1BNPA

Nmr solution structure of the n-terminal domain of dna polymerase beta, 55 structures
Total Genus 12
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
12
sequence length
87
structure length
87
Chain Sequence
MSKRKAPQETLNGGITDMLVELANFEKNVSQAIHKYNAYRKAASVIAKYPHKIKSGAEAKKLPGVGTKIAEKIDEFLATGKLRKLEK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Nucleotidyltransferase (dna-binding)
molecule keywords DNA POLYMERASE BETA
publication title Three-dimensional solution structure of the N-terminal domain of DNA polymerase beta and mapping of the ssDNA interaction interface.
pubmed doi rcsb
source organism Rattus norvegicus
total genus 12
structure length 87
sequence length 87
ec nomenclature ec 2.7.7.7: DNA-directed DNA polymerase.
pdb deposition date 1996-04-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF14716 HHH_8 Helix-hairpin-helix domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.110 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 DNA polymerase beta, N-terminal domain-like 1bnpA00
1HUOA 7ICUA 2BCRA 1XSNA 4RQ7A 4YMMA 1ZJMA 8ICEA 5J0TA 1RZTA 4QZ8A 5IILA 4DOBA 5J0RA 5DBCA 3MGHA 8ICCA 4O5CA 4XA5A 4RQ8A 4UAWA 4DO9A 8ICLA 8ICVA 3RJJA 3C2MA 5BOMA 4KLIA 2PFQA 3JPQA 4F5OA 5J29A 3PNCA 5J2BA 3MDCA 4PPXA 7ICTA 7ICVA 2FMQA 5HHIA 4O5EA 7ICJA 4JWMA 5IIMA 4NY8A 5J2HA 2W9MA 2GWSA 4M9JA 5DB8A 3RJEA 1BPXA 4KLUA 4RQ6A 1ZQJA 4RPZA 4IQTA 3JPOA 8ICHA 8ICRA 7ICRA 1ZQSA 3RJIA 2BPGA 4K4HA 9ICRA 3GDXA 2PFPA 4RQ5A 1ZQHA 5D4BA 2BCUA 1ZQTA 3JPTA 5J0YA 3MDAA 4DOAA 1ZQQA 4R66A 4RQ2A 1ZQOA 4NM2A 4YD2A 7ICGA 3JPSA 4QZDA 3C2LA 3OGUA 9ICBA 9ICTA 4QZFA 3AUOA 4NLNA 9ICEA 5EOZA 4I2HA 4RQ1A 4PGYA 9ICHA 3HW8A 3V7JA 3PMNA 3AU2A 5DBBA 3ISBA 3RH4A 1ZQLA 3ISCA 5IINA 4GXIA 5IIKA 1DK3A 4Z6EA 4NXZA 1ZQKA 4DOCA 1ZQMA 4YN4A 3HX0A 5DB7A 3TFRA 7ICOA 9ICWA 2ISPA 5D49A 5DB6A 3JPPA 4R65A 1ZQEA 8ICOA 1MQ3A 3LK9A 4LVSA 1ZQIA 4PH5A 4YMNA 3V7LA 1ZQAA 4MF8A 4Z6DA 8ICYA 4UBBA 4TUPA 4M9GA 7ICKA 8ICKA 4RQ0A 5J2JA 1JMSA 4M9HA 5J0WA 3JPNA 3UXOA 4Z6FA 3JPRA 9ICXA 1ZQDA 1ZQFA 4PHDA 3PMLA 5J2GA 4PGQA 4TURA 4MF2A 3MGIA 5CB1A 2BCVA 1ZQNA 9ICLA 7ICFA 4I27A 4UB5A 5BPCA 4M9NA 4QZAA 1ZJNA 4YCXA 5DB9A 9ICQA 4I28A 4YD1A 8ICTA 4MFFA 4XUSA 7ICIA 7ICSA 9ICKA 4M2YA 1BNPA 8ICNA 9ICIA 4KLGA 4PGXA 8ICBA 1BPDA 4O5KA 3UQ0A 8ICMA 9ICVA 3B0YA 3MBYA 4UBCA 4RPYA 3RJHA 4PHAA 9ICGA 4QZGA 3RH5A 4UAZA 4UB3A 1XSPA 5J2EA 7ICHA 4M04A 3UXNA 4QZIA 4K4GA 5IIOA 2PXIA 7ICNA 8ICUA 8ICPA 4I2CA 5J2KA 3ISDA 1XSLA 9ICOA 4LZDA 4I2FA 3RJGA 1NZPA 4YMOA 4QZCA 4TUQA 4NLZA 2FMSA 5IIIA 3V7KA 3RJFA 5DBAA 4KLOA 1BNOA 1ZQBA 3TFSA 5BOLA 4M0AA 3UPQA 4I2BA 4IQWA 1MQ2A 4I2DA 8ICJA 4KLFA 5J0PA 8ICZA 4I2AA 1KEJA 4UB1A 1TVAA 4IQUA 4RT3A 2P66A 7ICPA 3UXPA 3B0XA 4R63A 4IQVA 2PFNA 4KLDA 4JWNA 4UAYA 3HWTA 3AU6A 4F5NA 1ZQRA 4F5RA 5J2AA 7ICMA 3C2KA 4M47A 1BPZA 4O9MA 1ZQCA 2FMPA 4KLJA 2KP7A 4I2IA 4QZBA 7ICEA 4I29A 4QZEA 4MFAA 3UQ2A 1HUZA 4Z6CA 8ICFA 1ZQPA 5J0OA 4KLLA 1KDHA 1DK2A 4KLHA 8ICWA 4UB4A 4F5PA 7ICQA 4FO6A 8ICIA 4R64A 3C5GA 5J2IA 1TV9A 4NM1A 4RPXA 2PFOA 4QZHA 5J0SA 4UB2A 4QZ9A 3V72A 4PHPA 9ICSA 7ICLA 8ICGA 9ICUA 5CWRA 5D46A 2BCQA 9ICFA 9ICMA 4M9LA 8ICAA 8ICXA 8ICQA 4I2JA 5J0XA 5TZVA 4RT2A 4P2HA 4RQ4A 1ZQGA 2IHMA 4NLKA 2ISOA 4X5VA 5J2FA 4LZGA 5J0QA 4KLMA 9ICPA 1BPYA 4K4IA 5DKWA 4GXKA 3RH6A 4KLSA 2BPFA 4KLQA 4PHEA 1BPEA 9ICJA 5IIJA 4I2GA 4I2EA 2BCSA 4KLEA 4MFCA 5J0UA 4F5QA 4RQ3A 5HHHA 3RJKA 4TUSA 8ICSA 5DDYA 9ICNA 4KLTA 4GXJA 9ICCA 2I9GA 3C5FA 5J2CA 9ICAA 5J2DA
chains in the Genus database with same CATH superfamily
5KAFU 4RZRA 7ICUA 1XSNA 2HBLA 5CHGA 4BWJA 2HMXA 3OHAA 1LV5A 5AK5A 8ICEA 3SR6A 4CF3A 2A1JB 3TACB 4QIWC 5IILA 2WB1F 1JXLA 1RYUA 5KFCA 1O03A 4DOBA 1N5XA 3NVYA 8ICCA 5ALEA 1T7PA 4XA5A 8ICLA 2JEGA 4JV1A 4YXJA 4O3PA 4E0DA 8ICVA 4QW8A 3NTUA 4RUCA 4NLBA 3PZPA 1MN8A 5EE9A 2JH1A 3PNCA 3RFAA 2KVSA 4O5EA 4Q8EA 4UAUA 3EYZA 2KZZA 4FBTA 5DB8A 2H3IA 4R8UA 3F5AA 1ZQJA 2HOQA 1ZQSA 5ALNA 5DQHA 4K4HA 4DQQA 2PFPA 3WK7A 5TISU 3KKAA 4ED8A 2ZIUA 4RU9A 1NK5A 3ZDAA 3GV5B 3QEAZ 1PZNA 5AI0A 3BJYA 4EENA 2KEYA 2XCPA 3H0MB 2HSZA 2E8PA 4GLXA 3WK6A 4IR1A 1COKA 4ED7A 3OGUA 1WG8A 3FC4A 2H3QA 2KFZA 2Y0SF 1D8LA 4NLNA 2K4EA 4J9RA 4I2HA 4RQ1A 9ICHA 3V7JA 2KN7A 3HW8A 3PMNA 4DFMA 3WKDA 3N7RC 2HDOA 1NJWA 3IM1A 4ECTA 3QEBZ 2W3SA 3K1ZA 5ALYA 4QJFB 3BDPA 3SZ2A 2K8CB 5HMLA 3AQFA 3KBBA 2BR0A 1O08A 3N4MB 1NK7A 5AKKA 4C80A 5HP4A 4JMUA 2WTFA 4QWBA 3HPOA 1ZQMA 4P4MA 5AM4A 5D49A 1JIHA 5DB6A 3JPPA 4R65A 3H8WA 1A0PA 1SXEA 1ZQIA 1S10A 4YMNA 3LVWA 1SKSA 3SAGA 3C1YA 4MF8A 1RYSA 5J8YA 4Z6DA 2ZG6A 8ICYA 5EE0A 4UBBA 2YB4A 2A1JA 1XC9A 1XU4A 2HHXA 4M9GA 2WB1C 2UVUA 5AK6A 2NRWA 2RP5A 2E8OA 2JZBB 2W9AA 8ICKA 1B22A 5FP0A 1SZHA 2RHFA 2PI5A 4Z6FA 2IA6A 3ZD9A 2IOFK 4F4YA 1X6IA 2KD1A 5L1KA 4ECXA 5J2GA 4PGQA 2BDPA 4P0PA 5CB1A 3NS1A 1FEZA 4XQ8A 3N7SC 2UVRA 3ALRA 4QZAA 4ED6A 5AKLA 4B9VA 4J9PA 5EWFA 4CCHA 1X2IA 3GZFA 1URJA 3MR6A 1X9SA 3IDWA 4M2YA 2BHNA 3K1RB 3MABA 9ICIA 3M8RA 2RRDA 4KN4A 1XO1A 5CJ7A 4HYKA 4GC6A 3UQ0A 1ZYQA 3M6KA 3SENA 1TK8A 4NLGA 4F92B 4PHAA 9ICGA 2BPCA 2XY5A 4ZH4A 4GIBA 5AHXA 4UB3A 3Q8MA 3IHQB 1ZD3A 4QWCA 4QZIA 4K4GA 2H3FA 4EEKA 5GTHU 5IIOA 1HIWA 5KFMA 1Z00B 5KFFA 1X6JA 4ACOA 3KHRA 1XSLA 9ICOA 4LZDA 1IG6A 4I2FA 4C8MA 4YG2A 3RJGA 1WCLA 5EWGA 2PMZF 1B43A 2WAQF 4TUQA 4NLZA 3PY8A 3CYMA 2Y0SC 3L3FX 3NUQA 3T3FA 3RJFA 4J9KA 1BNOA 1ZQBA 3TFSA 2NRXA 5BOLA 1HJPA 2EQYA 3G6VA 3SQIA 4KN7A 4C8KA 1C7YA 2E5SA 4ED3A 2P66A 3UXPA 4ELUA 2G5HB 2KZ3A 4C0ZA 4KLDA 1U49A 2C2DA 4YFKA 3AU6A 3DDHA 5J2AA 4UQGA 2CRXA 4M47A 2ZTEA 4C8LA 4EBEA 5KFTA 3PW7A 1ZQCA 5ALQA 1LKYB 4KLJA 2KP7A 5GTIU 4ECZA 1A77A 2XO7A 4P0QB 1S5LU 4QZBA 3C23A 2JMGA 3RB3A 7ICEA 1P7DA 1IXRA 1S8OA 1RQNA 5F9NA 1T3QA 4PZOA 2FE9A 4F4ZA 1Y88A 3MR3A 1QSYA 4NWIA 4Y2JA 2AXTU 2YMPA 4KLLA 3QE9Y 4KLHA 4O3OA 8ICWA 3QZ7A 2JZBA 2G09A 1UA1A 5AM5A 2PFOA 4QZHA 5J0SA 4RQNA 2W8LA 1NK0A 2LYBA 9ICSA 3J81j 3HILA 5AKYA 2YMMA 5F3XB 3TANA 1K1QA 1JUDA 4O3QA 4DFKA 4QWEA 2KV2A 3ZDEA 2R8KA 3BQ0A 9ICUA 5D46A 9ICFA 1V97A 5KG4A 9ICMA 3TKAA 3SI8A 2GOLA 1VJ5A 1FO4A 4KMOB 1JROA 2AGQA 5AM1A 3IV6A 3SYZA 1TKDA 4RT2A 4OJOA 1TFRA 2JH7A 3G6YA 3BQ7A 2RDJA 2IHMA 4LJXA 5ALPA 2ISOA 5KT6A 5J2FA 1K5OA 4KLMA 5F9LA 5EWEA 2DKZA 3RH6A 3TARA 1X42A 5L9XA 4RUAA 2KK0A 4PHEA 3QU5A 5IIJA 4F2RA 3D2NA 4MFCA 2F44A 5HHHA 4DF8A 4Y2QA 8ICSA 3BQTA 3QU4A 4J9SA 2R8GA 4JV2A 3GILA 1CI4A 2E3TA 1RQLA 5J2CA 2DPIA 1WWVA 1CEZA 1COOA 1ZXIA 1SKWA 2DWQA 1NZBA 3OPXA 1TK0A 1HUOA 5KFSA 2CPRA 1L7PA 3C29A 2AU0A 5ALFA 3Q8LA 1ZJMA 1L3SA 2K4PA 3QNMA 5J0TA 2DL0A 2PMZC 4QZ8A 2IHNA 2WAQC 1N62A 1GO3F 1N60A 4B9SA 2WF9A 4RQ8A 2KMDA 2NRZA 4Y2XA 3NGDA 5KFYA 2ZJAA 3HJEA 3KHHA 2I5HA 4F5OA 4P4PA 2HHVA 1IV8A 1JN3A 2LI6A 5J2BA 2ZUCA 5KG5A 4ED2A 4B9NA 4JWMA 2EDUA 4NY8A 2F3NA 2GWSA 3ZI4A 4RNNA 4M9JA 4F3OA 3RJEA 1JXEA 4CF4A 2LKYA 2MUTB 4RPZA 2IBKA 4P0QA 8ICHA 8ICRA 2VA8A 1DOQA 3B9JA 3C21A 3ZDBA 3GDXA 4Y2VA 2FLNA 1TK5A 1NJXA 1ZQHA 1PK1B 2N1RA 2NO5A 3QUBA 2C2EA 2G0AA 3MDAA 5J0YA 1T94A 4FS1A 1N5WA 2KG5A 1ZQQA 1J2NA 4R66A 2EAPA 4JK1A 4DSIA 1A76A 4OD0A 2ASLA 3OHBA 2BQ3A 2W04A 3E2EA 3JPSA 4QZDA 2NO4A 5AKEA 4ECUA 2F77X 2J6TA 1C20A 5KG0A 5DLGA 3AUOA 3OSPA 1KL9A 1BGXT 4FS2A 5DBBA 2EANA 3QU9A 3I76A 2LM4A 5KFGA 4O3NA 4F4KA 4DF4A 1ZOLA 3ISCA 1S9FA 5ALMA 1DK3A 4Z6EA 1Z3EB 1ZQKA 4YN4A 3HX0A 3H8SA 4PJ0U 8ICOA 1MQ3A 3LK9A 5C0YA 2EAMA 4U7CA 1S0VA 3V7LA 1UHUA 2XIDA 1ZQAA 3RB6A 4CDGA 1M6YA 1L3VA 2C2RA 4P0PB 4OJPA 1Q3UA 2ALZA 4O0IA 4KITB 5E79U 5KT2A 5HR6A 1NK8A 1L7MA 3QU2A 4ECWA 4RQ0A 5KFUA 3TAPA 2HHUA 2EH9A 4F4XA 3KTQA 4Y2TA 4O3RA 3RB4A 5JTIA 2YN4A 2A3VA 4TURA 3RB0A 3IG5A 2VJ4A 2KNJA 1U45A 1JALA 1ZQNA 3ICXA 1F5SA 9ICLA 3T5KA 5BPCA 2J6UA 2EAOA 4YCXA 3A0BU 2MAXA 3WK4A 5ALRA 4XUSA 3H4BA 1Z4OA 2W9CB 1QCKA 2MUTA 2KVCA 2IOFA 2MRLA 3F2BA 4KLGA 1SIJA 4OCZA 1TAQA 3WK8A 4PGXA 3S6JA 8ICBA 2F1IA 1PVRA 3MR5A 3EW9A 2DBYA 1KFTA 5K4LA 1Q46A 3L5KA 3B0YA 3EPIA 1PK1A 4US9A 2O6KA 3RJHA 1L5UA 4QZGA 3RH5A 1XSPA 2J6SA 4BX9C 1X66A 1NJYA 3H40A 1KQQA 7ICHA 3UXNA 2ZIVB 3GIIA 1L7NA 1N63A 1ZQYA 2Z7JA 4ECYA 5J2KA 2RDIA 4PZNA 3AL0B 2ZXHA 1DGJA 3GIMA 5KFLA 2FPMA 4BJQA 3SEIA 5IIIA 3T5JA 3MFHA 2K8BB 1V38A 3UMGA 2I1QA 5KFAA 2ZXIA 4DQSA 3UPQA 3ETRA 1S0MA 4I2BA 4MHVA 2MSNA 1WUDA 1XS9D 8ICZA 4I2AA 2MU2A 5KG1A 2ASJA 2ZIXB 1V9PA 4IQUA 5ALGA 4RT3A 3NRZA 4YVZA 2FDRA 7ICPA 2AH5A 4R63A 2AQ4A 4KTQA 4IQVA 1NK9A 2PFNA 2OWOA 4BUGA 3T5HA 3TI0A 3BZKA 3LVVA 5KFZA 4Y2YA 7ICMA 3C2KA 1UPHA 2JEIA 1BPZA 5JUMA 4NJ8A 2FMPA 1YZ7A 1L8OA 4I2IA 5KFKA 1RXWA 1B0XA 5KG6A 1J97A 3UQ2A 1HUZA 3HP6A 3AN1A 4IR9A 4UATA 4DWIA 1KBUA 1KDHA 2AGOA 2W9BA 3C28A 4DFDA 4FO6A 1XNSA 2YB1A 4F71A 5J2IA 1TAMA 3M8SA 4EZ9A 4QZ9A 3V72A 4PHPA 2KTQA 3UMBA 3TADA 1JX4A 2HW3A 3T5LA 3DV9A 5CR0A 4A8EA 1ZQUA 5CWRA 4G3IA 4M6WB 2HVHA 2ASDA 4JB3A 4BGDA 5KT5A 4J9OA 2M9NA 3AQEA 4P2HA 3THVA 1Z1BA 4EBDA 2K60A 1FIQA 4RQ4A 2EZXA 3H8MA 3FDSA 2K4IA 2W9CA 5AKGA 5HNKA 2JV3A 4DL3A 3WKBA 1BPYA 3H0LB 5DG8A 5CRXA 4F72A 4G9BA 2W11A 4KLSA 2BPFA 9ICJA 4I2GA 2VIXA 4DSFA 5HMMA 2XC9A 2KOBA 5KFRA 4EBCA 2JGAA 4DQPA 3N97B 4RQ3A 1XWLA 9ICNA 1OW5A 2DFLA 1B4FA 3OTQA 3IP4B 3OJSA 4GXJA 3EPGA 2ZIVA 3RRHA 3Q8RB 4GFJA 5DGBA 5AI8A 4DL2A 4YMMA 3PW0A 3PSIA 5KL8B 1DGSA 2NV3A 1RG6A 3TQ1A 1RZTA 5AK4A 4FZNA 3QZ8A 4YR2A 3Q8SB 2ZTCA 5J0RA 5DBCA 4HAIA 4IL6U 3MGHA 2KKPA 3SAHA 3Q8QB 2DGZA 3R9KA 4UAWA 4DO9A 2KJ9A 4ELVA 5ALUA 1AROP 4F93B 1U47A 3RJJA 2A1AA 3C2MA 2DQNB 3L4PA 5BOMA 1A6SA 1Z1VA 2ZIXA 2PFQA 1MC8A 3MC1A 3KOOA 2JRZA 1LVHA 5J29A 2W43A 5ALJA 3EUB2 3GV7B 4F8RA 5KAIU 2W7PA 2GLEA 5KFHA 2KSOA 2FMQA 7ICJA 4DLGA 3FM9A 5J2HA 2HOIA 2W9MA 1HEKA 3ZD8A 4ED1A 2OYYA 2XCAA 2HCFA 2DKXA 3QX7A 4KLUA 4RQ6A 5KG7A 4KX3A 2KICA 5ALZA 1KW4A 1YT3A 4JV0A 4F50A 7ICRA 2ZUDA 3RJIA 9ICRA 3QYPA 4BDPA 4DCCA 5D4BA 2PKEA 5DQIA 1ZQTA 4DOAA 1T8EA 3HRDD 1X9WA 4P4OA 2F8LA 4WJ3B 2NRTA 2B6GA 1ZQOA 3EZ5A 4YD2A 2UVVA 1L7OA 5L1IA 1T4GA 1WYGA 3GFKB 4DS4A 5KFJA 5AICA 3N7PD 4M6WA 9ICEA 5EOZA 2QB1A 1Q8KA 3CW2C 5L1MA 2JHDA 4BXOB 3AU2A 4Y2UA 5KG2A 5AM2A 5EE3A 3ISBA 3BS5B 2VA3A 3RH4A 3KKAC 1ZQLA 1CRXA 3HKZF 2JR5A 4GXIA 5IIKA 2Q0ZX 3V6JA 4TQRA 2UVWA 1CUKA 4DOCA 2XY6A 1K1SA 1WWUA 3WK9A 2E1EA 5DDMA 3TFRA 2C28A 3GQCA 2F2AB 4DSJA 2ISPA 2LM1A 5AIAA 4OJLA 1ZQEA 3QUQA 1N61A 1ZQ1C 4LVSA 3G6XA 3RR8A 4DL4A 4OJ6A 4CGZA 2W3RA 2KFNA 1IIPA 5KFEA 5KFDA 1ZD4A 2W03A 4F91B 4OJ5A 4EZ6A 4DL5A 5AKXA 2QARB 3Q8PB 1KN5A 2FLPA 3K75D 2BKEA 4M9HA 3C1ZA 3KHLA 1SV0A 9ICXA 1UQVA 4B6JA 5B66U 3SV4A 2IOHA 1D8YA 3BS7A 4ICAA 2WF6A 4IRCA 2FLLA 2M0NA 4FE3A 3PMLA 4YR3A 2HHWA 3MGIA 4IRKA 2CN1A 2JEJA 5KG3A 3WKAA 2BCVA 2OHFA 2VANA 1SL2A 1ZETA 5DQGA 7ICFA 2DPJA 3SV3A 3VC8A 3PV8A 1IM4A 5KFBA 1S77D 3WU2U 5J8YC 5DB9A 2KZMA 9ICQA 4Q45A 4I28A 8ICTA 2QLTA 1VLBA 2OEHA 7ICIA 5EE1A 2R8HA 3V6HA 1QQ7A 9ICKA 4PL1A 4UB6U 1ZRNA 1NKEA 3ZDCA 4ECRA 2R8JA 3MGVA 4O5KA 8ICMA 4FZMA 2HHTA 3MBYA 4RPYA 4U6PA 3KD3A 3RRGA 3KHGA 3PW5A 1UT5A 4UAZA 4QW9A 4FZLA 1RYRA 3IRUA 3PX4A 5J2EA 3VCBA 4DL6A 4M04A 2BZFA 1SKRA 3N28A 1JRPA 2H5XA 1S0NA 8ICPA 4CNQA 2KIWA 5ALLA 4C4SA 2ZJ5A 1KFDA 3ISDA 3M7DA 3NVWA 2BQRA 1NZPA 1BPBA 4QZCA 2HBKA 4Q44A 5KFQA 4ECSA 2Y9TA 3PX0A 3V7KA 4BXOA 5AIBA 5DBAA 2B21A 1DXSA 3BZCA 5DLFA 3BS5A 3WKEA 4IQWA 1MQ2A 1KRPA 4I2DA 8ICJA 1QSLA 3U26A 2Y1IA 4DL7A 1ZQVA 1L6NA 3LDAA 4J9LA 5ALKA 4UB1A 4NV0A 2XY7A 3HKZC 1SXDA 3B0XA 2ATLA 3H0RB 4GC7A 2PI4A 4JUZA 3WKCA 4JWNA 4UAYA 2EZZA 4EYIB 4F5NA 2AGPA 1T3NA 4O3MA 2E1FA 1S0OA 3M6ZA 2W9BB 1ZQRA 3PX6A 2L5YA 5B5EU 2XGQA 4YXMA 3SAFA 4FBUA 3PO5A 4DFPA 2KE7A 2LHTA 5A0LA 4I29A 4MFAA 4QZEA 1NK6A 1LB2B 2HHSA 4Z6CA 2KJ8A 4IRDA 5JU5A 3QU7A 5J0OA 1D8BA 1SB3C 1MSWD 5KT3A 3HT3A 5ALTA 3GIJA 4UB4A 4F5PA 7ICQA 4R64A 1ZD5A 2YY6A 2QARA 1TV9A 3E0FA 4RPXA 4UB2A 2LYHA 2AHOB 1U4BA 1DRGA 4DSLA 3NVZA 1OUQA 2G08A 3PSPA 2KHVA 5KFOA 4PL2A 2WHEA 2AQ0A 3PW2A 8ICGA 5HR7A 3AMZA 4IS7A 1NI3A 5KFPA 3M9MB 4M9LA 3CP8A 1FFVA 4B9UA 4C4TA 2F8KA 4I2JA 5TZVA 3SD7A 3KZXA 2YMQA 2G5IB 1QH9A 3F2DA 3RBEA 4LZGA 5J0QA 1Z19A 3FAHA 5DKWA 3T79A 5JRTA 4DSKA 1YZ6A 2B0CA 3PO4A 3PR5B 5AI4A 4KLQA 1BPEA 1N2XA 5AKIA 4I2EA 1PVPA 5J0UA 2HHQA 4NL9A 1QTMA 4FFDA 3RJKA 4TUSA 5DDYA 2Y9UA 3C5FA 1RXVA 4DQIA 3NASA 5J2DA 4DFJA 3FYHA 2BCRA 5ALXA 2MA1A 4RQ7A 2ZJ8A 2FJ6A 4C4RA 2QB0B 3D2QA 5AI6A 1F44A 2KSOB 3K4GA 2ZIWB 1N56A 4O5CA 4USAA 4F4WA 1SWVA 3GIKA 2E8NA 2WF5A 4CRXA 5AM3A 2NRVA 4RNMA 3D2SA 4EEYA 4KLIA 3CNHA 2OXOA 2YX8A 3JPQA 2V4RA 4EX6A 4AP9A 5CP2A 3KFUF 5KFWA 2LBOA 4EELA 3MDCA 1F0MA 1L3UA 4PPXA 7ICTA 1ZD2P 7ICVA 5HHIA 5IIMA 2F1HA 2KIVA 1J2MA 2AJQA 5ALWA 1BPXA 2W54A 2LYAA 5AI5A 2OH2A 2E8MA 4UASA 4IQTA 3JPOA 3MFIA 1TE2A 3ED5A 3OJUA 5AKJA 2VJ5A 3DEEA 2ESEA 5KNIA 2BPGA 2ZTDA 4ELTA 4RQ5A 4Y2SA 1V85A 2HI0A 4F2SA 1X9XA 2IMWP 2LPEA 2BCUA 3QUTA 2F1JA 3JPTA 2ZUBA 5KFNA 2BGWA 2DUYA 2KKVA 4RQ2A 5ALHA 4EX7A 3RAXA 4YP3A 1EXNA 1UCVA 4NM2A 4C8NA 1NJZA 1S97A 2BQUA 7ICGA 3ONNA 4J9MA 1PUZA 1ZQXA 3C2LA 5KL1B 1FFUA 4B9LA 2P6RA 1SV0C 9ICBA 4QZFA 9ICTA 3PSFA 4ED0A 2WFAA 4Q8FA 4AYBF 4PGYA 3F53A 4TQSA 1MA7A 4QNLA 2D8CA 1KFSA 3RR7A 2RQ5A 3ETLA 4C8OA 2HOFA 4ECQA 5ALIA 2C22A 2A19A 3H8JA 5IINA 3BQ1A 5KFVA 2W8KA 1QQ5A 4NXZA 1RDFA 5DB7A 1KSPA 2QKQA 3PR4A 1TAUA 4Y2PA 1U9LA 4MEXA 7ICOA 2VA2A 1D9FA 2WF7A 9ICWA 3A0HU 4J9NA 5L1LA 1ECWA 3CRXA 4C7YA 4J9QA 2ES6A 4PH5A 1Q3VA 3D6JA 2H3VA 4RQMA 3OSNA 4DQRA 3LYSA 4UARA 2XVTA 5DG7A 2FPKA 4TUPA 2W7OA 3M1YA 5T14A 3LWMA 3NRWA 1QQ6A 2QB0A 3RBDA 2ZIWA 2XI9A 2VKQA 3I1YA 3PVXA 7ICKA 4B9MA 2GH1A 5J2JA 4US8A 1JMSA 5J0WA 3JPNA 3UXOA 1JI7A 5AI9A 3JPRA 1ZQDA 1ZQFA 4UAVA 5ALOA 4PHDA 3GV8B 1XO0A 3UM9A 3H7IA 3RF9A 4MF2A 4UW9A 5G5HA 3TAQA 1NNLA 1RPLA 1N48A 2K8AA 3QXGA 4I27A 2W55A 4UB5A 1SL0A 4M9NA 1ZJNA 3E58A 5DGAA 4YD1A 4MFFA 2OM6A 5G5GA 2FPLA 3SMVA 2K89A 3BQ2A 7ICSA 4KMUA 3IN5A 1S76D 2R18A 1NKBA 1BNPA 1RM6C 8ICNA 2D3DA 4KX5A 1PVQA 4B9TA 5AM0A 5KTQA 1BPDA 2CXYA 3EWAA 2WF8A 9ICVA 4UBCA 1SGGA 1Z4NA 1D9DA 1UA0A 2YQEA 3LWLA 1L3TA 3M9OB 2XGPA 4CE6A 1H38A 4QWDA 4BWMA 2FI1A 2PXIA 7ICNA 8ICUA 4I2CA 1NK4A 4DS5A 5H2FU 1U48A 4QIWF 4YMOA 2YMLA 4ECVA 2FMSA 3AEVA 5CEHA 3GU3A 1X9MA 4AYBC 4KLOA 2I6XA 2ODGA 4IC9A 1OXJA 4M0AA 1ZRMA 1X40A 1Z00A 4Y2RA 2G06A 5ALSA 4KLFA 5J0PA 3ORYA 2KJ5A 1KEJA 1SV4A 1TVAA 3IG8A 5DG9A 2R8IA 2V9WA 2Q4TA 5CA7A 1QLNA 1ZQZA 3HWTA 4YQWA 4ZOHC 1ED1A 3PSTA 2K4HA 4F5RA 4R8UB 1SWWA 4O9MA 3F2CA 3M9NB 5KT7A 4RNOA 4NL9C 3PW4A 3QUCA 1BVSA 4MEYA 2HBJA 2EZYA 1AQ6A 2DF4B 2D6FC 3MR2A 3I28A 2KHQA 3RTVA 8ICFA 1ZQPA 3H4DA 3F5EA 4C7ZA 3ZDDA 2ZIUB 1DK2A 2HVIA 4Q43A 2JXJA 4QWAA 8ICIA 3C5GA 1VDVA 4NLCA 5AK3A 4NM1A 1LKYA 4EYHB 4J03A 4XRHA 3O0FA 3AM9A 4DEZA 7ICLA 1UT8A 1WCNA 2JEFA 1L8LA 2BCQA 2G07A 4OO1J 3Q8KA 2XICA 1KKXA 2P35A 8ICAA 5AKZA 1QSSA 8ICXA 3KZIU 2RLTA 2Y1JA 1SZPA 8ICQA 4CF5A 5J0XA 4O3SA 2P6UA 5KFIA 5KT4A 1NKCA 1ZQGA 2OCEA 4NLKA 1ZQWA 2HBMA 4X5VA 5KFXA 9ICPA 2V4QA 2LMRA 4K4IA 2GO7A 5ALVA 4DSEA 4GXKA 1NOMA 1KLNA 5C5JA 1KTQA 1SL1A 1PK3A 2YTUA 2BCSA 2H3ZA 4KLEA 4F5QA 4DLEA 3TADC 4YR0A 5ALDA 4KLTA 2BDUA 2F76X 2NYVA 4UB8U 3WK5A 9ICCA 2I9GA 3V6KA 9ICAA 3RAQA 3UMCA 3NVVA 5L1JA 5AKHA
chains in the Genus database with same CATH topology
1HUOA 7ICUA 2BCRA 1XSNA 4RQ7A 4YMMA 1ZJMA 8ICEA 5J0TA 1RZTA 4QZ8A 5IILA 4DOBA 5J0RA 5DBCA 3MGHA 8ICCA 4O5CA 4XA5A 4RQ8A 4UAWA 4DO9A 8ICLA 8ICVA 3RJJA 3C2MA 5BOMA 4KLIA 2PFQA 3JPQA 4F5OA 5J29A 3PNCA 5J2BA 3MDCA 4PPXA 7ICTA 7ICVA 2FMQA 5HHIA 4O5EA 7ICJA 4JWMA 5IIMA 4NY8A 5J2HA 2W9MA 2GWSA 4M9JA 5DB8A 3RJEA 1BPXA 4KLUA 4RQ6A 1ZQJA 4RPZA 4IQTA 3JPOA 8ICHA 8ICRA 7ICRA 1ZQSA 3RJIA 2BPGA 4K4HA 9ICRA 3GDXA 2PFPA 4RQ5A 1ZQHA 5D4BA 2BCUA 1ZQTA 3JPTA 5J0YA 3MDAA 4DOAA 1ZQQA 4R66A 4RQ2A 1ZQOA 4NM2A 4YD2A 7ICGA 3JPSA 4QZDA 3C2LA 3OGUA 9ICBA 9ICTA 4QZFA 3AUOA 4NLNA 9ICEA 5EOZA 4I2HA 4RQ1A 4PGYA 9ICHA 3HW8A 3V7JA 3PMNA 3AU2A 5DBBA 3ISBA 3RH4A 1ZQLA 3ISCA 5IINA 4GXIA 5IIKA 1DK3A 4Z6EA 4NXZA 1ZQKA 4DOCA 1ZQMA 4YN4A 3HX0A 5DB7A 3TFRA 7ICOA 9ICWA 2ISPA 5D49A 5DB6A 3JPPA 4R65A 1ZQEA 8ICOA 1MQ3A 3LK9A 4LVSA 1ZQIA 4PH5A 4YMNA 3V7LA 1ZQAA 4MF8A 4Z6DA 8ICYA 4UBBA 4TUPA 4M9GA 7ICKA 8ICKA 4RQ0A 5J2JA 1JMSA 4M9HA 5J0WA 3JPNA 3UXOA 4Z6FA 3JPRA 9ICXA 1ZQDA 1ZQFA 4PHDA 3PMLA 5J2GA 4PGQA 4TURA 4MF2A 3MGIA 5CB1A 2BCVA 1ZQNA 9ICLA 7ICFA 4I27A 4UB5A 5BPCA 4M9NA 4QZAA 1ZJNA 4YCXA 5DB9A 9ICQA 4I28A 4YD1A 8ICTA 4MFFA 4XUSA 7ICIA 7ICSA 9ICKA 4M2YA 1BNPA 8ICNA 9ICIA 4KLGA 4PGXA 8ICBA 1BPDA 4O5KA 3UQ0A 8ICMA 9ICVA 3B0YA 3MBYA 4UBCA 4RPYA 3RJHA 4PHAA 9ICGA 4QZGA 3RH5A 4UAZA 4UB3A 1XSPA 5J2EA 7ICHA 4M04A 3UXNA 4QZIA 4K4GA 5IIOA 2PXIA 7ICNA 8ICUA 8ICPA 4I2CA 5J2KA 3ISDA 1XSLA 9ICOA 4LZDA 4I2FA 3RJGA 1NZPA 4YMOA 4QZCA 4TUQA 4NLZA 2FMSA 5IIIA 3V7KA 3RJFA 5DBAA 4KLOA 1BNOA 1ZQBA 3TFSA 5BOLA 4M0AA 3UPQA 4I2BA 4IQWA 1MQ2A 4I2DA 8ICJA 4KLFA 5J0PA 8ICZA 4I2AA 1KEJA 4UB1A 1TVAA 4IQUA 4RT3A 2P66A 7ICPA 3UXPA 3B0XA 4R63A 4IQVA 2PFNA 4KLDA 4JWNA 4UAYA 3HWTA 3AU6A 4F5NA 1ZQRA 4F5RA 5J2AA 7ICMA 3C2KA 4M47A 1BPZA 4O9MA 1ZQCA 2FMPA 4KLJA 2KP7A 4I2IA 4QZBA 7ICEA 4I29A 4QZEA 4MFAA 3UQ2A 1HUZA 4Z6CA 8ICFA 1ZQPA 5J0OA 4KLLA 1KDHA 1DK2A 4KLHA 8ICWA 4UB4A 4F5PA 7ICQA 4FO6A 8ICIA 4R64A 3C5GA 5J2IA 1TV9A 4NM1A 4RPXA 2PFOA 4QZHA 5J0SA 4UB2A 4QZ9A 3V72A 4PHPA 9ICSA 7ICLA 8ICGA 9ICUA 5CWRA 5D46A 2BCQA 9ICFA 9ICMA 4M9LA 8ICAA 8ICXA 8ICQA 4I2JA 5J0XA 5TZVA 4RT2A 4P2HA 4RQ4A 1ZQGA 2IHMA 4NLKA 2ISOA 4X5VA 5J2FA 4LZGA 5J0QA 4KLMA 9ICPA 1BPYA 4K4IA 5DKWA 4GXKA 3RH6A 4KLSA 2BPFA 4KLQA 4PHEA 1BPEA 9ICJA 5IIJA 4I2GA 4I2EA 2BCSA 4KLEA 4MFCA 5J0UA 4F5QA 4RQ3A 5HHHA 3RJKA 4TUSA 8ICSA 5DDYA 9ICNA 4KLTA 4GXJA 9ICCA 2I9GA 3C5FA 5J2CA 9ICAA 5J2DA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1HUO A;  7ICU A;  2BCR A;  1XSN A;  4RQ7 A;  4YMM A;  1ZJM A;  8ICE A;  5J0T A;  1RZT A;  4QZ8 A;  5IIL A;  4DOB A;  5J0R A;  5DBC A;  3MGH A;  8ICC A;  4O5C A;  4XA5 A;  4RQ8 A;  4UAW A;  4DO9 A;  8ICL A;  8ICV A;  3RJJ A;  3C2M A;  5BOM A;  4KLI A;  2PFQ A;  3JPQ A;  4F5O A;  5J29 A;  3PNC A;  5J2B A;  3MDC A;  4PPX A;  7ICT A;  7ICV A;  2FMQ A;  5HHI A;  4O5E A;  7ICJ A;  4JWM A;  5IIM A;  4NY8 A;  5J2H A;  2W9M A;  2GWS A;  4M9J A;  5DB8 A;  3RJE A;  1BPX A;  4KLU A;  4RQ6 A;  1ZQJ A;  4RPZ A;  4IQT A;  3JPO A;  8ICH A;  8ICR A;  7ICR A;  1ZQS A;  3RJI A;  2BPG A;  4K4H A;  9ICR A;  3GDX A;  2PFP A;  4RQ5 A;  1ZQH A;  5D4B A;  2BCU A;  1ZQT A;  3JPT A;  5J0Y A;  3MDA A;  4DOA A;  1ZQQ A;  4R66 A;  4RQ2 A;  1ZQO A;  4NM2 A;  4YD2 A;  7ICG A;  3JPS A;  4QZD A;  3C2L A;  3OGU A;  9ICB A;  9ICT A;  4QZF A;  3AUO A;  4NLN A;  9ICE A;  5EOZ A;  4I2H A;  4RQ1 A;  4PGY A;  9ICH A;  3HW8 A;  3V7J A;  3PMN A;  3AU2 A;  5DBB A;  3ISB A;  3RH4 A;  1ZQL A;  3ISC A;  5IIN A;  4GXI A;  5IIK A;  1DK3 A;  4Z6E A;  4NXZ A;  1ZQK A;  4DOC A;  1ZQM A;  4YN4 A;  3HX0 A;  5DB7 A;  3TFR A;  7ICO A;  9ICW A;  2ISP A;  5D49 A;  5DB6 A;  3JPP A;  4R65 A;  1ZQE A;  8ICO A;  1MQ3 A;  3LK9 A;  4LVS A;  1ZQI A;  4PH5 A;  4YMN A;  3V7L A;  1ZQA A;  4MF8 A;  4Z6D A;  8ICY A;  4UBB A;  4TUP A;  4M9G A;  7ICK A;  8ICK A;  4RQ0 A;  5J2J A;  1JMS A;  4M9H A;  5J0W A;  3JPN A;  3UXO A;  4Z6F A;  3JPR A;  9ICX A;  1ZQD A;  1ZQF A;  4PHD A;  3PML A;  5J2G A;  4PGQ A;  4TUR A;  4MF2 A;  3MGI A;  5CB1 A;  2BCV A;  1ZQN A;  9ICL A;  7ICF A;  4I27 A;  4UB5 A;  5BPC A;  4M9N A;  4QZA A;  1ZJN A;  4YCX A;  5DB9 A;  9ICQ A;  4I28 A;  4YD1 A;  8ICT A;  4MFF A;  4XUS A;  7ICI A;  7ICS A;  9ICK A;  4M2Y A;  1BNP A;  8ICN A;  9ICI A;  4KLG A;  4PGX A;  8ICB A;  1BPD A;  4O5K A;  3UQ0 A;  8ICM A;  9ICV A;  3B0Y A;  3MBY A;  4UBC A;  4RPY A;  3RJH A;  4PHA A;  9ICG A;  4QZG A;  3RH5 A;  4UAZ A;  4UB3 A;  1XSP A;  5J2E A;  7ICH A;  4M04 A;  3UXN A;  4QZI A;  4K4G A;  5IIO A;  2PXI A;  7ICN A;  8ICU A;  8ICP A;  4I2C A;  5J2K A;  3ISD A;  1XSL A;  9ICO A;  4LZD A;  4I2F A;  3RJG A;  1NZP A;  4YMO A;  4QZC A;  4TUQ A;  4NLZ A;  2FMS A;  5III A;  3V7K A;  3RJF A;  5DBA A;  4KLO A;  1BNO A;  1ZQB A;  3TFS A;  5BOL A;  4M0A A;  3UPQ A;  4I2B A;  4IQW A;  1MQ2 A;  4I2D A;  8ICJ A;  4KLF A;  5J0P A;  8ICZ A;  4I2A A;  1KEJ A;  4UB1 A;  1TVA A;  4IQU A;  4RT3 A;  2P66 A;  7ICP A;  3UXP A;  3B0X A;  4R63 A;  4IQV A;  2PFN A;  4KLD A;  4JWN A;  4UAY A;  3HWT A;  3AU6 A;  4F5N A;  1ZQR A;  4F5R A;  5J2A A;  7ICM A;  3C2K A;  4M47 A;  1BPZ A;  4O9M A;  1ZQC A;  2FMP A;  4KLJ A;  2KP7 A;  4I2I A;  4QZB A;  7ICE A;  4I29 A;  4QZE A;  4MFA A;  3UQ2 A;  1HUZ A;  4Z6C A;  8ICF A;  1ZQP A;  5J0O A;  4KLL A;  1KDH A;  1DK2 A;  4KLH A;  8ICW A;  4UB4 A;  4F5P A;  7ICQ A;  4FO6 A;  8ICI A;  4R64 A;  3C5G A;  5J2I A;  1TV9 A;  4NM1 A;  4RPX A;  2PFO A;  4QZH A;  5J0S A;  4UB2 A;  4QZ9 A;  3V72 A;  4PHP A;  9ICS A;  7ICL A;  8ICG A;  9ICU A;  5CWR A;  5D46 A;  2BCQ A;  9ICF A;  9ICM A;  4M9L A;  8ICA A;  8ICX A;  8ICQ A;  4I2J A;  5J0X A;  5TZV A;  4RT2 A;  4P2H A;  4RQ4 A;  1ZQG A;  2IHM A;  4NLK A;  2ISO A;  4X5V A;  5J2F A;  4LZG A;  5J0Q A;  4KLM A;  9ICP A;  1BPY A;  4K4I A;  5DKW A;  4GXK A;  3RH6 A;  4KLS A;  2BPF A;  4KLQ A;  4PHE A;  1BPE A;  9ICJ A;  5IIJ A;  4I2G A;  4I2E A;  2BCS A;  4KLE A;  4MFC A;  5J0U A;  4F5Q A;  4RQ3 A;  5HHH A;  3RJK A;  4TUS A;  8ICS A;  5DDY A;  9ICN A;  4KLT A;  4GXJ A;  9ICC A;  2I9G A;  3C5F A;  5J2C A;  9ICA A;  5J2D A; 
#chains in the Genus database with same CATH topology
 5KAF U;  4RZR A;  7ICU A;  1XSN A;  2HBL A;  5CHG A;  4BWJ A;  2HMX A;  3OHA A;  1LV5 A;  5AK5 A;  8ICE A;  3SR6 A;  4CF3 A;  2A1J B;  3TAC B;  4QIW C;  5IIL A;  2WB1 F;  1JXL A;  1RYU A;  5KFC A;  1O03 A;  4DOB A;  1N5X A;  3NVY A;  8ICC A;  5ALE A;  1T7P A;  4XA5 A;  8ICL A;  2JEG A;  4JV1 A;  4YXJ A;  4O3P A;  4E0D A;  8ICV A;  4QW8 A;  3NTU A;  4RUC A;  4NLB A;  3PZP A;  1MN8 A;  5EE9 A;  2JH1 A;  3PNC A;  3RFA A;  2KVS A;  4O5E A;  4Q8E A;  4UAU A;  3EYZ A;  2KZZ A;  4FBT A;  5DB8 A;  2H3I A;  4R8U A;  3F5A A;  1ZQJ A;  2HOQ A;  1ZQS A;  5ALN A;  5DQH A;  4K4H A;  4DQQ A;  2PFP A;  3WK7 A;  5TIS U;  3KKA A;  4ED8 A;  2ZIU A;  4RU9 A;  1NK5 A;  3ZDA A;  3GV5 B;  3QEA Z;  1PZN A;  5AI0 A;  3BJY A;  4EEN A;  2KEY A;  2XCP A;  3H0M B;  2HSZ A;  2E8P A;  4GLX A;  3WK6 A;  4IR1 A;  1COK A;  4ED7 A;  3OGU A;  1WG8 A;  3FC4 A;  2H3Q A;  2KFZ A;  2Y0S F;  1D8L A;  4NLN A;  2K4E A;  4J9R A;  4I2H A;  4RQ1 A;  9ICH A;  3V7J A;  2KN7 A;  3HW8 A;  3PMN A;  4DFM A;  3WKD A;  3N7R C;  2HDO A;  1NJW A;  3IM1 A;  4ECT A;  3QEB Z;  2W3S A;  3K1Z A;  5ALY A;  4QJF B;  3BDP A;  3SZ2 A;  2K8C B;  5HML A;  3AQF A;  3KBB A;  2BR0 A;  1O08 A;  3N4M B;  1NK7 A;  5AKK A;  4C80 A;  5HP4 A;  4JMU A;  2WTF A;  4QWB A;  3HPO A;  1ZQM A;  4P4M A;  5AM4 A;  5D49 A;  1JIH A;  5DB6 A;  3JPP A;  4R65 A;  3H8W A;  1A0P A;  1SXE A;  1ZQI A;  1S10 A;  4YMN A;  3LVW A;  1SKS A;  3SAG A;  3C1Y A;  4MF8 A;  1RYS A;  5J8Y A;  4Z6D A;  2ZG6 A;  8ICY A;  5EE0 A;  4UBB A;  2YB4 A;  2A1J A;  1XC9 A;  1XU4 A;  2HHX A;  4M9G A;  2WB1 C;  2UVU A;  5AK6 A;  2NRW A;  2RP5 A;  2E8O A;  2JZB B;  2W9A A;  8ICK A;  1B22 A;  5FP0 A;  1SZH A;  2RHF A;  2PI5 A;  4Z6F A;  2IA6 A;  3ZD9 A;  2IOF K;  4F4Y A;  1X6I A;  2KD1 A;  5L1K A;  4ECX A;  5J2G A;  4PGQ A;  2BDP A;  4P0P A;  5CB1 A;  3NS1 A;  1FEZ A;  4XQ8 A;  3N7S C;  2UVR A;  3ALR A;  4QZA A;  4ED6 A;  5AKL A;  4B9V A;  4J9P A;  5EWF A;  4CCH A;  1X2I A;  3GZF A;  1URJ A;  3MR6 A;  1X9S A;  3IDW A;  4M2Y A;  2BHN A;  3K1R B;  3MAB A;  9ICI A;  3M8R A;  2RRD A;  4KN4 A;  1XO1 A;  5CJ7 A;  4HYK A;  4GC6 A;  3UQ0 A;  1ZYQ A;  3M6K A;  3SEN A;  1TK8 A;  4NLG A;  4F92 B;  4PHA A;  9ICG A;  2BPC A;  2XY5 A;  4ZH4 A;  4GIB A;  5AHX A;  4UB3 A;  3Q8M A;  3IHQ B;  1ZD3 A;  4QWC A;  4QZI A;  4K4G A;  2H3F A;  4EEK A;  5GTH U;  5IIO A;  1HIW A;  5KFM A;  1Z00 B;  5KFF A;  1X6J A;  4ACO A;  3KHR A;  1XSL A;  9ICO A;  4LZD A;  1IG6 A;  4I2F A;  4C8M A;  4YG2 A;  3RJG A;  1WCL A;  5EWG A;  2PMZ F;  1B43 A;  2WAQ F;  4TUQ A;  4NLZ A;  3PY8 A;  3CYM A;  2Y0S C;  3L3F X;  3NUQ A;  3T3F A;  3RJF A;  4J9K A;  1BNO A;  1ZQB A;  3TFS A;  2NRX A;  5BOL A;  1HJP A;  2EQY A;  3G6V A;  3SQI A;  4KN7 A;  4C8K A;  1C7Y A;  2E5S A;  4ED3 A;  2P66 A;  3UXP A;  4ELU A;  2G5H B;  2KZ3 A;  4C0Z A;  4KLD A;  1U49 A;  2C2D A;  4YFK A;  3AU6 A;  3DDH A;  5J2A A;  4UQG A;  2CRX A;  4M47 A;  2ZTE A;  4C8L A;  4EBE A;  5KFT A;  3PW7 A;  1ZQC A;  5ALQ A;  1LKY B;  4KLJ A;  2KP7 A;  5GTI U;  4ECZ A;  1A77 A;  2XO7 A;  4P0Q B;  1S5L U;  4QZB A;  3C23 A;  2JMG A;  3RB3 A;  7ICE A;  1P7D A;  1IXR A;  1S8O A;  1RQN A;  5F9N A;  1T3Q A;  4PZO A;  2FE9 A;  4F4Z A;  1Y88 A;  3MR3 A;  1QSY A;  4NWI A;  4Y2J A;  2AXT U;  2YMP A;  4KLL A;  3QE9 Y;  4KLH A;  4O3O A;  8ICW A;  3QZ7 A;  2JZB A;  2G09 A;  1UA1 A;  5AM5 A;  2PFO A;  4QZH A;  5J0S A;  4RQN A;  2W8L A;  1NK0 A;  2LYB A;  9ICS A;  3J81 j;  3HIL A;  5AKY A;  2YMM A;  5F3X B;  3TAN A;  1K1Q A;  1JUD A;  4O3Q A;  4DFK A;  4QWE A;  2KV2 A;  3ZDE A;  2R8K A;  3BQ0 A;  9ICU A;  5D46 A;  9ICF A;  1V97 A;  5KG4 A;  9ICM A;  3TKA A;  3SI8 A;  2GOL A;  1VJ5 A;  1FO4 A;  4KMO B;  1JRO A;  2AGQ A;  5AM1 A;  3IV6 A;  3SYZ A;  1TKD A;  4RT2 A;  4OJO A;  1TFR A;  2JH7 A;  3G6Y A;  3BQ7 A;  2RDJ A;  2IHM A;  4LJX A;  5ALP A;  2ISO A;  5KT6 A;  5J2F A;  1K5O A;  4KLM A;  5F9L A;  5EWE A;  2DKZ A;  3RH6 A;  3TAR A;  1X42 A;  5L9X A;  4RUA A;  2KK0 A;  4PHE A;  3QU5 A;  5IIJ A;  4F2R A;  3D2N A;  4MFC A;  2F44 A;  5HHH A;  4DF8 A;  4Y2Q A;  8ICS A;  3BQT A;  3QU4 A;  4J9S A;  2R8G A;  4JV2 A;  3GIL A;  1CI4 A;  2E3T A;  1RQL A;  5J2C A;  2DPI A;  1WWV A;  1CEZ A;  1COO A;  1ZXI A;  1SKW A;  2DWQ A;  1NZB A;  3OPX A;  1TK0 A;  1HUO A;  5KFS A;  2CPR A;  1L7P A;  3C29 A;  2AU0 A;  5ALF A;  3Q8L A;  1ZJM A;  1L3S A;  2K4P A;  3QNM A;  5J0T A;  2DL0 A;  2PMZ C;  4QZ8 A;  2IHN A;  2WAQ C;  1N62 A;  1GO3 F;  1N60 A;  4B9S A;  2WF9 A;  4RQ8 A;  2KMD A;  2NRZ A;  4Y2X A;  3NGD A;  5KFY A;  2ZJA A;  3HJE A;  3KHH A;  2I5H A;  4F5O A;  4P4P A;  2HHV A;  1IV8 A;  1JN3 A;  2LI6 A;  5J2B A;  2ZUC A;  5KG5 A;  4ED2 A;  4B9N A;  4JWM A;  2EDU A;  4NY8 A;  2F3N A;  2GWS A;  3ZI4 A;  4RNN A;  4M9J A;  4F3O A;  3RJE A;  1JXE A;  4CF4 A;  2LKY A;  2MUT B;  4RPZ A;  2IBK A;  4P0Q A;  8ICH A;  8ICR A;  2VA8 A;  1DOQ A;  3B9J A;  3C21 A;  3ZDB A;  3GDX A;  4Y2V A;  2FLN A;  1TK5 A;  1NJX A;  1ZQH A;  1PK1 B;  2N1R A;  2NO5 A;  3QUB A;  2C2E A;  2G0A A;  3MDA A;  5J0Y A;  1T94 A;  4FS1 A;  1N5W A;  2KG5 A;  1ZQQ A;  1J2N A;  4R66 A;  2EAP A;  4JK1 A;  4DSI A;  1A76 A;  4OD0 A;  2ASL A;  3OHB A;  2BQ3 A;  2W04 A;  3E2E A;  3JPS A;  4QZD A;  2NO4 A;  5AKE A;  4ECU A;  2F77 X;  2J6T A;  1C20 A;  5KG0 A;  5DLG A;  3AUO A;  3OSP A;  1KL9 A;  1BGX T;  4FS2 A;  5DBB A;  2EAN A;  3QU9 A;  3I76 A;  2LM4 A;  5KFG A;  4O3N A;  4F4K A;  4DF4 A;  1ZOL A;  3ISC A;  1S9F A;  5ALM A;  1DK3 A;  4Z6E A;  1Z3E B;  1ZQK A;  4YN4 A;  3HX0 A;  3H8S A;  4PJ0 U;  8ICO A;  1MQ3 A;  3LK9 A;  5C0Y A;  2EAM A;  4U7C A;  1S0V A;  3V7L A;  1UHU A;  2XID A;  1ZQA A;  3RB6 A;  4CDG A;  1M6Y A;  1L3V A;  2C2R A;  4P0P B;  4OJP A;  1Q3U A;  2ALZ A;  4O0I A;  4KIT B;  5E79 U;  5KT2 A;  5HR6 A;  1NK8 A;  1L7M A;  3QU2 A;  4ECW A;  4RQ0 A;  5KFU A;  3TAP A;  2HHU A;  2EH9 A;  4F4X A;  3KTQ A;  4Y2T A;  4O3R A;  3RB4 A;  5JTI A;  2YN4 A;  2A3V A;  4TUR A;  3RB0 A;  3IG5 A;  2VJ4 A;  2KNJ A;  1U45 A;  1JAL A;  1ZQN A;  3ICX A;  1F5S A;  9ICL A;  3T5K A;  5BPC A;  2J6U A;  2EAO A;  4YCX A;  3A0B U;  2MAX A;  3WK4 A;  5ALR A;  4XUS A;  3H4B A;  1Z4O A;  2W9C B;  1QCK A;  2MUT A;  2KVC A;  2IOF A;  2MRL A;  3F2B A;  4KLG A;  1SIJ A;  4OCZ A;  1TAQ A;  3WK8 A;  4PGX A;  3S6J A;  8ICB A;  2F1I A;  1PVR A;  3MR5 A;  3EW9 A;  2DBY A;  1KFT A;  5K4L A;  1Q46 A;  3L5K A;  3B0Y A;  3EPI A;  1PK1 A;  4US9 A;  2O6K A;  3RJH A;  1L5U A;  4QZG A;  3RH5 A;  1XSP A;  2J6S A;  4BX9 C;  1X66 A;  1NJY A;  3H40 A;  1KQQ A;  7ICH A;  3UXN A;  2ZIV B;  3GII A;  1L7N A;  1N63 A;  1ZQY A;  2Z7J A;  4ECY A;  5J2K A;  2RDI A;  4PZN A;  3AL0 B;  2ZXH A;  1DGJ A;  3GIM A;  5KFL A;  2FPM A;  4BJQ A;  3SEI A;  5III A;  3T5J A;  3MFH A;  2K8B B;  1V38 A;  3UMG A;  2I1Q A;  5KFA A;  2ZXI A;  4DQS A;  3UPQ A;  3ETR A;  1S0M A;  4I2B A;  4MHV A;  2MSN A;  1WUD A;  1XS9 D;  8ICZ A;  4I2A A;  2MU2 A;  5KG1 A;  2ASJ A;  2ZIX B;  1V9P A;  4IQU A;  5ALG A;  4RT3 A;  3NRZ A;  4YVZ A;  2FDR A;  7ICP A;  2AH5 A;  4R63 A;  2AQ4 A;  4KTQ A;  4IQV A;  1NK9 A;  2PFN A;  2OWO A;  4BUG A;  3T5H A;  3TI0 A;  3BZK A;  3LVV A;  5KFZ A;  4Y2Y A;  7ICM A;  3C2K A;  1UPH A;  2JEI A;  1BPZ A;  5JUM A;  4NJ8 A;  2FMP A;  1YZ7 A;  1L8O A;  4I2I A;  5KFK A;  1RXW A;  1B0X A;  5KG6 A;  1J97 A;  3UQ2 A;  1HUZ A;  3HP6 A;  3AN1 A;  4IR9 A;  4UAT A;  4DWI A;  1KBU A;  1KDH A;  2AGO A;  2W9B A;  3C28 A;  4DFD A;  4FO6 A;  1XNS A;  2YB1 A;  4F71 A;  5J2I A;  1TAM A;  3M8S A;  4EZ9 A;  4QZ9 A;  3V72 A;  4PHP A;  2KTQ A;  3UMB A;  3TAD A;  1JX4 A;  2HW3 A;  3T5L A;  3DV9 A;  5CR0 A;  4A8E A;  1ZQU A;  5CWR A;  4G3I A;  4M6W B;  2HVH A;  2ASD A;  4JB3 A;  4BGD A;  5KT5 A;  4J9O A;  2M9N A;  3AQE A;  4P2H A;  3THV A;  1Z1B A;  4EBD A;  2K60 A;  1FIQ A;  4RQ4 A;  2EZX A;  3H8M A;  3FDS A;  2K4I A;  2W9C A;  5AKG A;  5HNK A;  2JV3 A;  4DL3 A;  3WKB A;  1BPY A;  3H0L B;  5DG8 A;  5CRX A;  4F72 A;  4G9B A;  2W11 A;  4KLS A;  2BPF A;  9ICJ A;  4I2G A;  2VIX A;  4DSF A;  5HMM A;  2XC9 A;  2KOB A;  5KFR A;  4EBC A;  2JGA A;  4DQP A;  3N97 B;  4RQ3 A;  1XWL A;  9ICN A;  1OW5 A;  2DFL A;  1B4F A;  3OTQ A;  3IP4 B;  3OJS A;  4GXJ A;  3EPG A;  2ZIV A;  3RRH A;  3Q8R B;  4GFJ A;  5DGB A;  5AI8 A;  4DL2 A;  4YMM A;  3PW0 A;  3PSI A;  5KL8 B;  1DGS A;  2NV3 A;  1RG6 A;  3TQ1 A;  1RZT A;  5AK4 A;  4FZN A;  3QZ8 A;  4YR2 A;  3Q8S B;  2ZTC A;  5J0R A;  5DBC A;  4HAI A;  4IL6 U;  3MGH A;  2KKP A;  3SAH A;  3Q8Q B;  2DGZ A;  3R9K A;  4UAW A;  4DO9 A;  2KJ9 A;  4ELV A;  5ALU A;  1ARO P;  4F93 B;  1U47 A;  3RJJ A;  2A1A A;  3C2M A;  2DQN B;  3L4P A;  5BOM A;  1A6S A;  1Z1V A;  2ZIX A;  2PFQ A;  1MC8 A;  3MC1 A;  3KOO A;  2JRZ A;  1LVH A;  5J29 A;  2W43 A;  5ALJ A;  3EUB 2;  3GV7 B;  4F8R A;  5KAI U;  2W7P A;  2GLE A;  5KFH A;  2KSO A;  2FMQ A;  7ICJ A;  4DLG A;  3FM9 A;  5J2H A;  2HOI A;  2W9M A;  1HEK A;  3ZD8 A;  4ED1 A;  2OYY A;  2XCA A;  2HCF A;  2DKX A;  3QX7 A;  4KLU A;  4RQ6 A;  5KG7 A;  4KX3 A;  2KIC A;  5ALZ A;  1KW4 A;  1YT3 A;  4JV0 A;  4F50 A;  7ICR A;  2ZUD A;  3RJI A;  9ICR A;  3QYP A;  4BDP A;  4DCC A;  5D4B A;  2PKE A;  5DQI A;  1ZQT A;  4DOA A;  1T8E A;  3HRD D;  1X9W A;  4P4O A;  2F8L A;  4WJ3 B;  2NRT A;  2B6G A;  1ZQO A;  3EZ5 A;  4YD2 A;  2UVV A;  1L7O A;  5L1I A;  1T4G A;  1WYG A;  3GFK B;  4DS4 A;  5KFJ A;  5AIC A;  3N7P D;  4M6W A;  9ICE A;  5EOZ A;  2QB1 A;  1Q8K A;  3CW2 C;  5L1M A;  2JHD A;  4BXO B;  3AU2 A;  4Y2U A;  5KG2 A;  5AM2 A;  5EE3 A;  3ISB A;  3BS5 B;  2VA3 A;  3RH4 A;  3KKA C;  1ZQL A;  1CRX A;  3HKZ F;  2JR5 A;  4GXI A;  5IIK A;  2Q0Z X;  3V6J A;  4TQR A;  2UVW A;  1CUK A;  4DOC A;  2XY6 A;  1K1S A;  1WWU A;  3WK9 A;  2E1E A;  5DDM A;  3TFR A;  2C28 A;  3GQC A;  2F2A B;  4DSJ A;  2ISP A;  2LM1 A;  5AIA A;  4OJL A;  1ZQE A;  3QUQ A;  1N61 A;  1ZQ1 C;  4LVS A;  3G6X A;  3RR8 A;  4DL4 A;  4OJ6 A;  4CGZ A;  2W3R A;  2KFN A;  1IIP A;  5KFE A;  5KFD A;  1ZD4 A;  2W03 A;  4F91 B;  4OJ5 A;  4EZ6 A;  4DL5 A;  5AKX A;  2QAR B;  3Q8P B;  1KN5 A;  2FLP A;  3K75 D;  2BKE A;  4M9H A;  3C1Z A;  3KHL A;  1SV0 A;  9ICX A;  1UQV A;  4B6J A;  5B66 U;  3SV4 A;  2IOH A;  1D8Y A;  3BS7 A;  4ICA A;  2WF6 A;  4IRC A;  2FLL A;  2M0N A;  4FE3 A;  3PML A;  4YR3 A;  2HHW A;  3MGI A;  4IRK A;  2CN1 A;  2JEJ A;  5KG3 A;  3WKA A;  2BCV A;  2OHF A;  2VAN A;  1SL2 A;  1ZET A;  5DQG A;  7ICF A;  2DPJ A;  3SV3 A;  3VC8 A;  3PV8 A;  1IM4 A;  5KFB A;  1S77 D;  3WU2 U;  5J8Y C;  5DB9 A;  2KZM A;  9ICQ A;  4Q45 A;  4I28 A;  8ICT A;  2QLT A;  1VLB A;  2OEH A;  7ICI A;  5EE1 A;  2R8H A;  3V6H A;  1QQ7 A;  9ICK A;  4PL1 A;  4UB6 U;  1ZRN A;  1NKE A;  3ZDC A;  4ECR A;  2R8J A;  3MGV A;  4O5K A;  8ICM A;  4FZM A;  2HHT A;  3MBY A;  4RPY A;  4U6P A;  3KD3 A;  3RRG A;  3KHG A;  3PW5 A;  1UT5 A;  4UAZ A;  4QW9 A;  4FZL A;  1RYR A;  3IRU A;  3PX4 A;  5J2E A;  3VCB A;  4DL6 A;  4M04 A;  2BZF A;  1SKR A;  3N28 A;  1JRP A;  2H5X A;  1S0N A;  8ICP A;  4CNQ A;  2KIW A;  5ALL A;  4C4S A;  2ZJ5 A;  1KFD A;  3ISD A;  3M7D A;  3NVW A;  2BQR A;  1NZP A;  1BPB A;  4QZC A;  2HBK A;  4Q44 A;  5KFQ A;  4ECS A;  2Y9T A;  3PX0 A;  3V7K A;  4BXO A;  5AIB A;  5DBA A;  2B21 A;  1DXS A;  3BZC A;  5DLF A;  3BS5 A;  3WKE A;  4IQW A;  1MQ2 A;  1KRP A;  4I2D A;  8ICJ A;  1QSL A;  3U26 A;  2Y1I A;  4DL7 A;  1ZQV A;  1L6N A;  3LDA A;  4J9L A;  5ALK A;  4UB1 A;  4NV0 A;  2XY7 A;  3HKZ C;  1SXD A;  3B0X A;  2ATL A;  3H0R B;  4GC7 A;  2PI4 A;  4JUZ A;  3WKC A;  4JWN A;  4UAY A;  2EZZ A;  4EYI B;  4F5N A;  2AGP A;  1T3N A;  4O3M A;  2E1F A;  1S0O A;  3M6Z A;  2W9B B;  1ZQR A;  3PX6 A;  2L5Y A;  5B5E U;  2XGQ A;  4YXM A;  3SAF A;  4FBU A;  3PO5 A;  4DFP A;  2KE7 A;  2LHT A;  5A0L A;  4I29 A;  4MFA A;  4QZE A;  1NK6 A;  1LB2 B;  2HHS A;  4Z6C A;  2KJ8 A;  4IRD A;  5JU5 A;  3QU7 A;  5J0O A;  1D8B A;  1SB3 C;  1MSW D;  5KT3 A;  3HT3 A;  5ALT A;  3GIJ A;  4UB4 A;  4F5P A;  7ICQ A;  4R64 A;  1ZD5 A;  2YY6 A;  2QAR A;  1TV9 A;  3E0F A;  4RPX A;  4UB2 A;  2LYH A;  2AHO B;  1U4B A;  1DRG A;  4DSL A;  3NVZ A;  1OUQ A;  2G08 A;  3PSP A;  2KHV A;  5KFO A;  4PL2 A;  2WHE A;  2AQ0 A;  3PW2 A;  8ICG A;  5HR7 A;  3AMZ A;  4IS7 A;  1NI3 A;  5KFP A;  3M9M B;  4M9L A;  3CP8 A;  1FFV A;  4B9U A;  4C4T A;  2F8K A;  4I2J A;  5TZV A;  3SD7 A;  3KZX A;  2YMQ A;  2G5I B;  1QH9 A;  3F2D A;  3RBE A;  4LZG A;  5J0Q A;  1Z19 A;  3FAH A;  5DKW A;  3T79 A;  5JRT A;  4DSK A;  1YZ6 A;  2B0C A;  3PO4 A;  3PR5 B;  5AI4 A;  4KLQ A;  1BPE A;  1N2X A;  5AKI A;  4I2E A;  1PVP A;  5J0U A;  2HHQ A;  4NL9 A;  1QTM A;  4FFD A;  3RJK A;  4TUS A;  5DDY A;  2Y9U A;  3C5F A;  1RXV A;  4DQI A;  3NAS A;  5J2D A;  4DFJ A;  3FYH A;  2BCR A;  5ALX A;  2MA1 A;  4RQ7 A;  2ZJ8 A;  2FJ6 A;  4C4R A;  2QB0 B;  3D2Q A;  5AI6 A;  1F44 A;  2KSO B;  3K4G A;  2ZIW B;  1N56 A;  4O5C A;  4USA A;  4F4W A;  1SWV A;  3GIK A;  2E8N A;  2WF5 A;  4CRX A;  5AM3 A;  2NRV A;  4RNM A;  3D2S A;  4EEY A;  4KLI A;  3CNH A;  2OXO A;  2YX8 A;  3JPQ A;  2V4R A;  4EX6 A;  4AP9 A;  5CP2 A;  3KFU F;  5KFW A;  2LBO A;  4EEL A;  3MDC A;  1F0M A;  1L3U A;  4PPX A;  7ICT A;  1ZD2 P;  7ICV A;  5HHI A;  5IIM A;  2F1H A;  2KIV A;  1J2M A;  2AJQ A;  5ALW A;  1BPX A;  2W54 A;  2LYA A;  5AI5 A;  2OH2 A;  2E8M A;  4UAS A;  4IQT A;  3JPO A;  3MFI A;  1TE2 A;  3ED5 A;  3OJU A;  5AKJ A;  2VJ5 A;  3DEE A;  2ESE A;  5KNI A;  2BPG A;  2ZTD A;  4ELT A;  4RQ5 A;  4Y2S A;  1V85 A;  2HI0 A;  4F2S A;  1X9X A;  2IMW P;  2LPE A;  2BCU A;  3QUT A;  2F1J A;  3JPT A;  2ZUB A;  5KFN A;  2BGW A;  2DUY A;  2KKV A;  4RQ2 A;  5ALH A;  4EX7 A;  3RAX A;  4YP3 A;  1EXN A;  1UCV A;  4NM2 A;  4C8N A;  1NJZ A;  1S97 A;  2BQU A;  7ICG A;  3ONN A;  4J9M A;  1PUZ A;  1ZQX A;  3C2L A;  5KL1 B;  1FFU A;  4B9L A;  2P6R A;  1SV0 C;  9ICB A;  4QZF A;  9ICT A;  3PSF A;  4ED0 A;  2WFA A;  4Q8F A;  4AYB F;  4PGY A;  3F53 A;  4TQS A;  1MA7 A;  4QNL A;  2D8C A;  1KFS A;  3RR7 A;  2RQ5 A;  3ETL A;  4C8O A;  2HOF A;  4ECQ A;  5ALI A;  2C22 A;  2A19 A;  3H8J A;  5IIN A;  3BQ1 A;  5KFV A;  2W8K A;  1QQ5 A;  4NXZ A;  1RDF A;  5DB7 A;  1KSP A;  2QKQ A;  3PR4 A;  1TAU A;  4Y2P A;  1U9L A;  4MEX A;  7ICO A;  2VA2 A;  1D9F A;  2WF7 A;  9ICW A;  3A0H U;  4J9N A;  5L1L A;  1ECW A;  3CRX A;  4C7Y A;  4J9Q A;  2ES6 A;  4PH5 A;  1Q3V A;  3D6J A;  2H3V A;  4RQM A;  3OSN A;  4DQR A;  3LYS A;  4UAR A;  2XVT A;  5DG7 A;  2FPK A;  4TUP A;  2W7O A;  3M1Y A;  5T14 A;  3LWM A;  3NRW A;  1QQ6 A;  2QB0 A;  3RBD A;  2ZIW A;  2XI9 A;  2VKQ A;  3I1Y A;  3PVX A;  7ICK A;  4B9M A;  2GH1 A;  5J2J A;  4US8 A;  1JMS A;  5J0W A;  3JPN A;  3UXO A;  1JI7 A;  5AI9 A;  3JPR A;  1ZQD A;  1ZQF A;  4UAV A;  5ALO A;  4PHD A;  3GV8 B;  1XO0 A;  3UM9 A;  3H7I A;  3RF9 A;  4MF2 A;  4UW9 A;  5G5H A;  3TAQ A;  1NNL A;  1RPL A;  1N48 A;  2K8A A;  3QXG A;  4I27 A;  2W55 A;  4UB5 A;  1SL0 A;  4M9N A;  1ZJN A;  3E58 A;  5DGA A;  4YD1 A;  4MFF A;  2OM6 A;  5G5G A;  2FPL A;  3SMV A;  2K89 A;  3BQ2 A;  7ICS A;  4KMU A;  3IN5 A;  1S76 D;  2R18 A;  1NKB A;  1BNP A;  1RM6 C;  8ICN A;  2D3D A;  4KX5 A;  1PVQ A;  4B9T A;  5AM0 A;  5KTQ A;  1BPD A;  2CXY A;  3EWA A;  2WF8 A;  9ICV A;  4UBC A;  1SGG A;  1Z4N A;  1D9D A;  1UA0 A;  2YQE A;  3LWL A;  1L3T A;  3M9O B;  2XGP A;  4CE6 A;  1H38 A;  4QWD A;  4BWM A;  2FI1 A;  2PXI A;  7ICN A;  8ICU A;  4I2C A;  1NK4 A;  4DS5 A;  5H2F U;  1U48 A;  4QIW F;  4YMO A;  2YML A;  4ECV A;  2FMS A;  3AEV A;  5CEH A;  3GU3 A;  1X9M A;  4AYB C;  4KLO A;  2I6X A;  2ODG A;  4IC9 A;  1OXJ A;  4M0A A;  1ZRM A;  1X40 A;  1Z00 A;  4Y2R A;  2G06 A;  5ALS A;  4KLF A;  5J0P A;  3ORY A;  2KJ5 A;  1KEJ A;  1SV4 A;  1TVA A;  3IG8 A;  5DG9 A;  2R8I A;  2V9W A;  2Q4T A;  5CA7 A;  1QLN A;  1ZQZ A;  3HWT A;  4YQW A;  4ZOH C;  1ED1 A;  3PST A;  2K4H A;  4F5R A;  4R8U B;  1SWW A;  4O9M A;  3F2C A;  3M9N B;  5KT7 A;  4RNO A;  4NL9 C;  3PW4 A;  3QUC A;  1BVS A;  4MEY A;  2HBJ A;  2EZY A;  1AQ6 A;  2DF4 B;  2D6F C;  3MR2 A;  3I28 A;  2KHQ A;  3RTV A;  8ICF A;  1ZQP A;  3H4D A;  3F5E A;  4C7Z A;  3ZDD A;  2ZIU B;  1DK2 A;  2HVI A;  4Q43 A;  2JXJ A;  4QWA A;  8ICI A;  3C5G A;  1VDV A;  4NLC A;  5AK3 A;  4NM1 A;  1LKY A;  4EYH B;  4J03 A;  4XRH A;  3O0F A;  3AM9 A;  4DEZ A;  7ICL A;  1UT8 A;  1WCN A;  2JEF A;  1L8L A;  2BCQ A;  2G07 A;  4OO1 J;  3Q8K A;  2XIC A;  1KKX A;  2P35 A;  8ICA A;  5AKZ A;  1QSS A;  8ICX A;  3KZI U;  2RLT A;  2Y1J A;  1SZP A;  8ICQ A;  4CF5 A;  5J0X A;  4O3S A;  2P6U A;  5KFI A;  5KT4 A;  1NKC A;  1ZQG A;  2OCE A;  4NLK A;  1ZQW A;  2HBM A;  4X5V A;  5KFX A;  9ICP A;  2V4Q A;  2LMR A;  4K4I A;  2GO7 A;  5ALV A;  4DSE A;  4GXK A;  1NOM A;  1KLN A;  5C5J A;  1KTQ A;  1SL1 A;  1PK3 A;  2YTU A;  2BCS A;  2H3Z A;  4KLE A;  4F5Q A;  4DLE A;  3TAD C;  4YR0 A;  5ALD A;  4KLT A;  2BDU A;  2F76 X;  2NYV A;  4UB8 U;  3WK5 A;  9ICC A;  2I9G A;  3V6K A;  9ICA A;  3RAQ A;  3UMC A;  3NVV A;  5L1J A;  5AKH A; 
#chains in the Genus database with same CATH homology
 1HUO A;  7ICU A;  2BCR A;  1XSN A;  4RQ7 A;  4YMM A;  1ZJM A;  8ICE A;  5J0T A;  1RZT A;  4QZ8 A;  5IIL A;  4DOB A;  5J0R A;  5DBC A;  3MGH A;  8ICC A;  4O5C A;  4XA5 A;  4RQ8 A;  4UAW A;  4DO9 A;  8ICL A;  8ICV A;  3RJJ A;  3C2M A;  5BOM A;  4KLI A;  2PFQ A;  3JPQ A;  4F5O A;  5J29 A;  3PNC A;  5J2B A;  3MDC A;  4PPX A;  7ICT A;  7ICV A;  2FMQ A;  5HHI A;  4O5E A;  7ICJ A;  4JWM A;  5IIM A;  4NY8 A;  5J2H A;  2W9M A;  2GWS A;  4M9J A;  5DB8 A;  3RJE A;  1BPX A;  4KLU A;  4RQ6 A;  1ZQJ A;  4RPZ A;  4IQT A;  3JPO A;  8ICH A;  8ICR A;  7ICR A;  1ZQS A;  3RJI A;  2BPG A;  4K4H A;  9ICR A;  3GDX A;  2PFP A;  4RQ5 A;  1ZQH A;  5D4B A;  2BCU A;  1ZQT A;  3JPT A;  5J0Y A;  3MDA A;  4DOA A;  1ZQQ A;  4R66 A;  4RQ2 A;  1ZQO A;  4NM2 A;  4YD2 A;  7ICG A;  3JPS A;  4QZD A;  3C2L A;  3OGU A;  9ICB A;  9ICT A;  4QZF A;  3AUO A;  4NLN A;  9ICE A;  5EOZ A;  4I2H A;  4RQ1 A;  4PGY A;  9ICH A;  3HW8 A;  3V7J A;  3PMN A;  3AU2 A;  5DBB A;  3ISB A;  3RH4 A;  1ZQL A;  3ISC A;  5IIN A;  4GXI A;  5IIK A;  1DK3 A;  4Z6E A;  4NXZ A;  1ZQK A;  4DOC A;  1ZQM A;  4YN4 A;  3HX0 A;  5DB7 A;  3TFR A;  7ICO A;  9ICW A;  2ISP A;  5D49 A;  5DB6 A;  3JPP A;  4R65 A;  1ZQE A;  8ICO A;  1MQ3 A;  3LK9 A;  4LVS A;  1ZQI A;  4PH5 A;  4YMN A;  3V7L A;  1ZQA A;  4MF8 A;  4Z6D A;  8ICY A;  4UBB A;  4TUP A;  4M9G A;  7ICK A;  8ICK A;  4RQ0 A;  5J2J A;  1JMS A;  4M9H A;  5J0W A;  3JPN A;  3UXO A;  4Z6F A;  3JPR A;  9ICX A;  1ZQD A;  1ZQF A;  4PHD A;  3PML A;  5J2G A;  4PGQ A;  4TUR A;  4MF2 A;  3MGI A;  5CB1 A;  2BCV A;  1ZQN A;  9ICL A;  7ICF A;  4I27 A;  4UB5 A;  5BPC A;  4M9N A;  4QZA A;  1ZJN A;  4YCX A;  5DB9 A;  9ICQ A;  4I28 A;  4YD1 A;  8ICT A;  4MFF A;  4XUS A;  7ICI A;  7ICS A;  9ICK A;  4M2Y A;  1BNP A;  8ICN A;  9ICI A;  4KLG A;  4PGX A;  8ICB A;  1BPD A;  4O5K A;  3UQ0 A;  8ICM A;  9ICV A;  3B0Y A;  3MBY A;  4UBC A;  4RPY A;  3RJH A;  4PHA A;  9ICG A;  4QZG A;  3RH5 A;  4UAZ A;  4UB3 A;  1XSP A;  5J2E A;  7ICH A;  4M04 A;  3UXN A;  4QZI A;  4K4G A;  5IIO A;  2PXI A;  7ICN A;  8ICU A;  8ICP A;  4I2C A;  5J2K A;  3ISD A;  1XSL A;  9ICO A;  4LZD A;  4I2F A;  3RJG A;  1NZP A;  4YMO A;  4QZC A;  4TUQ A;  4NLZ A;  2FMS A;  5III A;  3V7K A;  3RJF A;  5DBA A;  4KLO A;  1BNO A;  1ZQB A;  3TFS A;  5BOL A;  4M0A A;  3UPQ A;  4I2B A;  4IQW A;  1MQ2 A;  4I2D A;  8ICJ A;  4KLF A;  5J0P A;  8ICZ A;  4I2A A;  1KEJ A;  4UB1 A;  1TVA A;  4IQU A;  4RT3 A;  2P66 A;  7ICP A;  3UXP A;  3B0X A;  4R63 A;  4IQV A;  2PFN A;  4KLD A;  4JWN A;  4UAY A;  3HWT A;  3AU6 A;  4F5N A;  1ZQR A;  4F5R A;  5J2A A;  7ICM A;  3C2K A;  4M47 A;  1BPZ A;  4O9M A;  1ZQC A;  2FMP A;  4KLJ A;  2KP7 A;  4I2I A;  4QZB A;  7ICE A;  4I29 A;  4QZE A;  4MFA A;  3UQ2 A;  1HUZ A;  4Z6C A;  8ICF A;  1ZQP A;  5J0O A;  4KLL A;  1KDH A;  1DK2 A;  4KLH A;  8ICW A;  4UB4 A;  4F5P A;  7ICQ A;  4FO6 A;  8ICI A;  4R64 A;  3C5G A;  5J2I A;  1TV9 A;  4NM1 A;  4RPX A;  2PFO A;  4QZH A;  5J0S A;  4UB2 A;  4QZ9 A;  3V72 A;  4PHP A;  9ICS A;  7ICL A;  8ICG A;  9ICU A;  5CWR A;  5D46 A;  2BCQ A;  9ICF A;  9ICM A;  4M9L A;  8ICA A;  8ICX A;  8ICQ A;  4I2J A;  5J0X A;  5TZV A;  4RT2 A;  4P2H A;  4RQ4 A;  1ZQG A;  2IHM A;  4NLK A;  2ISO A;  4X5V A;  5J2F A;  4LZG A;  5J0Q A;  4KLM A;  9ICP A;  1BPY A;  4K4I A;  5DKW A;  4GXK A;  3RH6 A;  4KLS A;  2BPF A;  4KLQ A;  4PHE A;  1BPE A;  9ICJ A;  5IIJ A;  4I2G A;  4I2E A;  2BCS A;  4KLE A;  4MFC A;  5J0U A;  4F5Q A;  4RQ3 A;  5HHH A;  3RJK A;  4TUS A;  8ICS A;  5DDY A;  9ICN A;  4KLT A;  4GXJ A;  9ICC A;  2I9G A;  3C5F A;  5J2C A;  9ICA A;  5J2D A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...