4C4RA

Structure of beta-phosphoglucomutase in complex with a phosphonate analogue of beta-glucose-1-phosphate and magnesium trifluoride
Total Genus 79
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
79
sequence length
218
structure length
218
Chain Sequence
MFKAVLFDLDGVITDTAEYHFRAWKALAEEIGINGVDRQFNEQLKGVSREDSLQKILDLADKKVSAEEFKELAKRKNDNYVKMIQDVSPADVYPGILQLLKDLRSNKIKIALASASKNGPFLLERMNLTGYFDAIADPAEVAASKPAPDIFIAAAHAVGVAPSESIGLEDSQAGIQAIKDSGALPIGVGRPEDLGDDIVIVPDTSHYTLEFLKEVWLQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Alpha-Fluorophosphonates Reveal How a Phosphomutase Conserves Transition State Conformation Over Hexose Recognition in its Two-Step Reaction.
pubmed doi rcsb
source organism Lactococcus lactis
molecule tags Isomerase
molecule keywords BETA-PHOSPHOGLUCOMUTASE
total genus 79
structure length 218
sequence length 218
ec nomenclature ec 5.4.2.6: Beta-phosphoglucomutase.
pdb deposition date 2013-09-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00702 Hydrolase haloacid dehalogenase-like hydrolase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.240 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 Putative phosphatase; domain 2 4c4rA02
3.40.50.1000 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold HAD superfamily/HAD-like 4c4rA01
2B30A 5AKZA 2Q5EA 3NUQA 3ONNA 2FI1A 5AVXA 4HGRA 1L7NA 3NAMA 4YIKA 2VKQA 1O03A 1Z88A 3L8GA 1QQ7A 3QX7A 3WGVA 3DV9A 2I7DA 2YMLA 3SD7A 2YJ5A 4BNDA 4UM7A 5IS2A 2OBBA 3QYPA 1NF2A 4NWIA 1RQLA 3QUBA 4DFDA 2B1QA 1L6RA 3I6BA 4HGQA 3VAYA 1U7OA 1ZJJA 5JJBA 5ALLA 5AW9A 5AIAA 4Y2XA 3KD3A 3AR2A 4EX7A 5AW6A 4YCMA 3W5DA 3KDPA 1L7OA 3I1YA 2AMYA 4F72A 1QQ5A 5AKIA 4EX6A 2WM8A 1WPGA 1FEZA 4AS2A 3A3YA 3ET5A 3ESRA 1KYTA 3WKEA 1J8DA 1ZD5A 1TJ3A 1XPJA 1N9KA 2IA5A 5AM2A 4OFZA 3ZVLA 4OCZA 1YV9A 2HI0A 2GFHA 4Y2UA 4CNQA 4XQ0A 5AVQA 2EAUA 4Y2SA 2IOFA 2B0CA 2C9MA 3AR5A 3L1VA 4JDPA 4MWOA 2ZG6A 5AI5A 2ZBGA 1YNSA 3E8MA 3WK4A 1Z5UA 4UAVA 5AIBA 3QNMA 3OCXA 2D2VA 5FP0A 3KBBA 2C8KA 3AR9A 4OD0A 4B6JA 2JGAA 3N8GA 5AI9A 3ZVMA 3W5AA 5AVSA 3PDWA 5AK5A 1Z4MA 1X42A 3BA6A 4YCNA 3P96A 3MC1A 3TLMA 4AS3A 1CR6A 3B9RA 4UARA 1VJ5A 3ZU6A 5AK6A 2HO4A 2R8YA 5AVVA 3U26A 5AI0A 5AKEA 3WGUA 4Y2RA 2BDUA 4ZEWA 3L8HA 5ALKA 1EK1A 3AR7A 4G63A 2OM6A 3L8EA 2W11A 3ZTYA 3CNHA 3ZWDA 2YMMA 3ZUPA 5AK3A 4EENA 5AKXA 3UMCA 3EF1A 4GXTA 2CFSA 1Q91A 3IRUA 2RAVA 4KN8A 4KX3A 2P11A 5AM0A 4BYGA 1S2OA 2Q4TA 2B8JA 2FPXA 3RFUA 3U7GA 4BBJA 5IT4A 2BY4A 3QUTA 1QYIA 3FPBA 2ZOSA 3FGOA 2I55A 1T5SA 4Y2PA 4UM5A 3EPRA 4NFLA 3NANA 3WKBA 2FUCA 2O2XA 1Z4KA 3ZTWA 5AK4A 4DWOA 3ZX4A 1ZD3A 3SMVA 5ALPA 3S6JA 4L6CA 5IT0A 3DDHA 5AM4A 2YJ4A 2HF7A 3K1ZA 4EELA 1WR8A 3ET4A 2YJ6A 5AW4A 5ALHA 4BNDB 3BWVA 4I9GA 2G08A 2GHQA 1NRWA 4UMVA 1U7PA 1QQ6A 4Y2QA 5AICA 1Q92A 2GO7A 5ALFA 1TE2A 2QYHA 3HYCA 4CF3A 4YCLA 3HLTA 5ALYA 3FZQA 2RBKA 3GYGA 4Y2VA 5AVYA 3J7TA 3N1UA 5T41A 2C8LA 2B8EA 5AW2A 2MSNA 1L7MA 3E81A 3U7HB 3UMGA 4J03A 3DNPA 5AHXA 3OCUA 5AVRA 2YY6A 2FPRA 2I34A 5ALIA 4QJBA 2ZBEA 5ALJA 2HOQA 5AVZA 1JUDA 3OCZA 4UMEA 1RC8A 3R9KA 1Z4QA 3AR8A 3RF6A 3PCTA 4BEVA 4KX5A 4YGYA 4HGNA 3WK6A 2JAWA 2P27A 3QXGA 3FVVA 3WKCA 3OCYA 4L57A 3W5BA 1ZS9A 3UMBA 2R8XA 4I9FA 3ED5A 1ZRNA 4Y3UA 2O9JA 4AP9A 4BX2A 2HHLA 5ALWA 4CF4A 2FEAA 3R09A 3I28A 4HAIA 4UMFA 1VJRA 3A1EA 1LVHA 4UU0A 3FM9A 2NYVA 2PKEA 5ALUA 2NO5A 4OHFA 4Y2JA 2R8ZA 2X4DA 5AW1A 3FPSA 4G9BA 4UW9A 1MH9A 3QU4A 3U13A 3WK7A 2GMWA 4CF5A 1ZD2P 2ZBFA 1YDFA 2CFRA 2YFYA 1RMTA 1N8NA 1Z4LA 5AW7A 3WKAA 3EWIA 2OYCA 5AKGA 3N28A 4KNWA 4FYPA 4Y2YA 1RKUA 3AR3A 1S8OA 4XPZA 2WF7A 2HSZA 1YS9A 1NNLA 3AR6A 1Z4JA 2B82A 4EZEA 5AW8A 3QU9A 1XVIA 2FPUA 2WF5A 2IOHA 5A3QA 2FPSA 2PR7A 4DCCA 4BKMA 1L8OA 3U7FB 1RQNA 5AVTA 1AQ6A 2I33A 2EATA 2NO4A 2JAOA 5AKKA 4EEKA 4BEWA 4Y2TA 2G07A 2YJ3A 2R8EA 3CZ4A 4HYTA 2MU2A 1Y8AA 1J97A 3OCWA 3OTQA 5AI8A 1Z4IA 2G1AA 5ALGA 3QU5A 2ZBDA 4C4SA 3L1UA 2WF9A 1U02A 4E88A 4UU1A 3QU2A 2C4NA 4GIBA 4HGPA 3SLRA 3B8EA 2EARA 1ZRMA 3PGVA 5AW3A 3WK9A 4L6AA 2YMPA 5ALNA 2AH5A 1T5TA 4JB3A 1RRCA 3MN1A 5AVUA 3IB6A 2HCFA 4F71A 2G0AA 5AKYA 4C4RA 1L8LA 3N5KA 2MU1A 4NABA 3N07A 2HX1A 3ESQA 3A1CA 5A3RA 1RMYA 3B9BA 3D6JA 2P9JA 2OA0A 2YMQA 5ALMA 2RARA 3WK8A 5AKJA 3L5KA 5AI6A 2Q4RA 5AESA 2IOFK 5ALEA 4MUMA 2WFAA 3U7EB 2ZXEA 3ZI4A 1VFPA 2G09A 3KZXA 3MPOA 2FDRA 3ZWKA 2GHTA 3NALA 4BX0A 4H1WA 4UMDA 1SWWA 4IFTA 4DW8A 3QGMA 4C4TA 3NIWA 2G06A 1LTQA 1Z4OA 3QLEA 1EK2A 4FFDA 3IJ5A 3PGLA 2WF8A 3EF0A 1RLMA 1RPZA 5AKLA 2AUTA 2YBDA 1YMQA 3KC2A 2DQSA 2G80A 3OPXA 2WF6A 4RESA 2HEGA 4CE6A 1O08A 3L0YA 2W43A 1T9ZA 5E0OA 1RLOA 1U2TA 3E58A 4RETA 1RMQA 5ALQA 1SWVA 5ALTA 1F5SA 3KOOA 5AW0A 1Z4NA 5ALOA 2CFTA 2IYEA 2I6XA 1WZCA 1RKVA 3L0CA 3M9LA 5ALDA 1RLTA 3QUQA 5ALZA 1WVIA 5AI4A 2C88A 4UATA 3M1YA 5AW5A 5ALVA 1U2SA 2FUEA 3WKDA 2JARA 3MMZA 5AM3A 4KNVA 5ALXA 1Z5GA 2FPWA 5AM5A 2JAUA 5AVWA 1RDFA 1Z4PX 4YIHA 1PW5A 2P69A 4BX3A 2YN4A 1CQZA 3L0BA 3SF0A 4NAVA 3AR4A 3W5CA 3OCVA 4UAUA 3NASA 4YH1A 3ZX5A 2B1RA 2HDOA 2ODAA 4FE3A 4ZEVA 3WK5A 3QU7A 5A3SA 2RB5A 3SKYA 3SKXA 2WHEA 3DAOA 5AKHA 3UM9A 1K1EA 3L8FA 3ZW7A 3QUCA 4UASA 2I54A 3I76A 2CN1A 5ALRA 4HGOA 4J2TA 1RKQA 4KYTA 3F9RA 2BDEA 1TJ4A 2W4MA 4IG4A 3SHQA 1IWOA 5ALSA 1XP5A 3U19A 4NV0A 3A1DA 4XE5A 3E84A 2AGVA 4XOUA 2PQ0A 3L7YA 2HF2A 3NRJA 1QH9A 1TJ5A 1TA0A 4ZEXA 5AM1A 4QQFA 2QLTA 4O8CA 1ZD4A 3ZVNA 1SU4A 1YJ5A 4PNHA 1L7PA 1ZOLA 3R4CA
chains in the Genus database with same CATH superfamily
2XBUA 4WESB 2UVDA 2RGEA 4CMKA 3CCCA 3QA9A 4AU1A 2OBXA 3SV3A 1FTSA 1GD1O 4H7PA 3UT5B 1YMVA 1QRSA 3BS4A 1GQ2A 4FW9A 2DXIA 1PF7E 3JVVA 3OOYA 1UCFA 5ARDA 5C7IO 3RFVA 3UMVA 3EIFA 2HBMA 4TYMA 3FYHA 1ZD9A 4I46A 2BMFA 4E14A 3ZNQA 1HYHA 5JJIA 4ZVLA 3TLEA 5ENDA 3DV9A 4DLGA 3G02A 4PSUA 4YAOA 4C87A 5AH0A 3NIFB 1BAPA 2A1TS 2FETA 3SD7A 3CRVA 4RKWA 1L5GB 4C8KA 3NC0C 5JEDA 3ISCA 5LLTA 2X6QA 3OEHA 1X19A 1EFRA 4YRNA 4W4TA 4NWIA 1XZCA 1QTIA 3UJAA 1DIGA 1O96B 4NZNA 4ANFA 3V4VB 3TPCA 1JHZA 3FZGA 3KUKA 2P6MA 5FOQA 3N2EA 1ZOPA 1GUDA 3KSAC 4KODA 1L6RA 1NMQA 3QWHA 4ZREA 3TX6A 3W1EA 1FSSA 1KBZA 4QREA 2BPOA 1FVFA 2PMFA 2I3AA 1MQ2A 1JBEA 2Y4NA 1I2MA 3FKQA 4JGBA 1P2SA 2YN2A 1G8AA 3OEHD 1JHPA 3BXEA 4OMDA 4QWBA 4TSFA 3KVOA 1N2ZA 1UMBA 3NHFA 4X1KB 4OUDA 2G17A 1JWAB 1E7QA 1QZTA 1TMGE 1SUCA 2NVBA 3AC0A 2GZ2A 1QKJA 5ELLA 2X9LA 4INPA 1JDZA 3BQ7A 1EG7A 3FTPA 2FX3A 4ZRNA 1NF9A 1JDBC 2C7GA 4IX9A 2WSSA 3UENA 5JMOA 1C7FA 2RGDA 5EIAA 1M0SA 3JRNA 5CIQA 4UPEA 2C59A 2WP8J 3TLZA 3V8RA 3V1TC 2MYPA 3QEOA 3LO8A 4IVNA 3EY9A 4E31A 3GRYA 1P2UA 1IXSB 2JZNA 2QRHA 1GO3F 3V6KA 3ET5A 3GGJA 3OSPA 3PQ2A 5KSPA 4NU5A 4NYMQ 4EEYA 3D0RA 4H9GA 1D0VA 4UXJA 2PVCA 3SHFA 4CHTA 4QM6A 4IHAA 1E98A 3S1SA 1YV9A 3B3FA 3MMPA 3QY0A 2J6IA 2O6HA 1H0SA 1XVUA 3PB3A 4BWGA 4UAJA 4BTLA 5IUNC 3IAHA 3FI9A 3ISVA 1KXJA 2H6EA 5E2BA 1EM8A 1KDVA 2LCQA 1UA0A 1GTG1 4E46A 5KX5A 2GM4A 5AVQA 3ZE2B 2R7KA 4ZAZA 3VNRA 4ISBA 1CY2A 5ESDA 2C9MA 1R0XA 3DFMA 3GFPA 3EXG1 5IRCD 3HM9A 5JTIA 3AUJB 2HHQA 2V7XA 3U5TA 4M6WB 2DBZA 2W7TA 1AC5A 1YUMA 1IDN1 1KFBB 2V0NA 1PT8A 3RC8A 3QLVC 4E2FA 5CA1B 4Q6BA 3ND7A 1ECCA 1JN3A 1THGA 1UXJA 1U9IC 4JSRA 4TZKA 3RBAA 1A04A 5JXGA 2A4MA 1MO3A 5CGQB 3AQEA 2OBYA 1XX6A 3GGGA 1W5FA 1P1RA 1FTWA 3EQ8A 1S9FA 1Q1AA 1GZ5A 4FZNA 1NX6A 2QAGC 3EGXB 3OP4A 2JCGA 4HPXB 2E1EA 1YU9A 1KK2A 2C8VA 1KZ6A 1KI6B 1QIHA 2V74B 3AF0A 3DKVA 4B4VA 1VG1A 1Z4MA 3M7DA 4FBLA 3TCNA 3BA6A 4ZVQA 1J7JA 2GGSA 5HBGA 4R64A 2OLKA 2J3MA 1RYFA 2XWBF 5KWSA 3WJ2A 4PG6A 2VTBB 2PUFA 5I9IA 1CR6A 3JVUA 3Q7SA 1COWD 1V45E 4DCTA 2EQYA 8ICMA 2FPKA 1Q0SA 2HO4A 1M72A 3G1UA 3PWSA 4PHHA 3F6SA 1ENYA 4G0NA 4XJVA 2VFAA 3BE4A 4S1WA 2HC9A 3IVRA 4OHPA 4REQA 721PA 7MHTA 1GCOA 5E2AA 4IQUA 3ENNA 4ZVOA 3R9WA 2FQWA 2ZR7A 3TI0A 1KMQA 3O8DA 3U3KA 3L8EA 3HJAA 3MF4A 3OI7A 2GXUA 1VBKA 5LQNA 2FY8A 4L15A 3DUFA 3ZUPA 2CYAA 3NH6A 3EF1A 3NBUA 4GXTA 1TVAA 2O2EA 2PPVA 3E9QA 5KFAA 3K0AB 3LPDA 1W36C 2W6NA 3PLAE 3EZXA 3PNVA 4CJXA 3WIUA 3BERA 2J0UB 1OZFA 1B8UA 2FNAA 1S1MA 1B8PA 3ND8A 2P11A 2MYNA 2GH1A 1OTYA 4N8EA 2EDCA 2Q5IA 8ABPA 2QTAA 4G07A 1FFGA 3ABZA 1QO7A 4Q00A 7ICPA 3A2LA 4UBBA 2QKYA 1R64A 2W8BA 2WAAA 1WE2A 3F5DA 5ILQA 2W9CB 3VFDA 2A1JA 2OB2A 4IH1A 1IM8A 2KYRA 2WHYA 1CQIA 2R4UA 5KQRA 2K4HA 1V8OA 2HY7A 1CUGA 1WKVA 4AJJA 5KYYB 2YC2C 4B45A 2MTBA 2RJOA 3WDMA 1PQWA 2GR9A 1LF0A 3IG8A 4NFLA 1VI6A 1CYDA 1MB2A 3LWDA 1Q16A 3WGJA 3WGLA 1RYBA 2R18A 3BZUA 2QQGA 3FWZA 4RZHA 2GQ0A 2PT9A 1UMBB 5L3RA 4AP6A 3FPAA 4F8EA 1V3UA 3LC2O 4CQMD 4RYDA 1ZJ5A 3VSEA 2VHCA 4PZDA 3EIQA 4B81A 4F97A 2PUAA 3AB7A 4IWNA 2HIMA 4HWOA 4JT8A 5KSWB 2LIVA 4MOWA 2IF0A 1THZA 4PBSA 2WE8A 3ONWA 4NARA 3OUTA 2H3QA 1UJ6A 2CXSA 5GOZA 3KPVA 3KYBA 4EELA 1PL6A 3DBHB 5I7OA 4JV5B 1FX0A 1W8IA 1ISSA 1E1DA 2C83A 4AF8A 1H66A 1V3VA 1DRJA 1SHUX 2BEVA 1S2GA 4JK3A 1IM2A 5FWXB 4YV7A 2QZPA 2VTVA 4OIMA 4UZFA 3R9XB 3KV1A 4AZ3A 1WL8A 2PGLA 1V11B 3HYCA 4PCUA 4CF3A 3V55A 3PIRA 3V1LA 4Y0VA 3QVWA 2GTPA 2RIRA 5I5GA 3L0SA 4YAKA 4BJ5A 3IKTA 1OBCA 4LOIA 4MR8A 5LCXA 2IE0A 2F55A 1J0AA 1T4CA 3UMFA 4ZQFA 4EA9A 1GKKA 2C8LA 3P94A 1F1BA 3K09A 5J2GA 2ZUDA 1C3XA 3K5WA 3AT1A 3P32A 3E81A 4P8RA 2BZ1A 3EIUA 1EE9A 2HFKA 1R88A 2H3IA 5C2JB 2QB1A 2HU7A 1Y1SA 2IYLD 2B4TO 1VJCA 3AEUA 3QJ5A 1GGJA 1E63A 3V8BA 5A04A 1DSSG 5EIEA 2D5AA 2KJ8A 1C9NA 3IHLA 2MR5A 3RADC 2WA2A 4WECA 3STVA 1UBSB 2Y1FA 3RF6A 1X15A 1U9ZA 1OWMA 3GHYA 1YRHA 2Q07A 4QYXA 5BSMA 1RFLA 2GPNA 2NZXA 2QAIA 1U8YA 3FIUA 2W2LA 4LY0A 1I1QB 2QRPA 1GTJ1 3FFTA 2R8RA 4WY8A 2QN2A 3CMCO 3GO4A 3MYYA 3S99A 4CKXA 1YE8A 5IFKA 3ZYZA 4EI8A 4ODIA 1ZFNA 4AECA 1JXMA 2K4IA 1AUPA 1CQWA 1L5YA 2BCJQ 4HNAA 4C21A 1W52X 2IOYA 3K9GA 4CCYA 1K75A 1AK1A 1Y1RA 1XE3A 4LJLA 1X0XA 2Z4RA 1HX7A 3TVDA 2P6PA 3I28A 3EZLA 1XQ6A 3C3DA 5F1OA 3H4TA 2IXDA 4EPVA 4O5OA 3BGDA 1MD9A 5AO9A 1T6YA 5DYNA 2HFJA 5LQAA 2VXBA 5FBVB 4O3SA 4GPBA 4QRHA 5CYOA 4A36A 5KG4A 1CJMA 3FUXA 4G1VA 1J56A 3ZE9A 5A5DA 1CNEA 4M87A 1RPJA 5GV8A 2QTVB 2C42A 3AVPA 5JDIA 4ND8A 3RRJA 4MRSA 4BL5A 1CP3A 4GXNA 3R0ZA 3CZCA 2BCSA 4V0ME 4BNFA 1A1VA 1F0MA 4IVQA 2WV7A 2H3HA 2VRBA 2W6JA 4I50B 4ZPJA 4DV1B 4O25A 3FFWA 1XRQA 2VQDA 1NBOA 1NQUA 1Z0SA 2ZQZA 3KRTA 4TMYA 3TQFA 4HAOA 4JYPA 2EKDA 4B75A 4Q05A 3UYLA 5BR8B 2CV2A 1XROA 4M7RA 4XQGA 3WJ7A 2R8JA 3NTQA 1WKBA 3A6HA 1SXPA 2O05A 4DA7A 4XIIA 1AKVA 4YAJA 4DJAA 3UUWA 2HVIA 4U39A 3IAM1 4L2IB 2VR1A 1HNNA 2NU9B 4YXWD 4X20B 2O6KA 4RPYA 1SU7A 4R63A 3PRKE 4W5JA 3K9QO 5KU1A 4DKXA 3NCTA 3FBTA 4V03A 4RPIA 4RPCA 2HMUA 4LYFA 3D2NA 4OLFA 3H97A 3SZUA 4B1FA 2QL5A 3L0DA 3OZEA 5E3IA 4EW2A 3QEAZ 3VGPA 2CLCX 3EWNA 1TC1A 1K7FB 4FUTA 3DV2A 3EVGA 3DBRB 4J1TA 4L0DA 2YWRA 2BGLA 3G88A 2FF5A 4ZXFA 4B3XA 5JQGF 4Q4LA 1M1YB 1Q15A 3VVBA 4K26A 5KOYA 3U7FB 3DOOA 2JFZA 2P9BA 5JZOA 5IBQA 2AR0A 4G23A 4RQ8A 2RHWA 4KQXA 2DWQA 2VSNA 2PZGA 2P2DA 4L4YA 4ZHSA 1I4EB 5GJVC 4L9WA 4UQGA 4CIVA 3T5LA 1RCUA 5E4YA 1KTQA 4U2DA 2X1LA 3P2MA 4JN6B 2BFFB 1QCYA 1MTOA 2QHXA 1IOWA 2OPBA 4BP3A 3HA3A 5KTKA 3PD0A 2A5GA 1IL0A 3E53A 3L40A 2PIDA 5D1HA 4AF7A 3CJQA 3H87A 4CIDA 1SULA 4EMUA 4V1CB 1Y8AA 4KUHA 2ECQA 3OTQA 2C57A 1Z4IA 2GCOB 3I2YX 3H13A 3HUFA 3OF3A 5JUWA 3NPAA 1H42A 4IMJB 5HCNA 1U02A 2HJSA 3P9ZA 4Z99A 4C6SA 4EFLA 2O1WA 2QG9A 3VJLA 4G26A 5CIWA 1UPFA 3FPEA 1C8LA 2AUNA 1NK5A 2MINB 3P2KA 2NYUA 2GRAA 4U7DA 3VYRB 3LLUA 3X1KA 3ROTA 2G5HB 2XYQA 5EHGA 2Q41A 2ZI5A 1O96A 1ZMOA 3BE8A 2IJGX 4F7DA 1IMOA 4ZA2A 4IJ6A 5F1PA 5DDIP 1GL6A 2AH5A 1I0LA 1T29A 2DR0A 2I6UA 3EDQA 4LMRA 1MQAA 3OJEA 4TM7A 5FO1A 5D49A 1BW9B 1DNPA 1Q17A 1PQPA 2VANA 1F20A 3LGAA 2R97A 1ISPA 1GZDA 4GL4A 4R1LA 3HJBA 2YYZA 1CD5A 3B1ZA 1C9MA 4XAQA 1RSZA 3FPHA 3PYMA 3O2QB 3H8VA 3R40A 4BMSA 4U2BA 4LHSA 5P8WA 2ZUEA 3GF4A 4RZUA 3KU4A 3PKZA 1TECE 3SNKA 1QF7A 2ATXA 2GN9A 1JYFA 2I4TA 3NBXX 4CDGA 4URUR 3UT0A 1LQ2A 1JLHA 2C1XA 2PJUA 1Y4AE 4OJTA 4ZO6A 1EM6A 2IZOA 4EKDA 5B2ZA 1SIJA 2O23A 2RGGA 3IEUA 2V5VA 5IXJA 3S5JA 1QCDA 4AMUA 1G16A 4Q7EA 5IAAA 1D2RA 2FMFA 7ICIA 4B9UA 1DZIA 2HHSA 1U8XX 4JC5A 3B3GA 5BUCA 4AYWA 1PFYA 1Z17A 1N6RA 3WLKX 1RE1A 3P9YA 3IP4B 4JVOA 3T3MB 4OJOA 2WJVA 1LLQA 9ICOA 1F2UB 2FJUA 2XMQA 2JC3A 3VHLB 4DM7A 5TQ2B 3GFVA 3BYZA 3WADA 3BK1A 5EUBA 5DM70 3O4GA 3KWJA 1QS0A 1VKRA 2QRQA 1XT6A 1ZSYA 3KOUA 4G0VA 2B3DA 1BJRE 2AEFA 3I05A 5LZ9A 1O0CA 2KWIA 1EVJA 3RUEA 4O4JB 3MUEA 1M7GA 3D7KA 5I51A 2Y0SF 2E4UA 3SSMA 4XDHA 2JD2A 4QBTA 2KG5A 4BVAA 2JVIA 5JH7B 2JXJA 5DI9A 5FV7A 2RHRA 2J3QA 1J2EA 2YIVX 3B1KA 3PQEA 3PTZA 2WG2A 5F5LA 3DFFA 3N0WA 1UPHA 3H2GA 4Z4EA 2DBRA 1JJIA 2ODEA 2Z43A 4PPFA 5KAFU 3EZ9A 3HXKA 2LVBA 4JELA 5I7AA 4DOBA 3VNSA 4EAQA 4F4UA 4YQFA 2ZT6A 5AW0A 1TKDA 3G68A 2O0HA 1UZNA 2ONZA 2Q3FA 3IT2A 4W7IA 4PNEA 3C3AA 4RCYA 3DP7A 1CB7A 3R5FA 2DG2A 3PQ4A 2BTQA 4MS1A 2XCTB 3HNRA 3R0JA 4UTRA 4RVGA 4HAYA 4IQ8A 2OGWA 2VPXA 3U80A 4UTVA 4P4OA 5LMZA 3CUKA 3MMZA 1QAMA 2ZTSA 4ZGWA 2VTBA 1L9KA 3EWSA 3RYIA 5KWJA 2KNJA 1N6KA 3WO1A 4IIYA 3N8IA 4GBGA 1EBFA 5F33A 1N2IA 4D4KA 2X9VA 3NNSA 2FJ6A 1ISIA 3AB3A 3NH9A 3AVUA 4YMWA 2A14A 3IOMA 3PUYA 1ZR4A 4I2EA 3PFHA 3HB9A 3IA7A 1XAGA 3KJNA 4AFNA 3UPTA 2NUBA 2AWNA 3UJCA 4I27A 3GMSA 3SF8B 4C7OB 3JAMA 4IC9A 1KSPA 2VPPA 4MW0A 5NLLA 3N53A 4Q37A 1QHFA 4RLQA 3V7JA 3KT6A 4TLMB 4BFWA 1QHYA 2D59A 2QUKA 4QUIA 2HLHA 3SAJA 4F3CA 1YB4A 2FUG6 3HTXA 4OA8A 3QELA 1T3GA 3PUWA 1VKJA 3B1VA 4HDOB 4L8VA 5BN5A 3GZJA 5FQOA 4J29A 4ZCRA 1HYGA 3D3KA 4BS9A 4IIHA 1OV4A 1KPIA 2EX1A 4M8LA 1KI6A 3UEOA 2KFZA 3IQGX 3MTAA 2BCGY 3U81A 2F1JA 4FFMA 4RSMA 1K4YA 3LTEA 5GJBA 4KN7A 1HYBA 3C6MA 1S01A 1TZKA 1LBSA 3T94A 1JTVA 4NV0A 3T41A 4IINA 3K94A 4PS1A 3AVXA 2FWMX 2JLRA 3L7YA 4O4IA 1HYEA 4UTZA 3R75A 2XT6A 2RDJA 3O1HB 1XLWA 4IV0A 3EAFA 4KFCA 4KQGA 4D6PA 1K86A 3HJNA 1MA0A 4DL3A 4BAZA 2WYVA 3REGA 4BLVA 1R4MB 4L1KA 3EW9A 1I2BA 1PG5A 4B17A 2FE4A 4DLTA 4QFMA 4BN5A 4BFZA 3ZOZA 3HB4X 2BD0A 2RD2A 3NBZC 5IC4A 2EW2A 2MR6A 2BQUA 2XNKA 3VSBA 1XNJA 1YH3A 1PLKA 2HNAA 3LC0A 3NTUA 4V0KA 3URMA 1QH0A 3KB6A 5KG7A 2JJYA 4DHWA 2G5IB 3W4JA 1IH8A 1A9PA 4U7FA 4UBOA 5JZ9A 1UC8A 3HKBB 1QOPB 2OO3A 4PHEA 2RK6A 1DTSA 3JZAA 1WXGA 3OU7A 4EOGA 5B3JC 1TEXA 4QPDA 5IASA 2IXTA 1L7EA 2I7DA 2J9GA 2Q6LA 2QZ9A 3PD7A 2BRUA 2LIPA 2BEVB 2FHPA 1Z82A 4TKMA 3ORSA 1Y8ZA 5KFVA 4JBYA 3TE7A 3U6BA 3HW8A 1OFGA 3DZGA 1GZ4A 2ZJ7A 2W6IA 4R69A 1IFXA 1QOQB 4N3CA 4U6PA 4Q9NA 2BFNA 1IWBB 2ZB7A 5T6MA 2C7OA 1RQLA 1NE2A 2SECE 2DULA 1NK6A 2Q8QA 1D8BA 3JALA 3I6BA 2O4CA 2Z56A 2RI1A 4F96A 1Y1QA 3IQFA 5HF9A 1YL5A 2GJKA 3GUUA 3O9ZA 3DHEA 4H17A 4WNAB 3H7IA 1LK7A 1N75A 1Y5LA 4HXEB 2C94A 1SVNA 5LQDA 1W4AA 3AEQA 3N2YA 3N58A 2KJQA 3FNHA 4IHJB 4OO3A 3JAKA 2Z1DA 3WBFA 2QUHA 4DJTA 1MDFA 4RH0A 1UL1X 1YZFA 2AX4A 4F45A 1Q8KA 1JHXA 1O57A 3M49A 2NO1A 4MR9B 3ZCVA 3PWKA 5KQSA 1QQ5A 4K4HA 2ZM6B 3I2JA 3ROFA 3BQ1A 3WWOA 2IBSA 2P35A 3WYEA 4ED7A 2WA1A 3E3OA 5JAMA 3N7AA 1ZUHA 4E0BA 4MB0A 2I9GA 1SUPA 4RA9B 3O8LA 1JHQA 2FEWB 4IIXA 3BQ2A 3KJIA 4YMSA 3HUUA 1HNWB 3LT5A 4X61A 3JQFA 3WKEA 1TJ3A 4XIYA 2XUJA 4E5DA 2FLNA 3ASUA 3NT4A 2R00A 1ZQQA 1Z29A 3DB2A 1K06A 4IRDA 5DHSA 2B9VA 1UOEA 4X1OA 8ICLA 3DE2X 1GPDG 4A0SA 2H06A 4I3FA 3SBEA 1W85B 2GDJA 4QFBA 3N8NA 3D7MA 2R1VA 2VVTA 1OFHA 1JKJB 2XH8A 1VL6A 4F56A 1YI1A 2YNMA 3AYZB 4MGKR 4BGEA 2B0CA 1USUA 1P3DA 2AYXA 1AUQA 5JXIA 4ECTA 4BO3A 4G4JA 4YMVA 4RBNA 1C1HA 4AROA 1B76A 1GXSB 1V26A 1YCDA 1C1DA 2OXCA 4LF6B 1NXPA 3W5UA 3UAYA 1ZQNA 1E7SA 1VMKA 3JQ9A 1TPZA 3KSMA 1Y63A 2QP9X 4BEJA 2F2AB 1ZNWA 4X8OA 3H4VA 1YZUA 1XD9A 2X2PA 3MEQA 1L7VC 3KBBA 5EZYB 2LGJA 4OD0A 2M6RA 2JGAA 4NULA 5E7IA 1PEDA 4MEYA 1SZDA 3N8GA 3D1JA 3KKNA 3R6WA 1JZQA 4CEHB 2CVOA 2J3IA 2JDIA 3K20A 4RM3A 1G21A 3B6KA 3KALA 3CISA 3NGLA 4GPEA 5AK5A 2W3SA 4KFTA 5GM1A 1ZICA 5IARA 1TZ2A 1KRWA 1FP4B 1R9MA 4DSAA 1IPEA 4Z54A 2P4EA 3F2VA 3R5KA 3GZNA 4G5OA 1QLNA 2HHHB 3VUFA 1E2PA 5IAJA 4JJGA 1OHHD 1JU3A 1QK5A 2QTLA 3L06A 2HNKA 3TADA 1V8PA 3K05A 1DKNA 1FLAA 1XRMA 1DXHA 3L8HA 1OIVA 4CT4B 4WXPA 1F5NA 3AR7A 1ZNZA 4KVFA 1MVNA 4MQFB 1MQ9A 1XDWA 3B2QA 3W79A 3GNQA 4A6DA 1QONA 1Q3HA 1L1EA 3RVBA 3DMHA 3VDRA 1NBEA 1A72A 3ZWDA 2ZE5A 4XARA 5KSOA 1FNNA 3GJ4A 3G2QA 4ESHA 3BF8A 4OYHA 3MVEA 1MEEA 4X9XA 4WCVA 3IBFA 1YBHA 1TNDA 1TQDA 1IOVA 1REQB 2CLKB 1WBJB 2ONKA 3AJEA 5KFHA 1XB2A 4KN8A 5HE9A 4K88A 3OU6A 1DRKA 4BKPA 1XGKA 2ZATA 5KTRA 2DERA 2Z5VA 4LXYA 3SDBA 5I01A 5JDIC 5HF8A 4BLTA 5F5XA 2VF4X 4TQUS 4QFCA 4YVFA 1SXQA 2O7SA 1E59A 4C1NA 2WMYA 5HMLA 1MT0A 1XCBA 3U7JA 1P17A 3S68A 2W9BB 1EEHA 2HF9A 2O6LA 4I1VA 5T57A 3T5PA 2ZBRA 5MFZA 8ICSA 2Q5JA 4QICA 2V3VA 3PNQA 4CEIA 4RHXA 1XF9A 1F44A 2IXBA 3UG7A 2IS6A 3P19A 4PM4A 4QE3A 7ICJA 3T8YA 5J43A 4G24A 3PENA 1ADBA 2F9FA 2R8IA 5HF5A 2CXTA 1WCXA 4RA6B 3BWEA 5GVSA 5IYZB 5BSTA 1N0IA 5IIKA 4KKXB 5TE9A 3WNCA 2WFZA 3F3KA 3T52A 3E70C 4TN1A 3QM1A 3VPHA 1DWQA 1U0SY 2AMJA 1ZCJA 2FW6A 1OIWA 2ZTCA 3E2EA 2UUOA 2YJ4A 3WIBA 4M9GA 1Q21A 5E4TA 2XMCA 4JODA 2VC2B 1GZHB 1OV6A 3UCFA 3BWVA 3DOUA 5L4NA 2V03A 3NWOA 2ZE6A 3S7ZA 3GDGA 3WNBA 5U9CA 1U7PA 1SXEA 1ZM4A 1D4ZA 3NYWA 3ONEA 1BGVA 1Q92A 1Z36A 2IITA 1E9FA 2AS0A 4OHOA 2PH7A 3N75A 2BHNA 2IDJA 3INGA 4I8XA 4WLVA 1RYDA 5BN3B 3K32A 3CUSA 1N5KA 1MFZA 1DS6A 1RAIA 3OE4A 4KWIA 4DOCA 4JMLA 4G5YA 3OQ1A 4MDFA 1EGAA 4PWYA 3AGPA 1MX3A 3B89A 4MGHA 1E79A 1PT7A 1YACA 4YUXA 1J8YF 4TKVA 2EZUA 1N8SA 1L5UA 3HX0A 1Y7HA 2AXQA 2CEAA 3DBLA 5LU8A 1RAGA 1JI7A 1UZAA 1I6KA 3W3AD 4IR7A 2AC2A 1OMOA 4QJBA 2ZAOA 4PZOA 4F4FA 2YXEA 4M47A 2O2DA 1E62A 2DJIA 3KLMX 4RJKA 4U7WA 1XZIA 3A2MA 2J7KA 1BHQ1 3GYBA 4L50A 1RC8A 2OCDA 3OOEA 1WB9A 1L5VA 4ETIA 1UKBA 2CWDA 4M1TA 1UAYA 4RA9A 1EESA 1P6UA 2OOSA 3OWXA 4UBLA 3SYMA 3TW8A 3C15C 3OTOB 5EWJB 3L07A 1I6MA 4RABA 4URHA 5JZBA 4J0CA 4MITA 3K1RB 1P2FA 2NU6A 3O3OB 4ACAA 4XVUA 1KSFX 5DLPA 2W2NA 1EZ4A 5IKMA 3NUGA 2FN9A 3EMDA 2IPAB 1GVNB 4XW2A 2XY4A 1J49A 3F8WA 2I9KA 1JJFA 1Y98A 3ZU2A 2NW6A 3DC2A 1LDNA 3HCWA 3VC8A 1JDSA 2GHRA 4BTEA 2I2FA 2HWYA 1Z19A 4ENTA 3OQHA 3ZS8A 4Z3KA 3COSA 3CW9A 3LUBA 2D6FA 1USVA 3JPRA 3MGBA 1C8KA 3DLAA 4I1RA 4PLCA 3UUFA 1DVRA 2KLBA 1BFDA 2NU8B 2VT2A 1UXHA 2KB0A 5AW1A 2LKDA 3C2QA 1GTSA 2F6RA 2LM4A 2VO1A 3QVGB 2QM8A 4D45A 3Q9UA 2YIJA 5LZ2A 4LJSA 4LNAA 2HEIA 1Y9ZA 3GUZA 4X45A 2V6FA 5DHRA 4DDVA 4YECA 1G3UA 2J85A 1YDFA 2WHPB 5D7BA 4EYHB 2GAFA 2GN2A 5KFFA 2PN1A 5FI3A 1PL7A 3ZKWB 3N2GB 1HLPA 1NP6A 1PLLA 1NLMA 3TB6A 1ODIA 1FDWA 2BJHA 3HXOA 2N46A 1LPOA 4YRDA 2V9WA 1V6AA 1CJCA 2J3KA 3AIOA 2HPVA 1HK7A 4H1UA 3C7DB 3AR3A 3PUZA 3R7WA 4MVJE 1QH1A 3UICA 4LJRA 5L7WA 3L0OA 2QVZX 1N2JA 1XHFA 4ENUA 3T79A 5KPDA 1YS9A 2WZBA 3DEEA 2O59A 2W3RA 1RWMA 3LOUA 4E07A 1WG8A 1G5HA 1JSLA 3PPYA 3WA6A 3SMQA 1RM4A 4ELUA 2HXYA 3ICPA 2R1TB 4NOMA 4UHCA 4O4JF 3HFJA 5H4HA 1HQDA 4EJSC 4UBJA 2PR7A 2YR0A 2Z9DA 3ON5A 4DSIA 3PPXA 1ILEA 1O0SA 2PMEA 1Y3DE 1QIFA 3WNQA 3JD0A 1XD2A 4DVGA 1RRVA 3GBVA 4KN9S 4TVOA 2MIIA 3GQCA 1NBME 2QAGA 3EA4A 1R4MA 3M1IA 4MCAA 2P0EA 5D87A 5CT9A 1A71A 1YNOA 2UZ0A 2ZI7A 2YVUA 2GCEA 4IICA 3VC2A 1WW8A 3DW1X 5AKKA 4F60A 2OORC 5AOBA 1Z56C 2BHSA 2YJ3A 5FOWA 3T7KA 3TTTA 2XB6A 3CC8A 4PFSA 2R0QC 4KLJA 1T1SA 1AA6A 4NXZA 1E61A 3RJ5A 4D41A 2BH2A 2KV2A 2OG2A 4HUJA 4FBGA 2AXNA 1A4RA 3DH0A 3VXKA 4AIRA 4AN0A 1KIFA 2ZSDA 3R3YA 1E58A 4YUAA 2WF9A 1SG6A 2QMOA 3DMTA 4DT1A 4IXMA 5C4GB 2OO5A 4Z8YA 4M9UA 4EO9A 2OGUA 1V9SA 3T54A 1PQYA 3QU2A 4OJ6A 2FMIA 2PI5A 1PWEA 2HGZA 1U2RA 3GLKA 4HQRA 4LHWA 3KOZA 1TCAA 4B6OA 4B43A 5DMHA 5JADA 5JNLA 2UVRA 4DIKA 1UZMA 3WLOA 5FUMA 1EFAA 2Y0SC 3OEYA 3L04A 2HLNA 3NVMB 1VPDA 1WUTA 3GK3A 1R4ZA 3NORA 1A95A 4LSZA 1AZTA 3PC3A 5DP1A 3IB6A 4BQOA 5M04A 5DYIA 4L95C 5AKYA 1E0AA 3C23A 1OA0A 1FLNA 4FXPA 3GEBA 2W4QA 2R44A 5FOVA 2HO5A 4PQGA 3OE5A 5I45A 2DL0A 4P4SA 1EU1A 4UDYX 5DKFA 1A77A 3MSCA 1P3Y1 4Q19A 2RARA 3A3OA 4P3YA 2KVSA 1WSWA 3EAGA 3CKMA 4LXGA 5T4FA 1WMBA 3L7BA 1VCNA 2NV3A 5EVJA 1UJCA 1RHRA 5BP7A 2P5SA 5GIPE 2CLLB 1R5OA 2NZJA 2NAPA 2ZXEA 3I6IA 3NM5A 4LYYA 1NKVA 3RR8A 2G09A 1E1MA 1EGQA 4O63O 3VKVA 1A8PA 2XPCA 4M49A 3ZK8A 1RPLA 5JHGB 3IUSA 2AJDA 2XVMA 1DMSA 5IG2A 4W5OA 1HNXB 3U48A 2ZI6A 4U00A 221PA 4FC6A 4U9HS 2F8LA 1FUIA 5K3FB 4ZZIA 4Y6LA 2H31A 3JYPA 2V6IA 1M1UA 3PXAA 2P5UA 2QN6A 1C5KA 3R3HA 1HZZA 1O87A 2PKRA 1CUFA 4BDPA 2BOVA 3HG7A 4C4PA 1XTBA 1F17A 2NPFA 5KFQA 1WPRA 4OG2A 5DOVA 4BX8A 2NRXA 1SKRA 1XMSA 5DGBA 3GP8A 3MLEA 3GA5A 4BQRA 3D2SA 1BWSA 5HVNA 2YXBA 2QD1A 1L8XA 5I7FA 3ZS9A 3ETGA 1RT9A 5JFTA 3IDWA 2GCNA 3JSAA 3ZNPA 1CUAA 4TWRA 5JUMA 1YB5A 1NQVA 1YOVB 4OGKA 1GTZA 2J7PD 4HMPA 4OJPA 2A88A 2WTEA 3CPJB 1C8VB 5ERXA 2HA6A 2VQFB 5E0OA 1N9ZA 1PWZA 2OHFA 1RLOA 2QWXA 1RI5A 2BP7A 3BJEA 4A82A 2VBIA 2OGTA 1HQKA 4JVLA 4UAWA 1K6XA 1RMQA 4NYJR 3I5UA 4E2XA 3QE3A 1CUXA 1CR1A 1SUWA 9ICJA 1H8HD 1TMKA 2H3VA 1ZGCA 5IEJA 2CFTA 2I6XA 1SU6A 1VB3A 5DEOA 3RIGA 4ALIA 2BH9A 4UHHA 4CV1A 3A6JA 5JY1A 4TZ0A 2GTIA 5ALDA 1S9HA 1U3WA 4RNNA 2AI2A 3OT4A 1OXJA 3NBFA 1YCGA 2YYSA 5G5HA 4O3MA 3GCXA 4MW5A 4QDZA 5C1BA 3VZQA 2IHMA 5KI6A 3WKDA 1O97D 2MSCB 3A10A 4M1SA 1HOTA 1DJPA 1RWBA 3LX5A 5FCDA 5A3VA 4YUVA 2VDKB 4AN4A 1NUPA 3TSCA 2ZRQA 2DFKB 1KQGA 4C7YA 4E15A 3ZHSA 1D2CA 3THWB 1FIQA 1T5HX 2BWJA 3IDSA 1U65A 1VA5A 2KJ5A 4CFYA 4GXRA 3M34A 2XDAA 3BQ9A 3O03A 3KNZA 5IMSA 1WNFA 1K7XB 2CD9A 3ZI0A 4US2R 3W5CA 5JSHA 5DBIA 5DF1A 4KEAA 3MR5A 2O0MA 3SXJA 1J0EA 2ZWIA 1L9XA 3BE5A 3FETA 4F11A 5L53A 1PTKA 3DE3X 1OFVA 4QELA 1VSVA 1Y1PA 4R8SA 2OFOA 3TZQA 4BFYA 4US8A 1K1EA 4H7JA 1XTQA 3S3TA 1AZLA 4ZI7A 1YJCA 2GD0A 1FP7A 3LLSA 1LD3A 5CW1A 4UCFA 5FL3A 5FWYB 4YBRA 5KNBD 2CN1A 4BLPA 4PYLA 3PE3A 4K9RA 4RTRA 4J2TA 5JISA 4C3OB 2RJNA 1QPGA 4L72A 4FYVA 4F9FA 5BOSB 1TK9A 3CP8A 1K8RA 2DFDA 2COUA 2VAWA 1Q1GA 1Y88A 3EXHB 3N6RA 2HU5A 3OHMA 3OPYA 1L7RA 3HR4A 4Q34A 5IHXA 1BVSA 4C6RA 2EX4A 2VJBA 4W5QA 1ZL0A 4FYHA 4XD2A 2D1SA 3O8OB 5AM1A 3IDOA 2D00A 5A4AA 2Q9CA 4LRXA 4IHJA 1IHPA 1QUFA 1JKXA 1O1YA 1L7PA 1K97A 1UMCA 3JYHA 4KXXA 3ROZA 4ZJYA 4EUNA 2HK8A 1E0DA 1YL6A 2HTEA 3D4IA 3WBBA 3GGPA 5BSKA 5A4JA 3RU3A 2FXIA 4KFUA 3VKWA 5KT6A 2SKCA 3KT3A 4GMXA 3SEAA 4QZHA 2GF9A 4A9AA 1OH8A 3MRSA 1XEWX 1BVYF 2AXTU 1GA6A 2A0UA 5DGAA 3SE0A 3QX7A 3HKZF 1VE1A 4RAQA 3GLGE 2YKGA 3ICCA 4B7XA 4EIWA 1S0OA 2O06A 4RIHA 1B8VA 4WBXC 4RKYA 1QO0D 2F9LA 3RSLA 2FGJA 3PPWA 2EP7A 2Z95A 3MDCA 3HYRA 3EGDA 2OBBA 3KR9A 1L3UA 2J6BA 2WU4A 4LJKA 2VHYA 1GNSA 2W5UA 5JO9A 3H11B 3N3BC 2EFGA 3FAZA 3K53A 4M9CA 1LI4A 1QIIA 2ZR9A 4ASUD 2N1BA 1RHMA 1ELOA 4Z4IA 3CN7A 3GDHA 2BZSA 3VJKA 3IEKA 4BMNA 4N0EA 4JB0A 2DHRA 1FU8A 2GZSA 5K05A 2ATCA 1OD6A 3ZWYA 4U5XA 2VP5A 3H9BA 4DDTA 4Y2XA 5DB8A 1YOVA 1FYWA 2OHGA 3LWNA 3PHLA 4D3XA 1ORVA 4EX7A 1OQAA 1UZLA 2VHJA 4RX1A 3G13A 3DQZA 1ORRA 2IEIA 4FSHA 4HWTA 2R3SA 4ASUA 4EVIA 3W5DA 3N76A 2UXCB 1L7OA 5EJ4A 1A7AA 4TUYA 1F4VA 1LFAA 1TXGA 2JGKA 3NATA 3CJRA 4JBXA 3ZK7A 2O8EA 1T9GS 4YDRA 2KIVA 4DYDA 2DBVO 5FL7A 3LUAA 4R40A 5DFAA 4TQRA 1UDXA 1N57A 3LZDA 1N2SA 3QXXA 3CHYA 2ZJOA 1J8DA 1L4HA 4E11A 3P4XA 3TM5A 1SKBA 3KOWA 4MVJH 5AM2A 2RCNA 1PVDA 3WWDA 2H51A 3GLFE 2POCA 1BXGA 2A5LA 2YS7A 3N8DA 1K3FA 1W4ZA 2ZS8A 3NONA 4OREX 4DAOA 4A92A 3L7KA 4DLLA 4E2WA 2BISA 1NUHA 2H5JA 4KQWA 2GFHA 2YQEA 1RWKA 8ICCA 4QJ5A 5C46F 3BRWA 2TMGA 5ICFA 2G8LA 1E3IA 4WDQA 3PR4A 3AXSA 1G8PA 3KPYA 3NC1C 4IDOA 4KO1S 2CNWA 2VHTA 4Y1RA 1YQUA 2QTMA 1D8AA 1AGRA 5IIJA 4GZ3A 3T9AA 4D4JA 1FIUA 1RHKA 1KRHA 1YNSA 1C3EA 2BEJA 2MHCA 1YB2A 4ITVA 4IJKA 4R05A 3R7DA 4BNJA 3DGEC 4PR3A 3CCBA 5EPUA 1ST2A 3KKLA 4LXXA 1SQ6A 2XYGA 3EF3A 3KLOA 4MROA 3V2GA 2UUPA 3AV0B 2OT3B 2I80A 7ICSA 1Q1QA 2C4HA 4RV9A 2E4WA 5F3WB 3BVPA 1ZMBA 4A73A 1NK7A 4F1WA 3WI7A 1JG1A 1X9HA 3G89A 3N2GA 4JWKA 4UOQA 1NBHA 1GFWA 3DWFA 2GK6A 2ZFUA 3EAQA 1JG2A 3C8ZA 3DZCA 3RU7A 3RNOA 4CCYB 2JK1A 2NTVA 4J8PA 3T4UA 5AVSA 1O5TA 4YMOA 1X42A 3EZYA 1G8YA 2RGBA 3GA7A 2V7PA 1SD1A 3B8HA 2NSJA 4MPTA 3ANLA 1I36A 5TLSA 3RAFC 3F2BA 4AP5A 5IAEA 1VPEA 4GXKA 3R6LA 1ND5A 2YWDA 3D6AA 1OZAA 3MINA 4D25A 2C2YA 3ZWQA 3SYTA 1F1JA 1LV5A 1N62A 1M7BA 4KN4A 2DTDA 3SZ2A 3W7AA 3K5PA 2VK1A 5FPPA 5JYEA 4PC3A 3M3PA 5BYKA 4FTWA 4PE5B 3V2HA 1Z6PA 3EHDA 3ELUA 4BNKA 5H8WA 1ID8A 1HT3A 4YRAA 1LI7A 3GLVA 3T9FA 1QIGA 4H4DA 4JEMA 4ARAA 1IXYA 3CWQA 3OAAD 2NTNA 5FD8A 2W42A 2LNDA 4X6UA 4YGXB 2AQKA 3BFKA 1P1HA 4IH9A 3A27A 3WGQA 1N9GA 4C1BA 3CNQS 3GPIA 3K9FC 1E8MA 4CG2A 3EZ5A 1SVWA 1Z2CA 1Z45A 2PWBA 3I64A 4EQ6A 3DDZX 1PJTA 3CW8X 1EX6A 3MGCA 1XJQA 4YAFA 1UKVY 4S1NA 1LS6A 1J7KA 3KLNA 2PPLA 2X0FA 3B3AA 5HGXA 2V7EA 4NE7A 2B20A 4EYOA 4TLDA 5GINE 3ZV7A 3VQTA 2F1IA 3SK0A 3T99A 4WOKA 1NP7A 1HIWA 3ZZ0A 5CEFA 1EZ1A 2FLVA 4MEXA 4EJ6A 1KJIA 1LDGA 3OOHA 4K9DA 1RYYA 4UUNA 1YFJA 2H2GA 3UHJA 1JPJA 4EO7A 2LM1A 5G1OA 3RUIA 3DBLB 1PLJA 4UQPA 2LXNA 4KO3S 2YHBA 3VV3A 3E9ZA 3G17A 3QW4B 4F3KA 4QBFA 2X5OA 1KIMA 1B0ZA 3GCGA 4ZC8A 5DG7A 3E15A 3AIIA 2BMVA 2W9CA 4KLLA 1ZI6A 3K15A 2HV9A 4ECRA 4PYQA 2H5LA 5DN6A 4LFAB 1VDZA 1WUKS 5E7MA 5DCLA 4DWOA 3U7IA 1NJSA 1O6CA 3AEZA 4Z9FA 3A4NA 5LLSA 4KSCA 3FSEA 5ALPA 2IHVA 2N3ZA 4L6CA 3PZRA 4H7IA 5TMDA 5IT0A 1T13A 5E9JA 4UNNA 1G0NA 1HE8B 2HJGA 2XX3A 3H9EO 5G0VA 1HE2A 1I33A 3BE6A 4RLSA 5DBFA 2C00A 5H3HA 3USES 3ILHA 1U99A 2WU8A 4CKBA 1W36D 1ILWA 1GG8A 1XXHA 2O8FB 2HM7A 2MSEB 5CDGA 2I99A 3WDKA 3BMNA 5HJEA 1E2DA 4K9QA 4AD8A 2P3SA 4HEQA 5JAPA 2HMAA 1H6AA 4FT4A 3IALA 3PFWO 5ALYA 1PEAA 2Q2WA 2OFWA 4IDAA 4IM7A 5EINA 4EPYA 3D43A 1ZQYA 4Y2VA 4PZCA 5EOZA 1NVGA 3EZNA 3FFXA 4FWIB 4I3GA 2OQVA 1JHVA 4O0IA 2B8EA 1H2HA 2W8BB 1G63A 2R86A 2RAFA 3AINA 3Q8WA 4KXFB 4QAQA 5J4LA 4YY3B 3MTJA 3ER8A 1RTTA 2XGJA 7ICQA 2QLMA 3DNPA 3RO7A 1YR7A 4P0PB 1CVLA 2I34A 5ALIA 1C7ZA 2PL3A 3VNAA 1Q7CA 4KXYA 3FMGA 2R8KA 4V2UA 3GUYA 2XECA 1IZZA 2Q5HA 2C7RA 2C03A 3NIGB 4CW7A 3C70A 4UNIA 1OWLA 3QHPA 1TVCA 4L5AA 4RQ1A 3TDMA 1LK5A 1ZO8A 2QYSA 3HPOA 3AIKA 4R7ZA 3RLFA 5HXAA 2Z8ZA 5DNAA 4YPFA 3GFGA 2CHVA 2WTBA 1YDEA 4GW3A 3FHTA 2C9DA 4L57A 2PUEA 4ZCMA 2IW3A 2O0LA 2QXYA 1HRKA 3IHKA 3N2LA 1GU7A 2JHPA 2C61A 1QFZA 1M3SA 2C4UA 2P2GA 4FFNA 4MUFA 1ZQBA 3IAM6 5I8ZA 1UM9A 5IDQA 1XTUA 1Z75A 2FEAA 1H8ED 3K35A 3CURA 4XUGB 1ZH2A 2H1RA 1O5OA 2N0SA 2ZB2A 2ZRNA 4LPSA 4ED8A 2FRDC 1JEQB 1XDDA 2Y3IA 4DTIA 5KREA 3SBDA 4BEBA 4K40A 1WJGA 3KAPA 3PI7A 2Y76A 1XXLA 3ZWAA 1FMLA 1YI8A 4G56A 3PJGA 2ZIEA 4GI2A 5GTDA 2ERCA 5ITVA 1TTTA 2BR5A 3AHJA 4IFIA 5IDVA 9ICHA 5A5VA 3FPSA 4KU4A 2V1XA 1UWLA 3PNCA 1XEAA 3FDSA 4PXYA 5CGZA 5KFCA 4OLJA 3P52A 3THWA 3JYOA 1V16B 5HR5A 1LVUA 2W2QA 3GRUA 1ZRHA 2IWHA 1N5RA 2W8KA 1DBRA 3HACA 4JQYA 1P1CA 1F0NA 4GXQA 1UDRA 4MRMB 3N2KB 4K9SA 4OGLA 3G7NA 5E7QA 2KICA 1WRBA 3H83A 2DRIA 1M0TA 2W03A 1KRPA 2IGBA 5KT3A 4ELTA 1PX0A 1QLJA 1Z2OX 3IESA 4KIJA 3CYMA 4D9NA 1I3OA 1EJ2A 3TIGA 1GGMA 2PLWA 1EXWA 1NSFA 4JMUA 1YD7A 3H0CA 3RPEA 1ZYUA 5KOJA 3UMYA 4ECZA 2PT7A 2GXQA 2P75A 5HMMA 3E82A 4WZAE 1SK9A 2PT6A 2IHYA 2ZPAA 4ACOA 3GR6A 2IXAA 2QLLA 1JN0A 2D3TA 3PX2A 4J0DA 4MA5A 2X8LA 5F7ZA 2AE2A 1HA3A 1GDDA 3V4ZA 3SHVA 2E87A 5TB5A 4MQBA 5JATA 1WB6A 2XMRA 4KO2S 5C1OA 4F4YA 3CRRA 4R51A 4UULA 1DBWA 3RB3A 1MO2A 4X3CA 5T7BA 2C8JA 1M6YA 3A1WA 1OREA 3PI6A 2DETA 2ZCVA 4KE8A 4KQIA 4EFMA 3V6LA 4AZWA 5L8VA 2FEOA 2P2YA 3LA8A 3OJCA 4B3SB 3UXYA 5BR7A 5A9TA 3IQDB 4ZVSA 2JLZA 4QEZA 3A6DA 5AVTA 1ZVVA 1AQ6A 4JU9A 2O1EA 2GVNA 1BYIA 1DGJA 4N47A 1F2TA 1V6CA 1PK1A 9ICMA 3D6HA 3CZ4A 3O4JA 5IKXA 2JVKA 4OSPA 1YE5A 2XD9A 2VSYA 1L4GA 5IDXA 4MV1A 1XTPA 4YRIA 3KTDA 3WZLA 2R9VA 1Z39A 3I62A 1TCVA 1UK8A 4MB6A 3UHOA 2DUJA 2Z0MA 1KDTA 5T4BA 4XWGA 1J2NA 4EKIA 4RK1A 3O26A 1E7MA 1G5TA 3CIOA 4PLTA 5JBQA 1UBKS 2B98A 5I3ZA 1DFHA 3NYIA 4C8LA 2VJLA 5BRJA 1WXEA 1YA8A 2C4NA 1OILA 3LCVB 4ECSA 4W63A 3N4MB 4HGPA 4LJ5A 2CLHB 1XCLA 3SYRA 3CB4A 2OC4A 2ET6A 3OPYB 4ITUA 5JD3A 5DW3A 1LY1A 2C9BA 1JSZA 2YJTD 3LSYA 2QLNA 1NURA 2NACA 4P9NA 4QOFA 1T0PA 4UBCA 2FK8A 3DLTA 3PK0A 2X4IA 5CVDA 2OZLA 3UFXB 4BDSA 5L3QA 2YMPA 4B79A 1Y89A 4JJFA 2FV8A 4RQ6A 3IO3A 4JB3A 2HSDA 1PU2A 4UAGA 3OWHA 3R6TA 4YRRA 1I80A 4R16A 4PX3A 2PZFA 1Z37A 3N5KA 2I6TA 3A3PA 4Y6PA 4F9GA 2L2QA 1JIUA 2IZ0A 5JR3A 4E5KA 1D07A 3ZGYA 1Q3VA 4F5YA 4QXMA 2KHQA 2IQ5A 5IZCC 1WXFA 2B2NA 3B1YA 3OT1B 4DSUA 1T4BA 4R2XA 3HDJA 2ALJA 4Y18A 4JJ7A 5CMLA 1V97A 3HM2A 4C8MA 2X5NA 4HDCA 4HX9A 2FYTA 1ESCA 4CM4B 3MCZA 4CTKA 1QVVA 4JR1A 1RXSA 1ZWKA 4P4MA 3ZNOA 2DUMA 4LWPA 5ILGA 6ABPA 3GJ8A 4H08A 4ZDJA 1G4AE 3G2IA 2BBSA 3PEWA 1WDKA 4DIDA 4UQLA 2BFBA 1BXGB 3ASZA 4Y1GA 1O9HA 5JJKA 4JLSA 3T35A 1M1XB 3IPRA 3PC2A 1V39A 1ITZA 4RPKA 3DE1X 2JLXA 3JALB 2QL6A 3LC1O 1CUJA 1A7UA 3C6QA 5DNYB 1RLMA 1PRYA 4UTXA 3KTQA 3KJQA 4UE2A 1ZYQA 5CA1F 4KXMA 3GV8B 2HEGA 3STUA 3BFJA 3JWHA 3P9XA 4MRMA 2FRVA 5FLEX 4ALLA 2VQSA 3OQOA 3PITA 2FP4B 1PW7A 3UXEA 3W9YA 5C8XA 3F6EX 4I1IA 2JAQA 2P7HA 4CNBA 5TMEA 1XN1A 1DAHA 3H1PA 5KFXA 4G4IA 2I1QA 1T91A 4OHZA 3T5GA 3L8DA 4DIFA 3FKSA 2K89A 3JD4A 1E2IA 2EW1A 2POQX 1SWVA 1CQJA 2ILVA 1V1MB 1RM0A 1KO7A 1KJ9A 3QFFA 4DNXA 5KWVA 1S8FA 3GAZA 1DBSA 1KWKA 3H8SA 3DEFA 2QVLA 4MYRA 2VA8A 1QRUA 2ZTMA 5J0TA 3DVRX 3ISTA 1WVIA 2I6GA 4B74A 3TTUA 2PKCA 5FUQA 2PGNA 2XKKA 1RLUA 2JIZD 2PLNA 2PX4A 3LCMA 4BB5A 3LYSA 1Y81A 5CD9A 5BSRA 1DOHA 2JARA 3CNBA 1L4LA 3HCCA 4AL4A 4BGUA 5KYWA 5IT9A 4R81A 4B2IA 3VO8A 1UJMA 4ED3A 4NE2A 4I66A 1C0LA 4MUIA 4Y2HA 2BR0A 4HRAA 1N3BA 4DTCA 4DRXB 1U2GC 4X6XA 4BX3A 3CVJA 4MSUA 1F8XA 3TAHA 1W76A 5MN4A 2C1ZA 2O2ZA 5E6SA 3GIJA 3DFZA 2ZIXA 1E7WA 4HAZA 1OHHA 2HJVA 4E4RA 5BMOA 3PCRB 3W9UA 4HQNA 1K8XB 4FHGA 3SC2B 3WK5A 2QPAA 1XCPA 4CR7A 5IAOA 1TCBA 1D6MA 1USGA 2GDZA 1Q95A 3C14C 4O4JA 3RJEA 1VKNA 3FI0A 4QSMA 4HQKA 1N0WA 4NBVA 4ESOA 5F2NA 2OC9A 3LT2A 2EFYA 3NOVA 4A2PA 4QWDA 1NMXA 3IXMA 4GBED 4D9GA 2YWBA 4JJ6A 4YLYA 3F46A 3SJUA 5G3YA 1KS2A 1WP4A 5H9WA 2AG1A 4TT3A 4MO9A 1QDEA 1C81A 3H4BA 4PGXA 4YRZA 1A8UA 2H1LA 5TQVA 3OE7A 3P9SA 3NAGA 2ZJ5A 4MJLA 1BYUA 3EQ2A 4ZTZB 1IWOA 4UEWA 5TT0A 3R5TA 9ICSA 3B7WA 3GRPA 4HLQB 1Y1TA 4BJ3A 3OIVA 3DD1A 3KELA 1NJ8A 1RWVA 1WZ2A 4KAFA 1MIOA 1KYQA 4G97A 5IVDA 4U2EA 1H4SA 2QL9A 3H5IA 3A1FA 3KWMA 3JVIA 3K6SB 3HB5X 2ZPTX 4R3NA 1OLXB 1UDCA 3AFHA 4RF3A 1ZD4A 1R4NA 1EXMA 2O1XA 5T3UA 4LJ7A 2GUWA 2W4IA 3L1HA 4QX6A 3DKIA 3WR5A 1RP1A 4EF4A 5IM4F 1B0AA 3EVEA 3RIMA 3N7RC 3WWYA 3TTWA 5JAUA 4MUYA 2WQ7A 3E7FA 3U44B 1AXGA 2H4JA 1JRLA 4RHTA 3ADPA 5AVXA 1NNSA 1VIMA 4JLBA 4YA6A 1L7NA 1X1SA 4P3KA 2AYZA 1N3IA 5LZ5A 3V00A 2Z2XA 3LH5A 4QYSA 1KC1A 3TVTA 4H35A 3ZWXA 3KV3O 3ZXSA 4Z49A 4P1ZA 4TTQA 4FNAA 4MVCA 5DTEA 5BR4A 4IY1A 2V0GA 1OTXA 1ZKMA 3B3QA 1TVKB 2OAQ1 2DKFA 5EP4A 4QJFB 4S2EA 1SA0B 4NBTA 4H0FA 5IS2A 3IKLA 2X15A 1N34B 2QB0A 1KP9A 4X92A 5AUQA 3EYWA 2DKXA 4JI3B 3OCCA 1EUZA 4F86A 2CPRA 3QUBA 1JDNA 3KJFA 1GG9A 2BKUA 2JH8A 1XC9A 1XTVA 3EQ6A 2EF1A 2H5XA 3E9DA 4YXFA 3MILA 3H0LB 4CQJA 1Y6ZA 2Y2VA 4LY9A 1PUZA 3MTGA 5JJBA 4UEJA 1JA0A 4LQ4A 5AIAA 5F1YA 3ZYCA 2H5IA 5B55A 2IYOA 2XUFA 3O2JA 3PLNA 4PPNA 4QUEA 3IQEA 3OSZA 2VCHA 3NM4A 5AW6A 2LRHA 3DE0X 2MUTB 3RJGA 4GL2A 3AOGA 1IJEA 4GX2A 2ZDHA 1JQ3A 2Z8YM 3HY3A 3UVEA 3T4EA 3ZV4A 1MGPA 3VR3D 1PAUA 3MSXA 2ORED 2DE0X 3UPDA 1ZVQA 4QXOA 1Y9EA 4TSFD 5KOIA 4I4TA 1GNVA 3R8FA 3ESRA 3FF1A 1EAMA 5H82A 5ER9A 3L43A 3IVAA 2ORIA 2R6HA 4KFRA 4BVEA 2DCMA 2FN3A 3HL4A 1PR1A 4UBMA 4OFZA 4D0SA 4B9LA 4X60A 4EJSB 4TUPA 4C03A 1F3OA 1TK2A 2B6HA 4LXQA 1BGXT 2FCAA 2FF7A 5CFQA 3WNZA 1OU0A 4Y8VA 2C0CA 4ZHQF 1FSGA 4X97A 1S8NA 2IPOA 2QD3A 3HN2A 2O7QA 3Q10A 3QPUA 3L7OA 4J0FA 3RB4A 1BROA 1TO6A 4R2WA 5FFFA 5BQPA 2BCEA 3LV8A 2CF6A 2PGAA 4P4UA 4C4ZA 2OP0A 3B7GA 5CB8A 1U1FA 3ZCTA 1VGQA 3K0HA 5JDCA 2Q50A 5AI5A 3K0CC 1LPAB 1ZOIA 1D2NA 2XGGA 2ZT7A 5TMPA 4WOJA 2G1KA 9ICBA 2N75A 1Z0JA 2XJ9A 3OLCX 4YT5A 4NG4A 5FTJA 2Q3HA 3A6ZA 3KQKA 1T9GR 4YI5A 1S3SA 2ZYAA 3ZLJA 4ZAFA 4EG7A 3M6LA 3KIPA 3WYNA 4ZJPA 2D2VA 3FNIA 2AR7A 2PZ8A 4ND5A 2OFFA 3EXEB 3AR9A 5JNRA 2AU0A 2JCYA 3H2HA 4FJ1A 4I2NA 3JPSA 3BQ0A 4KI0A 4XD7A 5IVIA 5IXSA 1IRXA 4I5FA 4F2DA 4HNGA 2N47A 2CHGA 1YASA 8ICOA 3RVSA 1ZR2A 3FPLA 3S70A 4PHTA 4HR7A 1ANKA 3ECCA 4YYEA 1IEWA 3SSAA 4AVYA 3DOEA 4JCOA 2WWRA 4EG8A 5A6SA 1PFKA 3ZBUA 4CMIB 3R6DA 1JAZA 3MC1A 4BFTA 1RP7A 3PRJA 4MYHA 3MJFA 3I04A 3RAPR 2Q3DA 4YMLA 1EK5A 3BFVA 4Q4CA 5ICGA 4LQDA 1RACA 3AWDA 1Y8QB 3BA1A 3FLAA 1ND6A 3ZY4A 3T3GA 4AUKA 1TFUA 1B14A 4BUCA 3NFYA 4ND1A 4B9MA 2IV7A 4EUSA 4UM9B 4BQNA 5CH5A 1M9NA 1T0JB 2V6MA 5A0FA 4KP7A 3HEAA 4OY3A 4A1OA 1TPYA 1DUVG 3DJFA 1F0YA 1JE1A 5AKXA 4OQYA 2BPCA 2NADA 1EVQA 1G60A 1MQ8B 3MCVA 2YHAA 2FZWA 1UOPA 2OQ2A 5C7LO 1S2LA 4R3WA 3L4BA 3DZJA 1JROA 3THXB 1XRNA 2QLBA 1LXCA 2PX8A 3M0EA 4FZ5A 4G0QA 4GLFA 4BB6A 4E33A 4UEOA 4P7GA 2AMLA 2KKPA 1J8FA 1G55A 3GFSA 3LOQA 3PXBA 4RPXA 3GBSA 3W5JA 1WNTA 5C80A 3F5FA 3I04M 3K9LA 4D9EA 4NBWA 1VB5A 4I5EA 4LJAA 5BW5A 5KMGB 2ILTA 4OJ5A 2IUYA 2V4UA 5AMXA 5JSQA 2X9NA 1PK8A 3BB1A 4JOCA 1E60A 3KZOA 4WPGA 1HLDA 3C45A 2FX2A 3I4CA 1ZUNA 2QJTA 4XUCA 3SR6A 3EXIB 3K9NA 1DAEA 4FD3A 1SOWA 3D6FA 4ZO8A 2R7AA 3WLQA 4UM5A 1SNYA 3UMSA 4J9OA 4PHAA 2ISOA 2DTEA 2XTZA 3U3DA 5FHRA 4XA5A 4EKNB 3H3JA 4LZGA 1JEJA 3I9NA 4FLFA 3ICQB 4HH0A 3A25A 3GLHB 4RL6A 4HDKB 4NL4H 4V0OA 4R84A 3C5GA 3C5VA 2B7CA 1BS1A 2JAHA 1UPBA 3TTXA 5CA0F 4OYLA 4YRMA 1NBAA 2WU0A 5IANA 4MUKA 1C1YA 2FB9A 2XQIA 2HCBA 4L22A 1QQAA 1F6WA 4RXMA 4FVTA 4Y6OA 5HGJA 4DLSA 3V6JA 2YCLA 2Z3WA 3Q4GA 4JUBA 1JBKA 4TKUB 2LHTA 3QEKA 4KLOA 3IFSA 4KSBA 4CMJA 5G1NA 4EL0A 1JJAA 4N0PA 1DKUA 2GO7A 1SIBE 3RRHA 2RG7A 4YQZA 4F2HA 4WK0B 1OW5A 2PKYX 5EE0A 1FU7A 4DPKA 4HWGA 2DSTA 1GKLA 2F43B 3N8KA 4KDRA 1VJ1A 4TUYF 1U28C 4Q12A 5K8UA 2Z5GA 3B82A 1PK3A 2V55B 2ZJ6A 4BBZA 4CMHA 5JEEA 1ID1A 2P3OA 2FWAA 5BWOA 1XJ5A 2NX2A 4NBSA 3GV7B 1DQSA 1X9WA 3HFRA 3L1JA 4K9NA 4F4HA 3HU5A 1BFKA 1Y7LA 1DT3A 2IOQA 2X2EA 4RHCA 1QZZA 1I7DA 1ZQAA 4XDZA 3GJRA 4OXIA 1HSZA 4PXSA 2NUTA 2QR2A 1D9ZA 4TV8B 2IT1A 4ZVKA 1JX6A 3A9RA 5KDOA 2OV3A 3F7TA 3BB3A 3AUUA 3ETCA 1DEKA 5CWRA 5TY0A 5CR9A 1R18A 3E9RA 3PNYA 4QYWA 4W5TA 3DMFA 4YGYA 4CKYA 1C80A 3O2NA 4DDHA 5EJEA 3BHIA 3D2BA 4GC9A 1NN5A 2C07A 1HE5A 3FW1A 4IIBA 5JQWA 4DCSA 3HMKA 3E7WA 1FW6A 2VPZA 3OCYA 5HHHA 2H1WA 4E70A 5K45A 1Q14A 5BW8A 1VRCA 3ED5A 2KP7A 4Y3UA 1TD1A 4ONEA 2OYSA 3HBFA 2PSSA 4OF4A 2GEKA 4B4WA 3GDOA 4DNFA 3BTSA 4IEFB 4AWAA 1RHJA 4EARA 3KVYA 1T8PA 1SCUB 2W2LD 3GLFA 2WM2A 2OCXA 4C89A 1L3SA 3BSFA 4P81A 4F2GA 4F91B 4ME6A 4FWBA 5TQ2A 3EIEA 3CT6A 4NBRA 3NR2A 4FINA 3O3CA 5BV0A 4XCXA 1QKIA 4CM9D 1VL0A 1FNCA 2ECPA 4PSKA 5LQSA 1XDUA 3W5HA 4ZGGA 4BWFB 4HYYA 4QECA 2IELA 1N0VC 3HBMA 2R6JA 2GZRA 3AHCA 1LDEA 1E3WB 1MH9A 3AOEA 3D02A 4ENQA 4P31A 3C24A 1SY7A 3LBIA 2W8LA 3DTYA 2QVBA 2OD2A 5IBRA 5JYBA 3AKZA 1NP3A 1RI4A 3MBIA 3UHPA 2VYFA 3AI2A 2ZW9A 1RMTA 3NYQA 4GEGA 2PD4A 2A4KA 2BCRA 3AETA 5ERGB 3FHCB 4DQPA 5DP2A 1TAHA 4X1IA 2IPNA 4R1QA 2IIPA 4KNWA 1YS2X 1U1IA 4DANA 3LWMA 4B2PA 3ABOB 1MVOA 2C3PA 1CUUA 4G4GA 3GIKA 4PHPA 1CVIA 1KHHA 3OURA 4HC4A 1Y0BA 2MA1A 4ZRMA 4MI9A 1PV2A 3SX0A 3INNA 2BMDA 1Y3AA 5JO0A 3VBEA 9ICRA 5HRCA 4LDAA 4CLDA 1I8TA 1KW4A 2XY5A 3H0RB 2ALZA 1FVOA 4KLZA 2I66A 2JEZA 3A9WA 1Y6RA 1U45A 1E1NA 2OEHA 3BMCB 3C6YA 2VKTA 3HA5A 3DZ8A 4B87A 2JRLA 4F3RA 3ILSA 3SQOA 3BULA 4NH0A 3NVZA 1XVIA 3ZWBA 1E0KA 2IOHA 3EQ9A 5KYYA 4DYHA 1P5HA 4MPPA 3TQRA 4B6SA 4M0KA 5CPBA 3PEUA 4WA8A 2F3TA 2REXB 4Z9BA 5SY6A 2P9CA 4BFVA 1E3TA 5FA6A 4YQYA 4WZZA 3II6X 4ATNA 1HR0B 1UJ4A 1Y5RA 1YA6A 5I4KA 3DMTC 3E8XA 4JS0A 7REQB 1N33B 4TVBA 4R54A 1GZVA 4RH1A 1QDLB 1A7JA 2PMZF 1MEJA 1MG0A 4L02A 3SJZA 4BVKA 1AVTA 4P80A 1Z00B 3AG5A 5EWMA 3TD9A 5DXAA 3ZDZB 1D9XA 3H6HA 2ZI3A 4QW8A 2XE8A 1J0BA 1H1LB 3HNPA 1J97A 3CX8A 3GDWA 5TR9A 4A91A 3C8MA 3G5MA 2V3WA 4UB8U 1MA7A 4JJKA 1Y5NA 1ZQJA 3LKZA 5F9FA 1NRXA 3BREA 5EQDA 4JJZA 3TZHA 4HO1X 1FK8A 2R5FA 5BOMA 4L3OA 3VTKA 1ZQUA 3IIMA 2PRIA 3SLRA 3V7FA 4OBXA 2R6FA 4PONA 5LN1A 1SPXA 3NVWA 1S76D 4MUGA 5DW0A 1ZJ4A 4WVFA 2WHXA 4P98A 3PGVA 4E2YA 1ZN9A 5HZGA 3QSYA 2W9MA 1YSCA 1CCWA 4DQIA 3IIJA 2J7PA 3NGMA 1JR4A 1E9DA 5HJ7A 1X1BA 1N2CE 1VL1A 5C0YA 2LW7A 2XF2A 1KO8A 3DYIA 4Q43A 4FJ2A 4RD6A 4ZIRB 1NXSA 3IMCA 5E79U 2JGFA 5FPYA 2PNJA 4QUAA 1E2KA 4A0HA 3LT4A 4QDOA 1HMPA 1K0UA 1RRKA 3QP9A 5BNFA 2Q8PA 3OZGA 3F53A 3AEUB 4EATA 3KUCA 1QV9A 3QTBA 2C2HA 4R66A 4NABA 3UJ3X 3V8MA 1OUMA 3CF6R 2IH4A 1X38A 3R7FA 4BNXA 3ESQA 1GR0A 3W4IA 3WE7A 4MGEA 2DLCX 1Z7YA 4NU8X 3AUAA 3IEVA 1U31A 3BL5A 3LBYA 2MUTA 2GZAA 4S2UA 1X14A 4I1SA 1CRZA 3UANA 4ZN6A 5E95A 4UAZA 1T8UA 1Z25A 3E18A 3KZNA 2H54A 4DRZA 1PT5A 4CQLB 1HUZA 5ELMA 5GAJA 4EFNA 4CIBA 3FNRA 4RVHA 1MPXA 4B5LA 3EX7C 1CIVA 1FDUA 3BWYA 2WOOA 3MJTA 2GFIA 1HLGA 2FLKA 4C22A 1E77A 1G5QA 4BX0A 1SA0A 2VYNA 1EH5A 4TOIA 1NBIA 1M2EA 3LPCA 3BZKA 1I6WA 3PQCA 2GZDA 4RIFA 5KVQA 3WGTA 1R7RA 4QXPA 2ZBQA 4RF5A 4YHHB 3RI3A 4KLCA 1NM5C 2XDQA 4OQZA 5KYXB 3VGJA 4QGSA 4YP5A 4Z7JA 4FMDF 4FBUA 2CNBA 1FFVA 2TECE 2WVHA 3ZCXA 1SBCA 4EW1A 4DDUA 2JCSA 4N3GA 3GQBA 1JHUA 1KSJA 2WYUA 3PX0A 3G2MA 3WYDA 1E0JA 1OYYA 4P5DA 2WDPA 5G5GA 1PR4A 3HSSA 1AQLA 4B09A 2BE9A 2PU5A 4EQ6B 4HWRA 1VMAA 2N42A 4OKIA 3PNLA 3T06B 3W5IA 5DGIA 2VA3A 1K6JA 5J0WA 1EJBA 2DPMA 3Q41A 5EMLA 5CHEA 3ETNA 3AV3A 1TOAA 2QTCA 4R98A 4NENB 5C3UA 2HU2A 2QJRA 4B4OA 3V2IA 3P2OA 1G5PA 1X7XB 9ICEA 4HXFB 4DFJA 1OVGA 2PO5A 1J22A 1LWOA 1T0HB 4QC2A 1DCMA 4BX9C 1RKVA 2ZBPA 3QUAA 1XTTA 4L2IA 1KYXA 3MJ4A 3THRA 2G63A 3UXMA 1OKKA 1XZKA 4R1UA 3ZVKA 1KH3A 3MT0A 2CW5A 3A4MA 1HV8A 4Q1CA 4DSJA 4TWZA 5F4ZA 4Z7NB 2PFOA 2CBXA 2R8HA 3BWDD 1RRGA 1X94A 5IFLA 2HBYA 3MGIA 1U2SA 2IU6A 1GP2A 1KQ3A 1M6EX 2GT1A 2NV0A 2XR1A 1L5MA 5CXSA 4B7UA 2FVXA 4OJYA 3FPFA 4E5VA 5JSZB 1T9KA 1MIOB 1BHSA 1SUBA 9ICNA 4XI9A 3RH6A 3V34A 1N2BA 1WTCA 1Z4PX 2WAXA 5C7OO 2D0OB 2I03A 4LRTB 4MYTA 1UANA 1TEVA 2FUNB 3CUEF 4KQEA 3G5TA 1G1MA 5KL1B 5TXGA 1PR5A 4GPD1 1A5SB 3Q3HA 3BK7A 3S44A 4MVWA 5H02A 1JU4A 2C5AA 3T5DA 1C1DB 1DWOA 2ZGVA 4I1OA 5ANRB 1ZD8A 3OCVA 4GWLA 3ETLA 3TLXA 3TTVA 1SKWA 3COZA 4BTVA 5JTTA 5J2UF 3I8SA 1XJWA 3H3XA 1YRBA 2EZTA 2KBFA 3LIIA 5KTTA 5C9ZA 4YX9A 2Q0ZX 2WWFA 2ZDGA 4JEUA 3QBVA 1P72A 4YDSA 3IAFA 5IAKA 2GZMA 2HK7A 4G8DA 4R6XA 4Z6FA 4XRHA 1W4BA 1H2WA 1M0WA 1W9MA 1P6XA 3ABRB 3TSYA 1W6RA 3A3KA 4XDGA 1WMSA 1Z33A 4EYSA 2HKIA 3K4QA 1S0NA 3OZRA 1QG0A 1FZTA 4I2GA 3FMPB 1RZRA 2M32A 3F9RA 2Q99A 3PF8A 4GM4A 1WSAA 4MWGA 1D2EA 1X8LA 2NZ8A 4A8JC 2PX5A 5CCXA 1P80A 2OTCA 3NVYA 4QGGA 3DBRA 3R3JA 1SELA 4RCVA 4JBLA 2X0EA 2V5UA 2D4HA 2J9ZB 2O2SA 2JLUA 1B8NA 2QMHA 4I81A 5B58T 1PZFA 5I7EA 3VJMA 4PSDA 4DG5A 5KTYA 2ZI4A 1FO4A 2ZAMA 4U2FA 1BVHA 4NQZA 1BDBA 1MRSA 4P58A 3QBTA 4KIGA 5FJIA 3B0XA 4IDDA 3WFIA 1XMQB 4DRYA 3R4CA 5FWDA 1X86B 5EN4A 3NBYC 4DDWA 4WDRA 4B6RA 5KVAA 4EY6A 3TARA 4KLIA 7ICVA 1NJ2A 1QG2A 2NXJA 3OY7A 1MEOA 2WD8A 1Q3TA 4HDSB 4ZVPA 4FZMA 4DBLE 3JD3A 9ICWA 5CB6A 3Q3VA 3FNFA 3UW1A 5BR1A 5J4YA 2GASA 2RGCA 4N5DA 3UJ9A 4ECAA 3RC2A 3UWMA 4RV5A 2I8AA 5J23A 3N6XA 1N6NA 4MW1A 4BKMA 1DKMA 5D5HA 2C1EA 2WIFA 1OI2A 1X1DA 3CB2A 5K3CA 3PKJA 4J9SA 1VBNA 3D31A 4MV7A 3PHHA 4ELVA 2Q4OA 2V45A 3LBFA 4MHOA 1G6HA 4UM7A 3RK4A 2ZCJA 5J8YA 1ZQ1C 2PA3A 3KKMA 5FLYA 3WMFA 4D44A 1MAHA 1Q20A 2A67A 5A4FS 5BNTA 4QZEA 4WUVA 5TRTA 3WSWA 2QP4A 2I3DA 3DHVA 2PXIA 2R11A 3F5SA 1YB6A 1GPKA 1BVRA 1DQZA 2YZGA 4PO1A 4FBTA 4TVKA 5HFJA 3VAYA 1M6VA 4QU5A 2IUSA 4Q02A 1IQRA 5ALLA 2EBWA 2EGUA 2Y0CA 1OX4B 2BBTA 3H1BA 3H2BA 3F98A 2O1SA 3D4PA 3KSZO 3R0QA 1BJTA 1IC6A 3AR2A 5K0LA 4EEZA 2RC6A 5H5JA 1IAVA 4YRBA 2IS2A 2X8BA 4O3OA 3O8OA 2IC5A 3SVLA 3JQRA 1R6XA 3FVQA 3H2JA 3KDPA 2F2TA 3I30X 3DVAA 1D8LA 3JQBA 3LZCA 2JGNA 2JRCA 4LZDA 4EX6A 2WM8A 3HWX1 3EVTA 5FAXA 1YQTA 4JAVC 1PFGA 3ROKA 2WWTA 6AT1A 1A8QA 3AM9A 2X4GA 1AIPA 4M21A 2R8BA 4M37A 3OZDA 4YLEA 3UXHA 3WLMA 4PZYA 5IJ9A 2DWPA 1NBMA 3VZSA 2EAOA 4NZPA 4TQAA 2X5JO 3C6BA 1L3VA 3JASB 2IA5A 2WYWA 1YZQA 2IHUA 3HRKA 1AB6A 3MHPA 4RVCA 3ZNNA 1PQ4A 1WV1A 1DXQA 1X1RA 2Q46A 3N0TA 4GU5A 2O57A 1GA1A 1T2CA 2GJ9A 4QOEA 4UXHA 1F14A 4DLBA 1QGUB 1K27A 2Q6OA 2QM3A 1U8AA 2VHEA 4Q03A 1L5ZA 4QNRA 1FMJA 5DI3B 2H63A 1BKSB 2ZXHA 2RGYA 4LZAA 1E9BA 1X2BA 3LDHA 4Y2UA 2QARA 4EY8A 2NRZA 1MC1A 2W7OA 2PYDA 5BYJA 1KTIA 4Y2SA 1IN6A 1WBBA 2X7JA 2CNKA 4LRQA 2NUTB 4LBZA 4XYMA 1XTSA 5KFNA 4FX5A 1H9BA 1V8DA 3INRA 1WULS 4L28A 4YXMA 2H59A 1D2AA 2ZJYA 1HSOA 2RCYA 4QTTB 4W1PA 4X7PA 3A11A 3IUYA 5DHAA 4K86A 2O3SA 3WK4A 4KBFA 2ZSHA 2GCIA 3MGGA 2HXSA 2IK8A 1KEUA 3ROMA 2VDOB 4UAVA 2QXUA 3PFCA 1N5WA 3JS5A 1KI9A 4MUXA 4OFWA 4QTUB 2QD4A 3IH5A 3OCXA 5A03A 1TRKA 2ODNA 3M6MD 4KC0A 1PS0A 1QO9A 1Z2DA 4JP5A 1IN4A 3RBZA 5AI9A 3FOFC 1NJXA 1WEKA 3FOCA 5A0LA 2G0NA 1QHXA 4I7EA 1IY1A 1ETUA 4IQ4A 1O8CA 4REQB 4BYMA 5A4DA 5LR6A 4ZQCB 3ZWMA 2DVMA 1JL3A 4DADA 3FMFA 5LWQA 5KU7A 2AEJA 3H99A 1FNSA 1G5FA 3TZKA 2GNAA 1CETA 2OK8A 3C8HA 3THOA 1O3YA 3B36A 5FUXA 3V1KA 3CONA 3JY6A 2XKJE 4AURA 5JAZA 1AV6A 4F50A 1SUEA 4PLWA 2KE5A 3B6JA 3B13B 3IP7A 3WGUA 3UGTA 1JX4A 2FZEA 5A7HA 1H69A 1K8QA 3DHWC 5JIBA 1P4AA 2FMHA 2ECKA 3B2NA 2XZDA 3I4FA 3UWPA 4CDNA 1EXDA 2ODQA 1TUGA 4DXAA 4Z2AA 4AM8A 5KFGA 1TIPA 4WBSA 4ECWA 5KINB 3OIUA 5JNTA 4JKYA 4LE2A 4BO0A 3JPOA 3Q0IA 2CBZA 3PEEA 3CR8A 3ESDA 4PZZA 3MELA 5JBNA 2AKYA 1M0EA 1S1CA 1OWNA 4E7OA 1WZIA 3LT1A 1RIFA 2PUTA 1UK6A 3UV3A 2J59A 4A0GA 2LBOA 5LA6B 4O3RA 3DQQA 2RGNA 3OUZA 4FHFA 3DLPX 3VU9B 4YC7A 3RARA 3H1EA 1TVMA 5JS1A 1SCNE 2CMKA 5B7QA 3K75D 5K0NA 2Z9CA 4E6EA 3DGFC 3K8YA 1AG9A 5LB2A 4ALNA 2ESEA 3R76A 3E05A 2OWEA 1LFDB 1QYIA 2R1TA 4GOOD 4MUHA 5HBRA 4M89A 4Y98A 3L41A 1QPZA 3PX3A 4RORA 1GYPA 4TS9A 1P0MA 1HE1C 1IIRA 2XGPA 4XYEA 1K5OA 5EUQB 2NO6A 5ULLA 1ZIOA 3RWMB 3BCHA 2WG1A 1JU9A 3ESZA 2W9AA 5C81A 1MC4A 4EUFA 2PGXA 2XCRB 1YHZA 3OJLA 2O2XA 4HF7A 4N9QA 4BUZA 5CTJA 4RUAA 4D56A 1HBJA 4WWHA 4JLVA 4BQQA 3SEIA 5AK4A 1CJKC 5CNJA 3LVRE 2FFAA 1GRRA 1L5NA 1ISJA 1K3UB 1ZD3A 2GCGA 1OGYA 1C14A 3MB8A 5EQTA 1OXUA 1ADJA 4IOKA 1IEQA 1Y42X 1DOQA 4FP9A 4RVSA 3B1WA 4LF4B 4NR0A 1LZLA 3M6AA 3K1ZA 2HOFA 3O21A 3RYHB 2GLTA 4D9MA 2JEJA 3DYVA 1E3MA 4I6GA 4FHEA 1FSFA 1I14A 2G82A 4CPDA 1QGDA 3OA2A 5EJ8A 3UPQA 4XEHA 1VDVA 1DB3A 2XOKA 2PTHA 1JNYA 1H8EA 2IZ1A 3OJSA 2VDQB 2WPNA 4Q4HA 4LV8B 3OMXA 1JEAA 4FR5A 4BFUA 5FPQA 4TROA 4S1PA 3PO5A 3DWEX 2BTEA 2WHRA 3GYGA 5EZYF 4E5PA 1LGYA 4CKBB 1BQ3A 3ANNA 3J7TA 1Y3IA 3M5WA 3SBXA 4ZK2A 4I36A 1XD8A 4LQCA 4NK4A 1GNRA 3C5HA 3A6EA 2XITA 1ZG3A 3INYA 1FY2A