2K8BB

Solution structure of plaa family ubiquitin binding domain (pfuc) cis isomer in complex with ubiquitin
Total Genus 16
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
16
sequence length
80
structure length
80
Chain Sequence
ANQQTSGKVLYEGKEFDYVFSIDVNEGGPSYKLPYNTSDDPWLTAYNFLQKNDLNPMFLDQVAKFIIDNTKGQMLGLGNP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Ubiquitin
publication title Structural Basis for Ubiquitin Recognition by a Novel Domain from Human Phospholipase A2-activating Protein.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Protein binding
total genus 16
structure length 80
sequence length 80
ec nomenclature
pdb deposition date 2008-09-04
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.410 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 DNA polymerase; domain 1 2k8bB00
2K89A 2K8BB 2K8AA 3PSTA 3L3FX 2K8CB 3PSPA
chains in the Genus database with same CATH superfamily
5ALUA 5KG2A 1UHUA 4ELTA 2YTUA 3OHBA 5ALDA 4FZLA 4KX5A 4PHAA 3V7JA 4US8A 3ISDA 2B6GA 2QB0B 2YQEA 3BQ0A 3V6KA 1N61A 4DFPA 1SIJA 1LV5A 3UXPA 1B43A 4JV2A 4UAVA 9ICMA 3HP6A 3PSTA 3LVVA 2KEYA 4YR2A 5ALJA 1ZQCA 3F2CA 4RU9A 2KFZA 1YZ6A 4YP3A 4QWBA 1TAQA 3JPRA 2CRXA 4B9MA 3GV7B 3FM9A 4DSLA 5IINA 3V6JA 1EXNA 1L3UA 1QQ5A 2MUTB 3MABA 5KFXA 1IIPA 3FDSA 3F2DA 3RTVA 3M7DA 3VCBA 2BPGA 4ECZA 2KOBA 2HDOA 3MGHA 4IC9A 5DGAA 4PL2A 3HKZF 5G5HA 5ALWA 2RP5A 3MDCA 2JGAA 2ZJ8A 2W9AA 1UPHA 4F5NA 3OSNA 8ICEA 2KJ5A 2AH5A 4QZCA 4O3QA 1DK3A 5KFQA 3SMVA 4TQRA 4EEYA 1MQ2A 5EE0A 5J2EA 3EZ5A 4CCHA 4ECQA 4BWMA 2Y1JA 3ZD8A 4TUQA 7ICRA 3AU2A 4O3MA 2HOIA 1DXSA 3WK8A 2ISOA 2W9CB 1UCVA 5ALRA 1BNPA 2G07A 3RB6A 2K4HA 1KSPA 4DL3A 2DGZA 2VA2A 2UVVA 1PZNA 2RRDA 9ICWA 5J0OA 3M8SA 3L3FX 2ZIUB 4DOBA 2YMMA 1CEZA 3OJUA 4KLIA 3OJSA 1SL0A 2HHWA 2R18A 3OPXA 4JV1A 2YX8A 2FPLA 2KIWA 1BPBA 3C2LA 5J2CA 5AKXA 1L5UA 4ECRA 4YFKA 1T3NA 4R8UA 5AI4A 5DB7A 4P2HA 1X40A 3E58A 5KFRA 3PR5B 2LHTA 2K89A 5G5GA 1X66A 5DG9A 5IIKA 5J8YC 1SXEA 3K4GA 3C28A 4B9VA 4QIWC 1NZPA 9ICUA 3TAQA 3C29A 3DV9A 2XIDA 4J9KA 3K1ZA 4IRDA 1DOQA 2WF8A 2A1JB 3PMNA 4MHVA 3PW0A 3M9OB 9ICBA 5J0SA 1NJZA 4TQSA 2BPFA 4PL1A 2QARB 3QEAZ 4I2BA 5J2DA 4I2AA 4P0PB 2J6SA 1H38A 2NRXA 1HIWA 1N62A 1Y88A 2RHFA 2HI0A 4UAYA 2A19A 1ZD3A 2D6FC 5KFCA 2JHDA 3GFKB 4I2GA 2K4IA 1N2XA 3CNHA 3OGUA 5HR6A 1D8BA 7ICIA 1LVHA 4DQIA 2OHFA 5AKEA 1J97A 2WF7A 4O3NA 2JV3A 3MFHA 1F5SA 2KV2A 3EPIA 5ALOA 1U47A 7ICVA 5HMMA 2E3TA 3RAQA 2HBLA 4UB4A 3PO4A 1V85A 5KG4A 4QJFB 3G6VA 2VA3A 4PH5A 4F5PA 2K8BB 1ZQRA 4QWAA 1SGGA 9ICHA 1LKYA 3UM9A 5FP0A 4Z6FA 5AIAA 2E8OA 2YB1A 2PFNA 4I2DA 2DPIA 3CW2C 4IQUA 2JZBA 3LYSA 9ICIA 2ESEA 4I2IA 3TADA 3RRGA 4O3OA 4C8NA 2A1AA 2ZJ5A 4NL9C 4F50A 5KFFA 3RR7A 1SKWA 4YVZA 1WWVA 1KRPA 2HHSA 2WAQC 2H3QA 5KFEA 5ALVA 3WKBA 4F4WA 1Z1VA 5EE3A 4RNNA 2HCFA 1KLNA 3M6ZA 3ZDDA 2F8KA 1J2MA 1UT5A 2CXYA 5L1LA 4M2YA 4IS7A 1HEKA 3WKCA 2KHQA 2IHNA 5IIIA 8ICHA 5HHIA 4QZIA 2MAXA 2F77X 1RXVA 9ICEA 4OJLA 4DFMA 2QB0A 1CUKA 4AP9A 1NK7A 1ZQHA 3FYHA 4BUGA 1ZQYA 1LB2B 5AK3A 4DQSA 3HILA 2W9BB 2W3SA 3UPQA 2XY5A 5ALQA 4FE3A 3KBBA 5AK4A 2ZG6A 3ED5A 3MR3A 1K5OA 5J0XA 5KG1A 1XO0A 1X42A 4O0IA 3D2SA 4EYHB 3KZXA 4Y2UA 2NYVA 3KHGA 5DBCA 1JIHA 2K8CB 2E1EA 3NASA 3H0MB 4ED0A 1SWWA 3S6JA 2R8JA 1ZD2P 5HR7A 2L5YA 3WK7A 1SZHA 4NLKA 4J9PA 5ALEA 4F93B 2C2EA 1ZQFA 5CWRA 1KFSA 1HJPA 2Y9UA 5KG5A 4C8KA 1HUZA 3AL0B 2FI1A 5AKYA 5AKKA 1BPYA 4PGYA 2C28A 9ICLA 4HYKA 1D8YA 3SR6A 3PMLA 4QWDA 8ICYA 3BDPA 5J2KA 4PGQA 3H8JA 4O9MA 4AYBC 4JMUA 4I2FA 3E0FA 7ICMA 9ICAA 2XICA 4EBDA 1FFUA 4R63A 2PKEA 2ZIXA 2OCEA 4DSIA 4TUSA 2ZIVA 4J9RA 3QZ8A 4NLZA 8ICGA 2M9NA 2ZIUA 4DQRA 1RG6A 4J9QA 2IA6A 3KTQA 4UB8U 3QU5A 2FLPA 1JUDA 4RQ7A 9ICRA 5ALLA 8ICKA 2K4PA 1QTMA 3NRWA 1DK2A 5AM3A 3ETLA 2RDIA 2KD1A 1QH9A 3KD3A 7ICEA 4EZ9A 4R64A 5ALYA 1ZD4A 2F2AB 3I1YA 2HW3A 2K8AA 1P7DA 1TV9A 4BWJA 3THVA 3EW9A 2LBOA 4QW9A 1JXEA 2LYHA 4KTQA 1JROA 3E2EA 3ISBA 1JALA 1KL9A 3QUCA 2UVWA 3PW7A 1DRGA 4PHDA 9ICVA 5IIOA 2K60A 2H5XA 1CRXA 2UVRA 1BPXA 4U7CA 1VJ5A 2CN1A 3BS7A 2PI4A 3RF9A 1ZQUA 2JEIA 7ICHA 2A1JA 5CJ7A 3TANA 9ICTA 3QU4A 2MU2A 3BQ1A 2W03A 1TK5A 2ISPA 8ICBA 5KFHA 4Q8FA 4GXIA 5J2JA 2QARA 4KLUA 5F3XB 4P0PA 2IOFA 2G5HB 5AI9A 5J29A 4J9NA 5JTIA 1V97A 1L3VA 3F2BA 3Q8LA 1V38A 4KLGA 2KZZA 2R8GA 1KEJA 5AKHA 2UVUA 5EOZA 3RB3A 9ICNA 5KFNA 5AKGA 2RDJA 3EPGA 1TE2A 4Z6DA 3UQ0A 3GZFA 4B9UA 4I27A 3IHQB 1K1QA 1DGSA 5DQIA 4LZDA 1ZETA 2HVIA 3HRDD 2BHNA 1Z19A 2QLTA 1ZQTA 5BPCA 3V7LA 3WK9A 2PI5A 4K4HA 1AROP 5AK5A 3IV6A 2JRZA 3H8SA 5KNIA 2ZUBA 4ZH4A 3PX4A 3OSPA 8ICUA 1BPDA 1RQLA 1WYGA 4BX9C 3PV8A 4P4PA 4IRKA 4GIBA 4O5KA 1L3TA 3F53A 3RBDA 2IOFK 5CRXA 3T3FA 2NV3A 4EBCA 3MR5A 1QSLA 1Q3VA 3AMZA 3R9KA 5DB6A 2IMWP 3Q8PB 1XSLA 1F44A 1KBUA 2BCQA 4C4TA 5J8YA 2W8LA 7ICSA 3GILA 1ZQBA 4UBBA 4UQGA 4Z6EA 5CR0A 5ALSA 4USAA 4M47A 4QNLA 1SWVA 5CA7A 4Y2VA 4KN4A 2DWQA 5KFDA 2JR5A 1JN3A 3JPPA 3D2QA 3JPOA 2G08A 4UAWA 5AM0A 2P6RA 5CEHA 2WB1C 5KG6A 1URJA 2NO5A 4EBEA 3NGDA 7ICGA 2ES6A 4UB1A 2BZFA 4Y2RA 3LWLA 4C4SA 4DF4A 5BOLA 2PFPA 4NXZA 4NLGA 2FMPA 3T5HA 4UW9A 4DF8A 2R8HA 2ZUCA 3QNMA 1RYUA 3SV3A 1ZJNA 1XS9D 2Y9TA 1ZQPA 1IV8A 5ALMA 2AQ0A 5CP2A 4Y2YA 1TK8A 4ECYA 3LVWA 1ED1A 1RYSA 3DEEA 4DCCA 4RZRA 2ASLA 8ICMA 1SV0C 4Y2QA 1ZOLA 2AHOB 4KLOA 3KHHA 7ICOA 1KFDA 3D2NA 3TARA 1B4FA 2XGQA 3QZ7A 5DBBA 3C2MA 2C2RA 7ICQA 4RQ1A 4XUSA 4KLTA 4KMUA 3F5AA 2F1JA 3KKAC 1PVRA 1K1SA 4Q44A 3O0FA 3B0YA 2WAQF 4RPXA 1KFTA 4YD1A 5K4LA 4NLBA 2YMQA 3NVZA 4NL9A 4MF8A 4DSKA 1ZRMA 2C2DA 1ZQOA 4CDGA 2DUYA 5CB1A 1XSPA 4UBCA 2NO4A 5JU5A 2KNJA 4UAUA 2D3DA 1BNOA 2ZTCA 5J0PA 2EANA 3BQ2A 5DLGA 5ALGA 1HUOA 2RQ5A 3UMBA 2BGWA 1ZQZA 3WKDA 2AGOA 3C2KA 3AM9A 4OCZA 4DLEA 4EEKA 4FBTA 3QU7A 4B9SA 2KIVA 1ZQSA 7ICUA 1S8OA 2EZXA 1A77A 1N56A 4RQNA 2KK0A 3PW4A 5AI8A 2GH1A 4P4OA 1N63A 5KFLA 4KLHA 4PPXA 4FO6A 4QW8A 3MGVA 2M0NA 3N7RC 2H3FA 3UXNA 3JPTA 2F1IA 5L9XA 3BZKA 5KFIA 2KSOB 4UB6U 1IM4A 3AN1A 3N7SC 1WG8A 1XWLA 1UA0A 5KFZA 2G06A 5AIBA 3KHRA 4QZ8A 2KE7A 1OXJA 8ICTA 5L1JA 3WU2U 4RQ2A 1IXRA 2BPCA 2NRTA 4ELVA 1RPLA 3PX0A 4NWIA 5AHXA 2OH2A 4JK1A 3ZI4A 3ORYA 4M9HA 4ECWA 1Z00B 4A8EA 2E8MA 4M6WB 4ED1A 2HVHA 4RUAA 4F4ZA 1U49A 1BPZA 2ASDA 1ZQIA 3HWTA 2FE9A 4KX3A 2O6KA 1GO3F 2AGPA 2Y0SF 1SV4A 4PHPA 2WFAA 4CGZA 5AICA 5KFYA 1ZQDA 9ICPA 4GFJA 3HKZC 5KL1B 2ALZA 1NOMA 5F9NA 5J0TA 4BXOA 2HHUA 3TAPA 1Q3UA 3RAXA 2PFQA 4FS1A 3TACB 5EWGA 4KLLA 3EWAA 2WF9A 2Z7JA 4DLGA 1L3SA 4P0QA 1QLNA 4RQ8A 4F3OA 1T7PA 2I5HA 4CNQA 2BCVA 5EE9A 2LM1A 2OM6A 4PHEA 2XVTA 1L8LA 2XI9A 2XO7A 1ZQAA 3TFSA 3SAFA 4F4KA 2YMPA 4I2EA 2DF4B 4O3SA 1N60A 4RQMA 2HBJA 5KT7A 1COKA 1TAMA 2DKZA 3IN5A 1XC9A 4OJ6A 1RZTA 3Q8RB 4ZOHC 4C80A 3CP8A 4Y2JA 2HSZA 2BR0A 3WKEA 5AKZA 3JPSA 4RNMA 9ICKA 1FEZA 2BDPA 8ICOA 4B6JA 4DSEA 3HT3A 3UMCA 4IR9A 1ZQMA 4Y2TA 1NJWA 1NNLA 4F4XA 1ZQ1C 4F71A 4EYIB 2DFLA 4DL2A 1PK3A 4J03A 4JUZA 5DQGA 4C8OA 2J6TA 4C7ZA 2VJ4A 1WUDA 2ATLA 5DKWA 2MUTA 1JMSA 2W43A 5KFPA 4NLCA 3LK9A 1T4GA 1NK5A 3VC8A 3FAHA 3IDWA 4ACOA 3C1YA 4UB2A 2F3NA 1WWUA 2P6UA 4ED8A 2BCSA 4Q43A 4DOAA 2Y1IA 4BGDA 2PMZF 2MRLA 2VANA 3SYZA 2KJ8A 3GIKA 7ICTA 3TFRA 4M0AA 5E79U 8ICJA 2EAOA 2R8IA 5ALZA 3RH6A 4RQ3A 4YXMA 2DKXA 3ZDCA 4DFJA 5HMLA 3KZIU 4RT2A 4YG2A 1WCNA 3D6JA 4DEZA 5J0UA 3MGIA 4FZMA 2VJ5A 4ED3A 2W9CA 4R66A 2ODGA 3PSPA 5IILA 5D49A 4Q8EA 3G6XA 1S0NA 1RDFA 3RR8A 8ICQA 4RNOA 4YR0A 3MDAA 4IQWA 1MSWD 5J0RA 5CHGA 3N7PD 4QZHA 2GWSA 2WHEA 4ED7A 3IM1A 4NV0A 1MN8A 2ZXHA 5AM4A 4F8RA 1ZQLA 2Q0ZX 2K4EA 3MFIA 4KLJA 1N48A 5BOMA 1S77D 5ALIA 5KT4A 5DB8A 3N97B 3JPQA 1TFRA 5KFSA 4R8UB 2HHXA 5AK6A 3PX6A 4E0DA 2VKQA 3QUBA 4GLXA 8ICSA 4OJPA 4F2SA 1NK4A 2IBKA 2G5IB 1QQ7A 1Z3EB 4EELA 3M6KA 2EAPA 3KFUF 5JUMA 4I2HA 2FPKA 3NVWA 4UB5A 3PR4A 4F5QA 8ICNA 4RQ0A 2E5SA 2B21A 1NI3A 4KITB 4ECUA 2W8KA 3ZDAA 2YMLA 3F5EA 4RQ4A 1L7OA 1ZD5A 4ICAA 1T3QA 1SZPA 3ETRA 4X5VA 2E8NA 4EX7A 5TZVA 2JEJA 2OXOA 2KSOA 4M9JA 1S0OA 4O5EA 3QXGA 3PW2A 3AU6A 3FC4A 1D8LA 3C23A 3RH5A 5H2FU 3AUOA 2W7OA 2OEHA 3T79A 5KG3A 4B9NA 3MR6A 2V4RA 1YZ7A 3HW8A 2V9WA 3Q8QB 4RT3A 2KKVA 3PY8A 4FS2A 4M6WA 2F8LA 5KFKA 3RJIA 3LWMA 4ELUA 2GLEA 1NK8A 4C8LA 1X9MA 2I9GA 1SL2A 1CI4A 2KMDA 3GIIA 5DG8A 2XY6A 1U9LA 3NRZA 3GU3A 2BQ3A 2NRVA 4R65A 1PK1B 1A6SA 1O08A 2XY7A 2W55A 4DSJA 5TISU 4M04A 3SAGA 5HP4A 1Q46A 3KKAA 2VA8A 2AGQA 2BKEA 5ALNA 4F5OA 1RYRA 2HBKA 3GDXA 4YXJA 3G6YA 1QSYA 4RPZA 3H40A 3M9MB 4KLSA 3H7IA 1X9SA 3AQFA 3ICXA 1NKEA 2XC9A 1U4BA 4Z6CA 5KL8B 4QZGA 8ICIA 2LPEA 4QIWF 3N4MB 3AQEA 4G9BA 4CF5A 2KTQA 3U26A 3QE9Y 2HHVA 2KKPA 3SI8A 5DQHA 5KFUA 4RPYA 1MA7A 3RB4A 9ICCA 4YMOA 1SL1A 2YB4A 1X6IA 3WK4A 4NY8A 4PZOA 4QZ9A 4F4YA 3SV4A 1BVSA 3SQIA 3ONNA 3A0BU 4IR1A 1OW5A 4C7YA 4K4GA 4UARA 1RXWA 8ICXA 4OJOA 4WJ3B 7ICLA 3SAHA 1DGJA 4HAIA 3T5KA 2W9BA 4DSFA 2EZZA 7ICFA 1S5LU 4YMNA 1O03A 4DFDA 8ICAA 3KHLA 4KMOB 2ZXIA 1U48A 1B22A 3UMGA 2EAMA 3GV5B 9ICXA 4IRCA 3RJGA 8ICZA 5F9LA 1ZQJA 3PZPA 4UAZA 4DQQA 1RQNA 3CRXA 4DOCA 2ZJAA 3BQTA 4F5RA 4P4MA 4YR3A 2W3RA 5D4BA 1IG6A 2NRWA 3NTUA 5ALKA 2G09A 3PSFA 2MSNA 1VLBA 3SZ2A 2IOHA 2WF5A 1KW4A 1JI7A 2EQYA 3RJKA 4JWMA 3C5FA 1YT3A 2BCUA 2QB1A 5AM2A 1Z1BA 3M1YA 4J9LA 2EDUA 1L7NA 2OYYA 9ICGA 2LKYA 5AKIA 1COOA 4M9GA 3PVXA 4DL4A 2AU0A 8ICFA 4YQWA 1ZJMA 4KLDA 4RUCA 1FFVA 5KT2A 2ZIXB 5AI5A 7ICKA 4GXJA 2ZIVB 4FZNA 2A3VA 2KP7A 5AM1A 8ICWA 2YN4A 2F44A 3HJEA 4NJ8A 2P66A 4ED6A 3ZDBA 5KFWA 5L1KA 3WK5A 2KHVA 5ALPA 5J0WA 5DDMA 3RB0A 2ZUDA 4DL7A 1S76D 4IL6U 2PXIA 3KOOA 8ICCA 3MBYA 4CF4A 2JXJA 1VDVA 5EWFA 1T8EA 1XNSA 3QU9A 5T14A 5ALXA 2I1QA 5AKJA 4F92B 4UATA 1QCKA 5ALHA 3PW5A 1X9WA 1L7PA 4J9OA 5EWEA 1BPEA 2KG5A 1ECWA 2ASJA 5KFGA 1ZXIA 9ICFA 3UQ2A 3C5GA 1KQQA 1XO1A 3RBEA 5D46A 1PVPA 4ECTA 2C22A 4DFKA 1ZQQA 2W9MA 4NM2A 3H0LB 4O5CA 3NS1A 2I6XA 4DS4A 3NVVA 2ZIWB 5AM5A 5KAIU 1B0XA 4QWEA 5A0LA 3GV8B 1ZQNA 3A0HU 3QX7A 4C0ZA 5KFMA 4RQ5A 2KJ9A 1BGXT 5L1IA 2KVSA 5AI0A 5JRTA 4AYBF 2JEGA 2AXTU 2H3IA 1TKDA 3Q8MA 4KLQA 4QZFA 9ICSA 1S0MA 5DGBA 3C1ZA 4TURA 1UT8A 4CRXA 2N1RA 3Q8SB 4QZEA 3ALRA 2JH1A 4M9LA 5J2HA 4ECSA 2KVCA 5KAFU 1X6JA 1S10A 3H4DA 4BDPA 2YY6A 1ZQEA 2H3ZA 1L7MA 5GTIU 2FMQA 3M9NB 1S97A 3M8RA 3DDHA 5KG7A 1QSSA 3QUTA 2BQRA 1PK1A 2KZ3A 4QZDA 1NKCA 3ZD9A 1PVQA 4MFFA 2ZTDA 8ICVA 4QWCA 3SD7A 4JB3A 3IP4B 1ZQXA 3Q8KA 1X9XA 2H3VA 1SKRA 1KKXA 1OUQA 5KFTA 1ZQVA 4F72A 5J2AA 3N28A 3CYMA 3BS5B 1F0MA 5DDYA 2QKQA 3K1RB 4MFAA 4XA5A 1ZYQA 4Q45A 4IQVA 5C0YA 3QUQA 3BJYA 2OWOA 4PJ0U 1Z4NA 2BCRA 5HNKA 5KG0A 3RH4A 4YD2A 4UASA 4EENA 3LDAA 1L8OA 4YN4A 4I2JA 4DL6A 3I76A 3HPOA 3PO5A 2HOFA 7ICNA 2JEFA 2J6UA 1N5WA 2FDRA 2HHTA 8ICLA 3BQ7A 3V7KA 2W54A 1PUZA 3JPNA 3B9JA 4DS5A 3OHAA 4OO1J 2KN7A 3TKAA 4I28A 1FO4A 4ECXA 3H8WA 2FPMA 5DBAA 3H4BA 2EH9A 1N5XA 3RJJA 4B9LA 4NM1A 4DL5A 3C21A 4KLMA 2HMXA 2HOQA 2RLTA 3J81j 5ALTA 4OJ5A 5J0YA 4BJQA 1SXDA 1TAUA 2JMGA 2MA1A 3NUQA 2LI6A 4OD0A 4YCXA 5J2IA 3RJEA 2AJQA 4PZNA 4LZGA 3SENA 2WF6A 2F76X 5KFAA 1SKSA 3WKAA 4GXKA 4DWIA 4MEYA 1S0VA 1XU4A 1UQVA 2LYAA 1RM6C 4FBUA 3V6HA 4G3IA 5EE1A 2E1FA 2NRZA 1NK9A 2KFNA 4J9MA 4XRHA 5KFBA 4U6PA 1TK0A 2HBMA 5DLFA 1M6YA 3H0RB 5KFJA 4LJXA 1KDHA 4FFDA 2FLNA 5B66U 2PFOA 3RFAA 3L5KA 2F1HA 4QZBA 4J9SA 4GC7A 1D9FA 2FMSA 4US9A 1JX4A 1C20A 1X2IA 1JRPA 2GO7A 4Y2PA 5AI6A 1NZBA 5AKLA 2W11A 5B5EU 2DL0A 5KT5A 2Y0SC 5J0QA 3HX0A 2CPRA 2BQUA 1MQ3A 1ZRNA 2JH7A 3EUB2 4MEXA 2LYBA 4UB3A 5KTQA 4C8MA 3TADC 1ZQGA 1S9FA 1WCLA 4TUPA 5J2BA 4XQ8A 5KT6A 2FLLA 3H8MA 2IHMA 2W7PA 5L1MA 3RJFA 4YMMA 3WK6A 5DB9A 4PGXA 4NLNA 3MC1A 2XGPA 1A76A 1QQ6A 9ICQA 1NJYA 3QEBZ 1NJXA 4DQPA 3MR2A 8ICPA 4O3RA 4I29A 1MC8A 1Z4OA 5DG7A 1NK0A 2R8KA 5C5JA 4GC6A 1J2NA 2WB1F 3TI0A 1FIQA 4KLEA 4RQ6A 3AEVA 3GIMA 3QU2A 1UA1A 3RJHA 4K4IA 3PNCA 3ISCA 4KLFA 5KFOA 1NK6A 3I28A 1KTQA 3EYZA 2KICA 7ICJA 2BDUA 4LVSA 4JV0A 4Y2XA 3IG5A 2GOLA 3IRUA 1TVAA 1L6NA 5J2GA 2HHQA 4JWNA 2E8PA 3PSIA 3TQ1A 9ICJA 4QZAA 4I2CA 4MFCA 1ZQWA 4CF3A 3RRHA 1KN5A 4ECVA 4ED2A 2WTFA 2ZIWA 3BZCA 2P35A 1Z00A 3QYPA 4CE6A 3T5JA 4EZ6A 2B0CA 2V4QA 2DPJA 1ZQKA 1SV0A 1NKBA 3UXOA 1JXLA 1V9PA 2D8CA 3OTQA 4EX6A 4B9TA 1Q8KA 5IIJA 4O3PA 4KN7A 5HHHA 4IQTA 1U45A 1LKYB 5GTHU 9ICOA 2DQNB 2AQ4A 2PMZC 4F2RA 4C4RA 3T5LA 4BXOB 8ICRA 7ICPA 2JZBB 3B0XA 1A0PA 2VIXA 2W04A 1AQ6A 4F91B 3GQCA 2EZYA 2FJ6A 4M9NA 3V72A 4P0QB 3ZDEA 4MF2A 1SB3C 5KT3A 1T94A 3L4PA 5ALFA 2KZMA 3GIJA 3NVYA 5KFVA 3SEIA 2LMRA 1XSNA 3BS5A 2Q4TA 2DBYA 2LM4A 3K75D 2ZTEA 4Y2SA 2G0AA 2XCPA 1C7YA 2XCAA 5J2FA 3IG8A 4DO9A 1D9DA 5IIMA
chains in the Genus database with same CATH topology
1TAMA 2E1FA 3IN5A 3SAHA 2KICA 4OJ6A 2KD1A 3N7PD 2BDUA 2KKVA 3L3FX 1PVQA 2ZIUB 3CP8A 4FZLA 4KX5A 3N7SC 2KV2A 2F8LA 3IP4B 2F2AB 3IG5A 4FE3A 2G06A 2H3VA 4NV0A 1XNSA 5T14A 2K8AA 2GOLA 2ZXHA 3LVWA 1OUQA 1ED1A 1P7DA 2ZG6A 1L6NA 4U6PA 2HBMA 3DEEA 2LBOA 3H0RB 4BX9C 3PSIA 1XO0A 2R18A 3OPXA 3CYMA 3D2SA 2K4EA 1ECWA 2YX8A 2HBLA 3F53A 4QJFB 5C0YA 5CRXA 2KIWA 2ZXIA 3D2NA 3KZXA 4KMOB 2K8BB 2OH2A 4NWIA 3RFAA 2NV3A 1DRGA 2K8CB 2E1EA 3GU3A 1A6SA 3H0MB 1CRXA 1ZQ1C 2ZIWA 2VKQA 3PSTA 3LVVA 2KEYA 4OJPA 3PZPA 1Q3VA 4U7CA 1NZBA 2CN1A 5HR7A 4A8EA 3F2CA 3SAGA 2YB1A 1SZHA 2G5IB 3RF9A 3F5AA 3CRXA 1PVRA 2HOFA 3O0FA 2LHTA 2CRXA 2Y0SC 1F44A 2K89A 1KBUA 2WAQF 2CPRA 2W03A 1PVPA 2HBKA 3M6KA 3LYSA 3KFUF 2VJ4A 2JH7A 4KX3A 2G09A 4NLBA 1WUDA 2LYBA 1GO3F 3H0LB 3PSFA 3AQFA 3C28A 2Y0SF 3ICXA 4QIWC 4OO1J 3AL0B 4P0PA 2E5SA 5KL8B 4CGZA 4NLCA 1YT3A 2G5HB 1IIPA 2ZIWB 4CDGA 3C29A 4QIWF 1Z1BA 2DQNB 2XIDA 3VC8A 4GFJA 3F2DA 3HKZC 3M7DA 3AQEA 4ACOA 3K1ZA 5KL1B 2WAQC 3F2BA 2PMZC 3F5EA 3VCBA 5A0LA 4QNLA 2H3QA 2OYYA 2KOBA 2KKPA 2LKYA 4C0ZA 4IC9A 2KNJA 2HMXA 3HKZF 4PL2A 4AYBC 1Q3UA 4JMUA 2KJ9A 2HOQA 2W7PA 1A0PA 1MA7A 2VIXA 3E0FA 2PMZF 2MRLA 2W04A 2RP5A 2KJ8A 4ICAA 2JGAA 4OJ5A 3M6ZA 4BJQA 3D2QA 1UPHA 2XICA 2Z7JA 2G08A 2ZIXB 4AYBF 2JMGA 2MA1A 3NUQA 2ZIXA 4P0QB 4PL1A 4P0QA 2ZIVB 4FZNA 2KJ5A 2H3IA 2WB1C 1HEKA 2ZIVA 2A3VA 3GZFA 4P0PB 1URJA 2YB4A 3SMVA 2KHQA 1HIWA 2OXOA 2ZIUA 1T94A 2F76X 4CRXA 2N1RA 2OM6A 2WB1F 4FZMA 2F77X 2XVTA 3SQIA 2XI9A 3ALRA 3ONNA 2JH1A 4O3MA 2HOIA 2RHFA 2VJ5A 2KVCA 4OJLA 2G07A 3PSPA 2KHVA 3SAFA 1Z19A 2H3ZA 2GH1A 2Q4TA 2DF4B 2K4HA 2D6FC 2W7OA 2LYAA 2G0AA 2HBJA 2DGZA 2JHDA 3T79A 2K4IA 3NRWA 4OJOA 4WJ3B 5HR6A 4BUGA 3IG8A 2M0NA 2RRDA 2H3FA 3N7RC 3MGVA 1D8BA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2K89 A;  2K8B B;  2K8A A;  3PST A;  3L3F X;  2K8C B;  3PSP A; 
#chains in the Genus database with same CATH topology
 5ALU A;  5KG2 A;  1UHU A;  4ELT A;  2YTU A;  3OHB A;  5ALD A;  4FZL A;  4KX5 A;  4PHA A;  3V7J A;  4US8 A;  3ISD A;  2B6G A;  2QB0 B;  2YQE A;  3BQ0 A;  3V6K A;  1N61 A;  4DFP A;  1SIJ A;  1LV5 A;  3UXP A;  1B43 A;  4JV2 A;  4UAV A;  9ICM A;  3HP6 A;  3PST A;  3LVV A;  2KEY A;  4YR2 A;  5ALJ A;  1ZQC A;  3F2C A;  4RU9 A;  2KFZ A;  1YZ6 A;  4YP3 A;  4QWB A;  1TAQ A;  3JPR A;  2CRX A;  4B9M A;  3GV7 B;  3FM9 A;  4DSL A;  5IIN A;  3V6J A;  1EXN A;  1L3U A;  1QQ5 A;  2MUT B;  3MAB A;  5KFX A;  1IIP A;  3FDS A;  3F2D A;  3RTV A;  3M7D A;  3VCB A;  2BPG A;  4ECZ A;  2KOB A;  2HDO A;  3MGH A;  4IC9 A;  5DGA A;  4PL2 A;  3HKZ F;  5G5H A;  5ALW A;  2RP5 A;  3MDC A;  2JGA A;  2ZJ8 A;  2W9A A;  1UPH A;  4F5N A;  3OSN A;  8ICE A;  2KJ5 A;  2AH5 A;  4QZC A;  4O3Q A;  1DK3 A;  5KFQ A;  3SMV A;  4TQR A;  4EEY A;  1MQ2 A;  5EE0 A;  5J2E A;  3EZ5 A;  4CCH A;  4ECQ A;  4BWM A;  2Y1J A;  3ZD8 A;  4TUQ A;  7ICR A;  3AU2 A;  4O3M A;  2HOI A;  1DXS A;  3WK8 A;  2ISO A;  2W9C B;  1UCV A;  5ALR A;  1BNP A;  2G07 A;  3RB6 A;  2K4H A;  1KSP A;  4DL3 A;  2DGZ A;  2VA2 A;  2UVV A;  1PZN A;  2RRD A;  9ICW A;  5J0O A;  3M8S A;  3L3F X;  2ZIU B;  4DOB A;  2YMM A;  1CEZ A;  3OJU A;  4KLI A;  3OJS A;  1SL0 A;  2HHW A;  2R18 A;  3OPX A;  4JV1 A;  2YX8 A;  2FPL A;  2KIW A;  1BPB A;  3C2L A;  5J2C A;  5AKX A;  1L5U A;  4ECR A;  4YFK A;  1T3N A;  4R8U A;  5AI4 A;  5DB7 A;  4P2H A;  1X40 A;  3E58 A;  5KFR A;  3PR5 B;  2LHT A;  2K89 A;  5G5G A;  1X66 A;  5DG9 A;  5IIK A;  5J8Y C;  1SXE A;  3K4G A;  3C28 A;  4B9V A;  4QIW C;  1NZP A;  9ICU A;  3TAQ A;  3C29 A;  3DV9 A;  2XID A;  4J9K A;  3K1Z A;  4IRD A;  1DOQ A;  2WF8 A;  2A1J B;  3PMN A;  4MHV A;  3PW0 A;  3M9O B;  9ICB A;  5J0S A;  1NJZ A;  4TQS A;  2BPF A;  4PL1 A;  2QAR B;  3QEA Z;  4I2B A;  5J2D A;  4I2A A;  4P0P B;  2J6S A;  1H38 A;  2NRX A;  1HIW A;  1N62 A;  1Y88 A;  2RHF A;  2HI0 A;  4UAY A;  2A19 A;  1ZD3 A;  2D6F C;  5KFC A;  2JHD A;  3GFK B;  4I2G A;  2K4I A;  1N2X A;  3CNH A;  3OGU A;  5HR6 A;  1D8B A;  7ICI A;  1LVH A;  4DQI A;  2OHF A;  5AKE A;  1J97 A;  2WF7 A;  4O3N A;  2JV3 A;  3MFH A;  1F5S A;  2KV2 A;  3EPI A;  5ALO A;  1U47 A;  7ICV A;  5HMM A;  2E3T A;  3RAQ A;  2HBL A;  4UB4 A;  3PO4 A;  1V85 A;  5KG4 A;  4QJF B;  3G6V A;  2VA3 A;  4PH5 A;  4F5P A;  2K8B B;  1ZQR A;  4QWA A;  1SGG A;  9ICH A;  1LKY A;  3UM9 A;  5FP0 A;  4Z6F A;  5AIA A;  2E8O A;  2YB1 A;  2PFN A;  4I2D A;  2DPI A;  3CW2 C;  4IQU A;  2JZB A;  3LYS A;  9ICI A;  2ESE A;  4I2I A;  3TAD A;  3RRG A;  4O3O A;  4C8N A;  2A1A A;  2ZJ5 A;  4NL9 C;  4F50 A;  5KFF A;  3RR7 A;  1SKW A;  4YVZ A;  1WWV A;  1KRP A;  2HHS A;  2WAQ C;  2H3Q A;  5KFE A;  5ALV A;  3WKB A;  4F4W A;  1Z1V A;  5EE3 A;  4RNN A;  2HCF A;  1KLN A;  3M6Z A;  3ZDD A;  2F8K A;  1J2M A;  1UT5 A;  2CXY A;  5L1L A;  4M2Y A;  4IS7 A;  1HEK A;  3WKC A;  2KHQ A;  2IHN A;  5III A;  8ICH A;  5HHI A;  4QZI A;  2MAX A;  2F77 X;  1RXV A;  9ICE A;  4OJL A;  4DFM A;  2QB0 A;  1CUK A;  4AP9 A;  1NK7 A;  1ZQH A;  3FYH A;  4BUG A;  1ZQY A;  1LB2 B;  5AK3 A;  4DQS A;  3HIL A;  2W9B B;  2W3S A;  3UPQ A;  2XY5 A;  5ALQ A;  4FE3 A;  3KBB A;  5AK4 A;  2ZG6 A;  3ED5 A;  3MR3 A;  1K5O A;  5J0X A;  5KG1 A;  1XO0 A;  1X42 A;  4O0I A;  3D2S A;  4EYH B;  3KZX A;  4Y2U A;  2NYV A;  3KHG A;  5DBC A;  1JIH A;  2K8C B;  2E1E A;  3NAS A;  3H0M B;  4ED0 A;  1SWW A;  3S6J A;  2R8J A;  1ZD2 P;  5HR7 A;  2L5Y A;  3WK7 A;  1SZH A;  4NLK A;  4J9P A;  5ALE A;  4F93 B;  2C2E A;  1ZQF A;  5CWR A;  1KFS A;  1HJP A;  2Y9U A;  5KG5 A;  4C8K A;  1HUZ A;  3AL0 B;  2FI1 A;  5AKY A;  5AKK A;  1BPY A;  4PGY A;  2C28 A;  9ICL A;  4HYK A;  1D8Y A;  3SR6 A;  3PML A;  4QWD A;  8ICY A;  3BDP A;  5J2K A;  4PGQ A;  3H8J A;  4O9M A;  4AYB C;  4JMU A;  4I2F A;  3E0F A;  7ICM A;  9ICA A;  2XIC A;  4EBD A;  1FFU A;  4R63 A;  2PKE A;  2ZIX A;  2OCE A;  4DSI A;  4TUS A;  2ZIV A;  4J9R A;  3QZ8 A;  4NLZ A;  8ICG A;  2M9N A;  2ZIU A;  4DQR A;  1RG6 A;  4J9Q A;  2IA6 A;  3KTQ A;  4UB8 U;  3QU5 A;  2FLP A;  1JUD A;  4RQ7 A;  9ICR A;  5ALL A;  8ICK A;  2K4P A;  1QTM A;  3NRW A;  1DK2 A;  5AM3 A;  3ETL A;  2RDI A;  2KD1 A;  1QH9 A;  3KD3 A;  7ICE A;  4EZ9 A;  4R64 A;  5ALY A;  1ZD4 A;  2F2A B;  3I1Y A;  2HW3 A;  2K8A A;  1P7D A;  1TV9 A;  4BWJ A;  3THV A;  3EW9 A;  2LBO A;  4QW9 A;  1JXE A;  2LYH A;  4KTQ A;  1JRO A;  3E2E A;  3ISB A;  1JAL A;  1KL9 A;  3QUC A;  2UVW A;  3PW7 A;  1DRG A;  4PHD A;  9ICV A;  5IIO A;  2K60 A;  2H5X A;  1CRX A;  2UVR A;  1BPX A;  4U7C A;  1VJ5 A;  2CN1 A;  3BS7 A;  2PI4 A;  3RF9 A;  1ZQU A;  2JEI A;  7ICH A;  2A1J A;  5CJ7 A;  3TAN A;  9ICT A;  3QU4 A;  2MU2 A;  3BQ1 A;  2W03 A;  1TK5 A;  2ISP A;  8ICB A;  5KFH A;  4Q8F A;  4GXI A;  5J2J A;  2QAR A;  4KLU A;  5F3X B;  4P0P A;  2IOF A;  2G5H B;  5AI9 A;  5J29 A;  4J9N A;  5JTI A;  1V97 A;  1L3V A;  3F2B A;  3Q8L A;  1V38 A;  4KLG A;  2KZZ A;  2R8G A;  1KEJ A;  5AKH A;  2UVU A;  5EOZ A;  3RB3 A;  9ICN A;  5KFN A;  5AKG A;  2RDJ A;  3EPG A;  1TE2 A;  4Z6D A;  3UQ0 A;  3GZF A;  4B9U A;  4I27 A;  3IHQ B;  1K1Q A;  1DGS A;  5DQI A;  4LZD A;  1ZET A;  2HVI A;  3HRD D;  2BHN A;  1Z19 A;  2QLT A;  1ZQT A;  5BPC A;  3V7L A;  3WK9 A;  2PI5 A;  4K4H A;  1ARO P;  5AK5 A;  3IV6 A;  2JRZ A;  3H8S A;  5KNI A;  2ZUB A;  4ZH4 A;  3PX4 A;  3OSP A;  8ICU A;  1BPD A;  1RQL A;  1WYG A;  4BX9 C;  3PV8 A;  4P4P A;  4IRK A;  4GIB A;  4O5K A;  1L3T A;  3F53 A;  3RBD A;  2IOF K;  5CRX A;  3T3F A;  2NV3 A;  4EBC A;  3MR5 A;  1QSL A;  1Q3V A;  3AMZ A;  3R9K A;  5DB6 A;  2IMW P;  3Q8P B;  1XSL A;  1F44 A;  1KBU A;  2BCQ A;  4C4T A;  5J8Y A;  2W8L A;  7ICS A;  3GIL A;  1ZQB A;  4UBB A;  4UQG A;  4Z6E A;  5CR0 A;  5ALS A;  4USA A;  4M47 A;  4QNL A;  1SWV A;  5CA7 A;  4Y2V A;  4KN4 A;  2DWQ A;  5KFD A;  2JR5 A;  1JN3 A;  3JPP A;  3D2Q A;  3JPO A;  2G08 A;  4UAW A;  5AM0 A;  2P6R A;  5CEH A;  2WB1 C;  5KG6 A;  1URJ A;  2NO5 A;  4EBE A;  3NGD A;  7ICG A;  2ES6 A;  4UB1 A;  2BZF A;  4Y2R A;  3LWL A;  4C4S A;  4DF4 A;  5BOL A;  2PFP A;  4NXZ A;  4NLG A;  2FMP A;  3T5H A;  4UW9 A;  4DF8 A;  2R8H A;  2ZUC A;  3QNM A;  1RYU A;  3SV3 A;  1ZJN A;  1XS9 D;  2Y9T A;  1ZQP A;  1IV8 A;  5ALM A;  2AQ0 A;  5CP2 A;  4Y2Y A;  1TK8 A;  4ECY A;  3LVW A;  1ED1 A;  1RYS A;  3DEE A;  4DCC A;  4RZR A;  2ASL A;  8ICM A;  1SV0 C;  4Y2Q A;  1ZOL A;  2AHO B;  4KLO A;  3KHH A;  7ICO A;  1KFD A;  3D2N A;  3TAR A;  1B4F A;  2XGQ A;  3QZ7 A;  5DBB A;  3C2M A;  2C2R A;  7ICQ A;  4RQ1 A;  4XUS A;  4KLT A;  4KMU A;  3F5A A;  2F1J A;  3KKA C;  1PVR A;  1K1S A;  4Q44 A;  3O0F A;  3B0Y A;  2WAQ F;  4RPX A;  1KFT A;  4YD1 A;  5K4L A;  4NLB A;  2YMQ A;  3NVZ A;  4NL9 A;  4MF8 A;  4DSK A;  1ZRM A;  2C2D A;  1ZQO A;  4CDG A;  2DUY A;  5CB1 A;  1XSP A;  4UBC A;  2NO4 A;  5JU5 A;  2KNJ A;  4UAU A;  2D3D A;  1BNO A;  2ZTC A;  5J0P A;  2EAN A;  3BQ2 A;  5DLG A;  5ALG A;  1HUO A;  2RQ5 A;  3UMB A;  2BGW A;  1ZQZ A;  3WKD A;  2AGO A;  3C2K A;  3AM9 A;  4OCZ A;  4DLE A;  4EEK A;  4FBT A;  3QU7 A;  4B9S A;  2KIV A;  1ZQS A;  7ICU A;  1S8O A;  2EZX A;  1A77 A;  1N56 A;  4RQN A;  2KK0 A;  3PW4 A;  5AI8 A;  2GH1 A;  4P4O A;  1N63 A;  5KFL A;  4KLH A;  4PPX A;  4FO6 A;  4QW8 A;  3MGV A;  2M0N A;  3N7R C;  2H3F A;  3UXN A;  3JPT A;  2F1I A;  5L9X A;  3BZK A;  5KFI A;  2KSO B;  4UB6 U;  1IM4 A;  3AN1 A;  3N7S C;  1WG8 A;  1XWL A;  1UA0 A;  5KFZ A;  2G06 A;  5AIB A;  3KHR A;  4QZ8 A;  2KE7 A;  1OXJ A;  8ICT A;  5L1J A;  3WU2 U;  4RQ2 A;  1IXR A;  2BPC A;  2NRT A;  4ELV A;  1RPL A;  3PX0 A;  4NWI A;  5AHX A;  2OH2 A;  4JK1 A;  3ZI4 A;  3ORY A;  4M9H A;  4ECW A;  1Z00 B;  4A8E A;  2E8M A;  4M6W B;  4ED1 A;  2HVH A;  4RUA A;  4F4Z A;  1U49 A;  1BPZ A;  2ASD A;  1ZQI A;  3HWT A;  2FE9 A;  4KX3 A;  2O6K A;  1GO3 F;  2AGP A;  2Y0S F;  1SV4 A;  4PHP A;  2WFA A;  4CGZ A;  5AIC A;  5KFY A;  1ZQD A;  9ICP A;  4GFJ A;  3HKZ C;  5KL1 B;  2ALZ A;  1NOM A;  5F9N A;  5J0T A;  4BXO A;  2HHU A;  3TAP A;  1Q3U A;  3RAX A;  2PFQ A;  4FS1 A;  3TAC B;  5EWG A;  4KLL A;  3EWA A;  2WF9 A;  2Z7J A;  4DLG A;  1L3S A;  4P0Q A;  1QLN A;  4RQ8 A;  4F3O A;  1T7P A;  2I5H A;  4CNQ A;  2BCV A;  5EE9 A;  2LM1 A;  2OM6 A;  4PHE A;  2XVT A;  1L8L A;  2XI9 A;  2XO7 A;  1ZQA A;  3TFS A;  3SAF A;  4F4K A;  2YMP A;  4I2E A;  2DF4 B;  4O3S A;  1N60 A;  4RQM A;  2HBJ A;  5KT7 A;  1COK A;  1TAM A;  2DKZ A;  3IN5 A;  1XC9 A;  4OJ6 A;  1RZT A;  3Q8R B;  4ZOH C;  4C80 A;  3CP8 A;  4Y2J A;  2HSZ A;  2BR0 A;  3WKE A;  5AKZ A;  3JPS A;  4RNM A;  9ICK A;  1FEZ A;  2BDP A;  8ICO A;  4B6J A;  4DSE A;  3HT3 A;  3UMC A;  4IR9 A;  1ZQM A;  4Y2T A;  1NJW A;  1NNL A;  4F4X A;  1ZQ1 C;  4F71 A;  4EYI B;  2DFL A;  4DL2 A;  1PK3 A;  4J03 A;  4JUZ A;  5DQG A;  4C8O A;  2J6T A;  4C7Z A;  2VJ4 A;  1WUD A;  2ATL A;  5DKW A;  2MUT A;  1JMS A;  2W43 A;  5KFP A;  4NLC A;  3LK9 A;  1T4G A;  1NK5 A;  3VC8 A;  3FAH A;  3IDW A;  4ACO A;  3C1Y A;  4UB2 A;  2F3N A;  1WWU A;  2P6U A;  4ED8 A;  2BCS A;  4Q43 A;  4DOA A;  2Y1I A;  4BGD A;  2PMZ F;  2MRL A;  2VAN A;  3SYZ A;  2KJ8 A;  3GIK A;  7ICT A;  3TFR A;  4M0A A;  5E79 U;  8ICJ A;  2EAO A;  2R8I A;  5ALZ A;  3RH6 A;  4RQ3 A;  4YXM A;  2DKX A;  3ZDC A;  4DFJ A;  5HML A;  3KZI U;  4RT2 A;  4YG2 A;  1WCN A;  3D6J A;  4DEZ A;  5J0U A;  3MGI A;  4FZM A;  2VJ5 A;  4ED3 A;  2W9C A;  4R66 A;  2ODG A;  3PSP A;  5IIL A;  5D49 A;  4Q8E A;  3G6X A;  1S0N A;  1RDF A;  3RR8 A;  8ICQ A;  4RNO A;  4YR0 A;  3MDA A;  4IQW A;  1MSW D;  5J0R A;  5CHG A;  3N7P D;  4QZH A;  2GWS A;  2WHE A;  4ED7 A;  3IM1 A;  4NV0 A;  1MN8 A;  2ZXH A;  5AM4 A;  4F8R A;  1ZQL A;  2Q0Z X;  2K4E A;  3MFI A;  4KLJ A;  1N48 A;  5BOM A;  1S77 D;  5ALI A;  5KT4 A;  5DB8 A;  3N97 B;  3JPQ A;  1TFR A;  5KFS A;  4R8U B;  2HHX A;  5AK6 A;  3PX6 A;  4E0D A;  2VKQ A;  3QUB A;  4GLX A;  8ICS A;  4OJP A;  4F2S A;  1NK4 A;  2IBK A;  2G5I B;  1QQ7 A;  1Z3E B;  4EEL A;  3M6K A;  2EAP A;  3KFU F;  5JUM A;  4I2H A;  2FPK A;  3NVW A;  4UB5 A;  3PR4 A;  4F5Q A;  8ICN A;  4RQ0 A;  2E5S A;  2B21 A;  1NI3 A;  4KIT B;  4ECU A;  2W8K A;  3ZDA A;  2YML A;  3F5E A;  4RQ4 A;  1L7O A;  1ZD5 A;  4ICA A;  1T3Q A;  1SZP A;  3ETR A;  4X5V A;  2E8N A;  4EX7 A;  5TZV A;  2JEJ A;  2OXO A;  2KSO A;  4M9J A;  1S0O A;  4O5E A;  3QXG A;  3PW2 A;  3AU6 A;  3FC4 A;  1D8L A;  3C23 A;  3RH5 A;  5H2F U;  3AUO A;  2W7O A;  2OEH A;  3T79 A;  5KG3 A;  4B9N A;  3MR6 A;  2V4R A;  1YZ7 A;  3HW8 A;  2V9W A;  3Q8Q B;  4RT3 A;  2KKV A;  3PY8 A;  4FS2 A;  4M6W A;  2F8L A;  5KFK A;  3RJI A;  3LWM A;  4ELU A;  2GLE A;  1NK8 A;  4C8L A;  1X9M A;  2I9G A;  1SL2 A;  1CI4 A;  2KMD A;  3GII A;  5DG8 A;  2XY6 A;  1U9L A;  3NRZ A;  3GU3 A;  2BQ3 A;  2NRV A;  4R65 A;  1PK1 B;  1A6S A;  1O08 A;  2XY7 A;  2W55 A;  4DSJ A;  5TIS U;  4M04 A;  3SAG A;  5HP4 A;  1Q46 A;  3KKA A;  2VA8 A;  2AGQ A;  2BKE A;  5ALN A;  4F5O A;  1RYR A;  2HBK A;  3GDX A;  4YXJ A;  3G6Y A;  1QSY A;  4RPZ A;  3H40 A;  3M9M B;  4KLS A;  3H7I A;  1X9S A;  3AQF A;  3ICX A;  1NKE A;  2XC9 A;  1U4B A;  4Z6C A;  5KL8 B;  4QZG A;  8ICI A;  2LPE A;  4QIW F;  3N4M B;  3AQE A;  4G9B A;  4CF5 A;  2KTQ A;  3U26 A;  3QE9 Y;  2HHV A;  2KKP A;  3SI8 A;  5DQH A;  5KFU A;  4RPY A;  1MA7 A;  3RB4 A;  9ICC A;  4YMO A;  1SL1 A;  2YB4 A;  1X6I A;  3WK4 A;  4NY8 A;  4PZO A;  4QZ9 A;  4F4Y A;  3SV4 A;  1BVS A;  3SQI A;  3ONN A;  3A0B U;  4IR1 A;  1OW5 A;  4C7Y A;  4K4G A;  4UAR A;  1RXW A;  8ICX A;  4OJO A;  4WJ3 B;  7ICL A;  3SAH A;  1DGJ A;  4HAI A;  3T5K A;  2W9B A;  4DSF A;  2EZZ A;  7ICF A;  1S5L U;  4YMN A;  1O03 A;  4DFD A;  8ICA A;  3KHL A;  4KMO B;  2ZXI A;  1U48 A;  1B22 A;  3UMG A;  2EAM A;  3GV5 B;  9ICX A;  4IRC A;  3RJG A;  8ICZ A;  5F9L A;  1ZQJ A;  3PZP A;  4UAZ A;  4DQQ A;  1RQN A;  3CRX A;  4DOC A;  2ZJA A;  3BQT A;  4F5R A;  4P4M A;  4YR3 A;  2W3R A;  5D4B A;  1IG6 A;  2NRW A;  3NTU A;  5ALK A;  2G09 A;  3PSF A;  2MSN A;  1VLB A;  3SZ2 A;  2IOH A;  2WF5 A;  1KW4 A;  1JI7 A;  2EQY A;  3RJK A;  4JWM A;  3C5F A;  1YT3 A;  2BCU A;  2QB1 A;  5AM2 A;  1Z1B A;  3M1Y A;  4J9L A;  2EDU A;  1L7N A;  2OYY A;  9ICG A;  2LKY A;  5AKI A;  1COO A;  4M9G A;  3PVX A;  4DL4 A;  2AU0 A;  8ICF A;  4YQW A;  1ZJM A;  4KLD A;  4RUC A;  1FFV A;  5KT2 A;  2ZIX B;  5AI5 A;  7ICK A;  4GXJ A;  2ZIV B;  4FZN A;  2A3V A;  2KP7 A;  5AM1 A;  8ICW A;  2YN4 A;  2F44 A;  3HJE A;  4NJ8 A;  2P66 A;  4ED6 A;  3ZDB A;  5KFW A;  5L1K A;  3WK5 A;  2KHV A;  5ALP A;  5J0W A;  5DDM A;  3RB0 A;  2ZUD A;  4DL7 A;  1S76 D;  4IL6 U;  2PXI A;  3KOO A;  8ICC A;  3MBY A;  4CF4 A;  2JXJ A;  1VDV A;  5EWF A;  1T8E A;  1XNS A;  3QU9 A;  5T14 A;  5ALX A;  2I1Q A;  5AKJ A;  4F92 B;  4UAT A;  1QCK A;  5ALH A;  3PW5 A;  1X9W A;  1L7P A;  4J9O A;  5EWE A;  1BPE A;  2KG5 A;  1ECW A;  2ASJ A;  5KFG A;  1ZXI A;  9ICF A;  3UQ2 A;  3C5G A;  1KQQ A;  1XO1 A;  3RBE A;  5D46 A;  1PVP A;  4ECT A;  2C22 A;  4DFK A;  1ZQQ A;  2W9M A;  4NM2 A;  3H0L B;  4O5C A;  3NS1 A;  2I6X A;  4DS4 A;  3NVV A;  2ZIW B;  5AM5 A;  5KAI U;  1B0X A;  4QWE A;  5A0L A;  3GV8 B;  1ZQN A;  3A0H U;  3QX7 A;  4C0Z A;  5KFM A;  4RQ5 A;  2KJ9 A;  1BGX T;  5L1I A;  2KVS A;  5AI0 A;  5JRT A;  4AYB F;  2JEG A;  2AXT U;  2H3I A;  1TKD A;  3Q8M A;  4KLQ A;  4QZF A;  9ICS A;  1S0M A;  5DGB A;  3C1Z A;  4TUR A;  1UT8 A;  4CRX A;  2N1R A;  3Q8S B;  4QZE A;  3ALR A;  2JH1 A;  4M9L A;  5J2H A;  4ECS A;  2KVC A;  5KAF U;  1X6J A;  1S10 A;  3H4D A;  4BDP A;  2YY6 A;  1ZQE A;  2H3Z A;  1L7M A;  5GTI U;  2FMQ A;  3M9N B;  1S97 A;  3M8R A;  3DDH A;  5KG7 A;  1QSS A;  3QUT A;  2BQR A;  1PK1 A;  2KZ3 A;  4QZD A;  1NKC A;  3ZD9 A;  1PVQ A;  4MFF A;  2ZTD A;  8ICV A;  4QWC A;  3SD7 A;  4JB3 A;  3IP4 B;  1ZQX A;  3Q8K A;  1X9X A;  2H3V A;  1SKR A;  1KKX A;  1OUQ A;  5KFT A;  1ZQV A;  4F72 A;  5J2A A;  3N28 A;  3CYM A;  3BS5 B;  1F0M A;  5DDY A;  2QKQ A;  3K1R B;  4MFA A;  4XA5 A;  1ZYQ A;  4Q45 A;  4IQV A;  5C0Y A;  3QUQ A;  3BJY A;  2OWO A;  4PJ0 U;  1Z4N A;  2BCR A;  5HNK A;  5KG0 A;  3RH4 A;  4YD2 A;  4UAS A;  4EEN A;  3LDA A;  1L8O A;  4YN4 A;  4I2J A;  4DL6 A;  3I76 A;  3HPO A;  3PO5 A;  2HOF A;  7ICN A;  2JEF A;  2J6U A;  1N5W A;  2FDR A;  2HHT A;  8ICL A;  3BQ7 A;  3V7K A;  2W54 A;  1PUZ A;  3JPN A;  3B9J A;  4DS5 A;  3OHA A;  4OO1 J;  2KN7 A;  3TKA A;  4I28 A;  1FO4 A;  4ECX A;  3H8W A;  2FPM A;  5DBA A;  3H4B A;  2EH9 A;  1N5X A;  3RJJ A;  4B9L A;  4NM1 A;  4DL5 A;  3C21 A;  4KLM A;  2HMX A;  2HOQ A;  2RLT A;  3J81 j;  5ALT A;  4OJ5 A;  5J0Y A;  4BJQ A;  1SXD A;  1TAU A;  2JMG A;  2MA1 A;  3NUQ A;  2LI6 A;  4OD0 A;  4YCX A;  5J2I A;  3RJE A;  2AJQ A;  4PZN A;  4LZG A;  3SEN A;  2WF6 A;  2F76 X;  5KFA A;  1SKS A;  3WKA A;  4GXK A;  4DWI A;  4MEY A;  1S0V A;  1XU4 A;  1UQV A;  2LYA A;  1RM6 C;  4FBU A;  3V6H A;  4G3I A;  5EE1 A;  2E1F A;  2NRZ A;  1NK9 A;  2KFN A;  4J9M A;  4XRH A;  5KFB A;  4U6P A;  1TK0 A;  2HBM A;  5DLF A;  1M6Y A;  3H0R B;  5KFJ A;  4LJX A;  1KDH A;  4FFD A;  2FLN A;  5B66 U;  2PFO A;  3RFA A;  3L5K A;  2F1H A;  4QZB A;  4J9S A;  4GC7 A;  1D9F A;  2FMS A;  4US9 A;  1JX4 A;  1C20 A;  1X2I A;  1JRP A;  2GO7 A;  4Y2P A;  5AI6 A;  1NZB A;  5AKL A;  2W11 A;  5B5E U;  2DL0 A;  5KT5 A;  2Y0S C;  5J0Q A;  3HX0 A;  2CPR A;  2BQU A;  1MQ3 A;  1ZRN A;  2JH7 A;  3EUB 2;  4MEX A;  2LYB A;  4UB3 A;  5KTQ A;  4C8M A;  3TAD C;  1ZQG A;  1S9F A;  1WCL A;  4TUP A;  5J2B A;  4XQ8 A;  5KT6 A;  2FLL A;  3H8M A;  2IHM A;  2W7P A;  5L1M A;  3RJF A;  4YMM A;  3WK6 A;  5DB9 A;  4PGX A;  4NLN A;  3MC1 A;  2XGP A;  1A76 A;  1QQ6 A;  9ICQ A;  1NJY A;  3QEB Z;  1NJX A;  4DQP A;  3MR2 A;  8ICP A;  4O3R A;  4I29 A;  1MC8 A;  1Z4O A;  5DG7 A;  1NK0 A;  2R8K A;  5C5J A;  4GC6 A;  1J2N A;  2WB1 F;  3TI0 A;  1FIQ A;  4KLE A;  4RQ6 A;  3AEV A;  3GIM A;  3QU2 A;  1UA1 A;  3RJH A;  4K4I A;  3PNC A;  3ISC A;  4KLF A;  5KFO A;  1NK6 A;  3I28 A;  1KTQ A;  3EYZ A;  2KIC A;  7ICJ A;  2BDU A;  4LVS A;  4JV0 A;  4Y2X A;  3IG5 A;  2GOL A;  3IRU A;  1TVA A;  1L6N A;  5J2G A;  2HHQ A;  4JWN A;  2E8P A;  3PSI A;  3TQ1 A;  9ICJ A;  4QZA A;  4I2C A;  4MFC A;  1ZQW A;  4CF3 A;  3RRH A;  1KN5 A;  4ECV A;  4ED2 A;  2WTF A;  2ZIW A;  3BZC A;  2P35 A;  1Z00 A;  3QYP A;  4CE6 A;  3T5J A;  4EZ6 A;  2B0C A;  2V4Q A;  2DPJ A;  1ZQK A;  1SV0 A;  1NKB A;  3UXO A;  1JXL A;  1V9P A;  2D8C A;  3OTQ A;  4EX6 A;  4B9T A;  1Q8K A;  5IIJ A;  4O3P A;  4KN7 A;  5HHH A;  4IQT A;  1U45 A;  1LKY B;  5GTH U;  9ICO A;  2DQN B;  2AQ4 A;  2PMZ C;  4F2R A;  4C4R A;  3T5L A;  4BXO B;  8ICR A;  7ICP A;  2JZB B;  3B0X A;  1A0P A;  2VIX A;  2W04 A;  1AQ6 A;  4F91 B;  3GQC A;  2EZY A;  2FJ6 A;  4M9N A;  3V72 A;  4P0Q B;  3ZDE A;  4MF2 A;  1SB3 C;  5KT3 A;  1T94 A;  3L4P A;  5ALF A;  2KZM A;  3GIJ A;  3NVY A;  5KFV A;  3SEI A;  2LMR A;  1XSN A;  3BS5 A;  2Q4T A;  2DBY A;  2LM4 A;  3K75 D;  2ZTE A;  4Y2S A;  2G0A A;  2XCP A;  1C7Y A;  2XCA A;  5J2F A;  3IG8 A;  4DO9 A;  1D9D A;  5IIM A; 
#chains in the Genus database with same CATH homology
 1TAM A;  2E1F A;  3IN5 A;  3SAH A;  2KIC A;  4OJ6 A;  2KD1 A;  3N7P D;  2BDU A;  2KKV A;  3L3F X;  1PVQ A;  2ZIU B;  3CP8 A;  4FZL A;  4KX5 A;  3N7S C;  2KV2 A;  2F8L A;  3IP4 B;  2F2A B;  3IG5 A;  4FE3 A;  2G06 A;  2H3V A;  4NV0 A;  1XNS A;  5T14 A;  2K8A A;  2GOL A;  2ZXH A;  3LVW A;  1OUQ A;  1ED1 A;  1P7D A;  2ZG6 A;  1L6N A;  4U6P A;  2HBM A;  3DEE A;  2LBO A;  3H0R B;  4BX9 C;  3PSI A;  1XO0 A;  2R18 A;  3OPX A;  3CYM A;  3D2S A;  2K4E A;  1ECW A;  2YX8 A;  2HBL A;  3F53 A;  4QJF B;  5C0Y A;  5CRX A;  2KIW A;  2ZXI A;  3D2N A;  3KZX A;  4KMO B;  2K8B B;  2OH2 A;  4NWI A;  3RFA A;  2NV3 A;  1DRG A;  2K8C B;  2E1E A;  3GU3 A;  1A6S A;  3H0M B;  1CRX A;  1ZQ1 C;  2ZIW A;  2VKQ A;  3PST A;  3LVV A;  2KEY A;  4OJP A;  3PZP A;  1Q3V A;  4U7C A;  1NZB A;  2CN1 A;  5HR7 A;  4A8E A;  3F2C A;  3SAG A;  2YB1 A;  1SZH A;  2G5I B;  3RF9 A;  3F5A A;  3CRX A;  1PVR A;  2HOF A;  3O0F A;  2LHT A;  2CRX A;  2Y0S C;  1F44 A;  2K89 A;  1KBU A;  2WAQ F;  2CPR A;  2W03 A;  1PVP A;  2HBK A;  3M6K A;  3LYS A;  3KFU F;  2VJ4 A;  2JH7 A;  4KX3 A;  2G09 A;  4NLB A;  1WUD A;  2LYB A;  1GO3 F;  3H0L B;  3PSF A;  3AQF A;  3C28 A;  2Y0S F;  3ICX A;  4QIW C;  4OO1 J;  3AL0 B;  4P0P A;  2E5S A;  5KL8 B;  4CGZ A;  4NLC A;  1YT3 A;  2G5H B;  1IIP A;  2ZIW B;  4CDG A;  3C29 A;  4QIW F;  1Z1B A;  2DQN B;  2XID A;  3VC8 A;  4GFJ A;  3F2D A;  3HKZ C;  3M7D A;  3AQE A;  4ACO A;  3K1Z A;  5KL1 B;  2WAQ C;  3F2B A;  2PMZ C;  3F5E A;  3VCB A;  5A0L A;  4QNL A;  2H3Q A;  2OYY A;  2KOB A;  2KKP A;  2LKY A;  4C0Z A;  4IC9 A;  2KNJ A;  2HMX A;  3HKZ F;  4PL2 A;  4AYB C;  1Q3U A;  4JMU A;  2KJ9 A;  2HOQ A;  2W7P A;  1A0P A;  1MA7 A;  2VIX A;  3E0F A;  2PMZ F;  2MRL A;  2W04 A;  2RP5 A;  2KJ8 A;  4ICA A;  2JGA A;  4OJ5 A;  3M6Z A;  4BJQ A;  3D2Q A;  1UPH A;  2XIC A;  2Z7J A;  2G08 A;  2ZIX B;  4AYB F;  2JMG A;  2MA1 A;  3NUQ A;  2ZIX A;  4P0Q B;  4PL1 A;  4P0Q A;  2ZIV B;  4FZN A;  2KJ5 A;  2H3I A;  2WB1 C;  1HEK A;  2ZIV A;  2A3V A;  3GZF A;  4P0P B;  1URJ A;  2YB4 A;  3SMV A;  2KHQ A;  1HIW A;  2OXO A;  2ZIU A;  1T94 A;  2F76 X;  4CRX A;  2N1R A;  2OM6 A;  2WB1 F;  4FZM A;  2F77 X;  2XVT A;  3SQI A;  2XI9 A;  3ALR A;  3ONN A;  2JH1 A;  4O3M A;  2HOI A;  2RHF A;  2VJ5 A;  2KVC A;  4OJL A;  2G07 A;  3PSP A;  2KHV A;  3SAF A;  1Z19 A;  2H3Z A;  2GH1 A;  2Q4T A;  2DF4 B;  2K4H A;  2D6F C;  2W7O A;  2LYA A;  2G0A A;  2HBJ A;  2DGZ A;  2JHD A;  3T79 A;  2K4I A;  3NRW A;  4OJO A;  4WJ3 B;  5HR6 A;  4BUG A;  3IG8 A;  2M0N A;  2RRD A;  2H3F A;  3N7R C;  3MGV A;  1D8B A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...