1BNPA

Nmr solution structure of the n-terminal domain of dna polymerase beta, 55 structures
Total Genus 12
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
12
sequence length
87
structure length
87
Chain Sequence
b'MSKRKAPQETLNGGITDMLVELANFEKNVSQAIHKYNAYRKAASVIAKYPHKIKSGAEAKKLPGVGTKIAEKIDEFLATGKLRKLEK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DNA POLYMERASE BETA
publication title Three-dimensional solution structure of the N-terminal domain of DNA polymerase beta and mapping of the ssDNA interaction interface.
pubmed doi rcsb
source organism Rattus norvegicus
molecule tags Nucleotidyltransferase (dna-binding)
total genus 12
structure length 87
sequence length 87
ec nomenclature ec 2.7.7.7: DNA-directed DNA polymerase.
pdb deposition date 1996-04-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF14716 HHH_8 Helix-hairpin-helix domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.110 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 DNA polymerase beta, N-terminal domain-like 1bnpA00
5IIMA 4PHDA 4NLZA 2BPFA 4UB4A 4TUPA 9ICPA 1BNOA 9ICWA 3LK9A 8ICEA 5J0WA 9ICBA 4LVSA 4O9MA 4M9HA 3TFRA 1MQ3A 5IIIA 2I9GA 3UQ2A 4O5EA 1ZQKA 4QZDA 4K4IA 4KLTA 4KLHA 5J0RA 4PGQA 4F5OA 4O5KA 4I29A 9ICLA 5J0PA 3B0XA 3RH5A 4NXZA 5J0UA 4RT2A 3UXOA 2IHMA 4MFCA 3C2KA 3JPRA 9ICGA 5J2IA 1ZQPA 1BPZA 4M9NA 4UAZA 1ZQLA 1ZQSA 8ICMA 2ISOA 9ICRA 4Z6EA 4X5VA 3C2LA 3RJHA 4PH5A 4NLNA 4YD1A 4F5QA 1ZQJA 3PMNA 3C5GA 1MQ2A 1NZPA 4KLIA 4KLUA 9ICJA 3V7KA 4NLKA 5DB8A 4MF8A 1ZQOA 9ICFA 4F5RA 5DDYA 3JPNA 4PHEA 2P66A 7ICHA 8ICIA 4UAYA 4RQ5A 4K4HA 4RQ2A 1ZQQA 2FMSA 1RZTA 3RH4A 7ICFA 7ICOA 1ZQDA 9ICVA 2PXIA 4DO9A 2ISPA 7ICTA 8ICRA 3JPPA 4R64A 1ZQRA 1TV9A 7ICEA 5J0TA 9ICIA 5CB1A 8ICBA 4UBBA 5J2EA 3RJFA 3RH6A 1ZQEA 4IQVA 3OGUA 7ICNA 4LZDA 5IIOA 8ICKA 4RPYA 4UB1A 4JWMA 8ICUA 4R65A 4MF2A 4YCXA 4F5PA 4M9GA 3UQ0A 3B0YA 2PFPA 5J29A 1ZJNA 1ZQCA 4NM2A 8ICFA 2FMPA 4QZ9A 5BOMA 5IIKA 3JPQA 4IQTA 8ICZA 3HX0A 4TURA 3ISCA 4UAWA 4XA5A 3TFSA 9ICAA 4I2FA 4YMMA 4RQ8A 3PNCA 9ICKA 3UXPA 3AUOA 2BCQA 4PHPA 8ICVA 3RJGA 7ICJA 8ICOA 5DB6A 1ZQMA 4RQ6A 4QZEA 7ICPA 4UB2A 4QZGA 5D49A 3GDXA 3ISDA 4I2IA 5HHHA 4RQ0A 4XUSA 5IILA 4KLEA 3C5FA 5DB9A 3MDAA 9ICCA 3V7JA 5J2GA 5J2KA 3AU2A 4P2HA 3JPOA 1HUOA 3V7LA 9ICQA 5J2FA 4PGXA 7ICRA 4UBCA 4GXJA 5BPCA 9ICMA 4NM1A 4Z6CA 3RJEA 4YN4A 5D4BA 4PHAA 4KLOA 9ICSA 4RQ3A 5EOZA 4UB5A 4MFFA 5IIJA 8ICXA 3RJIA 3JPSA 4QZHA 7ICLA 4I2AA 4I2CA 1BNPA 4IQUA 2FMQA 4DOCA 3UPQA 5J2AA 4M47A 7ICUA 5HHIA 1BPYA 4KLGA 1ZQAA 4IQWA 4TUSA 4I28A 4M2YA 3C2MA 1BPXA 4PGYA 4M9JA 4R63A 4I2HA 5J2BA 4RQ1A 1DK3A 7ICMA 5BOLA 5J2HA 4K4GA 2W9MA 1BPEA 4I2JA 5J0OA 5J2DA 1ZQBA 4M04A 1ZQTA 4FO6A 4RQ7A 5J0YA 7ICGA 3V72A 4YMNA 4GXIA 4NY8A 4M0AA 3MGIA 4I2BA 1ZJMA 2BCUA 3AU6A 1XSNA 4YD2A 3HWTA 3UXNA 4RT3A 4RPZA 8ICJA 1XSLA 1TVAA 1ZQGA 3HW8A 5TZVA 5J0QA 4M9LA 4I2DA 4QZIA 9ICEA 5DBCA 3JPTA 8ICCA 7ICSA 1XSPA 3PMLA 2BCRA 8ICQA 4LZGA 2BCSA 1ZQHA 4QZAA 3RJKA 9ICTA 1KEJA 8ICAA 1ZQNA 4KLMA 1ZQFA 8ICHA 4I2GA 8ICNA 4F5NA 4DOBA 5J0XA 3MDCA 3MBYA 2GWSA 7ICIA 3ISBA 4Z6FA 5IINA 2PFQA 5CWRA 3RJJA 4RPXA 4KLJA 5DBAA 4Z6DA 4KLLA 9ICOA 4KLQA 5DKWA 2BCVA 4I2EA 2PFOA 5J0SA 4MFAA 2BPGA 4YMOA 4GXKA 5J2CA 4R66A 4QZFA 4PPXA 8ICYA 4DOAA 4QZ8A 5DB7A 1KDHA 4O5CA 1ZQIA 4QZCA 9ICXA 8ICTA 4KLSA 8ICWA 5J2JA 7ICVA 4UB3A 9ICUA 8ICPA 1DK2A 9ICNA 4KLDA 4KLFA 8ICLA 1HUZA 2PFNA 1BPDA 9ICHA 2KP7A 4JWNA 4I27A 4RQ4A 5D46A 8ICSA 3MGHA 7ICKA 4TUQA 5DBBA 8ICGA 4QZBA 1JMSA 7ICQA
chains in the Genus database with same CATH superfamily
1PK1B 5IIMA 1F44A 3KZXA 4NLZA 2ODGA 5KFIA 2HBMA 4UB4A 1J2NA 4TUPA 3NVZA 2F76X 1SB3C 9ICPA 2KV2A 3C1ZA 2Y1IA 9ICWA 4F50A 4R8UA 5KT7A 1V38A 1N63A 1PVPA 1UHUA 3MC1A 2XGQA 5KFVA 1D8LA 1MQ3A 5IIIA 3HKZC 4YXMA 5KG7A 4P0PB 3C21A 4K4IA 3EYZA 4KLTA 2EZYA 2DPJA 3QUBA 5J0RA 5KFMA 4F5OA 4O5KA 3G6YA 5J0PA 2ALZA 2XICA 4FZMA 1NJXA 5JRTA 3SENA 2WFAA 2EAOA 5DG7A 4NWIA 5CJ7A 3C2KA 2KSOA 4G3IA 2KZZA 2R18A 1ZQPA 4EZ9A 3WU2U 4M9NA 2NRVA 1SWVA 5KFDA 4QWDA 3RAXA 8ICMA 2BDPA 5G5HA 4X5VA 4EX7A 3C2LA 4NLNA 2G07A 4YD1A 2DFLA 1D9FA 3PSIA 2WB1C 3V7KA 1X9SA 4Y2JA 1A0PA 4EX6A 5DB8A 1ZQOA 1N61A 4C8LA 5KFQA 2A3VA 3JPNA 4PHEA 7ICHA 2MUTB 4UAYA 4BGDA 3SEIA 3KKAC 2FMSA 2GOLA 1RZTA 1ZQZA 4IRDA 2VA3A 7ICFA 3SZ2A 1ZQDA 5KG0A 5KG2A 1NK6A 4EYHB 5ALGA 7ICTA 1LB2B 4FFDA 4CF4A 5DG8A 4PL2A 3NGDA 3MR6A 8ICBA 5J2EA 2JRZA 2A19A 2XVTA 3DDHA 4WJ3B 4OJLA 1ZQEA 1FIQA 2V4QA 5IIOA 2BQUA 8ICKA 4RPYA 1ZOLA 1XNSA 4UB1A 8ICUA 2KIVA 5ALTA 2VA2A 2W04A 4Y2QA 4RUCA 4MF2A 1TFRA 4DSKA 1S76D 1DOQA 5AKGA 2KJ9A 2MUTA 5G5GA 2DGZA 1ZQCA 4FS2A 1RXVA 3K75D 5B5EU 3HP6A 2FMPA 3QU5A 2ZIWB 4B9UA 3TAPA 1O08A 1JXLA 3SYZA 4C8KA 3MR3A 1DRGA 5ALUA 5AKLA 3TADA 5DLGA 3QNMA 3ICXA 1DGSA 1MA7A 1COKA 3HPOA 2BCQA 4PHPA 7ICJA 8ICOA 4USAA 5DB6A 2AJQA 4HYKA 4O3MA 4RQ6A 1N5XA 4QZEA 1RPLA 7ICPA 2EH9A 4QZGA 4J9PA 5D49A 2ZUDA 3F5AA 4XUSA 1ZQUA 4KLEA 1RXWA 1U48A 2KMDA 1PZNA 4ECRA 2ZIWA 1L3SA 4YR2A 5J2KA 1L8LA 5ALFA 2LM1A 3AU2A 5AKYA 2RHFA 1WUDA 5KFRA 3VC8A 5J2FA 5DGBA 4PGXA 2ZIXB 3NVYA 4RNMA 3H4DA 4GXJA 1KRPA 2OEHA 2VJ5A 3CNHA 4TQSA 4Z6CA 5EWGA 3Q8MA 3RAQA 1KFDA 2ZXIA 4PHAA 3BQ1A 4HAIA 4YXJA 4GC6A 5EOZA 2KFNA 2W9BB 3MGVA 2K4PA 3LWMA 3NUQA 5IIJA 3N7SC 2QARB 3QZ8A 3TKAA 4CF3A 4BDPA 1LKYB 2ZTEA 3UMGA 1S0OA 1JALA 5ALDA 3TI0A 5KT5A 4IQUA 2KTQA 1X40A 4DOCA 4JV0A 3C28A 5L9XA 2FDRA 5J2AA 4M47A 1KN5A 3UMBA 1UT5A 4ELTA 1SXDA 2DWQA 5KFLA 1X9WA 1ZQAA 4IQWA 4ED0A 4TUSA 3FM9A 4PGYA 4I2HA 2ZXHA 3H8WA 4C8NA 4DQPA 2HDOA 4LJXA 4K4GA 4F92B 2W9BA 1QTMA 1TKDA 4ACOA 5HR7A 1URJA 3PW7A 1P7DA 4EEYA 1ZQBA 5CP2A 4M04A 2A1JB 4RQ7A 5J0YA 1YT3A 2W03A 4DFMA 2V4RA 4DL6A 1SXEA 4YMNA 3IG8A 2W7OA 2KICA 1ZD3A 1ZJMA 2NRTA 3GU3A 4RPZA 4B9VA 1SL1A 1ZQGA 4DQRA 4KX5A 2W8LA 2K4EA 5KL1B 3KD3A 2PMZF 5KNIA 2FPLA 1L7PA 4UAVA 2RQ5A 1U45A 3SV4A 2NV3A 3FAHA 2Q4TA 1XSPA 4DL3A 4C0ZA 3KHGA 3T5JA 3EZ5A 4BWMA 4DSIA 4O0IA 3KHHA 1ZQHA 3WK4A 2KK0A 4DEZA 3THVA 8ICAA 3GILA 4JMUA 2KKVA 1ZQFA 3O0FA 8ICHA 1K1QA 4MEXA 2JHDA 3RRHA 1A77A 3K1ZA 2D3DA 5GTHU 2K4IA 7ICIA 3ISBA 4EBCA 5ALJA 5CEHA 2K89A 2QLTA 2RDIA 2FJ6A 4F2RA 4UB6U 2UVVA 5DBAA 1J2MA 3M1YA 1JRPA 4Z6DA 1X9MA 3ED5A 4J03A 3PR5B 2BCVA 4I2EA 4RZRA 2PFOA 2MAXA 4GXKA 3M6KA 1U47A 5EE9A 4B9LA 2H3FA 2LMRA 5J2CA 4R66A 4DS4A 1NK7A 5DQGA 4ZOHC 5GTIU 1Q3UA 4FBTA 4DL5A 5L1JA 4F8RA 2LYHA 5L1MA 5L1LA 3IG5A 4ZH4A 4KLSA 2AGQA 3H7IA 2ATLA 7ICVA 4UB3A 2CPRA 3AM9A 2GO7A 2MRLA 2GLEA 1QSSA 4KLDA 4KLFA 1HUZA 2HVHA 2PFNA 1ZETA 9ICHA 3WK9A 4BXOB 3UMCA 4RQ4A 4TUQA 5AK5A 1V85A 8ICGA 1WCNA 2W43A 2KG5A 5HR6A 1HJPA 3M9MB 5JUMA 4B9SA 3AEVA 5ALVA 1XC9A 3KOOA 2JZBA 2KZMA 2BPFA 2FPMA 4OJOA 2WF9A 3WKCA 1BNOA 4P4MA 1NJWA 1N62A 5J0WA 2YQEA 5AM2A 1NK0A 4J9SA 4O9MA 2FPKA 3SD7A 2FI1A 2RP5A 3PW0A 2I9GA 3UQ2A 4O5EA 4QZDA 3R9KA 2JH7A 2JEIA 4KLHA 3MFHA 3T5HA 3AQEA 5K4LA 3HRDD 2KZ3A 3D6JA 4Y2PA 3UXOA 4MFCA 2HI0A 1ZQ1C 3KBBA 4UB8U 4DQIA 2C22A 1GO3F 1DGJA 9ICGA 3IHQB 5ALHA 3PR4A 3IDWA 3PSPA 1ZQLA 2ISOA 9ICRA 2O6KA 4Z6EA 4XRHA 3RJHA 3E58A 4F5QA 1D9DA 3WK6A 2HBJA 5ALYA 4KLIA 3KHRA 9ICJA 1X2IA 4EENA 4NLKA 4ICAA 1SV4A 3KKAA 4OCZA 4BUGA 1T7PA 2C28A 8ICIA 4RQ5A 4F72A 1TAMA 3BQ7A 3OJUA 1WWUA 5AI9A 2KEYA 5KFNA 4F4WA 2ISPA 4IL6U 4CDGA 4R8UB 3I76A 8ICRA 1ZQRA 5ALEA 2CN1A 2NRZA 9ICIA 5F9LA 1VJ5A 4ECTA 2KVSA 3NVVA 3OTQA 2J6UA 2P6RA 5J8YA 2KIWA 4DWIA 7ICNA 4LZDA 4Q8EA 1XO1A 2W54A 2G06A 1QSYA 3OSNA 4JWMA 2BGWA 4R65A 2HBLA 3NS1A 4EZ6A 3LVVA 2E8NA 4M9GA 3UQ0A 1BGXT 2Y0SC 5KFZA 2KSOB 1T8EA 4DSFA 2CRXA 2K8AA 2VA8A 2F1HA 4NM2A 8ICFA 2AQ4A 4QZ9A 2R8IA 5BOMA 5IIKA 5CR0A 3MR2A 8ICZA 3M6ZA 4GLXA 4TURA 5F9NA 4IRCA 2BQRA 4UAWA 4XA5A 1C7YA 5HMMA 1U9LA 5AM1A 1IM4A 4I2FA 5AIAA 3B9JA 3CW2C 3EW9A 1UPHA 4YG2A 4QIWC 1QLNA 4C4TA 2VKQA 1Z4NA 2HOFA 1KKXA 1ZQMA 4DL2A 4Y2UA 4DFKA 4RUAA 3SAHA 3ISDA 2W9AA 2E3TA 2KD1A 5IILA 3M7DA 9ICCA 3OSPA 3QU4A 3A0BU 4O3PA 3ZD8A 2M9NA 1SKWA 3SMVA 5ALIA 2CXYA 1TAUA 2E8OA 3WK8A 3D2QA 2ZTDA 7ICRA 1KSPA 5BPCA 2DUYA 1ZXIA 9ICMA 5KAIU 4NM1A 4OJ5A 3KTQA 5KFHA 2ASDA 3RJEA 4YN4A 5D4BA 1Z1BA 3V6KA 4KLOA 5KT4A 4RQ3A 1COOA 1HEKA 3I28A 3J81j 1RG6A 2LBOA 8ICXA 2ZTCA 1SKSA 3JPSA 3BZKA 3HJEA 4I2AA 5KFEA 3RBEA 2HHQA 2FMQA 4F93B 1SZHA 1NI3A 2G09A 5KT2A 1DXSA 2Z7JA 3RFAA 7ICUA 4Q44A 3SQIA 2NO5A 2WF5A 2XI9A 4QNLA 4M2YA 4ED6A 3DEEA 3L5KA 5KFPA 4EBDA 1LVHA 3T5KA 1T3QA 5KT3A 4RQ1A 1IV8A 2KHQA 1JI7A 1B0XA 5BOLA 5AKKA 3QUQA 2IHNA 2W9MA 3HT3A 2OWOA 4DSLA 2BHNA 5HNKA 1KFSA 4CE6A 5AKZA 3AQFA 4FO6A 2B0CA 2YMMA 3QEAZ 4Y2RA 2VIXA 3MGIA 2BCUA 1UCVA 1XSNA 4YD2A 2EQYA 3HWTA 3UXNA 5ALPA 1XSLA 1U4BA 3N7RC 3HW8A 5TZVA 5J0QA 1HIWA 2XC9A 1F5SA 4DLEA 2YMQA 5EE0A 9ICEA 3N4MB 5DBCA 1IG6A 2IA6A 7ICSA 3PMLA 3PW5A 4O3OA 2F8LA 5KG5A 3OHAA 5AI8A 1RQLA 2BCSA 2YN4A 3I1YA 1KEJA 4TQRA 4DFPA 2AU0A 4KLMA 3Q8QB 4I2GA 2YMPA 3MBYA 4RQNA 2ZJ8A 2W11A 4O3SA 2WAQF 5IINA 2PFQA 5KT6A 3RJJA 3QU9A 2MSNA 2WF7A 4J9QA 1S9FA 4FS1A 1ZQWA 2JEGA 3H40A 4KLLA 4AYBF 4JK1A 3BQ2A 5DKWA 1MSWD 2BZFA 2HCFA 4KX3A 2KE7A 2BPGA 3GV7B 5L1KA 4PPXA 2I5HA 4KMOB 2K60A 1Z19A 8ICYA 5DB7A 1KDHA 4O5CA 1ZQIA 4IR1A 3PY8A 4Q45A 1Q3VA 2H3QA 1SKRA 8ICTA 1X9XA 8ICWA 5J2JA 1NJYA 3RRGA 2B21A 1QQ6A 8ICPA 1DK2A 3KZIU 9ICNA 1L5UA 1N60A 2ZUCA 4ELVA 3MFIA 1SGGA 2Y1JA 3T5LA 1RYUA 4C4RA 4YR3A 3H0MB 4I27A 5F3XB 8ICSA 2W9CA 3E0FA 1L8OA 3L4PA 3ALRA 5AI6A 1A76A 3BS7A 5KG4A 4QZBA 2LM4A 4B6JA 3SI8A 4EYIB 3GFKB 5KFFA 1Z3EB 3C1YA 2KFZA 1PUZA 4DFJA 2HHTA 3RB3A 4PHDA 5AI4A 3BS5A 3MR5A 3SAFA 4F71A 5KFUA 4DL4A 9ICBA 3T79A 3EPIA 4LVSA 3U26A 3FYHA 5ALRA 2ZJ5A 5KFKA 3TFRA 4F4XA 4UW9A 3H0LB 3IV6A 3NRWA 4RNOA 3TACB 4I29A 4DSEA 2LYAA 3RH5A 4ECZA 5J0UA 4KMUA 1TE2A 1Y88A 1CI4A 3WKAA 2IHMA 2KKPA 1JN3A 1XS9D 4F4KA 2OYYA 5J2IA 3K4GA 1BPZA 1N5WA 2WF8A 4EBEA 1ZQSA 1UA1A 2XIDA 2W3SA 5E79U 3PMNA 3OHBA 3C5GA 1EXNA 1NZPA 5EWFA 2RLTA 3ZDDA 4KLUA 4Y2XA 3FDSA 3WKDA 1JX4A 4NL9C 2LKYA 9ICFA 2MU2A 5AHXA 4CF5A 3NTUA 2F3NA 4JV1A 4Y2VA 2D8CA 4K4HA 1NK4A 1X66A 2JZBB 4ED2A 1V97A 2M0NA 2NO4A 3RH4A 3BDPA 2XCAA 9ICVA 1X42A 2PXIA 4ECQA 1OW5A 4JB3A 2R8KA 3JPPA 4R64A 2ASJA 7ICEA 2YY6A 1YZ6A 3WKBA 1ZQVA 4UBBA 2A1AA 5DQIA 3RH6A 3CYMA 3OGUA 3RR8A 4CGZA 2EDUA 4O3QA 1WYGA 3H8SA 1SV0A 4F5PA 2DKZA 3QUCA 2OH2A 2DBYA 1X6JA 5J29A 3C23A 3QEBZ 3LVWA 1S0NA 2G08A 2BPCA 5AICA 3PW2A 5L1IA 3JPQA 4IR9A 4ECVA 4DS5A 4IQTA 3EPGA 2PMZC 3HX0A 2W8KA 1B43A 4DSJA 3ISCA 4US8A 2YB1A 3F5EA 1SZPA 1S97A 1L6NA 4RQ8A 3PNCA 9ICKA 3UXPA 3AUOA 2EZZA 3RJGA 4A8EA 1TK5A 1SL0A 1KFTA 4M6WA 2F1JA 5EE1A 4KTQA 4DQQA 4IRKA 5HHHA 4RQ0A 4IC9A 3LDAA 3Q8PB 2BKEA 3M9OB 5DB9A 3MDAA 2YTUA 3HKZF 3V7JA 2N1RA 4Q43A 5C5JA 4Y2YA 5DQHA 1BPBA 3KHLA 4ECUA 4P2HA 1O03A 4FZNA 1HUOA 1L7MA 3V7LA 1Z00A 3NVWA 1S0VA 1ZQYA 5KG3A 4NV0A 3T3FA 3PX4A 2K8BB 4UBCA 1ZQXA 2C2EA 4BWJA 4B9TA 2HW3A 5AK4A 2HHUA 1NZBA 3RB6A 1SL2A 2AGPA 1CEZA 4UB5A 2F77X 3K1RB 2P6UA 1RYSA 4QZHA 5KFGA 2J6SA 1KBUA 1L3UA 3UPQA 5AI0A 5HHIA 3OJSA 1BPYA 4KLGA 2AHOB 4FZLA 3WK7A 1ZRMA 2KJ5A 2OM6A 2K4HA 3GIMA 3Q8LA 5KAFU 1BPXA 1X6IA 4ECXA 4M9JA 5DDMA 4R63A 5AIBA 1KW4A 1QQ7A 3H8JA 2UVUA 2BQ3A 2JV3A 2JEFA 2LI6A 1NK8A 4U7CA 3S6JA 3ZDAA 3LWLA 5J2HA 5ALQA 5KG6A 2C2RA 4C8OA 3BQ0A 5J0OA 2HHXA 4CRXA 2JR5A 4ECWA 4C7YA 4P4OA 1TK0A 3BZCA 1NKEA 4P0QA 3H4BA 3UM9A 7ICGA 3L3FX 1FFVA 1D8YA 4NY8A 1L3TA 3RTVA 4I2BA 3AU6A 5ALKA 2D6FC 5HMLA 1PVRA 8ICJA 1K1SA 1TVAA 2ZIVB 1S10A 2IOFK 3CP8A 5KFOA 2JEJA 2DL0A 1J97A 1V9PA 4M9LA 3RB0A 4Y2TA 5AI5A 2QB0A 1RDFA 1SIJA 4J9MA 1UA0A 1D8BA 2EAMA 3JPTA 4PZNA 3QE9Y 4US9A 2BCRA 8ICQA 3AL0B 4QZAA 4J9LA 3RJKA 9ICTA 3CRXA 4FE3A 5AM3A 1ZQNA 1RM6C 3PX0A 3GIIA 1B4FA 4F5NA 2QKQA 4F2SA 3MDCA 1VDVA 2EZXA 2GWSA 5TISU 2IOHA 1PK1A 4PL1A 3PO5A 4BJQA 2W7PA 1Q8KA 2DF4B 1PVQA 4DF8A 2HOQA 5FP0A 5KFSA 4KLQA 5DLFA 2ZIVA 4QJFB 5AKIA 3GV8B 1T3NA 3ZDCA 3VCBA 4P0PA 1TAQA 2L5YA 1T4GA 2HHSA 4QWAA 4QZ8A 2XGPA 4DOAA 2ASLA 3D2NA 5KFAA 5AKJA 3MABA 3IP4B 3QX7A 9ICXA 4QWBA 3PO4A 3PSFA 4OJ6A 4JUZA 4RNNA 1XU4A 2HBKA 3SAGA 2KNJA 2H5XA 4MHVA 1JROA 2XY6A 1ZYQA 3D2SA 1KLNA 2UVRA 5CRXA 2KP7A 4F3OA 4JWNA 4ELUA 5J8YC 5DG9A 3QZ7A 1NOMA 4EEKA 4QWEA 3DV9A 2W3RA 4UASA 4UAUA 4ED7A 7ICKA 4NLBA 4YFKA 5CA7A 1CRXA 1JMSA 1S8OA 7ICQA 1MN8A 3OPXA 2HVIA 2F2AB 3GIJA 1UT8A 2R8HA 2WHEA 4J9NA 3N97B 2AXTU 3ETLA 4DLGA 3LK9A 8ICEA 3TQ1A 5KL8B 4M9HA 3N28A 2G0AA 2E8MA 4YQWA 4F91B 4JV2A 2FLPA 2JGAA 1ZQKA 4B9MA 2G5IB 4PGQA 1ZD4A 2YMLA 2DQNB 9ICLA 3B0XA 3GQCA 3ETRA 1LV5A 3RF9A 4NXZA 4Q8FA 1ED1A 2DPIA 3IN5A 5KFXA 4RT2A 3ZDBA 5C0YA 3F53A 5AK3A 1NJZA 5ALOA 3JPRA 4ED3A 4FBUA 1ZRNA 1ZD2P 5KFWA 5EWEA 1K5OA 4UAZA 4F4ZA 3PW4A 3FC4A 4Y2SA 1JUDA 1WWVA 2IOFA 4PH5A 2IBKA 1ZQJA 2ZJAA 3QU2A 4YP3A 1MQ2A 4NL9A 2W9CB 2VJ4A 1CUKA 2KJ8A 4MF8A 1JXEA 4F5RA 5DDYA 2ZIUB 2P66A 2IMWP 3PX6A 4RQ2A 1ZQQA 1F0MA 3BS5B 4UQGA 7ICOA 4J9RA 1KL9A 3E2EA 4DO9A 1NNLA 4NJ8A 3QXGA 2OHFA 1TV9A 5JTIA 5J0TA 5CB1A 4CCHA 2BDUA 5B66U 1Z1VA 1NK9A 2UVWA 4DCCA 2H3VA 3RJFA 2PKEA 3V6HA 5DGAA 4IQVA 2Q0ZX 3ORYA 4J9KA 3F2DA 1N56A 4PJ0U 2NRXA 3IRUA 4ECYA 4QW9A 3LYSA 5AKEA 3GZFA 2HSZA 1N2XA 3TANA 4NLCA 2ZIXA 4YCXA 3RBDA 2XO7A 2FLLA 1T94A 2F8KA 3B0YA 2PFPA 2ZIUA 3EWAA 1ZJNA 1FFUA 5AK6A 1TK8A 3HILA 5EE3A 2BR0A 2WTFA 4C4SA 5T14A 2QARA 5A0LA 2I6XA 3NRZA 2DKXA 1IIPA 4UARA 4IS7A 1LKYA 1S5LU 3PVXA 5KFTA 2E8PA 5AM5A 2KN7A 2Y9UA 1H38A 2E1FA 3TADC 3TFSA 9ICAA 1S0MA 4YMMA 2YB4A 3NASA 3V6JA 2AGOA 2LYBA 1NK5A 8ICVA 3M8RA 2G5HB 2B6GA 2WAQC 3C29A 4P4PA 4UB2A 4KN4A 1A6SA 3ZD9A 2AQ0A 4F4YA 3GDXA 4DF4A 2E1EA 3Q8SB 4I2IA 4AYBC 3GV5B 3C5FA 3H0RB 2P35A 2XY7A 3PSTA 2LHTA 3G6VA 5ALXA 5J2GA 3F2CA 2HOIA 2J6TA 1OUQA 4ECSA 3JPOA 3Q8KA 2F44A 2F1IA 2A1JA 2Y9TA 9ICQA 4RQMA 4NLGA 5KFCA 2XCPA 3QUTA 2OXOA 1KQQA 3A0HU 2YX8A 4AP9A 1L7OA 3BQTA 9ICSA 1ECWA 4E0DA 5KFYA 3N7PD 4BX9C 2V9WA 4QWCA 1SWWA 4MFFA 4J9OA 3RJIA 4B9NA 7ICLA 3WKEA 3H8MA 3G6XA 4I2CA 1BNPA 2WF6A 1IXRA 5ALSA 2C2DA 5ALNA 1WG8A 2KHVA 4DQSA 1Q46A 1QQ5A 3BJYA 4M6WB 4C8MA 4C80A 1JIHA 1ZD5A 2K8CB 3Q8RB 3C2MA 1NKCA 5JU5A 4I28A 4YVZA 3PZPA 4ED8A 5J2BA 1BVSA 4U6PA 5HP4A 1DK3A 2HMXA 4OO1J 3PV8A 7ICMA 2E5SA 2H3IA 1S77D 1KTQA 1BPEA 3WK5A 4I2JA 1C20A 1UQVA 2KOBA 1L7NA 5J2DA 5AKHA 1Z4OA 1ZQTA 2RRDA 5AM4A 1Z00B 5ALMA 3SR6A 1M6YA 3V72A 1FO4A 4PZOA 3KFUF 4GXIA 2NYVA 1NKBA 4M0AA 1RYRA 4RU9A 2Y0SF 5KG1A 1B22A 4EELA 3RB4A 4RT3A 3EUB2 2I1QA 1N48A 2H3ZA 4OJPA 2QB1A 5ALWA 4YR0A 4I2DA 4QZIA 1U49A 1WCLA 2HHWA 2PI5A 2ES6A 8ICCA 4BXOA 3IM1A 4C7ZA 3ZI4A 1L3VA 4LZGA 3TARA 5KFBA 2RDJA 4KITB 5KTQA 2MA1A 3F2BA 2R8GA 3ONNA 3TAQA 2PI4A 2ZUBA 1XO0A 4QW8A 8ICNA 3ZDEA 2KVCA 4DOBA 4DFDA 5J0XA 2FE9A 4ED1A 4QIWF 5KFJA 2EANA 4Z6FA 4GC7A 5AM0A 5CWRA 4RPXA 4UATA 2AH5A 4KLJA 4GFJA 3M9NB 1AQ6A 9ICOA 1AROP 2EAPA 4CNQA 4OD0A 5ALLA 1QCKA 5ALZA 1QSLA 5J0SA 2GH1A 4MFAA 1YZ7A 4YMOA 2R8JA 1VLBA 3SV3A 1MC8A 3GIKA 4QZFA 1PK3A 4GIBA 2W55A 4O3RA 2OCEA 4P0QB 2WB1F 4QZCA 2NRWA 2ESEA 3RR7A 2FLNA 3QU7A 2HHVA 2JH1A 9ICUA 1QH9A 4G9BA 1XWLA 2XY5A 2VANA 2QB0B 8ICLA 3AN1A 1BPDA 4XQ8A 1FEZA 1OXJA 2ZG6A 2JMGA 2JXJA 5D46A 2LPEA 5H2FU 5CHGA 3MGHA 3QYPA 3M8SA 5DBBA 3AMZA 1RQNA 5AKXA 4DL7A 4MEYA 4KN7A 4O3NA 1SV0C
chains in the Genus database with same CATH topology
5IIMA 4PHDA 4NLZA 2BPFA 4UB4A 4TUPA 9ICPA 1BNOA 9ICWA 3LK9A 8ICEA 5J0WA 9ICBA 4LVSA 4O9MA 4M9HA 3TFRA 1MQ3A 5IIIA 2I9GA 3UQ2A 4O5EA 1ZQKA 4QZDA 4K4IA 4KLTA 4KLHA 5J0RA 4PGQA 4F5OA 4O5KA 4I29A 9ICLA 5J0PA 3B0XA 3RH5A 4NXZA 5J0UA 4RT2A 3UXOA 2IHMA 4MFCA 3C2KA 3JPRA 9ICGA 5J2IA 1ZQPA 1BPZA 4M9NA 4UAZA 1ZQLA 1ZQSA 8ICMA 2ISOA 9ICRA 4Z6EA 4X5VA 3C2LA 3RJHA 4PH5A 4NLNA 4YD1A 4F5QA 1ZQJA 3PMNA 3C5GA 1MQ2A 1NZPA 4KLIA 4KLUA 9ICJA 3V7KA 4NLKA 5DB8A 4MF8A 1ZQOA 9ICFA 4F5RA 5DDYA 3JPNA 4PHEA 2P66A 7ICHA 8ICIA 4UAYA 4RQ5A 4K4HA 4RQ2A 1ZQQA 2FMSA 1RZTA 3RH4A 7ICFA 7ICOA 1ZQDA 9ICVA 2PXIA 4DO9A 2ISPA 7ICTA 8ICRA 3JPPA 4R64A 1ZQRA 1TV9A 7ICEA 5J0TA 9ICIA 5CB1A 8ICBA 4UBBA 5J2EA 3RJFA 3RH6A 1ZQEA 4IQVA 3OGUA 7ICNA 4LZDA 5IIOA 8ICKA 4RPYA 4UB1A 4JWMA 8ICUA 4R65A 4MF2A 4YCXA 4F5PA 4M9GA 3UQ0A 3B0YA 2PFPA 5J29A 1ZJNA 1ZQCA 4NM2A 8ICFA 2FMPA 4QZ9A 5BOMA 5IIKA 3JPQA 4IQTA 8ICZA 3HX0A 4TURA 3ISCA 4UAWA 4XA5A 3TFSA 9ICAA 4I2FA 4YMMA 4RQ8A 3PNCA 9ICKA 3UXPA 3AUOA 2BCQA 4PHPA 8ICVA 3RJGA 7ICJA 8ICOA 5DB6A 1ZQMA 4RQ6A 4QZEA 7ICPA 4UB2A 4QZGA 5D49A 3GDXA 3ISDA 4I2IA 5HHHA 4RQ0A 4XUSA 5IILA 4KLEA 3C5FA 5DB9A 3MDAA 9ICCA 3V7JA 5J2GA 5J2KA 3AU2A 4P2HA 3JPOA 1HUOA 3V7LA 9ICQA 5J2FA 4PGXA 7ICRA 4UBCA 4GXJA 5BPCA 9ICMA 4NM1A 4Z6CA 3RJEA 4YN4A 5D4BA 4PHAA 4KLOA 9ICSA 4RQ3A 5EOZA 4UB5A 4MFFA 5IIJA 8ICXA 3RJIA 3JPSA 4QZHA 7ICLA 4I2AA 4I2CA 1BNPA 4IQUA 2FMQA 4DOCA 3UPQA 5J2AA 4M47A 7ICUA 5HHIA 1BPYA 4KLGA 1ZQAA 4IQWA 4TUSA 4I28A 4M2YA 3C2MA 1BPXA 4PGYA 4M9JA 4R63A 4I2HA 5J2BA 4RQ1A 1DK3A 7ICMA 5BOLA 5J2HA 4K4GA 2W9MA 1BPEA 4I2JA 5J0OA 5J2DA 1ZQBA 4M04A 1ZQTA 4FO6A 4RQ7A 5J0YA 7ICGA 3V72A 4YMNA 4GXIA 4NY8A 4M0AA 3MGIA 4I2BA 1ZJMA 2BCUA 3AU6A 1XSNA 4YD2A 3HWTA 3UXNA 4RT3A 4RPZA 8ICJA 1XSLA 1TVAA 1ZQGA 3HW8A 5TZVA 5J0QA 4M9LA 4I2DA 4QZIA 9ICEA 5DBCA 3JPTA 8ICCA 7ICSA 1XSPA 3PMLA 2BCRA 8ICQA 4LZGA 2BCSA 1ZQHA 4QZAA 3RJKA 9ICTA 1KEJA 8ICAA 1ZQNA 4KLMA 1ZQFA 8ICHA 4I2GA 8ICNA 4F5NA 4DOBA 5J0XA 3MDCA 3MBYA 2GWSA 7ICIA 3ISBA 4Z6FA 5IINA 2PFQA 5CWRA 3RJJA 4RPXA 4KLJA 5DBAA 4Z6DA 4KLLA 9ICOA 4KLQA 5DKWA 2BCVA 4I2EA 2PFOA 5J0SA 4MFAA 2BPGA 4YMOA 4GXKA 5J2CA 4R66A 4QZFA 4PPXA 8ICYA 4DOAA 4QZ8A 5DB7A 1KDHA 4O5CA 1ZQIA 4QZCA 9ICXA 8ICTA 4KLSA 8ICWA 5J2JA 7ICVA 4UB3A 9ICUA 8ICPA 1DK2A 9ICNA 4KLDA 4KLFA 8ICLA 1HUZA 2PFNA 1BPDA 9ICHA 2KP7A 4JWNA 4I27A 4RQ4A 5D46A 8ICSA 3MGHA 7ICKA 4TUQA 5DBBA 8ICGA 4QZBA 1JMSA 7ICQA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5IIM A;  4PHD A;  4NLZ A;  2BPF A;  4UB4 A;  4TUP A;  9ICP A;  1BNO A;  9ICW A;  3LK9 A;  8ICE A;  5J0W A;  9ICB A;  4LVS A;  4O9M A;  4M9H A;  3TFR A;  1MQ3 A;  5III A;  2I9G A;  3UQ2 A;  4O5E A;  1ZQK A;  4QZD A;  4K4I A;  4KLT A;  4KLH A;  5J0R A;  4PGQ A;  4F5O A;  4O5K A;  4I29 A;  9ICL A;  5J0P A;  3B0X A;  3RH5 A;  4NXZ A;  5J0U A;  4RT2 A;  3UXO A;  2IHM A;  4MFC A;  3C2K A;  3JPR A;  9ICG A;  5J2I A;  1ZQP A;  1BPZ A;  4M9N A;  4UAZ A;  1ZQL A;  1ZQS A;  8ICM A;  2ISO A;  9ICR A;  4Z6E A;  4X5V A;  3C2L A;  3RJH A;  4PH5 A;  4NLN A;  4YD1 A;  4F5Q A;  1ZQJ A;  3PMN A;  3C5G A;  1MQ2 A;  1NZP A;  4KLI A;  4KLU A;  9ICJ A;  3V7K A;  4NLK A;  5DB8 A;  4MF8 A;  1ZQO A;  9ICF A;  4F5R A;  5DDY A;  3JPN A;  4PHE A;  2P66 A;  7ICH A;  8ICI A;  4UAY A;  4RQ5 A;  4K4H A;  4RQ2 A;  1ZQQ A;  2FMS A;  1RZT A;  3RH4 A;  7ICF A;  7ICO A;  1ZQD A;  9ICV A;  2PXI A;  4DO9 A;  2ISP A;  7ICT A;  8ICR A;  3JPP A;  4R64 A;  1ZQR A;  1TV9 A;  7ICE A;  5J0T A;  9ICI A;  5CB1 A;  8ICB A;  4UBB A;  5J2E A;  3RJF A;  3RH6 A;  1ZQE A;  4IQV A;  3OGU A;  7ICN A;  4LZD A;  5IIO A;  8ICK A;  4RPY A;  4UB1 A;  4JWM A;  8ICU A;  4R65 A;  4MF2 A;  4YCX A;  4F5P A;  4M9G A;  3UQ0 A;  3B0Y A;  2PFP A;  5J29 A;  1ZJN A;  1ZQC A;  4NM2 A;  8ICF A;  2FMP A;  4QZ9 A;  5BOM A;  5IIK A;  3JPQ A;  4IQT A;  8ICZ A;  3HX0 A;  4TUR A;  3ISC A;  4UAW A;  4XA5 A;  3TFS A;  9ICA A;  4I2F A;  4YMM A;  4RQ8 A;  3PNC A;  9ICK A;  3UXP A;  3AUO A;  2BCQ A;  4PHP A;  8ICV A;  3RJG A;  7ICJ A;  8ICO A;  5DB6 A;  1ZQM A;  4RQ6 A;  4QZE A;  7ICP A;  4UB2 A;  4QZG A;  5D49 A;  3GDX A;  3ISD A;  4I2I A;  5HHH A;  4RQ0 A;  4XUS A;  5IIL A;  4KLE A;  3C5F A;  5DB9 A;  3MDA A;  9ICC A;  3V7J A;  5J2G A;  5J2K A;  3AU2 A;  4P2H A;  3JPO A;  1HUO A;  3V7L A;  9ICQ A;  5J2F A;  4PGX A;  7ICR A;  4UBC A;  4GXJ A;  5BPC A;  9ICM A;  4NM1 A;  4Z6C A;  3RJE A;  4YN4 A;  5D4B A;  4PHA A;  4KLO A;  9ICS A;  4RQ3 A;  5EOZ A;  4UB5 A;  4MFF A;  5IIJ A;  8ICX A;  3RJI A;  3JPS A;  4QZH A;  7ICL A;  4I2A A;  4I2C A;  1BNP A;  4IQU A;  2FMQ A;  4DOC A;  3UPQ A;  5J2A A;  4M47 A;  7ICU A;  5HHI A;  1BPY A;  4KLG A;  1ZQA A;  4IQW A;  4TUS A;  4I28 A;  4M2Y A;  3C2M A;  1BPX A;  4PGY A;  4M9J A;  4R63 A;  4I2H A;  5J2B A;  4RQ1 A;  1DK3 A;  7ICM A;  5BOL A;  5J2H A;  4K4G A;  2W9M A;  1BPE A;  4I2J A;  5J0O A;  5J2D A;  1ZQB A;  4M04 A;  1ZQT A;  4FO6 A;  4RQ7 A;  5J0Y A;  7ICG A;  3V72 A;  4YMN A;  4GXI A;  4NY8 A;  4M0A A;  3MGI A;  4I2B A;  1ZJM A;  2BCU A;  3AU6 A;  1XSN A;  4YD2 A;  3HWT A;  3UXN A;  4RT3 A;  4RPZ A;  8ICJ A;  1XSL A;  1TVA A;  1ZQG A;  3HW8 A;  5TZV A;  5J0Q A;  4M9L A;  4I2D A;  4QZI A;  9ICE A;  5DBC A;  3JPT A;  8ICC A;  7ICS A;  1XSP A;  3PML A;  2BCR A;  8ICQ A;  4LZG A;  2BCS A;  1ZQH A;  4QZA A;  3RJK A;  9ICT A;  1KEJ A;  8ICA A;  1ZQN A;  4KLM A;  1ZQF A;  8ICH A;  4I2G A;  8ICN A;  4F5N A;  4DOB A;  5J0X A;  3MDC A;  3MBY A;  2GWS A;  7ICI A;  3ISB A;  4Z6F A;  5IIN A;  2PFQ A;  5CWR A;  3RJJ A;  4RPX A;  4KLJ A;  5DBA A;  4Z6D A;  4KLL A;  9ICO A;  4KLQ A;  5DKW A;  2BCV A;  4I2E A;  2PFO A;  5J0S A;  4MFA A;  2BPG A;  4YMO A;  4GXK A;  5J2C A;  4R66 A;  4QZF A;  4PPX A;  8ICY A;  4DOA A;  4QZ8 A;  5DB7 A;  1KDH A;  4O5C A;  1ZQI A;  4QZC A;  9ICX A;  8ICT A;  4KLS A;  8ICW A;  5J2J A;  7ICV A;  4UB3 A;  9ICU A;  8ICP A;  1DK2 A;  9ICN A;  4KLD A;  4KLF A;  8ICL A;  1HUZ A;  2PFN A;  1BPD A;  9ICH A;  2KP7 A;  4JWN A;  4I27 A;  4RQ4 A;  5D46 A;  8ICS A;  3MGH A;  7ICK A;  4TUQ A;  5DBB A;  8ICG A;  4QZB A;  1JMS A;  7ICQ A; 
#chains in the Genus database with same CATH topology
 1PK1 B;  5IIM A;  1F44 A;  3KZX A;  4NLZ A;  2ODG A;  5KFI A;  2HBM A;  4UB4 A;  1J2N A;  4TUP A;  3NVZ A;  2F76 X;  1SB3 C;  9ICP A;  2KV2 A;  3C1Z A;  2Y1I A;  9ICW A;  4F50 A;  4R8U A;  5KT7 A;  1V38 A;  1N63 A;  1PVP A;  1UHU A;  3MC1 A;  2XGQ A;  5KFV A;  1D8L A;  1MQ3 A;  5III A;  3HKZ C;  4YXM A;  5KG7 A;  4P0P B;  3C21 A;  4K4I A;  3EYZ A;  4KLT A;  2EZY A;  2DPJ A;  3QUB A;  5J0R A;  5KFM A;  4F5O A;  4O5K A;  3G6Y A;  5J0P A;  2ALZ A;  2XIC A;  4FZM A;  1NJX A;  5JRT A;  3SEN A;  2WFA A;  2EAO A;  5DG7 A;  4NWI A;  5CJ7 A;  3C2K A;  2KSO A;  4G3I A;  2KZZ A;  2R18 A;  1ZQP A;  4EZ9 A;  3WU2 U;  4M9N A;  2NRV A;  1SWV A;  5KFD A;  4QWD A;  3RAX A;  8ICM A;  2BDP A;  5G5H A;  4X5V A;  4EX7 A;  3C2L A;  4NLN A;  2G07 A;  4YD1 A;  2DFL A;  1D9F A;  3PSI A;  2WB1 C;  3V7K A;  1X9S A;  4Y2J A;  1A0P A;  4EX6 A;  5DB8 A;  1ZQO A;  1N61 A;  4C8L A;  5KFQ A;  2A3V A;  3JPN A;  4PHE A;  7ICH A;  2MUT B;  4UAY A;  4BGD A;  3SEI A;  3KKA C;  2FMS A;  2GOL A;  1RZT A;  1ZQZ A;  4IRD A;  2VA3 A;  7ICF A;  3SZ2 A;  1ZQD A;  5KG0 A;  5KG2 A;  1NK6 A;  4EYH B;  5ALG A;  7ICT A;  1LB2 B;  4FFD A;  4CF4 A;  5DG8 A;  4PL2 A;  3NGD A;  3MR6 A;  8ICB A;  5J2E A;  2JRZ A;  2A19 A;  2XVT A;  3DDH A;  4WJ3 B;  4OJL A;  1ZQE A;  1FIQ A;  2V4Q A;  5IIO A;  2BQU A;  8ICK A;  4RPY A;  1ZOL A;  1XNS A;  4UB1 A;  8ICU A;  2KIV A;  5ALT A;  2VA2 A;  2W04 A;  4Y2Q A;  4RUC A;  4MF2 A;  1TFR A;  4DSK A;  1S76 D;  1DOQ A;  5AKG A;  2KJ9 A;  2MUT A;  5G5G A;  2DGZ A;  1ZQC A;  4FS2 A;  1RXV A;  3K75 D;  5B5E U;  3HP6 A;  2FMP A;  3QU5 A;  2ZIW B;  4B9U A;  3TAP A;  1O08 A;  1JXL A;  3SYZ A;  4C8K A;  3MR3 A;  1DRG A;  5ALU A;  5AKL A;  3TAD A;  5DLG A;  3QNM A;  3ICX A;  1DGS A;  1MA7 A;  1COK A;  3HPO A;  2BCQ A;  4PHP A;  7ICJ A;  8ICO A;  4USA A;  5DB6 A;  2AJQ A;  4HYK A;  4O3M A;  4RQ6 A;  1N5X A;  4QZE A;  1RPL A;  7ICP A;  2EH9 A;  4QZG A;  4J9P A;  5D49 A;  2ZUD A;  3F5A A;  4XUS A;  1ZQU A;  4KLE A;  1RXW A;  1U48 A;  2KMD A;  1PZN A;  4ECR A;  2ZIW A;  1L3S A;  4YR2 A;  5J2K A;  1L8L A;  5ALF A;  2LM1 A;  3AU2 A;  5AKY A;  2RHF A;  1WUD A;  5KFR A;  3VC8 A;  5J2F A;  5DGB A;  4PGX A;  2ZIX B;  3NVY A;  4RNM A;  3H4D A;  4GXJ A;  1KRP A;  2OEH A;  2VJ5 A;  3CNH A;  4TQS A;  4Z6C A;  5EWG A;  3Q8M A;  3RAQ A;  1KFD A;  2ZXI A;  4PHA A;  3BQ1 A;  4HAI A;  4YXJ A;  4GC6 A;  5EOZ A;  2KFN A;  2W9B B;  3MGV A;  2K4P A;  3LWM A;  3NUQ A;  5IIJ A;  3N7S C;  2QAR B;  3QZ8 A;  3TKA A;  4CF3 A;  4BDP A;  1LKY B;  2ZTE A;  3UMG A;  1S0O A;  1JAL A;  5ALD A;  3TI0 A;  5KT5 A;  4IQU A;  2KTQ A;  1X40 A;  4DOC A;  4JV0 A;  3C28 A;  5L9X A;  2FDR A;  5J2A A;  4M47 A;  1KN5 A;  3UMB A;  1UT5 A;  4ELT A;  1SXD A;  2DWQ A;  5KFL A;  1X9W A;  1ZQA A;  4IQW A;  4ED0 A;  4TUS A;  3FM9 A;  4PGY A;  4I2H A;  2ZXH A;  3H8W A;  4C8N A;  4DQP A;  2HDO A;  4LJX A;  4K4G A;  4F92 B;  2W9B A;  1QTM A;  1TKD A;  4ACO A;  5HR7 A;  1URJ A;  3PW7 A;  1P7D A;  4EEY A;  1ZQB A;  5CP2 A;  4M04 A;  2A1J B;  4RQ7 A;  5J0Y A;  1YT3 A;  2W03 A;  4DFM A;  2V4R A;  4DL6 A;  1SXE A;  4YMN A;  3IG8 A;  2W7O A;  2KIC A;  1ZD3 A;  1ZJM A;  2NRT A;  3GU3 A;  4RPZ A;  4B9V A;  1SL1 A;  1ZQG A;  4DQR A;  4KX5 A;  2W8L A;  2K4E A;  5KL1 B;  3KD3 A;  2PMZ F;  5KNI A;  2FPL A;  1L7P A;  4UAV A;  2RQ5 A;  1U45 A;  3SV4 A;  2NV3 A;  3FAH A;  2Q4T A;  1XSP A;  4DL3 A;  4C0Z A;  3KHG A;  3T5J A;  3EZ5 A;  4BWM A;  4DSI A;  4O0I A;  3KHH A;  1ZQH A;  3WK4 A;  2KK0 A;  4DEZ A;  3THV A;  8ICA A;  3GIL A;  4JMU A;  2KKV A;  1ZQF A;  3O0F A;  8ICH A;  1K1Q A;  4MEX A;  2JHD A;  3RRH A;  1A77 A;  3K1Z A;  2D3D A;  5GTH U;  2K4I A;  7ICI A;  3ISB A;  4EBC A;  5ALJ A;  5CEH A;  2K89 A;  2QLT A;  2RDI A;  2FJ6 A;  4F2R A;  4UB6 U;  2UVV A;  5DBA A;  1J2M A;  3M1Y A;  1JRP A;  4Z6D A;  1X9M A;  3ED5 A;  4J03 A;  3PR5 B;  2BCV A;  4I2E A;  4RZR A;  2PFO A;  2MAX A;  4GXK A;  3M6K A;  1U47 A;  5EE9 A;  4B9L A;  2H3F A;  2LMR A;  5J2C A;  4R66 A;  4DS4 A;  1NK7 A;  5DQG A;  4ZOH C;  5GTI U;  1Q3U A;  4FBT A;  4DL5 A;  5L1J A;  4F8R A;  2LYH A;  5L1M A;  5L1L A;  3IG5 A;  4ZH4 A;  4KLS A;  2AGQ A;  3H7I A;  2ATL A;  7ICV A;  4UB3 A;  2CPR A;  3AM9 A;  2GO7 A;  2MRL A;  2GLE A;  1QSS A;  4KLD A;  4KLF A;  1HUZ A;  2HVH A;  2PFN A;  1ZET A;  9ICH A;  3WK9 A;  4BXO B;  3UMC A;  4RQ4 A;  4TUQ A;  5AK5 A;  1V85 A;  8ICG A;  1WCN A;  2W43 A;  2KG5 A;  5HR6 A;  1HJP A;  3M9M B;  5JUM A;  4B9S A;  3AEV A;  5ALV A;  1XC9 A;  3KOO A;  2JZB A;  2KZM A;  2BPF A;  2FPM A;  4OJO A;  2WF9 A;  3WKC A;  1BNO A;  4P4M A;  1NJW A;  1N62 A;  5J0W A;  2YQE A;  5AM2 A;  1NK0 A;  4J9S A;  4O9M A;  2FPK A;  3SD7 A;  2FI1 A;  2RP5 A;  3PW0 A;  2I9G A;  3UQ2 A;  4O5E A;  4QZD A;  3R9K A;  2JH7 A;  2JEI A;  4KLH A;  3MFH A;  3T5H A;  3AQE A;  5K4L A;  3HRD D;  2KZ3 A;  3D6J A;  4Y2P A;  3UXO A;  4MFC A;  2HI0 A;  1ZQ1 C;  3KBB A;  4UB8 U;  4DQI A;  2C22 A;  1GO3 F;  1DGJ A;  9ICG A;  3IHQ B;  5ALH A;  3PR4 A;  3IDW A;  3PSP A;  1ZQL A;  2ISO A;  9ICR A;  2O6K A;  4Z6E A;  4XRH A;  3RJH A;  3E58 A;  4F5Q A;  1D9D A;  3WK6 A;  2HBJ A;  5ALY A;  4KLI A;  3KHR A;  9ICJ A;  1X2I A;  4EEN A;  4NLK A;  4ICA A;  1SV4 A;  3KKA A;  4OCZ A;  4BUG A;  1T7P A;  2C28 A;  8ICI A;  4RQ5 A;  4F72 A;  1TAM A;  3BQ7 A;  3OJU A;  1WWU A;  5AI9 A;  2KEY A;  5KFN A;  4F4W A;  2ISP A;  4IL6 U;  4CDG A;  4R8U B;  3I76 A;  8ICR A;  1ZQR A;  5ALE A;  2CN1 A;  2NRZ A;  9ICI A;  5F9L A;  1VJ5 A;  4ECT A;  2KVS A;  3NVV A;  3OTQ A;  2J6U A;  2P6R A;  5J8Y A;  2KIW A;  4DWI A;  7ICN A;  4LZD A;  4Q8E A;  1XO1 A;  2W54 A;  2G06 A;  1QSY A;  3OSN A;  4JWM A;  2BGW A;  4R65 A;  2HBL A;  3NS1 A;  4EZ6 A;  3LVV A;  2E8N A;  4M9G A;  3UQ0 A;  1BGX T;  2Y0S C;  5KFZ A;  2KSO B;  1T8E A;  4DSF A;  2CRX A;  2K8A A;  2VA8 A;  2F1H A;  4NM2 A;  8ICF A;  2AQ4 A;  4QZ9 A;  2R8I A;  5BOM A;  5IIK A;  5CR0 A;  3MR2 A;  8ICZ A;  3M6Z A;  4GLX A;  4TUR A;  5F9N A;  4IRC A;  2BQR A;  4UAW A;  4XA5 A;  1C7Y A;  5HMM A;  1U9L A;  5AM1 A;  1IM4 A;  4I2F A;  5AIA A;  3B9J A;  3CW2 C;  3EW9 A;  1UPH A;  4YG2 A;  4QIW C;  1QLN A;  4C4T A;  2VKQ A;  1Z4N A;  2HOF A;  1KKX A;  1ZQM A;  4DL2 A;  4Y2U A;  4DFK A;  4RUA A;  3SAH A;  3ISD A;  2W9A A;  2E3T A;  2KD1 A;  5IIL A;  3M7D A;  9ICC A;  3OSP A;  3QU4 A;  3A0B U;  4O3P A;  3ZD8 A;  2M9N A;  1SKW A;  3SMV A;  5ALI A;  2CXY A;  1TAU A;  2E8O A;  3WK8 A;  3D2Q A;  2ZTD A;  7ICR A;  1KSP A;  5BPC A;  2DUY A;  1ZXI A;  9ICM A;  5KAI U;  4NM1 A;  4OJ5 A;  3KTQ A;  5KFH A;  2ASD A;  3RJE A;  4YN4 A;  5D4B A;  1Z1B A;  3V6K A;  4KLO A;  5KT4 A;  4RQ3 A;  1COO A;  1HEK A;  3I28 A;  3J81 j;  1RG6 A;  2LBO A;  8ICX A;  2ZTC A;  1SKS A;  3JPS A;  3BZK A;  3HJE A;  4I2A A;  5KFE A;  3RBE A;  2HHQ A;  2FMQ A;  4F93 B;  1SZH A;  1NI3 A;  2G09 A;  5KT2 A;  1DXS A;  2Z7J A;  3RFA A;  7ICU A;  4Q44 A;  3SQI A;  2NO5 A;  2WF5 A;  2XI9 A;  4QNL A;  4M2Y A;  4ED6 A;  3DEE A;  3L5K A;  5KFP A;  4EBD A;  1LVH A;  3T5K A;  1T3Q A;  5KT3 A;  4RQ1 A;  1IV8 A;  2KHQ A;  1JI7 A;  1B0X A;  5BOL A;  5AKK A;  3QUQ A;  2IHN A;  2W9M A;  3HT3 A;  2OWO A;  4DSL A;  2BHN A;  5HNK A;  1KFS A;  4CE6 A;  5AKZ A;  3AQF A;  4FO6 A;  2B0C A;  2YMM A;  3QEA Z;  4Y2R A;  2VIX A;  3MGI A;  2BCU A;  1UCV A;  1XSN A;  4YD2 A;  2EQY A;  3HWT A;  3UXN A;  5ALP A;  1XSL A;  1U4B A;  3N7R C;  3HW8 A;  5TZV A;  5J0Q A;  1HIW A;  2XC9 A;  1F5S A;  4DLE A;  2YMQ A;  5EE0 A;  9ICE A;  3N4M B;  5DBC A;  1IG6 A;  2IA6 A;  7ICS A;  3PML A;  3PW5 A;  4O3O A;  2F8L A;  5KG5 A;  3OHA A;  5AI8 A;  1RQL A;  2BCS A;  2YN4 A;  3I1Y A;  1KEJ A;  4TQR A;  4DFP A;  2AU0 A;  4KLM A;  3Q8Q B;  4I2G A;  2YMP A;  3MBY A;  4RQN A;  2ZJ8 A;  2W11 A;  4O3S A;  2WAQ F;  5IIN A;  2PFQ A;  5KT6 A;  3RJJ A;  3QU9 A;  2MSN A;  2WF7 A;  4J9Q A;  1S9F A;  4FS1 A;  1ZQW A;  2JEG A;  3H40 A;  4KLL A;  4AYB F;  4JK1 A;  3BQ2 A;  5DKW A;  1MSW D;  2BZF A;  2HCF A;  4KX3 A;  2KE7 A;  2BPG A;  3GV7 B;  5L1K A;  4PPX A;  2I5H A;  4KMO B;  2K60 A;  1Z19 A;  8ICY A;  5DB7 A;  1KDH A;  4O5C A;  1ZQI A;  4IR1 A;  3PY8 A;  4Q45 A;  1Q3V A;  2H3Q A;  1SKR A;  8ICT A;  1X9X A;  8ICW A;  5J2J A;  1NJY A;  3RRG A;  2B21 A;  1QQ6 A;  8ICP A;  1DK2 A;  3KZI U;  9ICN A;  1L5U A;  1N60 A;  2ZUC A;  4ELV A;  3MFI A;  1SGG A;  2Y1J A;  3T5L A;  1RYU A;  4C4R A;  4YR3 A;  3H0M B;  4I27 A;  5F3X B;  8ICS A;  2W9C A;  3E0F A;  1L8O A;  3L4P A;  3ALR A;  5AI6 A;  1A76 A;  3BS7 A;  5KG4 A;  4QZB A;  2LM4 A;  4B6J A;  3SI8 A;  4EYI B;  3GFK B;  5KFF A;  1Z3E B;  3C1Y A;  2KFZ A;  1PUZ A;  4DFJ A;  2HHT A;  3RB3 A;  4PHD A;  5AI4 A;  3BS5 A;  3MR5 A;  3SAF A;  4F71 A;  5KFU A;  4DL4 A;  9ICB A;  3T79 A;  3EPI A;  4LVS A;  3U26 A;  3FYH A;  5ALR A;  2ZJ5 A;  5KFK A;  3TFR A;  4F4X A;  4UW9 A;  3H0L B;  3IV6 A;  3NRW A;  4RNO A;  3TAC B;  4I29 A;  4DSE A;  2LYA A;  3RH5 A;  4ECZ A;  5J0U A;  4KMU A;  1TE2 A;  1Y88 A;  1CI4 A;  3WKA A;  2IHM A;  2KKP A;  1JN3 A;  1XS9 D;  4F4K A;  2OYY A;  5J2I A;  3K4G A;  1BPZ A;  1N5W A;  2WF8 A;  4EBE A;  1ZQS A;  1UA1 A;  2XID A;  2W3S A;  5E79 U;  3PMN A;  3OHB A;  3C5G A;  1EXN A;  1NZP A;  5EWF A;  2RLT A;  3ZDD A;  4KLU A;  4Y2X A;  3FDS A;  3WKD A;  1JX4 A;  4NL9 C;  2LKY A;  9ICF A;  2MU2 A;  5AHX A;  4CF5 A;  3NTU A;  2F3N A;  4JV1 A;  4Y2V A;  2D8C A;  4K4H A;  1NK4 A;  1X66 A;  2JZB B;  4ED2 A;  1V97 A;  2M0N A;  2NO4 A;  3RH4 A;  3BDP A;  2XCA A;  9ICV A;  1X42 A;  2PXI A;  4ECQ A;  1OW5 A;  4JB3 A;  2R8K A;  3JPP A;  4R64 A;  2ASJ A;  7ICE A;  2YY6 A;  1YZ6 A;  3WKB A;  1ZQV A;  4UBB A;  2A1A A;  5DQI A;  3RH6 A;  3CYM A;  3OGU A;  3RR8 A;  4CGZ A;  2EDU A;  4O3Q A;  1WYG A;  3H8S A;  1SV0 A;  4F5P A;  2DKZ A;  3QUC A;  2OH2 A;  2DBY A;  1X6J A;  5J29 A;  3C23 A;  3QEB Z;  3LVW A;  1S0N A;  2G08 A;  2BPC A;  5AIC A;  3PW2 A;  5L1I A;  3JPQ A;  4IR9 A;  4ECV A;  4DS5 A;  4IQT A;  3EPG A;  2PMZ C;  3HX0 A;  2W8K A;  1B43 A;  4DSJ A;  3ISC A;  4US8 A;  2YB1 A;  3F5E A;  1SZP A;  1S97 A;  1L6N A;  4RQ8 A;  3PNC A;  9ICK A;  3UXP A;  3AUO A;  2EZZ A;  3RJG A;  4A8E A;  1TK5 A;  1SL0 A;  1KFT A;  4M6W A;  2F1J A;  5EE1 A;  4KTQ A;  4DQQ A;  4IRK A;  5HHH A;  4RQ0 A;  4IC9 A;  3LDA A;  3Q8P B;  2BKE A;  3M9O B;  5DB9 A;  3MDA A;  2YTU A;  3HKZ F;  3V7J A;  2N1R A;  4Q43 A;  5C5J A;  4Y2Y A;  5DQH A;  1BPB A;  3KHL A;  4ECU A;  4P2H A;  1O03 A;  4FZN A;  1HUO A;  1L7M A;  3V7L A;  1Z00 A;  3NVW A;  1S0V A;  1ZQY A;  5KG3 A;  4NV0 A;  3T3F A;  3PX4 A;  2K8B B;  4UBC A;  1ZQX A;  2C2E A;  4BWJ A;  4B9T A;  2HW3 A;  5AK4 A;  2HHU A;  1NZB A;  3RB6 A;  1SL2 A;  2AGP A;  1CEZ A;  4UB5 A;  2F77 X;  3K1R B;  2P6U A;  1RYS A;  4QZH A;  5KFG A;  2J6S A;  1KBU A;  1L3U A;  3UPQ A;  5AI0 A;  5HHI A;  3OJS A;  1BPY A;  4KLG A;  2AHO B;  4FZL A;  3WK7 A;  1ZRM A;  2KJ5 A;  2OM6 A;  2K4H A;  3GIM A;  3Q8L A;  5KAF U;  1BPX A;  1X6I A;  4ECX A;  4M9J A;  5DDM A;  4R63 A;  5AIB A;  1KW4 A;  1QQ7 A;  3H8J A;  2UVU A;  2BQ3 A;  2JV3 A;  2JEF A;  2LI6 A;  1NK8 A;  4U7C A;  3S6J A;  3ZDA A;  3LWL A;  5J2H A;  5ALQ A;  5KG6 A;  2C2R A;  4C8O A;  3BQ0 A;  5J0O A;  2HHX A;  4CRX A;  2JR5 A;  4ECW A;  4C7Y A;  4P4O A;  1TK0 A;  3BZC A;  1NKE A;  4P0Q A;  3H4B A;  3UM9 A;  7ICG A;  3L3F X;  1FFV A;  1D8Y A;  4NY8 A;  1L3T A;  3RTV A;  4I2B A;  3AU6 A;  5ALK A;  2D6F C;  5HML A;  1PVR A;  8ICJ A;  1K1S A;  1TVA A;  2ZIV B;  1S10 A;  2IOF K;  3CP8 A;  5KFO A;  2JEJ A;  2DL0 A;  1J97 A;  1V9P A;  4M9L A;  3RB0 A;  4Y2T A;  5AI5 A;  2QB0 A;  1RDF A;  1SIJ A;  4J9M A;  1UA0 A;  1D8B A;  2EAM A;  3JPT A;  4PZN A;  3QE9 Y;  4US9 A;  2BCR A;  8ICQ A;  3AL0 B;  4QZA A;  4J9L A;  3RJK A;  9ICT A;  3CRX A;  4FE3 A;  5AM3 A;  1ZQN A;  1RM6 C;  3PX0 A;  3GII A;  1B4F A;  4F5N A;  2QKQ A;  4F2S A;  3MDC A;  1VDV A;  2EZX A;  2GWS A;  5TIS U;  2IOH A;  1PK1 A;  4PL1 A;  3PO5 A;  4BJQ A;  2W7P A;  1Q8K A;  2DF4 B;  1PVQ A;  4DF8 A;  2HOQ A;  5FP0 A;  5KFS A;  4KLQ A;  5DLF A;  2ZIV A;  4QJF B;  5AKI A;  3GV8 B;  1T3N A;  3ZDC A;  3VCB A;  4P0P A;  1TAQ A;  2L5Y A;  1T4G A;  2HHS A;  4QWA A;  4QZ8 A;  2XGP A;  4DOA A;  2ASL A;  3D2N A;  5KFA A;  5AKJ A;  3MAB A;  3IP4 B;  3QX7 A;  9ICX A;  4QWB A;  3PO4 A;  3PSF A;  4OJ6 A;  4JUZ A;  4RNN A;  1XU4 A;  2HBK A;  3SAG A;  2KNJ A;  2H5X A;  4MHV A;  1JRO A;  2XY6 A;  1ZYQ A;  3D2S A;  1KLN A;  2UVR A;  5CRX A;  2KP7 A;  4F3O A;  4JWN A;  4ELU A;  5J8Y C;  5DG9 A;  3QZ7 A;  1NOM A;  4EEK A;  4QWE A;  3DV9 A;  2W3R A;  4UAS A;  4UAU A;  4ED7 A;  7ICK A;  4NLB A;  4YFK A;  5CA7 A;  1CRX A;  1JMS A;  1S8O A;  7ICQ A;  1MN8 A;  3OPX A;  2HVI A;  2F2A B;  3GIJ A;  1UT8 A;  2R8H A;  2WHE A;  4J9N A;  3N97 B;  2AXT U;  3ETL A;  4DLG A;  3LK9 A;  8ICE A;  3TQ1 A;  5KL8 B;  4M9H A;  3N28 A;  2G0A A;  2E8M A;  4YQW A;  4F91 B;  4JV2 A;  2FLP A;  2JGA A;  1ZQK A;  4B9M A;  2G5I B;  4PGQ A;  1ZD4 A;  2YML A;  2DQN B;  9ICL A;  3B0X A;  3GQC A;  3ETR A;  1LV5 A;  3RF9 A;  4NXZ A;  4Q8F A;  1ED1 A;  2DPI A;  3IN5 A;  5KFX A;  4RT2 A;  3ZDB A;  5C0Y A;  3F53 A;  5AK3 A;  1NJZ A;  5ALO A;  3JPR A;  4ED3 A;  4FBU A;  1ZRN A;  1ZD2 P;  5KFW A;  5EWE A;  1K5O A;  4UAZ A;  4F4Z A;  3PW4 A;  3FC4 A;  4Y2S A;  1JUD A;  1WWV A;  2IOF A;  4PH5 A;  2IBK A;  1ZQJ A;  2ZJA A;  3QU2 A;  4YP3 A;  1MQ2 A;  4NL9 A;  2W9C B;  2VJ4 A;  1CUK A;  2KJ8 A;  4MF8 A;  1JXE A;  4F5R A;  5DDY A;  2ZIU B;  2P66 A;  2IMW P;  3PX6 A;  4RQ2 A;  1ZQQ A;  1F0M A;  3BS5 B;  4UQG A;  7ICO A;  4J9R A;  1KL9 A;  3E2E A;  4DO9 A;  1NNL A;  4NJ8 A;  3QXG A;  2OHF A;  1TV9 A;  5JTI A;  5J0T A;  5CB1 A;  4CCH A;  2BDU A;  5B66 U;  1Z1V A;  1NK9 A;  2UVW A;  4DCC A;  2H3V A;  3RJF A;  2PKE A;  3V6H A;  5DGA A;  4IQV A;  2Q0Z X;  3ORY A;  4J9K A;  3F2D A;  1N56 A;  4PJ0 U;  2NRX A;  3IRU A;  4ECY A;  4QW9 A;  3LYS A;  5AKE A;  3GZF A;  2HSZ A;  1N2X A;  3TAN A;  4NLC A;  2ZIX A;  4YCX A;  3RBD A;  2XO7 A;  2FLL A;  1T94 A;  2F8K A;  3B0Y A;  2PFP A;  2ZIU A;  3EWA A;  1ZJN A;  1FFU A;  5AK6 A;  1TK8 A;  3HIL A;  5EE3 A;  2BR0 A;  2WTF A;  4C4S A;  5T14 A;  2QAR A;  5A0L A;  2I6X A;  3NRZ A;  2DKX A;  1IIP A;  4UAR A;  4IS7 A;  1LKY A;  1S5L U;  3PVX A;  5KFT A;  2E8P A;  5AM5 A;  2KN7 A;  2Y9U A;  1H38 A;  2E1F A;  3TAD C;  3TFS A;  9ICA A;  1S0M A;  4YMM A;  2YB4 A;  3NAS A;  3V6J A;  2AGO A;  2LYB A;  1NK5 A;  8ICV A;  3M8R A;  2G5H B;  2B6G A;  2WAQ C;  3C29 A;  4P4P A;  4UB2 A;  4KN4 A;  1A6S A;  3ZD9 A;  2AQ0 A;  4F4Y A;  3GDX A;  4DF4 A;  2E1E A;  3Q8S B;  4I2I A;  4AYB C;  3GV5 B;  3C5F A;  3H0R B;  2P35 A;  2XY7 A;  3PST A;  2LHT A;  3G6V A;  5ALX A;  5J2G A;  3F2C A;  2HOI A;  2J6T A;  1OUQ A;  4ECS A;  3JPO A;  3Q8K A;  2F44 A;  2F1I A;  2A1J A;  2Y9T A;  9ICQ A;  4RQM A;  4NLG A;  5KFC A;  2XCP A;  3QUT A;  2OXO A;  1KQQ A;  3A0H U;  2YX8 A;  4AP9 A;  1L7O A;  3BQT A;  9ICS A;  1ECW A;  4E0D A;  5KFY A;  3N7P D;  4BX9 C;  2V9W A;  4QWC A;  1SWW A;  4MFF A;  4J9O A;  3RJI A;  4B9N A;  7ICL A;  3WKE A;  3H8M A;  3G6X A;  4I2C A;  1BNP A;  2WF6 A;  1IXR A;  5ALS A;  2C2D A;  5ALN A;  1WG8 A;  2KHV A;  4DQS A;  1Q46 A;  1QQ5 A;  3BJY A;  4M6W B;  4C8M A;  4C80 A;  1JIH A;  1ZD5 A;  2K8C B;  3Q8R B;  3C2M A;  1NKC A;  5JU5 A;  4I28 A;  4YVZ A;  3PZP A;  4ED8 A;  5J2B A;  1BVS A;  4U6P A;  5HP4 A;  1DK3 A;  2HMX A;  4OO1 J;  3PV8 A;  7ICM A;  2E5S A;  2H3I A;  1S77 D;  1KTQ A;  1BPE A;  3WK5 A;  4I2J A;  1C20 A;  1UQV A;  2KOB A;  1L7N A;  5J2D A;  5AKH A;  1Z4O A;  1ZQT A;  2RRD A;  5AM4 A;  1Z00 B;  5ALM A;  3SR6 A;  1M6Y A;  3V72 A;  1FO4 A;  4PZO A;  3KFU F;  4GXI A;  2NYV A;  1NKB A;  4M0A A;  1RYR A;  4RU9 A;  2Y0S F;  5KG1 A;  1B22 A;  4EEL A;  3RB4 A;  4RT3 A;  3EUB 2;  2I1Q A;  1N48 A;  2H3Z A;  4OJP A;  2QB1 A;  5ALW A;  4YR0 A;  4I2D A;  4QZI A;  1U49 A;  1WCL A;  2HHW A;  2PI5 A;  2ES6 A;  8ICC A;  4BXO A;  3IM1 A;  4C7Z A;  3ZI4 A;  1L3V A;  4LZG A;  3TAR A;  5KFB A;  2RDJ A;  4KIT B;  5KTQ A;  2MA1 A;  3F2B A;  2R8G A;  3ONN A;  3TAQ A;  2PI4 A;  2ZUB A;  1XO0 A;  4QW8 A;  8ICN A;  3ZDE A;  2KVC A;  4DOB A;  4DFD A;  5J0X A;  2FE9 A;  4ED1 A;  4QIW F;  5KFJ A;  2EAN A;  4Z6F A;  4GC7 A;  5AM0 A;  5CWR A;  4RPX A;  4UAT A;  2AH5 A;  4KLJ A;  4GFJ A;  3M9N B;  1AQ6 A;  9ICO A;  1ARO P;  2EAP A;  4CNQ A;  4OD0 A;  5ALL A;  1QCK A;  5ALZ A;  1QSL A;  5J0S A;  2GH1 A;  4MFA A;  1YZ7 A;  4YMO A;  2R8J A;  1VLB A;  3SV3 A;  1MC8 A;  3GIK A;  4QZF A;  1PK3 A;  4GIB A;  2W55 A;  4O3R A;  2OCE A;  4P0Q B;  2WB1 F;  4QZC A;  2NRW A;  2ESE A;  3RR7 A;  2FLN A;  3QU7 A;  2HHV A;  2JH1 A;  9ICU A;  1QH9 A;  4G9B A;  1XWL A;  2XY5 A;  2VAN A;  2QB0 B;  8ICL A;  3AN1 A;  1BPD A;  4XQ8 A;  1FEZ A;  1OXJ A;  2ZG6 A;  2JMG A;  2JXJ A;  5D46 A;  2LPE A;  5H2F U;  5CHG A;  3MGH A;  3QYP A;  3M8S A;  5DBB A;  3AMZ A;  1RQN A;  5AKX A;  4DL7 A;  4MEY A;  4KN7 A;  4O3N A;  1SV0 C; 
#chains in the Genus database with same CATH homology
 5IIM A;  4PHD A;  4NLZ A;  2BPF A;  4UB4 A;  4TUP A;  9ICP A;  1BNO A;  9ICW A;  3LK9 A;  8ICE A;  5J0W A;  9ICB A;  4LVS A;  4O9M A;  4M9H A;  3TFR A;  1MQ3 A;  5III A;  2I9G A;  3UQ2 A;  4O5E A;  1ZQK A;  4QZD A;  4K4I A;  4KLT A;  4KLH A;  5J0R A;  4PGQ A;  4F5O A;  4O5K A;  4I29 A;  9ICL A;  5J0P A;  3B0X A;  3RH5 A;  4NXZ A;  5J0U A;  4RT2 A;  3UXO A;  2IHM A;  4MFC A;  3C2K A;  3JPR A;  9ICG A;  5J2I A;  1ZQP A;  1BPZ A;  4M9N A;  4UAZ A;  1ZQL A;  1ZQS A;  8ICM A;  2ISO A;  9ICR A;  4Z6E A;  4X5V A;  3C2L A;  3RJH A;  4PH5 A;  4NLN A;  4YD1 A;  4F5Q A;  1ZQJ A;  3PMN A;  3C5G A;  1MQ2 A;  1NZP A;  4KLI A;  4KLU A;  9ICJ A;  3V7K A;  4NLK A;  5DB8 A;  4MF8 A;  1ZQO A;  9ICF A;  4F5R A;  5DDY A;  3JPN A;  4PHE A;  2P66 A;  7ICH A;  8ICI A;  4UAY A;  4RQ5 A;  4K4H A;  4RQ2 A;  1ZQQ A;  2FMS A;  1RZT A;  3RH4 A;  7ICF A;  7ICO A;  1ZQD A;  9ICV A;  2PXI A;  4DO9 A;  2ISP A;  7ICT A;  8ICR A;  3JPP A;  4R64 A;  1ZQR A;  1TV9 A;  7ICE A;  5J0T A;  9ICI A;  5CB1 A;  8ICB A;  4UBB A;  5J2E A;  3RJF A;  3RH6 A;  1ZQE A;  4IQV A;  3OGU A;  7ICN A;  4LZD A;  5IIO A;  8ICK A;  4RPY A;  4UB1 A;  4JWM A;  8ICU A;  4R65 A;  4MF2 A;  4YCX A;  4F5P A;  4M9G A;  3UQ0 A;  3B0Y A;  2PFP A;  5J29 A;  1ZJN A;  1ZQC A;  4NM2 A;  8ICF A;  2FMP A;  4QZ9 A;  5BOM A;  5IIK A;  3JPQ A;  4IQT A;  8ICZ A;  3HX0 A;  4TUR A;  3ISC A;  4UAW A;  4XA5 A;  3TFS A;  9ICA A;  4I2F A;  4YMM A;  4RQ8 A;  3PNC A;  9ICK A;  3UXP A;  3AUO A;  2BCQ A;  4PHP A;  8ICV A;  3RJG A;  7ICJ A;  8ICO A;  5DB6 A;  1ZQM A;  4RQ6 A;  4QZE A;  7ICP A;  4UB2 A;  4QZG A;  5D49 A;  3GDX A;  3ISD A;  4I2I A;  5HHH A;  4RQ0 A;  4XUS A;  5IIL A;  4KLE A;  3C5F A;  5DB9 A;  3MDA A;  9ICC A;  3V7J A;  5J2G A;  5J2K A;  3AU2 A;  4P2H A;  3JPO A;  1HUO A;  3V7L A;  9ICQ A;  5J2F A;  4PGX A;  7ICR A;  4UBC A;  4GXJ A;  5BPC A;  9ICM A;  4NM1 A;  4Z6C A;  3RJE A;  4YN4 A;  5D4B A;  4PHA A;  4KLO A;  9ICS A;  4RQ3 A;  5EOZ A;  4UB5 A;  4MFF A;  5IIJ A;  8ICX A;  3RJI A;  3JPS A;  4QZH A;  7ICL A;  4I2A A;  4I2C A;  1BNP A;  4IQU A;  2FMQ A;  4DOC A;  3UPQ A;  5J2A A;  4M47 A;  7ICU A;  5HHI A;  1BPY A;  4KLG A;  1ZQA A;  4IQW A;  4TUS A;  4I28 A;  4M2Y A;  3C2M A;  1BPX A;  4PGY A;  4M9J A;  4R63 A;  4I2H A;  5J2B A;  4RQ1 A;  1DK3 A;  7ICM A;  5BOL A;  5J2H A;  4K4G A;  2W9M A;  1BPE A;  4I2J A;  5J0O A;  5J2D A;  1ZQB A;  4M04 A;  1ZQT A;  4FO6 A;  4RQ7 A;  5J0Y A;  7ICG A;  3V72 A;  4YMN A;  4GXI A;  4NY8 A;  4M0A A;  3MGI A;  4I2B A;  1ZJM A;  2BCU A;  3AU6 A;  1XSN A;  4YD2 A;  3HWT A;  3UXN A;  4RT3 A;  4RPZ A;  8ICJ A;  1XSL A;  1TVA A;  1ZQG A;  3HW8 A;  5TZV A;  5J0Q A;  4M9L A;  4I2D A;  4QZI A;  9ICE A;  5DBC A;  3JPT A;  8ICC A;  7ICS A;  1XSP A;  3PML A;  2BCR A;  8ICQ A;  4LZG A;  2BCS A;  1ZQH A;  4QZA A;  3RJK A;  9ICT A;  1KEJ A;  8ICA A;  1ZQN A;  4KLM A;  1ZQF A;  8ICH A;  4I2G A;  8ICN A;  4F5N A;  4DOB A;  5J0X A;  3MDC A;  3MBY A;  2GWS A;  7ICI A;  3ISB A;  4Z6F A;  5IIN A;  2PFQ A;  5CWR A;  3RJJ A;  4RPX A;  4KLJ A;  5DBA A;  4Z6D A;  4KLL A;  9ICO A;  4KLQ A;  5DKW A;  2BCV A;  4I2E A;  2PFO A;  5J0S A;  4MFA A;  2BPG A;  4YMO A;  4GXK A;  5J2C A;  4R66 A;  4QZF A;  4PPX A;  8ICY A;  4DOA A;  4QZ8 A;  5DB7 A;  1KDH A;  4O5C A;  1ZQI A;  4QZC A;  9ICX A;  8ICT A;  4KLS A;  8ICW A;  5J2J A;  7ICV A;  4UB3 A;  9ICU A;  8ICP A;  1DK2 A;  9ICN A;  4KLD A;  4KLF A;  8ICL A;  1HUZ A;  2PFN A;  1BPD A;  9ICH A;  2KP7 A;  4JWN A;  4I27 A;  4RQ4 A;  5D46 A;  8ICS A;  3MGH A;  7ICK A;  4TUQ A;  5DBB A;  8ICG A;  4QZB A;  1JMS A;  7ICQ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...