4C4RA

Structure of beta-phosphoglucomutase in complex with a phosphonate analogue of beta-glucose-1-phosphate and magnesium trifluoride
Total Genus 79
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
79
sequence length
218
structure length
218
Chain Sequence
MFKAVLFDLDGVITDTAEYHFRAWKALAEEIGINGVDRQFNEQLKGVSREDSLQKILDLADKKVSAEEFKELAKRKNDNYVKMIQDVSPADVYPGILQLLKDLRSNKIKIALASASKNGPFLLERMNLTGYFDAIADPAEVAASKPAPDIFIAAAHAVGVAPSESIGLEDSQAGIQAIKDSGALPIGVGRPEDLGDDIVIVPDTSHYTLEFLKEVWLQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords BETA-PHOSPHOGLUCOMUTASE
publication title Alpha-Fluorophosphonates Reveal How a Phosphomutase Conserves Transition State Conformation Over Hexose Recognition in its Two-Step Reaction.
pubmed doi rcsb
source organism Lactococcus lactis
molecule tags Isomerase
total genus 79
structure length 218
sequence length 218
ec nomenclature ec 5.4.2.6: Beta-phosphoglucomutase.
pdb deposition date 2013-09-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00702 Hydrolase haloacid dehalogenase-like hydrolase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.240 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 Putative phosphatase; domain 2 4c4rA02
3.40.50.1000 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold HAD superfamily/HAD-like 4c4rA01
3FM9A 4J03A 1EK1A 3EF0A 5AK4A 5AKLA 1U7OA 5AK6A 1YNSA 2DQSA 3ET5A 4XE5A 3WK8A 2G80A 1K1EA 2R8XA 2I7DA 3ZVNA 3QUCA 2WF6A 5ALDA 3KD3A 2RARA 4Y2UA 3MC1A 1SWVA 2WF8A 2YFYA 1NRWA 4BYGA 3R4CA 2HDOA 2ODAA 3ET4A 1ZD3A 3EF1A 4ZEWA 3SD7A 3MN1A 4RETA 3ZU6A 1LTQA 3N1UA 2W11A 2I33A 4IFTA 4F72A 5E0OA 3FGOA 3AR6A 5ALFA 1TJ5A 4OCZA 2CFSA 2HEGA 3M1YA 4BBJA 1YV9A 1QYIA 2D2VA 2NO4A 1SWWA 3WK4A 1RMQA 2AGVA 3OCZA 1T5SA 3E58A 2Q5EA 3L1VA 2FUCA 4BKMA 3U7EB 3S6JA 5ALHA 4PNHA 5AVRA 2MU2A 4EX6A 4DCCA 4HYTA 5AW3A 5AESA 3L0YA 3QU9A 2P27A 2YJ3A 2C88A 3RFUA 1ZOLA 3QUBA 4C4RA 3SMVA 3D6JA 3QU4A 3KC2A 2G1AA 1TE2A 1WZCA 2B8EA 4NABA 5AHXA 2B1RA 3CZ4A 3OCVA 3A1CA 2YMQA 2P69A 4GXTA 1Z5UA 1Z4QA 5AM0A 2OYCA 5A3SA 3L5KA 3AR2A 3SHQA 4XQ0A 5FP0A 5AW1A 4C4SA 5IT0A 4UW9A 1RPZA 2QYHA 2AMYA 2ZBDA 5AW8A 1L8LA 4Y3UA 3DAOA 1Z88A 3I6BA 5A3QA 3N28A 5AIBA 3GYGA 1JUDA 2YMPA 5AIAA 2P9JA 3B9RA 4NWIA 2HSZA 3N5KA 3L7YA 3WK7A 2HX1A 4NV0A 2CN1A 1YJ5A 3ED5A 4H1WA 2YY6A 3E84A 3FPBA 1Z5GA 4BEWA 2CFRA 2X4DA 2YJ5A 3QU2A 4BEVA 2OA0A 3A3YA 3WKBA 1YS9A 4G9BA 4UAUA 1L7NA 4EX7A 1U2SA 1U2TA 3NASA 4E88A 3UMBA 1XVIA 4BX2A 3UMCA 3FPSA 1RMYA 1TJ3A 4UAVA 2JARA 4UU1A 1VJRA 2RBKA 4CF3A 1EK2A 1PW5A 1QH9A 3M9LA 2IOHA 3IRUA 2AUTA 3L0CA 2I34A 2Q4RA 2G07A 3ZX4A 1ZD5A 4XOUA 2HCFA 3VAYA 1ZD4A 1ZD2P 3AR8A 3DDHA 3J7TA 4XPZA 2ZBGA 5AW7A 3NAMA 4QJBA 2R8ZA 5AW0A 4IG4A 4KX5A 5AVUA 3ZUPA 3W5CA 3ZWDA 1Q92A 3B8EA 4KYTA 4DW8A 2HHLA 3HLTA 2EARA 2RAVA 4HGNA 1CQZA 4HGRA 2ZOSA 4ZEXA 1Z4PX 4EZEA 4Y2QA 3QXGA 4KNVA 3WKEA 4C4TA 3R9KA 5AK3A 4UMDA 5AVVA 3WKAA 4Y2PA 2FUEA 5ALNA 3WGUA 5ALJA 3L1UA 5ALUA 2WF7A 5IS2A 1L7OA 5AVZA 2G09A 4HAIA 3KDPA 3AR3A 4L6AA 2WF5A 1L7PA 2C9MA 3ESQA 5AI5A 3W5DA 3HYCA 5AKEA 4ZEVA 5AI4A 3UMGA 2PR7A 3A1EA 3SLRA 5AKHA 5AW5A 1RC8A 1MH9A 4BNDB 5AI6A 5AKYA 4UARA 1L8OA 5AI9A 2C8KA 4CNQA 4UMFA 2NYVA 3I28A 2R8EA 3MPOA 2G06A 2C8LA 3NRJA 1LVHA 1RRCA 5JJBA 1KYTA 4MWOA 1XP5A 3N8GA 4HGPA 3ZTYA 3WGVA 5ALIA 2I55A 3AR9A 3QLEA 1Z4MA 4RESA 4FYPA 5AKGA 2EAUA 5A3RA 3AR4A 3AR5A 1O03A 1XPJA 2GMWA 3E8MA 3WK9A 5ALXA 1J8DA 5AKZA 1TA0A 5AKXA 1RLMA 4UATA 5AI8A 3TLMA 3CNHA 3QX7A 2WF9A 2JAWA 4L57A 5ALWA 1RQLA 2VKQA 1FEZA 4I9FA 1L6RA 1T5TA 4MUMA 3OPXA 2YJ4A 5AVSA 1SU4A 3QU7A 4KX3A 3U7FB 4GIBA 3WKCA 3R09A 3KOOA 3WK6A 2JAUA 1ZS9A 2B0CA 1ZRNA 1Z4KA 3F9RA 2HI0A 2WFAA 1U02A 5AICA 2IA5A 5AK5A 2OBBA 4YGYA 5AKKA 4J2TA 5ALOA 1O08A 4EELA 3ZVMA 3NANA 4DWOA 1L7MA 5ALVA 4O8CA 1QQ6A 1N8NA 1YMQA 3U19A 3U26A 4YCLA 1Y8AA 3P96A 2PKEA 1Z4IA 2CFTA 4YIKA 5AM1A 2R8YA 3K1ZA 3L8FA 2B30A 2PQ0A 1QQ7A 1T9ZA 4L6CA 2BY4A 2IOFA 5ALEA 2FEAA 2YMMA 1RMTA 2QLTA 3IB6A 3OCXA 3QNMA 2G0AA 3WK5A 4EEKA 1YDFA 1RKUA 5T41A 3SF0A 5AW4A 5IT4A 3FZQA 5AVQA 4YIHA 4EENA 5AVTA 1CR6A 5AM5A 1RQNA 2O2XA 2HF7A 4HGOA 5AVYA 3U7HB 1Q91A 4BX3A 2IOFK 2GHTA 4JDPA 3NUQA 2ZXEA 4UU0A 4AS2A 1QQ5A 3I76A 4BX0A 5AVXA 2P11A 4F71A 5ALRA 5AVWA 2W43A 4FFDA 3PGLA 4YCNA 1Z4JA 3BA6A 5ALYA 3L8GA 2YN4A 4Y2RA 5ALMA 5AM2A 2WM8A 3OCWA 2IYEA 4UM5A 4KNWA 3OTQA 3FVVA 5AW6A 5ALPA 4Y2XA 2RB5A 1RKVA 2YBDA 4AS3A 2AH5A 4Y2SA 3IJ5A 4OHFA 3KBBA 4CF4A 1N9KA 1F5SA 3ZVLA 4QQFA 1RKQA 2GO7A 2B1QA 4Y2VA 5AI0A 3OCYA 3W5BA 2FDRA 2Q4TA 3QGMA 5AM4A 1J97A 2YMLA 1RLOA 4HGQA 5ALGA 2FI1A 3ZTWA 4AP9A 5ALQA 1NF2A 3QUQA 2BDEA 3W5AA 2FPRA 3QUTA 2YJ6A 3L0BA 1U7PA 2JGAA 3E81A 1S8OA 3ZX5A 2ZBEA 2W4MA 3DV9A 3QYPA 3QU5A 2HOQA 4G63A 1WR8A 4NFLA 1NNLA 2FPSA 4JB3A 1AQ6A 1WPGA 1Z4LA 3BWVA 2BDUA 5AKIA 2HO4A 3L8HA 3ESRA 3NALA 4CE6A 5ALTA 3B9BA 4UASA 3I1YA 5AW9A 5ALKA 4B6JA 3A1DA 5ALSA 3PGVA 2ZBFA 2FPUA 2NO5A 1VJ5A 2EATA 1IWOA 2OM6A 3N07A 2GHQA 5AM3A 3NIWA 3U13A 1TJ4A 3ZW7A 2FPXA 3WKDA 1RDFA 3PDWA 4Y2YA 1WVIA 1X42A 3ZI4A 2GFHA 4UMEA 5ALZA 2JAOA 3L8EA 4CF5A 2B8JA 4I9GA 4DFDA 4UMVA 2WHEA 4NAVA 1VFPA 3AR7A 2I54A 2ZG6A 2HF2A 4FE3A 2G08A 1Z4NA 2O9JA 2I6XA 3DNPA 1ZRMA 5AW2A 4BNDA 2MU1A 2B82A 2FPWA 1S2OA 3SKYA 4UM7A 4OD0A 4YCMA 3EPRA 1ZJJA 4YH1A 3UM9A 2C4NA 2MSNA 5AKJA 3MMZA 3OCUA 3ONNA 3RF6A 3ZWKA 3KZXA 4KN8A 5ALLA 1RLTA 3U7GA 4Y2TA 3EWIA 4Y2JA 3SKXA 1Z4OA 4OFZA 3PCTA
chains in the Genus database with same CATH superfamily
2VANA 1GZSA 2FOIA 4M9LA 3LD9A 3OO1A 4U0JA 5CPBA 1SGGA 2I9PA 1G6KA 2ZSUA 5IBCA 2C97A 2A4MA 3ABOB 3SE7A 3S40A 3C41J 1Z5OA 1YB1A 4TN5A 2VWPA 5JLAA 3M1LA 4M3NA 1KFKB 3AH8A 5LKAA 1JPVA 4RTNA 4EG7A 3N8NA 3Q7SA 4FB5A 2K4IA 5I9NA 5D3KA 2IF0A 2D59A 2GPTA 4NNPA 2IJGX 1W47A 4C89A 3IUBA 4MPDA 5C7YA 5LZ7A 4M1WA 1KJYA 1NMYA 4QU9A 4WFKA 1VMKA 4BNFA 3ZN2A 1PJQA 3PWSA 4U39A 2HHAA 1Z68A 1XC9A 3IQDB 4BLUA 4WFJA 1U0NA 2HMTA 4RCYA 2BKUA 1GAJA 4HUQA 3ZYCA 2VF4X 5D6NA 1E4EB 1G59A 2VNHA 2ALZA 3IJRA 4PX3A 1ZQWA 2VHVA 1OI4A 2C77A 4GSKA 3BL5A 4E51A 2QS9A 1XT6A 3W6ZA 3DVSX 4XXHA 2WQ6A 5HJ2A 1NVUQ 1Z0AA 4BAGA 1GQYA 1Z18A 4EO4A 1OZAA 3G9XA 2O2DA 1QV7A 4MV5A 4FLFA 4PPXA 2CMDA 2J3EA 3RVPA 4RTQA 4ALKA 1UJCA 2VBFA 1E63A 2X6RA 2HK6A 2VUTA 2X6TA 3FGNA 5T6BA 3ZDZB 4EHAA 2JJ2A 4JP8A 2NLOA 1DSSG 2CVHA 3OQVA 2Z8YM 3OKCA 3GUYA 3M9NB 5JUMA 2VJMB 3I9JA 1E1NA 3QYJA 4BV2A 5AVZA 1JEYA 1V8ZA 4I1OA 2SBTA 3BTVA 3JZMA 3DKRA 2OYRA 4JVLA 4MITA 3CKMA 3VOBA 5AI6A 4D3ZA 3A4IA 1QSYA 2DR2A 1JLLB 1RXUA 3DAFA 3TG8A 3SZOA 3R7WB 1LVHA 1MB0A 4DFJA 5BQ5A 3FPHA 3JYHA 2X8AA 1QNFA 5EHXA 4BASA 5P8WA 1ZCAA 1ANKA 4UTVA 2JK1A 2GOYA 1AE1A 3MRVA 1I1HA 3IHTA 4AY2A 4ONEA 5DHAA 3QF7A 2FMXA 2YHAA 4Y30A 2LUOA 3KHUA 4ZCTA 3AM3A 2VDWB 5AICA 2O3UA 4EELA 4MKFA 4MJLA 1XPUA 3N0VA 4F4IA 4FBTA 5J2DA 1JJFA 4NCIA 4QWAA 5FYQA 1RRPA 3B85A 3K92A 1XLTA 1QTQA 4R63A 1PV4A 1FFDA 3GR6A 4I2NA 4FEEA 2WR8A 1UA0A 2M1ZA 3EMKA 4O2LA 4JA0A 3ZBPA 2YXBA 3OLXA 3DCYA 4M53A 3HDQA 2RHRA 1P39A 4GQBA 4BWVA 1E79A 4RY0A 4GXQA 3JR7A 1COWD 5DB6A 2ZR7A 5EE9A 4MV0A 4DCUA 4DSZA 2MIIA 3RT7A 2XTAA 3I32A 2I2BA 3DBRB 4M9QA 5B6PA 5H3CA 1AGYA 3B12A 4C7OA 2VT7A 2C2ZA 5BXQC 2OC4A 1YS1X 3QHAA 2O05A 3SNHA 1LD3A 3G3EA 1SD2A 1XD9A 4BMSA 5HZKA 1XRPA 5KT5A 4NYJQ 1C8BA 4AKHA 3DDNA 4LMPA 1L5MA 3ZV3A 1HDXA 1LKYA 3PFBA 1QK4A 3C2LA 4ZVRA 1XNJA 1E5QA 4LKOA 3UGQA 5IF3A 1E1YA 2K8CB 2JGJA 3C6QA 1R5BA 2VA3A 5K8VA 2YX8A 1JP7A 4HH0A 1GNPA 3JD2A 4W7SA 1UKVY 4EI8A 2YC2C 2H8KA 1II8B 4E5YA 4C4PA 4OI2A 1V16A 1RE1A 1QHEA 4BQEA 4NVRA 3AFOA 1OBVA 3UJAA 2CDNA 3TG2A 3VNQA 3CWQA 7ADHA 5ENDA 3JWPA 1OW3B 2V5AA 3INNA 1MAAA 3EZFA 4RKRA 2ZUFA 5IF9A 3AP1A 3S8YA 2YQ5A 1TQ6A 2HXSA 1ZJ6A 3EXFB 3E0QA 1T36A 2QL7A 4G01B 3BS7A 3P9CA 3EC1A 5LQSA 4EK9A 2Z6UA 5BR7A 4ENUA 3OPMA 5JY1A 3ESCA 3UG6A 1NWCA 2A2ZA 2QTFA 3AYZB 3F1KA 2ACEA 1KVUA 2ZCUA 1MQ2A 2IWRA 3HP6A 3IYLW 1Q0HA 2ZPUA 3IEPA 1QTRA 3G8YA 2JKYA 5FWXB 4RQTA 3DO8A 4HEQA 2EQAA 3AONB 3MIZA 1NGSA 3WMXA 4DLPA 5KVSA 3Q41A 5JXWA 1IHYA 1J2EA 1X1RA 3B5EA 4OREX 4B6OA 3GHHA 3ENVA 1TK0A 4G9BA 1YRBA 4EI7A 2IBSA 3NUZA 4EY7A 1T91A 4D9JA 6REQB 3GZ4A 2B8NA 1NOKA 2QRVA 1FU4A 2XGJA 3OD5A 1EP1B 3VR4A 5TQJA 4LGCA 2ONCA 2WIKA 4MUHA 4Z86A 1TUEA 4TKUA 3HYRA 4I27A 3C5VA 4BRSA 1OJ7A 1AXGA 2DKXA 4GSYA 1RWKA 2YH2A 3BS4A 5IM4F 4HNTA 5CW2A 1ZO8A 3V4OA 3GFTA 2ZOSA 1VPDA 3ZK7A 1QGUB 5AK3A 1I10A 1APBA 3HMQA 4ME6A 4ZCLA 2XCLA 2OCXA 1JXMA 1XQ6A 2NT3A 2XOEA 4BB6A 4O0IA 3MYRA 1J22A 4EJSC 2FZGA 1ZAYA 2WUDA 4JI3B 3GJYA 3DONA 3L6DA 4COOA 3DFMA 2X76A 4NMXB 4A5SA 4V0LA 5DYYA 3O95A 4PJ0U 4PS1A 2C99A 3A37A 1ZL2A 2DFDA 5AKGA 3K16A 5I7AA 3A7DA 4C29A 3EFOB 1BKDR 2XQVA 1NL3A 4F5WA 2JFYA 2WF9A 5J5CA 3EAGA 4A91A 4HQRA 3HDHA 2JRCA 4B43A 4DOMA 3TXAA 1XNQB 1XQYA 2QMEA 2FPIB 2E4WA 2WZDA 5LFAA 3SJZA 1RCFA 3NFRA 1HMPA 2Z5FA 3RVDA 3KQTA 2XB2A 1EM8A 3UHOA 3VNRA 3AHIA 2G71A 1KDRA 2NUTA 3AL0B 3HTXA 1A4IA 4I9NA 3WWYA 3F5DA 2O0HA 2QF7A 3K8YA 2REOA 4NBRA 2VDPB 4KB5A 3VV3A 1C7ZA 2JDIA 1E2PA 5T3YA 1GLNA 3U7HB 2XUPA 3RHSA 1C0EA 3INGA 4FYHA 1JECA 4D96A 1KN5A 4YCJA 2XXBA 5CYPA 3RSHA 3E9YA 2W2XA 5ALRA 1U1GA 4YTEA 3GVCA 2EF1A 4F4YA 4X44A 4BLOA 1S0UA 3TLKA 2P8JA 1JRLA 4RCVA 4Y2SA 3H9JA 1U3VA 3D7KA 4H9GA 4NMMA 3DOUA 4ZODA 4IO0A 3ROFA 1DFGA 5C51B 1N7JA 1AKWA 5KTKA 4Y2GA 1IUNA 1HDGO 4F04A 2IHTA 3LT2A 3RS7A 3V7UA 5J1SB 1SVKA 3VKGA 4PQRA 1X13A 3DW1X 1EBFA 3QU5A 4J07A 4EHHA 4QBGB 4IJUA 3IE1A 3C43A 5BVGB 5JH7B 5LQNA 3FUTA 3E22B 3EPKA 2F1HA 3SJ7A 3HZOA 4GYYA 2AK3A 1L3UA 4EMSA 2NQTA 3MDCA 3RFFA 4QUGA 4HXGA 1K6JA 3NCTA 1WTAA 4P5DA 4QWBA 1VFPA 1X8LA 1U90A 4MV7A 1GGNA 5KFZA 1S8FA 4CM6A 1EU1A 2BPOA 4AIIA 3WWOA 3PNMA 3EY4A 3HJRA 4LHWA 4BE4A 2V45A 4DANA 1HT0A 3KHSA 4URUR 3WRWA 3BE8A 1ADBA 4W5JA 1FSZA 1KI4A 2YFYA 4X1OA 1BDBA 3MTEA 5BO5A 5FUXA 2GPNA 3H1AA 4L4SA 3MA0A 4PAQA 3OZXA 1R0BA 2XYHA 3AUYA 2EAMA 1S96A 3I01A 3R7FA 1YZLA 3LQFA 1CU1A 4EBCA 4XIYA 5FPYA 4MGHA 1N2CB 1XYGA 1RZVA 2BKLA 2HYDA 3OT1A 3R5HA 4W1QA 2UYOA 2JGDA 4IVNA 3TBHA 2CLEB 3EDYA 1VJ1A 1DOQA 3KQKA 2D54A 5EKTA 3KTAA 3TADA 3OY7A 3ZWPA 2N47A 4TLCA 3WFIA 4DCTA 5B1SA 1ZD1A 3PVSA 4DWVA 1QIJA 4HAOA 4JBHA 4KQ1A 5DG7A 1LF0A 4HDMB 4TZTA 2BZSA 5IYZA 1T2UA 1PG0A 2HWKA 1QG6A 3BE5A 3JQ9C 1TUBB 2IYVA 3AY7A 5LBIA 4H1WA 1CQJA 7ICPA 3ZCTA 2P9EA 4GZMA 1P7ZA 1Y3CE 3HRDD 5A04A 1ZHFA 1XEXB 3UN1A 4FFSA 4FDMA 3VR0A 1Q0SA 2MR6A 4RLQA 3U3DA 1LDNA 1RXSA 1FTSA 4ND1A 1UMBB 1AA6A 3X1KA 3TOVA 2I6UA 1H6DA 1KVQA 3RYTC 2OP1A 2IVFA 3HPOA 2ZRQA 2V58A 1G4HA 4EZEA 4DMHA 1ZONA 2HRZA 1ZSNA 1R15A 2HRRA 4KLDA 4NYMQ 4E6PA 4IYRA 3F67A 3GGGA 4LY3A 3P0FA 3IUSA 3FOFC 1E2DA 2G63A 2ZXUA 2ZDHA 3EJWA 5DGXA 1SKYE 3IC5A 1N6OA 3A1EA 1NKEA 3P9SA 3KEMA 2JASA 1WABA 3EC2A 3GYBA 4AO8A 2YKGA 4R2MA 1T5DX 1PL8A 1HNXB 2XTNA 2DWUA 1U81A 4QBFA 5DSZA 3CLVA 3W2TA 1P2TA 1JWLA 1VIYA 2VAPA 3ZGZA 1JVNA 3R3HA 4PO8A 2FKNA 2Z8XA 2H4XA 1OW5A 4OYHA 3PHCA 2P79A 3F3MA 4XSVA 4ZOAA 3BJYA 3C7AA 3GG9A 2MA1A 2OBBA 5LZ2A 4UE2A 4EHNA 5C3UA 3BMCB 1H38A 1T6ZA 2WIGA 3ZXXA 3THXA 4M0LA 4G8CA 4K9RA 1D1SA 1NW3A 2REQB 5C53B 5ADUS 3EIQA 4ZIRB 2B61A 2OZVA 1W36D 2RBGA 5JZMA 3WTBA 3IERA 3DBHB 4K5QA 4AZTA 2K4PA 3FLAA 4HMOA 4UULA 1FNMA 3N8IA 3PSFA 2CD9A 1JX6A 4FUQA 5L9AA 2J67A 4B3DA 4BB5A 4QUKA 2H1VA 1YZTA 3G2KA 4UDYX 4XW2A 3P4YA 2OUKA 4MGKR 3EG5A 5FWDA 1RPLA 3HXKA 2LIPA 2EZ8A 3HXPA 4Y2VA 2ZJ8A 4DS4A 4RQ5A 4G25A 4LDNA 4PRZA 2GNAA 2IZZA 1J0EA 2XDQB 4KLLA 1O57A 4O4HA 1MBZA 4KHZA 4M8NE 5F1YA 1XMOB 4K1XA 2B2CA 3GUHA 5FLXA 4XFJA 4HNHA 1YE5A 4IDBA 1OAAA 2YFQA 3MWEA 2UXDB 1PV1A 4H15A 1KYQA 2GVDC 2AC7A 4TM7A 2DWOA 2VO1A 4NK4A 4DTIA 1NJWA 2OOSA 2GA9A 2WKPA 1L6IA 2GAAA 3HN6A 4QSMA 3KJXA 4KO1S 4QHTA 1OH6A 3NC4A 3SSNA 2GEKA 3ANNA 5K3EA 2QR5A 4JQYA 1RHRA 5H9VA 3ZDBA 4RIIA 1NRIA 2VUIB 2JLWA 2QN6A 2AC2A 1GFIA 4LN1A 2Q6TA 4M1EA 2LZ0A 5FL7D 5AK6A 3R2JA 3QF4A 3WLFA 1F8GA 4CFYA 2OLEA 2RGNC 1H8ED 3BERA 5B58T 1T10A 3NIBA 3BQMB 4B6PA 1PFGA 2XF8A 2PT7A 1JAIA 1PN3A 3EGXA 2I33A 2JI4A 3LT0A 3I92A 2G1JA 3Q0TA 3K0BA 5FUYA 4DL5A 4CMHA 4PX5A 1EFCA 3QUAA 4KLJA 1Z8FA 5B37A 2XKAA 5EE1A 5AW3A 5C8ZA 1N5OX 2EP8A 1EDDA 4MWDA 1O96A 1WX1A 3L3BA 2Q9UA 1PJAA 4XVRA 3CZ4A 4U2GA 4GXTA 3RBAA 1M75A 2NZYA 2H1OA 4LK3A 3K4QA 2P2SA 1W87A 4PAWA 1RFGE 1NBAA 4CDGA 1M6HA 4KV7A 4JKIA 2DLNA 2D4HA 2ZU6A 3FPBA 2OBFA 2X4DA 2V7QA 1XNRB 2ZETA 4QLBA 1XUOA 1A96A 4G3IA 1ZQTA 2OM2A 3BMNA 1CP2A 3QVKA 3TLBA 1E6KA 1PJRA 3PUYA 1R9JA 2M1XA 3VO2A 4FLEA 3D1JA 1KFTA 1WYGA 1VG1A 4OHCA 2RKOA 3UW1A 1WB9A 1XDDA 3O8DA 4BVAA 4CTKA 1WO8A 3RHTA 3HVUA 2CXXA 3IPXA 3OVMA 1QCZA 2E89A 3ICXA 1UUFA 2PM8A 1JJVA 2YV4A 1D8LA 2FFQA 2BM1A 2HU7A 1RWMA 1FZQA 4JJEA 4BTLA 3GJ5A 4TWJA 4EUFA 3SWWA 3ADDA 1TAQA 4EOGA 3RSLA 1DMSA 2VT2A 4HGYA 3FROA 2AXNA 2P2GA 4EKGA 1C7IA 1CNMA 2HREA 3L6OO 1AQIA 2OHVA 2OXFA 5ICFA 3QLUC 3UYKA 3EQ9A 2N1RA 2DBZA 3E3OA 3CM0A 5JASA 4US1R 1QVAA 2ZQ5A 1DXSA 2VHXA 3HDGA 4ZXPA 1U1EA 3WTCA 3CNLA 3DUFA 1PZXA 2P35A 1NW6A 4GBMA 1F2TA 3L0ZA 2YS7A 2B4KA 4LWPA 1LJUA 4E3ZA 2B21A 4EA9A 3KXDA 3CUVA 4RDHA 4AP5A 1ZA1A 3UBMA 4DXAA 1IBCA 1VBMA 3U7FB 4WT7A 4RV9A 4UXIA 3WIVA 2OB2A 2HI0A 3EOZA 2KIVA 3QMVA 4RZXA 2O5VA 4G1EB 4MQEA 5FWAA 3DJYA 1NXVA 1N1MA 3TUIC 1NPDA 5D8DA 2AOUA 3V8MA 3KHRA 4QU0A 1JHVA 4X7MA 3JYOA 1TM5E 2H1SA 5H4HA 1K89A 5B30A 2HMUA 4C1NA 1MEEA 1KYZA 5IJ9A 4C0HA 1N6PA 4IZ6A 4WGFA 3ADKA 5A4DA 4PCAA 3AN1A 4GM0A 2D8MA 2CUNA 2O19A 3C3YA 2BMEA 5JMWA 5HHHA 3ZLTA 4W9NC 1O94C 4Y2RA 1ULBA 4W5WA 4YEDA 5DM70 2XZTA 2A4KA 1X38A 1MRNA 4Z99A 1DWUA 3W79A 2GO7A 4BKUA 3R7AA 2JV3A 2J85A 2FETA 1HH4A 3P9ZA 5CEEA 3BEDA 2A58A 5JMOA 1GNLA 5K5EA 3BSYA 1KQ3A 4JLPA 2O2YA 5KTQA 3H87A 3SEAA 3WI7A 2X2EA 1N8TA 1YRHA 3K75D 5BN3B 3U44A 1R50A 4PC7A 1A9QA 5TSDA 4CE6A 3PA8A 1OFIA 1KKUA 4DY6A 2FW8A 1W9HA 4ZC8A 3FOZA 1TYAE 3PNSA 3MGIA 3DR5A 3R7LA 1YJQA 3PNYA 1K63A 1ORVA 1S4MA 5FNVA 1U0TA 1GGJA 2HJGA 4IOJA 1EFLA 4XWGA 3OMXA 1S0MA 4DLXA 5KYTA 4NZYA 3EIXA 4KL8S 1RZRD 3OFKA 2MSWA 5AH0A 1FFVA 4L8LA 5LNK6 2XB6A 2DUWA 3R8CA 1MC5A 1L8AA 4GP6A 3LL7A 2FZKA 1QM5A 4D02A 3MQFA 1QOZA 4HXYA 1FNCA 3FWKA 5BWLA 4DC0A 4N82A 4DT1B 1UK8A 1QMGA 4FCVA 1N3BA 1VB3A 3ANLA 4KWHA 1Q1GA 2I67A 2FN4A 3FA2A 3S2FA 2BTQB 1EJBA 1FF9A 4BVKA 2V5VA 1W0JD 5IIKA 2IHYA 4NSNA 4KH1A 4D9GA 2RCNA 5JTUA 2Q2VA 4X65B 3GRCA 2JXJA 3L84A 1DBWA 3MWDA 1FLNA 1KDYA 2UUPA 1FK8A 3EZGA 1IB0A 3W8EA 1Z7EA 3AR2A 4KN4A 1BWPA 1SVLA 1MPXA 4KBGA 3D4IA 4A8TA 2JFOA 3A9CA 1A0PA 2Q1WA 2SCUA 4Q4AB 4MJ7A 2PYDA 3I9OA 5BMOA 1BQ3A 4RJJA 2YS6A 4X8HA 5EJ9A 4Q00A 5IJZA 4BEWA 1CG6A 3VVLA 5CB1A 3OCJA 3LA6A 1IDN1 4NBNA 9ICQA 3R9IA 5CLHA 4JJAA 2FLWA 1V1JA 1M0WA 4IRXA 4O2AA 3LSYA 2PLNA 1SU6A 2ZRMA 3KFUF 3TDMA 3THWB 1IK6A 3ZWDA 5FORA 3EQ6A 4BMDA 4PQEA 1FO4A 3TACB 1J8VA 5CRXA 5ELLA 4LCEA 4RMJA 4QJFB 3SI8A 3ZJUA 2GDZA 5AHOA 3HX0A 1R4NB 1RVDA 1U9IC 4D8WA 2HMWA 2WOOA 3AW9A 3DYBA 4GI7A 3Q9SA 3OF5A 3VO1A 1L8OA 4IFBA 3DEHA 1SNYA 1TD9A 3C29A 5BQXA 2Z5LA 4OV6B 3OPYB 3C3DA 1B0UA 4U2FA 3UXHA 3PD1A 3EXG2 1WXQA 2WWXA 1RXCA 1NQVA 2ZYDA 2EAUA 2XZOA 2RLTA 1FP7A 1KFEB 1FVOA 2Q8QA 3MTDA 5FWYA 4TXJA 3ZE7A 4NG4A 1XKTA 1Z2PX 4ZAFA 3DF7A 2C03A 1CFJA 1DRGA 3UK1A 5H8WA 4Y0NA 4RVDA 2FG7C 3THVA 4S12A 4ALNA 4DQDA 5CA1A 2NZVG 2FZLA 1ZWLA 2PWPA 3RC1A 3KXLA 5CXXA 1OGYA 4Q4DA 3LZ6A 4OBWA 3ULKA 1IDOA 1K8ZB 3IESA 4I4NA 4J7XA 4JIGA 1XB2A 4JFRA 2OGZA 2FEAA 4MARA 2VHZA 5K0GA 2AJQA 2X8WA 3F49S 4BO8A 5EMHA 1DJOA 4C0KA 4YD1A 1E7YA 1RAGA 2GN9A 2WJZB 2ZSBA 3DZKA 3HM9A 4DWIA 3ICEA 3G2LA 1OHHA 4ITVA 4MAMA 1FFCA 1I2AA 3H2KA 2FWAA 4I3FA 2Z2YA 3H2GA 1G5TA 1IN1A 3K5IA 1QRTA 3D02A 1INLA 3SM9A 1XBTA 2QPOA 1W88A 9ICUA 2AI2A 2PFSA 1S97A 4TQ9A 5KNDA 3WGKA 2WKQA 3C8DA 1IHDA 3ADPA 2FEXA 4D42A 2Y1GA 5JS7A 1N62A 3FTPA 1OXSC 1I4OA 3B9BA 2P5TB 3GPBA 1NW9B 1FYWA 1OLXA 4LRSB 4F4FA 5IP5A 1TFRA 4OQLA 8ICNA 3RODA 3AWIA 3DCJA 3IE0A 2V9CA 3BCSA 2VDJA 3PDWA 1OLSB 3A9WA 5CDYA 3GP3A 5KG1A 1IHUA 4Q18A 2PMEA 4ZV9A 3L8EA 4IIJB 4R68A 3EA0A 4FGSA 4MDFA 3LV8A 1HORA 4IKEA 4QD3A 3UGKA 2PUCA 3PC6A 3T3EA 5JBQA 5DMHA 1RM3A 2H51A 5CDFE 2PUJA 1ZK0A 4O2BA 3IG5A 2G25A 1LWNA 4BV9A 1SV4A 3RBZA 2RGUA 3QVSA 1LTHR 2R62A 3ZVNA 1IJFA 1TA4A 5IKMA 3I8SA 2MSLA 2FAXA 2GT1A 2P1DA 2ZRNA 5GGXA 4IIVA 4F8EA 3ZV7A 2JHCA 4DZRA 3T7RA 5U4QA 3ZU6A 3I2FA 4IFTA 2HIHA 1NOIA 4NLLA 4FS8A 1N5RA 2CY0A 1K7XB 1Y6FA 3C8UA 4BQOA 2VAWA 2Q3MA 1GRQA 2VDKB 4CQMD 5KYUA 2YRFA 1WY5A 2HIGA 5SYMA 5D46A 3BWDD 2FTKE 4Q6WA 4AJHA 1IU9A 4C4RA 4JL5A 1KE1A 1USWA 2CHEA 1HPLA 3LT5A 1J06A 2JIQA 4GFDA 1Z0KA 5DPMA 1EBBA 1Y33E 1Q3UA 4G5RA 2RIPA 2B35A 3RR2A 5AW8A 1UT8A 4HEA1 5JU6A 1XLTC 3UWSA 5BSKA 1BA3A 4KQ6A 4RTMA 1QAMA 4ZI7A 3FNQA 5FIUA 5C5IA 3P20A 3KCQA 1WG8A 3R4VA 3WKBA 2J6IA 3UA4A 4L4ZA 4XB1A 1OYVA 4W99A 2O6HA 3KJEA 1OX6A 1L5SA 5D3MB 4ZZ1A 5KFIA 1N5MA 4HN4B 5UKDA 5EOZA 1OX4B 3PY8A 4V39A 5KTMA 4IGKA 5EG5A 5KIAA 2JVIA 2ZBGA 3D4LA 5ERGB 1RZTA 1F5NA 4Q7KA 1KR2A 1RBYA 1SQFA 1F60A 5H82A 4EGJA 5CB6A 3PHIA 2GN1A 3WLQA 3B52X 3E7XA 2O3TA 3AP3A 3A1FA 4N8SA 1OIWA 2QD1A 1GR0A 2ONZA 1XZQA 3IP3A 4WY2A 1FP4A 1PHRA 3A4VA 1N6KA 2AQKA 2NU9B 4QFMA 2QN7A 2XRZA 4AJ9A 4JI5B 5E6SB 1IBRA 2JFQA 3RJIA 2IFTA 3WK9A 3G5MA 4F92B 4O4LF 3VCBA 3A31A 2VF5X 4ZOLA 4AY6A 1M8JA 2C9YA 2GBCA 5LZ8A 1T15A 4OHZA 2FSPA 1YVUA 4WXHA 3NU1A 1BYIA 2OO3A 4I8DA 5HCNA 2P65A 2GCNA 3ZVKA 4XI9A 2I4NA 1CUXA 1GGMA 3KYCB 5K6RA 2PL1A 3TL6A 5M3BA 4DOCA 5JNLA 5J5VA 2PX6A 5E3JA 1MFPA 4LOLA 4FEYA 2QD3A 2V6FA 4E33A 4X93A 3A25A 3OIWA 3VR6D 4DBLE 1QQAA 2HH9A 4BJ6A 4KLZA 4IOLA 3RUFA 4AJPA 2YRXA 3CEHA 4LOAA 2ISQA 1U8YA 2XHZA 3GNLA 4F5ZA 4QGHA 5AVXA 5ED4A 5CLIA 4G5QA 5LQMA 2IS2A 3PPXA 4XJSA 4H3SA 2J3HA 1SXQA 1P2DA 5SICE 3SXUA 1BE0A 4DNPA 4MLZA 5KFHA 2PNFA 3ROKA 1GZDA 3RYIB 3SR4A 3DA8A 5HPYB 4XUCA 1SKQA 3QY9A 2W4IA 1P9NA 1A4XA 4ND8B 1N78A 2YJ6A 3DTTA 3RC3A 1YQWA 1VI6A 1K08A 4H1TA 4BO3A 1AGPA 4NFLA 3IUPA 1JI0A 4QTZA 4ZWNA 2VF2A 1ZHHA 2I91A 2GN6A 5KQLA 3ESRA 4JWMA 1BPYA 4QWDA 2YN0A 2QMYA 4Z51A 2OXTA 1EK0A 3MAGA 1EM6A 4C0ZA 3U7JA 5DX0A 2CKMA 3PRJA 3BWMA 5FA8A 5GM2A 1E6EA 3WVNA 4QZBA 5EWJB 5AJVB 3E15A 1OVGA 5J47A 1JB9A 2UXBB 3OKFA 1ST3A 1LPPA 1V3TA 5JE8A 1L4HA 4H60A 4QPDA 4V24A 1ZVVA 5DB7A 2I2AA 1RRMA 1SBTA 3X1XA 3ESAA 2PE5A 2OAGA 2XCSB 3B1KA 4A2PA 3SKXA 1F0MA 4AJEA 3P8ZA 1JZTA 3HDJA 2XXAB 1BVRA 4WXMA 4ILEA 4R1NA 4H77A 3ZZUA 4PCUA 4UCXA 3HB9A 1W9MA 3RR8A 3FNEA 3N2ZB 3RVSA 3PPIA 1GRCA 3IOCA 3UO8B 3QZ7A 1SUFA 1SZDA 3GFVA 3TUJC 1UMDA 3COSA 4F3YA 5DI3A 3JQEA 2Y0SC 1JKMA 3ITEA 3WDSA 4ZQFA 5DEOA 1TE2A 4KACA 2WZQA 5C3MA 3RU9A 3CRW1 4OJNA 4RACA 5FL3A 1N5DA 4UHDA 3HCFA 4K0KB 3V4SA 1KY2A 1NNEA 5FD8A 4UBJA 2BC9A 4Q12A 3KQNA 4ETNA 3NHZA 2GF9A 5AJZA 3KXKA 2HPVA 1NK0A 1NNI1 2H00A 3Q4GA 3O4FA 4DIMA 2CLDX 2ZJOA 4BPBA 4BGVA 2VDVE 2PMCA 5IKXA 2DVMA 4IO1A 3R8FA 2IDJA 2Y27A 5CB4A 3WZMA 2X0DA 3SF8B 3H5LA 2I9GA 1GZ5A 4JL6A 1VSTA 1NZBA 1E92A 2R18A 3T3FA 3YASA 4PZPA 4EPRA 2RAVA 4B84A 2BAGA 4KR3A 3AF6A 3NVMB 4R5HA 2I1WA 3FYSA 1SIBE 3VVCA 3MWFA 1V9SA 2FUEA 5DNAA 2X2FA 3NGMA 3PKJA 4NMHA 4YJ2F 2ZXHA 3HKZF 1QO7A 1AHHA 2IDZA 2R6FA 4TQAA 4RFVA 3IOMA 4ZDWA 3RB0A 4AULA 4QZVA 2QUBA 5IAAA 1GQOA 4UU8A 5KAMA 2C57A 2RGCA 2ZW9A 1N33B 3L43A 3KX2A 3SGLA 3MK31 1MHPA 2ZPAA 4ZU6X 4DRYA 3RCBA 4QL3A 3VISA 1G17A 1OXJA 2IMWP 2ZU0C 1EHIA 3LYSA 3H11B 1KE2A 1YI0A 3GLFE 3DBIA 2K4HA 4RPZA 3JR3A 4PPFA 2ASLA 1NKSA 4PYOA 4LF6B 4CMCA 1WD7A 4K8RB 4ALIA 2RJNA 4J2TA 1KPIA 3H5OA 1CJVC 2AA3A 3KV1A 5HEKA 4D9KA 1XSPA 4ZEMA 1JSZA 4YCSA 4OP1A 1IM8A 4O59O 2B30A 1JJIA 5CA0B 1UFKA 3G02A 3VU9A 4S2UA 2YMMA 5F98A 2IZOA 3DFFA 3CO0S 3DWEX 1DX4A 1QKKA 2GFIA 1DG9A 3IAEA 4N5NA 5KFRA 4MEYA 3MLAA 1CRWG 1Y82A 1QS0B 1XAGA 4R4JA 3M33A 2F64A 4PSVA 2XY4A 2P67A 3VBCA 3EIOA 2CCJA 1E0DA 4C3VA 4ZT7A 3TADC 2FN9A 3W5VA 2LM1A 1UCFA 3G9QA 1ESZA 1E4OA 3VI4B 3WC4A 1OH8A 4F1KA 1IY2A 4G1MB 1X7YA 3DWGA 3LYAA 5F5XA 1KAOA 1QGZA 3COJA 1OPXA 2NZJA 4FOSA 3AVQA 1HT2E 1VLVA 4MR8A 4P7JA 3RH4A 1DK2A 1M2GA 3KQUA 4KKVA 1QZ3A 2YVUA 3CYMA 2WKSA 1R1DA 1QYDA 4GPBA 3AUJB 3TTTA 1T13A 4YR9A 1JQ3A 4QO7A 1CZOA 3A1SA 4UMVA 1U7DA 2H48A 2PSDA 1NJFA 2YWJA 4YP0A 3VPXA 2OXRA 5C8YB 4G5OA 5JPDA 4XOIA 4GC7A 4X00A 2WA2A 2WJ3A 2X5NA 1NBWB 1KMMA 3RTBA 4R40A 4QGAA 4PLPA 3ZWKA 2KQUA 1R8XA 3N8DA 1CY7A 1E58A 1ZVKA 2BGWA 1DXOA 3M49A 3IQGX 3V7WA 3BVPA 1XWLA 1KVSA 1V8OA 4A8HA 5DXJA 2WIJA 4G56A 2A5LA 4H7JA 2BL4A 4Q21A 2WF8A 3PC7A 1ZM3A 4HO1X 1WCIB 2HJSA 3U5ZB 1LX6A 1SKUA 1TADA 2UZ3A 1B42A 1WKBA 5MGNA 2FUKA 3NBMA 1V25A 3B0XA 1R64A 2GTPA 2QI9F 5DG8A 5G0WA 5LPNA 3QLJA 2ES4A 5J0OA 3QNWA 3GVPA 5E9AA 4PANA 4B3XA 1NUPA 4X8MA 1BXGB 2R751 1FFWA 4CTMA 5DMXA 3MLBA 2J6SA 2B99A 4RUKA 5K8LA 1BD3A 3IEKA 1ULSA 3ROGA 2YX1A 2QVXX 1BQ4A 3CVYA 1L9KA 2YVQA 3QU2A 3NWBA 1TCBA 4WVLA 2H4HA 3CE6A 3IT1A 2IX3A 3M3DA 1F0NA 1K8YB 2V0NA 3DAYA 4YJDA 5DYNA 2ZI9A 1JR2A 4YRLA 1OVMA 3MGCA 2VN8A 3A6GA 3ZX4A 2YWBA 4ND6A 3SOPA 4J0FA 3U4IA 3N7AA 4NCXA 3M4NA 1Q20A 4LF9B 4EH1A 1FUUA 1ZHOA 1PK1A 1E61A 3WBKA 2B0JA 4JT8A 5J2TB 2JLXA 1VKJA 5IS2A 2ZK7A 5KOHA 1Q3HA 4NHOA 4RUAA 5AVOA 2RC6A 1QIHA 4O1IA 3IPRA 4OKNA 1OX5A 2XZDA 4QDTA 5EQFA 3BXOA 5DBHX 4XPIB 4BY9E 1BN6A 1U9JA 5JADA 5T8KA 3TDKA 2XLCA 4N7MA 3F71A 1USVA 3T4XA 4DJEC 1W0KA 3IDWA 2RB4A 4ECRA 4BP8A 5KVQA 2J33A 3UXNA 3FGPA 3A0HU 4S3MA 4B1FA 4ZVOA 2O8CA 4PNZA 2E8MA 5TIIA 1Q7RA 4PIMA 1RG6A 1VLJA 4GQIA 2UKDA 4XFDA 3QKRB 2IUTA 2O1SA 3I2KA 4PGMA 5ECWA 4YUVA 4EF4A 3FUXA 2INGX 1IQRA 4CVNA 4F97A 1U0OC 2LTAA 1U8EA 3I8OA 1V7PC 1PG2A 1ZGAA 2L69A 1EUDA 2HLDD 2PNJA 2XCRB 3R5XA 3BJRA 4HZIA 4KQJA 3TKLA 4CCWA 3CPJB 1C81A 4UC0A 4Z6FA 2QSJA 5JXGA 5CD1A 3M4YA 2BI7A 3QEBZ 1ES9A 2DFPA 1WSDA 2AS0A 4MQ4A 2FLKA 3CZCA 3ILSA 2N1MA 2A35A 8ICWA 1JA1A 4D4IA 1C29B 1ZQHA 1QVRA 4YCAA 2HMAA 4FJ1A 3HJEA 5ER6A 4E2FA 4KIGA 1LV7A 4DQQA 5KJEA 2OD2A 2F2AB 1X3SA 4KAJA 2X77A 4CRXA 1OFUA 4NTZA 2M6KA 1E4VA 2WJIA 1XDBA 3CS3A 3UKOA 1ZKDA 3T7TA 3SVTA 2XMQA 2DHCA 3DEEA 5KOYA 4ESOA 3UM9A 1MB4A 1NJZA 1GXSB 4KFTA 3PHJA 3CJRA 4F0JA 2D0OB 2A9QA 3ROXA 1W93A 1V5EA 1JMSA 2RARA 3MOIA 4S04A 1TYDE 1M1UA 4QBTA 3F6PA 4P53A 3LC2O 4XSGA 4Q45A 4X20A 2XECA 3WO1A 2HGZA 2RRDA 4L4YA 3U37A 3OQIB 2YV3A 1T3HA 2HLHA 1L1RA 3QSGA 4ENPA 3LYHA 1Z1VA 1UAGA 5CFPA 2VJDA 3A4MA 1MQ3A 1KMHA 2K4EA 3AUSA 4FE7A 1T9CA 1BWRA 1FP1D 1ZISA 1TKAA 3ZWQA 4RU1A 3J7AC 1AOXA 2I5HA 2J08A 4UBNA 3D2AA 4JLWA 1GKLA 3SYTA 4IR9A 3LY5A 4EB6A 3MTAA 4E09A 1JFFA 4Q1DA 2YJTD 3MNFA 4CUZA 4JENA 1HKUA 2OHHA 3FG9A 2QTVB 1XZKA 1EG7A 3EE6A 4EY8A 5EEGA 3QX9A 1F44A 4TXNA 4BU0A 2ERCA 1ICEA 1GU7A 2TECE 4C7BA 3DP9A 2VQSA 4JBXA 4X62B 2HV8A 5TF4A 3AOGA 1R00A 1HOTA 5HMMA 4XDZA 3VU0A 3V1YA 2R79A 4YECA 4JLDA 3H2SA 3O73A 3F2DA 4CW7A 1CC1S 4Q37A 5KTYA 1SV0A 1U2DC 5KINB 1C0PA 3RDPA 1A4RA 2I29A 4N6GA 5EWMA 1ZH0A 3HLYA 4JASB 1R6UA 3NAMA 3DKVA 3PR5B 4OJMX 4XIFA 3O83A 2YB1A 3WP0A 1N6LA 2OSBA 3SJAA 3F5AA 1XRJA 1OI7A 4P6VF 4IYJA 2KHZA 3MT0A 1O4WA 1KZ6A 3OZUA 3GDOA 2ZTMA 2QDKA 1P45A 2WTBA 1S7GA 5LP6B 3C3WA 3HUTA 3PF8A 5IAKA 2HU8A 2F1JA 3RTDA 3K72B 2F43B 4DOBA 1IK4A 5G40A 3FY4A 2F17A 5K3OA 1I7PA 2QRHA 1NMSA 3X2FA 2Y76A 1TKCA 1EDZA 3JQAD 2QRGA 2ZXIA 3SHVA 3VR3D 4X3CA 5EJGA 2O14A 3AETB 1QP0A 4XIJA 1H2AS 1YL7A 4B33A 1A5AB 1NC1A 1NY6A 4IJKA 2WDPA 2V8BA 4UBBA 2O8FA 5I45A 4R3UC 3SVLA 1ZS9A 4HFMA 1NJ1A 2RHOA 4YRAA 3GLTA 1TKBA 1MNAA 1T1SA 4C3UA 3BCHA 3V2IA 4XB6B 2COKA 3SV4A 4OX9B 4C5BA 4TL7A 3T0IA 2H7VA 2GEUA 4V0NA 5DHFA 5F9NA 3NTOA 1MFZA 2C1XA 4IJ5A 5LJLA 3DC2A 3I4CA 5KQGA 1ZRHA 2EAPA 3E23A 3K0EA 4UZSA 1H9AA 2Z43A 3N2KA 4BCBA 3TIXB 1T1GA 1IE3A 2O2XA 3KOZA 4N18A 1A88A 3M8KA 2AQ8A 4IRCA 4IUDS 3NM6B 3GWZA 4BZPA 3A1TA 2IKSA 2CLOB 2H7XA 2IUSA 3LRPA 4Q39A 16PKA 4Y6QA 4GVLA 4AMBA 1NSFA 4BNVA 3L1IA 3IODA 2QPLA 1EK5A 3MT9A 5AM4A 3UB4A 2B4RO 4XKJA 4E31A 2X5OA 3MB8A 3R0VA 4A0HA 3OMLA 4ZRNA 1PJZA 1UP7A 4KO4S 2QARA 2YW9A 3OJUA 3F6SA 3GLIA 5FNZA 1EG2A 4AY4A 4TWIA 3IUMA 3EFEA 1H8HA 4Y1FA 5AW9A 2WYWA 3JQ7B 1XLWA 4H6PA 1CJMA 3TTSA 4R66A 4KVAA 3H5TA 2C4VA 4L74A 4JR2A 1ADFA 2H7YA 3Q7PA 1GU1A 1ZSVA 2HA5A 2HA6A 3QVOA 2X19A 5DM2A 1ULZA 1DBIA 4IDNA 1QTMA 4Q4JB 1BU8A 3K5WA 2C4NA 3M9MB 3CX4A 3UMFA 3H18A 1F9EA 2VAVA 3F6YA 3FM9A 3LCUA 2KG5A 2BFDA 3KKMA 3R74A 4UNRA 1B8VA 1OA1A 2XKBA 4C20A 1KEWA 1OLUB 3C28A 3I30X 1OBFO 3NORA 5AXCA 3NTVA 4JV5B 1D2HA 3F1LA 1BX0A 3T54A 2FE4A 4M46A 2EDAA 4UEJA 4X94A 4OQEA 3EWSA 2Q50A 4ZAGA 5FOTA 1D03A 1NLYA 2YIMA 1FFYA 4C8LA 9ICSA 4X3PA 4S1PA 3BK2A 3ZDEA 1G7SA 1PX2A 2H3HA 1PNVA 2QN2A 3UWMA 3U5TA 3EJ6A 5LLDA 2MWMA 3O4JA 4UUBA 3D4BA 3FYHA 4JROA 4C8OA 2DOKA 5HQTA 5EINA 4YC7A 1DO8A 2EERA 3EZ7A 3TRFA 4ID9A 1J20A 1JE1A 4YBRA 2NSJA 2CZGA 5D5QA 2GLUA 2Q6LA 2EFYA 4XR4A 1R0ZA 2O3JA 2AFIA 3TPCA 2ZBQA 1V6AA 3F98A 3BEOA 3SQNA 1V5IA 2FP4B 3FAZA 4WOCA 3E9NA 4D5EA 1XWWA 1NUHA 3JVIA 3K70B 2K4MA 4M0CA 2HBZA 3DMPA 2PSEA 2H52A 2AEEA 4UU1A 5BMVA 4MP8A 2JFVA 5K45A 3G1WA 1MJNA 4XZ3A 1P9RA 3ZI7A 2WMOB 2IPAB 5K3AA 2WU3A 4OO1J 1C4OA 4E5SA 3G6VA 3AX6A 3D4OA 2NP7A 2R8IA 3VR5H 3F46A 4AC9A 3ICWA 1PK3A 1GTL1 2IYYA 4JQOA 5ALJA 5BRNA 3E3NA 4HYQA 1DQNA 1FVXA 4FZ3A 3ZDFA 1PKXA 5AI4A 1KRPA 4QBIA 5LOVA 4PG4A 5J4YA 1U9ZA 1A8UA 2NQ8A 4IL5A 1KP2A 4WACA 2AI1A 1E7QA 1ZVJA 4FYPA 2J3IA 4MDEA 4FX5A 1B1CA 3FDZA 5T4FA 2Q3JA 2PWYA 3E03A 3HKCA 1KO1A 1IM4A 1N36B 4G37A 4IDFA 2CF6A 3R5FA 3JWIA 3UHFA 5CK4A 2AZDA 3CPHA 2GM3A 3ZNPA 1ZUNB 4FKBA 3QM1A 3WS7A 1Z5ZA 3BZUA 4Y0VA 4AI6A 3FZEA 4EW6A 4KPGA 3DJFA 1UZNA 3L8FA 4OSEA 4C0LA 4R2HA 3FH0A 4POAA 5ICEA 5A62A 1BH6A 1ZC4A 2MINB 3SAJA 4BX3A 1XL0A 2WSSA 5D7NA 4NDAA 1PVQA 4M1KA 1VSQA 3A6PC 5JQGB 4XARA 2AN4A 3H83A 1F1BA 1KQPA 2AFRA 3TFOA 4L7QA 1TCAA 5ADVA 3AF4A 4NICA 4FFRA 2WHPB 3F8WA 3LO5A 4J3FA 1T9GS 5I9SA 4YRBA 5BSFA 1F7UA 4ECZA 3OETA 2BP7A 2D1TA 3G6KA 4WDQA 3NXKA 3WGNA 2VPQA 4PGFA 2W6MA 4C4XA 2ZAGA 4K6KA 5K99A 1T8RA 3O2JA 1ZQXA 2YZNA 4PBTA 3O1HB 4FCTA 3NIWA 4HX2A 5BT8A 4GUAA 1O9BA 4RZ2A 4MVJM 2BMDA 2OHIA 3A4NA 4QWMA 2AFHA 3RIGA 2K8AA 1GADO 1EE1A 1W75A 2IYPA 3TLZA 5JS6A 5KMGA 1I51A 2VDMB 3ETJA 1MENA 5FPSA 3AUTA 3T35A 2CNDA 3HA5A 4XUGB 4D4KA 1Q1AA 2XCUA 1BXZA 3PJFA 2C20A 4ARUA 2BCVA 4EPTA 2NZXA 4B6RA 2V7GA 4TVBA 1J0CA 4XSHA 1XK7A 2ZVDA 1JKJA 1KEEB 2W0SA 3EIHA 4LV5B 4IHJB 4MWBA 1GCOA 2BEJA 5ILQA 3UXOA 4E12A 4UAZA 5ILGA 3G8DA 4D81A 1P6XA 3M1YA 2ZIXA 1G20E 1GRNA 1D6SA 3BAFA 4B8ZA 1RM5A 3O84A 3DZGA 4IVPA 4GW3A 3MUOA 4OB7A 2ZT6A 2KEYA 3BRSA 4TTJA 2EKQA 4FI3C 2VT3A 2G5CA 1UC5B 4WY5A 1IONA 3TM4A 4PZ0A 2M9NA 2A1JB 1VI5A 5G3YA 4AZWA 2FLVA 3UV6A 3AL3A 4MS4B 1XCJA 3MR5A 3UMYA 5AIAA 1QQTA 3HWWA 1D0IA 5DF1A 2AD5A 3WB1A 4MKRA 3L9WA 5KYVA 5ENZA 1FNBA 2IYSA 1LBHA 3IMFA 5FCDA 4TV9B 1QC5A 4HTFA 2RHJA 4ZKDA 1MUUA 4MI1A 1Z12A 3CNOA 3FPSA 3KUCA 4U7WA 4J9RA 3S5UA 1YBFA 4E7OA 1A69A 1RJ9B 2NXJA 4RHEA 4ICIA 5BNWA 1GTG1 2NRXA 1A2BA 5FRDA 1ZOIA 2WSYB 1EVYA 2HHHB 1TK3A 3P0RA 5CCEA 3WYAA 4MGZR 3M4ZA 2C7VA 4DLEA 4CGZA 2Q5JA 5C0OE 2HY7A 1N9GA 1EVQA 2EDUA 3MF4A 4LYAA 3OIDA 1U2DA 4PVDA 4JUDX 4I50F 4X97A 4LBZA 2BLLA 3CEMA 5F7OA 5B3JA 4FU0A 4YAJA 3I6YA 4K6HA 4LZGA 4B76A 3C5EA 1LC3A 2OCLA 1J25A 5GJWC 3OQHA 2HJHA 3GJ6A 3G2PA 4YR3A 1MO2A 4FS1A 5LR6A 2JANA 1B1AA 2NTVA 3UAZA 5I4KA 2KZMA 4XR9A 3K0CA 1Y34E 2QVBA 3CF4G 3THYA 3AEVA 3FFBA 1AUVA 4LE2A 2VHWA 2AGPA 2BKAA 3NO4A 1ZNQO 4KDCA 2V6BA 5EIWA 1DIOB 4JLUA 5JJLA 1CR1A 4MR9A 1P2SA 5A9RA 5KSZA 3NDPA 4EA7A 3UV7A 4BNNA 2OV8A 1E3WB 1QTNA 2VSQA 5EXPA 1ONNA 2FSUA 2GJ9A 2W83A 2XMGA 1QIIA 4II7A 2P6OA 4LQDA 2PQ0A 4L6CA 2GAJA 2GPSA 3A7EA 1F14A 4JV1A 3EYAA 2JEZA 3C16C 1NVEA 1WMAA 3ZHVA 3VC1A 4YUYA 3CA8A 5E6RB 5AVWA 1SXGA 1JQKA 2AXPA 4Y9TA 4L5IA 1SIUA 4DJTA 1U4NA 4C6TB 4ZCQA 5J2HA 3MINA 3LUJA 3AJAA 4P4SA 3SZLA 4B2LA 5AXDA 3NGLA 4TYNA 3EHDA 5BUQA 5DCYA 3GFBA 3QEMB 4L95C 9GPBA 1Y5RA 2D1SA 4XQ8A 2ZB8A 1QDEA 3F47A 3RVLA 3EVGA 3QI7A 3R76A 1IQ0A 3ZXYA 5AD1A 3GJRA 5LD2B 1O95D 1PO7A 3GBSA 4AYBF 3DOFA 2BCRA 1CX9B 3OIFA 1ZQSA 2CLIB 1UKAA 5DG9A 1S6YA 4M22A 2RAUA 2WAAA 1UH5A 5A1JA 2XNDA 2X7JA 1GNRA 4YJGA 1KSJA 1E6LA 1RADA 4LJKA 1RDFA 4AJ2A 4MIEA 3M1AA 1QSLA 3ROQA 2BF4A 3B13B 4DFDA 1V26A 1NIJA 3GD7A 4EHIA 1BRTA 1IHXA 3NWPA 3S2EA 1C3LA 3ELDA 3ABZA 5AW2A 1QH1B 5DLEA 5ICMA 1PR4A 4QG7A 2QAJA 2P4UA 3MBOA 3H75A 4GNKA 1SFRA 4RZUA 4BWGA 2P2ZA 1EIWA 5JARA 3HFGA 5ARBA 1JHMA 3STWA 1F8FA 3TIFA 2ODQA 2FR8A 4WUVA 4ZJUA 3MG9A 1MO5A 1RR6A 1K5GA 4CG0A 3GD5A 1A1SA 4RETA 2G4VA 1ZG3A 2OZLA 2BEVB 4X8OA 2P4EA 3FSRA 3AUUA 1R8JA 1K4KA 3CR8A 4XLTA 4UD6A 2NSDA 3IMEA 2QB0A 2DQKA 1FLVA 5BYKA 3KZOA 2B7BA 5IULC 2GXQA 2JB9A 2KB0A 4PN7A 4WMLA 4PXYA 3AVUA 1D5WA 4O5OA 2IZ0A 2BI8A 3A1CA 5J59A 5CLQA 4PAMA 3K5PA 3WB9A 5THQA 3TQ1A 1QDUA 2ZBDA 2OL4A 1JIXA 2VF7A 3EIUA 3V34A 3EGEA 5L1IA 4EGQA 1VI2A 3T3MB 1EWKA 4UB8U 2WE8A 3T9CA 1R0CA 2G5HB 3LBNA 4KQXA 2CL5A 3HGQA 1QFMA 1D2CA 5KYYB 1ADGA 2XGOA 7ICRA 1XDSA 2GKOA 3AHGA 1U2SA 5HNKA 1VHLA 7AT1A 4UQPA 4J91A 4DRZA 1MD9A 1EK2A 3TX2A 5HIAA 1Q7EA 2I34A 4OJYA 4XFKA 1JVSA 2CJWB 1DS6A 4R71A 2PX2A 4I3GA 4FM9A 1C7FA 4ZDJA 4QYXA 4BFTA 1YH3A 5LWQA 3HO1A 1QB7A 1I6MA 4YR2A 3QXGA 2DUJA 1P5ZB 3O8OA 1Z7WA 1N2OA 4L6AA 3AI1A 3IKJA 3VI3B 1XO1A 3CFYA 2VUSA 5IANA 5GTHU 2HQRA 4YV0A 4H18A 2E18A 4XYBA 2ZRCA 1H3FA 3GRYA 2BYTA 1CHNA 5ED0A 4DQUA 2Q8PA 3JSAA 2HJ9A 4MQBA 2OYSA 5ES3A 3NNSA 4RLHA 2P2LA 3SCZA 3LP6A 3K9BA 1J8YF 1VCIA 1YZHA 3OZDA 3PVXA 3JWGA 4MCAA 4RVGA 2P91A 4DB2A 4D5GA 4IV0A 9ICEA 5LCXA 1KI3A 4F7DA 3UJ3X 1X7WA 5TQ2B 2A9KA 3MVEA 4C3OB 1HT1E 4CIDA 4G0MA 5K8JB 3SN6A 4LY0A 5DKFA 4NU6A 1XQXA 2R1VB 2RKBA 3IA7A 2M32A 3I9MA 1Z0DA 1OXUA 3WK5A 3CVWA 5GJBA 2GZHA 5CCXA 4RNNA 1FFUA 1M2EA 1N2BA 3RRJA 4CM4A 4MIKA 2VL7A 3LQ1A 4ASUA 5TX7A 4KPYA 3URMA 1XNGA 4YMIA 4IIUA 1PNTA 3O3NB 1JJAA 4YAGA 3DZCA 2W2OA 3BSSA 1Q14A 4MRAA 4DE5A 1S3SA 2OD7A 4XGRA 3SZUA 3OZEA 5SY9A 5JAOA 4EFDA 5KYXA 4OFWA 2VHUA 4HVTA 1WVMA 1MAUA 3KRTA 2Q9AA 3MGKA 3B5JA 4WEQA 1J49A 1M66A 4KSCA 3HE3A 3GRFA 4V0OA 2D3WA 2BONA 5EUMA 1XZPA 4OEHA 1M3SA 2AVDA 1QORA 3AGPA 2IY9A 3Q72A 2EJWA 1PVPA 3D8HA 3NALA 3M9XA 4MZDA 4BVJA 5JD6A 1KFBB 1ZMRA 1MOQA 2ZYUX 1Z0UA 3NHMA 2DXIA 4DYVA 1YIDA 3NHJA 4EW2A 5SY4A 1ECFA 4BKQA 1T5IA 4K9DA 3L6CA 3TEFA 5DM0A 3OZBA 1E1CA 4QOSA 5IIMA 4FOLA 5C8VA 3C3XA 3U81A 3BORA 5JVDB 5AOVA 4EQ6A 2NZ8A 1LW6E 3CLRC 1Y7PA 2C84A 1NQOA 3KKZA 2PFOA 3U0VA 4FGUA 2OC9A 3VZRA 1JHUA 1MCZA 5H5JA 2XCTB 1JU4A 2HDWA 3GAMA 3QKSB 1WWKA 3PW2A 2GAIA 1SVOA 3BJMA 4FYWA 4D0LB 2BZGA 1VBKA 3CLHA 5BWCA 3C85A 3GROA 2ICAA 2IHJA 8ICIA 1VJDA 4HSEA 1FPQA 3GA7A 1UPTA 3EXHA 5A4AA 1Z3CA 5T8KC 2J3LA 2WVAA 1LX7A 1J00A 3REGA 1HDYA 1GPAA 4UBIA 4RVFA 3Q6NA 3L1VA 2IPXA 5J9FA 4XWAA 4DIFA 2BRUA 2ZTDA 1JHAA 4HLNA 1YQTA 2DF4B 3OPYI 5JC1A 2HNBA 4OY3A 1XZDA 2CNWD 2FEOA 1K8QA 5JWHA 1Q3TA 3OJEA 1JROA 4NARA 2WVGA 1LTKA 4XA8A 3AFMA 1PEYA 2FJ0A 2J09A 4AF7A 3N5KA 3T7CA 2PUWA 1W52X 4BGDA 3SENA 5DDMA 1VL8A 2O8EA 2O07A 3BD7A 3EF3A 1NQXA 3AKEA 5TMPA 3K32A 5BNTA 5K2OA 1IM5A 4FN5A 3TE6A 4MUKA 3IKTA 5FJIA 2QT1A 2WB1C 3HNRA 1P5RA 3VU3A 4A4DA 3LIIA 5IM4A 4O6VA 4Q66C 3KDSE 3II6X 1W2GA 2WB2A 3I6QA 1W4CA 4E1VA 5I5EA 2ILTA 5EKUA 4AJOA 2JGMA 3B1WA 4FEAA 3W2HA 4MVYA 4O3PA 4P4OA 1BGXT 2CW5A 3W9UA 4HQFA 3JPPA 3A2LA 2ZIGA 3L4SO 2WJGA 5KAPA 5IC4A 4D57A 4DUPA 3PF9A 4BLVA 3TNLA 3CNBA 2D1YA 3N8HA 2YVAA 3KHKA 3ABIA 1ZBQA 4X6XA 4JJ8A 1HL7A 4DGQA 3VZPA 4TMKA 3B1JA 4M8IA 5FO1A 5DNCA 1VKHA 1JHDA 2R0QC 4Y6RA 4NQRA 3O8QB 1JKFA 3UBTA 3BWYA 3HA2A 5GJCA 1VKNA 1FP2A 2HZBA 2PD3A 4QXMA 2CYCA 2H06A 2VOEA 3EPHA 4R1TA 3PXUA 2E48A 3T99A 1GQRA 3HA3A 2CLSA 2X23A 2RP5A 3H3JA 4FFOA 4B40A 6AT1A 1GPDG 2J0UB 1GGKA 1ZRSA 5FR2A 5B2FA 2QUJA 3DOHA 4EY4A 3FXAA 5DGDA 2V3CC 5KNCH 1GFZA 1JG3A 5LQUA 3G23A 3PR3A 4GXIA 5FI5A 1UM9B 1G8MA 4G0QA 1NYQA 3IELA 4DN6A 1MRSA 2NSLA 1H2FA 4RNDB 4KR2A 1H4TA 5ITVA 1XTUA 1LFAA 4NU8X 4LCBA 7ICKA 2QW8A 2CXRA 1ZX1A 4QBKA 1LQ2A 1M6VB 1KL7A 4XCXA 3SZ3A 2YN4A 4RT2A 2YJNA 4FYMA 2W6PA 3ND6A 3PNKA 3KIPA 4KQKA 2GASA 3ZD6A 2ZSFA 2MDTA 3HILA 4XIGS 1QQBA 2FI1A 1PZNA 1M83A 1E9VA 3G6YA 1J2RA 2FQYA 4B9UA 5F77A 1L7BA 1A2KC 1E3QA 2VXBA 1B0AA 4JCOA 3BFJA 4DJJA 1W36C 2Y1FA 2AF4C 2MCFA 1N92A 1D07A 1SV0C 2A0YA 3SEIA 1T5LA 1NVKA 4AXBA 1SIJA 4C6HA 2GH1A 3WGGA 4DIEA 1W8DA 4HZUA 3JQFA 4B9AA 3BDPA 1BPDA 1KI6A 4R3WA 5LMNB 4OXRA 2VUUA 3PJGA 2Z57A 3DZIA 3REQA 2MSCB 4PZYA 1TYCA 3OZCA 4LAFA 1K3FA 4DSKA 1KMIY 1FBNA 3QXJA 4J0KA 5C1OA 3SHWA 4HVAA 3IHLA 3PDUA 4O4JB 5JRJA 2VFAA 4NBKA 1HX7A 1YU9A 5H0IA 3U6KA 4WK4B 5KNBH 1COWA 1VYVA 3DM9B 4B3TB 4M21A 4QW8A 3Q8LA 4YV1A 5GOZA 2O06A 2BFEA 1JG4A 3PQDA 4J4TA 3UXEA 4R0VA 3B3AA 1M2OB 1XAJA 2ZDGA 4ACBA 2WG1A 4S24A 4B7XA 5JH7F 4UTRA 5CDGA 2DTXA 1SKBA 1Y6QA 4CIBA 3IV6A 4MGIR 3U7QA 4GPEA 4KMOB 4IC9A 3A04A 4P0TA 4Y9DA 3Q12A 4DMGA 3CVJA 1DJMA 3EGIA 1GQQA 3OESA 2IRWA 3AU9A 3JD4A 3LPLA 1UT6A 1Q7TA 5C4GB 3STHA 4UTPA 2NVWA 4DQKA 2XYPA 4P83A 5AJYA 3HEAA 4QDXA 4RCZA 3BZWA 5HDQA 2PBLA 1DDGA 2B4QA 3HQ4O 3KPJA 1LPMA 3BDIA 3P9RA 4XB2A 1Y3BE 1QWSA 4RO0A 5DKWA 4Q3DA 4L22A 3OZGA 3WLNA 5DGHA 1E9BA 4D82A 1W581 2UYYA 4EG0A 3O91A 3T0GA 3PW0A 4GYWA 1KQOA 1U11A 1OI3A 1ZQ9A 3GA0A 4AMYA 2ZIVA 2ZWMA 3H13A 3GEPA 1ZJ5A 1P81A 5DJ5A 3K05A 4S35A 1VC2A 4JT2A 1MIHA 3R9KA 3EGDA 1C0LA 4HEA6 4OMCA 1VIVA 3BC1A 1JEQB 2JJMA 5EXTA 4HDNB 4U6PA 3JZIA 4AF8A 3N59A 5BW4A 1BJTA 1B8NA 4UXJA 1R3DA 4PX2A 3H2BA 2NWQA 1SAYA 3QWAA 4JLAA 4CWAA 1JHOA 5HCUA 1XFDA 1QIGA 4OYLA 3EZ6A 1RACA 2AJ8A 3Q5GA 3M83A 2VI5A 4BWFB 5CYFA 5BOSB 1M2KA 2X13A 2KJ9A 1LJLA 2PUHA 5AKZA 4IVQA 4N9QA 3PVZA 2II6A 1E2MA 1Z00A 2VH2A 5IG2A 3WKCA 2AN9A 1Q74A 1JNYA 5KU1A 4IJVA 1XRRA 7GPBA 1QANA 5G0SA 4OGFA 4WKOA 2H5LA 13PKA 2EFHB 2Y6VA 5GJVC 5GM1A 4FZNA 4O8CA 2WYHA 2LKYA 1U31A 4F84A 2L17A 2OFWA 4FFWA 4JBGA 1WDMA 1HI9A 3IB6A 1RAIA 4UPEA 2J9YB 3ZK9A 3IQWA 3BRWD 5HQ3A 1KTVA 4WNIA 2VYFA 2XB9A 4CKBB 2EBUA 3TTUA 4RV4A 3U3XA 4GBED 3LCJA 4RTRA 2W43A 2Y3IA 4P58A 2X42A 3H86A 2RG7A 1XDGA 3BTOA 4WZZA 5JFOA 2Y05A 4BMPB 1E0JA 3RM3A 5HVNA 1EYZA 4J43A 5LQKA 5ALGA 3CLSD 2C4KA 1KDTA 2G17A 2W8BA 1IXKA 1GGFA 1N4AA 3CPEA 1PL7A 1FUEA 1WMEA 1L1QA 3EEIA 2AW5A 2JFNA 3T12A 2JLRA 4RSGA 1IOZA 1R9NA 4GKVA 3U49A 2A1UB 1UXOA 4DLAA 4B6JA 5REQB 4ML3A 4LF8B 4MLCA 3TZBA 3BS5A 5SZJA 2NXCA 1ZGBA 2YFHA 1WVIA 1P60A 1XO0A 4D6XA 5AQ1A 5F78A 1YB2A 1NN1A 1QFSA 3T3HA 3WWDA 1A9XB 1M74A 3KZCA 4ABYA 4H4CA 2HVIA 5J8YC 3W5HA 3EXIA 1CRQA 1EEHA 4F46A 3Q9NA 1IFXA 5CNIA 3HJBA 1YE3A 4KPUB 3CH4B 4I2AA 2VCHA 3CZ5A 2X0IA 4PSDA 5JIBA 1G1MA 2XIDA 3C0KA 4TYPA 3H9BA 2WTMA 3ZLBA 2A7QA 4Q3CA 4BKOA 4WDRA 2G83A 4Z8XA 3UAGA 1T8PA 3U7EB 1OFGA 3EHEA 3S6JA 3TW8B 1TC2A 2Q49A 3VX3A 5EYPA 1U3FA 2R7LA 3GEBA 1Y48E 2G9UA 1IZZA 1V0JA 1TW3A 3ALRA 3LKDA 1VLMA 1R8SA 3Q5DA 3IDOA 5TGTA 2E37A 2IHBA 1UBKS 1GFSA 2Q1SA 1KW4A 5JSZB 5A3QA 2XF2A 3W7BA 3NS1A 4DC9A 4OIMA 1KO4A 4HB0A 1Q0ZA 5CFZA 3DMTA 3VZQA 3QXHA 5JYBA 2W48A 1W5SA 3H2IA 3Q8KA 2O8BA 2V6GA 3HBJA 3KEOA 1B4DA 5B6IA 3E9MA 3EEQA 3T6KA 2ECOA 2WINI 2R00A 1WBBA 5SV2A 1D8BA 3IMGA 1HSZA 1N75A 2OSVA 1VJRA 4ICAA 1AU9A 3OJOA 2XLBA 4YAOA 4CDNA 1X2BA 3V55A 1QGAA 4MVJE 5AW7A 1F2VA 1AS3A 3W4JA 5KREA 1FOEB 4Y6OA 4JUBA 4P84A 3SKVA 4QIWF 2J6CA 2F67A 1IG6A 8ICXA 3R5TA 4MPJA 1YA6A 1AA9A 3U3OA 3HVIA 1XROA 1PEDA 5L3QB 1JQBA 1N1GA 1FYFA 1L4NA 2OZEA 2XZLA 5JS8A 3D1VA 4WZAA 2P3OA 2BFBB 4BNIA 3QIAA 1J5EB 3I5XA 1Q8KA 3D7RA 1U3CA 4V0MA 3PNOA 5TC4A 3R3WA 1CW2B 4ZDIA 5ALIA 4G1BA 3IOYA 4TYYA 2EBWA 3RVJA 2BCUA 1JFSA 5TPWA 1P1CA 1G9SA 4GAEA 4RTPA 1XL1A 2OCAA 4WKGA 3WYNA 2DLCX 1H22A 1C8KA 4HDKA 2IPNA 1H4SA 4DLNA 3FUUA 3WGJA 1NFRA 1A97A 4DL7A 1VRWA 3PW4A 4H7IA 2R6ZA 1U2PA 5KVCA 4IZOA 3E05A 4U8HA 4FIZA 4M0DA 3MTBA 2FJ6A 4AJKA 1ZESA 4KTVE 2RHGB 3ZY5A 4Q1VA 3QNMA 1MU0A 3TGWA 3U4QB 1XVTA 4NXNB 3QKIA 3N7PD 1BIFA 3BMOA 5IH7A 2XY7A 4Q9KA 3HKDA 5KFXA 1MIOA 4D9CA 1CR2A 1DXQA 1KYWA 1GDHA 5IDXA 1EDOA 4FDUA 3WSVA 1Z19A 4BNGA 4XVUA 4Z3KA 3LPDA 2PWBA 4P36A 2WAXA 2JAPA 5FOQA 3UQ2A 3ABSB 5I4BA 2JGIA 5ISMA 3CONA 1TRKA 1WXEA 3DE7X 1VJ0A 3ZWVA 4HUJA 2AK2A 4ZYZA 1F4LA 4ZVQA 8ICVA 2VYCA 1BWSA 3OZRA 3X1MA 2M6RA 4CL0A 3RUDA 4G63A 5C5CA 1TGYA 1S3FA 1VBFA 3QWBA 3OTHA 3T4UA 5EIBC 1NKBA 1WNFA 1XCMA 3P9IA 4UB4A 4BQPA 5A71A 2OM6A 2W3SA 3O7WA 4LJ9A 4N6OA 2P9CA 1T4GA 2JG3A 1LPSA 4BB9A 2FPXA 1SXJB 3OU6A 3BH6A 1JS1X 3C97A 2Q0ZX 3AK4A 3BMQA 5E8JA 3NDRA 3PS9A 2B1IA 3RREA 1USGA 3UPUA 2I6XA 2GYWA 5FBVB 3ML1A 3W78A 3JASB 4RPIA 5IM5A 3QP9A 2GAFA 1QZXA 1RYHA 4I4LA 3DVRX 3D1LA 1FXWF 3JAWB 4PGAA 5H80A 5L3ZA 3BIJA 4QTTB 5BR1A 1SUPA 1W8IA 4RGBA 1RXVA 5BVHA 4LRTB 5B3JC 4DHWA 1UDXA 3DBVO 5ALDA 2P3SA 2BFCB 4CF6A 3A10A 1Z06A 3OM9A 2C31A 3MJCA 4HDCA 4WESB 5F33A 1FMTA 5L7YA 1KJ9A 4J4BA 4OAQA 4WKNA 3K0CC 3W9YA 4QZEA 5J2EA 5DOZA 4GP7A 4TT3D 3TVYA 1GR1A 3NQ41 2ZKIA 3FWHA 5KX5B 4CIAA 1YZ6A 2R1TA 3AVXA 1XA0A 3OIYA 3FOEC 2ID9A 2DETA 2FG6C 1DJNA 3SZRA 4AWAA 1P1HA 2IU3A 1VQ1A 5J5AA 4AZ0B 2EZXA 3T95A 3ABRB 2QGNA 3O8BA 1UQRA 4YMLA 4MLDA 4GKKB 4RD0A 4BB0A 4UM8B 4RQ2A 4Y9UA 4EUHA 5DOVA 4B7ZA 4BS9A 5JAMA 3V7LA 1PYOA 2GARA 4BNKA 4JSRA 4M60A 4RFSB 3HNPA 4JC4A 4JHLA 3R9XA 5HKAA 4DJ5X 4MUEA 3GT4A 2E0IA 2NU8B 4EMBA 1KK3A 3UT6A 4WASA 1RYDA 2FPGA 2FOLA 1RJEA 1JALA 1FFSA 3TARA 3ND8A 4GX1A 5KS2A 2JS7A 2BFWA 5FL7A 3PHGA 3F7TA 1Q1QA 2NRZA 1BSVA 1H8EA 2OG2A 1G8GA 4YAWA 3OZAA 3VC3A 2JH8A 3WKEA 4PL2A 2F9FA 1DRVA 3WKAA 4IXDA 5CM2Z 1RM6C 1NI4B 1P2BA 2QGZA 4JI6B 3AR3A 1X6JA 3RTCA 1JR3D 2PGDA 3FOWA 1THMA 2C8LA 1UQTA 3IQFA 3NRJA 1X77A 2B37A 1ODTC 3L04A 2VPXA 4OHKA 1ZKMA 3PL1A 3UJ7A 3FZGA 2J5KA 4HYKA 1BCSB 1KAEA 1STOA 4GPIB 4LRUA 2RQ5A 2LR0A 2H1RA 1HY3A 4ABTA 3A4TA 4MUMA 5JNTA 4IIDA 1LSJA 1IN6A 3KKNA 2DCMA 1QRUA 3DO6A 3T9AA 3H5IA 5J2UB 1KDHA 1VLLA 4ILKA 3GEDA 1ZZEA 1E2JA 3WX0A 1M72A 4CU5A 2FR8C 1K5PA 2NYRA 3WHLA 5DIZA 4EPXA 5KFFA 1BE8A 4X45A 4DSOA 1M7BA 4PYQA 3OLVA 2JIPA 5FPQA 1XP8A 3DEAA 1CEQA 2QNRA 1XHFA 5HRUA 1T4BA 2A9FA 4CL3A 4CLDA 1P7PA 2C7BA 1BEUB 3PGLA 3AESB 3ELWA 3OZWA 1WLYA 1AKNA 2W7TA 5AW6A 4HQ0A 4TL8A 3GQBA 2G72A 3AEUB 2C29D 3W3AD 5KFPA 2J7PD 3AFGA 2XMBA 1GZ6A 4KFSA 2Y1JA 3GQVA 2GJ4A 1H65A 5J2IA 2PZLA 1V9LA 1YOVA 5HE9A 5C5JA 1VRVA 3KJIA 3BUSA 1KTIA 3IBYA 1PIWA 2ZJFA 1T7PA 4MCJA 2WT4A 2ZTLA 5BN4B 4D0GA 1EHCA 1FPMA 5TDHA 5IFLA 4JS0A 4RM3A 1GQ2A 2QKQA 2V59A 3PSHA 3Q98A 3TXXA 1F4PA 3RRHA 3ORRA 2J3KA 4KC0A 3OD1A 1NVVQ 3I45A 1DGQA 2XDWA 4GZ6A 4KXNA 1B6SA 3U4GA 3L4KA 1Y8RB 1ZITA 5FX2A 3QE0A 1JT9A 5C34B 5DT2A 1MDFA 2AWNA 4DTCA 4PTYA 3NIFB 3SG0A 2VJBA 2F90A 3IP7A 4W63A 5B1IA 3EAQA 5FAXA 3IS3A 2WU1A 4A2CA 4AMVA 2VSFA 3WGOA 3GRAA 2CK3D 4IHKA 4Y2TA 4RQ4A 3EDMA 2J59A 3V4FA 2NPFA 1FDOA 4LTNA 4KRFA 5CW1A 1F2UA 4MHTA 4KLRA 1G1AA 4ETIA 4KLAA 3EUFA 3MJDA 4YFYA 3HKEB 4H1VA 2JCXA 5J8YA 3AHEA 1YJ8A 2OO5A 1NYLA 3FBGA 3FF4A 2W9XA 1SQGA 2YY5A 3RVQA 5JNRA 1CY4A 2Y2UA 2C78A 5T3UA 4PS0A 2A5DA 2BDPA 4YY3B 1C20A 2BGNA 1K4YA 4HYTA 2OCEA 4Y1RB 3LAWA 4GMXA 4I2VA 1FQJA 4GLBA 4J0JA 4KMSA 2FH5B 2VDOB 1ADCA 3CPSA 2P69A 3N0RA 3L7IA 1X7HA 2JL1A 2PYZA 4IIJF 3WLOA 3BRCA 5KHOC 3HC7A 4OBBA 2C2RA 4Y3UA 3KL4A 3QTLA 1N48A 5JALA 5FHRA 3DNMA 2WC1A 1O6GA 2R4QA 4ITRC 3C3BA 4BVFA 4OQFA 3CRMA 4JI0B 3IAUA 4UNQA 4HNVA 3IAM1 2REXB 2A1TR 4M0PA 4P5EA 3WJAA 3T9EA 2KV2A 2VWGA 1S7CA 2QT9A 2FUG1 1RZRA 5HZMA 1GCGA 4TOIA 5SZKB 3HBLA 2KMLA 5JAIA 4P1ZA 2E7ZA 2OBXA 1JYSA 3AZQA 1MSWD 3N87A 4QRIA 2E2WA 3SAFA 2AOTB 1YKFA 5CFQA 2A84A 1J4AA 4MQ6A 3A4YA 4KYIB 2ZANA 3HYSA 1WUTA 4B73A 2YV5A 3C3AA 4KGXA 2QYTA 4CG1A 5CR0A 4TL6A 2JJ8A 4RFLA 4E4RA 4EPWA 3MRTA 1N5KA 5EZQA 2P0AA 1IBMB 5C1PA 4KI0A 3KT8A 4ROSA 1L7PA 3WIBA 3K5HA 2NP6A 5AOBA 3IDFA 1NW4A 1RYUA 5MN5A 1MH9A 1W0JA 2EW8A 3KLOA 3RU3A 4MSUA 2GJ8A 2PXAA 2X4IA 2MMGA 3ZI0A 4QNNA 5DCWA 4O4LA 4HNSA 5BN5A 3GZNB 5JDIA 2GOLA 4RHYA 3I09A 2BPGA 2ZYHA 5K0CA 4QPZA 1YR2A 1BE6A 1RYBA 3EPPA 4CCSA 4JI1B 1YL6A 5CLGA 1II8A 3F7MA 1SOAA 2QWXA 2FY8A 2ZGVA 2XI4A 1TZCA 2PKQP 4E14A 4CHTA 5JZ9A 4NHEA 2RFLA 2X7XA 1AKQA 1PVDA 1HEYA 1QRSA 3C23A 5G5GA 5CJ7A 4V02A 5E3HA 4LF5B 3LUKA 4KTTE 1T2FA 3P5BA 4M8SA 4A2WA 5JNVA 3AM9A 1MABB 1U5BA 2R7AA 5KFKA 3EXHC 3TTWA 1PQPA 1U63A 5KU7A 1J39A 1IHOA 2HHVA 3IQXA 4FX2A 3I9FA 5TVGA 4MMZB 1YVEI 2XQJA 2GHTA 3M7DA 5A3VA 4ECXA 2GO1A 1L4BA 1M1NB 2ZI4A 2BM0A 4BFCA 2BRUC 3WAGA 1SCUB 1HM5A 4EZIA 1C1DB 4K28A 4Z1MD 1DADA 2PMZF 3EG9A 2BR4A 3HH8A 1Z2NX 4G5HA 3G6XA 2HHCA 4JOCA 2X8BA 2QTMA 1F2DA 2UYQA 1SELA 3PQFA 3V1MA 3WIOA 4P81A 2WP0A 1A8PA 3CHYA 1YCDA 4LG1A 1IATA 5PNTA 3IHWA 1DOHA 4KQFA 1I9GA 4RVSA 3FCEA 4KJZA 4PLHA 1YS4A 2R1ZA 4YN3A 7ICVA 4GR5A 2Z3ZA 3MYYA 3GXBA 3KR0A 3KUXA 4OUDB 1M34A 3SIXA 3SAGA 3GZFA 4ZZ3A 4ZT4A 1SURA 4M98A 1U8ZA 2RH9B 4DV7B 1A6SA 2QD2A 4MVJP 4DLBA 2QMHA 1X42A 3PDCA 4LJAA 5D7BA 1IWPB 1N5XA 5EPOA 3DD5A 1YO6A 1QDLB 3EZ5A 4GVPA 4HFRA 4BFSA 5DZSA 7ICJA 1YOBA 1U7TA 1MTOA 1XD2B 4HLUA 3RAPR 3AUOA 4BTEA 1XZJA 2CDBA 4RJKA 5A6VA 3PJRA 1D1PA 2CNLA 2BBTA 4YI3A 3ORYA 4C8MA 2B3DA 4L7VA 4EYEA 4F2SA 2CEAA 4QYSA 2ORVA 1E6MA 4ZV7A 2YC4C 2HHUA 3D6AA 3VYSB 3NHLA 3UHAA 3JU3A 1PT9A 4ZZ0A 1BPXA 4X8LA 2SNIE 4LV6A 3GDXA 2C82A 4M1OA 1TVCA 4QFDA 1KAGA 5J23A 2RAFA 2FNAA 4RVNA 2PAFA 3FRJA 1Y80A 4XX0A 1D4OA 1LBTA 3S2SA 3IEVA 3LUAA 5HGXA 2VJKA 2G76A 1UXKA 1XMVA 2QM7A 2C5HA 3PLAE 4IZIA 4EHLA 3U7RA 3QMWA 2CEKA 1PK8A 4EARA 5TXGA 1YUMA 3I4FA 4FT4A 1RYSA 4BRUA 3N7UA 1C9YA 3AEQB 2BEUA 3CBQA 5BPCA 2EYQA 1A71A 4FBMA 9MHTA 3ZCXA 3VJKA 5KCMA 3GLSA 5HJ7A 1X80A 4GOKA 4BX9A 3LGAA 4DQRA 1VG0B 1W29A 4LXUA 3VZCA 3NASA 2C1ZA 3ZHCA 4BUCA 2HT6A 3X0DA 5LLTA 5IJ0B 2PUTA 2XEXA 4LSZA 9ICOA 4HFJA 5KFEA 1I4EB 2HQBA 1CDEA 5F3XB 2YJZA 3O4RA 2Y9TA 3BQ9A 1Q12A 3FDIA 1ZXIA 5AW0A 1ZN8A 1A5ZA 4B6SA 3GLGB 2HF8A 3O2QB 4YJ2A 2WLSA 1LPOA 2Q6VA 3EVTA 3T52A 4GD3Q 5JS2A 4FIDA 3MXTA 1GFWA 4RDIA 1I8TA 4MFCA 3NDIA 5DBOA 3TD9A 3HP7A 5GINE 3BM5A 5EZSA 4CRWB 2XYQA 4CQMA 1YHZA 1JKIA 1JAHA 3NOQA 3I01M 4FYJA 1TVKA 4ENRA 2Y4NA 2NYVA 3RVNA 1NX6A 4J9QA 5BV2P 2CB0A 5JY6A 2TYSB 3RKUA 3RYHA 1AIPA 3JQFC 1T2EA 1X14A 4KXXA 1I2MA 1EESA 1JXOA 3AEKA 5JRZA 4OQQA 2YTZA 4P5PA 1ECLA 3RANA 2H17A 4YRNA 1KWGA 3QVTA 5EE0A 1NHGA 1KKLA 4D3DA 2ACVA 4F9FA 3SP1A 4BMZA 1X9SA 3L1KA 4TLBA 3OKPA 2K2WA 4FMDB 4Q9AA 5EESA 2QGFA 3SDZA 2XUGA 4O4JF 3U19A 3U26A 3ASZA 2O8DA 1HLFA 3H2YA 1ZUWA 1T9ZA 3LOUA 3OCXA 3I12A 1A9PA 4AG5A 3DUWA