RR8A 1SL2A 3M7DA 1NJZA 5E79U 4QW8A 2OWOA 2XCPA 4YXMA 4RQNA 4YR2A 2LYHA 1IIPA 1KFTA 1TK5A 3ISCA 4CRXA 4IRCA 5CEHA 5IIIA 2ATLA 1GO3F 1HEKA 1DGSA 4R65A 3BS5B 2ZTEA 4FBTA 3M1YA 1SL0A 1QH9A 3C21A 3CRXA 2E8PA 2JH1A 5ALEA 3GIIA 2W9BA 9ICMA 3RTVA 2UVWA 4EYHB 3EW9A 4ELUA 2FPMA 2IBKA 5EWGA 2VA2A 8ICJA 3AU6A 5AI8A 3QEAZ 2JEFA 2XCAA 4UAUA 1H38A 3BS7A 8ICVA 4DLEA 3N7PD 3S6JA 4ECTA 4M9LA 3JPSA 5ALVA 5KFAA 2W7PA 1ED1A 5KTQA 5KFBA 1WCNA 2W8KA 3RRHA 1S9FA 4I2JA 4RQ8A 2NO5A 4WJ3B 3N7RC 3ZD8A 5DB6A 3PX6A 1WG8A 3PV8A 4PL2A 8ICFA 1ZRNA 2BCQA 2EDUA 4UW9A 5TISU 5KG6A 3H4BA 4IQWA 5CR0A 4F92B 4BXOB 4RQ3A 5DQIA 2Y9TA 4RQ5A 5DB8A 1K1SA 1WCLA 3IP4B 4KLMA 3ETRA 5KFWA 3DDHA 4NLKA 5AI4A 3B0YA 8ICTA 1ZQRA 1KL9A 2BQRA 3PSTA 4Y2SA 4RQ2A 4OCZA 2YX8A 4EYIB 4GFJA 3GZFA 5KFLA 4B9LA 4DLGA 3KKAA 1ZQCA 3H8SA 2PFPA 3GV8B 1F5SA 1Q3UA 1ZRMA 1ZYQA 3QU4A 3H0MB 4F93B 4J9NA 2LM1A 2K89A 2WF7A 4I2DA 2ZIXA 4UB2A 1XNSA 3EPIA 2YQEA 3KOOA 5DB7A 2XO7A 2XC9A 1ZD5A 5KNIA 5DBAA 7ICRA 2ASJA 1YZ6A 4C80A 4UBBA 4CF4A 2F8LA 5J0YA 3CNHA 3KTQA 4HAIA 4Q45A 1UA1A 1PVRA 3EPGA 4RQ4A 3KBBA 5KFZA 5G5GA 5JUMA 1Z00B 3L4PA 2CXYA 4JB3A 1X66A 1XO0A 5AKHA 4DF8A 3QU5A 4HYKA 4P0QB 1WWVA 2KJ9A 5ALGA 4I2AA 1NJXA 3BQ2A 2BCUA 3N4MB 5DQHA 3C1YA 1JXEA 2ASDA 4F5PA 5GTIU 2Q0ZX 2NRVA 1JMSA 2BHNA 4O3SA 3H7IA 1ZQTA 3A0BU 3RJJA 4DQPA 5G5HA 4E0DA 1UT5A 4RT2A 4EEYA 1KDHA 4NM2A 5L1IA 5J0QA 5KG4A 3N97B 3KHLA 5DKWA 1S76D 1OUQA 4R8UA 4Y2JA 3WK6A 2W9MA 1S0MA 5L9XA 3RJHA 2VJ5A 2HBKA 3HKZF 2OHFA 3WKDA 4EX7A 3AMZA 1M6YA 1K1QA 3AQEA 4FZNA 1PK1A 3LWMA 1HUOA 4ELTA 4F71A 2E8MA 5ALYA 3QE9Y 2D8CA 2VA3A 8ICXA 9ICWA 5TZVA 3VC8A 2WTFA 3MBYA 2ZIWB 4U7CA 2HHTA 5KFNA 2KNJA 4JK1A 4TURA 4Z6FA 1B4FA 4J03A 1MSWD 9ICIA 5DBBA 3KZIU 4EBDA 3PW7A 4KLFA 2HI0A 4DSIA 2RP5A 5AKIA 1IXRA 1NK8A 1QTMA 5J2HA 4OJPA 1RG6A 4P0QA 9ICUA 3HILA 3AUOA 2C2RA 2ISOA 4RUCA 4F4WA 2F76X 4Y2VA 4FZLA 1ZOLA 4PGXA 3PY8A 1Z00A 9ICNA 1U48A 1V85A 4DOAA 3IHQB 1SZHA 4MFFA 4QJFB 4J9QA 2EZZA 2KZMA 5DGAA 2BPGA 2W9AA 2PI4A 4ECYA 2JEGA 1A6SA 1RDFA 5EOZA 4F4ZA 2K60A 3V6JA 2JZBB 3GU3A 1N62A 2RLTA 4O3NA 4BUGA 4G3IA 4PHDA 2PFNA 1ZQDA 3K4GA 4Q44A 5HHHA 4ED0A 1SKSA 4PL1A 3E2EA 2W7OA 4DOBA 7ICUA 4DO9A 4J9LA 3JPQA 1CI4A 5ALSA 2QB0A 2BPFA 9ICBA 1L6NA 4YP3A 1JUDA 3MABA 3C23A 4YN4A 3HRDD 8ICHA 2AQ0A 2IOHA 3QXGA 5ALWA 5ALFA 1V97A 1ZQQA 1YT3A 4ACOA 4O3MA 4CDGA 3HX0A 4IQTA 1BPYA 4M47A 1VDVA 3PNCA 3T3FA 1D9DA 3RR7A 1Z19A 2JR5A 2KMDA 4QZ9A 4R63A 2N1RA 2HBJA 4ECUA 1KTQA 2J6TA 4DCCA 3C29A 1Z4NA 5KT6A 8ICIA 2OEHA 2W9CB 3SR6A 2ZJAA 2W04A 2K8CB 7ICLA 4ECQA 2C2EA 1QQ5A 4ED3A 2HHQA 4EEKA 5J8YC 3WK4A 5IINA 3G6YA 8ICLA 4DL7A 2YTUA 5H2FU 9ICEA 2W9BB 2YMPA 2K8AA 5HP4A 3A0HU 1ZQJA 1A0PA 1L7OA 4I27A 5KG5A 3TACB 4F72A 5KFYA 4NLZA 1NK5A 4JV0A 2W03A 3K75D 1NKBA 4PH5A 2K4IA 2LI6A 8ICEA 2I6XA 1T94A 4ED7A 5DLGA 4MHVA 2IMWP 4M9HA 1BPXA 5CB1A 3I1YA 1X9WA 4J9PA 3TKAA 3I28A 4XRHA 5J0RA 2F3NA 4RQ1A 4YMOA 4DSFA 4QZ8A 2ZUDA 3RH5A 5AM1A 4PJ0U 4YD2A 2FLLA 4M6WA 1S8OA 8ICBA 2HSZA 2IA6A 4C0ZA 3VCBA 3RJFA 2OH2A 3BZCA 3C1ZA 4IQVA 4Y2UA 2XY6A 5IILA 1DK3A 4OO1J 3WKAA 5B66U 1JIHA 3OGUA 2HBMA 1ECWA 1TAMA 2JEIA 1KKXA 9ICCA 1MQ2A 4ED6A 2ODGA 1CEZA 3QUQA 3V6HA 2WF5A 4RPXA 2ZTCA 3PR5B 3KHHA 1OXJA 1V9PA 1IM4A 3D6JA 2DF4B 2A1AA 3PW4A 4QWBA 7ICJA 3MDCA 3KFUF 4C7YA 1BPZA 3UXPA 2A3VA 5KT4A 3RAQA 2LYBA 3UMBA 1KN5A 1U45A 5C5JA 5AKXA 1SGGA 3AN1A 2DL0A 5KG7A 3C2KA 4PGYA 1NK6A 2F2AB 2ES6A 3D2QA 2HOFA 5KFOA 4J9RA 2FMQA 4FS2A 3FDSA 1SV4A 4UB6U 2G06A 4DQSA 4IL6U 4QZEA 5KG1A 3OSNA 2JEJA 4Y2YA 2HOIA 4ECWA 3V6KA 2DKZA 2RDIA 3EZ5A 4U6PA 1ZQLA 5EE1A 4BWMA 5HNKA 4NL9C 3FAHA 3MR3A 9ICFA 4F50A 4M9GA 4RQ6A 3HPOA 4CGZA 1RZTA 3PVXA 3HT3A 1BVSA 4KLTA 2KIVA 3Q8LA 3UQ2A 5J0WA
chains in the Genus database with same CATH topology
3F53A 2VIXA 2WAQC 5T14A 2ZIXB 2H3VA 2HBMA 1ECWA 1TAMA 3F2CA 3AL0B 3PSIA 1ZQ1C 3N7SC 3AQEA 2G07A 4FZNA 1YT3A 3F5EA 4NLBA 4ACOA 1Q3UA 4CDGA 4O3MA 2D6FC 2XIDA 1IIPA 3H0MB 3MGVA 2KV2A 2K89A 2WB1F 2E1FA 3C28A 1Z1BA 3SAGA 1Z19A 4CRXA 2ZIXA 3CYMA 1XNSA 2ZIUA 5HR7A 2N1RA 2HBJA 4P0PB 1GO3F 3VC8A 2ZIWB 1HEKA 2YB4A 4U7CA 3C29A 4A8EA 4FZMA 2Y0SC 2CRXA 3NRWA 2DF4B 2KHVA 4KX3A 2W04A 2K8CB 4ICAA 2OM6A 3K1ZA 2K4HA 2MA1A 1URJA 1PVPA 2KNJA 4IC9A 2ZIUB 1MA7A 3KFUF 2GOLA 3CRXA 4P0PA 2A3VA 2JH1A 2ZIWA 2Y0SF 3RF9A 2HMXA 2KJ8A 4BJQA 2XI9A 1DRGA 2ZXIA 1CRXA 2DQNB 2F8LA 2LHTA 2RP5A 2LYBA 4NWIA 2JH7A 4KX5A 4AYBC 1PVRA 2H3FA 2LKYA 1NZBA 2MRLA 3CP8A 4OJPA 5A0LA 2KIWA 2KOBA 2KVCA 2M0NA 4OJOA 3N7PD 2K8AA 2WB1C 1P7DA 1A0PA 2G5HB 4P0QA 2G0AA 2F2AB 2YB1A 3ALRA 3D2NA 2DGZA 4OJ5A 4OJLA 2W7PA 2ZXHA 3D2QA 5KL8B 3IN5A 2HOFA 2RRDA 1ED1A 4BX9C 3M6KA 3ONNA 2GH1A 3IG8A 2W03A 3LYSA 3F5AA 1XO0A 2K4IA 2F76X 1D8BA 4FZLA 3D2SA 2PMZF 3HKZC 2KHQA 2F77X 2VKQA 2CN1A 4WJ3B 1T94A 2KEYA 2H3IA 4P0QB 2KJ9A 2KJ5A 3N7RC 4QNLA 3PZPA 4QIWC 1SZHA 3KZXA 3SMVA 2HOQA 2WAQF 2Z7JA 2XVTA 4QJFB 4PL2A 2XICA 5HR6A 5C0YA 3PSFA 2G5IB 3M6ZA 5KL1B 2G06A 2G09A 2ZIVA 4NV0A 1A6SA 2KICA 2OXOA 2VJ4A 3RFAA 4QIWF 3F2DA 2KKPA 1Q3VA 2H3QA 2JGAA 4KMOB 2K8BB 2LYAA 2ZG6A 4NLCA 2HOIA 2RHFA 3GU3A 4BUGA 2E5SA 4U6PA 3H0RB 3F2BA 3AQFA 3ICXA 2ZIVB 2E1EA 3PSPA 3IP4B 4JMUA 4AYBF 2JMGA 2OYYA 3T79A 5CRXA 3O0FA 4PL1A 4GFJA 3SAFA 2W7OA 3E0FA 4OJ6A 3SQIA 4CGZA 1PVQA 1OUQA 3LVWA 3L3FX 2H3ZA 1KBUA 2Q4TA 1HIWA 2G08A 1F44A 3DEEA 2R18A 2LBOA 4C0ZA 2KKVA 3VCBA 2OH2A 2NV3A 1UPHA 3OPXA 3SAHA 3PSTA 2VJ5A 2KD1A 2HBKA 2PMZC 3HKZF 2YX8A 1L6NA 3H0LB 2JHDA 1WUDA 2HBLA 3LVVA 4OO1J 4FE3A 2BDUA 2K4EA 3GZFA 3NUQA 3M7DA 3IG5A 2CPRA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2K8B B;  3PSP A;  3L3F X;  2K8C B;  3PST A;  2K89 A;  2K8A A; 
#chains in the Genus database with same CATH topology
 2VIX A;  1V38 A;  3ETL A;  5EE0 A;  1SL1 A;  1RXV A;  5IIM A;  3N7S C;  3ZD9 A;  4YR0 A;  4NLB A;  5ALZ A;  7ICN A;  5AKY A;  4Y2T A;  2AJQ A;  4ELV A;  1L5U A;  1ZD4 A;  4J9S A;  3AM9 A;  4XA5 A;  1NKE A;  1ZQB A;  3PO5 A;  1TE2 A;  1LVH A;  1NJY A;  3ISB A;  2P66 A;  1XSP A;  1A77 A;  5AKG A;  9ICH A;  3JPP A;  2GOL A;  1JI7 A;  2R8K A;  4BJQ A;  2KFZ A;  2LHT A;  5D49 A;  7ICI A;  5J2C A;  1ZQS A;  3K1R B;  3UPQ A;  1NZB A;  2MSN A;  8ICK A;  2XGQ A;  3RH4 A;  4CE6 A;  3PO4 A;  4M0A A;  1VJ5 A;  4O3P A;  3SI8 A;  2BCV A;  2O6K A;  1ARO P;  3Q8P B;  2CN1 A;  3GFK B;  7ICK A;  1T3Q A;  4O0I A;  3QUB A;  2Y1J A;  2LYA A;  4Z6C A;  3LDA A;  2YMQ A;  2A19 A;  3UMC A;  2NRX A;  3NGD A;  2ZIV B;  3RJK A;  3L5K A;  9ICX A;  2JMG A;  5EE9 A;  5CRX A;  3T5J A;  5AM5 A;  4I28 A;  3EWA A;  3RBE A;  4YR3 A;  2FLP A;  2DFL A;  2IHN A;  5ALD A;  3OPX A;  5J0P A;  3RB3 A;  5J2G A;  1JAL A;  1KFD A;  3V7K A;  8ICW A;  2AGQ A;  1N56 A;  3F53 A;  1N5X A;  1FEZ A;  3IV6 A;  5AM3 A;  1XO1 A;  2YML A;  3MC1 A;  2XGP A;  7ICM A;  3BS5 A;  1KSP A;  2JRZ A;  2ALZ A;  3HWT A;  2E1F A;  1QLN A;  3TAR A;  4IRK A;  3QEB Z;  3WK9 A;  3TQ1 A;  1L8L A;  4QZG A;  4UB5 A;  2EQY A;  1L3S A;  3TAD C;  4KX3 A;  2KSO A;  1SKR A;  1ZQW A;  1TVA A;  2FMS A;  1J2N A;  4PHA A;  2WF6 A;  3PML A;  4B9N A;  1S0V A;  5ALU A;  2W55 A;  4O5E A;  4UB4 A;  4KN4 A;  4KX5 A;  5J2B A;  4Q8F A;  5KFU A;  3QYP A;  4RNN A;  5KFS A;  3SD7 A;  2KIW A;  2GLE A;  3U26 A;  2BQU A;  1QSL A;  1UQV A;  2ZXH A;  1ZQY A;  2RRD A;  4MF2 A;  4P4M A;  3C2L A;  3I76 A;  5J2F A;  2VKQ A;  4CF5 A;  8ICU A;  2IOF A;  3EUB 2;  5HML A;  4KMU A;  2G09 A;  5KT7 A;  4NV0 A;  1L8O A;  4IR9 A;  2KKP A;  3QU9 A;  4NLC A;  4KTQ A;  4IS7 A;  1NZP A;  4P4O A;  4GXJ A;  4UQG A;  3ZI4 A;  3PSP A;  2P35 A;  1RPL A;  4F4Y A;  5AM4 A;  7ICQ A;  3FM9 A;  2ASL A;  3LVW A;  1ZET A;  1JXL A;  5DDY A;  2I9G A;  5L1M A;  5B5E U;  3SAH A;  2GWS A;  4KN7 A;  4I29 A;  3LK9 A;  3JPO A;  3H0L B;  1PK1 B;  5ALJ A;  5HMM A;  4C7Z A;  1ZQI A;  2V4Q A;  3MGI A;  2ZTD A;  1UHU A;  4GXK A;  2MU2 A;  2BKE A;  3CYM A;  1KW4 A;  2QKQ A;  3WKB A;  1RQN A;  1FO4 A;  3K1Z A;  3C5F A;  1URJ A;  4UAY A;  4F5O A;  3G6V A;  3BQ0 A;  5DG9 A;  2XI9 A;  2ZXI A;  4NLN A;  1CRX A;  1B22 A;  4KLU A;  4C8L A;  3GIK A;  2IHM A;  1QQ7 A;  2QLT A;  1S5L U;  2M0N A;  3OJS A;  1SWW A;  4YXJ A;  5J29 A;  4UAT A;  1S10 A;  1SV0 C;  3HP6 A;  3M6K A;  1K5O A;  3IG8 A;  5AK3 A;  3QU2 A;  2H5X A;  1JX4 A;  1XSL A;  3ZDB A;  9ICL A;  4ECZ A;  5CJ7 A;  1X9S A;  1J97 A;  3H40 A;  4GLX A;  4DS4 A;  4M9N A;  2HVI A;  2JV3 A;  2VJ4 A;  3ORY A;  2ZUB A;  1NK7 A;  7ICP A;  1ZQU A;  3UXN A;  1UT8 A;  3N28 A;  3ICX A;  4DWI A;  2AXT U;  1C20 A;  2BDP A;  3ISD A;  3TFR A;  3NS1 A;  8ICA A;  5KG2 A;  2H3Z A;  1N63 A;  4ED8 A;  2DKX A;  4C8K A;  2NV3 A;  1UPH A;  5DGB A;  5ALI A;  5JRT A;  1WUD A;  1L3U A;  1Q8K A;  5AKZ A;  3H4D A;  3NVW A;  1T8E A;  4B9T A;  9ICP A;  5ALO A;  4DL5 A;  1WYG A;  1RM6 C;  2NYV A;  4F2S A;  1D8L A;  5KAI U;  4EZ9 A;  1NNL A;  5KFI A;  3UMG A;  1SWV A;  1SXD A;  4F2R A;  3BJY A;  1ZQF A;  4F91 B;  4LVS A;  3ZDC A;  4PZO A;  4F8R A;  1QSS A;  1ZXI A;  2KFN A;  3NRW A;  3WK7 A;  2A1J B;  3GV5 B;  4O9M A;  2W54 A;  2UVR A;  2B0C A;  4DL6 A;  2EZX A;  4RNM A;  3WK5 A;  4NJ8 A;  3V7L A;  4OD0 A;  3GIJ A;  4F5Q A;  2PKE A;  1BGX T;  2BPC A;  4J9K A;  4M04 A;  3QUT A;  1U49 A;  1DOQ A;  5JTI A;  3JPR A;  2G5H B;  4OJL A;  4OJ5 A;  4MEX A;  4BX9 C;  2UVU A;  2UVV A;  5J2A A;  2F77 X;  4YMM A;  5AIA A;  2KJ5 A;  2Z7J A;  3M9N B;  5ALM A;  3MR5 A;  3UM9 A;  3WKE A;  3H8J A;  3RFA A;  4QIW F;  4QW9 A;  2ESE A;  3HJE A;  2JGA A;  4KMO B;  2B6G A;  1MQ3 A;  4KLL A;  5J2I A;  1ZJN A;  1LKY B;  1X9X A;  1ZD3 A;  4GIB A;  2KE7 A;  3AEV A;  1XWL A;  1BPB A;  5F9N A;  1LV5 A;  5KFC A;  1NKC A;  5EWF A;  3LWL A;  1F44 A;  9ICO A;  3B0X A;  4I2C A;  2OCE A;  1L7N A;  1UCV A;  4YMN A;  2KVS A;  5HHI A;  4CNQ A;  4C8M A;  1T3N A;  2BDU A;  2K4E A;  3BQ7 A;  3IG5 A;  2WAQ C;  1SXE A;  5KFG A;  4TQS A;  4Z6E A;  2F8K A;  1NJW A;  2VA8 A;  1Z1B A;  5KFP A;  4R66 A;  1ZQH A;  2R8H A;  8ICZ A;  1NK0 A;  3KD3 A;  4C8N A;  4P0P B;  4J9M A;  5J0X A;  1QCK A;  5J2K A;  3RJE A;  1HUZ A;  2CRX A;  4UB1 A;  2NRZ A;  2LM4 A;  4KIT B;  1MC8 A;  4C4R A;  4FO6 A;  4F4K A;  1N48 A;  4DSK A;  2FI1 A;  3RB6 A;  2A1J A;  3SEN A;  4NWI A;  2PFO A;  1OW5 A;  2FLN A;  4C8O A;  5A0L A;  3Q8Q B;  1RXW A;  1XSN A;  4Y2X A;  3H8W A;  1P7D A;  1D9F A;  4ECR A;  4UAW A;  3LYS A;  3V7J A;  3F5A A;  4I2E A;  2C2D A;  2KHQ A;  1TKD A;  2KEY A;  2H3I A;  4BGD A;  1SKW A;  4QNL A;  4JV2 A;  2XVT A;  4MF8 A;  1T7P A;  4BDP A;  4FBU A;  5KFJ A;  3M8R A;  1PK3 A;  2MAX A;  4M6W B;  3GIL A;  4YFK A;  4RQ0 A;  5KG3 A;  4DFK A;  5KFR A;  2PXI A;  4JMU A;  3EYZ A;  4DSE A;  4UBC A;  4QZA A;  2V4R A;  1T4G A;  1PVQ A;  1BPE A;  1ZQA A;  4EBE A;  2G08 A;  3DEE A;  4B9V A;  1KEJ A;  2LBO A;  2E8O A;  5ALH A;  9ICT A;  2P6R A;  3OHA A;  3RRG A;  1IV8 A;  4UAS A;  4DSJ A;  3NUQ A;  3WU2 U;  3ZDD A;  5T14 A;  1Y88 A;  3Q8M A;  3F2C A;  4O5K A;  2HVH A;  2XID A;  4DQR A;  4CF3 A;  5JU5 A;  4O5C A;  3TAQ A;  5J0S A;  4QWC A;  3SYZ A;  1VLB A;  4BWJ A;  1RYS A;  2DBY A;  1KQQ A;  5AM2 A;  1ZQP A;  3V72 A;  5CHG A;  5AI5 A;  4K4H A;  2WHE A;  5AKJ A;  4I2I A;  5ALT A;  4Y2P A;  2ZIW A;  2Y0S F;  3JPT A;  1B43 A;  1XC9 A;  2LKY A;  1U4B A;  5FP0 A;  4QZI A;  2KVC A;  4YD1 A;  4ZH4 A;  1QQ6 A;  5IIK A;  2W8L A;  4F5N A;  1O08 A;  3AU2 A;  3MFI A;  3SV3 A;  5D4B A;  3KHG A;  4KLG A;  3D2S A;  2PMZ F;  4Q8E A;  9ICK A;  5AI0 A;  4I2H A;  4LJX A;  4QIW C;  4GC6 A;  4DL2 A;  2HHS A;  3J81 j;  2G5I B;  3M6Z A;  5KL1 B;  3BQT A;  2KN7 A;  3BQ1 A;  1MN8 A;  2OXO A;  3FC4 A;  8ICC A;  3M8S A;  3IDW A;  2QAR B;  8ICY A;  2FPL A;  1JN3 A;  4QZD A;  2AQ4 A;  2OYY A;  4M2Y A;  3T79 A;  4PHP A;  4BXO A;  4Y2R A;  2F1J A;  2JZB A;  1NK9 A;  5KFQ A;  2V9W A;  2J6U A;  1Q46 A;  2R18 A;  4JUZ A;  1N60 A;  2WF8 A;  1ZQV A;  4TUP A;  2KD1 A;  1TK0 A;  2PMZ C;  1FIQ A;  4LZG A;  1X6J A;  2I5H A;  3WK8 A;  1WWU A;  2H3V A;  4Z6D A;  3AL0 B;  3QZ7 A;  3UXO A;  5KFD A;  1SB3 C;  1X40 A;  1TV9 A;  5AK5 A;  5L1K A;  3B9J A;  3SAG A;  4QZH A;  1ZQO A;  5J8Y A;  2L5Y A;  5K4L A;  4FZM A;  4UB3 A;  2KHV A;  3MGH A;  3Q8R B;  5BOL A;  4IRD A;  9ICR A;  2YMM A;  1PVP A;  2LPE A;  2HHX A;  1FFU A;  4ECX A;  5IIO A;  2NO4 A;  5DG7 A;  2H3F A;  3PMN A;  2RDJ A;  4IR1 A;  2KOB A;  4OJO A;  3WKC A;  1PZN A;  4USA A;  4O3Q A;  5AHX A;  3PX4 A;  3QNM A;  2DGZ A;  3IN5 A;  3CW2 C;  8ICS A;  5ALN A;  1B0X A;  1XS9 D;  3RB4 A;  2MUT A;  1S0N A;  4DFJ A;  3Q8K A;  3TFS A;  2M9N A;  1SZP A;  2HCF A;  5HR6 A;  2E3T A;  2HHW A;  1RQL A;  3T5L A;  1SV0 A;  2F44 A;  2ZG6 A;  3QU7 A;  5KT5 A;  2YY6 A;  1TAQ A;  4NXZ A;  2FDR A;  3G6X A;  4DFP A;  5DB9 A;  1NK4 A;  7ICG A;  2EAN A;  8ICO A;  4RNO A;  9ICA A;  4I2B A;  2EAM A;  3SAF A;  3L3F X;  2E8N A;  3HW8 A;  3NVV A;  3SZ2 A;  4R64 A;  3M9O B;  2NRW A;  1F0M A;  3GDX A;  2WF9 A;  4QZF A;  2HDO A;  5CWR A;  1RYU A;  1ZJM A;  2JHD A;  4ED2 A;  5ALK A;  5EE3 A;  4UAR A;  2RQ5 A;  4DF4 A;  1Z4O A;  1PUZ A;  3F5E A;  4K4I A;  3NVZ A;  3MGV A;  3M9M B;  2LMR A;  3C28 A;  2FE9 A;  2ZIU A;  4RPY A;  5HR7 A;  1ZQG A;  3TAN A;  1COK A;  8ICP A;  2YB4 A;  1TK8 A;  5KFM A;  3NRZ A;  2Y0S C;  5AI9 A;  4QZC A;  2DPJ A;  2W3S A;  1S97 A;  2OM6 A;  7ICF A;  5KFH A;  4IC9 A;  4DS5 A;  4DOC A;  1LB2 B;  8ICR A;  4PZN A;  2KSO B;  3PR4 A;  4AP9 A;  2DQN B;  4DEZ A;  3RJG A;  2JH7 A;  3RBD A;  1SIJ A;  4B9S A;  4EEN A;  3BDP A;  2HHV A;  2ZUC A;  5L1L A;  1BPD A;  4LZD A;  5AKE A;  1BNO A;  5ALL A;  4QWA A;  1L7M A;  4RUA A;  2YB1 A;  2VAN A;  3ONN A;  3OTQ A;  5DBC A;  2IOF K;  5AIC A;  2HHU A;  4Q43 A;  4DFD A;  2DUY A;  5J0T A;  1AQ6 A;  3QX7 A;  4RQM A;  4JWM A;  5KG0 A;  4YQW A;  4MEY A;  7ICV A;  1X2I A;  3PW0 A;  2BCR A;  4J9O A;  2W3R A;  4F4X A;  3E0F A;  8ICM A;  4FFD A;  2ISP A;  3KKA C;  3RH6 A;  3PX0 A;  1KBU A;  4JWN A;  2Q4T A;  8ICQ A;  1HJP A;  1S77 D;  4NL9 A;  4PGQ A;  2AU0 A;  4DL4 A;  4QZB A;  4KLH A;  1DK2 A;  5KFK A;  2ZIX B;  2BGW A;  3E58 A;  4KLQ A;  1D8Y A;  4M9J A;  4KLI A;  1DXS A;  2C22 A;  2Y9U A;  5D46 A;  5L1J A;  5EWE A;  2W9C A;  2KV2 A;  8ICG A;  1U47 A;  2P6U A;  2KG5 A;  2D3D A;  4RT3 A;  4KLD A;  3R9K A;  4ZOH C;  4A8E A;  2R8I A;  5ALR A;  2PFQ A;  1YZ7 A;  1ZQX A;  5BPC A;  5IIJ A;  3RAX A;  2JXJ A;  4RZR A;  2KJ8 A;  9ICQ A;  1UA0 A;  4EZ6 A;  3IM1 A;  4DSL A;  3OSP A;  3GQC A;  3KHR A;  2MUT B;  1RYR A;  5DQG A;  2EAO A;  5AK4 A;  4G9B A;  5ALX A;  3D2N A;  1CUK A;  2J6S A;  4ECS A;  1N2X A;  4B9U A;  5DLF A;  4B9M A;  5KFV A;  3QUC A;  4XQ8 A;  1BNP A;  3KZX A;  5AK6 A;  3SMV A;  4EEL A;  2WAQ F;  4F3O A;  2F1I A;  4P4P A;  3GV7 B;  4DFM A;  1Q3V A;  3NTU A;  2K8B B;  7ICH A;  3F2B A;  4CCH A;  1TAU A;  3AQF A;  5J0O A;  1L3T A;  7ICE A;  1L3V A;  1JRP A;  4DL3 A;  8ICN A;  4OJ6 A;  3SV4 A;  3OHB A;  1KFS A;  4US8 A;  1L7P A;  2KKV A;  4EBC A;  5ALQ A;  1J2M A;  2AGO A;  5AKK A;  2FPK A;  7ICO A;  4ECV A;  3TAP A;  2W43 A;  4FE3 A;  5KFT A;  3ZDA A;  5AM0 A;  3SEI A;  4PHE A;  2K4P A;  3THV A;  1FFV A;  1ZQ1 C;  2GO7 A;  4I2F A;  5AIB A;  4O3R A;  3ZDE A;  2WB1 F;  1A76 A;  2R8G A;  1XU4 A;  4I2G A;  2I1Q A;  4NY8 A;  4UAV A;  3T5H A;  4XUS A;  4YVZ A;  4ICA A;  1ZQZ A;  2ZJ8 A;  4JV1 A;  2ZIU B;  3PW2 A;  4B6J A;  4P0P A;  4PPX A;  2XY7 A;  2XY5 A;  3RF9 A;  2KZZ A;  4RQ7 A;  2FMP A;  4QWD A;  1C7Y A;  4KLS A;  2KTQ A;  3FYH A;  2AGP A;  1IG6 A;  2EZY A;  4UAZ A;  3MFH A;  5DDM A;  3GIM A;  2MRL A;  3CP8 A;  3TAD A;  2HW3 A;  5KAF U;  7ICT A;  2WB1 C;  3NVY A;  1Z3E B;  1ZQE A;  5AKL A;  3ALR A;  3MR6 A;  3ED5 A;  5KL8 B;  2GH1 A;  1DGJ A;  1O03 A;  1D8B A;  5F9L A;  5J2E A;  2AHO B;  3MR2 A;  4NLG A;  2EH9 A;  1LKY A;  5C0Y A;  3PSF A;  2C28 A;  5ALP A;  4MFC A;  1U9L A;  1KLN A;  4F5R A;  2R8J A;  4KLE A;  2H3Q A;  2RHF A;  2F1H A;  2KK0 A;  2DWQ A;  3H0R B;  4R8U B;  4MFA A;  2E1E A;  4UB8 U;  5KT2 A;  4X5V A;  2DPI A;  3SQI A;  2NRT A;  3DV9 A;  5CP2 A;  4TUS A;  2AH5 A;  2B21 A;  4TUQ A;  2KP7 A;  4KLO A;  1QSY A;  2HBL A;  3UQ0 A;  2CPR A;  4C4S A;  5KFF A;  3T5K A;  2W11 A;  3PSI A;  9ICJ A;  5J2J A;  9ICS A;  2G07 A;  5KFX A;  1ZQM A;  1ZQN A;  2D6F C;  1X9M A;  1Z1V A;  1NOM A;  2BZF A;  3QZ8 A;  1COO A;  1S0O A;  2KZ3 A;  2EAP A;  1N5W A;  2PI5 A;  5GTH U;  5AI6 A;  4TQR A;  9ICG A;  2YN4 A;  2K4H A;  2MA1 A;  4C4T A;  1JRO A;  5F3X B;  1MA7 A;  2WFA A;  4IQU A;  2HMX A;  5KT3 A;  5DG8 A;  5J0U A;  3MDA A;  3C2M A;  1DRG A;  4AYB C;  1EXN A;  7ICS A;  4RPZ A;  1X42 A;  4DQQ A;  5BOM A;  2G0A A;  3Q8S B;  2FJ6 A;  4Y2Q A;  4K4G A;  9ICV A;  3HKZ C;  3NAS A;  3C5G A;  3IRU A;  3JPN A;  3PZP A;  2HOQ A;  2QAR A;  2QB1 A;  2XIC A;  4GXI A;  4RU9 A;  1ZD2 P;  2Y1I A;  2ZIV A;  1ZQK A;  2BQ3 A;  2KIC A;  3F2D A;  2BR0 A;  4P2H A;  1X6I A;  4NM1 A;  1TFR A;  3RB0 A;  4O3O A;  2E5S A;  4YCX A;  1NI3 A;  3H8M A;  4AYB F;  4US9 A;  5CA7 A;  4GC7 A;  3O0F A;  4YG2 A;  2QB0 B;  4ED1 A;  4QWE A;  3RJI A;  2BCS A;  5KFE A;  1HIW A;  5J2D A;  2ZJ5 A;  1KRP A;  4DQI A;  1N61 A;  4KLJ A;  3OJU A;  4FS1 A;  3TI0 A;  3BZK A;  3LVV A;  4EX6 A;  3PW5 A;  3RR8 A;  1SL2 A;  3M7D A;  1NJZ A;  5E79 U;  4QW8 A;  2OWO A;  2XCP A;  4YXM A;  4RQN A;  4YR2 A;  2LYH A;  1IIP A;  1KFT A;  1TK5 A;  3ISC A;  4CRX A;  4IRC A;  5CEH A;  5III A;  2ATL A;  1GO3 F;  1HEK A;  1DGS A;  4R65 A;  3BS5 B;  2ZTE A;  4FBT A;  3M1Y A;  1SL0 A;  1QH9 A;  3C21 A;  3CRX A;  2E8P A;  2JH1 A;  5ALE A;  3GII A;  2W9B A;  9ICM A;  3RTV A;  2UVW A;  4EYH B;  3EW9 A;  4ELU A;  2FPM A;  2IBK A;  5EWG A;  2VA2 A;  8ICJ A;  3AU6 A;  5AI8 A;  3QEA Z;  2JEF A;  2XCA A;  4UAU A;  1H38 A;  3BS7 A;  8ICV A;  4DLE A;  3N7P D;  3S6J A;  4ECT A;  4M9L A;  3JPS A;  5ALV A;  5KFA A;  2W7P A;  1ED1 A;  5KTQ A;  5KFB A;  1WCN A;  2W8K A;  3RRH A;  1S9F A;  4I2J A;  4RQ8 A;  2NO5 A;  4WJ3 B;  3N7R C;  3ZD8 A;  5DB6 A;  3PX6 A;  1WG8 A;  3PV8 A;  4PL2 A;  8ICF A;  1ZRN A;  2BCQ A;  2EDU A;  4UW9 A;  5TIS U;  5KG6 A;  3H4B A;  4IQW A;  5CR0 A;  4F92 B;  4BXO B;  4RQ3 A;  5DQI A;  2Y9T A;  4RQ5 A;  5DB8 A;  1K1S A;  1WCL A;  3IP4 B;  4KLM A;  3ETR A;  5KFW A;  3DDH A;  4NLK A;  5AI4 A;  3B0Y A;  8ICT A;  1ZQR A;  1KL9 A;  2BQR A;  3PST A;  4Y2S A;  4RQ2 A;  4OCZ A;  2YX8 A;  4EYI B;  4GFJ A;  3GZF A;  5KFL A;  4B9L A;  4DLG A;  3KKA A;  1ZQC A;  3H8S A;  2PFP A;  3GV8 B;  1F5S A;  1Q3U A;  1ZRM A;  1ZYQ A;  3QU4 A;  3H0M B;  4F93 B;  4J9N A;  2LM1 A;  2K89 A;  2WF7 A;  4I2D A;  2ZIX A;  4UB2 A;  1XNS A;  3EPI A;  2YQE A;  3KOO A;  5DB7 A;  2XO7 A;  2XC9 A;  1ZD5 A;  5KNI A;  5DBA A;  7ICR A;  2ASJ A;  1YZ6 A;  4C80 A;  4UBB A;  4CF4 A;  2F8L A;  5J0Y A;  3CNH A;  3KTQ A;  4HAI A;  4Q45 A;  1UA1 A;  1PVR A;  3EPG A;  4RQ4 A;  3KBB A;  5KFZ A;  5G5G A;  5JUM A;  1Z00 B;  3L4P A;  2CXY A;  4JB3 A;  1X66 A;  1XO0 A;  5AKH A;  4DF8 A;  3QU5 A;  4HYK A;  4P0Q B;  1WWV A;  2KJ9 A;  5ALG A;  4I2A A;  1NJX A;  3BQ2 A;  2BCU A;  3N4M B;  5DQH A;  3C1Y A;  1JXE A;  2ASD A;  4F5P A;  5GTI U;  2Q0Z X;  2NRV A;  1JMS A;  2BHN A;  4O3S A;  3H7I A;  1ZQT A;  3A0B U;  3RJJ A;  4DQP A;  5G5H A;  4E0D A;  1UT5 A;  4RT2 A;  4EEY A;  1KDH A;  4NM2 A;  5L1I A;  5J0Q A;  5KG4 A;  3N97 B;  3KHL A;  5DKW A;  1S76 D;  1OUQ A;  4R8U A;  4Y2J A;  3WK6 A;  2W9M A;  1S0M A;  5L9X A;  3RJH A;  2VJ5 A;  2HBK A;  3HKZ F;  2OHF A;  3WKD A;  4EX7 A;  3AMZ A;  1M6Y A;  1K1Q A;  3AQE A;  4FZN A;  1PK1 A;  3LWM A;  1HUO A;  4ELT A;  4F71 A;  2E8M A;  5ALY A;  3QE9 Y;  2D8C A;  2VA3 A;  8ICX A;  9ICW A;  5TZV A;  3VC8 A;  2WTF A;  3MBY A;  2ZIW B;  4U7C A;  2HHT A;  5KFN A;  2KNJ A;  4JK1 A;  4TUR A;  4Z6F A;  1B4F A;  4J03 A;  1MSW D;  9ICI A;  5DBB A;  3KZI U;  4EBD A;  3PW7 A;  4KLF A;  2HI0 A;  4DSI A;  2RP5 A;  5AKI A;  1IXR A;  1NK8 A;  1QTM A;  5J2H A;  4OJP A;  1RG6 A;  4P0Q A;  9ICU A;  3HIL A;  3AUO A;  2C2R A;  2ISO A;  4RUC A;  4F4W A;  2F76 X;  4Y2V A;  4FZL A;  1ZOL A;  4PGX A;  3PY8 A;  1Z00 A;  9ICN A;  1U48 A;  1V85 A;  4DOA A;  3IHQ B;  1SZH A;  4MFF A;  4QJF B;  4J9Q A;  2EZZ A;  2KZM A;  5DGA A;  2BPG A;  2W9A A;  2PI4 A;  4ECY A;  2JEG A;  1A6S A;  1RDF A;  5EOZ A;  4F4Z A;  2K60 A;  3V6J A;  2JZB B;  3GU3 A;  1N62 A;  2RLT A;  4O3N A;  4BUG A;  4G3I A;  4PHD A;  2PFN A;  1ZQD A;  3K4G A;  4Q44 A;  5HHH A;  4ED0 A;  1SKS A;  4PL1 A;  3E2E A;  2W7O A;  4DOB A;  7ICU A;  4DO9 A;  4J9L A;  3JPQ A;  1CI4 A;  5ALS A;  2QB0 A;  2BPF A;  9ICB A;  1L6N A;  4YP3 A;  1JUD A;  3MAB A;  3C23 A;  4YN4 A;  3HRD D;  8ICH A;  2AQ0 A;  2IOH A;  3QXG A;  5ALW A;  5ALF A;  1V97 A;  1ZQQ A;  1YT3 A;  4ACO A;  4O3M A;  4CDG A;  3HX0 A;  4IQT A;  1BPY A;  4M47 A;  1VDV A;  3PNC A;  3T3F A;  1D9D A;  3RR7 A;  1Z19 A;  2JR5 A;  2KMD A;  4QZ9 A;  4R63 A;  2N1R A;  2HBJ A;  4ECU A;  1KTQ A;  2J6T A;  4DCC A;  3C29 A;  1Z4N A;  5KT6 A;  8ICI A;  2OEH A;  2W9C B;  3SR6 A;  2ZJA A;  2W04 A;  2K8C B;  7ICL A;  4ECQ A;  2C2E A;  1QQ5 A;  4ED3 A;  2HHQ A;  4EEK A;  5J8Y C;  3WK4 A;  5IIN A;  3G6Y A;  8ICL A;  4DL7 A;  2YTU A;  5H2F U;  9ICE A;  2W9B B;  2YMP A;  2K8A A;  5HP4 A;  3A0H U;  1ZQJ A;  1A0P A;  1L7O A;  4I27 A;  5KG5 A;  3TAC B;  4F72 A;  5KFY A;  4NLZ A;  1NK5 A;  4JV0 A;  2W03 A;  3K75 D;  1NKB A;  4PH5 A;  2K4I A;  2LI6 A;  8ICE A;  2I6X A;  1T94 A;  4ED7 A;  5DLG A;  4MHV A;  2IMW P;  4M9H A;  1BPX A;  5CB1 A;  3I1Y A;  1X9W A;  4J9P A;  3TKA A;  3I28 A;  4XRH A;  5J0R A;  2F3N A;  4RQ1 A;  4YMO A;  4DSF A;  4QZ8 A;  2ZUD A;  3RH5 A;  5AM1 A;  4PJ0 U;  4YD2 A;  2FLL A;  4M6W A;  1S8O A;  8ICB A;  2HSZ A;  2IA6 A;  4C0Z A;  3VCB A;  3RJF A;  2OH2 A;  3BZC A;  3C1Z A;  4IQV A;  4Y2U A;  2XY6 A;  5IIL A;  1DK3 A;  4OO1 J;  3WKA A;  5B66 U;  1JIH A;  3OGU A;  2HBM A;  1ECW A;  1TAM A;  2JEI A;  1KKX A;  9ICC A;  1MQ2 A;  4ED6 A;  2ODG A;  1CEZ A;  3QUQ A;  3V6H A;  2WF5 A;  4RPX A;  2ZTC A;  3PR5 B;  3KHH A;  1OXJ A;  1V9P A;  1IM4 A;  3D6J A;  2DF4 B;  2A1A A;  3PW4 A;  4QWB A;  7ICJ A;  3MDC A;  3KFU F;  4C7Y A;  1BPZ A;  3UXP A;  2A3V A;  5KT4 A;  3RAQ A;  2LYB A;  3UMB A;  1KN5 A;  1U45 A;  5C5J A;  5AKX A;  1SGG A;  3AN1 A;  2DL0 A;  5KG7 A;  3C2K A;  4PGY A;  1NK6 A;  2F2A B;  2ES6 A;  3D2Q A;  2HOF A;  5KFO A;  4J9R A;  2FMQ A;  4FS2 A;  3FDS A;  1SV4 A;  4UB6 U;  2G06 A;  4DQS A;  4IL6 U;  4QZE A;  5KG1 A;  3OSN A;  2JEJ A;  4Y2Y A;  2HOI A;  4ECW A;  3V6K A;  2DKZ A;  2RDI A;  3EZ5 A;  4U6P A;  1ZQL A;  5EE1 A;  4BWM A;  5HNK A;  4NL9 C;  3FAH A;  3MR3 A;  9ICF A;  4F50 A;  4M9G A;  4RQ6 A;  3HPO A;  4CGZ A;  1RZT A;  3PVX A;  3HT3 A;  1BVS A;  4KLT A;  2KIV A;  3Q8L A;  3UQ2 A;  5J0W A; 
#chains in the Genus database with same CATH homology
 3F53 A;  2VIX A;  2WAQ C;  5T14 A;  2ZIX B;  2H3V A;  2HBM A;  1ECW A;  1TAM A;  3F2C A;  3AL0 B;  3PSI A;  1ZQ1 C;  3N7S C;  3AQE A;  2G07 A;  4FZN A;  1YT3 A;  3F5E A;  4NLB A;  4ACO A;  1Q3U A;  4CDG A;  4O3M A;  2D6F C;  2XID A;  1IIP A;  3H0M B;  3MGV A;  2KV2 A;  2K89 A;  2WB1 F;  2E1F A;  3C28 A;  1Z1B A;  3SAG A;  1Z19 A;  4CRX A;  2ZIX A;  3CYM A;  1XNS A;  2ZIU A;  5HR7 A;  2N1R A;  2HBJ A;  4P0P B;  1GO3 F;  3VC8 A;  2ZIW B;  1HEK A;  2YB4 A;  4U7C A;  3C29 A;  4A8E A;  4FZM A;  2Y0S C;  2CRX A;  3NRW A;  2DF4 B;  2KHV A;  4KX3 A;  2W04 A;  2K8C B;  4ICA A;  2OM6 A;  3K1Z A;  2K4H A;  2MA1 A;  1URJ A;  1PVP A;  2KNJ A;  4IC9 A;  2ZIU B;  1MA7 A;  3KFU F;  2GOL A;  3CRX A;  4P0P A;  2A3V A;  2JH1 A;  2ZIW A;  2Y0S F;  3RF9 A;  2HMX A;  2KJ8 A;  4BJQ A;  2XI9 A;  1DRG A;  2ZXI A;  1CRX A;  2DQN B;  2F8L A;  2LHT A;  2RP5 A;  2LYB A;  4NWI A;  2JH7 A;  4KX5 A;  4AYB C;  1PVR A;  2H3F A;  2LKY A;  1NZB A;  2MRL A;  3CP8 A;  4OJP A;  5A0L A;  2KIW A;  2KOB A;  2KVC A;  2M0N A;  4OJO A;  3N7P D;  2K8A A;  2WB1 C;  1P7D A;  1A0P A;  2G5H B;  4P0Q A;  2G0A A;  2F2A B;  2YB1 A;  3ALR A;  3D2N A;  2DGZ A;  4OJ5 A;  4OJL A;  2W7P A;  2ZXH A;  3D2Q A;  5KL8 B;  3IN5 A;  2HOF A;  2RRD A;  1ED1 A;  4BX9 C;  3M6K A;  3ONN A;  2GH1 A;  3IG8 A;  2W03 A;  3LYS A;  3F5A A;  1XO0 A;  2K4I A;  2F76 X;  1D8B A;  4FZL A;  3D2S A;  2PMZ F;  3HKZ C;  2KHQ A;  2F77 X;  2VKQ A;  2CN1 A;  4WJ3 B;  1T94 A;  2KEY A;  2H3I A;  4P0Q B;  2KJ9 A;  2KJ5 A;  3N7R C;  4QNL A;  3PZP A;  4QIW C;  1SZH A;  3KZX A;  3SMV A;  2HOQ A;  2WAQ F;  2Z7J A;  2XVT A;  4QJF B;  4PL2 A;  2XIC A;  5HR6 A;  5C0Y A;  3PSF A;  2G5I B;  3M6Z A;  5KL1 B;  2G06 A;  2G09 A;  2ZIV A;  4NV0 A;  1A6S A;  2KIC A;  2OXO A;  2VJ4 A;  3RFA A;  4QIW F;  3F2D A;  2KKP A;  1Q3V A;  2H3Q A;  2JGA A;  4KMO B;  2K8B B;  2LYA A;  2ZG6 A;  4NLC A;  2HOI A;  2RHF A;  3GU3 A;  4BUG A;  2E5S A;  4U6P A;  3H0R B;  3F2B A;  3AQF A;  3ICX A;  2ZIV B;  2E1E A;  3PSP A;  3IP4 B;  4JMU A;  4AYB F;  2JMG A;  2OYY A;  3T79 A;  5CRX A;  3O0F A;  4PL1 A;  4GFJ A;  3SAF A;  2W7O A;  3E0F A;  4OJ6 A;  3SQI A;  4CGZ A;  1PVQ A;  1OUQ A;  3LVW A;  3L3F X;  2H3Z A;  1KBU A;  2Q4T A;  1HIW A;  2G08 A;  1F44 A;  3DEE A;  2R18 A;  2LBO A;  4C0Z A;  2KKV A;  3VCB A;  2OH2 A;  2NV3 A;  1UPH A;  3OPX A;  3SAH A;  3PST A;  2VJ5 A;  2KD1 A;  2HBK A;  2PMZ C;  3HKZ F;  2YX8 A;  1L6N A;  3H0L B;  2JHD A;  1WUD A;  2HBL A;  3LVV A;  4OO1 J;  4FE3 A;  2BDU A;  2K4E A;  3GZF A;  3NUQ A;  3M7D A;  3IG5 A;  2CPR A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...