4C4RA

Structure of beta-phosphoglucomutase in complex with a phosphonate analogue of beta-glucose-1-phosphate and magnesium trifluoride
Total Genus 79
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
79
sequence length
218
structure length
218
Chain Sequence
MFKAVLFDLDGVITDTAEYHFRAWKALAEEIGINGVDRQFNEQLKGVSREDSLQKILDLADKKVSAEEFKELAKRKNDNYVKMIQDVSPADVYPGILQLLKDLRSNKIKIALASASKNGPFLLERMNLTGYFDAIADPAEVAASKPAPDIFIAAAHAVGVAPSESIGLEDSQAGIQAIKDSGALPIGVGRPEDLGDDIVIVPDTSHYTLEFLKEVWLQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords BETA-PHOSPHOGLUCOMUTASE
publication title Alpha-Fluorophosphonates Reveal How a Phosphomutase Conserves Transition State Conformation Over Hexose Recognition in its Two-Step Reaction.
pubmed doi rcsb
source organism Lactococcus lactis
molecule tags Isomerase
total genus 79
structure length 218
sequence length 218
ec nomenclature ec 5.4.2.6: Beta-phosphoglucomutase.
pdb deposition date 2013-09-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00702 Hydrolase haloacid dehalogenase-like hydrolase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.240 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 Putative phosphatase; domain 2 4c4rA02
3.40.50.1000 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold HAD superfamily/HAD-like 4c4rA01
5AI8A 1XVIA 3KBBA 2YMMA 4I9GA 4HGQA 2B8EA 2B82A 3ONNA 3R9KA 3EF1A 4Y2RA 3AR6A 3OCUA 4MWOA 1RMQA 3KZXA 4UM7A 1YV9A 1U2SA 5AM2A 3N5KA 2B30A 1MH9A 1S2OA 2AUTA 2ZBEA 5FP0A 4FFDA 5AVRA 3GYGA 4XOUA 2OA0A 1YNSA 1QH9A 5ALVA 5AW4A 5A3RA 3QUCA 3U7HB 1XP5A 3ZWDA 1ZJJA 2HCFA 3B8EA 1SWVA 4BX2A 5AKIA 2HDOA 2EAUA 5ALRA 1T5TA 2G0AA 4EENA 2P69A 2FPRA 4DFDA 1TE2A 3NANA 1TJ3A 1WZCA 5AW1A 2GHTA 4OHFA 3SHQA 2FPUA 4JDPA 1U7PA 4O8CA 3SMVA 4Y2YA 3A1CA 3CZ4A 5AW2A 2B1RA 5AM4A 4OFZA 3AR4A 1L7MA 1Z4KA 4BBJA 4NV0A 4NABA 2NYVA 1YS9A 3MPOA 1QQ5A 1Q92A 1Z4JA 4OD0A 1QQ7A 3B9BA 3NAMA 1L8OA 5AI9A 3N1UA 3KD3A 1ZD4A 5ALYA 5ALGA 2CFRA 1RKQA 5ALMA 3PGVA 4IFTA 2RBKA 5JJBA 3OTQA 2AMYA 1SU4A 2CFSA 3R09A 1TJ5A 3WK4A 3N8GA 3R4CA 2YJ3A 2HHLA 3FM9A 5AK6A 3QYPA 4UATA 5AK5A 5AKXA 1RLOA 3OCZA 5AHXA 3ZVNA 2YMPA 1L6RA 3HYCA 3U7FB 3L8EA 3PGLA 5ALOA 1RKUA 4CNQA 3WGVA 5A3QA 1VJRA 5AW8A 5ALPA 4BYGA 5ALWA 3WK7A 3AR3A 3OCVA 3QGMA 2WF8A 3WKDA 2ZG6A 3FZQA 2OBBA 3AR8A 4FE3A 4Y2XA 3I1YA 1RC8A 2G08A 3FPSA 1QYIA 2HF2A 3AR9A 4YH1A 1FEZA 2AGVA 3WK6A 4C4SA 4JB3A 4DCCA 2BDUA 2I54A 4G9BA 5ALXA 2I7DA 3AR5A 3W5DA 2NO4A 5AKJA 1EK1A 2QYHA 4Y2SA 2PQ0A 3DNPA 4KNWA 3I28A 4UMFA 3SD7A 2VKQA 2WF7A 1CR6A 4HGNA 1Z88A 5AI5A 4H1WA 2ZBGA 3B9RA 2MSNA 3QXGA 4EELA 1Y8AA 2HX1A 3UM9A 3D6JA 2YBDA 4NFLA 4HGPA 2B8JA 3NRJA 4YGYA 4NAVA 1ZD3A 2R8ZA 3QU2A 2RARA 4MUMA 1RMYA 1RDFA 4C4TA 3ESQA 4OCZA 3ZTWA 2B0CA 4HYTA 3QUBA 3L1UA 1RKVA 1ZRMA 3ZUPA 4EX6A 2JAOA 3NALA 4DW8A 5ALSA 4L6CA 4YIHA 2GFHA 3QU5A 2YFYA 3L1VA 1Z5UA 1ZS9A 4UU1A 1WR8A 4F72A 2ODAA 1EK2A 4L6AA 2YJ5A 3WKAA 1L8LA 5AKLA 1Z4IA 1Z4PX 5AKHA 2FEAA 3ZX4A 4DWOA 1RQLA 2C88A 3MMZA 2X4DA 3U7EB 2IOHA 4CF5A 4Y2UA 5AVTA 4BNDA 3WKBA 1L7NA 4PNHA 4YCMA 5AIBA 2ZBDA 2HSZA 5AICA 3ZWKA 1YDFA 1WVIA 2GHQA 5ALUA 1Z4MA 4GIBA 2I55A 1CQZA 4E88A 3WK9A 3SF0A 4UU0A 2HO4A 3I6BA 4EZEA 2B1QA 1K1EA 4YCNA 3ET4A 4J2TA 2WHEA 1N9KA 1RMTA 5ALKA 2BDEA 5AI6A 5IT4A 3L7YA 2C8LA 4UASA 3UMCA 1TA0A 2WM8A 4BEVA 1JUDA 2C9MA 4AP9A 2WF6A 3SKYA 3ZW7A 2FUCA 3L0CA 3QU4A 3FPBA 2HI0A 5ALHA 3E58A 2JAWA 3RFUA 1O08A 5AM5A 2FUEA 3IRUA 3EPRA 1Z4NA 2PR7A 4CF4A 5AW5A 3DDHA 1TJ4A 2YN4A 1T9ZA 1YJ5A 4HGOA 4UW9A 1AQ6A 3IB6A 2YMQA 5AIAA 4BNDB 1RQNA 2IOFK 2YJ4A 2GMWA 3NASA 3ZU6A 4KNVA 2QLTA 3L5KA 5AKGA 4F71A 1LTQA 5ALIA 3M9LA 4ZEXA 3U7GA 1NNLA 1ZRNA 4ZEVA 2RB5A 4IG4A 4Y3UA 1QQ6A 4UAUA 1RPZA 5AW6A 4BX0A 3SLRA 3KOOA 3EWIA 4RETA 4Y2TA 2JGAA 3ZVLA 2OM6A 1F5SA 5AVZA 1NRWA 2ZOSA 2I6XA 3ZI4A 5AVXA 3BA6A 1J97A 1RLMA 5AM1A 4XQ0A 3HLTA 4L57A 3UMBA 2OYCA 5E0OA 3WK8A 2BY4A 4UMDA 3W5AA 2HF7A 2IYEA 4BEWA 4UM5A 3OCXA 3WGUA 3P96A 3TLMA 2WFAA 2CN1A 5AKZA 2Q4TA 4UMVA 3W5BA 3SKXA 1ZD2P 1WPGA 2RAVA 3AR7A 3W5CA 3L8FA 3DV9A 3M1YA 5AVUA 3A1DA 2O2XA 3AR2A 2G80A 1RRCA 3U19A 2FI1A 2W4MA 3CNHA 4YIKA 5ALLA 5AI0A 3NIWA 3S6JA 3U13A 1Z4OA 2G09A 2JAUA 3OCWA 5AVSA 5AW7A 2Q4RA 5A3SA 4G63A 2CFTA 3OPXA 3PDWA 3OCYA 2ZXEA 3DAOA 2P9JA 3QLEA 2FPWA 1YMQA 4CF3A 2D2VA 5AKKA 5AM0A 2P27A 4HAIA 2GO7A 4Y2QA 2EARA 3NUQA 3L8GA 5ALQA 3QUTA 5AK4A 3MC1A 2I33A 3E84A 3WKCA 4CE6A 3L0YA 4Y2VA 2P11A 2DQSA 3ZX5A 2G06A 2FPSA 2JARA 3ZTYA 1ZD5A 3E8MA 4GXTA 3RF6A 5T41A 2FDRA 5ALTA 3F9RA 2YY6A 2MU1A 3N28A 3ZVMA 4QQFA 2R8YA 5AW3A 5AVWA 5AI4A 4BX3A 4I9FA 3KC2A 5AESA 3ED5A 5IT0A 4FYPA 3WK5A 4XPZA 3J7TA 2WF9A 3I76A 3PCTA 5ALJA 3U26A 3A3YA 2FPXA 2YJ6A 3BWVA 4Y2PA 5ALEA 3ET5A 5ALDA 4KYTA 4UMEA 1J8DA 4NWIA 4B6JA 4KX5A 4BKMA 1PW5A 1Q91A 3ESRA 1L7PA 4HGRA 3QU7A 5AM3A 4KX3A 1VFPA 3EF0A 5ALZA 1U7OA 1LVHA 2W43A 3A1EA 3E81A 1U2TA 3QNMA 3QX7A 4Y2JA 2C4NA 1L7OA 2HOQA 1Z4LA 3FGOA 4KN8A 4AS2A 5AVVA 1N8NA 1KYTA 2IOFA 4RESA 2I34A 2NO5A 1U02A 2O9JA 5AKEA 1Z5GA 2R8XA 5AW9A 5ALFA 5AVYA 2G07A 2WF5A 3N07A 4UAVA 4C4RA 1IWOA 4J03A 1T5SA 2YMLA 3WKEA 2PKEA 3QUQA 2IA5A 4UARA 2EATA 1O03A 3UMGA 4QJBA 3VAYA 2C8KA 1RLTA 2G1AA 3KDPA 5AVQA 2ZBFA 1NF2A 2Q5EA 1ZOLA 3IJ5A 4EX7A 3L0BA 1VJ5A 2AH5A 3FVVA 4EEKA 1Z4QA 4ZEWA 1S8OA 2HEGA 4AS3A 1X42A 3K1ZA 5AW0A 5IS2A 5AK3A 5ALNA 3MN1A 2MU2A 2W11A 3L8HA 1SWWA 4XE5A 5AKYA 3QU9A 2R8EA 4YCLA 1XPJA
chains in the Genus database with same CATH superfamily
2I2BA 1XVIA 2VDWA 3D7KA 4TXHA 1W46A 4F60A 2HA6A 3PU6A 1PK7A 4QYSA 4G9EA 4OJPA 4J49A 3CUWA 5HGXA 1E63A 2EG9A 4PZAA 2V98A 3W8DA 2IS6A 3ETGA 1H2YA 3ZNPA 5TQ0A 4AZVA 6LDHA 2OZEA 1CUDA 1C9MA 3GFFA 1I33A 4IYRA 3HRDD 1YZNA 2NYVA 1YS9A 2PWAA 4LF5B 1QIKA 1NM5A 4Q7JB 5A5DA 3V8VA 2LBOA 1VDVA 2IUSA 1C81A 4C3ZA 2IEBA 3I1FA 1TFUA 3E7DA 2HSJA 4PXAA 4AF6A 2IBMA 1UEJA 5A3QA 2X8JA 1VJRA 4W63A 3OFNA 3K1TA 4FDVA 2J9XB 1H2BA 3C4QA 4PFSA 2IH2A 4Y2XA 3I6QA 4F2SA 3HDTA 1W94A 3H2ZA 3BXPA 2JFBA 3UJHA 1Z7WA 3QFCA 3GVIA 3GJ8A 4LRUA 3RGWS 1FTSA 2G4LA 2NLOA 4Y18A 1JA1A 4QZDA 3D64A 2P65A 3KHTA 4J9NA 1UOOA 1EJ6A 1ZAKA 2YW9A 3EYZA 4IS3A 1XLTA 4UM8B 3T5MA 3EGDA 4ND7A 1W4CA 1UXKA 1XQYA 5TVGA 1H9BA 4LSGA 2IYOA 3FOAA 3FI9A 3PQ4A 2GOLA 1CY8A 2E5SA 1KQQA 2CXNA 1J2RA 3TIGA 3AVWA 1I13A 1NJZA 1X1RA 3ZX4A 4CODB 1U49A 1NUQA 5A9TA 4MFFA 1TQ4A 2KQUA 1OH8A 2D1QA 9LDBA 5JS2A 5L3QB 1E2QA 1TGVA 2GOYA 2YIDA 1V2HE 4EG6A 3NG1A 3KL2A 1X7GA 3VO1A 2HA0A 5F52A 2MR6A 4ZAXA 3PKJA 1QNLA 2G83A 1IG3A 1JIUA 3B36A 3FPBA 4ZCRA 1K89A 1NFRA 2Q62A 3HJEA 2W9MA 4R1OA 5BT9A 1BVSA 3W6NA 4NU8X 3P2MA 4M1YA 5DEIA 4LFBB 1DINA 2YJ4A 4XJTA 3VSEA 5HXAA 8ICNA 2QIPA 2ALZA 2OXEA 1IOVA 2V4MA 4DLEA 2CHGA 1Z06A 1WB4A 1X9GA 4Q4LA 4WOKA 3EUWA 2PD3A 3DBOB 4AO7A 3F9IA 1KN5A 1M7HA 1RLMA 4MWZA 1BROA 4GI1A 3A28A 3W6OA 3RNOA 3L84A 1C3VA 2M1ZA 2WD7B 2IHVA 1M1NB 1PUJA 1JLKA 2FLPA 3ROXA 4UB5A 4AIRA 1Y8RA 4R8SA 4RPCA 2FP3A 2POQX 1GXSA 1DC8A 5IMSA 2JAUA 2X0IA 2JAQA 1EFRD 4JYZA 1YGYA 1ZRSA 3KQNA 3R3UA 3DBHB 4YQZA 4FFWA 3V42A 3A32A 3H5OA 5AOBA 1RWQA 3L0YA 1GIAA 1VOTA 1DV2A 1HOTA 1UP7A 3O2SB 4AJ2A 2YY6A 2JK1A 1H8HD 4K9NA 2ZIAA 1CEYA 4Q3NA 1XD9A 1YDWA 1E6WA 3I30X 3IEPA 4YAFA 3DBLA 1TKRA 2QZSA 1R6TA 1L7PA 4L9AA 4F85A 4QFMA 5IABA 4PF1A 2YV2A 5FOWA 2XYGA 4HHEA 1VG9B 4OI4A 1WHTA 1ZQ1A 4QG3A 2YW2A 2V58A 4DR5B 1E6CA 2DFDA 5AKEA 4IJ5A 2G07A 4DPMA 3KKZA 1USVA 3OEHA 1FZQA 3V4SA 4F6RA 2J09A 4GVLA 4RDIA 2PFNA 4AJ9A 5KVCA 3QMVA 2DPMA 4W5HA 3SJBA 3SS8A 1DKOA 1K08A 5CNIA 4O3MA 2QN2A 4H17A 1A27A 2W11A 2WUEA 5HRUA 3NHPA 3OUTA 3QU9A 5GIPE 1W5FA 4G0VA 3KBBA 5HILA 4B8YA 3CZPA 1R37A 2O3JA 2BFFB 4GC5A 3FAZA 4BX8A 5IC6A 1KF0A 3RV4A 4USAA 3CX4A 4MVYA 4L0CA 1ZQYA 4PZPA 1COOA 1SC3A 4RE6A 5P8WA 4O02B 1I01A 3IT1A 3QUCA 3QELA 6GPBA 8MHTA 1YC5A 2EBWA 3A25A 3QX3A 1FP4B 4EB8A 5JD6A 3NOOA 4A2CA 1ONOA 4KR0A 2RAFA 3N2ZB 4U7FA 4FXOA 4X5VA 1MF7A 2R47A 4IIEA 2GWHA 3NM4A 4NX2A 1V1MA 2PRIA 3AETB 3IP3A 4KXXA 3CP8A 1SO8A 3OOHA 1N6OA 4B33A 2FWJA 3CPJB 4QA9A 1X7WB 2EEZA 1KI8A 4LDAA 3TE7A 2FEKA 5FUWA 1NVFA 4IDPA 2WHXA 4CL2A 1KYWA 3D2QA 4RGBA 4DWJA 1SZCA 1M66A 3F5SA 2WAOA 1UXIA 2F48A 4QPNA 2VJKA 5CDUA 3HS3A 5COBA 4UCWA 3IH5A 1E79A 3EXG1 2P5YA 4ZN6A 5JFGA 1QF9A 1RQXA 1NAIA 3QLTA 1LLQA 4S04A 1GEEA 3LOQA 4OMFG 4KACA 4YB8A 2XCPA 3THXB 2BI8A 4UBIA 5HIIA 2L18A 1ULUA 2PYDA 4NICA 1C4XA 3NEYA 4OB6A 2I71A 5HKKD 2RARA 1G1MA 1H1TA 1P7ZA 4LY9A 3CPSA 4LPSA 5HF6A 3EUB2 4ELUA 3OIDA 3SQMA 4FMDF 1Z22A 2O8CB 1CJBA 3G17A 4OQPA 2FP4B 4EL0A 4KWHA 1QRRA 5DNUA 1HORA 4L6AA 3TQFA 3TW8B 1GAJA 2R6HA 2QJRA 3TBKA 1NZBA 4UEKA 4GXNA 1UCVA 4MVJI 5IKMA 5DBGA 2O0MA 2A14A 3QFFA 2YZMA 4X41A 1KE1A 3IBYA 3AIKA 1VP9A 1MB9A 2WMOB 4J1TA 3WYAA 3R0ZA 1Y89A 1J5PA 1IWBB 3CH5A 4C78A 1A98A 2O2HA 1DRKA 4C08A 1YCGA 1ZYUA 3WL8A 3BAZA 2RBGA 1ZD1A 1DNPA 1XVAA 5KKCA 1M2EA 2Y1KA 3NS1A 2JF0A 4DRXA 3ESDA 2HBRA 4M7RA 3OFKA 5JATA 4PJ0U 4DV6B 1AKTA 1JECA 3L5OA 1Q2XA 3AFIA 3KXLA 4BAUA 4D7AA 3U7GA 3CONA 3ZH2A 5LU8A 3W3AD 3L92A 3GPIA 4YR0A 4KTQA 4YP7A 1M6EX 1R74A 4Q66C 3JRWA 1SHZA 2Q0ZX 3WHPA 4I81A 4JWNA 2WW8A 4LDRA 2QPOA 4UEQA 5D6OA 1ADGA 1FTYA 2KBEA 4ZCIA 3GVXA 4G85A 2HF7A 4FFLA 2UVDA 2WSSD 2FQXA 3D4OA 4K1LA 2BFPA 5JASA 1JBEA 3S70A 3ZQ6A 1BNCA 1PEKE 4TRNA 2Q4RA 3NGLA 3M70A 5THQA 2YJGA 1J7JA 1VTKA 4V3CA 2MINB 4TLMB 1Z1BA 3M89A 1KAMA 3RRXA 4UBKA 3BCRA 1TA9A 4MO2A 3RO7A 1OR8A 3PNKA 2MRLA 1MDBA 2C4VA 2B2NA 2CRXA 3WK5A 2EERA 4YQWA 3R77A 3SEAA 3S40A 4ZYTA 1YC2A 1AKYA 1CRWG 5IJZA 2QUIA 1MXFA 3H1AA 3BGDA 3LCMA 5FWXB 4P2HA 4H60A 3HG7A 5DHQA 4YASA 3K4QA 3RVQA 2UU9B 1HIWA 3FGOA 3OZGA 4L75A 2MOKA 4R9SA 4DIMA 1SPXA 2ISOA 4MH0R 4FYHA 3ZY6A 2ACKA 5CXXA 1P9LA 3CWCA 1TTHA 1ZQGA 3EGOA 1NJ6A 3PW7A 1Q12A 1PNTA 3AUSA 3AVPA 1UPFA 4PPYA 5F9HA 3OQMA 3RJHA 4AAYA 3HA5A 1WDLA 3I42A 3KOWA 4EUEA 5D1NA 2JZBB 3Q6MA 3SIWA 2VJLA 2UZ1A 5BYJA 2PJZA 4X3CA 2RGYA 1MFPA 2K2QB 1AQYA 3UW1A 5ICMA 1U0HC 2H8KA 3EWSA 1NE7A 1T3SA 4JQZA 3DKRA 1NJ5A 1C1XB 4DG8A 4JI6B 2BFNA 4Q03A 2VTBA 1A8HA 3K9GA 4HYEA 3WOVA 3W77A 5BSFA 4EW1A 4E2XA 4F5ZA 3P0HA 3UCXA 4ILEA 3ST7A 1WUDA 4TTRA 3VAAA 1XJ0A 3UPDA 3KD3A 1DBWA 4TTIA 1OWLA 3WISA 5ALMA 4QOHA 1Q1EA 3HJGA 3GA0A 3C8ZA 3R5JA 1IN4A 2IXDA 1TI7A 4K9DA 3RE1A 2JVIA 3I64A 2JHGA 4PQRA 2F1OA 4FGUA 1LNSA 3KKAC 5CNJA 2IS2A 4MB6A 5DZSA 4FHDA 4A92A 1N5OX 3ZDYB 1A82A 5J8YA 2FWMX 2EQAA 5FB3A 1VLQA 1U3FA 2AV6A 3DXZA 2B37A 3R3XA 4FGSA 1Z35A 2IJGX 2GZ2A 1SQ5A 3HN2A 3ZWVA 1PGPA 4CG0A 2XMDA 2GM3A 2YJZA 3LSTA 4OV6B 5E1DA 1GU1A 3FF4A 2CVOA 3GIKA 2HVIA 4LWZA 1ZD3A 3EOBI 1YOBA 4GE0A 5JNRA 2FF5A 4KDEA 1X80B 4ZOQI 4S1OA 2XA9A 2HZ7A 3M9WA 2H4XA 4F8EA 5CHEA 1N9ZA 5EI5A 5IYZA 1FX0B 1JVSA 1L7NA 2C2DA 1JDJA 1YVUA 3A0RB 1E99A 2R0QC 3ZU2A 4BO5A 3Q0EA 2NRXA 2FLLA 4HXGA 3DOHA 1CD5A 4MRRA 1EZ1A 1V9PA 2NUBA 4YALA 5DXFA 4RXUA 3K73O 1NVGA 5CB4A 5CXUA 3F6SA 3KQYA 2HUPA 2C9MA 1BW9A 3AC0A 1W29A 5CB8A 1YJCA 3X1MA 2ISCA 4EAQA 3IKLA 2KS6A 1HZZC 1T9ZA 3UCFA 3LFTA 1QHYA 1GZ6A 4DG9A 3LH5A 2W2LD 2HADA 2AZMA 1JLLA 1COWA 3PNQA 5I9MA 4CIAA 1EFVA 4EFNA 1LXCA 4DPLA 4ZOEA 4IS2A 4UDNA 2AJCA 1KAQA 5JSFA 3MD0A 1BEZA 1RBYA 1VB3A 3A58B 3FHTA 3OQHA 4FB5A 3BQ7A 1H22A 2BC9A 4MIYA 5IF3A 1NBOA 3LGSA 1H0HA 5DP1A 1BH2A 2G1PA 4GLJA 3E3LA 5K01A 3WQSB 1R9JA 3MQ4A 4G0OA 2J3HA 1Y98A 3N7PD 4IHJA 5CRIA 2DRIA 3N05A 2QZZA 1P1IA 1Y1RA 4TYQA 1WABA 1SD5A 4BMOB 5IHPA 3E3NA 4KO2S 4DJDC 4KBGA 2D7JA 1RQGA 3NR2A 2XUHA 3A6PC 2NVWA 1Y3CE 3O4RA 5AESA 5IT0A 4C8OA 2X4LA 2AI2A 1LBTA 5TEVA 2JMGA 3BWVA 4NH0A 2WWYA 1PN3A 2D6FC 3JQ8B 1WQ4A 1MRSA 1EGVB 4IGEA 4R8KA 1J23A 1E98A 1ISSA 3P4YA 3GBSA 2B21A 1GEGA 2O3TA 1UKYA 1M1YE 4D4GA 1T6YA 5DBBA 4TWZA 4R16A 5IF9A 1TQDA 1KYTA 4F56A 2J6HA 1PUIA 1NLUA 4US8A 3UV6A 3HVRA 5AYVA 5DHRA 1NV9A 1RTKA 3K53A 5IYZF 3JVDA 5G4LA 1GT91 1WXQA 4F4DA 4B9MA 2QTMA 5JYDA 3SNHA 1EG2A 3L4PA 1WP4A 4TLEA 1X42A 2WTMA 3LXUX 1O8BA 5CHGA 3GW8A 2FWBA 4NG4A 3MN1A 5CB4F 3EH2A 3VTFA 1KYQA 3O8QB 4AJIA 3IP1A 4C89A 5EJ8A 1Z63A 1PTKA 2C92A 3O83A 2DHEA 2XCLA 1QFJA 3NO4A 3DGFC 5FUYA 2B92A 4Q05A 3OT5A 4YP0A 1SGGA 4B3TB 5BNIA 3THYA 3MHPA 1B2LA 2VTDA 2ISPA 2DL0A 3N3AC 5KNCA 2VKTA 3BTSA 1MTOA 5LD2C 2G36A 3N7AA 4IXNA 1NJYA 2X5KO 2X5OA 1OFVA 4P3OA 5EMNA 4JP3A 2RHWA 4L76A 1CVIA 2JEZA 5TMEA 1ORDA 4CIWA 1C50A 1CF2O 1O8CA 3BDIA 3LYLA 3F5MA 2WNIA 1QG0A 3WL6A 4HQNA 1GDDA 4IHJF 4C0ZA 2HSDA 4RACA 5ULLA 3WS7A 4I0WB 1G8JA 2GAFA 5JCJA 2YWDA 1SVIA 4Q37A 2XODA 2GCOB 4UMFA 3GJRA 3ZDQA 2FRVA 3FE2A 3VBEA 1Y1PA 1QMGA 4LHZA 4MP6A 3JPOA 3TK1A 4HAUA 5F33A 5D5QA 1JFSA 1NSFA 1NKCA 1MIHA 2CMFA 1JFVA 1CZLA 2NV6A 4JI0B 4X65B 3AHGA 1XCGB 1L8XA 4BCDA 3N97B 1OU0A 2QRVA 2C4HA 2FPIA 4OM8A 3BZBA 2CSUA 2BR0A 3K8ZA 3NIFB 3H5NA 3MILA 1I2AA 2MUTB 1EK5A 2IYUA 4OXIA 1KEJA 1PTJC 1NKEA 1XDGA 3GDOA 5CRXA 5B7QA 5E1BA 1KKMA 1FQOA 2NWQA 3PXBA 2YZKA 5K8JB 4TM7A 5FOTA 4WKNA 1TZ2A 1LQ2A 2FK8A 3IHLA 3ELDA 5BXYA 2NRVA 4BNDB 3ZWBA 1WP9A 3BILA 1P80A 3I01A 4MUBA 4YMLA 1YB6A 2Z1NA 4FLEA 3U0BA 4BLSA 3F6BX 5JBIA 1WW2A 3KSRA 2ZTEA 1BPYA 1KP2A 1E77A 2A9PA 3SLRA 3NM5A 3S2ZA 2ZS7A 5BQ3A 3UXEA 5GJVC 5H80A 4LXTA 2X9QA 5KYWB 2ATIA 3AF3A 5CGZA 4BGDA 1SZDA 1PW7A 2YR0A 1XL1A 1XNGA 4PR3A 2W6OA 4MEYA 3UWMA 4DQXA 4TV8A 1O1YA 3U0VA 3SAHA 3QLEA 3C3CA 1S7CA 5F51A 8ICCA 3S5JA 2CV2A 4BP3A 1U2ZA 3KT0A 4EFMA 3U48A 3NVYA 2W8BB 3MR5A 3DOEA 2VXCA 4C6SA 3W5HA 4ELTA 1U5CA 3PKZA 4E3ZA 4J9MA 1V8BA 1YJ8A 4QBHA 2WF9A 3D0RA 1UK8A 1WF6A 2WICA 4LWOA 2FVXA 5ALEA 3MT9A 4KX5A 2ZYVX 5K03A 3PRHA 2QZPA 2PA3A 3F6YA 2D2FA 1EP2B 1HE8B 1PFYA 5EP3A 2BBWA 2WVJA 4RTLA 3ZLJA 1SD2A 1FLNA 2WF5A 4Q4DA 3H19A 3ZY4A 1V7PC 3LFUA 2I3BA 2CVPA 4K6HA 2C8KA 5AJZA 5JCOC 2LIVA 4ZEWA 2P2CA 3Q8PB 3ZBPA 3IEMA 4GKAA 1B8PA 1R0RE 8AT1A 4GQIA 1PD1A 5GMOA 1OXSC 1EHIA 4KV7A 2FR8A 2JDIA 2JC3A 3BL5A 4F4KA 5FFNA 3SU8A 4LHVA 3WL3A 3NEJA 5K8TA 2X22A 1P1KA 1OXMA 4N40A 3JASB 4R0MA 4ZHQB 4AMVA 2XRMA 3DAGA 2HWXA 3EQ2A 1ZGAA 9LDTA 1P0IA 4N3GA 3DDZX 1DXSA 5FI1B 2P2DA 3EEQA 3KQKA 3RS0A 3WYEA 4QVGA 1T2AA 5F5XA 3F2CA 2WUGA 3C48A 2YDXA 1SVWA 4YO8A 5EL0A 2H3VA 1ZOPA 5KAMA 4XVRA 3UK7A 5B2FA 4FQ5A 3HXOA 2PY6A 2A78A 1Q0SA 2NXJA 3NDRA 1K4YA 1CNEA 3QSYA 4PZCA 3IQZA 1P2GA 2Y0BA 1G8AA 4CLOB 1KA9H 3OM8A 3KB6A 4AZ3B 1E1NA 2HW3A 2F2AB 2PT6A 3E2IA 4TV8F 3WGKA 4J91A 4A82A 1QCKA 5J4HA 4N03A 2HF2A 1Q5PA 4YRDA 1CERA 2BDUA 3QBVA 3PX7A 2CSXA 4WUTA 1JQ3A 4WLUA 4JYAB 4KSCA 1IIPA 4QWAA 1Y1SA 2IPNA 3V7YA 3S8YA 5ECGC 2YHIB 1GY8A 3W5JA 1SBIA 1RJGA 2ORIA 4RY8A 3ZBUA 1W8IA 4W5OA 2YJNA 1EWRA 1ZS9A 2X77A 1N33B 1CUSA 4L6IA 3WKAA 2R9VA 2VAMA 3OIYA 3MMZA 4ZVNA 5FI0B 1T7PA 3W6UA 2JVKA 5C7LO 5AICA 1R8QA 5FJJA 1RZVA 3RFCA 5C1BA 1GG8A 3N2LA 4YCNA 1ZMBA 2WVAA 1BPZA 1IULA 1HYHA 5AK0A 1GGMA 2WM8A 1OB2A 1KHHA 2QVGA 1GRRA 1MJ5A 4HGYA 1ZQKA 2JGJA 4FNGA 1LBQA 3ND6A 3WWOA 2WHRA 2Q1XA 8OHMA 5BSRA 4FFNA 1IOWA 4ENTA 2ZCJA 2BSXA 2R1UA 5CH8A 4MEXA 3M7DA 4U9IS 4ZEVA 2YX1A 2B69A 1W7AA 4B0OA 3IHTA 4ZQBA 2F8KA 2PGXA 1RYYA 3L4JA 4IEFB 2C00A 2QL9A 3ZWMA 4FMCF 3MMPA 2R97A 3WU2U 4Z6EA 1N2SA 5E3IA 5EG5A 4BFTA 1N8SA 3W4IA 3KHHA 1ZNXA 2FK7A 1B26A 2CN1A 3P4XA 3TACB 1D5WA 2TMKA 5IJ9A 1D2HA 5IUNC 4J43A 2BZFA 4C03A 1ODKA 3GMIA 4Q1FA 1OBOA 1SXJD 4QM7A 1GD1O 1WU8A 1ACJA 4PC6A 4RZXA 3D0OA 1YAHA 3GIIA 4EMSA 4Q7QA 2M9NA 4I9UA 1SL2A 3A6FA 3TTUA 2QN3A 1CQXA 5J3JA 3RSLA 1QZZA 1F2UB 4BMZA 4R65A 2C3YA 4HNUA 2W48A 1F9AA 4OBBA 1XZAA 5JALA 1KK3A 3UPTA 2R66A 1Y34E 1MR3F 4QYTA 3G5TA 1ZJ5A 4JGBA 3EPGA 2KLHA 3GCWA 3VR1A 2X9LA 4KO1S 4AQ7A 1JR4A 1LVHA 1E9AA 1MQ2A 4TSKA 4Y2JA 3AIOA 2ZSUA 1R4AA 3LPNA 4MROA 1WB5A 1U3UA 3N07A 2XQVA 1TV9A 2VPXA 1MX5A 2HB6A 1U2RA 4C4YA 2FJPA 1EBBA 2VP9A 2PUTA 4UARA 1VKHA 3I12A 1DC7A 2A3NA 2DM6A 2O2ZA 4PEVA 1JEYA 3LQYA 2O8FA 4Q4CA 4TROA 4GT1A 3QEBZ 4ARCA 4J0HA 2IV2X 4QTTB 2QUAA 4RKYA 4EARA 2X3UA 5E1MA 1T9AA 3AB8A 1IFXA 1THGA 3OOSA 1WBJB 3FUVA 5AVRA 2F6RA 1UIMA 4IRUB 3I52A 4Z4GA 3B1FA 5BN4B 2HDOA 1WBDA 1PL8A 1QRTA 2XWBF 3GRVA 1SHTX 4FUQA 1HRKA 1U2GC 3NANA 1S96A 2XE6A 1X1EA 3PP8A 4YAWA 1EM6A 2CT8A 2B5WA 4B3BA 4HATA 1HGXA 3MPOA 4ZVSA 1M2KA 3RJJA 4K9SA 2BZ0A 1BPDA 2EFJA 3IIJA 2FX3A 5EGSA 3S2SA 4QW8A 1G291 2UV8A 2JCGA 3ZJYA 4KE9A 3SXPA 1CJUC 1E1DA 3F96A 3D8NA 2R4UA 2DPXA 4L3WA 3QKIA 4QIWF 3CJQA 4F8RA 3Q9LA 1SXHA 2G08A 3FPSA 4GX1A 2QG6A 4A2QA 5JMPA 3BQ2A 5C53B 1FDRA 2I66A 3AUOA 3OKPA 2O7VA 5JDCC 1OX5A 1XZQA 4YMGA 4H7HA 3D2NA 4KLCA 3BD9A 4Y6SA 1B6RA 3RH0A 8ICXA 1U8EA 1OBCA 1DOZA 3E9RA 4DWVA 3IILA 2VBIA 5REQB 3ZTWA 1CS0B 3QVJA 4KQ6A 2Q2OA 1POXA 4F0JA 2BF4A 1JTEA 2PK3A 5JSHA 4KGVA 3O8OA 1SBNE 3IVMA 5JG7A 4NY8A 5TVKA 5EWJB 4AFNA 3P9XA 2QR3A 3IIKA 1V6AA 3ZWXA 1R64A 4Y2UA 2Z5FA 3JPWA 3T7TA 3IT2A 2DUJA 2MJLA 3MOIA 3LQFA 5J5CA 5DNEA 5D51S 5KZMB 1GZ4A 3VSDA 3WTBA 5KYYA 1HYBA 4NYIR 1HQCA 3AUYA 4YJGB 1OLUB 4V1CA 3VPHA 3PR4A 3Q3VA 3UMJA 1E1LA 1PFKA 5JS1A 2W2KA 4JR0A 3RRFA 1ZNQO 1OD6A 5T67A 3WGYA 2GPTA 1AGPA 1SCKA 3BIJA 5E8JA 3BKWA 2UYYA 5CA0A 2J7PA 4TUQA 4K9LA 1OX4B 3A4LA 4D80A 1YB4A 4ZAZA 2RB5A 2WWVD 2KFZA 1NVXQ 5CA1B 4CDMA 5IT9A 1GTSA 1CRXA 2XXAA 2X5JO 4JXJA 4EO7A 2Y1IA 2IEZA 5FR2A 3R75A 3MAAC 3JD4A 5E4TA 1G4AE 1ZQDA 1ZESA 2J31A 3UV7A 2O0KA 2VPWA 2ZI3A 5CX4A 1QRUA 1GDTA 1F8FA 3LNTA 1T1EA 5GJWC 1JNXX 1P6QA 5ECWA 3UUGA 5G0UA 4E13A 4MKRA 1IY1A 1N7JA 1QO7A 1E9BA 4WKOA 2KZMA 1GUZA 2HHCA 1HOXA 2H00A 2IW3A 4XGQA 1R6VA 4YT5A 2AUMA 4GH5A 1W47A 4INJA 2OV2A 2F59A 1TZJA 5AVJA 1ARZA 4PG8A 5FL7A 8ICAA 4HL6A 1MENA 1XQ9A 4DHWA 1R0CA 4ABYA 1PK1B 9ATCA 4NBLA 1EFTA 4M1MA 2O5RA 4TMXA 3H1TA 4WBSA 4ZC8A 4I3HA 3CIFA 4FWIB 4UHHA 3E81A 1K7XB 1OWMA 5TGDA 1ZU5A 5KOYA 4PV7A 1TMGE 1L3CA 4HFMA 1ZZEA 2IHZA 2ZTCA 1X6VA 1HXHA 3O2NA 2FV8A 3G13A 3DZFA 3A9VA 1K06A 4IDFA 1OA0A 2IV3A 2IFTA 5BSHA 3CEMA 4UREA 1XRMA 1I9GA 3VKUA 3I6MA 4BV2A 5FLXA 1UC8A 3E9DA 2VN8A 5EHNA 1FNBA 1PFUA 4L50A 4PE5B 1NG1A 5AK3A 4GC6A 4NLKA 1K3TA 2OFOA 1C30B 4YCLA 3IUBA 1A76A 3W1VA 4RDHA 3WIEA 1EXMA 2LV8A 1PEAA 3GMDA 1FQJA 1DPFA 5E38A 3TIFA 1K3FA 2ASDA 3JQ7A 1CEZA 4QNRA 3V9PA 5CFZA 4CMEC 3LLVA 5CA0F 2EQYA 5LD2B 1JHXA 3FWHA 2NW6A 1TAMA 3SI7A 1R9GA 3KVYA 2Y66A 3FVQA 1SVUA 2EANA 2PX5A 1E69A 1UWCA 3MJCA 3JS5A 1DFIA 4HQKA 2Y76A 2QRQA 4E7OA 3NAMA 4MMZB 1OI2A 5ALYA 3GT4A 4L9WA 3WGNA 1LLDA 4TYNA 4UHJA 2HHJA 4O2BB 1CU1A 3EVZA 2CLSA 1AV6A 5A4FS 2KSOB 3MR3A 4K86A 2XO7A 3VR3D 3WX0A 3HEBA 1WCV1 5JQGA 1JROA 2ZWMA 4IHQA 3FUUA 3WNZA 5HIJA 4GWLA 4HS9A 5IZ4A 5D86A 2VDRB 4URWR 3C6ZA 1U1EA 5IBRA 3F5AA 3T3EA 2DKFA 1U04A 5HHTA 1KOLA 3OD5A 2R6JA 3VZRA 8ICRA 1DQNA 2P9HA 4ZRMA 2IUEA 2PU7A 3E22B 3D5TA 2OP1A 1KRPA 5JECA 3ZD8A 3PHJA 1ZCJA 2E4AA 3KHKA 1B42A 3EXAA 4IDNA 3WL4A 2Q29A 4BQEA 3WGMA 1E2FA 1HKUA 5K8LA 1ESNA 2ZJ5A 4AJ1A 1JPNA 3DKVA 2HQRA 3ED1A 4MVJP 4WRRA 4N76A 1BXGA 3JYOA 4HXYA 2H9AA 3T9FA 1AU9A 3WV5A 5K0ZA 4DL6A 4GSKA 3AU2A 4W9NC 3WLRA 1M2VA 5IVPA 5IN5A 3T1HB 3GUHA 4GXQA 3KZKA 3INRA 1Z4MA 2H0RA 3ROPA 4TQRA 5M29A 2WUWE 3KEGA 1GPAA 3SDBA 3TSCA 3R7WA 3KEQA 4MQMA 1HEIA 2FAXA 1U1FA 1Z7YA 5I51A 1Y82A 1O57A 4OXXA 2I3AA 3BXFA 3T4PA 3WIBA 4BDTA 3TJMA 2G7ZA 4Z0NA 4A5OA 1H2AS 1JBQA 2ESEA 2C2OA 1XXLA 3I5XA 4M8KA 3IFSA 4FQ8A 3TX6A 4IICA 4X1YA 3IURA 1K7EB 4ICAA 2DYKA 2DC1A 2OV6A 3GD7A 2DFKB 1G21A 1PZEA 1P1BA 4PGYA 1BE8A 4GR5A 4IJWA 2F67A 1GV1A 2OYCA 3ZU4A 2AG5A 4JASB 2A1AA 3CMMA 2IYEA 4MUXA 1SBYA 3R8FA 1NN5A 5I7VA 1QZXA 2AHRA 5TMPA 4O63O 1V1JA 1UJ4A 4PSVA 3UOWA 1I1NA 1TRKA 1LDGA 1U8YA 2JGLA 1ZCZA 3RJIA 3MQFA 4BWVA 2J6SA 5KFJA 4K4HA 5JQGF 3R0XA 2YVAA 3SZUA 4L1KA 2I33A 4ZJUA 1K68A 2DQSA 3ZX5A 2WJHA 4ZVMA 1Y37A 1I7PA 4DABA 1Z25A 4C7BA 1HSOA 5JI3E 4BB9A 1OCEA 4I4TA 4H7DA 1DAFA 2QARB 3O38A 2PMBA 1I3KA 1YR3A 3KVNA 3T5GA 5BWOA 3FYTA 4ELVA 3FBTA 4A36A 2R6DA 1GZ5A 3UBTA 1A2OA 4O59O 2VEOA 1KYVA 1MNAA 5CYFA 5JD5A 2CD7A 1ZG3A 3BHIA 3L79A 1U0GA 1Z5GA 3IJRA 5IAKA 4HPJB 2XNHA 1IIRA 2GKOA 4MVJD 5IAEA 2WZQA 5FO1A 1SCBA 1FSZA 2PKEA 4PG5A 4E5SA 2G1AA 2Q5EA 1FIUA 3LKBA 2AS0A 4X60A 3AEQB 2Z98A 3HCEA 2PR2A 4J7XA 3WMRA 4ZEMA 4CT5A 3D7SA 4Q1DA 4B80A 2NYUA 1LDBA 3SENA 2X5XA 1NBAA 5IFKA 3R9KA 4EG7A 3OKCA 1QWSA 3NYQA 1B4FA 2PYIA 2Q6IA 1R10A 4DV2B 2LYHA 5D46A 2FPOA 1NQWA 4PG7A 3H2BA 1GCAA 1YZKA 1N9GA 1ST2A 4FTWA 1M1ZA 5P21A 1D9DA 4FZ3A 3CHYA 4RPIA 1SCAA 4Y2YA 4KGXA 4XDZA 5CD1A 4XRRA 4CUKA 2KFNA 5K2OA 3P9IA 5IBPA 1A5ZA 5T4FA 3ZGNA 4WDRA 2P3LA 3NHBA 2ASEA 1UDXA 2JGEA 3Q9SA 4QU8A 3R8CA 2PTGA 4LNUB 3JZDA 2HHXA 3PUKA 1JDVA 4QE3A 4ZV7A 3DBRB 4KI0A 3GDWA 1EFRA 2DU8A 4P4PA 3WFIA 4CKBA 4ECRA 3ABSB 2AG1A 4CDRA 4CF6A 2QYHA 2OQVA 4H31A 3TG8A 1H8HA 3MCUA 1O6GA 3G2IA 4I4TF 2P0YA 3ENVA 4HGNA 2Y1GA 3QI7A 2OHVA 4IIYA 3WGOA 2NMVA 4URFA 3FWYA 2JGMA 1SBCA 3U4GA 5KJ6A 3IQEA 1T9DA 4ETWA 1MUUA 5DHUA 4X00A 4QECA 2EKPA 2R8IA 4NFHA 3L1VA 3PE6A 3WWEA 4HX9A 1M8PA 4OBEA 2QWXA 3O4HA 2Z8XA 1G5QA 1EWTA 3ORHA 4IP0A 5BWNA 1WM1A 3VPCA 4DDUA 1L5MA 3LQ2A 2R3SA 2LCFA 3AG6A 4G09A 4KUEA 2RHMA 2XNCA 5FO0A 4XKJA 4JUBA 3MAGA 2YYZA 4CLDA 4BE9A 2QLLA 4YHBA 3QX9A 4BNGA 3ODPA 3AVXA 4YUYA 1BG6A 5JSQA 1N62A 3A2NA 3KJGA 4HWTA 5E6SB 1Y5IA 4U2KA 4C5AA 3I5YA 5J40A 3H17A 1BJTA 4B81A 1I30A 2C5SA 2V97A 2H1CA 3GP5A 1L5OA 5HX7A 3Q10A 2GMWA 3ZIAA 3KLBA 3C1TA 3OZRA 4F5OA 4EJ2A 1W48A 3ZJ5A 2OSVA 3S99A 1N6KA 4BL5A 4JR1A 3EZ7A 4P22A 1RCFA 3LFHA 4UEWA 2AKEA 2JEIA 2JGAA 3RYIB 3X3HA 2CC2A 3S29A 1K1SA 2O7NA 4HQFA 1NUHA 2XCUA 1GCOA 1QXSA 4D9MA 2L5YA 3TTWA 1E9FA 1HUQA 1E2UA 2I91A 1UZLA 4DL4A 3COWA 2RHFA 1J0DA 1AT1A 1CW2B 2B61A 1PDWA 4DDWA 1ECGA 2NXEA 2EJVA 3OPXA 2CCJA 4ZCLA 4XQ9A 3AG5A 1O5IA 2CXQA 4FC6A 5AKKA 4PYNA 1KZ1A 1JS1X 1N8TA 2ZBPA 3QA9A 3X1JA 3AH8A 3SYTA 3QPWA 3ZHRA 3UH0A 4DVJA 1N6IA 1P60A 4HH0A 2R8YA 4C0SA 1S0VA 1H05A 2NACA 1BXRA 1VJ0A 1YZYA 2N0SA 2UVPB 4EG5A 2W8KA 1QGUA 1F8GA 3C0KA 4Y1RA 1PJ3A 2B34A 5FOVA 5FQNA 2KTQA 4MJLA 2VAPA 2ZJYA 4B1FA 4DJEC 2MMGA 1NW9B 4ILKA 3EJWA 2BI4A 3D2SA 1QLWA 4KDRA 4K4IA 1XVUA 1KR2A 1GQSA 1Z47A 1F4VA 2ORWA 2VH1A 2F43A 1EX6A 1JI3A 3KUXA 2OWEA 3FB4A 3HP7A 4JGGA 4R7GA 2KWIA 3M6MD 4FIZA 3KV3O 5A3VA 3JAWB 3C8DA 5PNTA 3G88A 3TZ6A 3T35A 1NVVQ 2ZDQA 3BTOA 1NNEA 1UMBB 5H5JA 2AF4C 1NG9A 2R6R1 1Q3HA 4BNWA 4RGYA 2VSFA 2R6GA 1JALA 4HGQA 4B87A 3BHJA 2OGUA 2J0UA 2C2WA 2WIDA 4ZCMA 5DW3A 5HWSA 3R7BA 3DV2A 1YE3A 1KERA 2ZYHA 1XMQB 2BP7B 1QDEA 2ZB4A 3FA2A 1UBNA 3AB7A 4H1HA 1O97D 4Y6QA 3PLRA 1P39A 3EOAI 1BD3A 4Q02A 1VDMA 3F98A 1QF6A 5CDSA 4ZVQA 2J3EA 3WMEA 1DOHA 1QDUA 3C1YA 3IBSA 1W85A 4O6VA 4TMTA 3R09A 4REQA 1T1RA 2X3YA 3SOZA 4L78A 4JI4B 4TOIA 1I1QB 4E4TA 5AMXA 1T35A 2CDBA 4LWQA 1T4BA 3NB0A 2QP4A 2BDTA 4C6TB 1NDHA 3WKDA 5BRJA 1W5EA 3G5UA 1NR5A 4GOKA 2AGVA 3BB4A 3A2KA 4UB1A 2V3CC 5I8ZA 1RXIA 1VZ2A 3VPFA 3EIHA 3L4SO 4OVKA 3LLCA 5T6MA 4Z6DA 1QR2A 4A1OA 2FMXA 2O57A 4FXPA 2I7CA 5JRJA 4P83A 1B6GA 1JWLA 5KFOA 4E46A 2BH2A 4IH9A 1X40A 1COZA 2ES4A 2XUIA 2IDKA 5J2TA 4BMVA 4ZU6X 1W9MA 1BEUB 4D8XA 4YRRA 1QB7A 2B7BA 3TYXA 2KM1A 2W2XA 5TGTA 1WLYA 4M1QA 1GZDA 3PHHA 4URVR 4LVCA 4BECA 2GZMA 5EPUA 4RD2A 3C2KA 1DXHA 5IJ0B 4TGLA 3HU3A 1RRMA 2IY7A 2X0RA 3V4ZA 4F1KA 1YR9A 3RJFA 2MMCA 2X6TA 4UU0A 1LBHA 1P3JA 2XGPA 1YAJA 4FDLA 2VRNA 2GASA 1M1YB 5EJEA 3GUYA 4YRJA 4A6EA 3KSMA 2BBTA 3PV0A 4Z9YA 4BJ1A 5JCZA 1FVXA 2QTNA 3HJTA 2BH9A 1PL7A 4EWLA 1ZK0A 1J07A 2CBXA 2AK3A 4I1IA 4RZSA 2I4LA 2RI6A 2H6EA 3LZDA 4NZOA 4ZOCA 3NASA 3LQQA 1NR1A 4ZEXA 2QX6A 2AI1A 3LVVA 2X1LA 1T4GA 4HDKB 1LI7A 4BVJA 5KG2A 3L0DA 4FEYA 4BX0A 3TIIA 4R71A 3ZK9A 4G0QA 3T6KA 3GJQA 1Z2NX 3WA6A 3JPNA 5DIZA 3UG6A 1OZ0A 1PJBA 3DUFA 4QLAA 4WNIA 1KH2A 1JHZA 4A8TA 1IQUA 3LCVB 2O50A 3DL7A 2E55A 4I4IA 4I46A 1YQTA 5G1OA 3NVDA 3VPGA 4P38A 4DO9A 4LCBA 3PSAA 3TLGB 5FPSA 3V48A 1CY4A 5HZHA 3BIWA 1FOEB 3N0XA 3EYAA 4F3NA 4QT0A 2W5UA 4BLWA 2Q2WA 2AXNA 4CCSA 2MU1A 2Q5JA 5AW3A 3AW9A 3GEEA 2FKNA 3RFAA 2UXCB 3RVNA 5DGXA 2PS9A 1IK4A 2BOVA 4MZXA 2B98A 4K81B 4B6JA 4JP8A 3BXGA 4RSHA 3UHOA 4R8UB 3H04A 1S2NA 1JFFB 4XEUA 2GCGA 2FQ1A 2ZRJA 1GN9A 1EDDA 1ZOSA 3O0DA 3SIPA 3E5NA 4GOLD 4RNCA 2CYAA 3KKNA 2WDZA 1QIMA 2VA2A 3HCDA 3L4BC 4QSMA 1E2EA 3ZDCA 1ESEA 4DMFA 3CH4B 3C85A 3V3TA 1G59A 5K09A 2HGSA 2ODWA 4PYMA 1T2FA 1Y7LA 2PGJA 2ZSKA 4RJLA 3KJHA 1DLIA 4AJJA 4KR9A 1ZVQA 1M8JA 4HSEA 3EW7A 2V59A 4PYKA 4WJKB 1H2FA 1JL3A 9ICAA 3P94A 1BMFD 1LPSA 6Q21A 3LWLA 3B0YA 3JALB 4CHTA 2UUAB 3MWDB 2VP5A 5E95A 2F3SA 3C28A 2WNHA 3R3YA 2YXLA 2W2LA 3Q7QA 1T6NA 3KPWA 5LBIA 3HXMA 2QVBA 5CX1B 2YL2A 1THMA 3PWKA 2ZP1A 4PGXA 1CEEA 3D54D 1ITZA 5CTJA 5EJ9A 3I01M 3TZEA 2J5RA 1Z4JA 1M0WA 4JXKA 1BNOA 4FDUA 3IERA 1X0VA 4C8KA 2B8TA 1HR0B 3HBJA 2BPGA 3ELWA 2WPNA 4L0MA 2WP8J 1NW3A 2PSSA 1ZVMA 4DNPA 1B8VA 2FSFA 3BFVA 4UKDA 4RZRA 4MYHA 2GPBA 4LY0A 3VR6H 1JILA 3H5AA 1S8AA 2AYZA 1OGYA 1XEFA 2ZIWB 1U8XX 1JAIA 3ZD9A 1LX6A 1L7XA 1LZKA 4YREA 1Z6QA 3TNLA 4WN9A 1BFUA 2V54A 1ZIPA 1YOVA 1STOA 1SVMA 2GLXA 2DWOA 5K3AA 3EXFA 1ODFA 3RSZA 1E4OA 2O2SA 2NT3A 1QOZA 1UMKA 4I55B 5E6UB 4WSOA 4AVYA 4KO8A 4RLSA 1P9WA 2VBCA 4UVHA 4EYSA 1CZNA 3UK1A 1AY0A 4LZOA 2Q1YA 2VSQA 4CIXA 3LF1A 2NUTA 2XECA 5ELXA 4D8WA 4CCWA 3A9TA 3GLUA 3Q8XB 1XTKA 3LA8A 1N2CE 3CSDA 3V1KA 3EEOA 4MW5A 4BEBA 3C4JA 4I28A 1U3DA 1TCUA 3H4IA 2QMHA 5SYNA 1KEVA 4CRWB 4LE0A 4AN0A 3LL4A 4NIMA 2ILVA 4JL5A 3K0FB 5HR6A 1DUVG 4MSUA 2NO1A 4GNRA 4KUHA 3WRWA 4EZEA 3VU1A 3NATA 4TKZA 4QYXA 1FBTA 1T0JB 5I3CA 5BWCA 4D4MA 2IEIA 3DP9A 3IR6A 3QOWA 5EE3A 4G5SA 5EE1A 2WUFA 4PO9A 3DYVA 1S2IA 2ANCA 2EH9A 5JHGB 4BNNA 4U7DA 1NURA 2PXCA 4P53A 5HBRA 3KR1A 4GSLA 2C5EA 2HH9A 5JNWA 5FEUA 2B1GA 2XBMA 3S2GA 4LRYA 3PPVA 4X0EA 5FA5A 2R1TA 3A0BU 3HYLA 2HT6A 4EMUA 4KXFB 2W6PA 1AKVA 2AXTU 3GELA 3OZAA 1HL3A 3EA4A 3T34A 2DGZA 3SC2B 1N34B 3PS9A 3E05A 3TOVA 4MV9A 5EN4A 3ZCPA 4LRQA 2QP3A 4RANA 2QX8A 1ZH8A 2HJ9A 3IVRA 4PYQA 4NEQA 4LZWA 3U19A 4DBLE 1UBRS 1E1QA 3SAJA 3BK2A 1BQ4A 3KR0A 2RCYA 1UQVA 3BCSA 1DAMA 4F5DA 1WY7A 1VCMA 4MWTA 4RD3A 3EH1A 1HQYE 4EEZA 5BW4A 1PJ8A 2GZ3A 4EECA 3AQIA 1CE8B 2IYRA 8ICUA 2Q2VA 4W8OA 4RK5A 2H2DA 4JJFA 2Q3BA 4A0RA 2E82A 2C95A 4UTPA 3RV3A 4CCYA 1GG2A 1XJ5A 1CB0A 2Z2YA 2RD2A 5IILA 3EFOA 4UFNA 3IJEB 2Z4TA 1A7JA 2KJQA 3KTAB 4DLPA 2E8NA 1JSLA 2FW6A 4XIYA 3PZBA 4X71A 3OO1A 1OX6A 3B2EA 2NUPA 4ERNA 5JS8A 4GYWA 5FYQA 3MYYA 5DTIA 3IG8A 2VNKA 1G5PA 2RGNC 1E6EA 1NVEA 1SA0A 4KGDA 1I3MA 1NJGA 4JYBA 3C1UA 3HXTA 3PGA1 4KHPB 3FTDA 2XI9A 4MUHA 4ZI7B 1IBLB 1U63A 3QRWA 4RSRA 4JJ8A 3GI1A 4XYMA 2GF0A 3B9QA 1W4ZA 4XPIB 1E1RD 2AFHE 4DARA 8ICMA 5L4SA 4EZBA 2XD4A 4X6LA 4TTTS 4R1NA 2QQ5A 4RMIA 3NEAA 5JS7A 4K9KA 4B4WA 4AY6A 2DWCA 3NONA 5EYPB 1Y4DE 2E48A 4U6NA 2MR5A 7ICMA 4D97A 2CMKA 2NQTA 4TTPA 1C3EA 2E87A 5F98A 3TAUA 5HJ5A 1P45A 4PW0A 2XY7A 3GPCA 4F3CA 1D9XA 3OZVA 3PZPA 1L1RA 1HDRA 1RKQA 4LJ8A 3UYLA 1M0TA 1SC1A 1H4QA 3DAPA 3KU1A 2IL1A 1CY7A 3RHTA 1GQYA 1YVRA 9ICVA 3TD9A 5KSOA 1QAMA 3VR4A 2XDQA 5KX5A 3ENZA 4DQPA 3F2IA 1QBGA 1JEJA 3DDUA 2PFSA 2W6JD 3ZCQA 3BCHA 3O1JC 5TB5A 2XZTA 4CG2A 5KTQA 1EFUA 3RAPR 2YY5A 4CKCA 2ZWOA 3E1KA 4RABA 3TLZA 3LU1A 4OXYA 4D9JA 3HFRA 5LL6P 5AHWA 3T7AA 4W7SA 2G9RA 4MDFA 4DQQA 2VF7A 4PGAA 4RQ0A 1SBTA 4IDGA 5DQGA 3OF5A 4L08A 1T3QA 4PH5A 4JQCA 1ZM4A 4JIGA 1NZFA 4ALMA 3OM0A 2I3ZA 3T94A 4B7CA 3OMWA 1A4RA 3RWBA 1KVQA 3ANTA 1LPNA 3HBNA 3NT5A 2IA6A 3M4XA 3DMYA 4OF4A 4MQEA 3PWSA 5ICGA 5AXDA 1UINA 4DWOA 1SC4A 3N8DA 2WYOA 2G3YA 3KR9A 3O9MA 1BAPA 1X7YB 5KFQA 1YRQA 3RWMB 3HCWA 3SF0A 4MS1A 3UMVA 5FHRA 1U7XA 3V6LA 1QOQB 3DDSA 4WI1A 2OBLA 1A1SA 4LF7B 4F04A 3OPYI 1UR5A 4X8MA 4KXNA 5CXQA 5K6RA 1Q50A 3QPDA 4LX8A 4V0MA 2ZTHA 2P6NA 3LHFA 3OCJA 2QNIA 5KJEA 1XZBA 4J1QA 5KSWB 2H2GA 4HDRA 2UYHA 3LVQE 3GLGA 1WSAA 3BMCA 3ZZ1A 3H75A 2HHUA 1Y33E 3IE1A 1BU5A 1NVDA 3AF6A 4RVFA 2H1LA 4G8CA 1E92A 3VDMA 1Q0TA 3RHFA 1UJBA 4E33A 2AQ4A 5IJXA 5CBKA 2VYQA 2HIGA 3EUAA 3H5VA 3TJRA 2PN1A 1OE0A 3AUTA 3HGTA 5F4ZA 1Z0JA 3P9YA 1ZQEA 3ROGA 1WMDA 5EWLA 5L7YA 1VMAA 4FDMA 4N65A 3LX4A 3SN6A 1P1JA 1K4MA 1DEKA 1T29A 5EIBC 3HO8A 1Z39A 2BMDA 5AK4A 1F7VA 4IRMA 2WABA 3TRHA 1H2ZA 4G0PA 3SVTA 1CLEA 4EJSA 3BIOA 2IEYA 3EK2A 3D1VA 4MPTA 3W5IA 3SV3A 1L3TA 2GJSA 1QCYA 1UBHS 3U1BA 4FGLA 2YJ6A 3KRTA 1CR4A 4CZ2A 4TKMA 3LMKA 4BNIA 1B22A 1VFPA 3BQNB 4IIFA 2EYQA 3RG8A 2OXTA 4C8LA 4H6XA 3ZDAA 4LOHA 2DKZA 5DT9A 3E6AA 3AVYA 1NOIA 2EOAA 4XYBA 1ISIA 1WYGA 3I72A 1VLMA 3FROA 3ZE0B 4LF9B 3A9WA 4JI5B 1ZGHA 4XB1A 4LOLA 2QF7A 5E1OA 2AQ0A 4EKDA 2OFPA 2H4FA 5KB3A 2HEIA 4OQYA 3PR3A 4M9JA 1H65A 1PSZA 1FRQA 3O7MA 1M5TA 2CDRA 3EIQA 4HZUB 3I3SR 1KSGA 4DLZA 5C5JA 4KLSA 4J2OA 3T06B 4ARIA 3TR6A 1YZUA 1YV9A 1PT5A 2TMYA 5J2DA 5MGBA 5C52B 1U99A 1WZUA 3SYNA 4I27A 1UFKA 4AY4A 3GXBA 4QAJA 5ELMA 2I6FA 1Z5ZA 3OIWA 2SKDA 2Y71A 2LW7A 4G5OA 3TSAA 1EDZA 2II6A 1T0PA 3QVMA 3G8CA 3GJXC 4N3NA 1XI2A 3NOVA 1FJGB 1F17A 4HLNA 3SY8A 3CRZA 3M8RA 1RJDA 4JLWA 4EK9A 5G1NA 3HSSA 2ZR7A 3C1ZA 4KREA 3O8LA 1CR2A 1SXJA 5EXXA 4PZEA 1VPWA 2HU2A 4NBWA 3A26A 2D4AA 3CS3A 2IZ6A 5K4LA 1ZQZA 3VZDA 3BD8A 1N2GA 1S2MA 3JAKB 4BC1A 4DANA 4O25A 3EHEA 3THWA 2V7EA 2KJ9A 5CG1A 3FBWA 3WQBA 4ENWA 3EIEA 4DWWA 3N6VA 2VKQA 1SQ6A 4YDSA 4CKEB 1P0FA 4LQDA 4DIKA 1CEQA 1HKHA 3ERCA 3X1XA 2OV3A 4O08A 1JPVA 3QF4A 2NXCA 5BMOA 3N0VA 2DWPA 5J0UA 4JLDA 4RD0A 4QYIA 3MBIA 2VL7A 2OFWA 1YRYE 3NVVA 1I7LA 1SU6A 2J4FA 1O77A 4ITUA 4OG2A 4GUDA 4FR5A 4EGFA 1O94C 1CI4A 1UP4A 2WKQA 4C7YA 1H5QA 3TR5A 1I14A 1U80A 3Q15C 3L43A 2ASJA 1U3TA 4ZMBA 3EGVA 4I2EA 1RRGA 4B5KA 5SICE 3LP5A 5THKA 3TD6A 4C7MA 2BZ1A 2B1QA 5KAPA 4YCBA 2C83A 5AI6A 3A0UA 1Q44A 3DQQA 1HNXB 3TVTA 2O7RA 1RYUA 5GAJA 1J6UA 3BSWA 3GQBA 1KMHB 3IC5A 2EU8A 3OOYA 4XXHA 9ICPA 2PVSA 2O05A 4EBEA 4MFAA 5IINA 1TK8A 1L2TA 3DLIA 4KLEA 3EPJA 3V6KA 5B12A 5EJ5A 1D6MA 5B1YA 2F9MA 2ID9A 2OO3A 4L4RA 2O8EA 4C05A 1KQGA 3P8ZA 3FSJX 3AVVA 4EI2A 2O1WA 4FZLA 4Z1MD 2MSKA 3R3HA 2BEUA 3OEED 1R0ZA 4ZWNA 2F1IA 1H3FA 4C0HA 5EWFA 3SQNA 5EERA 1YTUA 3B6ZA 3ZNOA 2JJYA 4YRAA 3HFSA 3NWEA 4KV9A 5AT1A 4RHFA 3L7NA 2NT4A 1ONPA 3M5CA 4ZK2A 2KZ3A 2IHTA 3KQQA 4PN3A 2VWGA 1N57A 5LXTA 3L6EA 5HK9A 2QX9A 1M8KA 2REOA 1H2XA 3HB9A 1A2BA 4MR8A 2GN1A 2JVJA 4WKPA 1SJ9A 2WFZA 5G0WA 1DKNA 4HN9A 3GPDG 1CULC 3QOYA 4YMIA 3AERB 1A6SA 2BFCA 3NYWA 1ODIA 2QX4A 4P4OA 1YKFA 2IK8A 2WSLA 4K2HA 4NSNA 4A23A 4PRLA 4H77A 2ZIGA 1OJLA 3OZBA 1J0AA 1Q7TA 4CTJA 1LJUA 3R9WA 4YLYA 4Q9DA 4ODIA 3WY9A 2COKA 3IKMB 4DLLA 1Z6XA 4GC7A 3GG2A 3BJRA 2PQ2A 1E1CB 2X8LA 1NRIA 1R8SA 3IOEA 4FGJA 3TTTA 2IS1A 2WTUA 1H8ED 5CPBA 1N8NA 1YZHA 1NI4B 3BGVA 2HDNB 2IDMA 3TQQA 4RESA 5B3JC 5BN3A 2O9JA 4DOCA 3QJ5A 2GNPA 4WK4B 3V4RA 4M87A 1UJ6A 3JR3A 3MR6A 1XZIA 2PSHA 2WHYA 3GIJA 5LOVB 4P86A 5DB6A 5LQSA 1AZTA 2ZBFA 3PHLA 1H93A 3QUSA 4OYYA 4EB6A 4BN0A 5KYXA 4BMDA 2G28A 1MVOA 3I4LA 4PSUA 2KICA 2JEYA 4OLFA 3SV4A 3KTFA 3G2NA 4F46A 4ZKEA 3Q85A 3NHMA 2IUYA 2IPLA 3OJFA 4GZLA 4PZOA 4D57A 3JTEA 2R7NA 1RXWA 3KQSA 1UXHA 2GAOA 1B0PA 2ZRHA 4JJGA 2I6QA 4M76B 3SHVA 2HRCA 2ICAA 3Q3JB 4X1KA 2PPLA 2NSJA 3NRZA 3AF0A 4ZQCB 5F2KA 1KJZA 4KVZA 3I2FA 2FDCA 1BX3A 4YJ2B 4BNFA 4OD0A 4HMOA 5H16A 2J46A 4L72A 1IZ7A 2PBLA 1FW8A 4DV7B 1LF0A 2CFSA 4M0LA 1BHSA 3NHAA 1NLMA 4KLFA 3RYFB 2OV8A 3QYPA 5AK5A 5LXTF 3STWA 2VCHA 4JC4A 4LDQA 4MYUA 4R9NA 3NTLA 3Q2KA 3V34A 2CNOA 1FYFA 4XFKA 2P9CA 4HB4A 2W3SA 1ZGGA 3H9EO 4UUBA 2YC4C 4LJYA 2VF4X 1B93A 5K0GA 3PQ5A 5EXEA 4Z4HA 4Z6CA 2FY8A 1CQJB 4XYGA 1K8XB 3ON5A 4AO8A 1A9OA 2JK0A 3ETDA 2WF7A 1B8UA 1RNLA 4G1FA 4CEHA 4LBVA 1J8QA 2B8JA 3BE8A 5CM9C 1DX9A 1DI0A 4LE2A 5CT9A 2JI6A 4DBLC 1W4LA 5DB8A 2YFYA 2C2YA 4LWPA 3HN7A 1CBUA 4B3CA 3BM5A 4BLUA 1KVSA 4DSEA 4AT1A 3NOXA 4FSDA 4RHUA 1W36B 3IDZA 1FTWA 3MM4A 1RG6A 4DSUA 2R7KA 5LC1A 1VE5A 4J76A 4UJ5A 4FI3F 5J58A 1IV8A 3MWFA 2VDPB 1M2OA 3G0BA 4LY3A 3N6RA 1J8VA 5BVHB 4RS4A 1MVNA 3TEJA 4TVSA 3ZY2A 4HTFB 4WESB 1QTRA 3OF2A 1DG9A 4QOSA 1M1XB 1X9MA 3EPRA 2NOAA 4QWBA 1WETA 5E2IA 1UJMA 4P84A 1R6DA 4NAHA 3HWWA 4NDNE 4BQQA 4V2UA 1AN0A 3UAGA 3HR7A 1RWXA 3D2BA 3ZVLA 2GSDA 1GPNA 1WD5A 3GD5A 1F6BA 4M83A 4XLLA 1S01A 4H0CA 5G4KA 2GEDA 1EDBA 2FQWA 1QPZA 2MSLA 5DQHA 1DO0A 3QBTA 4PSAA 4P7BA 1IM8A 3ND5A 2G80A 4WEQA 3LY9A 1H2HA 2QTZA 2CFTA 3RD5A 3NS7A 5DYGA 5DIFA 4O2AA 4MA0A 1AMNA 5K2MA 2VNHA 4YJ3A 2Y0DA 5FPPA 2QQFA 1NNI1 4F21A 3HB0A 3VYTB 3JVIA 2XNSA 5FOXA 2ZJFA 4BMNA 5K3CA 1EFPB 1Y3IA 1SKWA 4JLNA 2Y8EA 1ABEA 4UE6A 3WFJA 4QXOA 1I5OA 1Z6YA 4OHWA 2JGIA 1XKXA 2FCRA 4AKHA 3NGMA 2O06A 2WPDA 2ZDGA 1S3FA 7ICUA 3ECCA 3TNJA 4N41A 2P2ZA 4ZVLA 2GPAA 4E2FA 1WTAA 4JVNA 1T43A 4FM9A 3VV2A 3EN0A 1ULAA 1R6UA 2B6HA 2FG5A 4OJMX 2WY2D 3RARA 4M4SA 3H3XA 2XB8A 3L8ZA 4LTNA 3M6KA 3B53X 4RTMA 3HNOA 2AZDA 2O8DB 2O14A 2IYTA 1TZMA 5DTJA 4A27A 3SJZA 4L5BA 1YDGA 1XPJA 5DEOA 4JBLA 3ILVA 2BWJA 3B3JA 2IDZA 1I3CA 4ZT2A 2ZYWX 1NTOA 4OGWA 5GV7A 4FT4A 4MQUA 3WXBA 3KYIB 3ZDXB 3RC1A 5AP9A 4G81A 5HCNA 2Z4SA 3AVOA 4M0PA 2XUQA 1QORA 1WCWA 2W8LA 5KYNA 3HGQA 4CW7A 1MJHA 1MO3A 2QYTA 4BVGA 1MO2A 1CJCA 1XQVA 1ONBA 1DU4A 5JTIA 1NYQA 5HNKA 2PL1A 3RIEA 5A7GA 3D3EA 3OOWA 4IXWA 2D1SA 3M9MB 1L9XA 3NBZC 3Q8QB 3PHIA 3W34A 3CT6A 3CYMA 4YXWD 2CFCA 2SKCA 5BMVA 2I1WA 4R0NA 4C29A 1O95C 3NORA 2VZ8A 2EW1A 4E94A 4EBDA 2AKAB 2V1UA 1QIGA 4IUCS 4BYGA 2C0PA 3LX5A 4A0GA 4MS3B 2OO5C 1XDBA 1L7VC 4ME6A 4LCJA 4O2AF 5T4HA 4YH1A 3GB9A 4RL4A 4AX8A 1UJ2A 4YJ3F 4YP5A 7YASA 4CN9A 3BS5A 4CLHA 2P4HX 5K0SA 1A8IA 1MOZA 3EULA 1XHFA 3X0DA 2NRWA 2Q1SA 4G3XA 2FVYA 1T2VA 1ADJA 1JW9B 7ICSA 4PBRA 4KL8S 4NLBA 3ENNA 3H11A 1BD4A 2G88A 3GCGA 2GT1A 3NKLA 3KOMA 4OQMA 1UK6A 3K92A 1ZQ9A 3HVKA 4KIUA 4RQ4A 1D1PA 1YFZA 2FEWB 2P6OA 2QGNA 1KYYA 3HKBA 4MVJA 2IHMA 4GGOA 4NARA 2QYSA 4KK4A 1X77A 3EC7A 4IUDS 4RKRA 4L4SA 1K1EA 2R7MA 3KJQA 5HHHA 3QWBA 1RRKA 2QNRA 2X1MA 3C6BA 1M9NA 1PP4A 2AWOA 3PI6A 2WG1A 2QAJA 4CQMB 3IDSA 4AF7A 2IMWP 5FT9A 5K5EA 1YHNA 3D6HA 3GFBA 1IHPA 4ZFNA 1ODTC 4RK4A 1DO2A 4BMYA 1M34A 1E7YA 2PKWA 4XRGA 5AW6A 1WKCA 1K4KA 4EEYA 2ENWA 1XCMA 2FN7A 5AVZA 3SPXA 5EMHA 4B3SB 2LPEA 1SB8A 3IPXA 2ZE5A 2BY4A 2NVUB 3T7CA 1ECBA 3T5KA 4M7OA 5KNBD 5IAOA 3QKRA 3AESA 4FD3A 4MR9A 3UMMA 2XAUA 1SR8A 2H3ZA 3OZEA 1Q0UA 4HNAA 5BMVF 4QZHA 3F5EA 4H1TA 5IT5A 1FUIA 1EVKA 3HZOA 4E70A 1ZIOA 3ENWA 2ZU6A 3AMVA 4Y2QA 2J8ZA 3JQFA 3G1WA 1ZONA 1Z19A 2WINI 1Z3IX 2G06A 4U7WA 4GW3A 4A8PA 1OWPA 2ZTDA 4ZMSA 2INGX 3G8YA 4ETNA 1Q7RA 4MS4B 4ZO4A 3K6SA 4X45A 5WRFA 2PL9A 1TAGA 1M72A 1JKJB 4TV9A 2JCXA 1J8DA 2LM4A 3JWHA 4GECA 4LHYA 3HW8A 4DFJA 3L18A 1JV2B 3R41A 4IOLA 4BRWA 1XVVA 1CUWA 2E5FA 1K66A 1X1BA 4RJJA 2BLLA 3N70A 4YUVA 5A6SB 2R1VA 3F3MA 4MFCA 3EUEA 4MVJF 3QUQA 4LI0A 4EYGA 4DS4A 3VAYA 5AFSA 2AQIA 3U7JA 5AVQA 1A97A 1NF2A 1JIIA 1S2DA 5DV9A 2XICA 3LOUA 3OE1A 3H4MA 3AXSA 2L0XA 5FDFA 3ROQA 2GVNA 3KLOA 2QMQA 4RTQA 2WHQA 5KSZA 1ZCFA 1VE1A 1RYBA 1LSJA 2QHXA 1Y81A 5LLSA 3A1NA 2PGIA 5YASA 4YO7A 3D3WA 3RTGA 3DJYA 5IVIA 2DF4B 4FHEA 3DSRA 1WDTA 2PBRA 5TX7A 2HSWA 3IP5A 5JNSA 4UZFA 1LQTA 1SZPA 2WZCA 2ORYA 3W2EA 3SC3A 2AEMA 5IULC 5BNZA 1SIJA 2VDUE 3VSAA 3PICA 4KMSA 3EZNA 2XVMA 2BRUA 3BA1A 3BWCA 4EABA 5IAAA 3QNUA 2M1XA 3EVCA 4FD2A 3OVMA 3UJ3X 3OY2A 1FU4A 2G76A 1JHUA 3KPJA 5LP6C 1S0NA 4Z4EA 3NPMA 4BY9E 1WXEA 1A9TA 2TRSB 3AUAA 2RRDA 1DBVO 3M9XA 2ZJAA 3HBAA 4F38A 5FTLA 1ZO8A 1HFJA 5LA6B 4QJ3A 4JBYA 3PMLA 1C3LA 2PWZA 5HKAA 4EGQA 3ZI7A 3D6UA 1Z5PA 5DRTA 1QQTA 4OQZA 1NHGA 4EBCA 1CIJA 3F49S 2BONA 2C3PA 1RM4A 4P7JA 3WMXA 1P31A 5HQ3A 1RCTE 2WTXA 5EKDA 1MH1A 1UBFA 4OUDA 4TV9F 3CLKA 3VH2A 3SFTA 3SM9A 8ICHA 3P2YA 1ZUD1 1JR3E 2VHTA 3QLUC 2WHPA 3LYUA 4A2PA 2GA8A 4MYCA 5K3BA 2V7QD 4D9FA 2H3FA 4DW8A 2MSDB 1VRVA 1DOQA 4MDEA 3GHYA 3OBBA 3ZDRA 4DR7B 2EGGA 1V8OA 9ICEA 3PWTA 5K0EA 2Q0QA 1DKRA 5BSKA 4R2KA 2HSZA 2Z5LA 3IO5A 3SX4A 2J4CA 4JLSA 1ZMXA 4FS3A 1CF9A 3LPAA 2QVXX 3TQRA 3KYCA 1L5HB 3VHXB 2J3JA 3FKJA 2RHJA 2DWQA 1Y8CA 4BEVA 3C43A 2ID4A 5DTMA 4PICA 2J08A 4P0PA 5J2AA 1VBKA 3LBAA 2JLCA 5AXBA 2JAWA 5CITA 2VUTA 2VK4A 5HKKA 3LECA 1ZITA 4Q34A 5KYUA 4NC9A 3ENQA 1ZL0A 4WNAA 2J0EA 3H05A 2PUJA 4JLJA 4B9AA 3EAFA 4KQWA 4Q4AB 1C1DA 1P4HA 3C6KA 4Z3OA 3ECAA 3RH6A 1KO4A 1F5SA 1TEHA 3RAGA 2Q0HA 9ICJA 2V6MA 5D3QA 4AY2A 2A0WA 1E3DA 1NPDA 1SUWA 5CAEA 2X0DA 3LWNA 1C4WA 4XIGS 4YCDA 3RABA 1KJYA 1EWQA 3NU1A 4QAQA 1X8JA 1TVKA 3C3AA 4IX1A 5GVRA 5L6LB 1HQDA 2ZTVA 3VJRA 3MMNA 4KLAA 1L3IA 3NAGA 4ZOBA 3H99A 4LHXA 5A6VA 4KAFA 3HKZF 3PR2B 5FWYB 2XWJI 4IJMA 4G4SP 3Q7TA 4N8DA 1FFYA 3ZGXA 4QW9A 3IBCA 4GOND 2Q41A 3W3AA 4H9GA 3LLUA 4R8MA 1VMKA 3JZIA 1Z2OX 3HRHA 3JQRA 4HEQA 3UV3A 3ROZA 1IE3A 3F7TA 4G07A 3RJGA 4U2DA 2I76A 3DD1A 5HA5A 3KZVA 2WSSA 9ICWA 4R69A 5DHFA 1CTQA 3BBPA 3LXMA 4HNHA 2FPLA 3B1KA 2BBOA 4IZ6A 3W8EA 4LECA 2FKAA 1G2IA 1PR9A 2EZXA 5PGMA 4M6WA 4G5GA 1IYZA 3ROMA 4K03A 3OPVA 4J9RA 2QTHA 3HJNA 4MVXA 1PNQA 5J0PA 2NSYA 3VSCA 2ZW9A 2PIAA 1SRRA 3B3QA 5IIJA 4OFBA 5JJ5A 4G1VA 1XYVA 4EGCB 5EOZA 5FNVB 4JC8A 1SUEA 3KUKA 1ZM9A 1N2CB 1WUJS 4YWJA 3K0HA 2QJOA 2P9GA 3P9PA 3GVCA 2X6QA 2C7VA 4LTDA 3U7HB 1X66A 5JQWA 3FWZA 4TUYB 1XX6A 2P69A 3NBUA 3GO4A 2FPRA 3H0MB 3AGQA 2W2MA 1GTJ1 2YVUA 5FUMA 4PC2A 3AQ4A 5K0LA 5A4KA 4CMIA 3X1DA 4AKIA 3MLEA 1ZD4A 4F9EA 4N7MA 5FLEX 4EG4A 3OE4A 4DHEA 5TPWA 3RIGA 3D5QA 3ZU5A 4QG7A 5DCLA 4O0IA 4M1WA 4IJVA 4S1VA 4U2EA 3TL2A 4BYMA 1G20E 1LQUA 2J5BA 3HKEB 3E35A 1PR5A 3WMGA 1R0BA 4G4GA 3IAM1 1ISJA 4D8VA 3FSGD 3L9XA 4JOQA 1XZKA 3NDPA 2DECA 3H13A 1QGZA 5DK4A 1HJPA 3UK0A 4P4TA 1KSPA 2G25A 3BFXA 1IXYA 1Z56C 4UAWA 1XR3A 3ZCXA 4PG6A 4DBZA 3BMQA 4EL5A 1ZQRA 1UBSB 4OQLA 5A2QA 3LZCA 2A0FA 2PMFA 3IHKA 4CLXA 3AEYA 3WBBA 2Q9CA 1BCRA 3JQBA 3RF9A 4AW9A 4YP3A 1C14A 2QU7A 2EVWX 5CLIA 2HZBA 2IUFA 2Q3CA 1TK0A 2OM2A 2ATXA 3TMKA 1ULBA 3DLTA 4J9OA 2RSLA 1GM5A 1VYUA 1SEVA 1CSEE 2EZ8A 2GHQA 2DR2A 2QAGA 2VBFA 4RPYA 2NZ2A 2NXNA 4WCFA 4UHKA 2ZRNA 2CHVA 2QRUA 3VMMA 2RIPA 4L4XA 5JAPA 2RIRA 2P2SA 3SR6A 3PUWA 2E6KA 2NZUG 3X1YA 3SK0A 3WGGA 4H7EA 4E5KA 1OLSA 2E6UX 3TQTA 3CKKA 1VC2A 2W6ZA 4BFZA 4JEIA 4OB7A 3DCYA 1SELA 5LKRA 3WR5A 5CDGA 5A02A 3VNVA 4FEAA 5J2TF 4M88A 1RXSA 5F21A 1G6Q1 1JHVA 3PDHA 1FFXB 2DGDA 4H6VA 1YR2A 3KOOA 2HXGA 4RA9B 5DBHX 2OM6A 5FI5A 2DJIA 5AVXA 1TKCA 3B9JA 4XSHA 2QNBA 4U2BA 1R6AA 2I87A 2ZT8A 3TL6A 1M0SA 1RJ9B 3V7UA 4EATA 3A1DA 3PNVA 3UB2A 2QV0A 2YHBA 5L4LA 2VOJA 1T1GA 4JI7B 2HA2A 2VA9A 3WICA 3OQPA 4JUFA 4JVOA 1E61A 4WK0B 3O90A 4B9VA 3T4EA 2C5AA 8ICEA 3GGGA 3WJ1A 3VPSA 4J0KA 4HK4A 2E89A 4G26A 3JATB 1O54A 1TOAA 5JBNA 1KBOA 2XYVA 4JP5A 4KJZA 1TTQB 3W8NA 2XKAA 4HDSB 4I2CA 4Y9UA 1AKQA 5HHIA 2P4EA 2C57A 1KZ4A 4AZTA 1SH7A 4YJDA 3AHDA 4C14A 2YS6A 1XDUA 1BXKA 1V39A 2VQSA 3QPAA 4MW1A 4E1AA 1O5OA 2AN1A 1C0IA 2VAWA 4MLZA 3NTOA 1N6PA 2P4SA 5LZ9A 1FFSA 4MWCA 3IR7A 4X92A 4QZEA 2CVFA 3WKEA 1UBKS 3MWLA 1DADA 1BFDA 1U7WA 4QBKA 4G5YA 1KFJB 1S8OA 4R98A 3SSNA 1BQ3A 2RC6A 4Q4HB 2Q21A 1VIDA 3CM0A 1BMDA 2IHJA 4BNLA 3JARA 4YRGA 2XA1A 3RT9A 3OQ1A 2JFNA 2G6TA 3JR7A 1CXZA 3KZXA 3KFLA 4R5HA 4MQ4A 4W7IA 4HEHA 1S2OA 4DN6A 5KFMA 3FJ1A 4BLPA 4GQBA 1AF4A 1GPLA 3U5ZB 3JQPA 1G7RA 5CVCA 4TX1A 4F4YA 4DLAA 1LI5A 5K6AA 1P4AA 1SHUX 3DL4A 16PKA 2F8SA 4TL9A 1RRVA 2ALJA 3U9SA 1ZBDA 3IVCA 1W36C 2OBXA 3ZKWA 1U11A 3DXXA 4WOJA 3IOCA 5JRZA 5GGYA 2SHKA 7ABPA 1G1AA 3BQ1A 3FMFA 1NWHA 3KHSA 1RKXA 3NWPA 3O31A 1XTJA 3AXTA 4DOMA 3DVQX 2JLUA 5DOZA 1GNQA 2JASA 4LBYA 1QP8A 4E2WA 1Q2UA 3K05A 3VNBA 2Y67A 5KWSA 5KMGA 4GMKA 4D81A 1CZOA 4AJOA 2C9BA 3H9CA 4AMYA 3F8SA 3H9QA 1N3YA 1X3LA 5EP4A 4WXYB 4JV0A 3FPEA 5JZVA 3QZUA 1A9XB 3VAZA 1CUXA 1XU9A 3MTDA 5JR3A 3PJFA 3L1UA 1UC9A 1VMEA 4MGYR 1NQ5A 3AF2A 2G04A 2BCRA 3PQ3A 2WYHA 3HJRA 2XUOA 9ICLA 1EVZA 3VKVA 2W71A 4UVEA 3OMXA 4PGGA 4PHTA 4KLUA 1GNRA 5AOVA 2AX3A 4Q48A 4CUZA 4TKVA 4P4SB 2AFIE 1KZYC 4HC4A 4KPGA 4MV8A 4I6GA 1GA1A 4UB3A 2PSEA 4M9ZA 3QVOA 3IBTA 3GJSA 2HMSA 5KFTA 1Z00A 1NMXA 1K7CA 2O1XA 5GONA 1E0KA 3RRJA 1N63A 3CRRA 3AUUA 2PXIA 4RD1A 1CUAA 1UT8A 4QODA 2YWGA 1Q0PA 4U6PA 4KQMA 1VYTA 5EWMB 2I1LA 1U1DA 4KHZA 1NLFA 4JLVA 3H0KA 3OPMA 2VC2B 4HMQA 3WK8A 1WEKA 2EXXA 5CFNA 3M3HA 4M0UA 2ZUDA 4WH0A 4CQLA 3X44A 1QIFA 2GHRA 1AKMA 3AEKA 1JQDA 2QMEA 1U3WA 4W4TA 1WULS 3IUEA 4YFVA 4A8HA 2WJ4A 3LJKA 4Z99A 1U65A 2Z9BA 4LZJA 1ZVVA 2H5EA 4BO1A 1M6WA 1H6AA 3GQCA 3L8GA 2W6JA 4ZOLB 1SZJG 3FVTA 1QG2A 3EVFA 5J1TB 1VBFA 2J6IA 4Q4JB 5LJIA 1GKLA 5LFAA 4YXFA 2P7IA 4HDAA 1JDSA 5BN1A 1Q91A 4WZAE 5EKTA 4KR3A 4QDTA 3CZCA 5BRNA 1USGA 1BDIA 2BE7A 2OZLB 1XMVA 4JLAA 2H5LA 3AEZA 2G4VA 4RIFA 4LN1A 2QB0A 3D6FA 2NO5A 3H86A 5CIYA 3ETCA 4RQ7A 2NTYC 2WTFA 3V8PA 1KDRA 2XB4A 2W93A 1RR6A 2ZYSA 4RX1A 3N5CA 4LTMA 4A73A 1L7DA 2PJUA 4FNMA 1KI2A 1NKSA 5B66U 2ZTMA 4GF5A 4J16C 4H3HB 4HX5A 4JFRA 1QE5A 4OLBA 2KVCA 1REQB 2GEJA 5EQJB 4EEKA 2VFAA 2F90A 2IU0A 1L4KA 3AEVA 4NE7A 5A4IS 2OCPA 3DGEC 4QGGA 1RBMA 1YCDA 1IXSB 5GQSA 1B1CA 3JYQA 3IHWA 4RORA 2YASA 4NJ8A 4O4LB 1KZ9A 1ZUNB 2AD1A 3GY0A 4J3FA 4X54A 4X3OA 4KPUA 1BN7A 1QH9A 1NXVA 5GONF 4FCVA 4PCAA 2WJPA 3EAGA 3SKVA 3OM1A 1CLUA 2V7TA 2HPZA 1W4RA 3KHUA 1V5IA 2BJVA 1PDVA 5CR0A 2PSFA 3T79A 4IZOA 3KVOA 1JIJA 1BWQA 4H15A 1KMCA 5F9NA 4GXIA 5NLLA 1QQ7A 2Q4BA 1T9GR 5LP6B 2IX9A 4M46A 4HVAA 3K6KA 2VK8A 1ECJA 1XEXA 3N8GA 1SKAA 1RQ7A 3DDWA 1QSYA 4EITA 1L6RA 1Z29A 2FW7A 4DCJA 1E2DA 4UB6U 4RGQA 1IZ0A 4MKHA 3INNA 1FVOA 3IIIA 1YI8A 4KSBA 4HRYA 4KKVA 3TXXA 2Z2JA 3SXUB 1HURA 4XQ8A 1ZLXA 1Z15A 3AI3A 1GFZA 1NPYA 3GRUA 3SYZA 3CJRA 1JG6A 4ZCTA 4NJMA 3FHJA 1NMQA 3C5WP 3JVUA 2AJLI 3NRJA 2QRZA 2XCSB 1OREA 3DPSA 3KLPX 3G2PA 3UFXA 1ONSA 2DY1A 1C7ZA 4M9XA 3DTVD 4G0XA 4LAFA 4JJKA 4BIIA 1YJQA 4MKIA 5DCWA 1PT7A 5KX5F 3FZYA 3H8WA 2FEXA 3NBFA 4BKQA 5G0VA 1X9HA 4EB0A 5KOJB 2C8JA 1YR8A 2YWJA 5AVTA 1L9KA 2MYPA 3UZUA 3U6KA 4Z86A 3TMAA 1MA3A 1MBZA 5JMWA 1BA2A 3RB8A 1E3WA 3I6BA 3I0ZA 4PX3A 2V7XA 4I2FA 3VVBA 3KTOA 5ITVA 4Z9AA 4S2UA 4ND4A 3MJDA 1H66A 2J33A 3RPEA 3FX2A 1X7ZB 2NX2A 3PUVA 3IUNA 4I19A 4D4KA 3FOCA 1TJ4A 3GVPA 3GRYA 2HL6A 2QM0A 4DEVA 4BNUA 2QXYA 1AQ6A 1B2RA 5E8RA 4OAQA 1ZHHA 3S1AB 1NBEA 5LM3A 4RJIA 1X7DA 5J2CA 5L40A 1U8TA 1XZLA 3T41A 1YJXA 2Q3LA 2NTEA 1VSUA 4L5AA 3GFSA 4BNYA 5BVGB 5CNKA 2GXUA 4UOZA 2DY0A 3DFFA 1W93A 5CDFA 5JTTA 2JKVA 4KWTA 1QP7A 1Y3BE 3FD8A 4U8GA 4MHTA 2XJ9A 1TKAA 2Z1DA 2GRUA 5JPIA 4EZ9A 2QT9A 4C7VA 2YXEA 1BVHA 1RM3A 2JHAA 4NU6A 2YYAA 5K3FA 1K2WA 3CLRC 5KEIA 1V6SA 3K70D 3BDPA 2P11A 1WXFA 3SFVA 2YWRA 4OQQA 2DR0A 3P2EA 1DO8A 2B0JA 2AGPA 1FU8A 1TVMA 4XLZA 1ZJYA 5FKJA 3QMWA 2VPYA