2K8BB

Solution structure of plaa family ubiquitin binding domain (pfuc) cis isomer in complex with ubiquitin
Total Genus 16
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
16
sequence length
80
structure length
80
Chain Sequence
ANQQTSGKVLYEGKEFDYVFSIDVNEGGPSYKLPYNTSDDPWLTAYNFLQKNDLNPMFLDQVAKFIIDNTKGQMLGLGNP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural Basis for Ubiquitin Recognition by a Novel Domain from Human Phospholipase A2-activating Protein.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Protein binding
molecule keywords Ubiquitin
total genus 16
structure length 80
sequence length 80
ec nomenclature
pdb deposition date 2008-09-04
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.410 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 DNA polymerase; domain 1 2k8bB00
2K89A 3PSTA 3L3FX 2K8CB 3PSPA 2K8BB 2K8AA
chains in the Genus database with same CATH superfamily
4Y2XA 3ORYA 3RRHA 2B0CA 5AK5A 1SWWA 1S0OA 2ZXIA 5KL8B 3RRGA 1ZJNA 4J9KA 4KLQA 1DOQA 4NV0A 4C7ZA 4O3OA 4F91B 2D6FC 1S0VA 5DG9A 8ICXA 4G9BA 1J2NA 4YMNA 3RB4A 5KT7A 4M9NA 4I2BA 4NJ8A 4DS4A 3H4BA 3H0LB 4JUZA 1WWVA 2BQ3A 4Q43A 3A0BU 1QQ7A 1U9LA 5AK4A 3IDWA 8ICPA 2JV3A 1JXEA 3RFAA 7ICUA 1Z4NA 2IHNA 2HW3A 1L8LA 2KMDA 1DRGA 2MRLA 9ICWA 2W04A 4ACOA 2RP5A 2IMWP 2A1JB 5AKGA 2R8HA 7ICLA 3V7KA 2YTUA 4IL6U 5DQHA 2XGPA 1TFRA 5L1IA 3AMZA 1SB3C 9ICEA 4AYBC 5J2EA 4UBCA 2FMPA 2YB4A 5AM3A 3SYZA 1QSYA 3OSPA 4XRHA 1T3NA 5J0WA 5AIAA 1LKYA 1V85A 5KFRA 4KTQA 4Y2RA 2XCPA 2K8AA 1DGSA 5ALQA 2QARB 2W8LA 3C28A 2ASDA 3NVYA 5J0XA 4DF8A 4QZIA 2PMZF 2VJ5A 2JGAA 2OXOA 3GFKB 1YZ7A 3KZIU 1H38A 1X9SA 2ZIUA 5AKKA 5EWGA 3RJJA 4DSLA 5J2AA 3DEEA 5T14A 1X42A 4UB5A 4M2YA 5KFLA 4IC9A 5J2IA 5KFVA 3QUBA 2ZTEA 3QUCA 4XA5A 3ALRA 3QU4A 1Y88A 4PH5A 5AHXA 3C29A 2ALZA 3RJHA 5B66U 4PHAA 2DUYA 4TUSA 3LVWA 3KTQA 5IINA 1BPDA 3KHHA 4C8OA 4Y2YA 2KG5A 9ICTA 9ICIA 1Z4OA 2PKEA 3AL0B 4IR1A 2FPLA 3PZPA 4OD0A 5CB1A 2WAQF 3BZCA 4DSEA 1NKEA 2H3VA 2BCVA 3PY8A 2HOIA 5HR7A 3QZ7A 2FLLA 3VC8A 3UQ2A 5H2FU 3H7IA 1T94A 3T3FA 4GXIA 4KLTA 2CPRA 3WK5A 8ICGA 3RBDA 4IRKA 4YXMA 1S8OA 3CW2C 3RR8A 2V4QA 4GXKA 2KJ8A 1BGXT 1ZQEA 4OJ5A 3WK8A 4EEYA 4PJ0U 2OHFA 2QKQA 9ICGA 1HUOA 2ISOA 4J9PA 5B5EU 4K4GA 2ZUDA 2ZIXB 5G5HA 4DFDA 3PX4A 3WKDA 3T5HA 2E1EA 4QWBA 3EW9A 4ELUA 4MF8A 1JXLA 5G5GA 1ZJMA 4Q44A 3SAHA 5KT6A 4B6JA 3F2DA 4F71A 1RQLA 1NZBA 2DKXA 5KL1B 3SZ2A 4R65A 3BS7A 3QEAZ 1KSPA 2KVSA 4ECRA 5CJ7A 3ETRA 2XC9A 4KLGA 3HILA 3RJGA 1Q3VA 3ED5A 2KIVA 3NTUA 1L7PA 1XU4A 1BPBA 4DL5A 2F8KA 2G09A 3ISDA 4Q45A 2GLEA 2E8MA 1ZQSA 4RU9A 5AIBA 3HKZC 4M6WA 1TAMA 5AKLA 2DKZA 4C80A 3WK4A 4MFCA 2KSOA 2BHNA 3EWAA 4NLCA 1U48A 2PFNA 4PHEA 3C1ZA 5DB8A 3E2EA 3UQ0A 3JPTA 5KFMA 4RQ2A 2WB1C 4I2AA 4KLDA 1QSSA 3TFSA 3AN1A 2W3RA 1ZQCA 3QX7A 4P0PB 3M1YA 5KFYA 3RAQA 2PXIA 4KMUA 1DK2A 3G6VA 1UQVA 3IHQB 5DG7A 1ZQJA 4MHVA 8ICOA 4J9NA 3Q8MA 9ICBA 4NM1A 2ZIXA 5IIJA 2KN7A 4P0QB 3OHAA 1S97A 1NJYA 1XC9A 4E0DA 2PMZC 1RYRA 3SAFA 1ZD5A 2F8LA 3QU9A 5TISU 2YQEA 4DEZA 3WU2U 2YY6A 2B6GA 3RJKA 3FAHA 5ALYA 4KLJA 2FE9A 3OPXA 2NRXA 3HWTA 3CNHA 5F3XB 3KZXA 4RQ1A 4GXJA 1JI7A 8ICBA 4EBEA 7ICTA 4F4KA 4YD1A 1RYUA 3ZD9A 1MQ2A 1COOA 5AM2A 1K1QA 5FP0A 4M6WB 2CN1A 5ALEA 4TQRA 4RUAA 5J2GA 2FPKA 4IR9A 4F8RA 4Y2TA 1Z00B 4JWNA 2LYBA 2BDUA 4PZOA 3UM9A 8ICCA 5IIOA 3NRZA 5AKIA 3N7PD 4P0PA 3O0FA 2LHTA 4ECUA 2LI6A 9ICSA 1P7DA 8ICAA 4R8UB 1PVRA 1V38A 2KICA 1TAQA 1U47A 4ECQA 4DFJA 4ECZA 3BQ7A 4YR3A 3NASA 4DQRA 4BJQA 3WKBA 4PHPA 2BDPA 2MSNA 1D9DA 4B9LA 2EANA 1ZQ1C 2BCUA 4UAVA 2HHTA 2JR5A 2RDJA 5JUMA 3GILA 1PK1B 1L7OA 2WF5A 4O5EA 1WG8A 1IIPA 2JEGA 2EZZA 2AXTU 1S0NA 1X40A 5KG2A 5KG5A 5HNKA 3MBYA 5BPCA 1B43A 4DF4A 2F76X 5ALVA 2K4EA 1ZQTA 2BPCA 3AEVA 4X5VA 3DV9A 4I2GA 4BUGA 2YN4A 5F9LA 3B0XA 2KZMA 2JZBA 3M7DA 2EH9A 1XSLA 3MABA 8ICKA 3LK9A 5J0YA 4DL7A 4EEKA 4DSKA 5JU5A 7ICSA 3PMNA 2K4HA 4PGXA 2VANA 3KKAC 5DBCA 4ED2A 5AK6A 1QQ6A 3S6JA 1N60A 2XI9A 4DFPA 1KFTA 4QZBA 2K4IA 3FDSA 1RXWA 1B4FA 3M6ZA 5J8YC 2IOHA 8ICYA 3KOOA 3K75D 2NO5A 4J9QA 2W11A 3MGHA 5EOZA 3QNMA 1SIJA 3PNCA 4M0AA 5HHHA 4RPYA 1RDFA 4DO9A 4DQSA 4O3RA 8ICWA 4UB2A 1ZQMA 4QIWF 1PK1A 7ICEA 1OUQA 3QZ8A 1NNLA 3RJFA 5KNIA 3JPQA 5KTQA 5AI8A 4UB1A 2ZIVA 1X6IA 1N62A 1T7PA 4PL1A 3TI0A 3D2SA 7ICRA 8ICNA 2J6SA 3GDXA 9ICOA 2EZYA 1SXDA 5DQGA 3AQFA 9ICNA 2W7PA 1MC8A 1KRPA 4EZ6A 1VJ5A 4MFAA 4F5OA 1PK3A 1UT5A 1TV9A 1D9FA 3KBBA 3MFHA 3IP4B 1B22A 5AM1A 2ZTDA 2RDIA 4YVZA 2NV3A 3A0HU 2PI4A 1K1SA 2I9GA 2I5HA 2H3ZA 5ALSA 2IOFK 5EE0A 5J2JA 3QE9Y 1KFSA 5HP4A 4FE3A 2JEFA 5IIMA 5ALHA 4CF4A 3Q8QB 5CP2A 4RPZA 3EZ5A 3V6HA 4FZMA 4B9MA 9ICLA 3WKCA 3BZKA 1GO3F 4PHDA 2XIDA 4J9OA 4P4MA 3C23A 2EZXA 4NWIA 5AI9A 3G6XA 3GV8B 4FBTA 2AQ4A 3TAQA 1C20A 1PUZA 4ECXA 2MUTB 3PVXA 3BQTA 1WUDA 2VJ4A 4C8LA 4MEYA 5ALGA 2CRXA 5AI5A 3CYMA 5KFQA 9ICJA 8ICSA 4TUQA 4CCHA 2KHVA 5DLFA 2G5IB 4YMOA 2VIXA 4O9MA 3NS1A 5DQIA 3RB3A 2WTFA 4RT2A 5BOMA 1ZQNA 5J2HA 8ICEA 4QZGA 3B0YA 5KG7A 5J0QA 4IRCA 7ICFA 4O3NA 3QUQA 5ALDA 5AI4A 2PI5A 2W9CA 9ICCA 2IOFA 4QIWC 4GC6A 5AK3A 3JPNA 4F4XA 2HHUA 3HPOA 7ICOA 2KVCA 1UCVA 2B21A 3F5EA 3ETLA 4UATA 4PGQA 1RXVA 3T5KA 4BX9C 4DLGA 3JPPA 1ZXIA 4RQ5A 3H8MA 3NVZA 5GTIU 1ZQYA 5DGAA 2VA8A 4QWAA 4RQNA 2EAOA 2MUTA 1L7NA 1SGGA 2KKVA 8ICJA 2JH7A 2UVRA 1D8BA 3Q8RB 3KHLA 4P0QA 1KTQA 8ICFA 2K89A 4Y2VA 5KFEA 4M04A 1WWUA 7ICPA 2WF8A 3CP8A 5JRTA 2ASLA 2VA2A 1KLNA 7ICJA 2RHFA 1Q46A 2DGZA 1ZQIA 1UPHA 2F77X 5J0OA 5KFDA 9ICQA 1SL2A 2K8BB 1K5OA 4CDGA 1B0XA 1JRPA 1ZQPA 7ICMA 3T5JA 2G0AA 2W9CB 4U7CA 3ZDAA 1AQ6A 4B9UA 3KKAA 4MEXA 3H8SA 4RNNA 3RAXA 3IN5A 3F53A 3GIJA 9ICVA 1JX4A 4KLLA 3GQCA 5D4BA 1SL1A 3PSFA 1TE2A 3ZI4A 4JK1A 1VLBA 1D8YA 1F5SA 1QLNA 4Y2JA 3KFUF 2XVTA 1ZQLA 1Z00A 3IRUA 2RLTA 2QB1A 2E8NA 4QZAA 2KOBA 4FZNA 3PW5A 5KFTA 4ECTA 3ZD8A 4NM2A 2HBMA 4MF2A 1IM4A 4PL2A 4NL9C 8ICMA 2Y0SC 3RJIA 3PMLA 1NKCA 2OEHA 1N5XA 4GLXA 3IG8A 2Y1IA 4O3PA 3V72A 4USAA 2NRTA 4R8UA 1X9XA 3OTQA 1QTMA 5DB6A 4XUSA 4IQWA 1OW5A 2LKYA 2EDUA 3SD7A 2FLNA 3GU3A 2IA6A 5BOLA 1XSPA 4RQ4A 2AQ0A 1L5UA 1T4GA 1TAUA 2LPEA 2XY5A 7ICHA 5HMMA 5J29A 3ZDBA 2KK0A 1KFDA 3QUTA 1FFVA 1WCNA 4IQTA 4DOAA 1BNPA 2KZ3A 2N1RA 3E58A 5IIKA 4I29A 3TARA 3PR5B 2C22A 4NLZA 4F5NA 2GH1A 5ALNA 1EXNA 5KG4A 1SXEA 4DSIA 5KFXA 2JZBB 5C5JA 1FO4A 2Q4TA 1SV0A 2W43A 3ISCA 5CEHA 4O5CA 2MU2A 2V4RA 3WKAA 3IM1A 2DFLA 1ZETA 2F2AB 5AKXA 5J2BA 2FLPA 4P4PA 4EYIB 4QZEA 2MAXA 2FI1A 2OWOA 3HKZF 1SKRA 1ZQDA 5AKJA 1SV0C 2WFAA 3MR2A 1N63A 1ZQWA 3KHGA 1XS9D 3N97B 2H3IA 3ICXA 3PW7A 5EE9A 5KG1A 4MFFA 8ICZA 4BGDA 1X66A 5ALKA 4DSFA 1BVSA 4YR0A 3AU2A 2FMSA 5KFBA 5KT5A 2VKQA 2XO7A 1CUKA 4P2HA 2YMMA 2J6UA 2ZIVB 3KD3A 2HSZA 5DDYA 4KLHA 3FC4A 4KITB 4PZNA 3H40A 5KFAA 1DGJA 4NLBA 2K60A 4QWDA 4RQ0A 2F1HA 4ED8A 4FO6A 1Z1BA 2BQRA 3EPIA 1AROP 1FIQA 2HOFA 5AI0A 4Z6CA 5ALOA 2JEJA 1A6SA 3H0RB 3JPSA 2RQ5A 1M6YA 2HHVA 3N7SC 2AHOB 1A0PA 3UMCA 4RQ3A 4XQ8A 5DBAA 4C4RA 4LJXA 9ICHA 5KFFA 4LVSA 4FFDA 9ICFA 4BDPA 4NXZA 2OYYA 1SWVA 1S0MA 5D49A 1N56A 1F0MA 4F5QA 5J8YA 5J2KA 4C0ZA 1ZQHA 1PZNA 5IIIA 4B9SA 1L3VA 2AJQA 3TQ1A 1U4BA 8ICIA 2HHQA 2J6TA 1YZ6A 1KL9A 5L1LA 2ZG6A 4B9TA 2M9NA 8ICVA 1JIHA 2ZJ8A 4EELA 2LYAA 3RTVA 1L3UA 3C5GA 5C0YA 4BWMA 1ED1A 4TURA 3QU2A 4BXOA 2F1JA 2KFZA 2KKPA 3LVVA 3H4DA 2PFQA 4J9SA 3TADC 4KLMA 4EBDA 3N4MB 5IILA 4Z6FA 5ALFA 1ZQVA 2BCRA 5ALXA 5KT3A 1SV4A 2E8PA 3F2BA 1S76D 4ED3A 1TKDA 2UVUA 3NRWA 9ICRA 3LWLA 4ELTA 3HJEA 2R8JA 4RZRA 3Q8PB 4UB8U 1DXSA 1HJPA 2ZUBA 5AKZA 1O03A 3ONNA 1VDVA 2ZIWA 4UARA 5EWEA 1Z19A 2KD1A 2O6KA 3DDHA 5AKEA 4TUPA 4FS1A 3N7RC 1S10A 4OO1J 5HHIA 4UB4A 1ZQUA 5E79U 3GZFA 3MR3A 3UMBA 2Y9TA 4NLKA 3PX0A 5AM0A 2BCSA 4YCXA 4RNOA 1WYGA 1ZQZA 4F5PA 4FS2A 4KLSA 2AU0A 4OJ6A 4PPXA 4DLEA 3NVWA 4QW8A 4Y2UA 1ZQFA 3D6JA 2F44A 3N28A 4Z6DA 5KFWA 4ZH4A 4KLUA 2H3QA 5KT2A 3L3FX 4DWIA 2HCFA 2JRZA 4DS5A 5J0SA 1NKBA 3E0FA 4YD2A 1URJA 3LYSA 4RT3A 3MR6A 2NRVA 4C8NA 2AGOA 2WHEA 4YR2A 3M9OB 3HX0A 2H3FA 4ICAA 3VCBA 5KFOA 4UB6U 3ZDEA 3ZDCA 2FPMA 4I2HA 4CF3A 2ZIWB 3HW8A 5KFSA 3RR7A 2ESEA 3HT3A 3QU5A 5KAIU 1NK8A 2QLTA 1L8OA 5JTIA 3J81j 8ICUA 2W7OA 3I76A 3TKAA 4O3SA 4DFKA 2ZJAA 3T5LA 3EPGA 5KG0A 4KLOA 3B9JA 2ODGA 2NRZA 4F5RA 2HVHA 2F3NA 3AQEA 7ICNA 3GIMA 2BQUA 1N2XA 1ZRMA 4F2SA 2I6XA 4DFMA 3WKEA 9ICPA 2R8GA 2G08A 4G3IA 4US8A 4M9GA 2GWSA 3PSPA 2A1AA 3UXNA 4QJFB 1N5WA 3PO5A 3V6JA 2P6UA 2LBOA 3BQ0A 3HRDD 4UQGA 2YMPA 4U6PA 2L5YA 5CHGA 5CA7A 4OCZA 5A0LA 4ED6A 1QQ5A 2HHWA 1J2MA 4RQ8A 4A8EA 5ALIA 3MGIA 4F4WA 5ALUA 1CEZA 3R9KA 3SR6A 1UA1A 1Q8KA 1FFUA 2VA3A 3EUB2 5ALRA 4K4IA 5D46A 2WF9A 2Y1JA 3MGVA 1BNOA 5J2CA 1ZQRA 5KFPA 2BCQA 4JB3A 1RG6A 4YQWA 1KQQA 4Q8FA 3GIIA 3UXOA 2C2RA 5KFJA 2YB1A 3H0MB 1ZQAA 2F1IA 1NK4A 4FBUA 4UAWA 3RH4A 1KBUA 2QB0A 3UXPA 3Q8LA 3HP6A 1NK5A 5ALPA 3RH5A 4J9RA 2K8CB 1SL0A 2HOQA 3RB0A 1U49A 1S9FA 4F93B 2ZUCA 4YN4A 5L1MA 1QH9A 1J97A 4ECYA 4NLGA 4QZCA 1UA0A 1TK8A 8ICTA 1N61A 1NJWA 2XCAA 2NO4A 1MSWD 2D3DA 1LVHA 4C7YA 2ZJ5A 4DOBA 2XGQA 2E3TA 4DQPA 3V6KA 2BR0A 4CRXA 2IHMA 4QZHA 1L3TA 2W55A 5EE1A 1ZYQA 4EENA 5KFIA 4ECWA 2W3SA 1X2IA 2C2EA 1BPEA 2IBKA 2A3VA 3D2QA 3SQIA 3NUQA 4LZDA 4KN7A 5DB7A 2I1QA 3M9MB 7ICGA 1DK3A 2DPJA 3WK7A 5ALTA 4CF5A 1SZPA 1V9PA 1WCLA 2YMLA 4QWCA 4UW9A 2R18A 2KTQA 4PGYA 1XWLA 1NK0A 3OHBA 4J9MA 3NVVA 1SZHA 3EYZA 5ALZA 4M9LA 4P4OA 5J2DA 3MR5A 2MA1A 2KFNA 1NOMA 2OH2A 4DL2A 4IQUA 3L4PA 4IQVA 1KW4A 2QB0B 4AYBF 1ZOLA 4KX5A 1BPYA 5HR6A 3I1YA 2AGQA 4F50A 4QZDA 1SKSA 3TACB 3BS5B 4QW9A 3F5AA 1C7YA 1XO0A 4C4SA 1QCKA 4YP3A 1JALA 4YG2A 4EZ9A 1A77A 1TVAA 9ICMA 3C21A 2EAMA 2FDRA 1ZQBA 2LM1A 4KLFA 2OCEA 3MC1A 4KN4A 3OJUA 3C2LA 4BXOB 2KZZA 5DKWA 4I2DA 3FM9A 2R8IA 1BPZA 2R8KA 4JMUA 4DL3A 9ICXA 4RQ6A 4JV2A 1IXRA 3RBEA 1ZQQA 4DQQA 2G06A 3C1YA 5J0RA 4O0IA 4Z6EA 8ICLA 2HHSA 4R63A 4WJ3B 1JN3A 4I28A 4F2RA 1KN5A 5DG8A 3JPRA 9ICAA 1COKA 1NZPA 4R64A 4C8KA 3SEIA 1IG6A 2KNJA 4J9LA 5J2FA 3K1ZA 1KDHA 5EE3A 1O08A 2KHQA 2AH5A 2HDOA 2HBJA 5DB9A 2AGPA 5J0PA 2UVVA 2W9MA 1RZTA 5DDMA 5L1JA 4RPXA 3SENA 5KG3A 4EBCA 3PV8A 4RQ7A 3PO4A 2ISPA 3BS5A 1ZQKA 1NJZA 1ZD2P 4B9NA 1X6JA 1ZQOA 2GO7A 1ZQGA 4YFKA 4EX6A 1RPLA 3TFRA 1TK5A 4EYHB 3RH6A 5KFKA 5L9XA 5AI6A 2HBKA 3M8RA 1T3QA 4ECSA 3ZDDA 1PVPA 4F4YA 2YMQA 4ZOHC 2WAQC 1CI4A 4HAIA 5KFGA 3OSNA 4DQIA 4Y2PA 4M9HA 2ZTCA 5AM4A 3WK6A 5ALJA 3GV5B 3BDPA 2K4PA 8ICHA 2KEYA 4I2CA 3AUOA 3PW2A 3UPQA 4O5KA 2DF4B 5KG6A 3LWMA 3PW0A 1QSLA 3PR4A 4DOCA 5CWRA 4Y2SA 8ICRA 7ICVA 4O3QA 4HYKA 2EQYA 4I2FA 3RB6A 1ZD4A 4NL9A 4OJPA 5AM5A 1OXJA 3SAGA 4RNMA 4O3MA 4ED0A 2E8OA 4KMOB 2GOLA 1NJXA 5KFUA 1YT3A 2WF7A 3U26A 1BPXA 4I2JA 5DLGA 3TADA 1NI3A 2KIWA 1X9MA 5L1KA 3H8WA 4QNLA 2KJ5A 4JV1A 4OJOA 4YXJA 4CE6A 5HMLA 3PSTA 2Z7JA 5DBBA 1KEJA 5GTHU 3THVA 4KX3A 2KE7A 1NK9A 2PFPA 3K1RB 4LZGA 1RYSA 2FJ6A 1L6NA 2G07A 2ZXHA 4DL4A 2HBLA 2A19A 2DL0A 1F44A 4DSJA 1V97A 3V7LA 4IS7A 1LKYB 1JROA 2XY7A 1S5LU 4QZ8A 1ECWA 4B9VA 1D8LA 1RM6C 2QARA 4DL6A 5CR0A 4F72A 4I27A 4UASA 4KLEA 1MA7A 3SI8A 7ICQA 3Q8KA 4ED1A 4C8MA 5J0UA 2Y0SF 2W03A 1MN8A 2G5HB 4CNQA 4K4HA 2LM4A 2PFOA 1TK0A 3OGUA 2ZIUB 4I2EA 4JWMA 3IG5A 2JHDA 3MFIA 2KP7A 4FZLA 3M9NB 1A76A 2XICA 4UBBA 1S77D 1CRXA 5KFNA 2JH1A 3MDCA 3QEBZ 2W8KA 3SMVA 1PVQA 1Q3UA 2E1FA 2W9AA 2UVWA 2LMRA 2DQNB 2E5SA 2Y9UA 4UAZA 2V9WA 3RJEA 4GIBA 4GFJA 2W54A 2BGWA 4C4TA 4ELVA 5AKHA 3SV3A 2JEIA 2KJ9A 5AICA 2KV2A 5KFHA 2RRDA 5KT4A 4RUCA 1FEZA 3OJSA 5K4LA 4Y2QA 3BQ2A 4EX7A 4UAYA 1RQNA 3AU6A 3PW4A 2Q0ZX 3AM9A 2BPGA 2EAPA 4F92B 1Z1VA 3CRXA 3G6YA 3FYHA 2JMGA 4US9A 5CRXA 3F2CA 1UHUA 3QXGA 3BQ1A 8ICQA 2DWQA 3IV6A 3M6KA 4QWEA 5KFCA 2DBYA 4CGZA 1KKXA 2DPIA 4JV0A 2W9BB 3V7JA 1LV5A 1LB2B 1ZD3A 2YX8A 3TAPA 1XNSA 1T8EA 5ALWA 2ATLA 9ICUA 3PSIA 3KHRA 1HIWA 4YMMA 2CXYA 4OJLA 3GV7B 2NYVA 1XO1A 3BJYA 1JUDA 3RF9A 1SKWA 5TZVA 3M8SA 1JMSA 2D8CA 4TQSA 1UT8A 4R66A 2M0NA 3NGDA 3UMGA 2HMXA 5ALLA 1MQ3A 5ALMA 2KSOB 3L5KA 2JXJA 4M9JA 3TANA 1ZQXA 3I28A 2BZFA 5KFZA 4DCCA 2P6RA 5EWFA 4ED7A 4J03A 2FMQA 2BKEA 4IRDA 2NRWA 1L7MA 5J0TA 4I2IA 3MDAA 7ICIA 9ICKA 2OM6A 2HHXA 3C2MA 4NY8A 3H8JA 5AKYA 1U45A 4ECVA 1NK7A 3D2NA 2W9BA 4KLIA 2HVIA 2C2DA 1ZRNA 5DGBA 1HEKA 1XSNA 2LYHA 2HI0A 3QU7A 2WF6A 7ICKA 2BPFA 1Z3EB 4NLNA 3C2KA 3C5FA 2P35A 4QZFA 2XY6A 4RQMA 3PX6A 1X9WA 1L3SA 3QYPA 4Q8EA 4AP9A 3Q8SB 2H5XA 4BWJA 1NK6A 3JPOA 3K4GA 5KAFU 1HUZA 4F4ZA 1N48A 4UAUA 2C28A 4M47A 3ISBA 2ES6A 2A1JA 4GC7A 4F3OA 3T79A 2ASJA 3LDAA 1IV8A 3GIKA 2WB1F 3SV4A 4QZ9A 2P66A 3WK9A 4UB3A 5F9NA
chains in the Genus database with same CATH topology
2K89A 2HOQA 3M7DA 2JH1A 3N7SC 3ONNA 2DF4B 2E1EA 4FZMA 4JMUA 1A0PA 2ZIWA 3C28A 1GO3F 2XIDA 2N1RA 1Z19A 3SMVA 1PVQA 3CP8A 1Q3UA 2PMZF 2VJ5A 2JGAA 2KD1A 4NWIA 3D2SA 2M0NA 2OXOA 3AQEA 2ZXIA 2K4HA 2RHFA 3N7RC 2E1FA 2G06A 5KL8B 2ZIUA 3SAHA 2DGZA 4OO1J 2DQNB 2E5SA 2GH1A 3F2DA 1WUDA 2HMXA 4OJPA 2VJ4A 3DEEA 2CN1A 5T14A 2XI9A 4CRXA 1UPHA 2K4IA 2F77X 4GFJA 3GZFA 3SAGA 1NZBA 4WJ3B 5KL1B 4O3MA 4IC9A 2K8BB 2G08A 4NV0A 2CRXA 4KMOB 3ALRA 2GOLA 3CYMA 2OYYA 3M6ZA 4CDGA 2D6FC 1YT3A 2Q4TA 3PSPA 2A3VA 3D2QA 2LYBA 2G0AA 2BDUA 3SQIA 3NUQA 2KJ9A 2KHVA 2KNJA 2KV2A 4QJFB 4U7CA 1Q3VA 3C29A 2G5IB 2LBOA 3K1ZA 2VIXA 2RRDA 1L6NA 4OJ6A 4C0ZA 2KIWA 2G09A 2KHQA 3LVWA 5C0YA 3H0LB 2HBJA 4QNLA 2KJ5A 3IN5A 4U6PA 3F53A 3N7PD 2F2AB 4OJOA 4P0PA 3HKZC 3O0FA 2R18A 5CRXA 1TAMA 2LHTA 1CRXA 3PSFA 5A0LA 3PSTA 2OM6A 2Z7JA 1P7DA 3HKZF 4NLCA 2H3QA 4QIWF 3KFUF 1PVRA 2XVTA 3D2NA 2KICA 4KX3A 1OUQA 1SZHA 3L3FX 4A8EA 2ZG6A 3RFAA 1HEKA 2KOBA 2WB1C 3CRXA 3AL0B 4BJQA 3E0FA 2ZIVA 2LYAA 4FZNA 2JMGA 2H3IA 1URJA 2G07A 2MA1A 2ZXHA 3ICXA 3LYSA 4PL1A 4QIWC 3PZPA 1DRGA 2WAQF 2OH2A 2MRLA 2W04A 4ACOA 2HBMA 1ZQ1C 2HBLA 2RP5A 3F2CA 1F44A 4P0PB 4PL2A 2H3VA 2KVCA 2Y0SC 3AQFA 2HOIA 2W7PA 5HR7A 3M6KA 3IG8A 3MGVA 4AYBF 1ED1A 4KX5A 3F5EA 3VC8A 4CGZA 5HR6A 1T94A 1ECWA 2H3FA 1IIPA 4ICAA 3VCBA 2KKPA 2ZIXA 4AYBC 3LVVA 4P0QB 2CPRA 2YX8A 2LKYA 3IP4B 2HBKA 2VKQA 2YB4A 1XNSA 3F5AA 2PMZC 2ZIVB 3GU3A 1XO0A 2ZIWB 2YB1A 4BX9C 3SAFA 1MA7A 2NV3A 1PVPA 3H0MB 2WAQC 3PSIA 2F8LA 1HIWA 4NLBA 2KJ8A 2Y0SF 2W03A 2H3ZA 3F2BA 2F76X 2G5HB 2K4EA 4OJ5A 4OJLA 1Z1BA 1KBUA 2W7OA 3T79A 3NRWA 2ZIUB 3IG5A 2JHDA 3OPXA 2HOFA 3RF9A 2KKVA 2JH7A 2WB1F 4FZLA 2KEYA 2K8CB 4BUGA 2ZIXB 1D8BA 4FE3A 2XICA 3KZXA 4P0QA 2K8AA 1A6SA 3H0RB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2K89 A;  3PST A;  3L3F X;  2K8C B;  3PSP A;  2K8B B;  2K8A A; 
#chains in the Genus database with same CATH topology
 4Y2X A;  3ORY A;  3RRH A;  2B0C A;  5AK5 A;  1SWW A;  1S0O A;  2ZXI A;  5KL8 B;  3RRG A;  1ZJN A;  4J9K A;  4KLQ A;  1DOQ A;  4NV0 A;  4C7Z A;  4O3O A;  4F91 B;  2D6F C;  1S0V A;  5DG9 A;  8ICX A;  4G9B A;  1J2N A;  4YMN A;  3RB4 A;  5KT7 A;  4M9N A;  4I2B A;  4NJ8 A;  4DS4 A;  3H4B A;  3H0L B;  4JUZ A;  1WWV A;  2BQ3 A;  4Q43 A;  3A0B U;  1QQ7 A;  1U9L A;  5AK4 A;  3IDW A;  8ICP A;  2JV3 A;  1JXE A;  3RFA A;  7ICU A;  1Z4N A;  2IHN A;  2HW3 A;  1L8L A;  2KMD A;  1DRG A;  2MRL A;  9ICW A;  2W04 A;  4ACO A;  2RP5 A;  2IMW P;  2A1J B;  5AKG A;  2R8H A;  7ICL A;  3V7K A;  2YTU A;  4IL6 U;  5DQH A;  2XGP A;  1TFR A;  5L1I A;  3AMZ A;  1SB3 C;  9ICE A;  4AYB C;  5J2E A;  4UBC A;  2FMP A;  2YB4 A;  5AM3 A;  3SYZ A;  1QSY A;  3OSP A;  4XRH A;  1T3N A;  5J0W A;  5AIA A;  1LKY A;  1V85 A;  5KFR A;  4KTQ A;  4Y2R A;  2XCP A;  2K8A A;  1DGS A;  5ALQ A;  2QAR B;  2W8L A;  3C28 A;  2ASD A;  3NVY A;  5J0X A;  4DF8 A;  4QZI A;  2PMZ F;  2VJ5 A;  2JGA A;  2OXO A;  3GFK B;  1YZ7 A;  3KZI U;  1H38 A;  1X9S A;  2ZIU A;  5AKK A;  5EWG A;  3RJJ A;  4DSL A;  5J2A A;  3DEE A;  5T14 A;  1X42 A;  4UB5 A;  4M2Y A;  5KFL A;  4IC9 A;  5J2I A;  5KFV A;  3QUB A;  2ZTE A;  3QUC A;  4XA5 A;  3ALR A;  3QU4 A;  1Y88 A;  4PH5 A;  5AHX A;  3C29 A;  2ALZ A;  3RJH A;  5B66 U;  4PHA A;  2DUY A;  4TUS A;  3LVW A;  3KTQ A;  5IIN A;  1BPD A;  3KHH A;  4C8O A;  4Y2Y A;  2KG5 A;  9ICT A;  9ICI A;  1Z4O A;  2PKE A;  3AL0 B;  4IR1 A;  2FPL A;  3PZP A;  4OD0 A;  5CB1 A;  2WAQ F;  3BZC A;  4DSE A;  1NKE A;  2H3V A;  2BCV A;  3PY8 A;  2HOI A;  5HR7 A;  3QZ7 A;  2FLL A;  3VC8 A;  3UQ2 A;  5H2F U;  3H7I A;  1T94 A;  3T3F A;  4GXI A;  4KLT A;  2CPR A;  3WK5 A;  8ICG A;  3RBD A;  4IRK A;  4YXM A;  1S8O A;  3CW2 C;  3RR8 A;  2V4Q A;  4GXK A;  2KJ8 A;  1BGX T;  1ZQE A;  4OJ5 A;  3WK8 A;  4EEY A;  4PJ0 U;  2OHF A;  2QKQ A;  9ICG A;  1HUO A;  2ISO A;  4J9P A;  5B5E U;  4K4G A;  2ZUD A;  2ZIX B;  5G5H A;  4DFD A;  3PX4 A;  3WKD A;  3T5H A;  2E1E A;  4QWB A;  3EW9 A;  4ELU A;  4MF8 A;  1JXL A;  5G5G A;  1ZJM A;  4Q44 A;  3SAH A;  5KT6 A;  4B6J A;  3F2D A;  4F71 A;  1RQL A;  1NZB A;  2DKX A;  5KL1 B;  3SZ2 A;  4R65 A;  3BS7 A;  3QEA Z;  1KSP A;  2KVS A;  4ECR A;  5CJ7 A;  3ETR A;  2XC9 A;  4KLG A;  3HIL A;  3RJG A;  1Q3V A;  3ED5 A;  2KIV A;  3NTU A;  1L7P A;  1XU4 A;  1BPB A;  4DL5 A;  2F8K A;  2G09 A;  3ISD A;  4Q45 A;  2GLE A;  2E8M A;  1ZQS A;  4RU9 A;  5AIB A;  3HKZ C;  4M6W A;  1TAM A;  5AKL A;  2DKZ A;  4C80 A;  3WK4 A;  4MFC A;  2KSO A;  2BHN A;  3EWA A;  4NLC A;  1U48 A;  2PFN A;  4PHE A;  3C1Z A;  5DB8 A;  3E2E A;  3UQ0 A;  3JPT A;  5KFM A;  4RQ2 A;  2WB1 C;  4I2A A;  4KLD A;  1QSS A;  3TFS A;  3AN1 A;  2W3R A;  1ZQC A;  3QX7 A;  4P0P B;  3M1Y A;  5KFY A;  3RAQ A;  2PXI A;  4KMU A;  1DK2 A;  3G6V A;  1UQV A;  3IHQ B;  5DG7 A;  1ZQJ A;  4MHV A;  8ICO A;  4J9N A;  3Q8M A;  9ICB A;  4NM1 A;  2ZIX A;  5IIJ A;  2KN7 A;  4P0Q B;  3OHA A;  1S97 A;  1NJY A;  1XC9 A;  4E0D A;  2PMZ C;  1RYR A;  3SAF A;  1ZD5 A;  2F8L A;  3QU9 A;  5TIS U;  2YQE A;  4DEZ A;  3WU2 U;  2YY6 A;  2B6G A;  3RJK A;  3FAH A;  5ALY A;  4KLJ A;  2FE9 A;  3OPX A;  2NRX A;  3HWT A;  3CNH A;  5F3X B;  3KZX A;  4RQ1 A;  4GXJ A;  1JI7 A;  8ICB A;  4EBE A;  7ICT A;  4F4K A;  4YD1 A;  1RYU A;  3ZD9 A;  1MQ2 A;  1COO A;  5AM2 A;  1K1Q A;  5FP0 A;  4M6W B;  2CN1 A;  5ALE A;  4TQR A;  4RUA A;  5J2G A;  2FPK A;  4IR9 A;  4F8R A;  4Y2T A;  1Z00 B;  4JWN A;  2LYB A;  2BDU A;  4PZO A;  3UM9 A;  8ICC A;  5IIO A;  3NRZ A;  5AKI A;  3N7P D;  4P0P A;  3O0F A;  2LHT A;  4ECU A;  2LI6 A;  9ICS A;  1P7D A;  8ICA A;  4R8U B;  1PVR A;  1V38 A;  2KIC A;  1TAQ A;  1U47 A;  4ECQ A;  4DFJ A;  4ECZ A;  3BQ7 A;  4YR3 A;  3NAS A;  4DQR A;  4BJQ A;  3WKB A;  4PHP A;  2BDP A;  2MSN A;  1D9D A;  4B9L A;  2EAN A;  1ZQ1 C;  2BCU A;  4UAV A;  2HHT A;  2JR5 A;  2RDJ A;  5JUM A;  3GIL A;  1PK1 B;  1L7O A;  2WF5 A;  4O5E A;  1WG8 A;  1IIP A;  2JEG A;  2EZZ A;  2AXT U;  1S0N A;  1X40 A;  5KG2 A;  5KG5 A;  5HNK A;  3MBY A;  5BPC A;  1B43 A;  4DF4 A;  2F76 X;  5ALV A;  2K4E A;  1ZQT A;  2BPC A;  3AEV A;  4X5V A;  3DV9 A;  4I2G A;  4BUG A;  2YN4 A;  5F9L A;  3B0X A;  2KZM A;  2JZB A;  3M7D A;  2EH9 A;  1XSL A;  3MAB A;  8ICK A;  3LK9 A;  5J0Y A;  4DL7 A;  4EEK A;  4DSK A;  5JU5 A;  7ICS A;  3PMN A;  2K4H A;  4PGX A;  2VAN A;  3KKA C;  5DBC A;  4ED2 A;  5AK6 A;  1QQ6 A;  3S6J A;  1N60 A;  2XI9 A;  4DFP A;  1KFT A;  4QZB A;  2K4I A;  3FDS A;  1RXW A;  1B4F A;  3M6Z A;  5J8Y C;  2IOH A;  8ICY A;  3KOO A;  3K75 D;  2NO5 A;  4J9Q A;  2W11 A;  3MGH A;  5EOZ A;  3QNM A;  1SIJ A;  3PNC A;  4M0A A;  5HHH A;  4RPY A;  1RDF A;  4DO9 A;  4DQS A;  4O3R A;  8ICW A;  4UB2 A;  1ZQM A;  4QIW F;  1PK1 A;  7ICE A;  1OUQ A;  3QZ8 A;  1NNL A;  3RJF A;  5KNI A;  3JPQ A;  5KTQ A;  5AI8 A;  4UB1 A;  2ZIV A;  1X6I A;  1N62 A;  1T7P A;  4PL1 A;  3TI0 A;  3D2S A;  7ICR A;  8ICN A;  2J6S A;  3GDX A;  9ICO A;  2EZY A;  1SXD A;  5DQG A;  3AQF A;  9ICN A;  2W7P A;  1MC8 A;  1KRP A;  4EZ6 A;  1VJ5 A;  4MFA A;  4F5O A;  1PK3 A;  1UT5 A;  1TV9 A;  1D9F A;  3KBB A;  3MFH A;  3IP4 B;  1B22 A;  5AM1 A;  2ZTD A;  2RDI A;  4YVZ A;  2NV3 A;  3A0H U;  2PI4 A;  1K1S A;  2I9G A;  2I5H A;  2H3Z A;  5ALS A;  2IOF K;  5EE0 A;  5J2J A;  3QE9 Y;  1KFS A;  5HP4 A;  4FE3 A;  2JEF A;  5IIM A;  5ALH A;  4CF4 A;  3Q8Q B;  5CP2 A;  4RPZ A;  3EZ5 A;  3V6H A;  4FZM A;  4B9M A;  9ICL A;  3WKC A;  3BZK A;  1GO3 F;  4PHD A;  2XID A;  4J9O A;  4P4M A;  3C23 A;  2EZX A;  4NWI A;  5AI9 A;  3G6X A;  3GV8 B;  4FBT A;  2AQ4 A;  3TAQ A;  1C20 A;  1PUZ A;  4ECX A;  2MUT B;  3PVX A;  3BQT A;  1WUD A;  2VJ4 A;  4C8L A;  4MEY A;  5ALG A;  2CRX A;  5AI5 A;  3CYM A;  5KFQ A;  9ICJ A;  8ICS A;  4TUQ A;  4CCH A;  2KHV A;  5DLF A;  2G5I B;  4YMO A;  2VIX A;  4O9M A;  3NS1 A;  5DQI A;  3RB3 A;  2WTF A;  4RT2 A;  5BOM A;  1ZQN A;  5J2H A;  8ICE A;  4QZG A;  3B0Y A;  5KG7 A;  5J0Q A;  4IRC A;  7ICF A;  4O3N A;  3QUQ A;  5ALD A;  5AI4 A;  2PI5 A;  2W9C A;  9ICC A;  2IOF A;  4QIW C;  4GC6 A;  5AK3 A;  3JPN A;  4F4X A;  2HHU A;  3HPO A;  7ICO A;  2KVC A;  1UCV A;  2B21 A;  3F5E A;  3ETL A;  4UAT A;  4PGQ A;  1RXV A;  3T5K A;  4BX9 C;  4DLG A;  3JPP A;  1ZXI A;  4RQ5 A;  3H8M A;  3NVZ A;  5GTI U;  1ZQY A;  5DGA A;  2VA8 A;  4QWA A;  4RQN A;  2EAO A;  2MUT A;  1L7N A;  1SGG A;  2KKV A;  8ICJ A;  2JH7 A;  2UVR A;  1D8B A;  3Q8R B;  3KHL A;  4P0Q A;  1KTQ A;  8ICF A;  2K89 A;  4Y2V A;  5KFE A;  4M04 A;  1WWU A;  7ICP A;  2WF8 A;  3CP8 A;  5JRT A;  2ASL A;  2VA2 A;  1KLN A;  7ICJ A;  2RHF A;  1Q46 A;  2DGZ A;  1ZQI A;  1UPH A;  2F77 X;  5J0O A;  5KFD A;  9ICQ A;  1SL2 A;  2K8B B;  1K5O A;  4CDG A;  1B0X A;  1JRP A;  1ZQP A;  7ICM A;  3T5J A;  2G0A A;  2W9C B;  4U7C A;  3ZDA A;  1AQ6 A;  4B9U A;  3KKA A;  4MEX A;  3H8S A;  4RNN A;  3RAX A;  3IN5 A;  3F53 A;  3GIJ A;  9ICV A;  1JX4 A;  4KLL A;  3GQC A;  5D4B A;  1SL1 A;  3PSF A;  1TE2 A;  3ZI4 A;  4JK1 A;  1VLB A;  1D8Y A;  1F5S A;  1QLN A;  4Y2J A;  3KFU F;  2XVT A;  1ZQL A;  1Z00 A;  3IRU A;  2RLT A;  2QB1 A;  2E8N A;  4QZA A;  2KOB A;  4FZN A;  3PW5 A;  5KFT A;  4ECT A;  3ZD8 A;  4NM2 A;  2HBM A;  4MF2 A;  1IM4 A;  4PL2 A;  4NL9 C;  8ICM A;  2Y0S C;  3RJI A;  3PML A;  1NKC A;  2OEH A;  1N5X A;  4GLX A;  3IG8 A;  2Y1I A;  4O3P A;  3V72 A;  4USA A;  2NRT A;  4R8U A;  1X9X A;  3OTQ A;  1QTM A;  5DB6 A;  4XUS A;  4IQW A;  1OW5 A;  2LKY A;  2EDU A;  3SD7 A;  2FLN A;  3GU3 A;  2IA6 A;  5BOL A;  1XSP A;  4RQ4 A;  2AQ0 A;  1L5U A;  1T4G A;  1TAU A;  2LPE A;  2XY5 A;  7ICH A;  5HMM A;  5J29 A;  3ZDB A;  2KK0 A;  1KFD A;  3QUT A;  1FFV A;  1WCN A;  4IQT A;  4DOA A;  1BNP A;  2KZ3 A;  2N1R A;  3E58 A;  5IIK A;  4I29 A;  3TAR A;  3PR5 B;  2C22 A;  4NLZ A;  4F5N A;  2GH1 A;  5ALN A;  1EXN A;  5KG4 A;  1SXE A;  4DSI A;  5KFX A;  2JZB B;  5C5J A;  1FO4 A;  2Q4T A;  1SV0 A;  2W43 A;  3ISC A;  5CEH A;  4O5C A;  2MU2 A;  2V4R A;  3WKA A;  3IM1 A;  2DFL A;  1ZET A;  2F2A B;  5AKX A;  5J2B A;  2FLP A;  4P4P A;  4EYI B;  4QZE A;  2MAX A;  2FI1 A;  2OWO A;  3HKZ F;  1SKR A;  1ZQD A;  5AKJ A;  1SV0 C;  2WFA A;  3MR2 A;  1N63 A;  1ZQW A;  3KHG A;  1XS9 D;  3N97 B;  2H3I A;  3ICX A;  3PW7 A;  5EE9 A;  5KG1 A;  4MFF A;  8ICZ A;  4BGD A;  1X66 A;  5ALK A;  4DSF A;  1BVS A;  4YR0 A;  3AU2 A;  2FMS A;  5KFB A;  5KT5 A;  2VKQ A;  2XO7 A;  1CUK A;  4P2H A;  2YMM A;  2J6U A;  2ZIV B;  3KD3 A;  2HSZ A;  5DDY A;  4KLH A;  3FC4 A;  4KIT B;  4PZN A;  3H40 A;  5KFA A;  1DGJ A;  4NLB A;  2K60 A;  4QWD A;  4RQ0 A;  2F1H A;  4ED8 A;  4FO6 A;  1Z1B A;  2BQR A;  3EPI A;  1ARO P;  1FIQ A;  2HOF A;  5AI0 A;  4Z6C A;  5ALO A;  2JEJ A;  1A6S A;  3H0R B;  3JPS A;  2RQ5 A;  1M6Y A;  2HHV A;  3N7S C;  2AHO B;  1A0P A;  3UMC A;  4RQ3 A;  4XQ8 A;  5DBA A;  4C4R A;  4LJX A;  9ICH A;  5KFF A;  4LVS A;  4FFD A;  9ICF A;  4BDP A;  4NXZ A;  2OYY A;  1SWV A;  1S0M A;  5D49 A;  1N56 A;  1F0M A;  4F5Q A;  5J8Y A;  5J2K A;  4C0Z A;  1ZQH A;  1PZN A;  5III A;  4B9S A;  1L3V A;  2AJQ A;  3TQ1 A;  1U4B A;  8ICI A;  2HHQ A;  2J6T A;  1YZ6 A;  1KL9 A;  5L1L A;  2ZG6 A;  4B9T A;  2M9N A;  8ICV A;  1JIH A;  2ZJ8 A;  4EEL A;  2LYA A;  3RTV A;  1L3U A;  3C5G A;  5C0Y A;  4BWM A;  1ED1 A;  4TUR A;  3QU2 A;  4BXO A;  2F1J A;  2KFZ A;  2KKP A;  3LVV A;  3H4D A;  2PFQ A;  4J9S A;  3TAD C;  4KLM A;  4EBD A;  3N4M B;  5IIL A;  4Z6F A;  5ALF A;  1ZQV A;  2BCR A;  5ALX A;  5KT3 A;  1SV4 A;  2E8P A;  3F2B A;  1S76 D;  4ED3 A;  1TKD A;  2UVU A;  3NRW A;  9ICR A;  3LWL A;  4ELT A;  3HJE A;  2R8J A;  4RZR A;  3Q8P B;  4UB8 U;  1DXS A;  1HJP A;  2ZUB A;  5AKZ A;  1O03 A;  3ONN A;  1VDV A;  2ZIW A;  4UAR A;  5EWE A;  1Z19 A;  2KD1 A;  2O6K A;  3DDH A;  5AKE A;  4TUP A;  4FS1 A;  3N7R C;  1S10 A;  4OO1 J;  5HHI A;  4UB4 A;  1ZQU A;  5E79 U;  3GZF A;  3MR3 A;  3UMB A;  2Y9T A;  4NLK A;  3PX0 A;  5AM0 A;  2BCS A;  4YCX A;  4RNO A;  1WYG A;  1ZQZ A;  4F5P A;  4FS2 A;  4KLS A;  2AU0 A;  4OJ6 A;  4PPX A;  4DLE A;  3NVW A;  4QW8 A;  4Y2U A;  1ZQF A;  3D6J A;  2F44 A;  3N28 A;  4Z6D A;  5KFW A;  4ZH4 A;  4KLU A;  2H3Q A;  5KT2 A;  3L3F X;  4DWI A;  2HCF A;  2JRZ A;  4DS5 A;  5J0S A;  1NKB A;  3E0F A;  4YD2 A;  1URJ A;  3LYS A;  4RT3 A;  3MR6 A;  2NRV A;  4C8N A;  2AGO A;  2WHE A;  4YR2 A;  3M9O B;  3HX0 A;  2H3F A;  4ICA A;  3VCB A;  5KFO A;  4UB6 U;  3ZDE A;  3ZDC A;  2FPM A;  4I2H A;  4CF3 A;  2ZIW B;  3HW8 A;  5KFS A;  3RR7 A;  2ESE A;  3HT3 A;  3QU5 A;  5KAI U;  1NK8 A;  2QLT A;  1L8O A;  5JTI A;  3J81 j;  8ICU A;  2W7O A;  3I76 A;  3TKA A;  4O3S A;  4DFK A;  2ZJA A;  3T5L A;  3EPG A;  5KG0 A;  4KLO A;  3B9J A;  2ODG A;  2NRZ A;  4F5R A;  2HVH A;  2F3N A;  3AQE A;  7ICN A;  3GIM A;  2BQU A;  1N2X A;  1ZRM A;  4F2S A;  2I6X A;  4DFM A;  3WKE A;  9ICP A;  2R8G A;  2G08 A;  4G3I A;  4US8 A;  4M9G A;  2GWS A;  3PSP A;  2A1A A;  3UXN A;  4QJF B;  1N5W A;  3PO5 A;  3V6J A;  2P6U A;  2LBO A;  3BQ0 A;  3HRD D;  4UQG A;  2YMP A;  4U6P A;  2L5Y A;  5CHG A;  5CA7 A;  4OCZ A;  5A0L A;  4ED6 A;  1QQ5 A;  2HHW A;  1J2M A;  4RQ8 A;  4A8E A;  5ALI A;  3MGI A;  4F4W A;  5ALU A;  1CEZ A;  3R9K A;  3SR6 A;  1UA1 A;  1Q8K A;  1FFU A;  2VA3 A;  3EUB 2;  5ALR A;  4K4I A;  5D46 A;  2WF9 A;  2Y1J A;  3MGV A;  1BNO A;  5J2C A;  1ZQR A;  5KFP A;  2BCQ A;  4JB3 A;  1RG6 A;  4YQW A;  1KQQ A;  4Q8F A;  3GII A;  3UXO A;  2C2R A;  5KFJ A;  2YB1 A;  3H0M B;  1ZQA A;  2F1I A;  1NK4 A;  4FBU A;  4UAW A;  3RH4 A;  1KBU A;  2QB0 A;  3UXP A;  3Q8L A;  3HP6 A;  1NK5 A;  5ALP A;  3RH5 A;  4J9R A;  2K8C B;  1SL0 A;  2HOQ A;  3RB0 A;  1U49 A;  1S9F A;  4F93 B;  2ZUC A;  4YN4 A;  5L1M A;  1QH9 A;  1J97 A;  4ECY A;  4NLG A;  4QZC A;  1UA0 A;  1TK8 A;  8ICT A;  1N61 A;  1NJW A;  2XCA A;  2NO4 A;  1MSW D;  2D3D A;  1LVH A;  4C7Y A;  2ZJ5 A;  4DOB A;  2XGQ A;  2E3T A;  4DQP A;  3V6K A;  2BR0 A;  4CRX A;  2IHM A;  4QZH A;  1L3T A;  2W55 A;  5EE1 A;  1ZYQ A;  4EEN A;  5KFI A;  4ECW A;  2W3S A;  1X2I A;  2C2E A;  1BPE A;  2IBK A;  2A3V A;  3D2Q A;  3SQI A;  3NUQ A;  4LZD A;  4KN7 A;  5DB7 A;  2I1Q A;  3M9M B;  7ICG A;  1DK3 A;  2DPJ A;  3WK7 A;  5ALT A;  4CF5 A;  1SZP A;  1V9P A;  1WCL A;  2YML A;  4QWC A;  4UW9 A;  2R18 A;  2KTQ A;  4PGY A;  1XWL A;  1NK0 A;  3OHB A;  4J9M A;  3NVV A;  1SZH A;  3EYZ A;  5ALZ A;  4M9L A;  4P4O A;  5J2D A;  3MR5 A;  2MA1 A;  2KFN A;  1NOM A;  2OH2 A;  4DL2 A;  4IQU A;  3L4P A;  4IQV A;  1KW4 A;  2QB0 B;  4AYB F;  1ZOL A;  4KX5 A;  1BPY A;  5HR6 A;  3I1Y A;  2AGQ A;  4F50 A;  4QZD A;  1SKS A;  3TAC B;  3BS5 B;  4QW9 A;  3F5A A;  1C7Y A;  1XO0 A;  4C4S A;  1QCK A;  4YP3 A;  1JAL A;  4YG2 A;  4EZ9 A;  1A77 A;  1TVA A;  9ICM A;  3C21 A;  2EAM A;  2FDR A;  1ZQB A;  2LM1 A;  4KLF A;  2OCE A;  3MC1 A;  4KN4 A;  3OJU A;  3C2L A;  4BXO B;  2KZZ A;  5DKW A;  4I2D A;  3FM9 A;  2R8I A;  1BPZ A;  2R8K A;  4JMU A;  4DL3 A;  9ICX A;  4RQ6 A;  4JV2 A;  1IXR A;  3RBE A;  1ZQQ A;  4DQQ A;  2G06 A;  3C1Y A;  5J0R A;  4O0I A;  4Z6E A;  8ICL A;  2HHS A;  4R63 A;  4WJ3 B;  1JN3 A;  4I28 A;  4F2R A;  1KN5 A;  5DG8 A;  3JPR A;  9ICA A;  1COK A;  1NZP A;  4R64 A;  4C8K A;  3SEI A;  1IG6 A;  2KNJ A;  4J9L A;  5J2F A;  3K1Z A;  1KDH A;  5EE3 A;  1O08 A;  2KHQ A;  2AH5 A;  2HDO A;  2HBJ A;  5DB9 A;  2AGP A;  5J0P A;  2UVV A;  2W9M A;  1RZT A;  5DDM A;  5L1J A;  4RPX A;  3SEN A;  5KG3 A;  4EBC A;  3PV8 A;  4RQ7 A;  3PO4 A;  2ISP A;  3BS5 A;  1ZQK A;  1NJZ A;  1ZD2 P;  4B9N A;  1X6J A;  1ZQO A;  2GO7 A;  1ZQG A;  4YFK A;  4EX6 A;  1RPL A;  3TFR A;  1TK5 A;  4EYH B;  3RH6 A;  5KFK A;  5L9X A;  5AI6 A;  2HBK A;  3M8R A;  1T3Q A;  4ECS A;  3ZDD A;  1PVP A;  4F4Y A;  2YMQ A;  4ZOH C;  2WAQ C;  1CI4 A;  4HAI A;  5KFG A;  3OSN A;  4DQI A;  4Y2P A;  4M9H A;  2ZTC A;  5AM4 A;  3WK6 A;  5ALJ A;  3GV5 B;  3BDP A;  2K4P A;  8ICH A;  2KEY A;  4I2C A;  3AUO A;  3PW2 A;  3UPQ A;  4O5K A;  2DF4 B;  5KG6 A;  3LWM A;  3PW0 A;  1QSL A;  3PR4 A;  4DOC A;  5CWR A;  4Y2S A;  8ICR A;  7ICV A;  4O3Q A;  4HYK A;  2EQY A;  4I2F A;  3RB6 A;  1ZD4 A;  4NL9 A;  4OJP A;  5AM5 A;  1OXJ A;  3SAG A;  4RNM A;  4O3M A;  4ED0 A;  2E8O A;  4KMO B;  2GOL A;  1NJX A;  5KFU A;  1YT3 A;  2WF7 A;  3U26 A;  1BPX A;  4I2J A;  5DLG A;  3TAD A;  1NI3 A;  2KIW A;  1X9M A;  5L1K A;  3H8W A;  4QNL A;  2KJ5 A;  4JV1 A;  4OJO A;  4YXJ A;  4CE6 A;  5HML A;  3PST A;  2Z7J A;  5DBB A;  1KEJ A;  5GTH U;  3THV A;  4KX3 A;  2KE7 A;  1NK9 A;  2PFP A;  3K1R B;  4LZG A;  1RYS A;  2FJ6 A;  1L6N A;  2G07 A;  2ZXH A;  4DL4 A;  2HBL A;  2A19 A;  2DL0 A;  1F44 A;  4DSJ A;  1V97 A;  3V7L A;  4IS7 A;  1LKY B;  1JRO A;  2XY7 A;  1S5L U;  4QZ8 A;  1ECW A;  4B9V A;  1D8L A;  1RM6 C;  2QAR A;  4DL6 A;  5CR0 A;  4F72 A;  4I27 A;  4UAS A;  4KLE A;  1MA7 A;  3SI8 A;  7ICQ A;  3Q8K A;  4ED1 A;  4C8M A;  5J0U A;  2Y0S F;  2W03 A;  1MN8 A;  2G5H B;  4CNQ A;  4K4H A;  2LM4 A;  2PFO A;  1TK0 A;  3OGU A;  2ZIU B;  4I2E A;  4JWM A;  3IG5 A;  2JHD A;  3MFI A;  2KP7 A;  4FZL A;  3M9N B;  1A76 A;  2XIC A;  4UBB A;  1S77 D;  1CRX A;  5KFN A;  2JH1 A;  3MDC A;  3QEB Z;  2W8K A;  3SMV A;  1PVQ A;  1Q3U A;  2E1F A;  2W9A A;  2UVW A;  2LMR A;  2DQN B;  2E5S A;  2Y9U A;  4UAZ A;  2V9W A;  3RJE A;  4GIB A;  4GFJ A;  2W54 A;  2BGW A;  4C4T A;  4ELV A;  5AKH A;  3SV3 A;  2JEI A;  2KJ9 A;  5AIC A;  2KV2 A;  5KFH A;  2RRD A;  5KT4 A;  4RUC A;  1FEZ A;  3OJS A;  5K4L A;  4Y2Q A;  3BQ2 A;  4EX7 A;  4UAY A;  1RQN A;  3AU6 A;  3PW4 A;  2Q0Z X;  3AM9 A;  2BPG A;  2EAP A;  4F92 B;  1Z1V A;  3CRX A;  3G6Y A;  3FYH A;  2JMG A;  4US9 A;  5CRX A;  3F2C A;  1UHU A;  3QXG A;  3BQ1 A;  8ICQ A;  2DWQ A;  3IV6 A;  3M6K A;  4QWE A;  5KFC A;  2DBY A;  4CGZ A;  1KKX A;  2DPI A;  4JV0 A;  2W9B B;  3V7J A;  1LV5 A;  1LB2 B;  1ZD3 A;  2YX8 A;  3TAP A;  1XNS A;  1T8E A;  5ALW A;  2ATL A;  9ICU A;  3PSI A;  3KHR A;  1HIW A;  4YMM A;  2CXY A;  4OJL A;  3GV7 B;  2NYV A;  1XO1 A;  3BJY A;  1JUD A;  3RF9 A;  1SKW A;  5TZV A;  3M8S A;  1JMS A;  2D8C A;  4TQS A;  1UT8 A;  4R66 A;  2M0N A;  3NGD A;  3UMG A;  2HMX A;  5ALL A;  1MQ3 A;  5ALM A;  2KSO B;  3L5K A;  2JXJ A;  4M9J A;  3TAN A;  1ZQX A;  3I28 A;  2BZF A;  5KFZ A;  4DCC A;  2P6R A;  5EWF A;  4ED7 A;  4J03 A;  2FMQ A;  2BKE A;  4IRD A;  2NRW A;  1L7M A;  5J0T A;  4I2I A;  3MDA A;  7ICI A;  9ICK A;  2OM6 A;  2HHX A;  3C2M A;  4NY8 A;  3H8J A;  5AKY A;  1U45 A;  4ECV A;  1NK7 A;  3D2N A;  2W9B A;  4KLI A;  2HVI A;  2C2D A;  1ZRN A;  5DGB A;  1HEK A;  1XSN A;  2LYH A;  2HI0 A;  3QU7 A;  2WF6 A;  7ICK A;  2BPF A;  1Z3E B;  4NLN A;  3C2K A;  3C5F A;  2P35 A;  4QZF A;  2XY6 A;  4RQM A;  3PX6 A;  1X9W A;  1L3S A;  3QYP A;  4Q8E A;  4AP9 A;  3Q8S B;  2H5X A;  4BWJ A;  1NK6 A;  3JPO A;  3K4G A;  5KAF U;  1HUZ A;  4F4Z A;  1N48 A;  4UAU A;  2C28 A;  4M47 A;  3ISB A;  2ES6 A;  2A1J A;  4GC7 A;  4F3O A;  3T79 A;  2ASJ A;  3LDA A;  1IV8 A;  3GIK A;  2WB1 F;  3SV4 A;  4QZ9 A;  2P66 A;  3WK9 A;  4UB3 A;  5F9N A; 
#chains in the Genus database with same CATH homology
 2K89 A;  2HOQ A;  3M7D A;  2JH1 A;  3N7S C;  3ONN A;  2DF4 B;  2E1E A;  4FZM A;  4JMU A;  1A0P A;  2ZIW A;  3C28 A;  1GO3 F;  2XID A;  2N1R A;  1Z19 A;  3SMV A;  1PVQ A;  3CP8 A;  1Q3U A;  2PMZ F;  2VJ5 A;  2JGA A;  2KD1 A;  4NWI A;  3D2S A;  2M0N A;  2OXO A;  3AQE A;  2ZXI A;  2K4H A;  2RHF A;  3N7R C;  2E1F A;  2G06 A;  5KL8 B;  2ZIU A;  3SAH A;  2DGZ A;  4OO1 J;  2DQN B;  2E5S A;  2GH1 A;  3F2D A;  1WUD A;  2HMX A;  4OJP A;  2VJ4 A;  3DEE A;  2CN1 A;  5T14 A;  2XI9 A;  4CRX A;  1UPH A;  2K4I A;  2F77 X;  4GFJ A;  3GZF A;  3SAG A;  1NZB A;  4WJ3 B;  5KL1 B;  4O3M A;  4IC9 A;  2K8B B;  2G08 A;  4NV0 A;  2CRX A;  4KMO B;  3ALR A;  2GOL A;  3CYM A;  2OYY A;  3M6Z A;  4CDG A;  2D6F C;  1YT3 A;  2Q4T A;  3PSP A;  2A3V A;  3D2Q A;  2LYB A;  2G0A A;  2BDU A;  3SQI A;  3NUQ A;  2KJ9 A;  2KHV A;  2KNJ A;  2KV2 A;  4QJF B;  4U7C A;  1Q3V A;  3C29 A;  2G5I B;  2LBO A;  3K1Z A;  2VIX A;  2RRD A;  1L6N A;  4OJ6 A;  4C0Z A;  2KIW A;  2G09 A;  2KHQ A;  3LVW A;  5C0Y A;  3H0L B;  2HBJ A;  4QNL A;  2KJ5 A;  3IN5 A;  4U6P A;  3F53 A;  3N7P D;  2F2A B;  4OJO A;  4P0P A;  3HKZ C;  3O0F A;  2R18 A;  5CRX A;  1TAM A;  2LHT A;  1CRX A;  3PSF A;  5A0L A;  3PST A;  2OM6 A;  2Z7J A;  1P7D A;  3HKZ F;  4NLC A;  2H3Q A;  4QIW F;  3KFU F;  1PVR A;  2XVT A;  3D2N A;  2KIC A;  4KX3 A;  1OUQ A;  1SZH A;  3L3F X;  4A8E A;  2ZG6 A;  3RFA A;  1HEK A;  2KOB A;  2WB1 C;  3CRX A;  3AL0 B;  4BJQ A;  3E0F A;  2ZIV A;  2LYA A;  4FZN A;  2JMG A;  2H3I A;  1URJ A;  2G07 A;  2MA1 A;  2ZXH A;  3ICX A;  3LYS A;  4PL1 A;  4QIW C;  3PZP A;  1DRG A;  2WAQ F;  2OH2 A;  2MRL A;  2W04 A;  4ACO A;  2HBM A;  1ZQ1 C;  2HBL A;  2RP5 A;  3F2C A;  1F44 A;  4P0P B;  4PL2 A;  2H3V A;  2KVC A;  2Y0S C;  3AQF A;  2HOI A;  2W7P A;  5HR7 A;  3M6K A;  3IG8 A;  3MGV A;  4AYB F;  1ED1 A;  4KX5 A;  3F5E A;  3VC8 A;  4CGZ A;  5HR6 A;  1T94 A;  1ECW A;  2H3F A;  1IIP A;  4ICA A;  3VCB A;  2KKP A;  2ZIX A;  4AYB C;  3LVV A;  4P0Q B;  2CPR A;  2YX8 A;  2LKY A;  3IP4 B;  2HBK A;  2VKQ A;  2YB4 A;  1XNS A;  3F5A A;  2PMZ C;  2ZIV B;  3GU3 A;  1XO0 A;  2ZIW B;  2YB1 A;  4BX9 C;  3SAF A;  1MA7 A;  2NV3 A;  1PVP A;  3H0M B;  2WAQ C;  3PSI A;  2F8L A;  1HIW A;  4NLB A;  2KJ8 A;  2Y0S F;  2W03 A;  2H3Z A;  3F2B A;  2F76 X;  2G5H B;  2K4E A;  4OJ5 A;  4OJL A;  1Z1B A;  1KBU A;  2W7O A;  3T79 A;  3NRW A;  2ZIU B;  3IG5 A;  2JHD A;  3OPX A;  2HOF A;  3RF9 A;  2KKV A;  2JH7 A;  2WB1 F;  4FZL A;  2KEY A;  2K8C B;  4BUG A;  2ZIX B;  1D8B A;  4FE3 A;  2XIC A;  3KZX A;  4P0Q A;  2K8A A;  1A6S A;  3H0R B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...