1BNPA

Nmr solution structure of the n-terminal domain of dna polymerase beta, 55 structures
Total Genus 12
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
12
sequence length
87
structure length
87
Chain Sequence
MSKRKAPQETLNGGITDMLVELANFEKNVSQAIHKYNAYRKAASVIAKYPHKIKSGAEAKKLPGVGTKIAEKIDEFLATGKLRKLEK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DNA POLYMERASE BETA
publication title Three-dimensional solution structure of the N-terminal domain of DNA polymerase beta and mapping of the ssDNA interaction interface.
pubmed doi rcsb
source organism Rattus norvegicus
molecule tags Nucleotidyltransferase (dna-binding)
total genus 12
structure length 87
sequence length 87
ec nomenclature ec 2.7.7.7: DNA-directed DNA polymerase.
pdb deposition date 1996-04-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF14716 HHH_8 Helix-hairpin-helix domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.110 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 DNA polymerase beta, N-terminal domain-like 1bnpA00
4YMOA 4RQ1A 4UB1A 3JPNA 3AU6A 1ZQPA 3PNCA 4I2GA 4PHPA 2PFNA 3JPRA 4F5RA 7ICHA 3B0YA 4I2AA 4KLQA 3AU2A 3ISDA 5IIOA 4QZDA 8ICPA 4KLEA 5TZVA 5J2EA 4PGQA 5DBBA 4YD2A 4PH5A 4PPXA 4IQUA 5J2KA 4I27A 3JPQA 1ZQJA 4X5VA 1ZQFA 3RJFA 5J0OA 5J2FA 4QZ8A 8ICYA 7ICPA 4IQVA 4PGXA 5J2IA 7ICQA 4KLGA 7ICVA 4M47A 2BCSA 3C5FA 4KLTA 5J0QA 9ICIA 4M9NA 5IIKA 4TUSA 3RJHA 5D49A 5J2GA 8ICQA 3UXNA 4DO9A 9ICLA 1NZPA 7ICRA 5J0SA 2BPGA 2BCRA 4K4IA 3V7JA 7ICUA 4LZGA 4UBBA 4FO6A 2FMPA 9ICKA 3ISCA 3UXPA 3RJJA 9ICWA 4Z6DA 3MDAA 1ZQAA 4I2FA 9ICSA 7ICOA 9ICPA 4LVSA 4MFAA 4QZEA 9ICMA 1KDHA 7ICJA 2IHMA 7ICFA 4QZAA 5DKWA 1RZTA 4K4HA 4RQ8A 8ICMA 4R63A 4QZFA 3ISBA 4I2EA 5J2AA 5IIMA 3JPSA 4UB5A 2PXIA 1ZQGA 4R65A 4RPYA 9ICBA 8ICNA 4PHAA 4RQ6A 4M9GA 5DBAA 2P66A 8ICKA 9ICTA 5J2CA 3HX0A 7ICIA 8ICVA 4F5PA 4NM1A 4Z6EA 1ZQNA 4I2BA 4M9HA 4GXIA 3JPOA 7ICLA 4KLSA 4O9MA 9ICCA 9ICQA 4JWNA 4QZIA 1HUOA 3RJGA 4UAYA 4KLLA 1ZQBA 4P2HA 5DBCA 1BPEA 7ICEA 5CWRA 5J2BA 4XUSA 4NXZA 8ICLA 1ZQCA 1ZQQA 5DB9A 1ZQEA 4K4GA 4LZDA 9ICUA 5HHIA 4KLHA 2I9GA 5DDYA 5J0WA 3HW8A 9ICOA 3MGIA 4IQWA 5D46A 3AUOA 4DOCA 5J0XA 2BCUA 4RQ3A 3C2LA 2FMSA 4QZCA 4RT2A 4RQ7A 3MBYA 1HUZA 8ICRA 1BPZA 4RPXA 5J0YA 3V7KA 4M0AA 9ICNA 3UPQA 4I2CA 5IILA 5CB1A 4QZBA 3RH6A 2ISOA 4I2HA 4O5KA 5DB8A 5J2HA 1XSPA 1DK3A 8ICIA 5BOMA 3RJIA 4RQ4A 8ICEA 8ICAA 5HHHA 9ICHA 4O5CA 5D4BA 4MF2A 3MGHA 2ISPA 8ICWA 4UB3A 4GXJA 4MFCA 8ICGA 1XSNA 4UB4A 3UQ0A 1BPDA 8ICUA 3RJKA 4PHDA 3RH5A 4UAZA 7ICTA 4RPZA 5DB7A 1ZQHA 1BPYA 9ICRA 3RJEA 9ICEA 4GXKA 5DB6A 4I28A 3TFSA 1BNOA 1JMSA 4KLJA 1ZJNA 4RQ5A 2KP7A 1ZQLA 4NLKA 3V7LA 4RT3A 3UXOA 4NY8A 5J0UA 1ZQDA 2BCVA 4YN4A 9ICVA 1ZQMA 8ICXA 3RH4A 8ICSA 3LK9A 3OGUA 4QZ9A 8ICCA 5IIIA 4I2IA 5IINA 7ICGA 4M2YA 1ZJMA 4NLNA 4I2DA 4TUQA 7ICNA 5J0PA 3JPPA 4R66A 5J29A 4M9JA 4QZGA 4M9LA 4I2JA 1DK2A 4UBCA 8ICOA 4RQ0A 3PMLA 3HWTA 8ICHA 5IIJA 3GDXA 1TV9A 2FMQA 2W9MA 4F5OA 4KLFA 5J2JA 4YMMA 7ICSA 4TUPA 5J0TA 2PFOA 1ZQKA 1TVAA 4KLOA 4Z6FA 5J0RA 2BCQA 9ICAA 7ICMA 2BPFA 4RQ2A 8ICBA 7ICKA 4YD1A 4Z6CA 4R64A 8ICFA 1ZQTA 3PMNA 5EOZA 2PFPA 2PFQA 4YCXA 3UQ2A 5BPCA 1ZQSA 1MQ2A 4PHEA 4KLIA 4M04A 4DOAA 3MDCA 3C2KA 4F5QA 1MQ3A 5J2DA 3TFRA 8ICTA 4KLUA 3JPTA 1BNPA 4I29A 4NLZA 4PGYA 1ZQOA 9ICFA 4F5NA 3B0XA 9ICXA 8ICJA 4KLMA 8ICZA 4XA5A 9ICGA 4MF8A 3C5GA 2GWSA 4IQTA 3V72A 1BPXA 1XSLA 3C2MA 1KEJA 4O5EA 4KLDA 4NM2A 4UB2A 1ZQRA 9ICJA 5BOLA 1ZQIA 4TURA 4QZHA 4DOBA 4MFFA 4JWMA 4UAWA 4YMNA
chains in the Genus database with same CATH superfamily
1NJYA 1KW4A 4UB1A 2QARB 5HP4A 3BDPA 4F5RA 3ALRA 4GFJA 1RYSA 1PK1B 1JX4A 2KSOA 5DBBA 3HKZC 4PH5A 4NL9A 3N4MB 5G5HA 5J2KA 2KJ5A 4I27A 3JPQA 1ZQJA 3KZIU 4X5VA 2C22A 3H0LB 5J0OA 3NASA 5EWGA 1A0PA 4IQVA 4OD0A 4ZOHC 3E2EA 1N56A 3OHBA 2E8OA 1DGSA 2MAXA 5ALLA 2XVTA 4PZNA 2VA8A 4EEKA 1WWVA 4Y2YA 1KLNA 2HBKA 1RDFA 1BVSA 1RYUA 2V4RA 4J9SA 3SEIA 2DGZA 4Y2SA 4KLTA 2MU2A 2ODGA 1U4BA 2ZIVA 5DG8A 4IRDA 2NV3A 1Q3UA 2ALZA 1MA7A 5D49A 2WFAA 2QB0A 4B9MA 8ICQA 5CJ7A 3UXNA 4C8MA 5CR0A 2KMDA 1PK3A 2BPGA 2JEIA 3UMGA 2WHEA 3H0MB 3NRWA 1DGJA 2BDPA 4ECSA 3BQ2A 4DL5A 2YMQA 2EAPA 3QZ8A 4FO6A 5L1IA 2FMPA 9ICKA 3SD7A 2WAQC 3PZPA 2H3VA 4J9MA 1XS9D 3DEEA 1X42A 3N7RC 2NRXA 4DSIA 1TK8A 2JHDA 3FDSA 4LVSA 4UAUA 4MFAA 3V6KA 1JRPA 9ICMA 2IHMA 4B9NA 4FBUA 1RZTA 1SV4A 3LDAA 3T5LA 5KFWA 2XICA 4YXJA 3ISBA 4WJ3B 4FS1A 4I2EA 1HEKA 4JMUA 5CHGA 2FLNA 2A1AA 5AKGA 1ZQGA 2VA2A 4EBDA 4DQPA 4M9GA 4DFDA 3RAQA 2MUTB 4ZH4A 1YT3A 1JIHA 5J2CA 4J9PA 2AGQA 4F5PA 4NM1A 2DWQA 1ZQNA 4I2BA 3QU4A 2Y9UA 2C28A 1NK0A 3KKAC 3GV8B 3TADC 2ATLA 4PJ0U 4ED3A 3LVWA 5ALZA 4KLLA 4P2HA 1BPEA 3G6VA 1NJWA 2K60A 3BZKA 4Q45A 3QEAZ 3C28A 2G09A 4Y2UA 1X6JA 3F5AA 3AN1A 2VJ4A 2VJ5A 3RF9A 4NXZA 4QIWC 5AI6A 4RZRA 2AJQA 1NZBA 4YVZA 3ZDBA 5T14A 5HHIA 5TISU 2I9GA 3PSPA 2W7PA 1UA1A 5KFCA 1V85A 2YMMA 4DL7A 2BCUA 4QZCA 2AHOB 3MBYA 2W55A 3J81j 3SV4A 2KKPA 2BR0A 2AU0A 4O5KA 3RR8A 5KT5A 1XSPA 2LM1A 1DK3A 5L1LA 4UAVA 1L3TA 3QU7A 3MR3A 5DQHA 2KZ3A 5HHHA 2WB1F 9ICHA 5DGBA 3T5KA 5ALWA 4QJFB 4R8UB 4KN7A 3IRUA 2JH7A 5AKXA 3MR2A 2F8KA 4UB4A 2L5YA 2WF8A 4P4OA 5EE9A 3R9KA 1YZ6A 4ACOA 4UAZA 3QUQA 4C7ZA 3KKAA 4US9A 3H7IA 3FYHA 1BPYA 2KK0A 2ZIWA 4RNMA 4XQ8A 1S0MA 9ICRA 3RJEA 4YFKA 4GXKA 5KG0A 3LVVA 2ZJAA 5AI9A 3WK9A 2QARA 2NRWA 4KLJA 1RG6A 2E8PA 4ED0A 1NNLA 1PK1A 1RQLA 5KTQA 1NK8A 3UXOA 1QSYA 1ZQZA 4C0ZA 4YN4A 3IM1A 8ICXA 4DFJA 1Z4OA 8ICSA 4FE3A 2HHXA 2EDUA 1FEZA 2KN7A 3LK9A 3F2CA 1IG6A 1KN5A 5IIIA 2K4EA 4DCCA 4M2YA 4NLNA 4JK1A 5DG9A 4I2DA 5KFMA 3C23A 3VCBA 1L3UA 1SV0A 4BX9C 1JROA 7ICNA 2KZZA 4QWEA 4C7YA 1J97A 4R66A 2Q0ZX 2HDOA 1FFUA 5J29A 2W9CB 5AK5A 2PI5A 4RNOA 4OJOA 4YR3A 3TAPA 1DK2A 3A0HU 4UBCA 8ICOA 5IIJA 4OJPA 1JXEA 2FMQA 2W9MA 4KLFA 4YMMA 4TUPA 1X9WA 4C4SA 5KFLA 3N7PD 4PZOA 4RQMA 2V9WA 1NK6A 1SIJA 2BQUA 1NK5A 5AK6A 2GO7A 1SZHA 4IS7A 1NJZA 2OWOA 7ICKA 2N1RA 3QU2A 5KFJA 1CRXA 4YQWA 4R64A 3CP8A 2PFPA 2BPCA 4GLXA 2ES6A 3UQ2A 4O3QA 5BPCA 3CRXA 4M04A 2HI0A 4IL6U 2JV3A 1TK0A 1SKWA 3MDCA 1XO0A 4F5QA 1P7DA 2GLEA 3M8SA 1T8EA 1VDVA 2WAQF 3H40A 1J2MA 4OCZA 5KT6A 5HR6A 2FI1A 2HOIA 2RHFA 2FJ6A 4ECWA 5EWEA 1K1SA 3PW2A 4UB6U 4F5NA 2HMXA 8ICJA 1PVPA 2MUTA 1T3QA 1PZNA 1HJPA 3F5EA 4MF8A 3F53A 3V72A 2D3DA 2ZIUB 5AIAA 5JRTA 4O5EA 4DLEA 1ZQ1C 2W54A 2W9BA 4DL4A 3T5HA 3K4GA 1RQNA 3RB6A 3Q8MA 2KJ9A 5ALKA 1ZRMA 4Q44A 1L8LA 3WK6A 4EZ6A 3QUBA 3PNCA 1CEZA 4EYIB 2XI9A 1SWVA 1L7NA 2YMPA 2PFNA 3B0YA 3EYZA 4KLQA 1WG8A 2KKVA 3AU2A 5IIOA 4QZDA 4KLEA 5HMLA 2J6TA 1SXDA 3N28A 4PGQA 2WF5A 3QXGA 1L7PA 4IQUA 2AH5A 5AKYA 1ZQFA 2F44A 2K4HA 5J2FA 2JEJA 8ICYA 2K8CB 4EX6A 4Y2PA 3AEVA 1S5LU 4PGXA 2KTQA 1DRGA 3H8SA 1U48A 2EZYA 4FZLA 1SKRA 3PR4A 1Z4NA 2HHTA 1K5OA 4QIWF 5KFDA 4US8A 1Z3EB 1ZYQA 4BJQA 1UA0A 4M9NA 5AKLA 5KFIA 3WKEA 2IOFK 5KFUA 5J2GA 2IOHA 3TKAA 2R8GA 5DQIA 7ICRA 5J0SA 1QSSA 2MA1A 2XGPA 4QWAA 4K4IA 3V7JA 5CEHA 3ETRA 3MFIA 3BS5A 1UT5A 7ICUA 2P35A 4F93B 3NVYA 4R8UA 4ECVA 1ZD4A 1X9MA 1L5UA 2M0NA 5KG7A 9ICWA 5EE3A 3MDAA 7ICOA 2G06A 4LJXA 2ZTDA 1FIQA 1QQ7A 7ICJA 1DXSA 5DKWA 2ASLA 4AP9A 4Q8FA 4R63A 2JGAA 5KFEA 1LKYA 5ALFA 3EW9A 3JPSA 5KG4A 4QW9A 2DF4B 4KMUA 2PXIA 4R65A 3MFHA 8ICNA 1URJA 4DSLA 2AGOA 2P66A 1D8BA 9ICTA 2LYAA 1D9DA 3MGVA 1ZD2P 3NS1A 3HX0A 1SL2A 7ICIA 2W7OA 4NLGA 2FPKA 4Z6EA 1Q46A 3GFKB 3RB3A 4GXIA 3JPOA 7ICLA 4JWNA 3RJGA 4UAYA 4ED8A 4ECZA 1COKA 3MR5A 2RLTA 1LB2B 5JUMA 4AYBC 7ICEA 3QUTA 5CWRA 2XCPA 4J9LA 4B9SA 2C2RA 5J2BA 1JN3A 2LYBA 3PW4A 1Q3VA 3MABA 2AQ4A 8ICLA 4F4WA 3T3FA 1ZQCA 1ZQQA 4O3MA 1N48A 3I28A 1NOMA 4ECUA 4J9RA 2HBMA 2OXOA 2BDUA 3HW8A 2VANA 2W9AA 3SQIA 2P6RA 3GU3A 3AUOA 2XIDA 2CRXA 5J0XA 2CPRA 2FMSA 4P4PA 8ICRA 2KNJA 1S76D 3IN5A 3BQ7A 3V7KA 4M0AA 5KT2A 9ICNA 2LPEA 4QZBA 2H3FA 5DB8A 4C8LA 3EWAA 2VIXA 2XY6A 5AKEA 3ICXA 4JV2A 5KFPA 3UMCA 4CNQA 3MR6A 1BPBA 8ICAA 5ALYA 1Z1BA 4P0PB 4O5CA 1NK4A 4MF2A 4IRCA 1WCNA 1UT8A 2YY6A 3KHGA 2M9NA 3OSNA 1SWWA 2XCAA 1CI4A 8ICUA 4PHDA 3FM9A 4BWMA 4Y2TA 2GOLA 5KFXA 5DB7A 2V4QA 1ZQHA 4DSJA 5KFQA 2ZIUA 3AQEA 4Y2JA 1IM4A 4RUAA 3KOOA 4MEYA 4DWIA 2ZXHA 9ICEA 2NRZA 5KNIA 1O03A 4O3RA 2Y1JA 2EQYA 3GIIA 5DB6A 3G6YA 5AK4A 1BNOA 3OTQA 4B9UA 2YX8A 2PMZF 3RFAA 1B22A 3V7LA 2OYYA 3M7DA 2UVWA 2KVCA 4NY8A 5J0UA 2KJ8A 3QU9A 3C1YA 3O0FA 4MEXA 5L9XA 4JV1A 5KT7A 3H8WA 4F4ZA 1NKEA 1SL0A 3CYMA 3SYZA 3H4BA 1NJXA 4FFDA 4DQRA 4U7CA 1KFDA 5IINA 7ICGA 1KQQA 1ZJMA 3GV5B 5GTIU 3NUQA 1ZD5A 4RU9A 2CXYA 4IR1A 3SAFA 4TUQA 1QTMA 3F2DA 3L4PA 1B0XA 2HHQA 2KIWA 1N63A 3BZCA 2H3IA 1M6YA 4M9JA 2W04A 1TAMA 2J6SA 4A8EA 3RRHA 3WKDA 3QNMA 5A0LA 4TQSA 2G0AA 4RQ0A 1UQVA 8ICHA 1FO4A 3SAHA 3TQ1A 5ALMA 1TV9A 5KFNA 4FZNA 1QSLA 5ALQA 4C8OA 2WF7A 4ELUA 4EX7A 5J0TA 4JV0A 2LKYA 4DF8A 4KLOA 1S0NA 1XNSA 7ICMA 4YR0A 4RQ2A 2NRVA 5KL1B 8ICBA 1PVQA 2YB4A 1LVHA 3ORYA 1U47A 3SMVA 4M6WB 2KD1A 4DOAA 3UMBA 2HVIA 1WUDA 3C2KA 4RUCA 5DLFA 3LYSA 3BS7A 1Z00B 2LM4A 4PL1A 8ICTA 3L5KA 2DFLA 3Q8LA 2YMLA 3NVVA 3RB4A 3WK4A 1SZPA 2JMGA 3TADA 3IDWA 5AM5A 2OEHA 1JALA 1QQ5A 3B0XA 9ICXA 4EBEA 3C5GA 3SI8A 4UW9A 2P6UA 4GC7A 3KFUF 2KE7A 5DGAA 1KEJA 4FBTA 3BQ0A 3VC8A 5KFFA 5ALTA 2HSZA 4QZHA 4DOBA 4MFFA 1VJ5A 2JZBB 4UAWA 5G5GA 3PSFA 4G9BA 4RQ1A 3EZ5A 3JPNA 2W3SA 5AI4A 4I2GA 1CUKA 3ED5A 4Q43A 3JPRA 7ICHA 3QEBZ 2KZMA 5TZVA 5KFAA 5J2EA 4F4XA 4O3SA 5L1KA 5AM4A 5KFHA 2DUYA 4BWJA 4F3OA 2RQ5A 4YR2A 5KFVA 3N7SC 5ALOA 2RP5A 3PVXA 3HKZF 2HHUA 1QH9A 3SR6A 2R8KA 3RJFA 1T7PA 3EPIA 3AL0B 3Q8RB 3UM9A 4J9KA 1LV5A 1NI3A 5J2IA 1Z19A 4ELTA 2KG5A 5KG2A 3BQTA 4ECTA 4F8RA 4FZMA 1IIPA 5J0QA 5AM0A 5IIKA 4TUSA 1D8YA 4UASA 4ED2A 5KG6A 4CF3A 5KFBA 3NGDA 2DL0A 9ICLA 2W03A 2F77X 1AQ6A 2ZIVB 2IA6A 3ONNA 4P0PA 4LZGA 3H8JA 3H8MA 1JXLA 1X6IA 2Y0SC 4NV0A 5KL8B 3Q8SB 3RJJA 2XY5A 2JH1A 4DSFA 1H38A 2JRZA 3PW5A 4Z6DA 3SENA 4J9QA 1FFVA 3Q8KA 1KBUA 1QCKA 1J2NA 2HOQA 1MC8A 4BUGA 4QZEA 2ASDA 3IV6A 1UHUA 5ALJA 3F2BA 5DLGA 4RQ8A 3GIMA 5KAFU 2YQEA 2NO4A 4QZFA 4E0DA 5IIMA 3HILA 4ED6A 5ALEA 4RPYA 9ICBA 5AI0A 4PHAA 4F71A 1XWLA 1O08A 4DL3A 2HHSA 3RAXA 1T94A 5F9NA 3KBBA 5C5JA 3KHLA 3GZFA 5CRXA 4M9HA 4UQGA 1B43A 4ECYA 2E8NA 3K75D 1WWUA 3PW0A 1N2XA 1ZQBA 2UVRA 2E5SA 4MHVA 3C1ZA 2KFNA 1Y88A 2ZTCA 3WKBA 4DEZA 1JI7A 2EAMA 5KFOA 4XUSA 1N60A 2I6XA 4PL2A 4YG2A 3RBDA 3HT3A 2W8LA 2BZFA 3N97B 5ALGA 5KFZA 1ZQEA 4OJ5A 1KL9A 4KLHA 3TI0A 5DDYA 5J0WA 4DQSA 3MGIA 4IQWA 4OJLA 5D46A 3E58A 2A19A 4O3OA 4RQ3A 3C2LA 1WCLA 1SXEA 2HHVA 4RT2A 4RQ7A 1QLNA 4U6PA 4DL2A 2A3VA 4RPXA 1MSWD 4YP3A 3UPQA 5IILA 4ECQA 3L3FX 2QB1A 2KICA 5J2HA 1ZQVA 3M6ZA 3WKCA 4OJ6A 3MC1A 3D2SA 2JR5A 5KFKA 2PKEA 5ALPA 2W11A 5EWFA 2BHNA 5BOMA 3RJIA 1V97A 4M6WA 1ZRNA 2I5HA 4RQ4A 1ZQUA 3RTVA 5D4BA 4KN4A 4F92B 3MGHA 2ISPA 4NLBA 1Z00A 8ICWA 4UB3A 3C29A 3IHQB 2LYHA 4IR9A 5H2FU 2F3NA 3H4DA 1U45A 8ICGA 4DL6A 1SKSA 2A1JB 3UQ0A 1BPDA 3QYPA 4EYHB 1ZQYA 4JUZA 3Q8PB 7ICTA 2KHQA 2ZG6A 5AI5A 5ALDA 2HOFA 4C4TA 3PO5A 3M8RA 3SAGA 1N5XA 4J9OA 4B9TA 4DQIA 1EXNA 1D9FA 5KT4A 2ZTEA 4BGDA 2FDRA 2ZIWB 1BGXT 1JMSA 1ZJNA 1OUQA 3CNHA 2KP7A 1ZQLA 4NLKA 4QW8A 3IP4B 2ZUCA 3RBEA 3PX0A 1OW5A 2D6FC 2EZZA 1ZXIA 2BCVA 3NVZA 9ICVA 1ZQMA 3RH4A 4DFKA 2H3QA 1PVRA 4GIBA 5ALUA 2ZXIA 3BJYA 2EZXA 3OGUA 5KFRA 5AICA 4QZ9A 4CE6A 8ICCA 2XC9A 3KD3A 2W9CA 3PR5B 5GTHU 4DF4A 5KG5A 1L7MA 1SGGA 4DQQA 3WK5A 2Z7JA 1F5SA 2DKZA 3K1RB 2FLPA 3PSIA 2Q4TA 2D8CA 4P4MA 3PY8A 2OCEA 5HNKA 3CW2C 3NVWA 3WKAA 3TANA 4F4KA 2F1JA 4I2JA 5JTIA 2WTFA 3PMLA 1TFRA 4F2SA 3GDXA 4F5OA 4DSKA 4XRHA 1C20A 3T79A 1A77A 5FP0A 1ZQXA 1ZQKA 2K4PA 5HMMA 5J0RA 5AM2A 4NWIA 2BCQA 3GQCA 5AHXA 2EANA 5KT3A 2BPFA 1TK5A 1ZQWA 2BKEA 5ALSA 5AKHA 5KFYA 2ZIXB 5ALHA 4YD1A 5L1MA 8ICFA 1ZQTA 3PMNA 4P0QB 3V6HA 4UB8U 4YCXA 1MQ2A 5CA7A 4PHEA 1N62A 3PV8A 3EUB2 4RNNA 1T3NA 4IRKA 4HYKA 1U49A 4KITB 2Y0SF 2CN1A 5K4LA 4JB3A 3TFRA 1L3VA 4KLUA 1S0OA 1BNPA 4I29A 4NLZA 4F50A 4UATA 1ZQOA 3Q8QB 2HBJA 2G08A 4KLMA 8ICZA 9ICGA 3NRZA 5AM1A 4ECRA 4IQTA 4C80A 2F8LA 1XSLA 3C2MA 1KTQA 3PX4A 5AI8A 4CF4A 4KLDA 1ZQRA 4Y2VA 9ICJA 5BOLA 1XU4A 1ZQIA 3HPOA 1S77D 1A76A 3KTQA 4JWMA 4YMNA 2ZUDA 1PUZA 2MRLA 4YMOA 1NK7A 3AU6A 1MN8A 1ZQPA 4KX3A 4PHPA 2W9BB 4I2AA 3ISDA 3AQFA 8ICPA 4FS2A 1SB3C 2BQRA 3QX7A 3HP6A 1SL1A 1RPLA 4YD2A 4PPXA 1ECWA 3I76A 2DPIA 2OH2A 3K1ZA 3OJUA 1IXRA 4QZ8A 7ICPA 3WK8A 1X66A 5KG1A 4J9NA 3OPXA 4F91B 7ICQA 1OXJA 3H0RB 4KLGA 3M9OB 4KTQA 7ICVA 4CDGA 4M47A 4GC6A 2YN4A 2BCSA 3C5FA 4QWDA 2W3RA 3PSTA 5KG3A 4KX5A 3I1YA 4USAA 4BDPA 1X9SA 9ICIA 1X40A 2QKQA 4BXOB 2G5HB 2UVVA 4CGZA 3RR7A 3RJHA 3SZ2A 4CRXA 2ZUBA 4EZ9A 2JEGA 2QLTA 4DO9A 5ALIA 5F9LA 1NZPA 2BCRA 1SV0C 5JU5A 5AKZA 2UVUA 4NJ8A 5KFTA 4UBBA 3ZDAA 2DBYA 3GIKA 3ISCA 2C2EA 1KSPA 3UXPA 1COOA 3M9NB 3HJEA 4G3IA 1RYRA 2A1JA 3ETLA 1ZQAA 4I2FA 9ICSA 5EE0A 3ZDDA 3BS5B 3PW7A 9ICPA 4KMOB 3EPGA 5AKKA 2F1HA 1V38A 1S8OA 1KDHA 7ICFA 5DQGA 1X2IA 4QZAA 4TQRA 4K4HA 1JUDA 1S10A 8ICMA 2KVSA 2B21A 2B0CA 2K8BB 3RRGA 5AK3A 5J2AA 4B9VA 2E1EA 4ELVA 4UB5A 2EAOA 2C2DA 3IG8A 4ED1A 4YXMA 1S97A 2LMRA 3B9JA 1N61A 4RQ6A 5E79U 5DBAA 3BQ1A 4OO1J 8ICKA 2AQ0A 1UPHA 1LKYB 1NKCA 8ICVA 4ED7A 1B4FA 1TAQA 3AM9A 3WK7A 2RRDA 4KLSA 4O9MA 9ICCA 2O6KA 9ICQA 3D6JA 5KFSA 3NTUA 4QZIA 1HUOA 1A6SA 3M1YA 4B6JA 4EBCA 3S6JA 2B6GA 5F3XB 2DPJA 5DBCA 2R18A 5ALNA 1IV8A 4C4RA 2KOBA 2AXTU 2MSNA 4AYBF 2KSOB 2RDJA 3ZI4A 1K1QA 2BQ3A 1XC9A 5DB9A 4K4GA 4LZDA 9ICUA 2K4IA 3A0BU 2KIVA 1HIWA 4UARA 1YZ7A 2OM6A 9ICOA 1QQ6A 2KFZA 1NK9A 1KFTA 4DOCA 1AROP 5AM3A 4DSEA 2KV2A 2HW3A 1HUZA 1KKXA 1BPZA 3RB0A 2IOFA 3U26A 4EENA 2G5IB 4QWBA 5J0YA 4CCHA 2W43A 5DDMA 2LBOA 4O3NA 2E1FA 4DFPA 4I2CA 3GV7B 5CB1A 3RH6A 2ISOA 2IBKA 4I2HA 2ZIXA 2F2AB 2ZJ5A 3D2QA 3LWMA 3SV3A 5C0YA 2QB0B 2ZJ8A 2GH1A 4P0QA 1KRPA 4EEYA 8ICIA 4DS5A 2I1QA 2KHVA 1S0VA 1F44A 1DOQA 8ICEA 3FC4A 4F4YA 1F0MA 3ZD9A 4F2RA 1L8OA 1ZD3A 5AKJA 4EELA 5KFGA 4O0IA 3GILA 4DLGA 3C21A 4J03A 4GXJA 3V6JA 4MFCA 1XSNA 2FPMA 2DKXA 4NLCA 3E0FA 3RJKA 2Y9TA 3RH5A 4CF5A 4RPZA 4F72A 5ALRA 1ZOLA 4Y2XA 2JEFA 3KHRA 1VLBA 2HCFA 3WU2U 2LHTA 2PMZC 4I28A 3TFSA 2K8AA 1RXVA 2YB1A 4RQ5A 5J8YC 4RT3A 4ICAA 3ZD8A 2FE9A 2JXJA 1L7OA 1TAUA 3HRDD 1ZQDA 4QNLA 1UCVA 3QU5A 1XO1A 3TACB 2H5XA 2NYVA 3D2NA 1RXWA 1N5WA 2NO5A 2J6UA 4I2IA 2R8HA 4QWCA 3LWLA 2FPLA 1X9XA 2IHNA 5ALXA 3TARA 3OSPA 5AKIA 1V9PA 5J0PA 1ED1A 4Q8EA 3JPPA 5B66U 2E3TA 2VA3A 2RDIA 1L6NA 2XGQA 3T5JA 1GO3F 2AGPA 3OJSA 4QZGA 4M9LA 3DV9A 4BXOA 3OHAA 4NL9C 3KZXA 4B9LA 2XY7A 3HWTA 3KHHA 5AIBA 3FAHA 5J2JA 3DDHA 7ICSA 2ASJA 3IG5A 5KAIU 2PFOA 1TE2A 1TVAA 4Z6FA 2WB1C 9ICAA 2LI6A 1KFSA 2OHFA 1C7YA 2BGWA 1NKBA 2ESEA 2WF9A 5DG7A 2WF6A 3QZ7A 3ZDCA 4Z6CA 4DS4A 1U9LA 1L3SA 2EH9A 1Q8KA 4IC9A 5EOZA 4O3PA 2PFQA 3THVA 2E8MA 2R8IA 1ZQSA 3TAQA 2H3ZA 3M9MB 2W8KA 4KLIA 1T4GA 4C8NA 2KEYA 1MQ3A 5J2DA 5CP2A 2F76X 3QUCA 3AMZA 2Y1IA 3PO4A 2YTUA 4Y2QA 3ZDEA 2DQNB 3JPTA 2NRTA 5ALVA 5J8YA 4PGYA 1D8LA 5EE1A 2F1IA 3G6XA 4C8KA 5HR7A 9ICFA 2K89A 1ZETA 1RM6C 4Y2RA 2HVHA 3M6KA 4RQNA 2XO7A 3QE9Y 4XA5A 2JZBA 2GWSA 2R8JA 5L1JA 2PI4A 1BPXA 1WYGA 1Z1VA 2G07A 2HHWA 4NM2A 5B5EU 4UB2A 2IMWP 4DFMA 4ECXA 4TURA 3PX6A 2FLLA 2HBLA 2VKQA 3GIJA 1TKDA 4HAIA 1S9FA
chains in the Genus database with same CATH topology
4YMOA 4RQ1A 4UB1A 3JPNA 3AU6A 1ZQPA 3PNCA 4I2GA 4PHPA 2PFNA 3JPRA 4F5RA 7ICHA 3B0YA 4I2AA 4KLQA 3AU2A 3ISDA 5IIOA 4QZDA 8ICPA 4KLEA 5TZVA 5J2EA 4PGQA 5DBBA 4YD2A 4PH5A 4PPXA 4IQUA 5J2KA 4I27A 3JPQA 1ZQJA 4X5VA 1ZQFA 3RJFA 5J0OA 5J2FA 4QZ8A 8ICYA 7ICPA 4IQVA 4PGXA 5J2IA 7ICQA 4KLGA 7ICVA 4M47A 2BCSA 3C5FA 4KLTA 5J0QA 9ICIA 4M9NA 5IIKA 4TUSA 3RJHA 5D49A 5J2GA 8ICQA 3UXNA 4DO9A 9ICLA 1NZPA 7ICRA 5J0SA 2BPGA 2BCRA 4K4IA 3V7JA 7ICUA 4LZGA 4UBBA 4FO6A 2FMPA 9ICKA 3ISCA 3UXPA 3RJJA 9ICWA 4Z6DA 3MDAA 1ZQAA 4I2FA 9ICSA 7ICOA 9ICPA 4LVSA 4MFAA 4QZEA 9ICMA 1KDHA 7ICJA 2IHMA 7ICFA 4QZAA 5DKWA 1RZTA 4K4HA 4RQ8A 8ICMA 4R63A 4QZFA 3ISBA 4I2EA 5J2AA 5IIMA 3JPSA 4UB5A 2PXIA 1ZQGA 4R65A 4RPYA 9ICBA 8ICNA 4PHAA 4RQ6A 4M9GA 5DBAA 2P66A 8ICKA 9ICTA 5J2CA 3HX0A 7ICIA 8ICVA 4F5PA 4NM1A 4Z6EA 1ZQNA 4I2BA 4M9HA 4GXIA 3JPOA 7ICLA 4KLSA 4O9MA 9ICCA 9ICQA 4JWNA 4QZIA 1HUOA 3RJGA 4UAYA 4KLLA 1ZQBA 4P2HA 5DBCA 1BPEA 7ICEA 5CWRA 5J2BA 4XUSA 4NXZA 8ICLA 1ZQCA 1ZQQA 5DB9A 1ZQEA 4K4GA 4LZDA 9ICUA 5HHIA 4KLHA 2I9GA 5DDYA 5J0WA 3HW8A 9ICOA 3MGIA 4IQWA 5D46A 3AUOA 4DOCA 5J0XA 2BCUA 4RQ3A 3C2LA 2FMSA 4QZCA 4RT2A 4RQ7A 3MBYA 1HUZA 8ICRA 1BPZA 4RPXA 5J0YA 3V7KA 4M0AA 9ICNA 3UPQA 4I2CA 5IILA 5CB1A 4QZBA 3RH6A 2ISOA 4I2HA 4O5KA 5DB8A 5J2HA 1XSPA 1DK3A 8ICIA 5BOMA 3RJIA 4RQ4A 8ICEA 8ICAA 5HHHA 9ICHA 4O5CA 5D4BA 4MF2A 3MGHA 2ISPA 8ICWA 4UB3A 4GXJA 4MFCA 8ICGA 1XSNA 4UB4A 3UQ0A 1BPDA 8ICUA 3RJKA 4PHDA 3RH5A 4UAZA 7ICTA 4RPZA 5DB7A 1ZQHA 1BPYA 9ICRA 3RJEA 9ICEA 4GXKA 5DB6A 4I28A 3TFSA 1BNOA 1JMSA 4KLJA 1ZJNA 4RQ5A 2KP7A 1ZQLA 4NLKA 3V7LA 4RT3A 3UXOA 4NY8A 5J0UA 1ZQDA 2BCVA 4YN4A 9ICVA 1ZQMA 8ICXA 3RH4A 8ICSA 3LK9A 3OGUA 4QZ9A 8ICCA 5IIIA 4I2IA 5IINA 7ICGA 4M2YA 1ZJMA 4NLNA 4I2DA 4TUQA 7ICNA 5J0PA 3JPPA 4R66A 5J29A 4M9JA 4QZGA 4M9LA 4I2JA 1DK2A 4UBCA 8ICOA 4RQ0A 3PMLA 3HWTA 8ICHA 5IIJA 3GDXA 1TV9A 2FMQA 2W9MA 4F5OA 4KLFA 5J2JA 4YMMA 7ICSA 4TUPA 5J0TA 2PFOA 1ZQKA 1TVAA 4KLOA 4Z6FA 5J0RA 2BCQA 9ICAA 7ICMA 2BPFA 4RQ2A 8ICBA 7ICKA 4YD1A 4Z6CA 4R64A 8ICFA 1ZQTA 3PMNA 5EOZA 2PFPA 2PFQA 4YCXA 3UQ2A 5BPCA 1ZQSA 1MQ2A 4PHEA 4KLIA 4M04A 4DOAA 3MDCA 3C2KA 4F5QA 1MQ3A 5J2DA 3TFRA 8ICTA 4KLUA 3JPTA 1BNPA 4I29A 4NLZA 4PGYA 1ZQOA 9ICFA 4F5NA 3B0XA 9ICXA 8ICJA 4KLMA 8ICZA 4XA5A 9ICGA 4MF8A 3C5GA 2GWSA 4IQTA 3V72A 1BPXA 1XSLA 3C2MA 1KEJA 4O5EA 4KLDA 4NM2A 4UB2A 1ZQRA 9ICJA 5BOLA 1ZQIA 4TURA 4QZHA 4DOBA 4MFFA 4JWMA 4UAWA 4YMNA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4YMO A;  4RQ1 A;  4UB1 A;  3JPN A;  3AU6 A;  1ZQP A;  3PNC A;  4I2G A;  4PHP A;  2PFN A;  3JPR A;  4F5R A;  7ICH A;  3B0Y A;  4I2A A;  4KLQ A;  3AU2 A;  3ISD A;  5IIO A;  4QZD A;  8ICP A;  4KLE A;  5TZV A;  5J2E A;  4PGQ A;  5DBB A;  4YD2 A;  4PH5 A;  4PPX A;  4IQU A;  5J2K A;  4I27 A;  3JPQ A;  1ZQJ A;  4X5V A;  1ZQF A;  3RJF A;  5J0O A;  5J2F A;  4QZ8 A;  8ICY A;  7ICP A;  4IQV A;  4PGX A;  5J2I A;  7ICQ A;  4KLG A;  7ICV A;  4M47 A;  2BCS A;  3C5F A;  4KLT A;  5J0Q A;  9ICI A;  4M9N A;  5IIK A;  4TUS A;  3RJH A;  5D49 A;  5J2G A;  8ICQ A;  3UXN A;  4DO9 A;  9ICL A;  1NZP A;  7ICR A;  5J0S A;  2BPG A;  2BCR A;  4K4I A;  3V7J A;  7ICU A;  4LZG A;  4UBB A;  4FO6 A;  2FMP A;  9ICK A;  3ISC A;  3UXP A;  3RJJ A;  9ICW A;  4Z6D A;  3MDA A;  1ZQA A;  4I2F A;  9ICS A;  7ICO A;  9ICP A;  4LVS A;  4MFA A;  4QZE A;  9ICM A;  1KDH A;  7ICJ A;  2IHM A;  7ICF A;  4QZA A;  5DKW A;  1RZT A;  4K4H A;  4RQ8 A;  8ICM A;  4R63 A;  4QZF A;  3ISB A;  4I2E A;  5J2A A;  5IIM A;  3JPS A;  4UB5 A;  2PXI A;  1ZQG A;  4R65 A;  4RPY A;  9ICB A;  8ICN A;  4PHA A;  4RQ6 A;  4M9G A;  5DBA A;  2P66 A;  8ICK A;  9ICT A;  5J2C A;  3HX0 A;  7ICI A;  8ICV A;  4F5P A;  4NM1 A;  4Z6E A;  1ZQN A;  4I2B A;  4M9H A;  4GXI A;  3JPO A;  7ICL A;  4KLS A;  4O9M A;  9ICC A;  9ICQ A;  4JWN A;  4QZI A;  1HUO A;  3RJG A;  4UAY A;  4KLL A;  1ZQB A;  4P2H A;  5DBC A;  1BPE A;  7ICE A;  5CWR A;  5J2B A;  4XUS A;  4NXZ A;  8ICL A;  1ZQC A;  1ZQQ A;  5DB9 A;  1ZQE A;  4K4G A;  4LZD A;  9ICU A;  5HHI A;  4KLH A;  2I9G A;  5DDY A;  5J0W A;  3HW8 A;  9ICO A;  3MGI A;  4IQW A;  5D46 A;  3AUO A;  4DOC A;  5J0X A;  2BCU A;  4RQ3 A;  3C2L A;  2FMS A;  4QZC A;  4RT2 A;  4RQ7 A;  3MBY A;  1HUZ A;  8ICR A;  1BPZ A;  4RPX A;  5J0Y A;  3V7K A;  4M0A A;  9ICN A;  3UPQ A;  4I2C A;  5IIL A;  5CB1 A;  4QZB A;  3RH6 A;  2ISO A;  4I2H A;  4O5K A;  5DB8 A;  5J2H A;  1XSP A;  1DK3 A;  8ICI A;  5BOM A;  3RJI A;  4RQ4 A;  8ICE A;  8ICA A;  5HHH A;  9ICH A;  4O5C A;  5D4B A;  4MF2 A;  3MGH A;  2ISP A;  8ICW A;  4UB3 A;  4GXJ A;  4MFC A;  8ICG A;  1XSN A;  4UB4 A;  3UQ0 A;  1BPD A;  8ICU A;  3RJK A;  4PHD A;  3RH5 A;  4UAZ A;  7ICT A;  4RPZ A;  5DB7 A;  1ZQH A;  1BPY A;  9ICR A;  3RJE A;  9ICE A;  4GXK A;  5DB6 A;  4I28 A;  3TFS A;  1BNO A;  1JMS A;  4KLJ A;  1ZJN A;  4RQ5 A;  2KP7 A;  1ZQL A;  4NLK A;  3V7L A;  4RT3 A;  3UXO A;  4NY8 A;  5J0U A;  1ZQD A;  2BCV A;  4YN4 A;  9ICV A;  1ZQM A;  8ICX A;  3RH4 A;  8ICS A;  3LK9 A;  3OGU A;  4QZ9 A;  8ICC A;  5III A;  4I2I A;  5IIN A;  7ICG A;  4M2Y A;  1ZJM A;  4NLN A;  4I2D A;  4TUQ A;  7ICN A;  5J0P A;  3JPP A;  4R66 A;  5J29 A;  4M9J A;  4QZG A;  4M9L A;  4I2J A;  1DK2 A;  4UBC A;  8ICO A;  4RQ0 A;  3PML A;  3HWT A;  8ICH A;  5IIJ A;  3GDX A;  1TV9 A;  2FMQ A;  2W9M A;  4F5O A;  4KLF A;  5J2J A;  4YMM A;  7ICS A;  4TUP A;  5J0T A;  2PFO A;  1ZQK A;  1TVA A;  4KLO A;  4Z6F A;  5J0R A;  2BCQ A;  9ICA A;  7ICM A;  2BPF A;  4RQ2 A;  8ICB A;  7ICK A;  4YD1 A;  4Z6C A;  4R64 A;  8ICF A;  1ZQT A;  3PMN A;  5EOZ A;  2PFP A;  2PFQ A;  4YCX A;  3UQ2 A;  5BPC A;  1ZQS A;  1MQ2 A;  4PHE A;  4KLI A;  4M04 A;  4DOA A;  3MDC A;  3C2K A;  4F5Q A;  1MQ3 A;  5J2D A;  3TFR A;  8ICT A;  4KLU A;  3JPT A;  1BNP A;  4I29 A;  4NLZ A;  4PGY A;  1ZQO A;  9ICF A;  4F5N A;  3B0X A;  9ICX A;  8ICJ A;  4KLM A;  8ICZ A;  4XA5 A;  9ICG A;  4MF8 A;  3C5G A;  2GWS A;  4IQT A;  3V72 A;  1BPX A;  1XSL A;  3C2M A;  1KEJ A;  4O5E A;  4KLD A;  4NM2 A;  4UB2 A;  1ZQR A;  9ICJ A;  5BOL A;  1ZQI A;  4TUR A;  4QZH A;  4DOB A;  4MFF A;  4JWM A;  4UAW A;  4YMN A; 
#chains in the Genus database with same CATH topology
 1NJY A;  1KW4 A;  4UB1 A;  2QAR B;  5HP4 A;  3BDP A;  4F5R A;  3ALR A;  4GFJ A;  1RYS A;  1PK1 B;  1JX4 A;  2KSO A;  5DBB A;  3HKZ C;  4PH5 A;  4NL9 A;  3N4M B;  5G5H A;  5J2K A;  2KJ5 A;  4I27 A;  3JPQ A;  1ZQJ A;  3KZI U;  4X5V A;  2C22 A;  3H0L B;  5J0O A;  3NAS A;  5EWG A;  1A0P A;  4IQV A;  4OD0 A;  4ZOH C;  3E2E A;  1N56 A;  3OHB A;  2E8O A;  1DGS A;  2MAX A;  5ALL A;  2XVT A;  4PZN A;  2VA8 A;  4EEK A;  1WWV A;  4Y2Y A;  1KLN A;  2HBK A;  1RDF A;  1BVS A;  1RYU A;  2V4R A;  4J9S A;  3SEI A;  2DGZ A;  4Y2S A;  4KLT A;  2MU2 A;  2ODG A;  1U4B A;  2ZIV A;  5DG8 A;  4IRD A;  2NV3 A;  1Q3U A;  2ALZ A;  1MA7 A;  5D49 A;  2WFA A;  2QB0 A;  4B9M A;  8ICQ A;  5CJ7 A;  3UXN A;  4C8M A;  5CR0 A;  2KMD A;  1PK3 A;  2BPG A;  2JEI A;  3UMG A;  2WHE A;  3H0M B;  3NRW A;  1DGJ A;  2BDP A;  4ECS A;  3BQ2 A;  4DL5 A;  2YMQ A;  2EAP A;  3QZ8 A;  4FO6 A;  5L1I A;  2FMP A;  9ICK A;  3SD7 A;  2WAQ C;  3PZP A;  2H3V A;  4J9M A;  1XS9 D;  3DEE A;  1X42 A;  3N7R C;  2NRX A;  4DSI A;  1TK8 A;  2JHD A;  3FDS A;  4LVS A;  4UAU A;  4MFA A;  3V6K A;  1JRP A;  9ICM A;  2IHM A;  4B9N A;  4FBU A;  1RZT A;  1SV4 A;  3LDA A;  3T5L A;  5KFW A;  2XIC A;  4YXJ A;  3ISB A;  4WJ3 B;  4FS1 A;  4I2E A;  1HEK A;  4JMU A;  5CHG A;  2FLN A;  2A1A A;  5AKG A;  1ZQG A;  2VA2 A;  4EBD A;  4DQP A;  4M9G A;  4DFD A;  3RAQ A;  2MUT B;  4ZH4 A;  1YT3 A;  1JIH A;  5J2C A;  4J9P A;  2AGQ A;  4F5P A;  4NM1 A;  2DWQ A;  1ZQN A;  4I2B A;  3QU4 A;  2Y9U A;  2C28 A;  1NK0 A;  3KKA C;  3GV8 B;  3TAD C;  2ATL A;  4PJ0 U;  4ED3 A;  3LVW A;  5ALZ A;  4KLL A;  4P2H A;  1BPE A;  3G6V A;  1NJW A;  2K60 A;  3BZK A;  4Q45 A;  3QEA Z;  3C28 A;  2G09 A;  4Y2U A;  1X6J A;  3F5A A;  3AN1 A;  2VJ4 A;  2VJ5 A;  3RF9 A;  4NXZ A;  4QIW C;  5AI6 A;  4RZR A;  2AJQ A;  1NZB A;  4YVZ A;  3ZDB A;  5T14 A;  5HHI A;  5TIS U;  2I9G A;  3PSP A;  2W7P A;  1UA1 A;  5KFC A;  1V85 A;  2YMM A;  4DL7 A;  2BCU A;  4QZC A;  2AHO B;  3MBY A;  2W55 A;  3J81 j;  3SV4 A;  2KKP A;  2BR0 A;  2AU0 A;  4O5K A;  3RR8 A;  5KT5 A;  1XSP A;  2LM1 A;  1DK3 A;  5L1L A;  4UAV A;  1L3T A;  3QU7 A;  3MR3 A;  5DQH A;  2KZ3 A;  5HHH A;  2WB1 F;  9ICH A;  5DGB A;  3T5K A;  5ALW A;  4QJF B;  4R8U B;  4KN7 A;  3IRU A;  2JH7 A;  5AKX A;  3MR2 A;  2F8K A;  4UB4 A;  2L5Y A;  2WF8 A;  4P4O A;  5EE9 A;  3R9K A;  1YZ6 A;  4ACO A;  4UAZ A;  3QUQ A;  4C7Z A;  3KKA A;  4US9 A;  3H7I A;  3FYH A;  1BPY A;  2KK0 A;  2ZIW A;  4RNM A;  4XQ8 A;  1S0M A;  9ICR A;  3RJE A;  4YFK A;  4GXK A;  5KG0 A;  3LVV A;  2ZJA A;  5AI9 A;  3WK9 A;  2QAR A;  2NRW A;  4KLJ A;  1RG6 A;  2E8P A;  4ED0 A;  1NNL A;  1PK1 A;  1RQL A;  5KTQ A;  1NK8 A;  3UXO A;  1QSY A;  1ZQZ A;  4C0Z A;  4YN4 A;  3IM1 A;  8ICX A;  4DFJ A;  1Z4O A;  8ICS A;  4FE3 A;  2HHX A;  2EDU A;  1FEZ A;  2KN7 A;  3LK9 A;  3F2C A;  1IG6 A;  1KN5 A;  5III A;  2K4E A;  4DCC A;  4M2Y A;  4NLN A;  4JK1 A;  5DG9 A;  4I2D A;  5KFM A;  3C23 A;  3VCB A;  1L3U A;  1SV0 A;  4BX9 C;  1JRO A;  7ICN A;  2KZZ A;  4QWE A;  4C7Y A;  1J97 A;  4R66 A;  2Q0Z X;  2HDO A;  1FFU A;  5J29 A;  2W9C B;  5AK5 A;  2PI5 A;  4RNO A;  4OJO A;  4YR3 A;  3TAP A;  1DK2 A;  3A0H U;  4UBC A;  8ICO A;  5IIJ A;  4OJP A;  1JXE A;  2FMQ A;  2W9M A;  4KLF A;  4YMM A;  4TUP A;  1X9W A;  4C4S A;  5KFL A;  3N7P D;  4PZO A;  4RQM A;  2V9W A;  1NK6 A;  1SIJ A;  2BQU A;  1NK5 A;  5AK6 A;  2GO7 A;  1SZH A;  4IS7 A;  1NJZ A;  2OWO A;  7ICK A;  2N1R A;  3QU2 A;  5KFJ A;  1CRX A;  4YQW A;  4R64 A;  3CP8 A;  2PFP A;  2BPC A;  4GLX A;  2ES6 A;  3UQ2 A;  4O3Q A;  5BPC A;  3CRX A;  4M04 A;  2HI0 A;  4IL6 U;  2JV3 A;  1TK0 A;  1SKW A;  3MDC A;  1XO0 A;  4F5Q A;  1P7D A;  2GLE A;  3M8S A;  1T8E A;  1VDV A;  2WAQ F;  3H40 A;  1J2M A;  4OCZ A;  5KT6 A;  5HR6 A;  2FI1 A;  2HOI A;  2RHF A;  2FJ6 A;  4ECW A;  5EWE A;  1K1S A;  3PW2 A;  4UB6 U;  4F5N A;  2HMX A;  8ICJ A;  1PVP A;  2MUT A;  1T3Q A;  1PZN A;  1HJP A;  3F5E A;  4MF8 A;  3F53 A;  3V72 A;  2D3D A;  2ZIU B;  5AIA A;  5JRT A;  4O5E A;  4DLE A;  1ZQ1 C;  2W54 A;  2W9B A;  4DL4 A;  3T5H A;  3K4G A;  1RQN A;  3RB6 A;  3Q8M A;  2KJ9 A;  5ALK A;  1ZRM A;  4Q44 A;  1L8L A;  3WK6 A;  4EZ6 A;  3QUB A;  3PNC A;  1CEZ A;  4EYI B;  2XI9 A;  1SWV A;  1L7N A;  2YMP A;  2PFN A;  3B0Y A;  3EYZ A;  4KLQ A;  1WG8 A;  2KKV A;  3AU2 A;  5IIO A;  4QZD A;  4KLE A;  5HML A;  2J6T A;  1SXD A;  3N28 A;  4PGQ A;  2WF5 A;  3QXG A;  1L7P A;  4IQU A;  2AH5 A;  5AKY A;  1ZQF A;  2F44 A;  2K4H A;  5J2F A;  2JEJ A;  8ICY A;  2K8C B;  4EX6 A;  4Y2P A;  3AEV A;  1S5L U;  4PGX A;  2KTQ A;  1DRG A;  3H8S A;  1U48 A;  2EZY A;  4FZL A;  1SKR A;  3PR4 A;  1Z4N A;  2HHT A;  1K5O A;  4QIW F;  5KFD A;  4US8 A;  1Z3E B;  1ZYQ A;  4BJQ A;  1UA0 A;  4M9N A;  5AKL A;  5KFI A;  3WKE A;  2IOF K;  5KFU A;  5J2G A;  2IOH A;  3TKA A;  2R8G A;  5DQI A;  7ICR A;  5J0S A;  1QSS A;  2MA1 A;  2XGP A;  4QWA A;  4K4I A;  3V7J A;  5CEH A;  3ETR A;  3MFI A;  3BS5 A;  1UT5 A;  7ICU A;  2P35 A;  4F93 B;  3NVY A;  4R8U A;  4ECV A;  1ZD4 A;  1X9M A;  1L5U A;  2M0N A;  5KG7 A;  9ICW A;  5EE3 A;  3MDA A;  7ICO A;  2G06 A;  4LJX A;  2ZTD A;  1FIQ A;  1QQ7 A;  7ICJ A;  1DXS A;  5DKW A;  2ASL A;  4AP9 A;  4Q8F A;  4R63 A;  2JGA A;  5KFE A;  1LKY A;  5ALF A;  3EW9 A;  3JPS A;  5KG4 A;  4QW9 A;  2DF4 B;  4KMU A;  2PXI A;  4R65 A;  3MFH A;  8ICN A;  1URJ A;  4DSL A;  2AGO A;  2P66 A;  1D8B A;  9ICT A;  2LYA A;  1D9D A;  3MGV A;  1ZD2 P;  3NS1 A;  3HX0 A;  1SL2 A;  7ICI A;  2W7O A;  4NLG A;  2FPK A;  4Z6E A;  1Q46 A;  3GFK B;  3RB3 A;  4GXI A;  3JPO A;  7ICL A;  4JWN A;  3RJG A;  4UAY A;  4ED8 A;  4ECZ A;  1COK A;  3MR5 A;  2RLT A;  1LB2 B;  5JUM A;  4AYB C;  7ICE A;  3QUT A;  5CWR A;  2XCP A;  4J9L A;  4B9S A;  2C2R A;  5J2B A;  1JN3 A;  2LYB A;  3PW4 A;  1Q3V A;  3MAB A;  2AQ4 A;  8ICL A;  4F4W A;  3T3F A;  1ZQC A;  1ZQQ A;  4O3M A;  1N48 A;  3I28 A;  1NOM A;  4ECU A;  4J9R A;  2HBM A;  2OXO A;  2BDU A;  3HW8 A;  2VAN A;  2W9A A;  3SQI A;  2P6R A;  3GU3 A;  3AUO A;  2XID A;  2CRX A;  5J0X A;  2CPR A;  2FMS A;  4P4P A;  8ICR A;  2KNJ A;  1S76 D;  3IN5 A;  3BQ7 A;  3V7K A;  4M0A A;  5KT2 A;  9ICN A;  2LPE A;  4QZB A;  2H3F A;  5DB8 A;  4C8L A;  3EWA A;  2VIX A;  2XY6 A;  5AKE A;  3ICX A;  4JV2 A;  5KFP A;  3UMC A;  4CNQ A;  3MR6 A;  1BPB A;  8ICA A;  5ALY A;  1Z1B A;  4P0P B;  4O5C A;  1NK4 A;  4MF2 A;  4IRC A;  1WCN A;  1UT8 A;  2YY6 A;  3KHG A;  2M9N A;  3OSN A;  1SWW A;  2XCA A;  1CI4 A;  8ICU A;  4PHD A;  3FM9 A;  4BWM A;  4Y2T A;  2GOL A;  5KFX A;  5DB7 A;  2V4Q A;  1ZQH A;  4DSJ A;  5KFQ A;  2ZIU A;  3AQE A;  4Y2J A;  1IM4 A;  4RUA A;  3KOO A;  4MEY A;  4DWI A;  2ZXH A;  9ICE A;  2NRZ A;  5KNI A;  1O03 A;  4O3R A;  2Y1J A;  2EQY A;  3GII A;  5DB6 A;  3G6Y A;  5AK4 A;  1BNO A;  3OTQ A;  4B9U A;  2YX8 A;  2PMZ F;  3RFA A;  1B22 A;  3V7L A;  2OYY A;  3M7D A;  2UVW A;  2KVC A;  4NY8 A;  5J0U A;  2KJ8 A;  3QU9 A;  3C1Y A;  3O0F A;  4MEX A;  5L9X A;  4JV1 A;  5KT7 A;  3H8W A;  4F4Z A;  1NKE A;  1SL0 A;  3CYM A;  3SYZ A;  3H4B A;  1NJX A;  4FFD A;  4DQR A;  4U7C A;  1KFD A;  5IIN A;  7ICG A;  1KQQ A;  1ZJM A;  3GV5 B;  5GTI U;  3NUQ A;  1ZD5 A;  4RU9 A;  2CXY A;  4IR1 A;  3SAF A;  4TUQ A;  1QTM A;  3F2D A;  3L4P A;  1B0X A;  2HHQ A;  2KIW A;  1N63 A;  3BZC A;  2H3I A;  1M6Y A;  4M9J A;  2W04 A;  1TAM A;  2J6S A;  4A8E A;  3RRH A;  3WKD A;  3QNM A;  5A0L A;  4TQS A;  2G0A A;  4RQ0 A;  1UQV A;  8ICH A;  1FO4 A;  3SAH A;  3TQ1 A;  5ALM A;  1TV9 A;  5KFN A;  4FZN A;  1QSL A;  5ALQ A;  4C8O A;  2WF7 A;  4ELU A;  4EX7 A;  5J0T A;  4JV0 A;  2LKY A;  4DF8 A;  4KLO A;  1S0N A;  1XNS A;  7ICM A;  4YR0 A;  4RQ2 A;  2NRV A;  5KL1 B;  8ICB A;  1PVQ A;  2YB4 A;  1LVH A;  3ORY A;  1U47 A;  3SMV A;  4M6W B;  2KD1 A;  4DOA A;  3UMB A;  2HVI A;  1WUD A;  3C2K A;  4RUC A;  5DLF A;  3LYS A;  3BS7 A;  1Z00 B;  2LM4 A;  4PL1 A;  8ICT A;  3L5K A;  2DFL A;  3Q8L A;  2YML A;  3NVV A;  3RB4 A;  3WK4 A;  1SZP A;  2JMG A;  3TAD A;  3IDW A;  5AM5 A;  2OEH A;  1JAL A;  1QQ5 A;  3B0X A;  9ICX A;  4EBE A;  3C5G A;  3SI8 A;  4UW9 A;  2P6U A;  4GC7 A;  3KFU F;  2KE7 A;  5DGA A;  1KEJ A;  4FBT A;  3BQ0 A;  3VC8 A;  5KFF A;  5ALT A;  2HSZ A;  4QZH A;  4DOB A;  4MFF A;  1VJ5 A;  2JZB B;  4UAW A;  5G5G A;  3PSF A;  4G9B A;  4RQ1 A;  3EZ5 A;  3JPN A;  2W3S A;  5AI4 A;  4I2G A;  1CUK A;  3ED5 A;  4Q43 A;  3JPR A;  7ICH A;  3QEB Z;  2KZM A;  5TZV A;  5KFA A;  5J2E A;  4F4X A;  4O3S A;  5L1K A;  5AM4 A;  5KFH A;  2DUY A;  4BWJ A;  4F3O A;  2RQ5 A;  4YR2 A;  5KFV A;  3N7S C;  5ALO A;  2RP5 A;  3PVX A;  3HKZ F;  2HHU A;  1QH9 A;  3SR6 A;  2R8K A;  3RJF A;  1T7P A;  3EPI A;  3AL0 B;  3Q8R B;  3UM9 A;  4J9K A;  1LV5 A;  1NI3 A;  5J2I A;  1Z19 A;  4ELT A;  2KG5 A;  5KG2 A;  3BQT A;  4ECT A;  4F8R A;  4FZM A;  1IIP A;  5J0Q A;  5AM0 A;  5IIK A;  4TUS A;  1D8Y A;  4UAS A;  4ED2 A;  5KG6 A;  4CF3 A;  5KFB A;  3NGD A;  2DL0 A;  9ICL A;  2W03 A;  2F77 X;  1AQ6 A;  2ZIV B;  2IA6 A;  3ONN A;  4P0P A;  4LZG A;  3H8J A;  3H8M A;  1JXL A;  1X6I A;  2Y0S C;  4NV0 A;  5KL8 B;  3Q8S B;  3RJJ A;  2XY5 A;  2JH1 A;  4DSF A;  1H38 A;  2JRZ A;  3PW5 A;  4Z6D A;  3SEN A;  4J9Q A;  1FFV A;  3Q8K A;  1KBU A;  1QCK A;  1J2N A;  2HOQ A;  1MC8 A;  4BUG A;  4QZE A;  2ASD A;  3IV6 A;  1UHU A;  5ALJ A;  3F2B A;  5DLG A;  4RQ8 A;  3GIM A;  5KAF U;  2YQE A;  2NO4 A;  4QZF A;  4E0D A;  5IIM A;  3HIL A;  4ED6 A;  5ALE A;  4RPY A;  9ICB A;  5AI0 A;  4PHA A;  4F71 A;  1XWL A;  1O08 A;  4DL3 A;  2HHS A;  3RAX A;  1T94 A;  5F9N A;  3KBB A;  5C5J A;  3KHL A;  3GZF A;  5CRX A;  4M9H A;  4UQG A;  1B43 A;  4ECY A;  2E8N A;  3K75 D;  1WWU A;  3PW0 A;  1N2X A;  1ZQB A;  2UVR A;  2E5S A;  4MHV A;  3C1Z A;  2KFN A;  1Y88 A;  2ZTC A;  3WKB A;  4DEZ A;  1JI7 A;  2EAM A;  5KFO A;  4XUS A;  1N60 A;  2I6X A;  4PL2 A;  4YG2 A;  3RBD A;  3HT3 A;  2W8L A;  2BZF A;  3N97 B;  5ALG A;  5KFZ A;  1ZQE A;  4OJ5 A;  1KL9 A;  4KLH A;  3TI0 A;  5DDY A;  5J0W A;  4DQS A;  3MGI A;  4IQW A;  4OJL A;  5D46 A;  3E58 A;  2A19 A;  4O3O A;  4RQ3 A;  3C2L A;  1WCL A;  1SXE A;  2HHV A;  4RT2 A;  4RQ7 A;  1QLN A;  4U6P A;  4DL2 A;  2A3V A;  4RPX A;  1MSW D;  4YP3 A;  3UPQ A;  5IIL A;  4ECQ A;  3L3F X;  2QB1 A;  2KIC A;  5J2H A;  1ZQV A;  3M6Z A;  3WKC A;  4OJ6 A;  3MC1 A;  3D2S A;  2JR5 A;  5KFK A;  2PKE A;  5ALP A;  2W11 A;  5EWF A;  2BHN A;  5BOM A;  3RJI A;  1V97 A;  4M6W A;  1ZRN A;  2I5H A;  4RQ4 A;  1ZQU A;  3RTV A;  5D4B A;  4KN4 A;  4F92 B;  3MGH A;  2ISP A;  4NLB A;  1Z00 A;  8ICW A;  4UB3 A;  3C29 A;  3IHQ B;  2LYH A;  4IR9 A;  5H2F U;  2F3N A;  3H4D A;  1U45 A;  8ICG A;  4DL6 A;  1SKS A;  2A1J B;  3UQ0 A;  1BPD A;  3QYP A;  4EYH B;  1ZQY A;  4JUZ A;  3Q8P B;  7ICT A;  2KHQ A;  2ZG6 A;  5AI5 A;  5ALD A;  2HOF A;  4C4T A;  3PO5 A;  3M8R A;  3SAG A;  1N5X A;  4J9O A;  4B9T A;  4DQI A;  1EXN A;  1D9F A;  5KT4 A;  2ZTE A;  4BGD A;  2FDR A;  2ZIW B;  1BGX T;  1JMS A;  1ZJN A;  1OUQ A;  3CNH A;  2KP7 A;  1ZQL A;  4NLK A;  4QW8 A;  3IP4 B;  2ZUC A;  3RBE A;  3PX0 A;  1OW5 A;  2D6F C;  2EZZ A;  1ZXI A;  2BCV A;  3NVZ A;  9ICV A;  1ZQM A;  3RH4 A;  4DFK A;  2H3Q A;  1PVR A;  4GIB A;  5ALU A;  2ZXI A;  3BJY A;  2EZX A;  3OGU A;  5KFR A;  5AIC A;  4QZ9 A;  4CE6 A;  8ICC A;  2XC9 A;  3KD3 A;  2W9C A;  3PR5 B;  5GTH U;  4DF4 A;  5KG5 A;  1L7M A;  1SGG A;  4DQQ A;  3WK5 A;  2Z7J A;  1F5S A;  2DKZ A;  3K1R B;  2FLP A;  3PSI A;  2Q4T A;  2D8C A;  4P4M A;  3PY8 A;  2OCE A;  5HNK A;  3CW2 C;  3NVW A;  3WKA A;  3TAN A;  4F4K A;  2F1J A;  4I2J A;  5JTI A;  2WTF A;  3PML A;  1TFR A;  4F2S A;  3GDX A;  4F5O A;  4DSK A;  4XRH A;  1C20 A;  3T79 A;  1A77 A;  5FP0 A;  1ZQX A;  1ZQK A;  2K4P A;  5HMM A;  5J0R A;  5AM2 A;  4NWI A;  2BCQ A;  3GQC A;  5AHX A;  2EAN A;  5KT3 A;  2BPF A;  1TK5 A;  1ZQW A;  2BKE A;  5ALS A;  5AKH A;  5KFY A;  2ZIX B;  5ALH A;  4YD1 A;  5L1M A;  8ICF A;  1ZQT A;  3PMN A;  4P0Q B;  3V6H A;  4UB8 U;  4YCX A;  1MQ2 A;  5CA7 A;  4PHE A;  1N62 A;  3PV8 A;  3EUB 2;  4RNN A;  1T3N A;  4IRK A;  4HYK A;  1U49 A;  4KIT B;  2Y0S F;  2CN1 A;  5K4L A;  4JB3 A;  3TFR A;  1L3V A;  4KLU A;  1S0O A;  1BNP A;  4I29 A;  4NLZ A;  4F50 A;  4UAT A;  1ZQO A;  3Q8Q B;  2HBJ A;  2G08 A;  4KLM A;  8ICZ A;  9ICG A;  3NRZ A;  5AM1 A;  4ECR A;  4IQT A;  4C80 A;  2F8L A;  1XSL A;  3C2M A;  1KTQ A;  3PX4 A;  5AI8 A;  4CF4 A;  4KLD A;  1ZQR A;  4Y2V A;  9ICJ A;  5BOL A;  1XU4 A;  1ZQI A;  3HPO A;  1S77 D;  1A76 A;  3KTQ A;  4JWM A;  4YMN A;  2ZUD A;  1PUZ A;  2MRL A;  4YMO A;  1NK7 A;  3AU6 A;  1MN8 A;  1ZQP A;  4KX3 A;  4PHP A;  2W9B B;  4I2A A;  3ISD A;  3AQF A;  8ICP A;  4FS2 A;  1SB3 C;  2BQR A;  3QX7 A;  3HP6 A;  1SL1 A;  1RPL A;  4YD2 A;  4PPX A;  1ECW A;  3I76 A;  2DPI A;  2OH2 A;  3K1Z A;  3OJU A;  1IXR A;  4QZ8 A;  7ICP A;  3WK8 A;  1X66 A;  5KG1 A;  4J9N A;  3OPX A;  4F91 B;  7ICQ A;  1OXJ A;  3H0R B;  4KLG A;  3M9O B;  4KTQ A;  7ICV A;  4CDG A;  4M47 A;  4GC6 A;  2YN4 A;  2BCS A;  3C5F A;  4QWD A;  2W3R A;  3PST A;  5KG3 A;  4KX5 A;  3I1Y A;  4USA A;  4BDP A;  1X9S A;  9ICI A;  1X40 A;  2QKQ A;  4BXO B;  2G5H B;  2UVV A;  4CGZ A;  3RR7 A;  3RJH A;  3SZ2 A;  4CRX A;  2ZUB A;  4EZ9 A;  2JEG A;  2QLT A;  4DO9 A;  5ALI A;  5F9L A;  1NZP A;  2BCR A;  1SV0 C;  5JU5 A;  5AKZ A;  2UVU A;  4NJ8 A;  5KFT A;  4UBB A;  3ZDA A;  2DBY A;  3GIK A;  3ISC A;  2C2E A;  1KSP A;  3UXP A;  1COO A;  3M9N B;  3HJE A;  4G3I A;  1RYR A;  2A1J A;  3ETL A;  1ZQA A;  4I2F A;  9ICS A;  5EE0 A;  3ZDD A;  3BS5 B;  3PW7 A;  9ICP A;  4KMO B;  3EPG A;  5AKK A;  2F1H A;  1V38 A;  1S8O A;  1KDH A;  7ICF A;  5DQG A;  1X2I A;  4QZA A;  4TQR A;  4K4H A;  1JUD A;  1S10 A;  8ICM A;  2KVS A;  2B21 A;  2B0C A;  2K8B B;  3RRG A;  5AK3 A;  5J2A A;  4B9V A;  2E1E A;  4ELV A;  4UB5 A;  2EAO A;  2C2D A;  3IG8 A;  4ED1 A;  4YXM A;  1S97 A;  2LMR A;  3B9J A;  1N61 A;  4RQ6 A;  5E79 U;  5DBA A;  3BQ1 A;  4OO1 J;  8ICK A;  2AQ0 A;  1UPH A;  1LKY B;  1NKC A;  8ICV A;  4ED7 A;  1B4F A;  1TAQ A;  3AM9 A;  3WK7 A;  2RRD A;  4KLS A;  4O9M A;  9ICC A;  2O6K A;  9ICQ A;  3D6J A;  5KFS A;  3NTU A;  4QZI A;  1HUO A;  1A6S A;  3M1Y A;  4B6J A;  4EBC A;  3S6J A;  2B6G A;  5F3X B;  2DPJ A;  5DBC A;  2R18 A;  5ALN A;  1IV8 A;  4C4R A;  2KOB A;  2AXT U;  2MSN A;  4AYB F;  2KSO B;  2RDJ A;  3ZI4 A;  1K1Q A;  2BQ3 A;  1XC9 A;  5DB9 A;  4K4G A;  4LZD A;  9ICU A;  2K4I A;  3A0B U;  2KIV A;  1HIW A;  4UAR A;  1YZ7 A;  2OM6 A;  9ICO A;  1QQ6 A;  2KFZ A;  1NK9 A;  1KFT A;  4DOC A;  1ARO P;  5AM3 A;  4DSE A;  2KV2 A;  2HW3 A;  1HUZ A;  1KKX A;  1BPZ A;  3RB0 A;  2IOF A;  3U26 A;  4EEN A;  2G5I B;  4QWB A;  5J0Y A;  4CCH A;  2W43 A;  5DDM A;  2LBO A;  4O3N A;  2E1F A;  4DFP A;  4I2C A;  3GV7 B;  5CB1 A;  3RH6 A;  2ISO A;  2IBK A;  4I2H A;  2ZIX A;  2F2A B;  2ZJ5 A;  3D2Q A;  3LWM A;  3SV3 A;  5C0Y A;  2QB0 B;  2ZJ8 A;  2GH1 A;  4P0Q A;  1KRP A;  4EEY A;  8ICI A;  4DS5 A;  2I1Q A;  2KHV A;  1S0V A;  1F44 A;  1DOQ A;  8ICE A;  3FC4 A;  4F4Y A;  1F0M A;  3ZD9 A;  4F2R A;  1L8O A;  1ZD3 A;  5AKJ A;  4EEL A;  5KFG A;  4O0I A;  3GIL A;  4DLG A;  3C21 A;  4J03 A;  4GXJ A;  3V6J A;  4MFC A;  1XSN A;  2FPM A;  2DKX A;  4NLC A;  3E0F A;  3RJK A;  2Y9T A;  3RH5 A;  4CF5 A;  4RPZ A;  4F72 A;  5ALR A;  1ZOL A;  4Y2X A;  2JEF A;  3KHR A;  1VLB A;  2HCF A;  3WU2 U;  2LHT A;  2PMZ C;  4I28 A;  3TFS A;  2K8A A;  1RXV A;  2YB1 A;  4RQ5 A;  5J8Y C;  4RT3 A;  4ICA A;  3ZD8 A;  2FE9 A;  2JXJ A;  1L7O A;  1TAU A;  3HRD D;  1ZQD A;  4QNL A;  1UCV A;  3QU5 A;  1XO1 A;  3TAC B;  2H5X A;  2NYV A;  3D2N A;  1RXW A;  1N5W A;  2NO5 A;  2J6U A;  4I2I A;  2R8H A;  4QWC A;  3LWL A;  2FPL A;  1X9X A;  2IHN A;  5ALX A;  3TAR A;  3OSP A;  5AKI A;  1V9P A;  5J0P A;  1ED1 A;  4Q8E A;  3JPP A;  5B66 U;  2E3T A;  2VA3 A;  2RDI A;  1L6N A;  2XGQ A;  3T5J A;  1GO3 F;  2AGP A;  3OJS A;  4QZG A;  4M9L A;  3DV9 A;  4BXO A;  3OHA A;  4NL9 C;  3KZX A;  4B9L A;  2XY7 A;  3HWT A;  3KHH A;  5AIB A;  3FAH A;  5J2J A;  3DDH A;  7ICS A;  2ASJ A;  3IG5 A;  5KAI U;  2PFO A;  1TE2 A;  1TVA A;  4Z6F A;  2WB1 C;  9ICA A;  2LI6 A;  1KFS A;  2OHF A;  1C7Y A;  2BGW A;  1NKB A;  2ESE A;  2WF9 A;  5DG7 A;  2WF6 A;  3QZ7 A;  3ZDC A;  4Z6C A;  4DS4 A;  1U9L A;  1L3S A;  2EH9 A;  1Q8K A;  4IC9 A;  5EOZ A;  4O3P A;  2PFQ A;  3THV A;  2E8M A;  2R8I A;  1ZQS A;  3TAQ A;  2H3Z A;  3M9M B;  2W8K A;  4KLI A;  1T4G A;  4C8N A;  2KEY A;  1MQ3 A;  5J2D A;  5CP2 A;  2F76 X;  3QUC A;  3AMZ A;  2Y1I A;  3PO4 A;  2YTU A;  4Y2Q A;  3ZDE A;  2DQN B;  3JPT A;  2NRT A;  5ALV A;  5J8Y A;  4PGY A;  1D8L A;  5EE1 A;  2F1I A;  3G6X A;  4C8K A;  5HR7 A;  9ICF A;  2K89 A;  1ZET A;  1RM6 C;  4Y2R A;  2HVH A;  3M6K A;  4RQN A;  2XO7 A;  3QE9 Y;  4XA5 A;  2JZB A;  2GWS A;  2R8J A;  5L1J A;  2PI4 A;  1BPX A;  1WYG A;  1Z1V A;  2G07 A;  2HHW A;  4NM2 A;  5B5E U;  4UB2 A;  2IMW P;  4DFM A;  4ECX A;  4TUR A;  3PX6 A;  2FLL A;  2HBL A;  2VKQ A;  3GIJ A;  1TKD A;  4HAI A;  1S9F A; 
#chains in the Genus database with same CATH homology
 4YMO A;  4RQ1 A;  4UB1 A;  3JPN A;  3AU6 A;  1ZQP A;  3PNC A;  4I2G A;  4PHP A;  2PFN A;  3JPR A;  4F5R A;  7ICH A;  3B0Y A;  4I2A A;  4KLQ A;  3AU2 A;  3ISD A;  5IIO A;  4QZD A;  8ICP A;  4KLE A;  5TZV A;  5J2E A;  4PGQ A;  5DBB A;  4YD2 A;  4PH5 A;  4PPX A;  4IQU A;  5J2K A;  4I27 A;  3JPQ A;  1ZQJ A;  4X5V A;  1ZQF A;  3RJF A;  5J0O A;  5J2F A;  4QZ8 A;  8ICY A;  7ICP A;  4IQV A;  4PGX A;  5J2I A;  7ICQ A;  4KLG A;  7ICV A;  4M47 A;  2BCS A;  3C5F A;  4KLT A;  5J0Q A;  9ICI A;  4M9N A;  5IIK A;  4TUS A;  3RJH A;  5D49 A;  5J2G A;  8ICQ A;  3UXN A;  4DO9 A;  9ICL A;  1NZP A;  7ICR A;  5J0S A;  2BPG A;  2BCR A;  4K4I A;  3V7J A;  7ICU A;  4LZG A;  4UBB A;  4FO6 A;  2FMP A;  9ICK A;  3ISC A;  3UXP A;  3RJJ A;  9ICW A;  4Z6D A;  3MDA A;  1ZQA A;  4I2F A;  9ICS A;  7ICO A;  9ICP A;  4LVS A;  4MFA A;  4QZE A;  9ICM A;  1KDH A;  7ICJ A;  2IHM A;  7ICF A;  4QZA A;  5DKW A;  1RZT A;  4K4H A;  4RQ8 A;  8ICM A;  4R63 A;  4QZF A;  3ISB A;  4I2E A;  5J2A A;  5IIM A;  3JPS A;  4UB5 A;  2PXI A;  1ZQG A;  4R65 A;  4RPY A;  9ICB A;  8ICN A;  4PHA A;  4RQ6 A;  4M9G A;  5DBA A;  2P66 A;  8ICK A;  9ICT A;  5J2C A;  3HX0 A;  7ICI A;  8ICV A;  4F5P A;  4NM1 A;  4Z6E A;  1ZQN A;  4I2B A;  4M9H A;  4GXI A;  3JPO A;  7ICL A;  4KLS A;  4O9M A;  9ICC A;  9ICQ A;  4JWN A;  4QZI A;  1HUO A;  3RJG A;  4UAY A;  4KLL A;  1ZQB A;  4P2H A;  5DBC A;  1BPE A;  7ICE A;  5CWR A;  5J2B A;  4XUS A;  4NXZ A;  8ICL A;  1ZQC A;  1ZQQ A;  5DB9 A;  1ZQE A;  4K4G A;  4LZD A;  9ICU A;  5HHI A;  4KLH A;  2I9G A;  5DDY A;  5J0W A;  3HW8 A;  9ICO A;  3MGI A;  4IQW A;  5D46 A;  3AUO A;  4DOC A;  5J0X A;  2BCU A;  4RQ3 A;  3C2L A;  2FMS A;  4QZC A;  4RT2 A;  4RQ7 A;  3MBY A;  1HUZ A;  8ICR A;  1BPZ A;  4RPX A;  5J0Y A;  3V7K A;  4M0A A;  9ICN A;  3UPQ A;  4I2C A;  5IIL A;  5CB1 A;  4QZB A;  3RH6 A;  2ISO A;  4I2H A;  4O5K A;  5DB8 A;  5J2H A;  1XSP A;  1DK3 A;  8ICI A;  5BOM A;  3RJI A;  4RQ4 A;  8ICE A;  8ICA A;  5HHH A;  9ICH A;  4O5C A;  5D4B A;  4MF2 A;  3MGH A;  2ISP A;  8ICW A;  4UB3 A;  4GXJ A;  4MFC A;  8ICG A;  1XSN A;  4UB4 A;  3UQ0 A;  1BPD A;  8ICU A;  3RJK A;  4PHD A;  3RH5 A;  4UAZ A;  7ICT A;  4RPZ A;  5DB7 A;  1ZQH A;  1BPY A;  9ICR A;  3RJE A;  9ICE A;  4GXK A;  5DB6 A;  4I28 A;  3TFS A;  1BNO A;  1JMS A;  4KLJ A;  1ZJN A;  4RQ5 A;  2KP7 A;  1ZQL A;  4NLK A;  3V7L A;  4RT3 A;  3UXO A;  4NY8 A;  5J0U A;  1ZQD A;  2BCV A;  4YN4 A;  9ICV A;  1ZQM A;  8ICX A;  3RH4 A;  8ICS A;  3LK9 A;  3OGU A;  4QZ9 A;  8ICC A;  5III A;  4I2I A;  5IIN A;  7ICG A;  4M2Y A;  1ZJM A;  4NLN A;  4I2D A;  4TUQ A;  7ICN A;  5J0P A;  3JPP A;  4R66 A;  5J29 A;  4M9J A;  4QZG A;  4M9L A;  4I2J A;  1DK2 A;  4UBC A;  8ICO A;  4RQ0 A;  3PML A;  3HWT A;  8ICH A;  5IIJ A;  3GDX A;  1TV9 A;  2FMQ A;  2W9M A;  4F5O A;  4KLF A;  5J2J A;  4YMM A;  7ICS A;  4TUP A;  5J0T A;  2PFO A;  1ZQK A;  1TVA A;  4KLO A;  4Z6F A;  5J0R A;  2BCQ A;  9ICA A;  7ICM A;  2BPF A;  4RQ2 A;  8ICB A;  7ICK A;  4YD1 A;  4Z6C A;  4R64 A;  8ICF A;  1ZQT A;  3PMN A;  5EOZ A;  2PFP A;  2PFQ A;  4YCX A;  3UQ2 A;  5BPC A;  1ZQS A;  1MQ2 A;  4PHE A;  4KLI A;  4M04 A;  4DOA A;  3MDC A;  3C2K A;  4F5Q A;  1MQ3 A;  5J2D A;  3TFR A;  8ICT A;  4KLU A;  3JPT A;  1BNP A;  4I29 A;  4NLZ A;  4PGY A;  1ZQO A;  9ICF A;  4F5N A;  3B0X A;  9ICX A;  8ICJ A;  4KLM A;  8ICZ A;  4XA5 A;  9ICG A;  4MF8 A;  3C5G A;  2GWS A;  4IQT A;  3V72 A;  1BPX A;  1XSL A;  3C2M A;  1KEJ A;  4O5E A;  4KLD A;  4NM2 A;  4UB2 A;  1ZQR A;  9ICJ A;  5BOL A;  1ZQI A;  4TUR A;  4QZH A;  4DOB A;  4MFF A;  4JWM A;  4UAW A;  4YMN A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...