4C4RA

Structure of beta-phosphoglucomutase in complex with a phosphonate analogue of beta-glucose-1-phosphate and magnesium trifluoride
Total Genus 79
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
79
sequence length
218
structure length
218
Chain Sequence
MFKAVLFDLDGVITDTAEYHFRAWKALAEEIGINGVDRQFNEQLKGVSREDSLQKILDLADKKVSAEEFKELAKRKNDNYVKMIQDVSPADVYPGILQLLKDLRSNKIKIALASASKNGPFLLERMNLTGYFDAIADPAEVAASKPAPDIFIAAAHAVGVAPSESIGLEDSQAGIQAIKDSGALPIGVGRPEDLGDDIVIVPDTSHYTLEFLKEVWLQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Isomerase
molecule keywords BETA-PHOSPHOGLUCOMUTASE
publication title Alpha-Fluorophosphonates Reveal How a Phosphomutase Conserves Transition State Conformation Over Hexose Recognition in its Two-Step Reaction.
pubmed doi rcsb
source organism Lactococcus lactis
total genus 79
structure length 218
sequence length 218
ec nomenclature ec 5.4.2.6: Beta-phosphoglucomutase.
pdb deposition date 2013-09-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00702 Hydrolase haloacid dehalogenase-like hydrolase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.240 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 Putative phosphatase; domain 2 4c4rA02
3.40.50.1000 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold HAD superfamily/HAD-like 4c4rA01
5AW8A 5A3SA 1K1EA 5ALVA 1ZJJA 4YH1A 3R4CA 1YNSA 1L7PA 4L6AA 3AR5A 4HGOA 5ALDA 2FI1A 3E8MA 5AW3A 5AKKA 4KNWA 1VJRA 1RPZA 2HI0A 5AI8A 3QUQA 5AI4A 1N9KA 5ALGA 3A1EA 3L0YA 3ESRA 3WKAA 3ZW7A 3QU4A 2OYCA 1L7NA 3L0BA 2HO4A 3L8GA 4C4SA 1ZRMA 4YCLA 3L0CA 1KYTA 4EELA 1SWVA 3NIWA 1YS9A 4CE6A 2IOFK 4RETA 2B1QA 4BKMA 3EPRA 4NABA 3N28A 3U19A 5T41A 1YMQA 4Y2TA 2ZBFA 2R8ZA 3WK8A 1S2OA 5ALEA 4JB3A 3UMBA 2HSZA 1XVIA 3FPBA 2WF9A 4UASA 2ZXEA 3L8EA 3ET4A 2YFYA 4DW8A 4ZEVA 3QU7A 2B8EA 3U7FB 4G63A 4OCZA 4Y2UA 3W5BA 3NRJA 1WVIA 2MU1A 5AIBA 4ZEWA 4CF5A 2FPSA 2C8KA 3QU9A 3A1CA 4UATA 2C9MA 2R8YA 2YMLA 3QYPA 1U2TA 4G9BA 2ZBGA 4Y3UA 2PKEA 4DWOA 2YY6A 3AR4A 2WFAA 2B0CA 4F71A 1ZOLA 5IT4A 1MH9A 3AR8A 4ZEXA 1FEZA 5AM2A 2EATA 4EENA 1Z4KA 1Z4JA 3E81A 4BYGA 1RLMA 5AI5A 4JDPA 2JGAA 4KNVA 4J2TA 5AW0A 1Z4QA 3DAOA 3WK5A 1SWWA 3QX7A 5AM1A 1CR6A 5ALLA 3M1YA 4YGYA 1RC8A 3AR3A 2GHTA 5IT0A 2OM6A 4HGPA 1TE2A 5FP0A 4XQ0A 2I55A 1L6RA 2GO7A 3FVVA 4F72A 3QU2A 3WKBA 3NALA 3IJ5A 5ALOA 3DV9A 3L7YA 1AQ6A 2R8XA 1EK1A 4HYTA 3F9RA 4BEVA 5AKGA 5AESA 3ZVNA 4FYPA 4HGQA 3TLMA 5AM5A 4Y2RA 1N8NA 5AICA 1Z5UA 3WK9A 4KX3A 2WHEA 4Y2YA 1U02A 3BWVA 5ALTA 4BEWA 5ALHA 5ALFA 5ALZA 1LVHA 2G08A 3PDWA 2WF6A 3W5AA 4UAUA 2GFHA 4NAVA 1WZCA 5A3QA 2W43A 4XPZA 4XE5A 2AMYA 3OCWA 2HX1A 1F5SA 2C88A 1J8DA 5AI6A 4UU1A 2FDRA 5AVTA 2OA0A 2HF7A 1Z4OA 3FPSA 1NRWA 3SLRA 4GXTA 4HGRA 3N8GA 5AM3A 3QXGA 1L8LA 5AHXA 1LTQA 4CF3A 4PNHA 5AW6A 5A3RA 5ALRA 4UM7A 3W5DA 5AK3A 3A1DA 2B8JA 3ZX4A 3S6JA 3ZX5A 1YV9A 5AW5A 1WPGA 4EX6A 2NO5A 3QUCA 2B1RA 3WK6A 3KZXA 3MN1A 2B82A 3I76A 2JARA 1Z5GA 2ZOSA 5AVSA 3QGMA 3B8EA 4BX2A 1PW5A 4UMEA 4BX0A 3A3YA 5AKEA 1Z4LA 4Y2PA 2B30A 2Q4RA 3L1UA 2IYEA 4L6CA 5AKYA 2HOQA 2FUEA 2JAUA 4FFDA 2YMQA 2WF7A 2BY4A 3QU5A 4GIBA 2CFTA 2MSNA 2BDEA 2EAUA 3N07A 5AK4A 4NWIA 1L8OA 4UM5A 5AI0A 1YJ5A 2I6XA 3MPOA 4DCCA 5AW4A 1EK2A 2R8EA 4OFZA 2PQ0A 1QQ7A 1RMQA 2Q5EA 3AR9A 3ESQA 3B9BA 3NANA 3ET5A 4IG4A 3WK7A 2YJ4A 5ALPA 3N5KA 4KX5A 2NO4A 1JUDA 1RQNA 2YMMA 1T5SA 2G80A 2FPRA 2FEAA 1U2SA 1Z4PX 1O03A 1Z4NA 1Q92A 2G0AA 2AGVA 3WKCA 4C4TA 2G06A 2JAOA 4UU0A 3U7HB 4MUMA 4UMDA 4UMFA 1Z88A 1S8OA 2QYHA 5AVVA 3DNPA 2I7DA 5E0OA 5ALYA 3HYCA 5ALXA 3SHQA 1J97A 3EF1A 3ZWDA 1Z4MA 3U13A 3ZTWA 5AI9A 3OCZA 2YN4A 4E88A 2IOFA 2HEGA 1WR8A 4BBJA 5AKHA 4QJBA 5AVXA 3L1VA 2YJ5A 2X4DA 5AW2A 2PR7A 2RBKA 2IA5A 4EX7A 4AP9A 3WGVA 1QQ6A 3MC1A 2C8LA 3OPXA 4UARA 2I34A 1TA0A 2P27A 4BNDA 1ZD3A 5AW1A 1NF2A 3MMZA 3E58A 2VKQA 4KYTA 3L8HA 5AIAA 3P96A 2OBBA 1TJ4A 2G07A 1RRCA 3QNMA 3PGLA 1RLOA 2CN1A 5AVUA 4UAVA 3K1ZA 4KN8A 3OCUA 2P9JA 3CZ4A 2WF5A 3KOOA 5ALUA 5AKJA 2MU2A 1XP5A 1L7OA 3SKXA 4YCMA 2ODAA 5AKZA 3AR2A 3WKEA 4UW9A 3QLEA 3RFUA 3KBBA 1XPJA 1CQZA 4BX3A 1SU4A 3DDHA 3ONNA 2G09A 2WF8A 2QLTA 3ZTYA 3I28A 2AH5A 5ALMA 5AVQA 5ALSA 4IFTA 5IS2A 1X42A 4B6JA 1QQ5A 4Y2XA 5AKXA 3ZVMA 5JJBA 2HCFA 3D6JA 3IRUA 2FPWA 3ZUPA 1VFPA 2P11A 4HAIA 1RKVA 2ZG6A 1ZD4A 1RKQA 4EEKA 1IWOA 4J03A 4I9FA 3WKDA 4OD0A 3BA6A 5AK5A 3OCYA 3J7TA 5AM4A 3WK4A 2CFSA 4Y2QA 2HF2A 4YIHA 5ALQA 3KC2A 3OCXA 4XOUA 3I1YA 3AR7A 3KD3A 2YMPA 4I9GA 2W4MA 4Y2JA 1RKUA 3SMVA 2DQSA 3I6BA 2YJ3A 4O8CA 4OHFA 3U7EB 5ALNA 3SD7A 3QUBA 2O9JA 2I33A 5AW9A 1NNLA 2FPUA 3L5KA 3EWIA 3FZQA 3U7GA 3PGVA 5ALIA 5ALKA 2RB5A 5AVWA 5ALJA 1RMYA 3FGOA 3SF0A 5AM0A 3WGUA 3E84A 3N1UA 4DFDA 3R9KA 3NAMA 2AUTA 1VJ5A 4AS3A 5AKIA 2G1AA 3U26A 1ZD2P 1TJ3A 4UMVA 3RF6A 5AVRA 4Y2VA 2W11A 2YBDA 5AVZA 3QUTA 3W5CA 1U7OA 4QQFA 1ZD5A 4C4RA 4HGNA 2GMWA 5AVYA 4CF4A 1YDFA 4AS2A 2D2VA 2YJ6A 3L8FA 2NYVA 5ALWA 4NV0A 1U7PA 2O2XA 2Q4TA 1RQLA 3ZVLA 3UMGA 1Y8AA 4RESA 3GYGA 2IOHA 1ZS9A 2RARA 3FM9A 1RLTA 1RMTA 2ZBEA 2GHQA 3ZWKA 3EF0A 3IB6A 1T9ZA 2CFRA 3PCTA 4H1WA 2FPXA 1QYIA 3KDPA 3UMCA 2ZBDA 4EZEA 3AR6A 2HDOA 3M9LA 1T5TA 2P69A 2EARA 3ED5A 1Q91A 2WM8A 3SKYA 3B9RA 2C4NA 1O08A 4NFLA 3NASA 3OTQA 4YIKA 3VAYA 4MWOA 1TJ5A 4FE3A 2HHLA 3NUQA 3R09A 4L57A 3HLTA 4CNQA 3OCVA 2FUCA 1L7MA 3ZU6A 3ZI4A 2JAWA 5AKLA 1QH9A 3UM9A 3CNHA 4BNDB 1RDFA 2BDUA 1ZRNA 4Y2SA 1Z4IA 2I54A 5AW7A 4YCNA 5AK6A 2RAVA
chains in the Genus database with same CATH superfamily
1MRNA 1E3QA 1KKUA 3G2PA 1U5BA 3HHEA 3NOQA 1ZEJA 4UEOA 2WJPA 2YQZA 4Q4HB 5CITA 4MV8A 4F56A 4NMHA 5EYPA 4EG1A 2A6PA 2XXBA 3KB8A 4YMMA 8ADHA 3GD7A 2W2PA 5LQRA 4JHLA 3AU9A 4G1VA 1QP0A 3K73O 3N28A 4A73A 4J1TA 1M1YB 3TQRA 3NT5A 5CUQA 4XUSA 3A6HA 4KAJA 3UMBA 1M6NA 1G291 3BFPA 2QF7A 2FZ4A 3C7AA 1F60A 5KJ6A 4OVKA 3TBFA 3HJRA 2FOIA 2ZRKA 3TAPA 4UTVA 2ZCVA 1XV5A 3V42A 4NEGA 4BO0A 1NWCA 1Z75A 1L7BA 4BGIA 4EA9A 5HS4A 1E1QD 1X2IA 1YJQA 3BRSA 5CVJA 2CLKB 1OPXA 1P2FA 1TXGA 4DLAA 4A92A 1GGMA 3ODPA 1SC3A 4O4HF 1RZ3A 2YNMD 1H2XA 2IV7A 1Z0UA 4LE0A 3CX8A 4HQRA 2QQ0A 2V3CC 4AMVA 2O3RA 4B6OA 2PQMA 3EIUA 3TN7A 1YR6A 5HZMA 1KH2A 4X62B 2NP6A 1IJEA 1G7SA 1KA9H 3A6LA 1YE8A 5CNIA 2RFLA 3L4JA 3EVAA 2PMZF 1DEOA 2ECKA 4EJSB 1UWVA 3B3JA 4IZHA 2I4IA 4PFQA 1SHLA 3MXOA 4EF4A 4MO2A 4PG6A 2PXIA 5E8JA 2DPYA 1BA3A 3CJTA 2R1TB 5A7HA 3UCFA 1M34A 2VVTA 1G6Q1 2K4IA 1S3SA 2XUQA 2BFBB 5KOHA 1PR1A 3RYCB 4RXTA 3VH3A 1YBMA 3LGSA 4AMGA 2ZWOA 5KKNB 5EZSA 3VR4A 5KIAA 1ZN7A 2IDZA 4A15A 1YO6A 2CC2A 4BDPA 4TXHA 1IHDA 5LA6A 3VC8A 3OM0A 4AMYA 1QYDA 2YMMA 3IVRA 3K70D 3LHSA 4D4MA 5GWXA 5DSXA 2EANA 1N3LA 4A8TA 5J2EA 2XA2A 1Z5OA 4JJ7A 1OXBB 4MHOA 3D2CA 1AQIA 3H0LB 1P1CA 3G0IA 3N0XA 3DLAA 3GFVA 2EG9A 4GPZA 3VNQA 2O1XA 2FSPA 4BNDA 4LF8B 2C5FA 3TR0A 3M9OB 4F5PA 2WG2A 4BRSA 1E5XA 2A19A 1JEYB 4RCVA 3ONWA 4EHDA 1RLOA 4KYUA 1IJKA 4KO1S 4CM7A 1ZQBA 1KDHA 2ZXIA 1KC1A 1WV0A 4QRHA 3PNPA 2ZTMA 5CYFA 4ENRA 4ZO8A 3IVXA 1XQYA 3QVVA 1FDWA 4URUR 2ODEA 5A4KA 2QSYA 2A1JB 5L45A 1Z0ZA 5I7AA 1FBNA 2QAGC 3EGVA 2FFQA 4J9LA 4RTPA 1UJBA 3HKEB 3O84A 4P80A 5IU6A 4R2JA 1NOJA 2ISCA 3WE7A 3EYZA 1RAEA 1W5FA 4GRIA 4JGIA 3H1TA 4MWBA 2B6GA 1EGAA 3H2HA 5KTOA 1UBRS 2G1AA 2JDID 3W5IA 4ZMRA 1P2BA 1Y89A 3NT2A 1QCYA 1JAXA 1GGJA 5JXIA 4QEZA 2G40A 2A9KA 3L7CA 3O93A 3CLTC 2QW1A 3ZVLA 4JZYA 1YL7A 1EFHA 4B3DA 2AOTB 3B70A 3CJRA 2ZVQX 4JVOA 1WF3A 2EWVA 1HK7A 5G1NA 4CLHA 3ROFA 2VYND 2HBKA 4NCBA 2VA2A 1Q91A 3F6EX 4F5OA 1HT2E 2JAQA 4PONA 2VYQA 4TS3A 2IHTA 4DLEA 3ORHA 3R9WA 5FWYA 5FB3A 1L3VA 1WCIA 2Q1TA 3TXAA 1FQOA 3DFFA 2VATA 1FFGA 5J4YA 3OZAA 2HQOA 4D25A 1YGYA 4K86A 5U4QA 5I5EA 4CIXA 3K96A 2XYPA 2EU8A 4QQNA 1J5PA 1NVBA 1ZJZA 1XTQA 3JTMA 2Z4RA 8ICBA 2HO5A 1G9XA 4UHEA 3AUSA 1RBMA 3QE9Y 3DE2X 1YMQA 2Q1YA 2X22A 2ZS7A 3E15A 1S1MA 4LDQA 1QP4A 3PMLA 1ESNA 2DRIA 1YASA 3RUAA 1WQ3A 1ISGA 1H8ED 2OAGA 1MOQA 4ZALA 2P2CA 5LLDA 3IS3A 4JI4B 5TQVA 1FO4A 4EGQA 2HVIA 5JV5A 4IRDA 3BZKA 3QFCA 4ES6A 3A11A 1MH9A 4DLKA 2NSHA 1UK6A 1J7KA 4J2TA 1YHYA 4MQ4A 5FUMA 2C29D 5CX1A 2PKWA 1USWA 4BBPA 2PAAA 4EKIA 5CHGA 2D2XA 3FHCB 4WSOA 1VI5A 5A0TA 3O83A 2XD4A 2YOGA 5I7VA 4MFCA 4J9MA 4KAFA 4J0FA 1J07A 1OGJA 2PH5A 3G0CA 4BWGA 1L4HA 2V54A 3WYFA 2IF0A 2BGIA 3DF9A 1NQ5A 2Y0PA 4FMCB 3STTA 2FLWA 4DL9A 3OMWA 2BLNA 3SDZA 4GX5A 1F6DA 2IVFA 4TKUB 1PHPA 2A88A 3C4QA 3NVWA 1OLUA 4UNSA 4YNBA 3SXPA 1V9CA 1HURA 3GF4A 3D6AA 2PFKA 2ZDHA 5CGZA 3OJLA 8ATCA 1GGFA 2H3QA 3QGMA 2C2HA 1ZN9A 3V55A 4NNJA 2BHNA 4D3XA 5C32A 3ITDA 3BGIA 5B53A 2BY4A 3FF1A 2EL9A 4MEYA 4DR7B 1IMJA 2AHOA 1KC3A 3ENWA 4AZWA 4LZNA 3PJGA 2R8EA 3QG1A 3TRHA 3S5JA 1QQ7A 4JV0A 2IYYA 4FBTA 4O4LB 2E3JA 1R8YA 5CLLA 4YASA 3R7SA 2XUFA 2COUA 4DL6A 4CKEB 3A6PC 5JD6A 1S8OA 3BXXA 3WWYA 1A7JA 1PN3A 1X7DA 4KO4S 1LX6A 3KWLA 4PAQA 3RS2A 3OTHA 2H5LA 5HG0A 4PIPA 5JQGA 5LQKA 1V9PA 3O8QA 3WLTA 4TMVA 4YALA 2KM1A 2H0AA 2DM6A 2V7PA 3AB3A 2YR0A 2FRDC 3KOOA 3TJRA 5L1IA 2ZPTX 5TNXA 3SSOA 2LHTA 2DF4B 3U4CA 3RASA 1UPAA 2UZ1B 4Z3KA 3RHZA 1ZQOA 5EGNA 1E4YA 2JIZD 4Q7LA 1SXHA 4EBCA 4MVWA 4N0MA 4E13A 3FDZB 3LVRE 3WK4A 3BZWA 4Z7NB 1Z0FA 2ZAGA 3KC2A 2NQ8A 1DIAA 4A82A 4PG8A 1VXOA 2VKTA 5J2JA 3VR6D 1LNQA 3CKLA 4LXUA 4K6CA 2ZVDA 1ZUD1 2JLYA 1UP7A 2GJ8A 2NXWA 4FOLA 4AD8A 2QMQA 4EHLA 2L69A 4PZYA 3V4ZA 4XWKA 3AQFA 3EGXB 1E1CB 4EF5A 4RSGA 1EK6A 1FP1D 3WAKA 2HNAA 1VPWA 3CNLA 3OHBA 1GP2A 4JUFA 3CVVA 3TFQA 4ZQIA 1E79A 1SK9A 3FIUA 3GT0A 4TS1A 4YV2A 3A7EA 2VDJA 1Z25A 2WB2A 2QUKA 3H2IA 1RQ2A 1S8FA 4H7JA 2IHUA 4Q9KA 1BDIA 2K4PA 5CD9A 1NJ1A 3L0SA 5IJ9A 4LBYA 2EH9A 5BV0A 4IW3B 4RK4A 1ZC3A 4DXHA 4O2AB 2PJUA 2IY7A 3K9FC 3WZMA 4FFLA 2Y1CA 3QUAA 1WXFA 3R7FA 3F90A 3SN6A 2JGDB 3WB2A 1U0OC 3AONB 5DYNA 3B6IA 1GYRA 3F2VA 1YAHA 1JFLA 3V4OA 4RETA 3G23A 4LRTB 2RD2A 4YT5A 2XUAA 4J0EA 4KR7A 4QFBA 2EZ8A 2VSNA 1XVIA 5FOXA 1TKCA 1K5HA 1E1RD 4ARAA 1O94D 1BOFA 1L5LA 1RJ9A 1RJDA 1GL6A 5HUQA 2Z6VA 5KFFA 4EECA 2QTLA 4HYEA 4L76A 1S01A 2XYVA 1PUIA 4KXUA 5ENDA 4CKWB 5A5DA 1QQTA 2EATA 1SC6A 3ACBA 5LXTF 1CRQA 3WL6A 1UXGA 9ICQA 1CJKC 3M34A 5JALA 5TEVA 2KJQA 4Q8FA 1G41A 3U4DA 4HLUA 2ZIWA 2RGWA 3Q8MA 3R5JA 2R8XA 1M73E 2BF7A 1JU9A 4EZIA 3H6KA 5JWOA 2GUGA 1MB9A 1ONPA 5AVOA 3F6YA 4PWYA 5FNVA 5JY1A 3V7WA 3T3PB 2QROA 1IB0A 2A1UB 5JNWA 2GN9A 4DXDA 3K0CC 1EFVA 2YVUA 4DSLA 5F2OA 1CQJB 3QTTA 3CC8A 5SV2A 3B8EA 5TT1A 4O5KA 1T10A 4LJ4A 1QHYA 5H3HA 5EJ9A 2ZIUA 5DM1A 4QLBA 3L8CA 5K0GA 3NO4A 1L3CA 2JG3A 1XQ6A 4AZ3B 5AI0A 2CY0A 4NTZA 1MA0A 2GEKA 4OFZA 4Q9IA 5LLSA 2ATIA 3T9BA 1I6WA 4RIFA 1T5SA 1CKEA 3RS8A 5CEJA 4I3FA 3OPNA 1GAEO 4IJQA 1NZFA 5KFZA 1HFEL 2XO7A 1D5WA 3MOGA 1H9CA 3G6YA 4NLGA 3MS7A 5GPBA 4LRXA 1PZNA 5I9LA 3LBFA 2IA5A 4K9OA 4KXQA 2DY1A 3RAPR 1HE4A 3NYIA 2ZWVA 2BCSA 4YRGA 4S04A 2Y2UA 3MDCA 2E9SA 1XCLA 5AXBA 2V7BA 1KR5A 2O20A 1KAHA 4R8LA 1RRCA 2O2HA 5H16A 2X9GA 1X3SA 3FAZA 3I39X 5DMXA 1LWOA 3CZ4A 2C31A 1PTJA 1S77D 3UKJA 5BYKA 2CL5A 1SU4A 2WK1A 2DPHA 3CTPA 1P5FA 4ZRDA 1A4XA 3AM5A 4H77A 3WSVA 1I2AA 2PVPA 5FO0A 2ZG6A 5FCDA 3F5DA 3C8MA 2E4ZA 3ZK7A 3FKSA 1I9GA 3OCYA 3J7TA 4F4CA 3K35A 2AWOA 1ITZA 2OQ2A 4Q6BA 2ZWIA 4TKMA 4CQJA 3PEUA 2MSDB 3HMQA 3VOSA 5ALNA 3QUBA 2Q4EA 5AW9A 3D81A 3AESA 4JI5B 1RHJA 5HPYB 1Y4ZA 4MHSA 1GTG1 2Y1GA 2B3TA 3SNHA 3R75A 3EWSA 3QEKA 1QTIA 3CUWA 1IY0A 1EP9A 3P97A 1RYSA 4BDTA 5KT4A 1W4ZA 3QXHA 1N8SA 1DMRA 4YI5A 8ICSA 4I4CA 1DTEA 3UYKA 3CW8X 3DPIA 2V1XA 3I8SA 2OHFA 4D45A 5I9SA 3COWA 2Y66A 3ZOKA 1FXWF 3EMKA 1DOQA 3EZ5A 1Z45A 4B87A 2G76A 4UC0A 4D97A 4FHFA 3HNOA 1YZFA 3TD6A 1XZBA 4XQ9A 3B36A 4DDHA 1IWPB 4JYCA 1FIUA 4Z1MD 4PGMA 1FJHA 1UKAA 1YBVA 1T3GA 1QRDA 2XY5A 4LGYA 1VJRA 2HLNA 4AY3A 4DG5A 1V38A 3ZJUA 1J8VA 4FUTA 7ICQA 3QBEA 2C0QA 1E1DA 1X1BA 2VTBB 1SRRA 3DVAB 3LIIA 4BQRA 3UXOA 4CMIB 3BJRA 5AUNB 1OB5A 1GGKA 4E12A 1D9ZA 4EKGA 1EVQA 2IJGX 1MDFA 2INGX 4GMGA 5J4VA 3RC3A 1V5EA 5LQCA 2WWXA 4TM7A 4HBGA 8ICOA 1W9HA 1PK3A 1E6LA 3OIGA 2JLVA 4BKPA 5J2CA 3E48A 3R23A 4HAVA 1Z07A 3SX2A 5B37A 1BFKA 2H8KA 3F5FA 4EEZA 4PGFA 3MTEA 4PBSA 5AHOA 3KQUA 2V59A 3WQRA 2IU3A 1ZUHA 2CJFA 3IV7A 1JDTA 3PQ2A 1TUBB 3QHAA 1YHNA 2WWRA 4F71A 4FR0A 2XKKA 5AI5A 4DT1A 5K0CA 1F38A 3NCHA 2DTXA 2DHDA 4FDUA 4EB6B 1I4TD 3QU2A 3ZD8A 4HQKA 4W1PA 2KHVA 2OV8A 4KLTA 4HYTA 4BEVA 4HMOA 3U39A 5FBQB 3UUGA 3H2JA 2H1LA 2AMYA 1W5EA 4DF3A 5DBEX 3RTDA 4WN3A 3C3PA 1COOA 1D0VA 3D6FA 1VZ2A 1X40A 5ELMA 3ZWAA 3ETJA 3ZWNA 4I2FA 5CFMA 2WNHA 1U0LA 2HXSA 1C7YA 1ZINA 4O63O 2PPVA 2HU2A 3P8ZA 4B34A 3ZLVA 5JZSA 4NRDA 2J4DA 3I64A 2H4XA 4WZAA 2QLFA 4MRMB 1M5TA 1SCUA 5DRTA 1OFHA 3FJYA 4UCWA 5KFIA 2DQNB 1XCMA 3NANA 2IGBA 4HLNA 1CUUA 2Q2QA 4TKZA 3N7AA 2VEOA 3GJQA 1DQSA 3FCEA 4MEBA 1NSTA 1OQAA 1NFQA 5J1SB 3U13A 4LZDA 2HEGA 3OSNA 2DZDA 1K5PA 1XRQA 4LBZA 2BI8A 5E3JA 2FP4A 1ZMBA 3A6GA 3FNHA 2BISA 1DG9A 3DTVA 1TYZA 4BX8A 5C51B 1R6DA 4LF4B 5EHQA 1CUIA 1WD7A 2QB5A 2OZPA 3LHFA 3MHPA 5BVHB 4UUAA 5BMOA 3MTDA 4CLDA 4J4TA 1YZYA 1KBUA 1XWIA 4XM0A 3UMYA 4GYWA 1SG6A 1YR1A 3A4NA 1GPKA 3KLOA 5AKXA 2O7RA 1H1TA 2GESA 1YKFA 4BZXA 1Y3HA 1CS0A 4DV6B 1U3FA 3PTLA 4HB0A 1XXHE 3B6MA 2WMNB 3MFQA 2RAFA 2VRNA 4PY2A 4OQMA 1PFYA 1FX0A 2WHRA 1KZGB 4DKJA 1OTYA 1R2QA 4N82A 1JQBA 1BS1A 2ZJ4A 4J0DA 1B0UA 9GPBA 4IAOA 1NNUA 1FYVA 2PIDA 1TD1A 1Q3KA 5CT5A 1X9IA 5FJIA 4NOKA 5B30A 1GTVA 1D1TA 5KO2A 2P1RA 4FN5A 4AUKA 3ZBUA 3V9PA 5L51A 3JQAB 2WZQA 3MT9A 1GFWA 4BNTA 5KYWA 1JX6A 4MGKR 2QP4A 2GB4A 1UMDB 1ESMA 2GZDA 4I55A 1J90A 1RPNA 1VBKA 1G2OA 2C4NA 2P0YA 1VGQA 1T4CB 5KNDD 4FDLA 5JTIA 3A1UA 2AXTU 3NIFB 3SYRA 1P33A 4HBZA 5F9MA 2EZXA 3GEIA 3RNLA 4CMJA 3SC4A 4OREX 1PZEA 3T4UA 1QFMA 4XWYA 4N8DA 1DMSA 2CNDA 4GKVA 4YQZA 5BYAA 1KH3A 4CIWA 2XMGA 3SXUB 4KZKA 3MRSA 1TADA 3ZW7A 4DMGA 4A1OA 2NNLD 3ETDA 2O3SA 4XGNA 3SS9X 1ST3A 1QP8A 1Z2CA 4LK3A 2B1QA 3ABRB 4DB2A 3EF3A 2M6KA 2ZRIA 3RU9A 3H05A 2IZ5A 3ON5A 3VZCA 3B2QA 3WYNA 1YA8A 2PSHA 4DXAA 1B8VA 3JS5A 4TQ9A 4WEQA 1NT2A 1N5MA 4V03A 4EABA 2YMLA 1Y8RB 4WEOA 1V96A 3B1VA 3O0TA 2RH5A 3DHYA 4QO8A 2WIGA 2C2KA 2QL7A 2P8JA 3RC7A 3ETLA 1U63A 2KHQA 4JJEA 1M10A 3JQFA 5E1DA 3PGKA 4JNCA 1Z6ZA 1MHTA 2H6EA 2O1WA 1VKHA 2PLAA 4FYWA 3R3YA 3UHJA 2Q5IA 1AKNA 1KN5A 4KX3A 3K5WA 2ZJ2A 1I14A 4BOYA 1QK3A 1N56A 1NQXA 2F3TA 2VJNA 3EXFB 1WZCA 1L5RA 4B9SA 2O3TA 3EEQA 4Y1GA 3V97A 3DJFA 2H4HA 4W1RA 2X0KA 3ROGA 4MS4A 2QRLA 1PVQA 1YZVA 2Q5FA 4PLGA 4L22A 5KC9A 3EZLA 2A5LA 3CH4B 2HU8A 5BYJA 1SKWA 2V7TA 5E2BA 5FL7D 1ZN2A 1JSCA 3MUOA 1F0KA 1NOMA 3BF7A 4OK6A 1I4OA 5L40A 1GU7A 1H2BA 1V7PC 2GPSA 5K0TA 2B30A 3R9XA 2ORIA 3N2KB 4PICA 1LS1A 4E2FA 1ID8A 4EB3A 3TNJA 2HAEA 2WSSD 4MIEA 3PJRA 3I5AA 3HO1A 1QM5A 1KSPA 1V3TA 1Z4NA 1WCV1 4R40A 1F2TB 3U7JA 4ARCA 2W42A 2JAOA 3QM1A 3DNPA 3QKRA 3H18A 1OJLA 3BTSA 1OH6A 2BKEA 3MOIA 4KLQA 5LP6C 4QJBA 4F8JA 4F9EA 4B6SA 1ZOOA 3M81A 1NI4B 3AK4A 3RI3A 1XJ5A 4UPDA 4V1CB 3CT6A 4G1EB 5CJ2A 3D0QA 1T9GR 4PLCA 4BGUA 4MYUA 1M8JA 4NLCA 1YVPA 1R64A 1NNEA 5JZOA 4I50F 4FX5A 2CPRA 3CINA 3UXPA 2J5QA 2I62A 4XSHA 3HLKA 1DCFA 1ISRA 2CVQA 3S1LA 1CUYA 2MR6A 4XSVA 4E6EA 2VNAA 3CZPA 1AGYA 3GPDG 2FX3A 3BXZA 3GUUA 2ZTDA 2JVIA 4WJKB 2NXNA 1XRPA 3VC2A 1WBBA 1JSZA 1MZPA 1JWBB 4F0JA 2VP0A 4Z6EA 4TTIA 1S2NA 3AH8A 2G17A 2ZTVA 4B48A 4E2YA 3B13B 4BQNA 3C4VA 1HETA 4BNUA 1PI3A 2P9EA 3FW1A 4IGKA 2OK8A 3WGUA 4ODIA 3O8CA 2XGOA 1YB7A 2XCRB 4WESA 2CXQA 3IDSA 2MR5A 3PR2B 3D7MA 3AF0A 3S28A 5LKRA 5JNVA 4HVLA 1U0GA 4HGNA 5HTOA 5AVYA 4BP3A 2OFWA 1YR9A 1T8PA 1SD2A 1U7UA 1E4EB 2H3EA 4G4SO 3PQFA 1H66A 5C31A 3R5KA 2XYHA 4OLFA 1JFFB 4M86A 5ITSA 5IAAA 4HDCA 1HV8A 4ALKA 1I7QB 3TVDA 2PX6A 4OG2A 1XQVA 1PJ4A 4JU9A 2DJIA 4EUSA 1T5BA 4I4TB 3AEUA 2UZ4A 1V25A 2JAWA 4G65A 4UVHA 2PN1A 3T15A 1DBPA 5DX8A 1G18A 9ICUA 4CDMA 1Q1ZA 5A3SA 2JHFA 4IGEA 2WU1A 2OXCA 1SOUA 3OZFA 2G1PA 2P30A 4ZEOA 2HIAA 3LRXA 3T3MB 1W19A 3OQ6A 3IDQA 2ZDGA 3O8OA 2GO1A 2FR8A 3DQZA 4AWAA 4A5OA 2FWBA 3HRDD 1XKXA 2HGZA 2LGJA 2RHDA 4L08A 5CDUA 1ZQIA 1F0PA 1B0ZA 3WJAA 5IYZF 1ZZEA 3EK2A 3STXA 3DE6X 3PX0A 2AJCA 5C1DA 1C7QA 2RGCA 5J2IA 1BPDA 4GR4A 5CBPB 7ICOA 3L8EA 1GITA 2Z3VA 4X6UA 2A5YB 1R5OA 4TQAA 3SJUA 2EYUA 4HN9A 3OTGA 4X8MA 3ZDFA 4V3BA 2P79A 2E5SA 4XCXA 3TQHA 3DZ8A 3I30X 4I6JA 3VPAA 4MV0A 4NCIA 2Q27A 4NBNA 5K0LA 3KD2A 1LZKA 2FSUA 1ZOSA 2DFPA 1Y4DE 3PNVA 4JQCA 4DV1B 1MRZA 1H2YA 1KEEB 1J2JA 3G68A 3EZFA 1WQ4A 3PC3A 2QLJA 2VTDA 4NKRA 1JFVA 4IIBA 2H4ZA 1AS2A 5KQSA 3KOZA 1H42A 3TOCA 2G8NA 3EG9A 3I2KA 9ICCA 1KMQA 2P5TB 3REQB 2WMOB 4DC9A 3GGPA 2Q3EA 5ILOA 1OVGA 2R1UA 1UDAA 5ICFA 1GJRA 4C7KA 1LLDA 2Y68A 1QF9A 3C1UA 1DDGA 3TG2A 3K3PA 3NFRA 1Z82A 3P2MA 2H51A 4YJ3F 1C1DA 4OQYA 3QUCA 4CM5A 3JCZA 4Q8EA 2PI5A 4CHGA 1X1AA 3GCGA 4IRCA 2XQVA 2XUOA 4RAOA 3P20A 3MJCA 1P81A 3DZIA 3AF5A 2PMBA 3V9AA 4YRBA 4R0MA 2EQAA 2RDMA 3KYJB 3MPOA 3L9XA 1HNWB 1ZHOA 3ET5A 2PD6A 2HWUA 4PYIA 3ITNA 4DCMA 9ICWA 3VUEA 5ERXA 1BN7A 2A33A 3NI2A 2EKBA 1TV9A 3P0HA 4AF6A 4XD7D 3LA8A 4XR4A 5DFAA 3VHQA 4OMFG 3KPVA 3E1KA 3PFBA 1U4OA 4LJRA 1A88A 1GZVA 4IMPA 3L0OA 3B8HA 3H86A 3RFVA 4QG7A 2A92A 2FKNA 3CUEF 2KG5A 3PPWA 5K0SA 1CP3A 4JI0B 4HNHA 1JKXA 3DEIA 4HV4A 4Q1CA 3DE4X 4RGYA 3OIFA 2W9BB 1VBMA 3MPUA 4RZRA 4KVZA 4EG4A 4Z2YA 2NO6A 3VRHA 4RZXA 4M7RA 2VDUE 4N0EA 3IRUA 4XKJA 1WHTB 3T34A 2G9RA 2FWRA 3ILHA 2OCDA 3QELA 5IVHA 2OCGA 3HYTA 1IG3A 2ZM6B 4RO0A 3PQ5A 4EPRA 4B45A 4QTYA 1EX9A 3PI6A 1BAPA 3VKWA 1L5NA 5FBHA 4FPXA 1J49A 4UMVA 3EH2A 4DCVA 2W11A 4Q18A 1BNOA 3QE4A 3CVYA 1OYWA 1UJ4A 1T25A 2VHTA 1UBEA 4MA4A 2X3FA 4ZC1A 5K0ZA 3EPLA 1UAYA 2PKXA 1B8PA 3VR1A 2G70A 4RC9A 3SENA 2IBKA 2R4QA 2JFXA 3D9QX 3GUCA 4UBIA 5JBIA 3EF0A 4U5XA 3U0VA 5FI5A 2ZK7A 1P4AA 1TEHA 3L07A 4U3JB 1T94A 4QUJA 5CHYA 3FLAA 4TUYB 2X4IA 3CNOA 5FQOA 3JD1A 2VTVA 1SC9A 2M6SA 2XTNA 3A0UA 3CLSD 1XKLA 2FR1A 2RAVA 3L9WA 3JQBC 1TLLA 3JYNA 1W0JA 7ICLA 2J9YB 4X0EA 2ZYAA 2FU5C 2E89A 3VR4D 1E4VA 4P58A 3V1LA 2X0DA 1Q7BA 2PMWB 1TK9A 2RK6A 3DHNA 2I03A 4OL0A 2G7ZA 1TQ4A 1FF9A 4CRXA 4E4RA 4RJKA 3KUUA 1Q0SA 4MJXA 4UOQA 3I62A 3C29A 2O52A 3UB2A 2R7MA 3BOSA 2UYYA 1F51E 4J07A 1H6AA 3QPAA 4QVKA 7ICFA 4C7ZA 3W5BA 1WVIA 1EFUA 3P9XA 3QVWA 1NLMA 3F2DA 2D2IA 3ZGXA 2QGZA 3JQ9A 5HBRA 1PWYE 4X5OA 2OCLA 4X1KA 2R25B 2VC2B 2V7XA 1TGYA 2RHMA 3GXOA 2VXCA 5C8YA 4K9NA 5J63A 3EN0A 2Y6VA 5DWQA 1I10A 2GJSA 4KLHA 1WPXA 3IDFA 1A9RA 5MFPA 1E3MA 1IZ9A 1EJ2A 2GHTA 5DZSA 3DZHA 4B84A 4R84A 2WYIA 2QARA 3F4KA 4IIJF 2BRUA 1DC3A 1PK7A 3X44A 2WJVA 4BPRA 1AXEA 4F11A 5B6IA 4ALLA 2K4HA 1JHVA 2CFOA 4NARA 4EITA 2A5JA 3KVRA 5LBTA 1VG0B 1UOEA 3U4QA 1KBQA 1IAQA 2W71A 2C03A 3K9WA 2J48A 4PCVA 4MUXA 5JJKA 4HOYA 3UOAB 1Q1NA 4EVRA 2UVVA 4LBWA 4W7HA 1TM1E 5KQGA 2H8GA 4FNMA 2OGWA 2EXXA 4AP6A 2HQSA 4RD3A 2B99A 5LN1A 2ATVA 3W2HA 2J9GA 2XUIA 2QN7A 5F23A 4OYYA 1CV2A 2KJ5A 4NSNA 1TTHA 1H38A 3FI9A 5EP4A 4MWDA 2DKNA 2Y0BA 3PC7A 3DAFA 1L9XA 1WULS 3T4PA 3G8CA 3SS8A 5JZ9A 3BFJA 4XPIB 4Q4JA 1QS0A 2RHJA 1T2UA 3KR1A 3V6HA 4D96A 4CEIB 5CNKA 1DQZA 4EGFA 1S89A 4X95A 4HEA6 2IH4A 3LKBA 1SVMA 1B74A 3ISCA 1IOLA 4BRWA 1PBNA 1DOHA 1TOAA 2WG0A 2Q3CA 4O02B 1TM4E 4LF6B 3GR6A 1OH7A 3E9ZA 3UMFA 3IIEA 4OYLA 1RVDA 4KQ9A 2FMFA 3CT4A 3LK7A 3OZDA 1YRWA 4YAWA 4DTCA 1R0SA 3L8HA 4YP7A 4QELA 2WSMA 1FFXB 3EDQA 4AFNA 1CRZA 4RTOA 1W5TA 1EINA 4HUTA 2WZCA 4IQGA 5FHRA 3H11A 1PK1A 2OB1A 3RG8A 3HKBB 1ZQTA 2AXNA 3QPVA 5IS2A 1X42A 2QMEA 3ZHOA 3WAGA 1CSEE 2IUFA 3L8MA 3UT5A 4I1OA 4ZJYA 3E7FA 3UVEA 3C8UA 9ABPA 1UKBA 4PQFA 3L02A 1DCTA 2H00A 1TQHA 2PH1A 3GG9A 3AVPA 4KR9A 2AKYA 5LQJA 3SIPA 1TQ2A 1YKSA 1HYHA 2VCHA 2UXDB 4G9GA 4DCPA 2K7ZA 3ECAA 5JI3E 3U3OA 2KIVA 1QMGA 1W9MA 1SKAA 5CB4F 2BKUA 4DREA 4O3PA 4BP8A 4EKNB 3KHGA 1XYGA 3NT4A 5LDGA 3OGUA 1EQUA 4BE9A 2HREA 3WLEA 1KAGA 2F1OA 5COQA 1O5OA 2JIBA 3CCBA 3HA2A 3NGXA 3OOJA 4D92A 1B8UA 2XBLA 4XX0B 5EXEA 4H3HB 4QU8A 1C8LA 4JITA 2F4VB 2PH7A 3T79A 5EZYF 1FTGA 3NAQA 4LN1A 2PWBA 4DSKA 1JG2A 2GILA 1YVRA 2CFRA 2J6UA 2W2KB 3KDPA 4AN4A 2QM0A 4OH1A 2RIPA 4JODA 1N2XA 4IYJA 4S1TA 1BMFD 1ZGZA 3B53X 3HBAA 4QZIA 1GUYA 5MHTA 2XE8A 1NMXA 3GRUA 3H8WA 5KFCA 2IQ5A 1FFHA 5C5JA 4GMDA 1J70A 1FS5A 2WD7B 1Z4IA 4QA9A 4QOHA 5JO9A 2HFJA 1OFTA 1IEVA 4PL2A 3RRNA 1J33A 2FJ6A 5GGXA 4J9PA 2AFVA 2PU5A 5FD8A 4FQ5A 3TINA 4QNRA 3OP1A 5J4KA 4KLOA 4QFCA 4OJ6A 1GXSA 4UNQA 1Z19A 2QDXA 2VJLA 3CVJA 4CKCB 1NM5A 4AZVA 4QXOA 1JPNA 1AK2A 4C0BA 4TMZA 4JP8A 3QVLA 1W4RA 1IMOA 1Y48E 4DJFC 4M1ZA 1UZNA 5K3BA 1LSJA 5GV7A 1NBMA 3OOYA 3SIWA 2NU6A 2FWAA 3I73A 4RIGA 5JCJA 4M1QA 3LXXA 1I4WA 5CM8B 3RVOA 3MJVA 4MYHA 2XA9A 4UE3S 1E2MA 3A1WA 3N76A 1UBUS 4GI2A 4RKFA 3JASB 4TL8A 1E2DA 5LDDC 1ZQFA 4D42A 1TUIA 4M9SA 2OPHA 3M1LA 3DDZX 1W35A 3OLVA 3QUSA 1EXMA 4DN6A 4IDEA 3ZDCA 1NASA 2XYRA 1KQNA 3NETA 4J90A 1XQWA 4R2LA 1C9NA 3JZFA 1H8HA 1EBUA 3G0GA 1BEZA 1KJZA 2A94A 3NWEA 2ATLA 2FETA 4NU8X 5FV7A 4C0HA 1T2EA 2IP4A 1RBQA 3GJ3A 2W43A 2ZIXA 2J6TA 1MX3A 4QE3A 5JC1A 1G0OA 1T5OA 1JJVA 5BSKA 1NUAA 3AV0B 4R2WA 2K8BB 4XVQA 5ALRA 3IOCA 3WLJA 5AK3A 2P90A 2DTDA 2C95A 2GXQA 1Y9EA 4LHWA 2Y9PB 2V55B 2V74B 2GCOA 2XZTA 4LHXA 2BDPA 1XROA 3D3WB 2QAIA 1CEEA 1E7YA 4UBKA 1V5FA 2X8JB 4F3YA 4DV2B 1MO4A 1E79D 4RKRA 1NHWA 1NXPA 5REQA 4YP6A 3K9NA 4PXYA 3GN1A 3W06A 5DX1A 1A96A 1KYYA 5JDCC 2PJRA 1RC1A 3TW8A 2YB1A 1PDOA 1IK4A 3Q6NA 3A1NA 3SHWA 2D1TA 1J97A 4YRKA 2IOFA 1VRVA 2RG7A 3CO5A 4PS1A 2C20A 5E6RB 4M9XA 1KOFA 3D2NA 3ESZA 1JB1A 2EFCB 2VHXA 3SYMA 4K9SA 4BNGA 1NXWA 3PSIA 4JJ6A 2DLCX 2PKRA 4QW8A 8ICJA 1QFZA 5DQGA 1NTRA 3FTEA 8ICKA 2QSJA 5JADA 4KN8A 3DTYA 3UJDA 4EPVA 5JC8A 1SFRA 5LP6F 1UMCA 2OC9A 1JF8A 2OV1A 3M3DA 1MQ3A 1MZVA 3KYDB 3LQ1A 5C3MA 2NOAA 5AVQA 3BQ0A 5CEEA 1CUFA 3G2HA 4B6PA 2G25A 4BO4A 2UYQA 3T5TA 4GRDA 4JQSA 4H1HA 4R5MA 2QBYB 1YRHA 5EIXA 2FG7C 1JVBA 3HKDB 3N2LA 2AG0A 3M9WA 4GLXA 1U48A 1D2NA 3ZCXA 4BMXA 5T4EA 3U6BA 3V6JA 4KR0A 1USGA 2FW7A 1EFDN 4W9NC 4LHEA 3BEDA 4GX1A 4JR0A 5THKA 1J42A 3O1HB 5H7XA 3TZKA 4BGEA 5KFYA 3HVHA 3RJGA 1U0SY 1NXTA 2B7CA 3DLTA 4IDOA 3MWGA 1SXIA 1R9JA 1MOZA 1QB7A 5A9RA 1XZGA 5BSVA 2DWUA 1RPAA 5P8WA 4GXJA 2O5CA 3PT5A 1RRPA 4ZOQI 2JFYA 1QRUA 4O3QA 2Z4TA 5FFFA 1SVLA 2RH4A 3N5CA 3TIGA 5DM60 4YQFA 5JZVA 5JAZA 3ED5A 4PHDA 2WM8A 1Q57A 4G86A 1O5TA 3ZEAA 1H0HA 1X87A 1GN8A 1IAVA 2E4YA 1BVRA 3LPCA 3NAZA 1OI4A 3MDAA 4Q4LA 3KLNA 4TS4A 3I01A 2JD0A 3ANXA 3GGGA 4XOIA 2WKPA 5A4DA 1K6XA 1J24A 4GW3A 3AL2A 1G20E 4RU9A 1P4RA 4LS3A 4C0AC 1XTJA 4P4LA 3SR6A 3I0NA 5KYKA 5LYJF 1NP7A 5ICCA 1QHNA 4GECA 1G8KA 4BE7B 2X8AA 2AD1A 5BSRA 3AF4A 2VK2A 1MIOA 4I9UA 4FZVA 5BRAA 3HS3A 2EW2A 1QIGA 1MQ9A 4G5YA 2OYCA 1N9GB 2CXYA 1UOPA 3WRVA 4HPWA 2FFJA 4IM7A 1C7FA 1HSZA 1VJTA 4R1NA 4JJ4A 2WE8A 4BRZA 1Q7GA 2CXSA 4KNYA 1MX1A 2PUVA 3WSWA 1XD2B 3ZKWA 2ZXEA 1ZQGA 3H4BA 3LVVA 4P0QA 4GO1A 1MX5A 1JLLB 2PD4A 3WRYC 5AIBA 3TQQA 4IBOA 2ZEJA 3B1KA 4R6XA 4DS3A 1RP7A 4ZH4A 2C77A 3WWEA 2E49A 1T35A 4YLGA 4ECWA 3ESAA 4F5EA 3KXLA 2F00A 4Y6SA 1X66A 1F14A 5M04A 2NPOA 1VIYA 2AFHE 2I78A 1JG4A 2C94A 3FPKA 2X8WA 1Z08A 3IMFA 5D3KA 2W54A 1C3OB 4Q1AA 3DCIA 7ICVA 4CCHA 1OYYA 2X4LA 1I2MA 2WVHA 3QE0A 1DXYA 3A4VA 3CUUA 3GT3A 4K6KA 4GOLD 3NC1C 2C7PA 4JWKA 1YU6A 3DL7A 3FKSD 4CIDA 4BY9E 3N74A 1SC1A 4I4IA 1MD9A 1SZDA 4FZ5A 3UQ0A 3DZKA 4GSLA 1CZRA 1QFJA 4RM2A 3L0ZA 1MENA 5DO9A 4HGRA 3OZVA 2ZATA 3GDOA 2EJVA 3R6WA 3DQQA 3H84A 4DSFA 2NZUG 1EEHA 4MUIA 4BV2A 1O6CA 4M83A 1CJCA 5KFSA 1KO5A 2GBLC 5C8ZA 2O6HA 3VJMA 2AE1A 1NPTO 2R48A 3K9LA 4FXOA 2REQA 3Q0TA 4GR9A 3T6KA 2H4YA 4MSUA 3MWDB 3ZBTA 2VQFB 1WCNA 3BGOS 2QI9F 2YN2A 2Y0EA 4JFRA 3S5UA 4EO9A 4XUDA 2Q5EA 5TGTA 4ENVA 1CD5A 3W5VA 3MSXA 1DRVA 1XWWA 3T3FA 1GAXA 5B55A 5EESA 4HNSA 4EEYA 1K75A 2OOKA 5B4UA 2CHFA 3PX2A 2RGNC 3CRNA 4KH0A 5GONB 4ZOLA 1TM5E 1AOXA 1TO1E 1L7RA 1OXKB 1C3LA 3X1JA 4A36A 4RTMA 2JCSA 2C3OA 3T35A 1G1MA 3OBIA 4QPJC 2ZSEA 5CLGA 4BJ5A 4BASA 4OXYA 4YFKA 1TJPB 3K9GA 3ETEA 1MJGA 4BFCA 4B9LA 1Z47A 3AR2A 2PRKA 1VFNA 1Z68A 2QLTA 3RR8A 3I28A 3THXB 1M1UA 2ZJYA 3PNKA 4BE4A 1JJIA 4L0QA 3CCCA 4YRFA 3HX0A 1VPLA 4CQMB 3WKDA 4LMAA 2Y0SC 3M7DA 4DRXA 2ILTA 1N3BA 3BJIC 3B89A 2VOEA 5E3HA 4TZ6A 3JAWB 2OBNA 2FPUA 2HUPA 1KEWA 4F1WA 5AVWA 3HVJA 3HR4A 5AM0A 5JG7A 3LRTA 4F4WA 2MRLA 1K9VF 4B3JA 4PG5A 4DFKA 1FFYA 4RNOA 4U7FA 5TMPA 2J5XA 4UZFA 3TIFA 5TQ2B 4QU0A 2WG1A 2E1PA 1RTTA 5KVVA 2W6IA 2CDRA 1FRNA 1W96A 2DUMA 2ZSBA 5EJEA 3GZFA 1WKCA 3REGA 2GPNA 5HMMA 1U81A 3DL4A 2FRVA 1JAIA 2I4NA 1COWA 4G0WA 4LDAA 5A3VA 1G4HA 4ECQA 4LJ9A 1ATZA 4HUJA 5ULLA 4DA8A 1YKGA 1H9AA 4OSOA 1YRYE 3T7JA 4JYPA 4LYEA 3K0SA 1KMIY 1RLJA 1J23A 4I66A 1AF4A 4NFLA 3GOHA 4RA9A 3KFLA 3WJ2A 3I58A 1XQXA 1Y5IA 1LEHA 5K8CA 3MSCA 3MS2A 1HO3A 3PA6A 2O8FA 1HLDA 4WV3A 4GMKA 4BO3A 4BFTA 3LLSA 4Y2SA 3EVDA 3RE1A 3F6BX 4NBRA 4D9GA 2AG6A 1JDPA 3QLJA 2G0TA 4XUEA 4GMHA 1UINA 4UQGA 3VKHA 4ZGWA 3SSAA 2W9AA 4WVFA 5L4SA 2XH8A 3O2SB 5F1YA 2K7FA 3NIWA 1H6BA 1U5CA 1KEZA 1SKYE 1E77A 5TPWA 4PW0A 1HKUA 3MGAA 3D7RA 3WK8A 3OE5A 3K1JA 1WUTA 1ONSA 1S2OA 3D1VA 3T7RA 4ECVA 4PYRA 2C0PA 3HJEA 1MR3F 3GILA 3LVWA 3QVUA 4QZCA 2VHQA 4D8YA 5JJCA 5JVDF 2I3GA 2ZI7A 1RLUA 3DTVD 1VBFA 4L7VA 4FHGA 3CSSA 4ZTBA 2P65A 1P2TA 5K09A 4IIGA 2PE5A 3HXLA 2GBFA 4XZ3A 1VSVA 4IIVA 4JB0A 3ZXSA 2BELA 4E07A 1ZJWA 4POOA 3GDXA 2UV8A 2J0VA 4EJ2A 2F7SA 2QM8A 1DELA 2DFTA 4ZVTA 1NI5A 1JU4A 2NZJA 1VL5A 3MD9A 1T29A 4J6EA 1J4AA 1K08A 2J32A 3FY4A 3EGCA 3RM3A 5K8VA 4DMUB 1XO0A 1AO0A 2Q3DA 4QFMA 5AI6A 4D3DA 4PAWA 3MD0A 4EKEA 5ED0A 4MR9B 2TMKA 4M0MA 4GXTA 2A3RA 2VK1A 1U8ZA 4FN4A 3COJA 5BW8A 4UNNA 4RAQA 4Y9RA 2PGDA 4DLYA 4QATA 3RYFB 3IAS6 4I4NA 1KU0A 2EDUA 1XRSB 4Q47A 2C5BA 5IRCD 5K05A 3MLEA 4GBJA 4QARA 2GN6A 3HV0A 4YMNA 5A7GA 3E03A 1JXQA 2PSSA 3KL4A 1WOYA 1U8AA 3O8RA 5GTHU 1F8UA 4KQXA 1A5TA 1UC4B 1AGRA 2YWCA 3PU6A 4RDCA 3CE6A 4MEAA 5CAEB 3B5IA 3L7BA 1M5UA 4DL5A 4JIGA 1WMFA 2RJOA 3PUXA 1KXJA 1D9FA 4CKBA 2C7BA 2SKDA 1XNJA 2NZVG 3GGJA 2AYZA 4YJGA 4E88A 2H7CA 2PYDA 2Z2XA 1N2EA 3UV6A 4YB8A 1J9ZA 2QSZA 4RDIA 2WC1A 5TB5A 1HYGA 1N6LA 2CW5A 1MQ8B 3G8YA 3GV0A 2IXAA 4NZPA 1E0KA 1KJYA 1Z39A 3I2IA 3WI7A 4FT4A 2I29A 5EIWA 1XRRA 3K6SB 1P2GA 5JCPA 4TVBA 3PWKA 4G5OA 1U28C 1ZM2A 4D9JA 1XCPA 4CM3A 2ZKIA 4AROA 5G1PA 2W5UA 3UQYS 2OM2A 9ICFA 1EZ4A 2YN0A 2GA8A 4J94A 4E32A 4DS4A 1GT91 3LVFO 1KTVA 2HNKA 2B2NA 1ZQXA 2OXEA 4L95C 2WM2A 3IR7A 4AO6A 1T1RA 3K1TA 2UUOA 3TM4A 3MVEA 1PJ8A 5J8YA 2XXJA 3HQ4O 2QUBA 3QXXA 4L3VA 4AMUA 1A6SA 4MVJI 3S99A 1PT9A 3LHKA 2I4LA 2DR0A 3ILYA 3I04A 1U7OA 3LAWA 4OBXA 2CYAA 1LD3A 1YDFA 3C5HA 1NZJA 5BWNA 3R5TA 1AKYA 2YHBA 5EOZA 1EGMB 3FLMA 1V6CA 2O2YA 2F8MA 3JQEA 1ZSVA 3H2BA 3TCNA 3ICQB 3AP3A 3RTCA 5LB2A 4JEHA 1TVKA 1ADYA 3W8NA 5EJ6A 1X80B 4IOMA 3KSZO 3GNSA 2L17A 2RP5A 5DYTA 2FRXA 2X1LA 5J2UF 4CODB 4GFJA 2H3FA 4WE3A 4FJ1A 2QP9X 1XA0A 2IELA 2B5VA 1FB5A 3NG1A 3SBXA 1FIQA 4GNRA 6AT1A 1A9ZA 3ZWVA 3S1SA 5LU9A 4Q00A 3LP8A 2EWMA 4MA5A 2RE8A 3HACA 3PV0A 1PGQA 1EJ0A 1NE7A 4UD6A 5D6NA 4JMLA 2J0QA 4Y67A 3C1YA 4B3MB 5BSTA 1JN0A 3C21A 3MIIA 4N0QA 4QW9A 4ZJZA 2X4GA 1NIJA 4O5EA 4O9MA 3ELBA 2FMTA 2QZZA 2WM9B 1YIDA 5F9NA 2CNNA 2HIGA 5FOQA 4WLOA 2D5IA 9ICEA 3H5RA 4X7PA 1KYZA 2A9RA 1VG9B 4JLAA 4V0SA 2O7QA 4P2HA 4IMIB 3RAFC 4XRGA 2IDKA 1N0WA 5JOQA 2Y9UA 1TO2E 3L7IA 4IH9A 5BQOA 3BRWA 2PZAA 4FWBA 4LTNA 4WBXC 5T6BA 3K4PA 5A3JA 5EE1A 1YZNA 4G5GA 5CCBA 4NPAA 3W9BA 4XE5A 4S05A 2ZQZA 4H16A 2C88A 1Q1AA 1D8TA 2FDRA 3MBKA 3I5XA 3R5SA 5JTTA 4CTMA 2YL2A 1U2GC 2XCAA 3PR4A 3GRAA 2QYTA 4XGKA 3OPQA 3H87A 1ZCAA 3HK2A 2L2QA 4MO9A 2NWQA 2WNIA 3HKCA 5KAMA 3MBYA 2EG5A 2O06A 4EBEA 2PGNA 1T13A 4NZNA 3KG2A 3UK6A 2FUEA 4U2CA 1WY7A 8ICNA 1CIVA 5BSGA 4J91A 2R6ZA 2CFTA 4K6HA 1QG4A 3QWBA 4IIYA 4UAZA 4P83A 3E2PA 1AGNA 4NDZA 3AQ4A 4KX5A 2NO4A 2CUTA 1ZQMA 4ILKA 4TX1A 2GA9A 2WY2D 5EWJB 4ALJA 2IWRA 2PL3A 4E5VA 3EXHA 3TLGA 3T7IA 3WDLA 3TXXA 1IHOA 3V00A 4LPKA 4E08A 4CL0A 4G5RA 1A9XB 5BQPA 4BMPB 4BTEA 1QV7A 4A8PA 3AF6A 2HH9A 4CFYA 2DECA 3ABQB 3GAZA 5A5GA 1S2LA 5EWMB 1ZIOA 3C5EA 4X00A 2ABWA 2NN3C 1L4FA 4WVLA 4KBFA 2HWWA 5MGNA 5JRTA 2OCPA 4LSWA 1JR3A 3WDSA 1KMNA 3EZGA 2WF5A 1BX0A 1WCWA 2ZM5A 7MDHA 1EDEA 3PC6A 3T1VA 3COVA 3M7IA 4BLVA 5DRYA 5JCOC 1D2HA 3HU2A 4NFSA 2YNMC 1CWUA 1OMOA 2J4FA 2MINB 3OOWA 3MTIA 4PZEA 2VQEB 5CVCA 3ZQ4A 5C52B 1AROP 2C61A 2NAFA 2EKDA 5FTNA 1LBTA 5T5QA 5C37A 3QVGB 2BZFA 1OA0A 5A2GA 3C3WA 1DJPA 1XU7A 3F9IA 1XZQA 3E9DA 2H7XA 2I91A 4MVXA 2G1UA 3UGJA 1KYXA 1WXIA 5G40A 3IP3A 2Z6QA 5JY6A 3WYEA 3T5PA 3FYUC 4MQFA 2M1XA 1L7VC 4S3MA 1FUUA 1FW6A 4RESA 2GSWA 1IY8A 1ZSYA 4CCSA 4ECRA 2EW8A 4ZT3A 3DBRB 1N2OA 1OV4A 3EGIA 5IT5A 2NPIA 3G6WA 4ZARA 3N8HA 5CFLA 4CNQA 1XU4A 3EODA 5AKLA 3IFSA 1CY2A 3IBSA 5IVPA 1DKUA 3CNHA 3PRYA 3PW5A 1V4VA 3K70C 2KEYA 5H82A 4QTTB 3D4IA 2VP4A 4K40A 2EX4A 5DWDA 3GARA 8ICUA 2FUNB 1TF7A 1NW4A 2RKWA 4Q05A 4JT4A 4GVLA 2ZYVX 2I7TA 1NW7A 3I4FA 3QOFA 4GVPA 4Q1EA 3PK0A 4YCAA 4G1CA 1VDZA 3DBOB 1D9DA 2JANA 1IY9A 9ICKA 3HY6A 1G42A 2W0SA 3I12A 4J16C 5TIIA 4BUJA 3I53A 3RU3A 3NEAA 4CEJB 4BVGA 5LIPA 4RQ8A 4CG0A 3ECCA 2B7BA 2OFXA 4QZEA 2FEWB 4UNPA 3K32A 1L3UA 4WINA 1QXSA 2AW3A 3B78A 4M99A 3OQJA 2W6JA 4BX9A 1V1RB 2F76X 3F53A 2IOQA 2Y99A 4P4SA 3CRRA 1KE2A 3L05A 1UPUA 5ICSA 4HX9A 1W87A 3GGDA 4HAUA 1TYCA 2IA6A 1R3UA 5J2GA 5A4FS 5AICA 1OXTA 5H02A 1NATA 1ZLXA 2H29A 5CFQA 2FJ0A 5L3SA 4TTPA 2D59A 4F21A 1OTXA 3KSUA 2MWMA 5HIJA 2HF9A 1ZZGA 1K97A 3ZU5A 1DCKA 2ICAA 1GADO 4BNXA 1SA0B 3CWQA 4WACA 2H2IA 1L0BA 5KHAA 4IHJB 4JBYA 1Z6GA 4FYIA 4RA6A 3UY4A 5DM2A 2XGJA 1M6HA 3VHXB 2ROQA 5HDQA 4LNUA 5KG7A 1WZEA 1GSHA 4L3OA 2X14A 1OB2A 5LC1A 1IZYA 2I65A 1L4LA 4AJ9A 1P0QA 1KHTA 4Y1EA 1WE2A 4TRRA 3H0RB 4UM5A 4IINA 4KHZA 4R9VA 4LV8B 3E5HA 3QEBZ 3N75A 4ZKDA 1BW9A 4P84A 1FRQA 4HO1X 5TX7A 1VLQA 2YX8A 1Z4PX 1Y6QA 2A57A 2KE7A 1POXA 4FDMA 1KEUA 2NUPB 3BGSA 1PFKA 4IQWA 1Z0IA 1N5KA 3A7DA 3WLFA 5BUQA 3EZ7A 3QSGA 1NV9A 2EAMA 5F3WB 5TS3A 1QH1A 5KX5A 1S3GA 4IVQA 2FSSA 1N57A 3LT5A 4KYTA 5J2TF 1MVLA 4EZBA 2IMWP 4FILA 5FPQA 1XMIA 3KZMA 3GIMA 2HCRA 1VG8A 1M7HA 3Q15C 2FPPA 1DNPA 2QX7A 1E66A 2ZYGA 5FBWB 1ZW6A 5CHEA 1JSRA 1H23A 1XI2A 3AU8A 5IWCA 2EW1A 3ASZA 5ARBA 4YRPA 1OX4B 4ZVPA 4TROA 4RVGA 1P1HA 2F67A 2EBUA 2UZAA 1J2TA 2AFHB 3RAGA 4NJEB 4RMNA 4XVCA 1RZTA 5CB8A 3LOUA 3SMVA 4RTSA 3Q72A 2ZT7A 4P82A 2ID8A 3DDWA 5E7IA 3JYQA 3KZNA 1W5AA 3AILA 2W7PA 4MW7A 2RHTA 4NBVA 2XYQA 3ZXYA 1ZD2P 2ZI4A 5KAIU 2SCUB 3D6VA 2Y0SF 3AL0B 4DSZA 4P7BA 5EJ5A 3QF4A 1BE8A 2WWWA 5EIEA 16PKA 3AM3A 3L6OO 2Z8XA 4HQNA 5DYWA 3WL7A 2OEPA 1LUAA 5BURA 1JWAB 2A3NA 1V45E 3GUHA 4CL8A 4H1WA 3RGWS 2QYOA 1KAEA 1CF2O 4YAEA 5KT6A 2WAQC 3IYLW 1ZL2A 5KMGB 2I9KA 5ADHA 4LV5B 2YX1A 1P0PA 1SKUA 4BNWA 4RTKA 2EBWA 3PC8C 3CPSA 4C4XA 5EQTA 1UXHA 2JGLA 2OBXA 4PSCA 3IHKA 3LQKA 4D9BA 3V4LA 1DRJA 2YVAA 3GLTA 3COYA 2XX3A 4BO5A 3DFUA 3TL3A 1MFZA 1YNSA 3GGOA 2N3ZA 3TEFA 3WMGA 3TECE 2OV6A 1GYPA 4QAQA 3HTXA 2HOIA 4REQB 2PM8A 1DBRA 4KODA 3HCCA 4JB8A 1QONA 3UV7A 3ND7A 7ICSA 2LMRA 3W4KA 5LM3A 4D9KA 4OQDA 3TG8A 1CLEA 4KPYA 1ZESA 3LE8A 2FMKA 2XE7A 2KYRA 2XUKA 3MCZA 4PLPA 1W4BA 3L1KA 1QMPA 4I5DA 1TCAA 5F3XB 4U00A 2B7LA 1HMPA 2DGZA 2Z3ZA 5GJBA 4P9NA 4DHEA 4HDKB 4C0SA 3ZHTA 3A32A 1NMSA 3AINA 5TARA 4UB4A 5CCXA 4YRCA 2NVOA 3CEHA 5JSKA 2J6HA 2VSQA 1U90A 3WHPA 1FP2A 4CKZA 5KS2A 2DULA 2DOKA 1QO9A 3WIDA 3Q11A 3HEAA 2OBMA 3TGWA 3M5WA 4DPLA 5DGIA 4LYGA 3DGFC 4U9HS 3TGPA 1FTSA 2TRSB 4P7GA 1KSGA 5CIYA 4U7DA 4Z4CA 2R47A 4RS4A 4R1MA 2C04A 5KOJB 3KVVA 2CFIA 3NEYA 3GLIE 3NATA 3K8ZA 1WY5A 2J9XB 5BWBA 2VZ8A 2C78A 5DTIA 5AJYA 5K8IA 4CXMA 1A0OA 3I32A 2NO5A 4E5KA 3T5CA 1A7UA 2ZE6A 3AFHA 1L3SA 3LX4A 2YXNA 4C1BA 1TA4A 4MW5A 5FI0B 5A4IS 3FPEA 3KTAB 3OX4A 5BMVB 2BJWA 1TQ8A 4F97A 2F1RA 1N33B 5BQ5A 1RQPA 3QU5A 2PUHA 3ZQJA 2GEBA 3OIWA 1NKCA 4Y6GB 1ZQPA 1GNTA 1VMKA 3AY0A 3GMIA 4K6FA 1WCYA 4OJYA 3VHLB 4FYMA 2VN8A 2MSEB 3HCRA 1EB9A 3BDVA 5ICGA 2VPIA 1F0NA 1VC2A 2PCJA 1W85A 2XQGA 2AC4A 3ZJTA 1TZ2A 3EIEA 4MW1A 3QEJA 3SHQA 4IOLA 4R64A 1A4IA 3AW8A 2MUTB 3SAFA 1X1EA 4A2QA 1U65A 2OYRA 3AT1A 3IUPA 1WSAA 1UBMS 3LX6A 5J5CA 1T36A 1N2CE 1E9RA 2FPIA 1U49A 1O94C 3BT7A 1A8QA 2IE0A 3KEGA 2V1UA 4NV1A 1NBMD 4X8HA 2H4WA 4TQGA 4EHJA 1DG3A 3EBOA 3KO8A 3OMXA 2KZMA 5JCJD 3HDTA 5JH7B 3FDXA 2FG5A 4D9MA 2W3RA 3SC2B 4MB6A 3EEIA 4LY6A 5KYVA 4PM4A 3OCXA 2DWCA 2PFNA 5HP4A 1GTZA 5GIPE 1DAFA 2W04A 4Z6KA 3U7RA 4DA0A 2FE9A 3MEQA 1FP4A 2I1LA 1DUVG 3P9SA 2J7PA 3DOJA 4DLBA 4ER3A 1NTOA 4ZIRA 3BFXA 3P19A 3X43A 3P9CA 3KB6A 4U2FA 4HWRA 2ERCA 3RBZA 1ZRHA 5K3SA 2QX4A 2O8CB 4RHXA 2BFAA 4QJFB 3M6FA 1H8HD 1ORDA 3Q9LA 3KZOA 2YVKA 3FMOB 2GNAA 2LCFA 3MFIA 4D3SA 2Y71A 3IE2A 3IT3A 4F4UA 5BOLA 3IPRA 4ICAA 1FBTA 4D43A 4CCYA 2OO5C 4QDTA 4C4ZA 1RYDA 6REQA 3R09A 4S1OA 2QG6A 4B2PA 4IVPA 3PHGA 1D4ZA 3UM9A 1UBTS 3M2PA 4IFIA 4ZI7A 2C92A 4NENB 2O8BB 3R8XA 2ISQA 1P31A 2C9CA 2FX2A 4OGGA 3X1WA 1WDWB 2XUZA 2YY5A 5K8JB 2REBA 4JL5A 1L4UA 3MYRA 1R8JA 1QYRA 5DH9A 3E7PA 3E18A 3K0AB 2C98A 3OZRA 1CERA 2JEGA 3QOYA 4CE6A 1WTCA 4R3WA 2PD3A 4PQRA 3K71B 1BDMA 3AERB 4MW4A 4PQGA 3KZ1E 1NULA 2GTPA 1VCHA 4WBNB 1P80A 1RWKA 4HDSB 1ORWA 1VE7A 2W9CB 3LUPA 3DSRA 3WA7A 3AZOA 4QU9A 1ZXBA 4RFSA 4DR4B 5BNFA 4P6VF 5CW2A 3ZWWA 2C4HA 1CQXA 4KLDA 1S7GA 2O6LA 4LRQA 2FZVA 4KSYA 3VZBA 3AR8A 4HYQA 2VZEA 2Q46A 2J0SA 4JA0A 3WK5A 1DGQA 1PJCA 3VC1A 2IL1A 2FWNA 4WZBA 1VPVA 2BFFB 2GO7A 1SV0A 4K4IA 3THYA 2ZUTA 3ZZNA 2E4AA 3DO6A 3GL9A 4F3TA 3D6UA 2I1WA 1TUEA 1V8ZA 2J09A 3C3AA 2IEGA 4BZPA 3JQQA 4CFZA 1XK7A 1MABB 3GFPA 3CN7A 4EL0A 5JPDA 2BMVA 1QGZA 2FQYA 5BNIA 3GLSA 5ICMA 1BWQA 1TU3A 3MUFA 1Q20A 3HG7A 2OVFA 1S0NA 2X13A 2O8VA 2VSYA 1E8MA 3QBTA 4NCXA 4KQHA 4F86A 2XJ9A 1WUJS 2GEJA 1DDOA 4TWRA 5DYGA 3BORA 2FQQA 5CP2A 1L8OA 1MCZA 3IA7A 3QV1A 3RUDA 2ZU0C 1J1UA 3GDGA 5JXGA 1SIWA 4AY2A 3KR0A 3GJXC 5TRTA 5DNEA 2QX8A 3U09A 1DAPA 1CJMA 3EH1A 1I2CA 4WNCA 2B5WA 2GPAA 4OMCA 2YTUA 1J20A 1HY3A 2G77B 3AEKA 2FHSA 2HBJA 3EFOB 2YUIA 2VDWB 3UWMA 4TV9B 4ZMSA 1NJ5A 4IF6A 4OBBA 1LKYB 2B4KA 1R0XA 2F3UA 3I83A 3HNRA 3CW2A 4HCJA 2BI4A 4KXLA 4Z9FA 5CA0B 1E9AA 2ZJOA 3RAEC 3NP7A 3F7TA 2I0FA 2WPDA 2ODQA 1VYHA 2XBMA 3ANNA 3K0BA 4YD2A 3KQKA 2Q50A 2GETA 2KVSA 1KR2A 3AHHA 3SQMA 3BA6A 1SHJA 3T7KA 2HBZA 3KSBC 2OZKA 5KTYA 1AO3A 2P6PA 4Q24A 4OO3A 4W9RA 1LDNA 1WEKA 2QNIA 1HR0B 1OU0A 3MYYA 2JLSA 1ILEA 3D2AA 1RCFA 4YJFB 4RF4A 3DXZA 5BN5A 1WVGA 3UJAA 4JT9A 5IIIA 4COKA 4JI2B 4NLBA 4O3FA 3N7UA 4GOOD 1Y3DE 2QVZX 2R5NA 3QBVA 4E30A 2W8LA 5FWDA 1ARZA 1WB4A 1JDVA 3WB9A 3PEFA 3WLNA 4JU8A 2PANA 3FPLA 4KWCA 2O2DA 2VPWA 3G5MA 4RTQA 3VYSB 3GIKA 3EC2A 2GM9A 1A9TA 2EIXA 3R6LA 1XXHB 2YWJA 1XSEA 2HDOA 3DBLB 3Q2OA 1FNMA 3M9XA 4YJHA 4XCQA 4ZCMA 3ZCUA 3COZA 3SYKA 2RGEA 3OTIA 2XUPA 3TNLA 3MMSA 1ZRNA 3Q9SA 4B3XA 4GMFA 1YWGO 4L1KA 1SELA 3RTAA 1Y8ZA 2QAJA 1PV1A 4GS5A 4QXPA 4UTZA 3D1JA 1IY1A 5I7FA 1KVRA 4QGSA 1A4UA 3VDQA 3QEAZ 1ZIXA 1YDWA 3G3EA 5IH7A 5LD2B 3PUWA 3ETCA 3ZU4A 4NABA 5BPHA 4W6ZA 5A05A 1DV1A 3EIXA 3UB4A 1C1XB 4BMNA 3RTEA 4KR2A 4OI4A 2JH8A 4D9CA 4R1PA 4DANA 1DXOA 1XA4A 4EYEA 4NBUA 1C9MA 4N54A 1V41E 4Q7JB 1DIBA 3HSYA 2R8HA 1L6IA 4DLNA 3PLAE 5MN5A 4DEXA 3E0QA 3KJEA 3V7UA 1PIWA 2WHPA 2LP4Y 2BMDA 3Q7IA 1JECA 3WGGA 3P9NA 4G07A 3RS0A 1L4KA 4DEVA 1Y4UA 4PIMA 4REMA 4K1XA 3PXGA 1NRXA 1MJNA 4TRMA 2OGSA 4UTRA 1R0CA 4YMWA 4MPDA 1DBQA 5EKUA 4QDUA 1TLFA 4JJZA 3ONEA 3RJIA 3PIRA 2WM3A 5E9QA 4Y2YA 1XKQA 2KFZA 2H1CA 4PBTA 2XVXA 1WDTA 5L95A 2H63A 1YMUA 5DGXA 3RYTC 8MHTA 1JQLB 1UC5B 3T4EA 3FC4A 1ZM9A 4F4DA 1CUCA 4L51A 4B44A 1YQEA 1H0SA 1XPOA 1JFRA 5IK2A 1DOAA 1DTWA 1KORA 4JV5B 2OAEA 4EO7A 3WFIA 4IIUA 2IPXA 3B52X 2JLQA 1UJ6A 4YAUA 4DR3B 1JHRA 4RL6A 4HRAA 2A7QA 4F4HA 2BUAA 2XTZA 2W6ID 2I22A 4F96A 5I3ZA 3QA9A 4OJLA 1JIJA 3UATA 3JPSA 1UK8A 5FUWA 3T7AA 1COWD 2Z9DA 4LOIA 4GIBA 3AWIA 3DL0A 4DCOA 3EX7C 4CGZA 1U8XX 1U9JA 3GFGA 1DSSG 1CJVC 3VVMA 5HOEA 2G9ZA 3CBGA 4X71A 2Y9TA 3ZZ1A 1BHSA 1O03A 3CRXA 4H7FA 1Z73A 1R9MA 3NHPA 4DDUA 1QCZA 4DPMA 3A8TA 1E1LA 4M1KA 3ZWQA 1TLTA 3SEQA 3NM6B 2H5IA 2C9OA 2O5VA 2A4MA 4DSEA 1MG0A 3V2UA 4F50A 1NW6A 3NOOA 3F7MA 2AT1A 5BP7A 1RJWA 5IXJA 4DJTA 1ZAKA 4NP6A 3OKCA 4AJPA 3VZQA 2WKQA 3NR2A 3IH5A 3R3ZA 4GI5A 1JI3A 4WOPA 2G1KA 3D8SA 2ACWA 1ZJMA 3IV9A 3R3HA 4QOFA 4BO7A 2C4TA 2GK6A 2ZIAA 4NU5A 2R6R1 2JD2A 3DO8A 2VPQA 1BXRA 2OO7A 1CY4A 4MMYB 1V6AA 4IHKA 3UNXA 3AUAA 4EATA 4PZZA 2H7YA 5JJLA 2Z98A 4XB6B 1ESDA 2IIBA 1I4LD 2G83A 3W2TA 1MO5A 3JU3A 2BHRA 4DR2B 3SBDA 1Y1TA 2OUIA 4FOTA 5EUQB 2H16A 4CG1A 3IBCA 4FE7A 3LK6A 4IVRA 1PEDA 1O95A 3Q6MA 7ICRA 4EPXA 2Z6UA 2DH5A 2BGTA 3A36A 1GYQA 2SNIE 2W2OA 2AJ8A 4FXPA 3VHRA 3PO4A 2I2DA 1W4AA 1KDVA 2J6BA 3IRVA 4RFVA 1P6QA 2CMGA 3QPWA 2VJBA 3D31A 2BPOA 4NE7A 2QT1A 2H1SA 5DGTA 1IPHA 4IH1A 1A97A 3DR5A 2JZBA 3U9SA 2OKGA 3GV7B 1Z5ZA 4NCAA 5CDTA 1CCWA 5LQDA 2Z08A 1Y33E 4RVSA 2BMWA 2KSOA 4FX2A 1CR4A 3FHLA 3HBNA 5A2QA 4WLVA 1GPYA 2PZJA 3VNRA 1HI9A 1GGHA 3RVLA 2P2DA 4YWJA 2Z6AA 3MCAA 1QK4A 4X1YB 1XRLA 3KBOA 3HCFA 2C5HA 2WAQF 5DB6A 4JX8A 2DFLA 5L9XA 2OXTA 1PR9A 4QPPA 1D4OA 2CEAA 2DG2A 3CNNA 1XTVA 1HFKA 4L5JA 4DVJA 3ZY6A 1L7AA 3EVTA 3DMHA 1EYZA 1I51A 2QIPA 4M04A 8ICTA 4MKZA 5I6DA 2XWPA 2CXOA 2EQ5A 1UFVA 1U3VA 5LOVF 4N7RA 1R6TA 3QVKA 2X40A 5EJAA 2WU8A 3VPSA 5JAQA 5EXPA 1YK1A 1NSFA 4YO8A 3W5HA 1DEHA 4IWNA 1OXUA 8ICEA 4KW7A 4CEHB 4B40A 4EHBA 5CVVA 4JCOA 2H5JA 1PLJA 3P2YA 3QX7A 5ALLA 4NATA 4OGKA 2JASA 1EWVA 4F72A 3HU3A 3DEFA 1V9LA 3L4BA 2YRFA 1YUBA 2IHJA 1LI5A 4LWQA 2GWSA 3GI1A 1RLIA 3UJ8A 3MAAC 4ECXA 1JA0A 4URWR 2JJ8A 3QX9A 5DBIA 4B09A 4V1CI 4KOAA 2HA0A 2HXGA 3MWKA 4DRZA 5KT2A 2QD4A 1VSUA 4ZI5A 2EKLA 3D3KA 3KKKA 4Q9DA 5DW0A 1KPHA 3K2EA 1KI8A 4DOAA 4IZOA 4U63A 3SF8A 4BP9A 3IELA 1Z3IX 2CHGA 3VZSA 4KFRA 4TTQA 5KTSA 4DQVA 7ICNA 2ZITA 4KMMA 4GKKB 4LOKA 4KWIA 2PV0A 3IEVA 2ZRQA 3VNBA 2J0UB 5KFWA 2O7SA 2BM1A 3QW4B 5DNAA 1RYBA 1E9VA 1LFAA 1NVTA 2QJRA 2R87A 3CG0A 3BHMA 1GUBA 1P75A 5IUJC 3VOBA 4UMFA 2GPBA 3R3VA 3NBUA 2O5EA 1FVFA 2A1AA 1KMHA 1EA7A 1YJXA 3OF2A 1VZ3A 4HEQA 5A5EA 3O3OB 4PYKA 3SZOA 1P8AA 4TTSA 3EUFA 1UQRA 1N6IA 4JI8B 5ESXA 4HX2A 4KAXA 4BB9A 1PSWA 2D3WA 2KNJA 3QVJA 2AQ8A 2HWYA 4KGZA 4Q16A 4H6XA 1ZQCA 3PXDA 3K0FA 1MB3A 2TMDA 3RLFA 2EJCA 2WIAA 5ALUA 4OM8A 3RSFA 3CF4A 3FTNA 3SEFA 3AC0A 2P7IA 3F6RA 3AB8A 4HDOB 4D4HA 2PZ8A 1U9YA 1Q7CA 1U4BA 5DDYA 5B12A 1KFBB 3LWZA 3ER8A 1BOOA 1XNGA 4TLEA 3M9MB 5IF3A 4ER5A 2VDMB 2YHAA 5ALQA 4HFMA 4A2CA 3IAEA 2O8EA 4Y2JA 1BCRA 2ERYA 3U44A 3RD5A 4FCTA 1FDSA 2Z3WA 3ZZTA 2V7EA 4C87A 1TL7C 3JWHA 3G13A 1ZCFA 3SF0A 3I9JA 3IO5A 2WJ3A 3HUUA 3PUKA 3UFBA 1KK3A 3P9KA 1JEOA 2QN2A 2W2MA 4DAEA 2QJOA 1RYYA 4NX2A 3M6IA 3KU1A 3RHFA 3GLIB 4ARBA 5IH3A 2JATA 5KHLB 1DAIA 1Q3VA 1RC0A 2DP4E 4BB6A 3I05A 1XC9A 4M2YA 1DKLA 4BQIA 1Q12A 3GCZA 5SZJA 4Q3LA 1FZQA 4B9NA 2E48A 2IQIA 2QTHA 4ZZ3A 4QDXA 1HUZA 4YRNA 4Q3BA 4RXUA 3AHGA 2CJWA 3HCPA 5JAUA 4IDFA 3N3AC 4Z5XA 5I9IA 3DMGA 4R83A 3AUKA 5DIZA 1QFYA 1N7HA 3TX2A 2PFSA 3KPUA 4RVFA 5K1ZA 1L7DA 3LC1O 1P1JA 2GYUA 3ZQUA 5H3LA 1PJSA 1W1IA 2XGMA 3W79A 3RB4A 2KKVA 2WB4A 3KEFA 2YJZA 2J9ZB 1VE9A 5FOUA 5LJLA 2BEJA 4P5DA 1N5RA 1TKBA 4RJ2A 3OX2A 5AJXA 2G28A 2JLRA 2NTEA 3OO1A 4KVAA 3KDSE 3ZS8A 3ESDA 1E96A 5KKCA 2PRJA 1AK9A 1EPUA 3C5CA 3BDIA 3GT4A 1QFSA 5JPIA 3ET4A 4UUNA 3TD2A 1C7RA 5CG2A 5E38A 2ZRNA 1NW3A 1FYEA 3C3EA 4J1TC 2H92A 2GLXA 4LOAA 3RUFA 1EP3B 4YT2A 4TPKA 3LZDA 4I5EA 3IJRA 1JR3D 3IOYA 1WMDA 1FS6A 3IQIX 3LUGA 4NS1A 2CDBA 4O6VA 2QXYA 4L02A 4PX5A 2A7XA 1PE0A 3DV9A 3GRVA 1HLGA 1OH5A 1P2DA 3M0EA 1S0VA 3D7NA 4YAFA 1VIAA 3GMSA 5B1HA 2YYSA 4PSDA 5KFUA 1FSSA 4BFSA 1QYXA 3LMKA 4UU1A 1E2GA 2Q2OA 5EC8A 3H1EA 5KG3A 2VDVE 3M8KA 2O0KA 1NLFA 1XBTA 4OP2A 2P3LA 3PENA 1SVIA 2X9NA 3EPPA 1BEEA 4MUEA 4D8XA 2J9FB 4B75A 3VYTB 4LOHA 4N65A 5A9TA 4CJXA 4IRUB 5IMSA 4HMQA 3TQSA 1FY2A 5IKMA 3B12A 3AG5A 2ET6A 1I24A 1XAJA 4NU6A 1ZR4A 1AXGA 3K92A 3VPFA 2WTUA 4IKEA 3CLSC 2D5BA 4WKBA 3B9BA 1SUCA 1JR6A 4PCUA 4KPUA 4CU2A 2C2BA 1NN0A 4DAOA 3HCNA 4JUBA 4J6FA 2WUEA 1D4FA 4P22A 4PZAA 3NUGA 4WKCA 1T9BA 2R60A 1PT6A 4I1RA 2XAAA 5KDDA 2FEMA 2II6A 3EAGA 4TTJA 4ZK6A 4GPBA 1IWBB 3L6BA 4YTEA 1BRMA 1ORTA 4OA8A 3BS7A 1NK0A 2EBFX 2H5XA 1KI3A 2P27A 5DXAA 2GKOA 4ACBA 3ZHYA 2E21A 1GPDG 4U7CA 5B66U 1J0DA 2VF4X 4CV3A 5JRZA 3UJ3X 3VAZA 1YTUA 1OKKA 4MI6A 5L3QB 1RXSA 1LLCA 3AFOA 1F0YA 4JJIA 1PR4A 4YP0A 5FULA 5FYQA 4ZOCA 3T7CA 4BKOA 3ZCPA 4GPTA 2KOBA 4J49A 4D8VA 3DOHA 1PBTA 4NNOA 4C0WA 1EGHA 1PJAA 4GDFA 4YV0A 4DUPA 1TEVA 1R15A 5DHTA 4D6YA 1DKPA 5CM2Z 9ICSA 4FSHA 4DZRA 4AG6A 1K3FA 4JC5A 3C5GA 4KN6A 1DIHA 1RMYA 2W6JD 1U45A 1DPGA 9ICPA 3HBMA 4B3BA 1YQTA 3KQNA 2GNPA 1L4MA 1ZA2A 2PLFA 3E9MA 2ZBPA 1HLFA 1UC9A 1AS0A 2RARA 4TWAA 1XDDA 5EFZA 2CCKA 2LXNA 1Q2XA 3G6VA 3EXEA 1KQPA 2A5FA 1K7XB 4HWGA 5FWXB 2DL0A 4JC4A 5J4HA 1Z0SA 1X7ZB 1U6JA 3UQZA 3ME5A 1DK3A 4X84A 3ICWA 2FTKE 1TK3A 2P2LA 3EZ2A 1ZQ9A 2LM1A 1VG1A 4JC0A 2HZBA 4KV7A 3CY6A 5TVGA 4HQ0A 3RB3A 4CIBA 4BJQA 4TRJA 2YZMA 1U0EA 2HSWA 5K3DA 1S3IA 3IUYA 4Y6LA 3UHFA 3TIXB 3Q87B 5ILGA 1CTQA 1R1DA 4R71A 2P9YA 1XWFA 3WKAA 3E9EA 3G1WA 3HY3A 3LU1A 3TZHA 2JJQA 2FN8A 3N8IA 4KIJA 1AQUA 3HWWA 3BGDA 2ZRJA 2Z1NA 3T3EA 3CF2A 1G19A 2VJPA 5KREA 4O3MA 1P3JA 4NOLA 3NRZA 4QYSA 1Z28A 5FKJA 2HSDA 4BJHB 2UVQA 1YIAA 3RHSA 1IN4A 1ZQRA 3KLBA 3PEYA 1J22A 5GINE 1H0RA 1Z37A 1ABBA 5L7WA 2C83A 3QU9A 4REOA 2GF9A 1JEDA 5KNLA 2FSGA 2Y1KA 4ZAGA 1SXJA 2PSJA 2DPGA 4CDNA 3WR5A 4BQEA 3JQGB 4UHJA 1ZQUA 4H7EA 1L1FA 4KLMA 2DHCA 2BTEA 4EUKA 2XMZA 1T9CA 3CLRD 5AESA 4GOND 8ICYA 4L0DA 3DWGA 4NESA 2B9EA 2JFPA 3OLZA 1DC5A 4K8RB 4U2BA 2P68A 3ANTA 4K81B 1WV1A 3RVQA 2JGFA 4GXNA 4B2LA 1SL1A 5YASA 4G23A 1Z13A 2SECE 4AJOA 1TT5A 5D7BA 4EJ0A 5AW5A 1WPGA 1S9HA 1HUQA 4R1TA 1T1GA 4MRAA 4S1WA 1KL7A 2CF6A 3P9YA 2C4MA 1B2LA 2DWOA 1KDRA 4OHPA 4EKYA 3L84A 2LW7A 2Q4RA 4OKSA 3KXDA 2WB1C 3DB1A 2DX7A 3S2EA 1H3FA 1KFCB 3MGBA 1E2IA 8ICCA 5KG1A 3WGOA 2I6XA 1W8DA 3C6BA 3BJMA 3IUQA 1T8TA 5KU7A 1M7GA 1NJ2A 3O8LA 1TVEA 3W9SA 1XZNA 1NPDA 5FTKA 2CZGA 4XCVA 1PUZA 3T3IA 1WD5A 1J2NA 3WIUA 5EWGA 3LF1A 3VCBA 5ITZB 3AVYA 1P91A 1DKQA 2WAXA 4MV5A 1AM4D 3JWJA 2DPLA 1C9JA 2VDOB 1E7WA 1IH8A 5I9TA 2CJPA 5IAEA 4KWEA 4C6RA 3MWJA 1XD9A 3FB1A 1SULA 4YP1A 5ES3A 1BDJA 1T5LA 3TFWA 1DC7A 4H7IA 1RJEA 4OOFA 4HXEB 3IKVA 3D02A 1R66A 2VTKA 4D02A 4BDSA 1AHHA 3F3YA 3GEMA 1OH8A 1WXXA 4Y6PA 5KTKA 2L82A 1KP2A 2QRUA 1V2GA 3ZV3A<