1BNPA

Nmr solution structure of the n-terminal domain of dna polymerase beta, 55 structures
Total Genus 12
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
12
sequence length
87
structure length
87
Chain Sequence
MSKRKAPQETLNGGITDMLVELANFEKNVSQAIHKYNAYRKAASVIAKYPHKIKSGAEAKKLPGVGTKIAEKIDEFLATGKLRKLEK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DNA POLYMERASE BETA
publication title Three-dimensional solution structure of the N-terminal domain of DNA polymerase beta and mapping of the ssDNA interaction interface.
pubmed doi rcsb
source organism Rattus norvegicus
molecule tags Nucleotidyltransferase (dna-binding)
total genus 12
structure length 87
sequence length 87
ec nomenclature ec 2.7.7.7: DNA-directed DNA polymerase.
pdb deposition date 1996-04-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF14716 HHH_8 Helix-hairpin-helix domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.110 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 DNA polymerase beta, N-terminal domain-like 1bnpA00
4MFCA 1ZQIA 4TUQA 4MFFA 4NLKA 4PHDA 1ZQLA 4TURA 4NXZA 4LZGA 4PGXA 4I27A 4KLFA 9ICOA 4YD1A 9ICWA 5J0YA 3LK9A 2GWSA 4M9NA 2FMPA 1BPYA 7ICRA 9ICXA 4QZ8A 4MFAA 4Z6EA 4IQTA 4KLJA 9ICEA 4F5PA 4PHAA 4Z6DA 4PHPA 4KLQA 1HUOA 4RPYA 5DBAA 4PHEA 1DK2A 3JPTA 5DDYA 7ICIA 4PGYA 3V72A 4QZ9A 1MQ3A 3B0YA 4PPXA 4I2DA 4TUPA 4DO9A 4O9MA 4F5NA 4KLSA 5J29A 1BNOA 7ICLA 2BCSA 4X5VA 1ZQQA 4M9GA 8ICVA 4RQ4A 5DB7A 4R64A 2PFPA 4I2CA 4QZIA 5J2DA 4DOAA 4M9LA 9ICSA 1ZQGA 9ICBA 5J0WA 1XSLA 2BCVA 8ICEA 1KEJA 4NLNA 8ICCA 4I29A 4IQVA 3V7LA 8ICHA 5EOZA 8ICFA 4YMOA 1ZJMA 1TVAA 4YMNA 4F5OA 9ICNA 1ZQRA 4I2FA 3RH5A 4KLLA 8ICGA 3RJGA 4QZDA 5CB1A 7ICUA 5D49A 2BPFA 4I2JA 4KLUA 1ZQNA 4KLDA 4RQ7A 4UAWA 5IIIA 4R66A 4GXJA 4IQUA 5J0UA 3RH6A 4UB5A 4I28A 5J2IA 4Z6CA 4RQ1A 4MF8A 4IQWA 5J2KA 7ICQA 4RQ0A 8ICMA 7ICPA 1ZQCA 2BPGA 4R65A 4UAZA 8ICBA 3MDCA 9ICGA 4RPXA 3JPSA 9ICPA 2BCRA 1XSNA 3C5FA 5BOMA 4UB4A 4JWMA 4YN4A 1BNPA 8ICWA 5J0QA 3B0XA 5J2AA 3JPOA 9ICQA 7ICSA 4RT3A 4DOCA 5BPCA 4M9HA 3MGIA 4NLZA 1BPEA 9ICFA 4RT2A 4UB2A 9ICJA 4QZFA 7ICVA 3UXOA 4M04A 4NM1A 8ICIA 2I9GA 1ZQOA 9ICKA 4K4IA 1ZQPA 4M0AA 5DB6A 3RJHA 3HX0A 2ISOA 5IIKA 9ICMA 1ZQBA 4UAYA 3OGUA 8ICJA 1ZJNA 4RQ8A 3C2MA 7ICGA 4RQ2A 4QZBA 3PNCA 7ICMA 3V7JA 4QZEA 3TFRA 4P2HA 4QZAA 4PGQA 4DOBA 1ZQTA 5DKWA 5HHIA 1ZQAA 8ICXA 4KLHA 3C5GA 4KLOA 3UQ2A 4UB1A 1ZQHA 8ICZA 2W9MA 3PMLA 8ICKA 5HHHA 4PH5A 7ICHA 4KLGA 4KLEA 8ICQA 5D46A 4O5CA 8ICPA 1BPZA 1ZQMA 5J0PA 5J0XA 4F5QA 3PMNA 1HUZA 4NY8A 4YD2A 2BCUA 1ZQJA 2ISPA 3GDXA 5DB8A 5J0OA 8ICAA 5IILA 3RH4A 3JPQA 4M2YA 9ICIA 9ICTA 3JPPA 8ICNA 5J2GA 9ICAA 4RQ6A 9ICCA 5J2EA 1ZQFA 2PFQA 3JPRA 3JPNA 3ISBA 5DBCA 4XA5A 3MGHA 5J2JA 3RJEA 2FMSA 3AU6A 7ICJA 4QZCA 4KLIA 9ICHA 9ICVA 5DB9A 5J2HA 2PXIA 4TUSA 3TFSA 3ISCA 3HWTA 3RJKA 3V7KA 4I2HA 2KP7A 4YMMA 3UQ0A 1XSPA 3HW8A 4F5RA 4UB3A 1KDHA 1ZQEA 3RJFA 1TV9A 4RPZA 4QZGA 4JWNA 8ICLA 4I2GA 5J0TA 7ICKA 8ICTA 1BPDA 1MQ2A 4I2BA 4RQ3A 4O5KA 5J0RA 4GXKA 1ZQSA 2IHMA 5CWRA 4K4HA 3MDAA 7ICNA 3AUOA 4KLTA 4NM2A 5TZVA 4M47A 5J2FA 5IINA 1RZTA 4GXIA 1NZPA 4I2EA 5IIJA 2P66A 4MF2A 5IIOA 2PFNA 7ICTA 7ICOA 3RJJA 5DBBA 3AU2A 4KLMA 2BCQA 4RQ5A 1JMSA 4M9JA 3C2KA 8ICRA 4LVSA 4I2AA 4QZHA 3UPQA 4K4GA 3UXPA 4LZDA 9ICLA 1ZQKA 5J0SA 4I2IA 4UBCA 7ICEA 5J2BA 9ICUA 4O5EA 2FMQA 4R63A 8ICYA 3MBYA 4XUSA 8ICOA 4FO6A 2PFOA 9ICRA 3RJIA 4Z6FA 5D4BA 8ICUA 4YCXA 8ICSA 1ZQDA 5BOLA 1DK3A 1BPXA 7ICFA 3C2LA 3ISDA 5J2CA 4UBBA 3UXNA 5IIMA
chains in the Genus database with same CATH superfamily
5JTIA 4O3QA 2QB1A 2YB1A 4OJOA 1B4FA 1A76A 4KTQA 5AI0A 3H8MA 4PHDA 1X9MA 4NXZA 3QNMA 1CI4A 4LZGA 4I27A 4YD1A 1UA1A 2FMPA 3C29A 3PY8A 7ICRA 4QZ8A 1L7MA 3WK5A 4IQTA 4B9LA 1RYSA 2OHFA 3F5AA 4PHPA 4DS4A 3BS7A 4KLQA 4DL7A 4MHVA 5ALQA 5KT4A 1N56A 5DDYA 7ICIA 4UB8U 2Y1JA 4Q8FA 1TAMA 5DLGA 5AKYA 4QNLA 1JIHA 1WWUA 3GV8B 4BUGA 3A0BU 4O9MA 1BPBA 2ZIVB 2ZG6A 4P4OA 1DRGA 3N4MB 4CRXA 2MUTB 1Q3UA 4F72A 4AYBC 8ICVA 3WK7A 4CF5A 3L5KA 5DB7A 2PFPA 3E0FA 4YR2A 5KT6A 3N7SC 3QUQA 5J2DA 4US9A 4DFJA 9ICBA 1XSLA 2JEJA 8ICEA 3EUB2 1WYGA 2FLLA 1ZQUA 4J9SA 8ICCA 2AJQA 4QIWC 3GIIA 5AI6A 3IHQB 3KZIU 4U7CA 3ICXA 1TVAA 2XCAA 9ICNA 4ED6A 4I2FA 3H0LB 4KMOB 4YXJA 4QZDA 5CB1A 7ICUA 3QX7A 4EZ6A 4ED1A 3NTUA 4KLUA 4RQ7A 2AGQA 2EQYA 3F2BA 2I5HA 4DL4A 4UB5A 4I28A 5J2IA 4IQWA 5J2KA 4RQ0A 8ICMA 2HBJA 3PW0A 5HMMA 4UAZA 2KG5A 3MDCA 2OEHA 2BQ3A 4EX7A 1IIPA 3QUCA 5ALVA 2DL0A 3H4BA 3C5FA 3M7DA 1D8LA 3UMBA 2P35A 1S77D 3HJEA 1PK3A 1BNPA 1QSSA 3JPOA 1KFSA 3M9NB 4UATA 4DOCA 1TAUA 2ZIWA 2I1QA 4J9KA 2HBMA 4EBCA 1BPEA 9ICFA 4RT2A 3M6ZA 1A77A 2KJ5A 1S97A 1A0PA 3PO4A 5AKXA 1IM4A 5J8YC 3SQIA 1ZQPA 2ZTCA 5ALHA 3EPGA 3MGVA 4FBUA 1CUKA 2DPJA 1N63A 2E8PA 1L5UA 2KOBA 1IG6A 3WK9A 2W43A 2Q0ZX 4DFDA 2WAQC 3C2MA 3TAPA 4C4RA 1RXWA 4RQ2A 2V4QA 3PNCA 7ICMA 1J2MA 4PL2A 5AK5A 2ZTDA 2R8KA 3TFRA 2WF5A 2FI1A 3RTVA 4UB6U 4JV1A 1TE2A 3RB0A 1C20A 1SL0A 1JXLA 2IOHA 2EZZA 5DKWA 2XC9A 2GOLA 4P4PA 1VJ5A 2ASLA 5ALMA 2HSZA 2XGQA 4KLHA 1P7DA 4J03A 2G06A 4KLOA 3NUQA 3UQ2A 1QH9A 3THVA 4CE6A 1L8OA 4GIBA 3Q8SB 5KFZA 4IRCA 2IA6A 4IS7A 1MN8A 8ICQA 4UASA 4UQGA 8ICPA 1BPZA 4MEXA 2GO7A 4YVZA 3RFAA 3QZ8A 2MUTA 3C28A 4NY8A 2G5IB 4YD2A 5KG5A 3GFKB 4B9UA 1T4GA 1N5WA 3N97B 4WJ3B 2O6KA 8ICAA 1C7YA 5CR0A 1TAQA 3JPQA 3EPIA 4Y2RA 4M2YA 9ICIA 3LWMA 4JUZA 2LM1A 3IG8A 4YP3A 4NJ8A 1KBUA 5ALFA 9ICCA 1V38A 4DQIA 4IL6U 5AICA 2C2DA 3K75D 5HMLA 1BVSA 3FYHA 3SENA 2LI6A 2XGPA 3RB3A 2CPRA 4CF4A 4XA5A 1D8BA 2BDUA 2H5XA 4GC7A 2FMSA 5F9NA 3SZ2A 2W3SA 2XICA 1RQNA 3EWAA 2KD1A 1RM6C 3PSTA 9ICVA 5DB9A 3TFSA 3NS1A 4BGDA 4J9NA 2KP7A 4JV0A 4F2RA 1KW4A 1ZQYA 4P4MA 5AM5A 2A1AA 3HW8A 3H0RB 3GV7B 4UB3A 4RQNA 3HT3A 2WTFA 2RQ5A 1TV9A 4F4WA 2R18A 4JWNA 8ICLA 5ALGA 3ALRA 3WKEA 5ALEA 4AYBF 1X40A 3I28A 2V9WA 5DQGA 4Y2VA 3QUTA 2LM4A 3MDAA 2YQEA 5TZVA 4Y2QA 1JALA 4DL6A 2NRZA 3UMCA 2QLTA 4GXIA 3FAHA 3ONNA 1NZPA 1LV5A 1ZQWA 2AGOA 1CEZA 2KEYA 7ICOA 2LYHA 4B6JA 1NI3A 4QIWF 3RBDA 3RJJA 4IRKA 1LVHA 3AU2A 1QQ7A 3HILA 2BCQA 1XO1A 2YMLA 3OHAA 4M9JA 2ATLA 1COOA 1SV4A 8ICRA 4LVSA 5KFXA 4Y2PA 4I2AA 2HCFA 1T7PA 4F4XA 4QW8A 1N2XA 2JMGA 2DKZA 4YFKA 4P0QB 3K1RB 1ZQKA 1CRXA 4UBCA 3NVVA 4NLBA 1KRPA 3Q8QB 2XO7A 3BQTA 2YN4A 1JI7A 1PK1A 8ICYA 2F8LA 4FO6A 2PFOA 3CRXA 4Z6FA 1FFUA 2QKQA 5D4BA 2YB4A 8ICUA 2F3NA 1NK4A 3G6YA 1SXEA 2WF9A 5ALIA 2WF8A 1DK3A 3N7RC 4F8RA 1Z1VA 1BGXT 1NK7A 3UXNA 4FS2A 1Y88A 1ZQIA 2DF4B 3Q8MA 4R8UB 2KK0A 3M8SA 4Y2JA 4TURA 2R8GA 4EYIB 1XO0A 1RXVA 4CDGA 4PGXA 4KLFA 1Z1BA 1X9SA 2A1JA 1SV0A 2XI9A 3RB6A 9ICWA 2KJ9A 2GWSA 4M9NA 3TKAA 1BPYA 3Q8KA 9ICXA 4ZH4A 4Z6EA 1Z4NA 5AI4A 3SV3A 9ICEA 2G07A 4F5PA 5GTHU 3AMZA 4DWIA 5KFJA 4QWCA 4TQSA 5AKLA 4RPYA 4NL9A 1RPLA 2IBKA 5DBAA 4PHEA 3T5HA 3RR8A 1JRPA 2JR5A 3RBEA 2KZZA 4FZLA 3WU2U 1Q46A 4QZ9A 3SEIA 1MQ3A 1S76D 3B0YA 3GQCA 4DL2A 1UT8A 5TISU 4TUPA 2WAQF 2W9CA 3KBBA 4DO9A 2KTQA 4ED8A 3WKCA 2ZUBA 4KN4A 4B9TA 1SWWA 3G6VA 3BQ0A 5KG0A 4X5VA 2QARB 1TK8A 4ED2A 2K60A 4QZIA 1NKBA 4ECUA 1YZ6A 4DOAA 2GLEA 3PR4A 5ALDA 5J0WA 1S5LU 2F44A 3FC4A 2E5SA 4FZNA 1ECWA 4DEZA 2H3QA 5DG9A 4ECRA 5KFOA 4GC6A 1KEJA 4NLNA 1XNSA 3ZDAA 2AH5A 4I29A 4IQVA 3QXGA 2DKXA 5AHXA 8ICHA 8ICFA 2UVRA 2ZIXA 3SYZA 4RNMA 4DL3A 1ZQRA 3RH5A 5KFTA 1QQ5A 4I2JA 3T5JA 2R8HA 1ZQNA 3PX6A 1OXJA 3CW2C 2LYBA 3GU3A 5J0UA 5KT7A 5ALLA 5KFLA 2BDPA 4Z6CA 1SL2A 5ALOA 4MF8A 1X9XA 5L1LA 5KG2A 1V9PA 5DG8A 3QU2A 1NK0A 3WK4A 4Q43A 1HIWA 2P6RA 5AK3A 4FBTA 2GH1A 3JPSA 4C8NA 1Z4OA 3RF9A 2LMRA 1D8YA 4JWMA 2FLNA 2F2AB 8ICWA 3KHLA 3BQ7A 1KSPA 4P0QA 1T3QA 1COKA 4RT3A 2YTUA 5HR6A 2KE7A 3KZXA 3MGIA 4NLZA 3HKZC 2LKYA 3H4DA 2BQRA 1V97A 3HRDD 3IP4B 5DQHA 2F76X 4M04A 8ICIA 4JK1A 5KFGA 9ICKA 2VIXA 3BQ1A 2WF7A 4OJPA 2F1JA 4M0AA 4R8UA 3PVXA 2JRZA 3HX0A 2ISOA 2IOFA 2K4HA 3OTQA 5A0LA 4BWMA 2KIVA 1ZQBA 2DFLA 4JB3A 4BDPA 3OGUA 3DDHA 2NV3A 2K4IA 1QSLA 3KKAA 4F4YA 3OSPA 2OWOA 4Y2XA 1SGGA 2FPLA 4QZBA 3V7JA 4QZEA 5AM3A 2RDJA 4P2HA 4KMUA 1H38A 1J2NA 4O3OA 3TARA 4DOBA 5AKJA 4NLCA 2G5HB 1ZQTA 2KMDA 5ALKA 1WG8A 2NRVA 2JEFA 1QSYA 1ZQAA 5FP0A 1ZD2P 2JHDA 2FJ6A 2F77X 3ETLA 4UB1A 2W9MA 3H8JA 5JRTA 3TQ1A 5AIBA 1S10A 3PO5A 3L4PA 4QWBA 7ICHA 1TK0A 4KLEA 5D46A 2NYVA 1L8LA 5J0PA 5J0XA 4OCZA 2WHEA 3KHGA 2QARA 2BCUA 3V6JA 3ORYA 2VJ4A 1ZETA 4O3SA 5AKGA 3GDXA 1Z19A 1D9DA 4ELVA 3LWLA 2Z7JA 5KFIA 2UVVA 2KKPA 3T79A 3IRUA 2W03A 5J2GA 5AI8A 1X2IA 5KG3A 4RQ6A 1ZQ1C 5KFEA 3D2NA 4EBEA 5ALTA 3NRWA 2Q4TA 4J9MA 4DFKA 5KFFA 2WB1C 2CXYA 1YT3A 1K1QA 5DBCA 5KNIA 3Q8PB 4O3NA 3MGHA 2F8KA 1JROA 1Q8KA 4GLXA 1ZOLA 7ICJA 4ECZA 4QZCA 4KLIA 5KFDA 3HPOA 1U45A 3AQEA 3SMVA 4C80A 3V7KA 2BZFA 3QU9A 2XY6A 1AQ6A 1NJYA 4B9VA 3EZ5A 3H7IA 3UQ0A 4B9MA 2H3ZA 3R9KA 3QZ7A 1NK6A 4NWIA 1JX4A 1ZQEA 4JV2A 3ZDBA 5J0TA 2YY6A 4ED3A 7ICKA 3BQ2A 1BPDA 2MSNA 1B0XA 1PK1B 3LDAA 2ZIUA 4F92B 2K8AA 4I2BA 4RQ3A 4ACOA 2ZJAA 3I76A 1S0VA 3NVYA 5HP4A 4K4HA 2RLTA 2BGWA 5AM1A 2YMQA 3RRGA 3GZFA 3SV4A 2KHVA 3OPXA 4XQ8A 3MFHA 2IOFK 4C8MA 1KFTA 5IIOA 4J9RA 5KAIU 3ED5A 5KFPA 4IR9A 4DFMA 4Y2SA 2B6GA 1FO4A 3RRHA 4RQ5A 2HHSA 3BS5B 2LBOA 4EELA 2ASDA 2MRLA 4FS1A 2A1JB 2AQ0A 5HNKA 1B22A 1ZQZA 3BZKA 3UXPA 5AI9A 5CP2A 4RQMA 1T94A 5J0SA 5AM2A 1KN5A 2QB0A 9ICUA 2MAXA 3KFUF 3C21A 3TADA 4P0PA 1TFRA 2DUYA 1X9WA 4XUSA 8ICOA 2WF6A 5ALWA 3FM9A 1J97A 4DQRA 2ASJA 4Y2UA 3WKBA 4YCXA 8ICSA 3BZCA 5BOLA 1BPXA 1NOMA 1N61A 4DFPA 5IIMA 2W9CB 4MFCA 4TUQA 4DSJA 4MFFA 5DLFA 4NLKA 5EE3A 1ZQLA 1X6JA 4Y2YA 2D8CA 3GIJA 2OM6A 1DXSA 4GFJA 2DPIA 1SWVA 5EWEA 4F50A 3HKZF 1ZQXA 5J0YA 2HBLA 3U26A 2BR0A 2NRWA 1KFDA 3QU7A 3M1YA 1UPHA 4BXOA 2KFZA 1U48A 4MFAA 2A3VA 2VA3A 1OUQA 1KQQA 4KLJA 2M0NA 1L3SA 2OCEA 4PHAA 1L7NA 4Z6DA 5HR7A 3H8SA 1MC8A 1HUOA 2XIDA 2LHTA 3JPTA 4DQPA 2ZIXB 3PW7A 2H3FA 5KFWA 4PGYA 3ZD9A 3V72A 3ZI4A 2KVSA 2IMWP 4DSKA 1L3VA 1HEKA 3TAQA 2AQ4A 2KFNA 1YZ7A 5KG7A 4KLSA 5J29A 5ALRA 7ICLA 1N48A 5L9XA 1K1SA 1UT5A 1ZQQA 4M9GA 1IV8A 4C8LA 2ES6A 2E1EA 4RQ4A 4R64A 1F0MA 4I2CA 5AM4A 4G9BA 3KTQA 2W7PA 2KZMA 1ZQGA 5KTQA 2BHNA 3LYSA 4ED7A 2BCVA 3QU4A 2PMZC 2W54A 3Q8RB 2HVHA 3M6KA 4OJLA 4C4SA 2W11A 2FPKA 3OJSA 2JEIA 3V7LA 5EOZA 4ICAA 3M9OB 1ZJMA 3AQFA 4YMNA 3F2CA 1LB2B 1QTMA 3F53A 4KLLA 5KFSA 3AM9A 3SAHA 5KAFU 1FIQA 4F71A 3GV5B 2BPFA 5C0YA 3H40A 3VC8A 2J6UA 5IIIA 5KFBA 4GXJA 1PVRA 4IQUA 4F4KA 1B43A 3RH6A 3N7PD 4EEYA 2F1HA 2P6UA 1RDFA 1ED1A 1ZQCA 4BX9C 2E3TA 4QW9A 2JH1A 4R65A 2WB1F 8ICBA 1M6YA 2JZBB 3BS5A 1NJWA 4RPXA 3M9MB 1TK5A 1K5OA 1JXEA 4DLEA 5AKEA 2UVWA 9ICPA 3VCBA 3IG5A 3D6JA 5G5HA 3PZPA 4O3PA 5J2AA 1JN3A 1NKCA 1PVQA 4EENA 4M9HA 1XU4A 3IM1A 5T14A 3MABA 4ECYA 4CCHA 3I1YA 4USAA 4UB2A 4C4TA 1X66A 4QZFA 7ICVA 3UXOA 3MR5A 4NM1A 4ECQA 1S0OA 3EW9A 4RNOA 2I9GA 2OXOA 1L3TA 4G3IA 3RAXA 2E8MA 1QCKA 4XRHA 4DLGA 5DB6A 3RJHA 2FPMA 5IIKA 3PW4A 5L1KA 1TKDA 3N28A 3NRZA 2R8IA 2YMPA 2ALZA 5G5GA 4CNQA 4RQ8A 4JMUA 4F3OA 7ICGA 2ODGA 5AK4A 4QZAA 1L6NA 3CYMA 1GO3F 4J9PA 2ZXIA 4IRDA 3E2EA 5L1IA 5HHIA 2FDRA 3TI0A 1NZBA 2M9NA 3C1ZA 3PW2A 8ICXA 5AKHA 2Y9UA 1ZQHA 8ICZA 2KSOA 3PMLA 4UARA 3UMGA 2JH7A 5JU5A 8ICKA 4PH5A 5DQIA 4KLGA 5KT3A 2XVTA 4O5CA 4DQQA 2EAPA 1WWVA 2AXTU 2EZYA 3PMNA 3D2QA 1HUZA 3AN1A 2RP5A 2BQUA 2C2EA 4DSEA 3MC1A 5J8YA 2ISPA 2F1IA 2RDIA 5CJ7A 4PZNA 5IILA 3WKDA 3ZDEA 5KT2A 8ICNA 3G6XA 2ZIUB 9ICAA 1FFVA 4YQWA 1FEZA 2ZJ8A 2A19A 3ZDCA 5J2EA 1ZQFA 4RUCA 1N62A 2E8NA 4B9SA 3JPRA 5KFAA 1QLNA 5ALZA 2HOFA 3JPNA 3K1ZA 5DGAA 4Q45A 3ISBA 1L7OA 3RJEA 1L7PA 5AKIA 2KKVA 3AU6A 1WUDA 4QWEA 9ICHA 1XC9A 4TUSA 3ISCA 2IHNA 3QEAZ 3RJKA 4DL5A 4I2HA 3V6KA 1U4BA 4KX3A 4DSIA 2DBYA 2W8KA 1O03A 4YMMA 5H2FU 3PSPA 1Z00B 4F5RA 5L1JA 5F9LA 2WFAA 3RJFA 4RPZA 4QZGA 1KLNA 2JZBA 4EX6A 2QB0B 3SAGA 8ICTA 2EZXA 4P0PB 4M6WB 5ALXA 5EE9A 2W9BB 4DS5A 4O5KA 1NKEA 1ZQSA 7ICNA 2I6XA 5KFNA 2C2RA 3AUOA 4KLTA 4M47A 3BDPA 3V6HA 3H8WA 1WCLA 1RZTA 3FDSA 4I2EA 5IIJA 2P66A 2PMZF 3EYZA 4A8EA 2PKEA 3LVWA 7ICTA 4J9QA 1SV0C 2NRTA 4LJXA 5K4LA 5DBBA 2KZ3A 5C5JA 4KLMA 1ZRMA 1JMSA 5AI5A 2YX8A 4DCCA 3C2KA 3DEEA 5AKZA 2HHUA 3B9JA 5B5EU 2Y0SC 4HYKA 4K4GA 4BXOB 4NL9C 4LZDA 2W9AA 2KV2A 3DV9A 4I2IA 3RB4A 3RR7A 1RG6A 1T3NA 3MFIA 7ICEA 5J2BA 2FMQA 4R63A 3CP8A 3RJIA 4ECTA 1ZRNA 2HHXA 2KN7A 1S8OA 5EWFA 4RZRA 1ZQDA 5AKKA 5ALSA 3C2LA 3ISDA 2HHTA 5J2CA 4Y2TA 4UW9A 4QJFB 4OD0A 3SAFA 4IC9A 3NVZA 2KVCA 1DGJA 2D3DA 2XY5A 1T8EA 5AK6A 2MA1A 2OYYA 3K4GA 9ICOA 1RYRA 3NGDA 4PZOA 1KTQA 3O0FA 3LK9A 3OJUA 3AL0B 3GILA 5KT5A 4YR3A 2HDOA 2L5YA 2HVIA 4C7YA 1ZD3A 5CRXA 3T5KA 3CNHA 5JUMA 1SKRA 1WCNA 5KFKA 4RU9A 2H3VA 1DK2A 2NO4A 2V4RA 3GIKA 4Q8EA 3OHBA 5ALYA 4RNNA 4Q44A 4E0DA 5KFQA 5KL1B 3QEBZ 4PPXA 4I2DA 3GIMA 2EDUA 3SR6A 4F5NA 2K4EA 2ZTEA 5ALJA 2R8JA 1BNOA 3QUBA 3SD7A 2HW3A 3PSIA 5CEHA 2BCSA 1Q3VA 4KITB 3NVWA 1SZPA 5KL8B 3Q8LA 1SKSA 2UVUA 1ZD5A 2NRXA 4YXMA 1ZXIA 3IN5A 4M9LA 9ICSA 4F91B 3QYPA 2HMXA 2KHQA 3D2SA 5ALNA 2XCPA 4C8OA 2ZUCA 3PSFA 1Z00A 4UAVA 2VANA 1DGSA 2PI4A 2HOIA 1F5SA 2AGPA 1ZYQA 1SKWA 4IR1A 3QE9Y 2ZUDA 4YMOA 5KG4A 4F5OA 4OJ5A 1D9FA 1RQLA 4CF3A 2J6SA 3IDWA 2Y9TA 8ICGA 3RJGA 2JEGA 4M6WA 1OW5A 4NLGA 2W9BA 1URJA 3PW5A 4ECVA 5D49A 5DDMA 4KLDA 3MR6A 1SIJA 1F44A 2G0AA 4ELUA 4UAWA 2ZIVA 1U49A 1S9FA 4R66A 2KICA 1NJZA 4NV0A 3L3FX 4KN7A 4RQ1A 4DQSA 7ICQA 7ICPA 3QU5A 5KFHA 2BPGA 3KKAC 1ZQVA 9ICGA 5EE0A 1X42A 2HOQA 5GTIU 2BCRA 1XSNA 2E8OA 5BOMA 2ESEA 2K8BB 4UB4A 2AHOB 2FE9A 3T3FA 4YN4A 2C28A 2CN1A 4F93B 5J0QA 3B0XA 3M8RA 1MSWD 9ICQA 7ICSA 3BJYA 1X6IA 5BPCA 4FFDA 4QWDA 3AEVA 1UQVA 4UAUA 4J9OA 9ICJA 1NNLA 2PI5A 2KSOB 4BJQA 2HBKA 1QQ6A 1ZQOA 2E1FA 3J81j 5E79U 1DOQA 4CGZA 1XWLA 4OJ6A 2Y1IA 2EH9A 2DQNB 4K4IA 4F2SA 4PJ0U 4C0ZA 1LKYB 4U6PA 1SL1A 2KNJA 1KKXA 9ICMA 4C8KA 4ED0A 3F5EA 4UAYA 2B0CA 2VJ5A 5ALUA 3F2DA 4OO1J 4FE3A 1UHUA 5L1MA 8ICJA 1ZJNA 3TACB 4DF4A 5B66U 4F4ZA 2XY7A 4QWAA 4DSLA 2ZJ5A 3ZD8A 4FZMA 1UCVA 3E58A 2EAMA 4KX5A 3KOOA 4PGQA 1JUDA 4DSFA 2Y0SF 2OH2A 3WKAA 1NJXA 4O3MA 3WK6A 1XS9D 2BKEA 3NASA 3C5GA 3A0HU 4RUAA 4B9NA 2W7OA 5KFCA 5DG7A 5HHHA 5KFVA 2D6FC 2K8CB 4PL1A 5AM0A 4EZ9A 1ZQMA 4F5QA 3MR3A 1N5XA 2H3IA 2YMMA 1UA0A 1O08A 2VA8A 2RRDA 3T5LA 1ZQJA 3IV6A 3C1YA 5DB8A 3OSNA 1PUZA 3S6JA 5J0OA 1SB3C 2ZXHA 4ZOHC 4C7ZA 1NK9A 3RH4A 4HAIA 1PZNA 1V85A 9ICTA 3JPPA 2JGAA 5KFMA 1EXNA 5CHGA 1A6SA 4O3RA 5ALPA 2PFQA 5AIAA 2LPEA 1SZHA 1N60A 3SI8A 1PVPA 2CRXA 2B21A 2HHVA 3H0MB 3KHRA 1SXDA 5J2JA 3TANA 1NK5A 1L3UA 4TQRA 2HHQA 2W04A 2W3RA 1ZD4A 3MR2A 1RYUA 4EEKA 2FLPA 5J2HA 2PXIA 2G08A 1HJPA 3HWTA 5KG1A 5KG6A 4ECXA 2W8LA 3TADC 1IXRA 1XSPA 2JV3A 2DGZA 4BWJA 5CA7A 3RAQA 2LYAA 1Z3EB 1KDHA 1VDVA 1KL9A 2NO5A 4I2GA 3LVVA 1NK8A 1MQ2A 5F3XB 1S0NA 2W55A 1S0MA 5KFRA 3WK8A 3PV8A 2HHWA 5J0RA 4GXKA 2IHMA 5CWRA 2VA2A 4NM2A 2C22A 2K89A 5J2FA 5IINA 3UM9A 2JXJA 4MEYA 2J6TA 5KFUA 3KHHA 4MF2A 4ELTA 1AROP 4YG2A 4AP9A 2PFNA 3PR5B 2RHFA 2VKQA 4DF8A 4J9LA 1VLBA 2EANA 3KD3A 1U9LA 5KFYA 4QZHA 3UPQA 2KIWA 1LKYA 2KJ8A 9ICLA 3PX0A 4ECWA 3C23A 5EE1A 2ZIWB 4O5EA 2N1RA 1MA7A 4EBDA 2EAOA 3ZDDA 3MBYA 2G09A 9ICRA 5DGBA 4US8A 2MU2A 4YR0A 2K4PA 4ECSA 3PX4A 2DWQA 3ETRA 2AU0A 5EWGA 2BPCA 7ICFA 3HP6A 4O0IA 4UBBA 1U47A 2HI0A 4EYHB
chains in the Genus database with same CATH topology
4MFCA 1ZQIA 4TUQA 4MFFA 4NLKA 4PHDA 1ZQLA 4TURA 4NXZA 4LZGA 4PGXA 4I27A 4KLFA 9ICOA 4YD1A 9ICWA 5J0YA 3LK9A 2GWSA 4M9NA 2FMPA 1BPYA 7ICRA 9ICXA 4QZ8A 4MFAA 4Z6EA 4IQTA 4KLJA 9ICEA 4F5PA 4PHAA 4Z6DA 4PHPA 4KLQA 1HUOA 4RPYA 5DBAA 4PHEA 1DK2A 3JPTA 5DDYA 7ICIA 4PGYA 3V72A 4QZ9A 1MQ3A 3B0YA 4PPXA 4I2DA 4TUPA 4DO9A 4O9MA 4F5NA 4KLSA 5J29A 1BNOA 7ICLA 2BCSA 4X5VA 1ZQQA 4M9GA 8ICVA 4RQ4A 5DB7A 4R64A 2PFPA 4I2CA 4QZIA 5J2DA 4DOAA 4M9LA 9ICSA 1ZQGA 9ICBA 5J0WA 1XSLA 2BCVA 8ICEA 1KEJA 4NLNA 8ICCA 4I29A 4IQVA 3V7LA 8ICHA 5EOZA 8ICFA 4YMOA 1ZJMA 1TVAA 4YMNA 4F5OA 9ICNA 1ZQRA 4I2FA 3RH5A 4KLLA 8ICGA 3RJGA 4QZDA 5CB1A 7ICUA 5D49A 2BPFA 4I2JA 4KLUA 1ZQNA 4KLDA 4RQ7A 4UAWA 5IIIA 4R66A 4GXJA 4IQUA 5J0UA 3RH6A 4UB5A 4I28A 5J2IA 4Z6CA 4RQ1A 4MF8A 4IQWA 5J2KA 7ICQA 4RQ0A 8ICMA 7ICPA 1ZQCA 2BPGA 4R65A 4UAZA 8ICBA 3MDCA 9ICGA 4RPXA 3JPSA 9ICPA 2BCRA 1XSNA 3C5FA 5BOMA 4UB4A 4JWMA 4YN4A 1BNPA 8ICWA 5J0QA 3B0XA 5J2AA 3JPOA 9ICQA 7ICSA 4RT3A 4DOCA 5BPCA 4M9HA 3MGIA 4NLZA 1BPEA 9ICFA 4RT2A 4UB2A 9ICJA 4QZFA 7ICVA 3UXOA 4M04A 4NM1A 8ICIA 2I9GA 1ZQOA 9ICKA 4K4IA 1ZQPA 4M0AA 5DB6A 3RJHA 3HX0A 2ISOA 5IIKA 9ICMA 1ZQBA 4UAYA 3OGUA 8ICJA 1ZJNA 4RQ8A 3C2MA 7ICGA 4RQ2A 4QZBA 3PNCA 7ICMA 3V7JA 4QZEA 3TFRA 4P2HA 4QZAA 4PGQA 4DOBA 1ZQTA 5DKWA 5HHIA 1ZQAA 8ICXA 4KLHA 3C5GA 4KLOA 3UQ2A 4UB1A 1ZQHA 8ICZA 2W9MA 3PMLA 8ICKA 5HHHA 4PH5A 7ICHA 4KLGA 4KLEA 8ICQA 5D46A 4O5CA 8ICPA 1BPZA 1ZQMA 5J0PA 5J0XA 4F5QA 3PMNA 1HUZA 4NY8A 4YD2A 2BCUA 1ZQJA 2ISPA 3GDXA 5DB8A 5J0OA 8ICAA 5IILA 3RH4A 3JPQA 4M2YA 9ICIA 9ICTA 3JPPA 8ICNA 5J2GA 9ICAA 4RQ6A 9ICCA 5J2EA 1ZQFA 2PFQA 3JPRA 3JPNA 3ISBA 5DBCA 4XA5A 3MGHA 5J2JA 3RJEA 2FMSA 3AU6A 7ICJA 4QZCA 4KLIA 9ICHA 9ICVA 5DB9A 5J2HA 2PXIA 4TUSA 3TFSA 3ISCA 3HWTA 3RJKA 3V7KA 4I2HA 2KP7A 4YMMA 3UQ0A 1XSPA 3HW8A 4F5RA 4UB3A 1KDHA 1ZQEA 3RJFA 1TV9A 4RPZA 4QZGA 4JWNA 8ICLA 4I2GA 5J0TA 7ICKA 8ICTA 1BPDA 1MQ2A 4I2BA 4RQ3A 4O5KA 5J0RA 4GXKA 1ZQSA 2IHMA 5CWRA 4K4HA 3MDAA 7ICNA 3AUOA 4KLTA 4NM2A 5TZVA 4M47A 5J2FA 5IINA 1RZTA 4GXIA 1NZPA 4I2EA 5IIJA 2P66A 4MF2A 5IIOA 2PFNA 7ICTA 7ICOA 3RJJA 5DBBA 3AU2A 4KLMA 2BCQA 4RQ5A 1JMSA 4M9JA 3C2KA 8ICRA 4LVSA 4I2AA 4QZHA 3UPQA 4K4GA 3UXPA 4LZDA 9ICLA 1ZQKA 5J0SA 4I2IA 4UBCA 7ICEA 5J2BA 9ICUA 4O5EA 2FMQA 4R63A 8ICYA 3MBYA 4XUSA 8ICOA 4FO6A 2PFOA 9ICRA 3RJIA 4Z6FA 5D4BA 8ICUA 4YCXA 8ICSA 1ZQDA 5BOLA 1DK3A 1BPXA 7ICFA 3C2LA 3ISDA 5J2CA 4UBBA 3UXNA 5IIMA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4MFC A;  1ZQI A;  4TUQ A;  4MFF A;  4NLK A;  4PHD A;  1ZQL A;  4TUR A;  4NXZ A;  4LZG A;  4PGX A;  4I27 A;  4KLF A;  9ICO A;  4YD1 A;  9ICW A;  5J0Y A;  3LK9 A;  2GWS A;  4M9N A;  2FMP A;  1BPY A;  7ICR A;  9ICX A;  4QZ8 A;  4MFA A;  4Z6E A;  4IQT A;  4KLJ A;  9ICE A;  4F5P A;  4PHA A;  4Z6D A;  4PHP A;  4KLQ A;  1HUO A;  4RPY A;  5DBA A;  4PHE A;  1DK2 A;  3JPT A;  5DDY A;  7ICI A;  4PGY A;  3V72 A;  4QZ9 A;  1MQ3 A;  3B0Y A;  4PPX A;  4I2D A;  4TUP A;  4DO9 A;  4O9M A;  4F5N A;  4KLS A;  5J29 A;  1BNO A;  7ICL A;  2BCS A;  4X5V A;  1ZQQ A;  4M9G A;  8ICV A;  4RQ4 A;  5DB7 A;  4R64 A;  2PFP A;  4I2C A;  4QZI A;  5J2D A;  4DOA A;  4M9L A;  9ICS A;  1ZQG A;  9ICB A;  5J0W A;  1XSL A;  2BCV A;  8ICE A;  1KEJ A;  4NLN A;  8ICC A;  4I29 A;  4IQV A;  3V7L A;  8ICH A;  5EOZ A;  8ICF A;  4YMO A;  1ZJM A;  1TVA A;  4YMN A;  4F5O A;  9ICN A;  1ZQR A;  4I2F A;  3RH5 A;  4KLL A;  8ICG A;  3RJG A;  4QZD A;  5CB1 A;  7ICU A;  5D49 A;  2BPF A;  4I2J A;  4KLU A;  1ZQN A;  4KLD A;  4RQ7 A;  4UAW A;  5III A;  4R66 A;  4GXJ A;  4IQU A;  5J0U A;  3RH6 A;  4UB5 A;  4I28 A;  5J2I A;  4Z6C A;  4RQ1 A;  4MF8 A;  4IQW A;  5J2K A;  7ICQ A;  4RQ0 A;  8ICM A;  7ICP A;  1ZQC A;  2BPG A;  4R65 A;  4UAZ A;  8ICB A;  3MDC A;  9ICG A;  4RPX A;  3JPS A;  9ICP A;  2BCR A;  1XSN A;  3C5F A;  5BOM A;  4UB4 A;  4JWM A;  4YN4 A;  1BNP A;  8ICW A;  5J0Q A;  3B0X A;  5J2A A;  3JPO A;  9ICQ A;  7ICS A;  4RT3 A;  4DOC A;  5BPC A;  4M9H A;  3MGI A;  4NLZ A;  1BPE A;  9ICF A;  4RT2 A;  4UB2 A;  9ICJ A;  4QZF A;  7ICV A;  3UXO A;  4M04 A;  4NM1 A;  8ICI A;  2I9G A;  1ZQO A;  9ICK A;  4K4I A;  1ZQP A;  4M0A A;  5DB6 A;  3RJH A;  3HX0 A;  2ISO A;  5IIK A;  9ICM A;  1ZQB A;  4UAY A;  3OGU A;  8ICJ A;  1ZJN A;  4RQ8 A;  3C2M A;  7ICG A;  4RQ2 A;  4QZB A;  3PNC A;  7ICM A;  3V7J A;  4QZE A;  3TFR A;  4P2H A;  4QZA A;  4PGQ A;  4DOB A;  1ZQT A;  5DKW A;  5HHI A;  1ZQA A;  8ICX A;  4KLH A;  3C5G A;  4KLO A;  3UQ2 A;  4UB1 A;  1ZQH A;  8ICZ A;  2W9M A;  3PML A;  8ICK A;  5HHH A;  4PH5 A;  7ICH A;  4KLG A;  4KLE A;  8ICQ A;  5D46 A;  4O5C A;  8ICP A;  1BPZ A;  1ZQM A;  5J0P A;  5J0X A;  4F5Q A;  3PMN A;  1HUZ A;  4NY8 A;  4YD2 A;  2BCU A;  1ZQJ A;  2ISP A;  3GDX A;  5DB8 A;  5J0O A;  8ICA A;  5IIL A;  3RH4 A;  3JPQ A;  4M2Y A;  9ICI A;  9ICT A;  3JPP A;  8ICN A;  5J2G A;  9ICA A;  4RQ6 A;  9ICC A;  5J2E A;  1ZQF A;  2PFQ A;  3JPR A;  3JPN A;  3ISB A;  5DBC A;  4XA5 A;  3MGH A;  5J2J A;  3RJE A;  2FMS A;  3AU6 A;  7ICJ A;  4QZC A;  4KLI A;  9ICH A;  9ICV A;  5DB9 A;  5J2H A;  2PXI A;  4TUS A;  3TFS A;  3ISC A;  3HWT A;  3RJK A;  3V7K A;  4I2H A;  2KP7 A;  4YMM A;  3UQ0 A;  1XSP A;  3HW8 A;  4F5R A;  4UB3 A;  1KDH A;  1ZQE A;  3RJF A;  1TV9 A;  4RPZ A;  4QZG A;  4JWN A;  8ICL A;  4I2G A;  5J0T A;  7ICK A;  8ICT A;  1BPD A;  1MQ2 A;  4I2B A;  4RQ3 A;  4O5K A;  5J0R A;  4GXK A;  1ZQS A;  2IHM A;  5CWR A;  4K4H A;  3MDA A;  7ICN A;  3AUO A;  4KLT A;  4NM2 A;  5TZV A;  4M47 A;  5J2F A;  5IIN A;  1RZT A;  4GXI A;  1NZP A;  4I2E A;  5IIJ A;  2P66 A;  4MF2 A;  5IIO A;  2PFN A;  7ICT A;  7ICO A;  3RJJ A;  5DBB A;  3AU2 A;  4KLM A;  2BCQ A;  4RQ5 A;  1JMS A;  4M9J A;  3C2K A;  8ICR A;  4LVS A;  4I2A A;  4QZH A;  3UPQ A;  4K4G A;  3UXP A;  4LZD A;  9ICL A;  1ZQK A;  5J0S A;  4I2I A;  4UBC A;  7ICE A;  5J2B A;  9ICU A;  4O5E A;  2FMQ A;  4R63 A;  8ICY A;  3MBY A;  4XUS A;  8ICO A;  4FO6 A;  2PFO A;  9ICR A;  3RJI A;  4Z6F A;  5D4B A;  8ICU A;  4YCX A;  8ICS A;  1ZQD A;  5BOL A;  1DK3 A;  1BPX A;  7ICF A;  3C2L A;  3ISD A;  5J2C A;  4UBB A;  3UXN A;  5IIM A; 
#chains in the Genus database with same CATH topology
 5JTI A;  4O3Q A;  2QB1 A;  2YB1 A;  4OJO A;  1B4F A;  1A76 A;  4KTQ A;  5AI0 A;  3H8M A;  4PHD A;  1X9M A;  4NXZ A;  3QNM A;  1CI4 A;  4LZG A;  4I27 A;  4YD1 A;  1UA1 A;  2FMP A;  3C29 A;  3PY8 A;  7ICR A;  4QZ8 A;  1L7M A;  3WK5 A;  4IQT A;  4B9L A;  1RYS A;  2OHF A;  3F5A A;  4PHP A;  4DS4 A;  3BS7 A;  4KLQ A;  4DL7 A;  4MHV A;  5ALQ A;  5KT4 A;  1N56 A;  5DDY A;  7ICI A;  4UB8 U;  2Y1J A;  4Q8F A;  1TAM A;  5DLG A;  5AKY A;  4QNL A;  1JIH A;  1WWU A;  3GV8 B;  4BUG A;  3A0B U;  4O9M A;  1BPB A;  2ZIV B;  2ZG6 A;  4P4O A;  1DRG A;  3N4M B;  4CRX A;  2MUT B;  1Q3U A;  4F72 A;  4AYB C;  8ICV A;  3WK7 A;  4CF5 A;  3L5K A;  5DB7 A;  2PFP A;  3E0F A;  4YR2 A;  5KT6 A;  3N7S C;  3QUQ A;  5J2D A;  4US9 A;  4DFJ A;  9ICB A;  1XSL A;  2JEJ A;  8ICE A;  3EUB 2;  1WYG A;  2FLL A;  1ZQU A;  4J9S A;  8ICC A;  2AJQ A;  4QIW C;  3GII A;  5AI6 A;  3IHQ B;  3KZI U;  4U7C A;  3ICX A;  1TVA A;  2XCA A;  9ICN A;  4ED6 A;  4I2F A;  3H0L B;  4KMO B;  4YXJ A;  4QZD A;  5CB1 A;  7ICU A;  3QX7 A;  4EZ6 A;  4ED1 A;  3NTU A;  4KLU A;  4RQ7 A;  2AGQ A;  2EQY A;  3F2B A;  2I5H A;  4DL4 A;  4UB5 A;  4I28 A;  5J2I A;  4IQW A;  5J2K A;  4RQ0 A;  8ICM A;  2HBJ A;  3PW0 A;  5HMM A;  4UAZ A;  2KG5 A;  3MDC A;  2OEH A;  2BQ3 A;  4EX7 A;  1IIP A;  3QUC A;  5ALV A;  2DL0 A;  3H4B A;  3C5F A;  3M7D A;  1D8L A;  3UMB A;  2P35 A;  1S77 D;  3HJE A;  1PK3 A;  1BNP A;  1QSS A;  3JPO A;  1KFS A;  3M9N B;  4UAT A;  4DOC A;  1TAU A;  2ZIW A;  2I1Q A;  4J9K A;  2HBM A;  4EBC A;  1BPE A;  9ICF A;  4RT2 A;  3M6Z A;  1A77 A;  2KJ5 A;  1S97 A;  1A0P A;  3PO4 A;  5AKX A;  1IM4 A;  5J8Y C;  3SQI A;  1ZQP A;  2ZTC A;  5ALH A;  3EPG A;  3MGV A;  4FBU A;  1CUK A;  2DPJ A;  1N63 A;  2E8P A;  1L5U A;  2KOB A;  1IG6 A;  3WK9 A;  2W43 A;  2Q0Z X;  4DFD A;  2WAQ C;  3C2M A;  3TAP A;  4C4R A;  1RXW A;  4RQ2 A;  2V4Q A;  3PNC A;  7ICM A;  1J2M A;  4PL2 A;  5AK5 A;  2ZTD A;  2R8K A;  3TFR A;  2WF5 A;  2FI1 A;  3RTV A;  4UB6 U;  4JV1 A;  1TE2 A;  3RB0 A;  1C20 A;  1SL0 A;  1JXL A;  2IOH A;  2EZZ A;  5DKW A;  2XC9 A;  2GOL A;  4P4P A;  1VJ5 A;  2ASL A;  5ALM A;  2HSZ A;  2XGQ A;  4KLH A;  1P7D A;  4J03 A;  2G06 A;  4KLO A;  3NUQ A;  3UQ2 A;  1QH9 A;  3THV A;  4CE6 A;  1L8O A;  4GIB A;  3Q8S B;  5KFZ A;  4IRC A;  2IA6 A;  4IS7 A;  1MN8 A;  8ICQ A;  4UAS A;  4UQG A;  8ICP A;  1BPZ A;  4MEX A;  2GO7 A;  4YVZ A;  3RFA A;  3QZ8 A;  2MUT A;  3C28 A;  4NY8 A;  2G5I B;  4YD2 A;  5KG5 A;  3GFK B;  4B9U A;  1T4G A;  1N5W A;  3N97 B;  4WJ3 B;  2O6K A;  8ICA A;  1C7Y A;  5CR0 A;  1TAQ A;  3JPQ A;  3EPI A;  4Y2R A;  4M2Y A;  9ICI A;  3LWM A;  4JUZ A;  2LM1 A;  3IG8 A;  4YP3 A;  4NJ8 A;  1KBU A;  5ALF A;  9ICC A;  1V38 A;  4DQI A;  4IL6 U;  5AIC A;  2C2D A;  3K75 D;  5HML A;  1BVS A;  3FYH A;  3SEN A;  2LI6 A;  2XGP A;  3RB3 A;  2CPR A;  4CF4 A;  4XA5 A;  1D8B A;  2BDU A;  2H5X A;  4GC7 A;  2FMS A;  5F9N A;  3SZ2 A;  2W3S A;  2XIC A;  1RQN A;  3EWA A;  2KD1 A;  1RM6 C;  3PST A;  9ICV A;  5DB9 A;  3TFS A;  3NS1 A;  4BGD A;  4J9N A;  2KP7 A;  4JV0 A;  4F2R A;  1KW4 A;  1ZQY A;  4P4M A;  5AM5 A;  2A1A A;  3HW8 A;  3H0R B;  3GV7 B;  4UB3 A;  4RQN A;  3HT3 A;  2WTF A;  2RQ5 A;  1TV9 A;  4F4W A;  2R18 A;  4JWN A;  8ICL A;  5ALG A;  3ALR A;  3WKE A;  5ALE A;  4AYB F;  1X40 A;  3I28 A;  2V9W A;  5DQG A;  4Y2V A;  3QUT A;  2LM4 A;  3MDA A;  2YQE A;  5TZV A;  4Y2Q A;  1JAL A;  4DL6 A;  2NRZ A;  3UMC A;  2QLT A;  4GXI A;  3FAH A;  3ONN A;  1NZP A;  1LV5 A;  1ZQW A;  2AGO A;  1CEZ A;  2KEY A;  7ICO A;  2LYH A;  4B6J A;  1NI3 A;  4QIW F;  3RBD A;  3RJJ A;  4IRK A;  1LVH A;  3AU2 A;  1QQ7 A;  3HIL A;  2BCQ A;  1XO1 A;  2YML A;  3OHA A;  4M9J A;  2ATL A;  1COO A;  1SV4 A;  8ICR A;  4LVS A;  5KFX A;  4Y2P A;  4I2A A;  2HCF A;  1T7P A;  4F4X A;  4QW8 A;  1N2X A;  2JMG A;  2DKZ A;  4YFK A;  4P0Q B;  3K1R B;  1ZQK A;  1CRX A;  4UBC A;  3NVV A;  4NLB A;  1KRP A;  3Q8Q B;  2XO7 A;  3BQT A;  2YN4 A;  1JI7 A;  1PK1 A;  8ICY A;  2F8L A;  4FO6 A;  2PFO A;  3CRX A;  4Z6F A;  1FFU A;  2QKQ A;  5D4B A;  2YB4 A;  8ICU A;  2F3N A;  1NK4 A;  3G6Y A;  1SXE A;  2WF9 A;  5ALI A;  2WF8 A;  1DK3 A;  3N7R C;  4F8R A;  1Z1V A;  1BGX T;  1NK7 A;  3UXN A;  4FS2 A;  1Y88 A;  1ZQI A;  2DF4 B;  3Q8M A;  4R8U B;  2KK0 A;  3M8S A;  4Y2J A;  4TUR A;  2R8G A;  4EYI B;  1XO0 A;  1RXV A;  4CDG A;  4PGX A;  4KLF A;  1Z1B A;  1X9S A;  2A1J A;  1SV0 A;  2XI9 A;  3RB6 A;  9ICW A;  2KJ9 A;  2GWS A;  4M9N A;  3TKA A;  1BPY A;  3Q8K A;  9ICX A;  4ZH4 A;  4Z6E A;  1Z4N A;  5AI4 A;  3SV3 A;  9ICE A;  2G07 A;  4F5P A;  5GTH U;  3AMZ A;  4DWI A;  5KFJ A;  4QWC A;  4TQS A;  5AKL A;  4RPY A;  4NL9 A;  1RPL A;  2IBK A;  5DBA A;  4PHE A;  3T5H A;  3RR8 A;  1JRP A;  2JR5 A;  3RBE A;  2KZZ A;  4FZL A;  3WU2 U;  1Q46 A;  4QZ9 A;  3SEI A;  1MQ3 A;  1S76 D;  3B0Y A;  3GQC A;  4DL2 A;  1UT8 A;  5TIS U;  4TUP A;  2WAQ F;  2W9C A;  3KBB A;  4DO9 A;  2KTQ A;  4ED8 A;  3WKC A;  2ZUB A;  4KN4 A;  4B9T A;  1SWW A;  3G6V A;  3BQ0 A;  5KG0 A;  4X5V A;  2QAR B;  1TK8 A;  4ED2 A;  2K60 A;  4QZI A;  1NKB A;  4ECU A;  1YZ6 A;  4DOA A;  2GLE A;  3PR4 A;  5ALD A;  5J0W A;  1S5L U;  2F44 A;  3FC4 A;  2E5S A;  4FZN A;  1ECW A;  4DEZ A;  2H3Q A;  5DG9 A;  4ECR A;  5KFO A;  4GC6 A;  1KEJ A;  4NLN A;  1XNS A;  3ZDA A;  2AH5 A;  4I29 A;  4IQV A;  3QXG A;  2DKX A;  5AHX A;  8ICH A;  8ICF A;  2UVR A;  2ZIX A;  3SYZ A;  4RNM A;  4DL3 A;  1ZQR A;  3RH5 A;  5KFT A;  1QQ5 A;  4I2J A;  3T5J A;  2R8H A;  1ZQN A;  3PX6 A;  1OXJ A;  3CW2 C;  2LYB A;  3GU3 A;  5J0U A;  5KT7 A;  5ALL A;  5KFL A;  2BDP A;  4Z6C A;  1SL2 A;  5ALO A;  4MF8 A;  1X9X A;  5L1L A;  5KG2 A;  1V9P A;  5DG8 A;  3QU2 A;  1NK0 A;  3WK4 A;  4Q43 A;  1HIW A;  2P6R A;  5AK3 A;  4FBT A;  2GH1 A;  3JPS A;  4C8N A;  1Z4O A;  3RF9 A;  2LMR A;  1D8Y A;  4JWM A;  2FLN A;  2F2A B;  8ICW A;  3KHL A;  3BQ7 A;  1KSP A;  4P0Q A;  1T3Q A;  1COK A;  4RT3 A;  2YTU A;  5HR6 A;  2KE7 A;  3KZX A;  3MGI A;  4NLZ A;  3HKZ C;  2LKY A;  3H4D A;  2BQR A;  1V97 A;  3HRD D;  3IP4 B;  5DQH A;  2F76 X;  4M04 A;  8ICI A;  4JK1 A;  5KFG A;  9ICK A;  2VIX A;  3BQ1 A;  2WF7 A;  4OJP A;  2F1J A;  4M0A A;  4R8U A;  3PVX A;  2JRZ A;  3HX0 A;  2ISO A;  2IOF A;  2K4H A;  3OTQ A;  5A0L A;  4BWM A;  2KIV A;  1ZQB A;  2DFL A;  4JB3 A;  4BDP A;  3OGU A;  3DDH A;  2NV3 A;  2K4I A;  1QSL A;  3KKA A;  4F4Y A;  3OSP A;  2OWO A;  4Y2X A;  1SGG A;  2FPL A;  4QZB A;  3V7J A;  4QZE A;  5AM3 A;  2RDJ A;  4P2H A;  4KMU A;  1H38 A;  1J2N A;  4O3O A;  3TAR A;  4DOB A;  5AKJ A;  4NLC A;  2G5H B;  1ZQT A;  2KMD A;  5ALK A;  1WG8 A;  2NRV A;  2JEF A;  1QSY A;  1ZQA A;  5FP0 A;  1ZD2 P;  2JHD A;  2FJ6 A;  2F77 X;  3ETL A;  4UB1 A;  2W9M A;  3H8J A;  5JRT A;  3TQ1 A;  5AIB A;  1S10 A;  3PO5 A;  3L4P A;  4QWB A;  7ICH A;  1TK0 A;  4KLE A;  5D46 A;  2NYV A;  1L8L A;  5J0P A;  5J0X A;  4OCZ A;  2WHE A;  3KHG A;  2QAR A;  2BCU A;  3V6J A;  3ORY A;  2VJ4 A;  1ZET A;  4O3S A;  5AKG A;  3GDX A;  1Z19 A;  1D9D A;  4ELV A;  3LWL A;  2Z7J A;  5KFI A;  2UVV A;  2KKP A;  3T79 A;  3IRU A;  2W03 A;  5J2G A;  5AI8 A;  1X2I A;  5KG3 A;  4RQ6 A;  1ZQ1 C;  5KFE A;  3D2N A;  4EBE A;  5ALT A;  3NRW A;  2Q4T A;  4J9M A;  4DFK A;  5KFF A;  2WB1 C;  2CXY A;  1YT3 A;  1K1Q A;  5DBC A;  5KNI A;  3Q8P B;  4O3N A;  3MGH A;  2F8K A;  1JRO A;  1Q8K A;  4GLX A;  1ZOL A;  7ICJ A;  4ECZ A;  4QZC A;  4KLI A;  5KFD A;  3HPO A;  1U45 A;  3AQE A;  3SMV A;  4C80 A;  3V7K A;  2BZF A;  3QU9 A;  2XY6 A;  1AQ6 A;  1NJY A;  4B9V A;  3EZ5 A;  3H7I A;  3UQ0 A;  4B9M A;  2H3Z A;  3R9K A;  3QZ7 A;  1NK6 A;  4NWI A;  1JX4 A;  1ZQE A;  4JV2 A;  3ZDB A;  5J0T A;  2YY6 A;  4ED3 A;  7ICK A;  3BQ2 A;  1BPD A;  2MSN A;  1B0X A;  1PK1 B;  3LDA A;  2ZIU A;  4F92 B;  2K8A A;  4I2B A;  4RQ3 A;  4ACO A;  2ZJA A;  3I76 A;  1S0V A;  3NVY A;  5HP4 A;  4K4H A;  2RLT A;  2BGW A;  5AM1 A;  2YMQ A;  3RRG A;  3GZF A;  3SV4 A;  2KHV A;  3OPX A;  4XQ8 A;  3MFH A;  2IOF K;  4C8M A;  1KFT A;  5IIO A;  4J9R A;  5KAI U;  3ED5 A;  5KFP A;  4IR9 A;  4DFM A;  4Y2S A;  2B6G A;  1FO4 A;  3RRH A;  4RQ5 A;  2HHS A;  3BS5 B;  2LBO A;  4EEL A;  2ASD A;  2MRL A;  4FS1 A;  2A1J B;  2AQ0 A;  5HNK A;  1B22 A;  1ZQZ A;  3BZK A;  3UXP A;  5AI9 A;  5CP2 A;  4RQM A;  1T94 A;  5J0S A;  5AM2 A;  1KN5 A;  2QB0 A;  9ICU A;  2MAX A;  3KFU F;  3C21 A;  3TAD A;  4P0P A;  1TFR A;  2DUY A;  1X9W A;  4XUS A;  8ICO A;  2WF6 A;  5ALW A;  3FM9 A;  1J97 A;  4DQR A;  2ASJ A;  4Y2U A;  3WKB A;  4YCX A;  8ICS A;  3BZC A;  5BOL A;  1BPX A;  1NOM A;  1N61 A;  4DFP A;  5IIM A;  2W9C B;  4MFC A;  4TUQ A;  4DSJ A;  4MFF A;  5DLF A;  4NLK A;  5EE3 A;  1ZQL A;  1X6J A;  4Y2Y A;  2D8C A;  3GIJ A;  2OM6 A;  1DXS A;  4GFJ A;  2DPI A;  1SWV A;  5EWE A;  4F50 A;  3HKZ F;  1ZQX A;  5J0Y A;  2HBL A;  3U26 A;  2BR0 A;  2NRW A;  1KFD A;  3QU7 A;  3M1Y A;  1UPH A;  4BXO A;  2KFZ A;  1U48 A;  4MFA A;  2A3V A;  2VA3 A;  1OUQ A;  1KQQ A;  4KLJ A;  2M0N A;  1L3S A;  2OCE A;  4PHA A;  1L7N A;  4Z6D A;  5HR7 A;  3H8S A;  1MC8 A;  1HUO A;  2XID A;  2LHT A;  3JPT A;  4DQP A;  2ZIX B;  3PW7 A;  2H3F A;  5KFW A;  4PGY A;  3ZD9 A;  3V72 A;  3ZI4 A;  2KVS A;  2IMW P;  4DSK A;  1L3V A;  1HEK A;  3TAQ A;  2AQ4 A;  2KFN A;  1YZ7 A;  5KG7 A;  4KLS A;  5J29 A;  5ALR A;  7ICL A;  1N48 A;  5L9X A;  1K1S A;  1UT5 A;  1ZQQ A;  4M9G A;  1IV8 A;  4C8L A;  2ES6 A;  2E1E A;  4RQ4 A;  4R64 A;  1F0M A;  4I2C A;  5AM4 A;  4G9B A;  3KTQ A;  2W7P A;  2KZM A;  1ZQG A;  5KTQ A;  2BHN A;  3LYS A;  4ED7 A;  2BCV A;  3QU4 A;  2PMZ C;  2W54 A;  3Q8R B;  2HVH A;  3M6K A;  4OJL A;  4C4S A;  2W11 A;  2FPK A;  3OJS A;  2JEI A;  3V7L A;  5EOZ A;  4ICA A;  3M9O B;  1ZJM A;  3AQF A;  4YMN A;  3F2C A;  1LB2 B;  1QTM A;  3F53 A;  4KLL A;  5KFS A;  3AM9 A;  3SAH A;  5KAF U;  1FIQ A;  4F71 A;  3GV5 B;  2BPF A;  5C0Y A;  3H40 A;  3VC8 A;  2J6U A;  5III A;  5KFB A;  4GXJ A;  1PVR A;  4IQU A;  4F4K A;  1B43 A;  3RH6 A;  3N7P D;  4EEY A;  2F1H A;  2P6U A;  1RDF A;  1ED1 A;  1ZQC A;  4BX9 C;  2E3T A;  4QW9 A;  2JH1 A;  4R65 A;  2WB1 F;  8ICB A;  1M6Y A;  2JZB B;  3BS5 A;  1NJW A;  4RPX A;  3M9M B;  1TK5 A;  1K5O A;  1JXE A;  4DLE A;  5AKE A;  2UVW A;  9ICP A;  3VCB A;  3IG5 A;  3D6J A;  5G5H A;  3PZP A;  4O3P A;  5J2A A;  1JN3 A;  1NKC A;  1PVQ A;  4EEN A;  4M9H A;  1XU4 A;  3IM1 A;  5T14 A;  3MAB A;  4ECY A;  4CCH A;  3I1Y A;  4USA A;  4UB2 A;  4C4T A;  1X66 A;  4QZF A;  7ICV A;  3UXO A;  3MR5 A;  4NM1 A;  4ECQ A;  1S0O A;  3EW9 A;  4RNO A;  2I9G A;  2OXO A;  1L3T A;  4G3I A;  3RAX A;  2E8M A;  1QCK A;  4XRH A;  4DLG A;  5DB6 A;  3RJH A;  2FPM A;  5IIK A;  3PW4 A;  5L1K A;  1TKD A;  3N28 A;  3NRZ A;  2R8I A;  2YMP A;  2ALZ A;  5G5G A;  4CNQ A;  4RQ8 A;  4JMU A;  4F3O A;  7ICG A;  2ODG A;  5AK4 A;  4QZA A;  1L6N A;  3CYM A;  1GO3 F;  4J9P A;  2ZXI A;  4IRD A;  3E2E A;  5L1I A;  5HHI A;  2FDR A;  3TI0 A;  1NZB A;  2M9N A;  3C1Z A;  3PW2 A;  8ICX A;  5AKH A;  2Y9U A;  1ZQH A;  8ICZ A;  2KSO A;  3PML A;  4UAR A;  3UMG A;  2JH7 A;  5JU5 A;  8ICK A;  4PH5 A;  5DQI A;  4KLG A;  5KT3 A;  2XVT A;  4O5C A;  4DQQ A;  2EAP A;  1WWV A;  2AXT U;  2EZY A;  3PMN A;  3D2Q A;  1HUZ A;  3AN1 A;  2RP5 A;  2BQU A;  2C2E A;  4DSE A;  3MC1 A;  5J8Y A;  2ISP A;  2F1I A;  2RDI A;  5CJ7 A;  4PZN A;  5IIL A;  3WKD A;  3ZDE A;  5KT2 A;  8ICN A;  3G6X A;  2ZIU B;  9ICA A;  1FFV A;  4YQW A;  1FEZ A;  2ZJ8 A;  2A19 A;  3ZDC A;  5J2E A;  1ZQF A;  4RUC A;  1N62 A;  2E8N A;  4B9S A;  3JPR A;  5KFA A;  1QLN A;  5ALZ A;  2HOF A;  3JPN A;  3K1Z A;  5DGA A;  4Q45 A;  3ISB A;  1L7O A;  3RJE A;  1L7P A;  5AKI A;  2KKV A;  3AU6 A;  1WUD A;  4QWE A;  9ICH A;  1XC9 A;  4TUS A;  3ISC A;  2IHN A;  3QEA Z;  3RJK A;  4DL5 A;  4I2H A;  3V6K A;  1U4B A;  4KX3 A;  4DSI A;  2DBY A;  2W8K A;  1O03 A;  4YMM A;  5H2F U;  3PSP A;  1Z00 B;  4F5R A;  5L1J A;  5F9L A;  2WFA A;  3RJF A;  4RPZ A;  4QZG A;  1KLN A;  2JZB A;  4EX6 A;  2QB0 B;  3SAG A;  8ICT A;  2EZX A;  4P0P B;  4M6W B;  5ALX A;  5EE9 A;  2W9B B;  4DS5 A;  4O5K A;  1NKE A;  1ZQS A;  7ICN A;  2I6X A;  5KFN A;  2C2R A;  3AUO A;  4KLT A;  4M47 A;  3BDP A;  3V6H A;  3H8W A;  1WCL A;  1RZT A;  3FDS A;  4I2E A;  5IIJ A;  2P66 A;  2PMZ F;  3EYZ A;  4A8E A;  2PKE A;  3LVW A;  7ICT A;  4J9Q A;  1SV0 C;  2NRT A;  4LJX A;  5K4L A;  5DBB A;  2KZ3 A;  5C5J A;  4KLM A;  1ZRM A;  1JMS A;  5AI5 A;  2YX8 A;  4DCC A;  3C2K A;  3DEE A;  5AKZ A;  2HHU A;  3B9J A;  5B5E U;  2Y0S C;  4HYK A;  4K4G A;  4BXO B;  4NL9 C;  4LZD A;  2W9A A;  2KV2 A;  3DV9 A;  4I2I A;  3RB4 A;  3RR7 A;  1RG6 A;  1T3N A;  3MFI A;  7ICE A;  5J2B A;  2FMQ A;  4R63 A;  3CP8 A;  3RJI A;  4ECT A;  1ZRN A;  2HHX A;  2KN7 A;  1S8O A;  5EWF A;  4RZR A;  1ZQD A;  5AKK A;  5ALS A;  3C2L A;  3ISD A;  2HHT A;  5J2C A;  4Y2T A;  4UW9 A;  4QJF B;  4OD0 A;  3SAF A;  4IC9 A;  3NVZ A;  2KVC A;  1DGJ A;  2D3D A;  2XY5 A;  1T8E A;  5AK6 A;  2MA1 A;  2OYY A;  3K4G A;  9ICO A;  1RYR A;  3NGD A;  4PZO A;  1KTQ A;  3O0F A;  3LK9 A;  3OJU A;  3AL0 B;  3GIL A;  5KT5 A;  4YR3 A;  2HDO A;  2L5Y A;  2HVI A;  4C7Y A;  1ZD3 A;  5CRX A;  3T5K A;  3CNH A;  5JUM A;  1SKR A;  1WCN A;  5KFK A;  4RU9 A;  2H3V A;  1DK2 A;  2NO4 A;  2V4R A;  3GIK A;  4Q8E A;  3OHB A;  5ALY A;  4RNN A;  4Q44 A;  4E0D A;  5KFQ A;  5KL1 B;  3QEB Z;  4PPX A;  4I2D A;  3GIM A;  2EDU A;  3SR6 A;  4F5N A;  2K4E A;  2ZTE A;  5ALJ A;  2R8J A;  1BNO A;  3QUB A;  3SD7 A;  2HW3 A;  3PSI A;  5CEH A;  2BCS A;  1Q3V A;  4KIT B;  3NVW A;  1SZP A;  5KL8 B;  3Q8L A;  1SKS A;  2UVU A;  1ZD5 A;  2NRX A;  4YXM A;  1ZXI A;  3IN5 A;  4M9L A;  9ICS A;  4F91 B;  3QYP A;  2HMX A;  2KHQ A;  3D2S A;  5ALN A;  2XCP A;  4C8O A;  2ZUC A;  3PSF A;  1Z00 A;  4UAV A;  2VAN A;  1DGS A;  2PI4 A;  2HOI A;  1F5S A;  2AGP A;  1ZYQ A;  1SKW A;  4IR1 A;  3QE9 Y;  2ZUD A;  4YMO A;  5KG4 A;  4F5O A;  4OJ5 A;  1D9F A;  1RQL A;  4CF3 A;  2J6S A;  3IDW A;  2Y9T A;  8ICG A;  3RJG A;  2JEG A;  4M6W A;  1OW5 A;  4NLG A;  2W9B A;  1URJ A;  3PW5 A;  4ECV A;  5D49 A;  5DDM A;  4KLD A;  3MR6 A;  1SIJ A;  1F44 A;  2G0A A;  4ELU A;  4UAW A;  2ZIV A;  1U49 A;  1S9F A;  4R66 A;  2KIC A;  1NJZ A;  4NV0 A;  3L3F X;  4KN7 A;  4RQ1 A;  4DQS A;  7ICQ A;  7ICP A;  3QU5 A;  5KFH A;  2BPG A;  3KKA C;  1ZQV A;  9ICG A;  5EE0 A;  1X42 A;  2HOQ A;  5GTI U;  2BCR A;  1XSN A;  2E8O A;  5BOM A;  2ESE A;  2K8B B;  4UB4 A;  2AHO B;  2FE9 A;  3T3F A;  4YN4 A;  2C28 A;  2CN1 A;  4F93 B;  5J0Q A;  3B0X A;  3M8R A;  1MSW D;  9ICQ A;  7ICS A;  3BJY A;  1X6I A;  5BPC A;  4FFD A;  4QWD A;  3AEV A;  1UQV A;  4UAU A;  4J9O A;  9ICJ A;  1NNL A;  2PI5 A;  2KSO B;  4BJQ A;  2HBK A;  1QQ6 A;  1ZQO A;  2E1F A;  3J81 j;  5E79 U;  1DOQ A;  4CGZ A;  1XWL A;  4OJ6 A;  2Y1I A;  2EH9 A;  2DQN B;  4K4I A;  4F2S A;  4PJ0 U;  4C0Z A;  1LKY B;  4U6P A;  1SL1 A;  2KNJ A;  1KKX A;  9ICM A;  4C8K A;  4ED0 A;  3F5E A;  4UAY A;  2B0C A;  2VJ5 A;  5ALU A;  3F2D A;  4OO1 J;  4FE3 A;  1UHU A;  5L1M A;  8ICJ A;  1ZJN A;  3TAC B;  4DF4 A;  5B66 U;  4F4Z A;  2XY7 A;  4QWA A;  4DSL A;  2ZJ5 A;  3ZD8 A;  4FZM A;  1UCV A;  3E58 A;  2EAM A;  4KX5 A;  3KOO A;  4PGQ A;  1JUD A;  4DSF A;  2Y0S F;  2OH2 A;  3WKA A;  1NJX A;  4O3M A;  3WK6 A;  1XS9 D;  2BKE A;  3NAS A;  3C5G A;  3A0H U;  4RUA A;  4B9N A;  2W7O A;  5KFC A;  5DG7 A;  5HHH A;  5KFV A;  2D6F C;  2K8C B;  4PL1 A;  5AM0 A;  4EZ9 A;  1ZQM A;  4F5Q A;  3MR3 A;  1N5X A;  2H3I A;  2YMM A;  1UA0 A;  1O08 A;  2VA8 A;  2RRD A;  3T5L A;  1ZQJ A;  3IV6 A;  3C1Y A;  5DB8 A;  3OSN A;  1PUZ A;  3S6J A;  5J0O A;  1SB3 C;  2ZXH A;  4ZOH C;  4C7Z A;  1NK9 A;  3RH4 A;  4HAI A;  1PZN A;  1V85 A;  9ICT A;  3JPP A;  2JGA A;  5KFM A;  1EXN A;  5CHG A;  1A6S A;  4O3R A;  5ALP A;  2PFQ A;  5AIA A;  2LPE A;  1SZH A;  1N60 A;  3SI8 A;  1PVP A;  2CRX A;  2B21 A;  2HHV A;  3H0M B;  3KHR A;  1SXD A;  5J2J A;  3TAN A;  1NK5 A;  1L3U A;  4TQR A;  2HHQ A;  2W04 A;  2W3R A;  1ZD4 A;  3MR2 A;  1RYU A;  4EEK A;  2FLP A;  5J2H A;  2PXI A;  2G08 A;  1HJP A;  3HWT A;  5KG1 A;  5KG6 A;  4ECX A;  2W8L A;  3TAD C;  1IXR A;  1XSP A;  2JV3 A;  2DGZ A;  4BWJ A;  5CA7 A;  3RAQ A;  2LYA A;  1Z3E B;  1KDH A;  1VDV A;  1KL9 A;  2NO5 A;  4I2G A;  3LVV A;  1NK8 A;  1MQ2 A;  5F3X B;  1S0N A;  2W55 A;  1S0M A;  5KFR A;  3WK8 A;  3PV8 A;  2HHW A;  5J0R A;  4GXK A;  2IHM A;  5CWR A;  2VA2 A;  4NM2 A;  2C22 A;  2K89 A;  5J2F A;  5IIN A;  3UM9 A;  2JXJ A;  4MEY A;  2J6T A;  5KFU A;  3KHH A;  4MF2 A;  4ELT A;  1ARO P;  4YG2 A;  4AP9 A;  2PFN A;  3PR5 B;  2RHF A;  2VKQ A;  4DF8 A;  4J9L A;  1VLB A;  2EAN A;  3KD3 A;  1U9L A;  5KFY A;  4QZH A;  3UPQ A;  2KIW A;  1LKY A;  2KJ8 A;  9ICL A;  3PX0 A;  4ECW A;  3C23 A;  5EE1 A;  2ZIW B;  4O5E A;  2N1R A;  1MA7 A;  4EBD A;  2EAO A;  3ZDD A;  3MBY A;  2G09 A;  9ICR A;  5DGB A;  4US8 A;  2MU2 A;  4YR0 A;  2K4P A;  4ECS A;  3PX4 A;  2DWQ A;  3ETR A;  2AU0 A;  5EWG A;  2BPC A;  7ICF A;  3HP6 A;  4O0I A;  4UBB A;  1U47 A;  2HI0 A;  4EYH B; 
#chains in the Genus database with same CATH homology
 4MFC A;  1ZQI A;  4TUQ A;  4MFF A;  4NLK A;  4PHD A;  1ZQL A;  4TUR A;  4NXZ A;  4LZG A;  4PGX A;  4I27 A;  4KLF A;  9ICO A;  4YD1 A;  9ICW A;  5J0Y A;  3LK9 A;  2GWS A;  4M9N A;  2FMP A;  1BPY A;  7ICR A;  9ICX A;  4QZ8 A;  4MFA A;  4Z6E A;  4IQT A;  4KLJ A;  9ICE A;  4F5P A;  4PHA A;  4Z6D A;  4PHP A;  4KLQ A;  1HUO A;  4RPY A;  5DBA A;  4PHE A;  1DK2 A;  3JPT A;  5DDY A;  7ICI A;  4PGY A;  3V72 A;  4QZ9 A;  1MQ3 A;  3B0Y A;  4PPX A;  4I2D A;  4TUP A;  4DO9 A;  4O9M A;  4F5N A;  4KLS A;  5J29 A;  1BNO A;  7ICL A;  2BCS A;  4X5V A;  1ZQQ A;  4M9G A;  8ICV A;  4RQ4 A;  5DB7 A;  4R64 A;  2PFP A;  4I2C A;  4QZI A;  5J2D A;  4DOA A;  4M9L A;  9ICS A;  1ZQG A;  9ICB A;  5J0W A;  1XSL A;  2BCV A;  8ICE A;  1KEJ A;  4NLN A;  8ICC A;  4I29 A;  4IQV A;  3V7L A;  8ICH A;  5EOZ A;  8ICF A;  4YMO A;  1ZJM A;  1TVA A;  4YMN A;  4F5O A;  9ICN A;  1ZQR A;  4I2F A;  3RH5 A;  4KLL A;  8ICG A;  3RJG A;  4QZD A;  5CB1 A;  7ICU A;  5D49 A;  2BPF A;  4I2J A;  4KLU A;  1ZQN A;  4KLD A;  4RQ7 A;  4UAW A;  5III A;  4R66 A;  4GXJ A;  4IQU A;  5J0U A;  3RH6 A;  4UB5 A;  4I28 A;  5J2I A;  4Z6C A;  4RQ1 A;  4MF8 A;  4IQW A;  5J2K A;  7ICQ A;  4RQ0 A;  8ICM A;  7ICP A;  1ZQC A;  2BPG A;  4R65 A;  4UAZ A;  8ICB A;  3MDC A;  9ICG A;  4RPX A;  3JPS A;  9ICP A;  2BCR A;  1XSN A;  3C5F A;  5BOM A;  4UB4 A;  4JWM A;  4YN4 A;  1BNP A;  8ICW A;  5J0Q A;  3B0X A;  5J2A A;  3JPO A;  9ICQ A;  7ICS A;  4RT3 A;  4DOC A;  5BPC A;  4M9H A;  3MGI A;  4NLZ A;  1BPE A;  9ICF A;  4RT2 A;  4UB2 A;  9ICJ A;  4QZF A;  7ICV A;  3UXO A;  4M04 A;  4NM1 A;  8ICI A;  2I9G A;  1ZQO A;  9ICK A;  4K4I A;  1ZQP A;  4M0A A;  5DB6 A;  3RJH A;  3HX0 A;  2ISO A;  5IIK A;  9ICM A;  1ZQB A;  4UAY A;  3OGU A;  8ICJ A;  1ZJN A;  4RQ8 A;  3C2M A;  7ICG A;  4RQ2 A;  4QZB A;  3PNC A;  7ICM A;  3V7J A;  4QZE A;  3TFR A;  4P2H A;  4QZA A;  4PGQ A;  4DOB A;  1ZQT A;  5DKW A;  5HHI A;  1ZQA A;  8ICX A;  4KLH A;  3C5G A;  4KLO A;  3UQ2 A;  4UB1 A;  1ZQH A;  8ICZ A;  2W9M A;  3PML A;  8ICK A;  5HHH A;  4PH5 A;  7ICH A;  4KLG A;  4KLE A;  8ICQ A;  5D46 A;  4O5C A;  8ICP A;  1BPZ A;  1ZQM A;  5J0P A;  5J0X A;  4F5Q A;  3PMN A;  1HUZ A;  4NY8 A;  4YD2 A;  2BCU A;  1ZQJ A;  2ISP A;  3GDX A;  5DB8 A;  5J0O A;  8ICA A;  5IIL A;  3RH4 A;  3JPQ A;  4M2Y A;  9ICI A;  9ICT A;  3JPP A;  8ICN A;  5J2G A;  9ICA A;  4RQ6 A;  9ICC A;  5J2E A;  1ZQF A;  2PFQ A;  3JPR A;  3JPN A;  3ISB A;  5DBC A;  4XA5 A;  3MGH A;  5J2J A;  3RJE A;  2FMS A;  3AU6 A;  7ICJ A;  4QZC A;  4KLI A;  9ICH A;  9ICV A;  5DB9 A;  5J2H A;  2PXI A;  4TUS A;  3TFS A;  3ISC A;  3HWT A;  3RJK A;  3V7K A;  4I2H A;  2KP7 A;  4YMM A;  3UQ0 A;  1XSP A;  3HW8 A;  4F5R A;  4UB3 A;  1KDH A;  1ZQE A;  3RJF A;  1TV9 A;  4RPZ A;  4QZG A;  4JWN A;  8ICL A;  4I2G A;  5J0T A;  7ICK A;  8ICT A;  1BPD A;  1MQ2 A;  4I2B A;  4RQ3 A;  4O5K A;  5J0R A;  4GXK A;  1ZQS A;  2IHM A;  5CWR A;  4K4H A;  3MDA A;  7ICN A;  3AUO A;  4KLT A;  4NM2 A;  5TZV A;  4M47 A;  5J2F A;  5IIN A;  1RZT A;  4GXI A;  1NZP A;  4I2E A;  5IIJ A;  2P66 A;  4MF2 A;  5IIO A;  2PFN A;  7ICT A;  7ICO A;  3RJJ A;  5DBB A;  3AU2 A;  4KLM A;  2BCQ A;  4RQ5 A;  1JMS A;  4M9J A;  3C2K A;  8ICR A;  4LVS A;  4I2A A;  4QZH A;  3UPQ A;  4K4G A;  3UXP A;  4LZD A;  9ICL A;  1ZQK A;  5J0S A;  4I2I A;  4UBC A;  7ICE A;  5J2B A;  9ICU A;  4O5E A;  2FMQ A;  4R63 A;  8ICY A;  3MBY A;  4XUS A;  8ICO A;  4FO6 A;  2PFO A;  9ICR A;  3RJI A;  4Z6F A;  5D4B A;  8ICU A;  4YCX A;  8ICS A;  1ZQD A;  5BOL A;  1DK3 A;  1BPX A;  7ICF A;  3C2L A;  3ISD A;  5J2C A;  4UBB A;  3UXN A;  5IIM A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...