1BNPA

Nmr solution structure of the n-terminal domain of dna polymerase beta, 55 structures
Total Genus 12
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
12
sequence length
87
structure length
87
Chain Sequence
MSKRKAPQETLNGGITDMLVELANFEKNVSQAIHKYNAYRKAASVIAKYPHKIKSGAEAKKLPGVGTKIAEKIDEFLATGKLRKLEK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Three-dimensional solution structure of the N-terminal domain of DNA polymerase beta and mapping of the ssDNA interaction interface.
pubmed doi rcsb
source organism Rattus norvegicus
molecule tags Nucleotidyltransferase (dna-binding)
molecule keywords DNA POLYMERASE BETA
total genus 12
structure length 87
sequence length 87
ec nomenclature ec 2.7.7.7: DNA-directed DNA polymerase.
pdb deposition date 1996-04-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF14716 HHH_8 Helix-hairpin-helix domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.110 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 DNA polymerase beta, N-terminal domain-like 1bnpA00
5IILA 2BCRA 3C5GA 4UB2A 1ZQPA 3UPQA 1BNPA 4QZCA 3V7LA 5BOMA 5IIJA 8ICHA 4M9GA 4KLSA 1ZQJA 3V7KA 2P66A 1ZQNA 4UB5A 2GWSA 1MQ2A 1TV9A 3GDXA 7ICOA 8ICFA 8ICSA 4M0AA 4R65A 4I2EA 2IHMA 3PMNA 8ICXA 3RJKA 3B0YA 2BCQA 3RJEA 4DOCA 1ZQFA 3MGHA 1XSPA 3LK9A 4DOAA 3JPQA 4M04A 2BPFA 4LZDA 5IIOA 8ICOA 9ICLA 4R64A 5TZVA 1ZQRA 4UBCA 9ICSA 1BNOA 7ICGA 2FMQA 5BOLA 7ICPA 3V72A 5J2EA 5BPCA 4JWNA 4UB3A 4IQTA 4I2BA 2BCSA 9ICNA 1ZQGA 9ICKA 7ICUA 4IQUA 3OGUA 5J2DA 5J0XA 5J2JA 1DK2A 4NLZA 5J0WA 5J0UA 4UAZA 9ICPA 3AU2A 4I2FA 1ZJMA 9ICFA 4YMMA 5D4BA 4RPXA 2FMPA 4RQ5A 4QZEA 3RJFA 7ICHA 4RQ2A 4YMOA 3TFRA 5J2GA 4PGXA 8ICYA 4R66A 4K4HA 4KLIA 4X5VA 8ICTA 2BCUA 4MF8A 4F5PA 3RJJA 4PH5A 3UQ0A 4NXZA 4KLTA 4QZDA 1HUZA 4YMNA 4K4IA 9ICIA 1KEJA 4PHEA 1BPEA 4GXIA 3RJGA 3TFSA 1ZJNA 4TUQA 4I2CA 4KLHA 7ICQA 9ICBA 4PGQA 3RJHA 7ICSA 9ICVA 2ISOA 4QZ9A 4P2HA 9ICMA 5DB9A 4IQVA 4M9JA 4PHDA 4FO6A 4KLEA 4PHAA 4KLFA 4F5QA 4M2YA 3ISDA 4QZ8A 1ZQAA 4PPXA 4RT2A 5J0OA 2PFQA 3JPRA 7ICVA 1JMSA 3C2MA 4LZGA 3B0XA 8ICRA 1ZQSA 4QZBA 5DBCA 4F5NA 4O5EA 4QZHA 1MQ3A 2I9GA 7ICKA 1TVAA 3RH5A 7ICLA 7ICJA 3UXOA 8ICPA 1DK3A 8ICAA 4I2IA 2W9MA 4YD1A 3JPSA 1ZQCA 8ICNA 1BPYA 9ICCA 8ICUA 4RPZA 1ZQEA 4I2JA 4XA5A 1ZQIA 7ICNA 4I2AA 3RH6A 4RT3A 3JPPA 5CWRA 4O9MA 9ICGA 9ICTA 5J0YA 4QZFA 1ZQBA 5DBAA 7ICEA 9ICUA 4NM1A 4PGYA 1ZQMA 5J2BA 4M47A 3UXPA 4QZAA 3PMLA 9ICRA 4QZIA 4KLMA 3V7JA 5J2KA 2ISPA 4Z6FA 9ICAA 7ICRA 3JPNA 5J29A 2PFPA 8ICEA 8ICBA 5IIKA 1BPZA 8ICIA 5IIMA 3C2KA 5J0QA 5HHHA 1ZQHA 4UAWA 3MGIA 3UQ2A 3C5FA 4Z6CA 1RZTA 8ICQA 1NZPA 5J0PA 4XUSA 5J2HA 5IINA 7ICTA 4O5KA 2BPGA 4I2GA 4KLJA 8ICKA 3RH4A 4TUSA 5DKWA 3HX0A 4Z6DA 4RQ0A 4Z6EA 1ZQLA 4QZGA 4NLKA 1XSNA 4YN4A 4NLNA 4MFCA 4IQWA 5J0TA 8ICMA 3MBYA 7ICMA 4UAYA 8ICCA 8ICWA 1ZQQA 1BPDA 5CB1A 4KLUA 4I2HA 4F5RA 7ICIA 5DB6A 4I27A 5DDYA 5D46A 8ICJA 4MFAA 5J0RA 3PNCA 4KLGA 9ICWA 3C2LA 5DBBA 5J2FA 3ISCA 1KDHA 1HUOA 4JWMA 9ICHA 5IIIA 4KLDA 5DB7A 4RQ6A 4M9NA 3UXNA 2PFNA 9ICJA 4K4GA 4RQ8A 9ICEA 8ICZA 9ICQA 4LVSA 3MDCA 9ICXA 1BPXA 3JPTA 4I2DA 3HWTA 2PFOA 3ISBA 8ICVA 5J0SA 4RQ1A 3HW8A 4PHPA 2KP7A 5EOZA 4O5CA 4UB4A 4RQ7A 4DOBA 2BCVA 4MF2A 3AU6A 2FMSA 9ICOA 5DB8A 4RQ3A 4I28A 5D49A 1ZQKA 4I29A 4YD2A 4UB1A 3AUOA 4M9HA 4GXJA 8ICGA 4GXKA 4KLQA 5J2IA 4RQ4A 5HHIA 4RPYA 4F5OA 1ZQOA 4TUPA 3JPOA 4M9LA 4NY8A 4MFFA 4KLLA 4YCXA 5J2AA 8ICLA 4R63A 4DO9A 7ICFA 5J2CA 1XSLA 4KLOA 4NM2A 1ZQTA 4TURA 3MDAA 4UBBA 1ZQDA 3RJIA 2PXIA
chains in the Genus database with same CATH superfamily
4F93B 3EZ5A 2BCRA 1JN3A 3C29A 3C5GA 4UB2A 4Y2VA 3UPQA 2G08A 3I28A 1A0PA 5B66U 3KKAC 5KFDA 2WF7A 4M9GA 4KLSA 2KD1A 4Y2XA 4ED0A 2ZIXB 2P66A 3M8SA 1KLNA 5KTQA 1L7MA 3L4PA 1T94A 3CP8A 3GILA 8ICSA 2KHVA 4M0AA 2N1RA 2QB0B 4YQWA 4US9A 3PMNA 1SV0C 1UPHA 3ZDBA 3B0YA 2KOBA 4QWDA 3RJEA 4DOCA 3TI0A 1WUDA 2OM6A 2RQ5A 4OJPA 4DFMA 4F71A 1A76A 1ZQFA 1TK8A 3M9OB 2VJ4A 3PX6A 5ALQA 3LK9A 2KFNA 4M04A 4DF4A 4LZDA 2OHFA 2OH2A 2YQEA 3RBEA 4JV0A 5EE3A 1FFUA 3QU2A 1ZQRA 4YXJA 3RAXA 3C1YA 1BNOA 3DV9A 7ICPA 3GIIA 4MEYA 3VCBA 2LYHA 9ICNA 2XO7A 2DBYA 1TE2A 2KMDA 3Q8RB 5AKIA 2FI1A 3SI8A 3BS7A 4G9BA 4F4ZA 3KKAA 3K4GA 5AI9A 2BHNA 1AROP 4RQ5A 3RJFA 7ICHA 4RQ2A 2WF6A 5KFJA 4YR2A 3PSPA 2ZTCA 1KN5A 4U6PA 1XO0A 1SV4A 4DL5A 5H2FU 3WK7A 3WKEA 3RJJA 2KZMA 2B6GA 3UQ0A 2NRXA 1BGXT 3AMZA 4YMNA 4K4IA 4CF3A 3T5LA 1X6IA 3T5HA 2W7OA 2DGZA 1ZJNA 4USAA 4F4WA 4KLHA 2VKQA 3AN1A 4DSKA 2EZXA 5KFHA 2V4QA 4GC6A 3SEIA 2B0CA 5KFYA 4P0PA 2ISOA 4P2HA 9ICMA 2VIXA 2HHVA 1VDVA 2YX8A 1X9WA 2E8PA 4M6WA 1H38A 3KHGA 5KFSA 3Q8PB 1CUKA 5KFPA 3J81j 2J6SA 4KLFA 2A19A 1O03A 3T5KA 5KFFA 1V85A 3PZPA 1NZBA 5HMMA 4LZGA 2F77X 2G07A 8ICRA 2JR5A 4ED8A 3IM1A 5DBCA 3H0RB 4QWEA 4QIWC 4F5NA 1MQ3A 2I9GA 3BDPA 3H8WA 3GV7B 1QQ5A 3PSFA 7ICKA 3NTUA 5KFUA 1TVAA 7ICJA 1MC8A 1IV8A 1FO4A 2PI4A 2W9MA 5AKEA 4RNNA 8ICNA 2WAQC 3H7IA 1BPYA 9ICCA 3KHHA 3ORYA 3KTQA 4I2JA 3MC1A 3QE9Y 5AI5A 1O08A 3EW9A 4CCHA 3HPOA 4YFKA 3IG5A 4RT3A 5CWRA 4IRDA 1WCNA 2FJ6A 1XO1A 2ZJ5A 4KTQA 4ED1A 3C23A 3RRGA 2KIVA 2HBMA 2W3SA 1QSYA 2K60A 1XS9D 1LV5A 4NM1A 4PGYA 4B9SA 1ZQMA 1URJA 4DQPA 4ICAA 9ICRA 5KL1B 2Y1IA 5L9XA 1OUQA 4KLMA 1EXNA 1COOA 1F0MA 1OXJA 5ALLA 1L5UA 4UARA 5KG3A 5IIKA 8ICIA 1TAQA 5IIMA 4CDGA 2WB1F 3MGVA 2C2RA 5DQGA 1ZQHA 1NJYA 4Q8FA 4O3NA 3MGIA 4BUGA 2C22A 4J9RA 4XRHA 4Z6CA 1Q46A 3QEAZ 1NK5A 2ASLA 1JIHA 5EE1A 5J2HA 7ICTA 2K89A 2BPGA 4KLJA 1SIJA 2HSZA 2E8OA 1DOQA 2JEJA 2CRXA 3PW7A 2XCAA 5AI8A 4GLXA 3D2QA 3F2DA 3BZKA 4QZGA 3M6ZA 1C7YA 4KX3A 2KVSA 2PMZF 4C4RA 4B9NA 2ZIVA 2F1JA 8ICMA 7ICMA 8ICWA 3UM9A 2E5SA 5HP4A 4FZNA 1ZQQA 2EZZA 4KLUA 1KTQA 2WF5A 2DL0A 5AKJA 5DB6A 2YTUA 2BGWA 2NRWA 2J6TA 5DDYA 3Q8MA 1T3QA 5AM2A 1U45A 8ICJA 3GV5B 3F2CA 4KLGA 3H4DA 2KG5A 4Y2SA 5AKLA 2JHDA 5KFZA 2ES6A 1CEZA 2HHSA 1ZQUA 5HR6A 1PVPA 4KLDA 2UVRA 3BJYA 2XCPA 3FAHA 4JUZA 9ICJA 1P7DA 5KFOA 9ICQA 4EZ9A 9ICXA 2B21A 3MR5A 1JROA 3HWTA 3ISBA 3Q8SB 2C2EA 1X9XA 4RQ1A 2JEIA 1PK1B 4Y2UA 2HOFA 4B9MA 4BXOA 4ECVA 4O5CA 2WF9A 4F50A 3C1ZA 4ELVA 2FMSA 3PSIA 1HJPA 3CYMA 4RQ3A 4F91B 4OO1J 5J8YC 3OJUA 3K1RB 5CRXA 2ASDA 4GXJA 2EZYA 5ALPA 4F5OA 3SZ2A 3G6YA 1A77A 5ALWA 1KQQA 1TAUA 2JXJA 4CRXA 5AM5A 3QUTA 4J9MA 4YCXA 5J2AA 5ALZA 4F4XA 4YR0A 4NWIA 4OJLA 4DSFA 3TQ1A 7ICFA 5ALNA 4IL6U 2LYAA 2JZBB 1SKWA 5KFNA 2Q0ZX 2OXOA 4NM2A 3RTVA 4TURA 3HILA 3WU2U 1NKBA 3QYPA 4DF8A 2PXIA 3M7DA 4J9LA 2XICA 2CN1A 2BQ3A 2F3NA 4C4TA 1ZQPA 1BNPA 1ZQYA 1D8BA 5KFEA 1NI3A 4DQIA 8ICHA 5AI4A 1RXWA 2MAXA 1Z1VA 2P6RA 4O0IA 3BQ0A 1MQ2A 1LKYB 7ICOA 2LM1A 5L1LA 2HHTA 2YB1A 1Z3EB 1S97A 3L5KA 8ICXA 3RJKA 2KHQA 4P4PA 2IA6A 3SAHA 4ELTA 5AIBA 3RB0A 4IS7A 2BQUA 5AHXA 2FPMA 2E1EA 1Z1BA 4CGZA 5TISU 3MGHA 5EE0A 4US8A 4EELA 4ECUA 1N63A 3HKZF 1SL2A 4FS2A 1N60A 1TAMA 4NLCA 1UT5A 4R64A 3ETRA 5KFIA 1S0OA 2W54A 3WKBA 2W8LA 3H0LB 2HI0A 2XI9A 9ICSA 1DRGA 4EBDA 3C21A 4FBTA 2G06A 1U9LA 2FMQA 2QB0A 3IP4B 3B9JA 3TADC 2DFLA 2ZUCA 3V72A 1NOMA 5KFRA 5BPCA 4IQTA 3MFHA 5L1JA 4B6JA 1ZD2P 4IQUA 2OEHA 2VJ5A 5ALGA 5J2DA 5J0XA 5J2JA 1RYRA 4NLZA 1ZOLA 5J0WA 9ICPA 3AU2A 1ZJMA 3M8RA 2HVHA 3H4BA 2FMPA 4QZEA 1IXRA 2I1QA 4MEXA 2AH5A 4PGXA 8ICYA 4EEYA 5B5EU 5E79U 2W11A 1NK0A 4K4HA 3FM9A 2D6FC 2R8IA 2EH9A 4MF8A 3NS1A 1WWUA 2LYBA 4C8MA 4DEZA 3F5AA 3ONNA 2DPJA 3NVYA 5KG2A 3E0FA 4BX9C 4KLTA 3ZDDA 1HUZA 3AQFA 9ICIA 3WK6A 1KEJA 3EYZA 1RG6A 3QZ7A 5DDMA 2ZIWB 3Q8LA 3TFSA 3Q8QB 1GO3F 5KFLA 4J9SA 2H3FA 3BQTA 4NL9C 7ICQA 1SV0A 3MFIA 4RZRA 5L1IA 4Q45A 2W9CA 2AJQA 9ICVA 4GC7A 3QXGA 4YVZA 1HIWA 5DB9A 5C0YA 3I76A 3PSTA 4PHDA 2JGAA 2K4EA 4C7ZA 2LMRA 1KW4A 1L8OA 4DWIA 4AP9A 5J0OA 3JPRA 5KG1A 4EBCA 3KZXA 5CJ7A 2A1JA 3WKAA 2EANA 3F2BA 4O3PA 2RDJA 3TAPA 2A1JB 3BQ2A 2V4RA 4JK1A 3EUB2 5DQHA 4F2SA 4FS1A 4GFJA 4QWCA 3UXOA 4BWMA 4EX6A 8ICPA 8ICAA 4EEKA 1U48A 4I2IA 1V97A 2H3VA 3JPSA 5A0LA 3H40A 3DDHA 2A1AA 4DCCA 3H0MB 3AQEA 2IMWP 1X66A 3RH6A 4J03A 4QNLA 1ZQXA 5T14A 4PJ0U 2P6UA 5AKKA 1ECWA 4O9MA 9ICGA 4O3RA 2YMQA 3D6JA 4DL7A 1L3UA 2K4HA 3FDSA 1BPBA 1N61A 1JRPA 3M6KA 2VA2A 3RB6A 3C28A 2ZJ8A 2GO7A 2JH7A 2H3ZA 2RDIA 2Y1JA 2QB1A 4QZAA 3PMLA 3V7JA 2ISPA 1FFVA 1QQ6A 2EAMA 1K5OA 2HBKA 5KFMA 3MR3A 7ICRA 2IHNA 2AGPA 2KVCA 3PX4A 2PFPA 4IRCA 3NVWA 5HHHA 1CRXA 5CA7A 2YN4A 5AK3A 2XY7A 5KFKA 3CW2C 4ECQA 1D8LA 1F44A 5J8YA 2NYVA 8ICQA 1NZPA 2M0NA 2P35A 5KT3A 3GIKA 1ZQZA 4TUSA 4Z6DA 5KG4A 5AKHA 2E8NA 1WYGA 2WHEA 5AKYA 3M9MB 4FBUA 4YN4A 4NLNA 5ALFA 5HMLA 4C0ZA 2BR0A 3TKAA 4UAYA 2KTQA 4UASA 5KT6A 1B0XA 1N2XA 1FIQA 1BPDA 5CB1A 4J9PA 3U26A 4BXOB 2C28A 4ZOHC 2K4IA 2FLLA 3SV4A 1ZQ1C 5KNIA 1IIPA 1YZ7A 4G3IA 2XY6A 2AQ4A 3T5JA 2LM4A 1PVRA 2JMGA 1ZXIA 3PNCA 5DBBA 2BDUA 2KFZA 1M6YA 3PO5A 3UMCA 3MABA 3LWMA 4DL2A 1K1QA 2XIDA 5KL8B 3LVWA 4RQ6A 1WWVA 3QUBA 2J6UA 3RF9A 4P0QB 5KFVA 2IOFK 4C8KA 4LVSA 5ALDA 1BPXA 2R8GA 4RNMA 1TKDA 1D8YA 8ICVA 1L7PA 1DXSA 3NRWA 4PHPA 4ACOA 2KP7A 4DSIA 1ZQVA 4UB4A 4ECWA 4DS5A 3AU6A 3WK5A 1PVQA 3AUOA 4M9HA 2KK0A 1L3SA 4Y2JA 4GXKA 4KLQA 1SXEA 5J2IA 4RQ4A 4RPYA 2PKEA 1ZQOA 5K4LA 4Q43A 3I1YA 4C80A 5AKXA 3SAGA 3EPGA 2LI6A 4KN4A 3QX7A 4NY8A 1LKYA 3PR5B 1Z4OA 2F8LA 4MFFA 4KLLA 2DUYA 2M9NA 1QSLA 8ICLA 4FZLA 3ZD8A 4KLOA 1PK1A 2ZTEA 2H3IA 3IRUA 1T7PA 2KZZA 4DL3A 2KV2A 4FZMA 3MDAA 2BQRA 1VJ5A 5F3XB 4IC9A 1B43A 4P4OA 3ALRA 3QEBZ 1SWWA 3BQ7A 4MHVA 1S5LU 1F5SA 3V7LA 3K75D 1Q3UA 1SGGA 5IIJA 3PY8A 4OD0A 1ZQJA 4UB5A 1L3VA 2GWSA 5KAIU 5DG8A 1TV9A 8ICFA 3PO4A 3F5EA 4R65A 1N56A 3SR6A 1J2MA 1ZRNA 3DEEA 4Y2PA 2KJ5A 2XY5A 1XSPA 2YY6A 3NGDA 3JPQA 4DQQA 1ZQWA 1XC9A 1X9MA 2BPFA 5IIOA 8ICOA 2E3TA 5KT5A 4J9NA 9ICLA 1KKXA 4ED6A 1Z4NA 1QTMA 2HHWA 4F72A 4UBCA 3BQ1A 3RBDA 1KFTA 3V6HA 2MRLA 4EBEA 4OJ6A 4UB3A 2ASJA 4I2BA 4ECRA 1PZNA 3IDWA 2BKEA 2ZXIA 2QARB 4JV2A 2QKQA 2EDUA 4KMUA 1DK2A 1RYSA 3CRXA 4UAZA 4P0QA 3H8JA 4RPXA 3SENA 2W9CB 3TFRA 1Z19A 4KN7A 4F4KA 5J2GA 4UQGA 4R66A 4KLIA 3OTQA 3PR4A 4X5VA 8ICTA 2F8KA 1SWVA 3T79A 5AKZA 1NJXA 4AYBF 1S76D 1CI4A 4PH5A 2ALZA 1RM6C 2IOFA 4Q8EA 3WK9A 4PHEA 3AL0B 1BPEA 3KOOA 3N28A 4C8LA 2MSNA 5JRTA 2KJ8A 2VA3A 3GIJA 4NJ8A 4PGQA 9ICBA 1OW5A 5CR0A 1DGSA 3G6XA 2CXYA 2W9AA 4PL2A 2W03A 4P0PB 3BS5A 4KLEA 1JXEA 3QU5A 5ALOA 3RAQA 1YZ6A 3NVZA 2W9BA 4PHAA 2ZUDA 1KRPA 1B22A 3RRHA 2R18A 3ISDA 3V6KA 1ZQAA 4PPXA 4RT2A 2PFQA 2F1HA 7ICVA 1JMSA 3C2MA 3OPXA 3B0XA 4BJQA 4DFPA 4YP3A 3WK4A 2WB1C 4QZBA 3F53A 2LKYA 2DWQA 5CEHA 4O5EA 2RHFA 2I5HA 3H8SA 2LPEA 2WFAA 2JZBA 3RH5A 1ZRMA 3SAFA 5AICA 4P4MA 1Z00B 2ATLA 2C2DA 4WJ3B 4J9QA 3ZI4A 1SZPA 1ZQCA 4YG2A 3SMVA 3ETLA 1V38A 4C4SA 4RPZA 2DKXA 2NRZA 4OJOA 4QJFB 1ZQIA 7ICNA 4I2AA 1ZD4A 1UT8A 4DLEA 3JPPA 2W8KA 1K1SA 4ED3A 5CHGA 4J9KA 1U4BA 3VC8A 1N5XA 5J0YA 4QZFA 1SKRA 5KFGA 4ED2A 5ALIA 4EENA 5DBAA 4GIBA 2FPKA 3RB3A 3N7PD 7ICEA 4C7YA 4TQSA 9ICUA 2VANA 2WAQF 3OJSA 3GU3A 4M47A 2MA1A 2HCFA 3ZDCA 2F44A 2RRDA 2NRTA 1C20A 5J2KA 4IRKA 4Z6FA 5JTIA 2W3RA 5JU5A 1X40A 3NVVA 1S8OA 2HBJA 5GTIU 5KFXA 2W43A 2AXTU 2FDRA 3PW5A 5ALUA 8ICEA 8ICBA 2XVTA 3QZ8A 4DLGA 5AI6A 2DQNB 1Y88A 1Q3VA 1X9SA 2R8JA 2D8CA 3UQ2A 2E8MA 3C5FA 4QWBA 2KKVA 3GZFA 1RZTA 1JX4A 5IINA 1TFRA 4O5KA 4I2GA 3RR7A 3RH4A 1T4GA 2GH1A 4RQ0A 2ESEA 3TANA 5C5JA 3OHBA 2CPRA 4Y2TA 2AU0A 1PUZA 5EWFA 4HYKA 4O3SA 5KFBA 1XSNA 2IBKA 4NLKA 1ED1A 4MFCA 2BPCA 4IQWA 2VA8A 4PL1A 5EWEA 5J0TA 3MBYA 2LHTA 8ICCA 5AK5A 3RR8A 1NJZA 1WCLA 3A0HU 4Y2YA 2HOIA 1S10A 4EZ6A 4F5RA 3OSNA 2Z7JA 4CF4A 5KFQA 4EYIB 1HEKA 7ICIA 1N48A 3S6JA 4I27A 2NO4A 2JV3A 1NK6A 3Q8KA 2PI5A 5D46A 5J0RA 2ZXHA 1S0VA 1TK5A 9ICWA 2NV3A 5ALVA 5ALMA 3N7SC 5J2FA 4JMUA 3HT3A 1KDHA 4CNQA 2NRVA 5AI0A 1Q8KA 2JH1A 4B9UA 2ZUBA 3O0FA 5DB7A 3QU4A 4BWJA 1L8LA 4M9NA 3UXNA 2IOHA 1S0MA 5ALHA 4JB3A 3MDCA 5DGBA 5F9NA 4I2DA 1FEZA 1UA1A 4R8UA 1AQ6A 4ZH4A 1S0NA 1L6NA 5EOZA 4B9TA 3ICXA 4O3OA 4RQ7A 4DOBA 2BCVA 2MUTB 4KX5A 5F9LA 9ICOA 5DB8A 2KN7A 4DL4A 5D49A 4UB1A 2WTFA 2W9BB 5AM1A 3KHRA 4KITB 3JPOA 2ZIXA 1D9FA 1KFDA 5JUMA 2F76X 4ECYA 5KG6A 3N4MB 2W04A 4NV0A 2Q4TA 4UB6U 4ECXA 4QW9A 1N62A 1RPLA 4F8RA 2XC9A 1JXLA 3H8MA 3IV6A 2GLEA 2KIWA 4ELUA 2DF4B 4DQRA 3E58A 1X42A 4J9OA 2HMXA 2FLNA 3RJIA 3QUCA 5IILA 2EAOA 5ALKA 3KZIU 4Y2QA 1QSSA 4QZCA 3PW4A 5BOMA 3SYZA 1SL1A 4BDPA 4NLGA 2G09A 3V7KA 1ZQNA 2JEFA 1VLBA 1SKSA 2G5HB 2WF8A 3GDXA 4JV1A 3QU7A 5DQIA 3IHQB 1ZETA 5GTHU 1MA7A 1L7NA 1KSPA 4I2EA 3WKDA 3N7RC 2IHMA 3WK8A 3THVA 1SXDA 3NASA 2JEGA 3HRDD 2BCQA 3TARA 2QARA 2OWOA 4E0DA 4DFJA 2YMMA 3NRZA 2K8BB 4DOAA 1KL9A 5KT7A 3ZDEA 3N97B 4UW9A 3HJEA 4ECZA 5TZVA 2AHOB 3E2EA 3SD7A 1XU4A 4F92B 4C8OA 2RP5A 3MR6A 7ICGA 4UATA 4AYBC 5KFWA 2KSOA 4PZNA 5BOLA 5AK4A 1ZYQA 5J2EA 4CF5A 4JWNA 2BCSA 3GFKB 3AEVA 4DL6A 1ZQGA 2ZIUA 4DS4A 9ICKA 7ICUA 4O3MA 4YXMA 5DG7A 2YMLA 3OGUA 3CNHA 3PW0A 5AM4A 5J0UA 3GQCA 1QQ7A 5AM3A 4I2FA 3RFAA 1RDFA 9ICFA 4YMMA 5D4BA 2AGQA 1NK9A 5EE9A 4Q44A 3SV3A 4YMOA 5ALEA 4R8UB 3M1YA 4KMOB 3TACB 5ALRA 2BCUA 2ZTDA 3BZCA 2UVVA 2JRZA 4F5PA 2OCEA 1NNLA 2MUTA 1JI7A 4NXZA 4QZDA 1MN8A 1QH9A 1XWLA 2Y9UA 4OJ5A 2UVUA 3KFUF 4GXIA 1NK8A 3HKZC 3LDAA 3RJGA 1X2IA 4DSJA 1JALA 3ED5A 2HDOA 4TUQA 2FPLA 1XNSA 1TK0A 5ALTA 4I2CA 2KE7A 2ODGA 2KICA 3LVVA 1SZHA 4DSEA 3RJHA 2G5IB 3AM9A 3GV8B 1UA0A 3RB4A 4RNOA 7ICSA 1KFSA 1JUDA 4QZ9A 1PK3A 5KG5A 2DPIA 4IQVA 5L1KA 4M9JA 4IR9A 3WKCA 2QLTA 2R8HA 4FO6A 1S77D 1RYUA 4F5QA 4M2YA 2XGQA 3LYSA 2A3VA 2ZJAA 1A6SA 1QLNA 3IN5A 4QZ8A 1LVHA 1UHUA 2K8CB 3M9NB 2HHUA 1NKEA 1ZQSA 2FE9A 2KNJA 2HW3A 1NJWA 2KKPA 3FYHA 4QZHA 5KFTA 2BZFA 1UCVA 4TQRA 2H5XA 7ICLA 1U47A 1DK3A 4C8NA 3UMGA 3TADA 4YD1A 2RLTA 4PZOA 3QUQA 2HOQA 1V9PA 3A0BU 4FE3A 2KEYA 8ICUA 3T3FA 2K8AA 4RQNA 4B9VA 3HP6A 5AK6A 1ZQEA 2AGOA 4XA5A 3KBBA 4ECSA 2W55A 2EQYA 4F2RA 1YT3A 3G6VA 3QU9A 9ICTA 1RQNA 3EPIA 4O3QA 4QIWF 2D3DA 1WG8A 1ZQBA 1LB2B 4DFDA 4OCZA 2HHXA 1SL0A 1NKCA 2NO5A 2G0AA 5ALSA 2W7PA 5J2BA 3UXPA 4QZIA 2ZIUB 1Z00A 4FFDA 4F4YA 4DQSA 2H3QA 5DLFA 9ICAA 1L7OA 2KZ3A 3JPNA 5J29A 2Y0SF 5HR7A 2OYYA 1ZD3A 2Y9TA 4RQMA 1U49A 1KBUA 2HVIA 2ZIVB 3R9KA 5DG9A 2LBOA 2O6KA 1NK4A 3V6JA 1BPZA 3PV8A 3C2KA 3KHLA 5J0QA 4UAWA 1J2NA 2HBLA 4YR3A 3PVXA 2F1IA 5G5GA 4CE6A 1D9DA 2GOLA 5FP0A 4BGDA 5J0PA 3PX0A 1SB3C 4XUSA 4XQ8A 4LJXA 5AM0A 8ICKA 5KFAA 4DSLA 4UAUA 5DKWA 3HX0A 2Y0SC 4Z6EA 4RU9A 1ZQLA 2KSOB 2FLPA 2KJ9A 5ALXA 2K4PA 1J97A 2XGPA 1COKA 3TAQA 2V9WA 2ZIWA 3L3FX 2I6XA 5KT4A 4U7CA 1B4FA 4UAVA 2AQ0A 3KD3A 5AKGA 1L3TA 4I2HA 4NLBA 1RQLA 3OHAA 3OSPA 2YMPA 3ZDAA 2E1FA 5ALYA 4MFAA 1IG6A 3C2LA 2ZG6A 1X6JA 3ISCA 4Y2RA 3IG8A 1HUOA 5DLGA 1RXVA 4JWMA 9ICHA 1UQVA 3FC4A 3ZD9A 5IIIA 4HAIA 2R8KA 4F3OA 2PFNA 2YB4A 2BDPA 5KT2A 1T3NA 4K4GA 1N5WA 4RQ8A 4IR1A 9ICEA 8ICZA 1IM4A 3EWAA 4DFKA 5KG7A 3JPTA 4M6WB 2PFOA 4RUCA 5ALJA 5DGAA 5J0SA 4ED7A 3BS5B 4EX7A 1S9FA 2DKZA 3HW8A 5HNKA 1NK7A 4B9LA 5G5HA 4QWAA 4MF2A 2PMZC 1DGJA 1ZD5A 2EAPA 4I28A 5KAFU 3QNMA 1ZQKA 4I29A 4YD2A 3LWLA 2HHQA 1QCKA 8ICGA 3MR2A 2UVWA 5HHIA 4TUPA 2F2AB 3NUQA 3GIMA 4M9LA 5EWGA 4RUAA 4EYHB 1MSWD 4UB8U 4NL9A 5AIAA 1T8EA 4A8EA 4ECTA 3K1ZA 1BVSA 2L5YA 4R63A 4DO9A 5J2CA 1XSLA 3D2NA 4QW8A 5L1MA 5KFCA 1ZQTA 3SQIA 2MU2A 3PW2A 3D2SA 3UMBA 4UBBA 1ZQDA 5CP2A 5KG0A
chains in the Genus database with same CATH topology
5IILA 2BCRA 3C5GA 4UB2A 1ZQPA 3UPQA 1BNPA 4QZCA 3V7LA 5BOMA 5IIJA 8ICHA 4M9GA 4KLSA 1ZQJA 3V7KA 2P66A 1ZQNA 4UB5A 2GWSA 1MQ2A 1TV9A 3GDXA 7ICOA 8ICFA 8ICSA 4M0AA 4R65A 4I2EA 2IHMA 3PMNA 8ICXA 3RJKA 3B0YA 2BCQA 3RJEA 4DOCA 1ZQFA 3MGHA 1XSPA 3LK9A 4DOAA 3JPQA 4M04A 2BPFA 4LZDA 5IIOA 8ICOA 9ICLA 4R64A 5TZVA 1ZQRA 4UBCA 9ICSA 1BNOA 7ICGA 2FMQA 5BOLA 7ICPA 3V72A 5J2EA 5BPCA 4JWNA 4UB3A 4IQTA 4I2BA 2BCSA 9ICNA 1ZQGA 9ICKA 7ICUA 4IQUA 3OGUA 5J2DA 5J0XA 5J2JA 1DK2A 4NLZA 5J0WA 5J0UA 4UAZA 9ICPA 3AU2A 4I2FA 1ZJMA 9ICFA 4YMMA 5D4BA 4RPXA 2FMPA 4RQ5A 4QZEA 3RJFA 7ICHA 4RQ2A 4YMOA 3TFRA 5J2GA 4PGXA 8ICYA 4R66A 4K4HA 4KLIA 4X5VA 8ICTA 2BCUA 4MF8A 4F5PA 3RJJA 4PH5A 3UQ0A 4NXZA 4KLTA 4QZDA 1HUZA 4YMNA 4K4IA 9ICIA 1KEJA 4PHEA 1BPEA 4GXIA 3RJGA 3TFSA 1ZJNA 4TUQA 4I2CA 4KLHA 7ICQA 9ICBA 4PGQA 3RJHA 7ICSA 9ICVA 2ISOA 4QZ9A 4P2HA 9ICMA 5DB9A 4IQVA 4M9JA 4PHDA 4FO6A 4KLEA 4PHAA 4KLFA 4F5QA 4M2YA 3ISDA 4QZ8A 1ZQAA 4PPXA 4RT2A 5J0OA 2PFQA 3JPRA 7ICVA 1JMSA 3C2MA 4LZGA 3B0XA 8ICRA 1ZQSA 4QZBA 5DBCA 4F5NA 4O5EA 4QZHA 1MQ3A 2I9GA 7ICKA 1TVAA 3RH5A 7ICLA 7ICJA 3UXOA 8ICPA 1DK3A 8ICAA 4I2IA 2W9MA 4YD1A 3JPSA 1ZQCA 8ICNA 1BPYA 9ICCA 8ICUA 4RPZA 1ZQEA 4I2JA 4XA5A 1ZQIA 7ICNA 4I2AA 3RH6A 4RT3A 3JPPA 5CWRA 4O9MA 9ICGA 9ICTA 5J0YA 4QZFA 1ZQBA 5DBAA 7ICEA 9ICUA 4NM1A 4PGYA 1ZQMA 5J2BA 4M47A 3UXPA 4QZAA 3PMLA 9ICRA 4QZIA 4KLMA 3V7JA 5J2KA 2ISPA 4Z6FA 9ICAA 7ICRA 3JPNA 5J29A 2PFPA 8ICEA 8ICBA 5IIKA 1BPZA 8ICIA 5IIMA 3C2KA 5J0QA 5HHHA 1ZQHA 4UAWA 3MGIA 3UQ2A 3C5FA 4Z6CA 1RZTA 8ICQA 1NZPA 5J0PA 4XUSA 5J2HA 5IINA 7ICTA 4O5KA 2BPGA 4I2GA 4KLJA 8ICKA 3RH4A 4TUSA 5DKWA 3HX0A 4Z6DA 4RQ0A 4Z6EA 1ZQLA 4QZGA 4NLKA 1XSNA 4YN4A 4NLNA 4MFCA 4IQWA 5J0TA 8ICMA 3MBYA 7ICMA 4UAYA 8ICCA 8ICWA 1ZQQA 1BPDA 5CB1A 4KLUA 4I2HA 4F5RA 7ICIA 5DB6A 4I27A 5DDYA 5D46A 8ICJA 4MFAA 5J0RA 3PNCA 4KLGA 9ICWA 3C2LA 5DBBA 5J2FA 3ISCA 1KDHA 1HUOA 4JWMA 9ICHA 5IIIA 4KLDA 5DB7A 4RQ6A 4M9NA 3UXNA 2PFNA 9ICJA 4K4GA 4RQ8A 9ICEA 8ICZA 9ICQA 4LVSA 3MDCA 9ICXA 1BPXA 3JPTA 4I2DA 3HWTA 2PFOA 3ISBA 8ICVA 5J0SA 4RQ1A 3HW8A 4PHPA 2KP7A 5EOZA 4O5CA 4UB4A 4RQ7A 4DOBA 2BCVA 4MF2A 3AU6A 2FMSA 9ICOA 5DB8A 4RQ3A 4I28A 5D49A 1ZQKA 4I29A 4YD2A 4UB1A 3AUOA 4M9HA 4GXJA 8ICGA 4GXKA 4KLQA 5J2IA 4RQ4A 5HHIA 4RPYA 4F5OA 1ZQOA 4TUPA 3JPOA 4M9LA 4NY8A 4MFFA 4KLLA 4YCXA 5J2AA 8ICLA 4R63A 4DO9A 7ICFA 5J2CA 1XSLA 4KLOA 4NM2A 1ZQTA 4TURA 3MDAA 4UBBA 1ZQDA 3RJIA 2PXIA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5IIL A;  2BCR A;  3C5G A;  4UB2 A;  1ZQP A;  3UPQ A;  1BNP A;  4QZC A;  3V7L A;  5BOM A;  5IIJ A;  8ICH A;  4M9G A;  4KLS A;  1ZQJ A;  3V7K A;  2P66 A;  1ZQN A;  4UB5 A;  2GWS A;  1MQ2 A;  1TV9 A;  3GDX A;  7ICO A;  8ICF A;  8ICS A;  4M0A A;  4R65 A;  4I2E A;  2IHM A;  3PMN A;  8ICX A;  3RJK A;  3B0Y A;  2BCQ A;  3RJE A;  4DOC A;  1ZQF A;  3MGH A;  1XSP A;  3LK9 A;  4DOA A;  3JPQ A;  4M04 A;  2BPF A;  4LZD A;  5IIO A;  8ICO A;  9ICL A;  4R64 A;  5TZV A;  1ZQR A;  4UBC A;  9ICS A;  1BNO A;  7ICG A;  2FMQ A;  5BOL A;  7ICP A;  3V72 A;  5J2E A;  5BPC A;  4JWN A;  4UB3 A;  4IQT A;  4I2B A;  2BCS A;  9ICN A;  1ZQG A;  9ICK A;  7ICU A;  4IQU A;  3OGU A;  5J2D A;  5J0X A;  5J2J A;  1DK2 A;  4NLZ A;  5J0W A;  5J0U A;  4UAZ A;  9ICP A;  3AU2 A;  4I2F A;  1ZJM A;  9ICF A;  4YMM A;  5D4B A;  4RPX A;  2FMP A;  4RQ5 A;  4QZE A;  3RJF A;  7ICH A;  4RQ2 A;  4YMO A;  3TFR A;  5J2G A;  4PGX A;  8ICY A;  4R66 A;  4K4H A;  4KLI A;  4X5V A;  8ICT A;  2BCU A;  4MF8 A;  4F5P A;  3RJJ A;  4PH5 A;  3UQ0 A;  4NXZ A;  4KLT A;  4QZD A;  1HUZ A;  4YMN A;  4K4I A;  9ICI A;  1KEJ A;  4PHE A;  1BPE A;  4GXI A;  3RJG A;  3TFS A;  1ZJN A;  4TUQ A;  4I2C A;  4KLH A;  7ICQ A;  9ICB A;  4PGQ A;  3RJH A;  7ICS A;  9ICV A;  2ISO A;  4QZ9 A;  4P2H A;  9ICM A;  5DB9 A;  4IQV A;  4M9J A;  4PHD A;  4FO6 A;  4KLE A;  4PHA A;  4KLF A;  4F5Q A;  4M2Y A;  3ISD A;  4QZ8 A;  1ZQA A;  4PPX A;  4RT2 A;  5J0O A;  2PFQ A;  3JPR A;  7ICV A;  1JMS A;  3C2M A;  4LZG A;  3B0X A;  8ICR A;  1ZQS A;  4QZB A;  5DBC A;  4F5N A;  4O5E A;  4QZH A;  1MQ3 A;  2I9G A;  7ICK A;  1TVA A;  3RH5 A;  7ICL A;  7ICJ A;  3UXO A;  8ICP A;  1DK3 A;  8ICA A;  4I2I A;  2W9M A;  4YD1 A;  3JPS A;  1ZQC A;  8ICN A;  1BPY A;  9ICC A;  8ICU A;  4RPZ A;  1ZQE A;  4I2J A;  4XA5 A;  1ZQI A;  7ICN A;  4I2A A;  3RH6 A;  4RT3 A;  3JPP A;  5CWR A;  4O9M A;  9ICG A;  9ICT A;  5J0Y A;  4QZF A;  1ZQB A;  5DBA A;  7ICE A;  9ICU A;  4NM1 A;  4PGY A;  1ZQM A;  5J2B A;  4M47 A;  3UXP A;  4QZA A;  3PML A;  9ICR A;  4QZI A;  4KLM A;  3V7J A;  5J2K A;  2ISP A;  4Z6F A;  9ICA A;  7ICR A;  3JPN A;  5J29 A;  2PFP A;  8ICE A;  8ICB A;  5IIK A;  1BPZ A;  8ICI A;  5IIM A;  3C2K A;  5J0Q A;  5HHH A;  1ZQH A;  4UAW A;  3MGI A;  3UQ2 A;  3C5F A;  4Z6C A;  1RZT A;  8ICQ A;  1NZP A;  5J0P A;  4XUS A;  5J2H A;  5IIN A;  7ICT A;  4O5K A;  2BPG A;  4I2G A;  4KLJ A;  8ICK A;  3RH4 A;  4TUS A;  5DKW A;  3HX0 A;  4Z6D A;  4RQ0 A;  4Z6E A;  1ZQL A;  4QZG A;  4NLK A;  1XSN A;  4YN4 A;  4NLN A;  4MFC A;  4IQW A;  5J0T A;  8ICM A;  3MBY A;  7ICM A;  4UAY A;  8ICC A;  8ICW A;  1ZQQ A;  1BPD A;  5CB1 A;  4KLU A;  4I2H A;  4F5R A;  7ICI A;  5DB6 A;  4I27 A;  5DDY A;  5D46 A;  8ICJ A;  4MFA A;  5J0R A;  3PNC A;  4KLG A;  9ICW A;  3C2L A;  5DBB A;  5J2F A;  3ISC A;  1KDH A;  1HUO A;  4JWM A;  9ICH A;  5III A;  4KLD A;  5DB7 A;  4RQ6 A;  4M9N A;  3UXN A;  2PFN A;  9ICJ A;  4K4G A;  4RQ8 A;  9ICE A;  8ICZ A;  9ICQ A;  4LVS A;  3MDC A;  9ICX A;  1BPX A;  3JPT A;  4I2D A;  3HWT A;  2PFO A;  3ISB A;  8ICV A;  5J0S A;  4RQ1 A;  3HW8 A;  4PHP A;  2KP7 A;  5EOZ A;  4O5C A;  4UB4 A;  4RQ7 A;  4DOB A;  2BCV A;  4MF2 A;  3AU6 A;  2FMS A;  9ICO A;  5DB8 A;  4RQ3 A;  4I28 A;  5D49 A;  1ZQK A;  4I29 A;  4YD2 A;  4UB1 A;  3AUO A;  4M9H A;  4GXJ A;  8ICG A;  4GXK A;  4KLQ A;  5J2I A;  4RQ4 A;  5HHI A;  4RPY A;  4F5O A;  1ZQO A;  4TUP A;  3JPO A;  4M9L A;  4NY8 A;  4MFF A;  4KLL A;  4YCX A;  5J2A A;  8ICL A;  4R63 A;  4DO9 A;  7ICF A;  5J2C A;  1XSL A;  4KLO A;  4NM2 A;  1ZQT A;  4TUR A;  3MDA A;  4UBB A;  1ZQD A;  3RJI A;  2PXI A; 
#chains in the Genus database with same CATH topology
 4F93 B;  3EZ5 A;  2BCR A;  1JN3 A;  3C29 A;  3C5G A;  4UB2 A;  4Y2V A;  3UPQ A;  2G08 A;  3I28 A;  1A0P A;  5B66 U;  3KKA C;  5KFD A;  2WF7 A;  4M9G A;  4KLS A;  2KD1 A;  4Y2X A;  4ED0 A;  2ZIX B;  2P66 A;  3M8S A;  1KLN A;  5KTQ A;  1L7M A;  3L4P A;  1T94 A;  3CP8 A;  3GIL A;  8ICS A;  2KHV A;  4M0A A;  2N1R A;  2QB0 B;  4YQW A;  4US9 A;  3PMN A;  1SV0 C;  1UPH A;  3ZDB A;  3B0Y A;  2KOB A;  4QWD A;  3RJE A;  4DOC A;  3TI0 A;  1WUD A;  2OM6 A;  2RQ5 A;  4OJP A;  4DFM A;  4F71 A;  1A76 A;  1ZQF A;  1TK8 A;  3M9O B;  2VJ4 A;  3PX6 A;  5ALQ A;  3LK9 A;  2KFN A;  4M04 A;  4DF4 A;  4LZD A;  2OHF A;  2OH2 A;  2YQE A;  3RBE A;  4JV0 A;  5EE3 A;  1FFU A;  3QU2 A;  1ZQR A;  4YXJ A;  3RAX A;  3C1Y A;  1BNO A;  3DV9 A;  7ICP A;  3GII A;  4MEY A;  3VCB A;  2LYH A;  9ICN A;  2XO7 A;  2DBY A;  1TE2 A;  2KMD A;  3Q8R B;  5AKI A;  2FI1 A;  3SI8 A;  3BS7 A;  4G9B A;  4F4Z A;  3KKA A;  3K4G A;  5AI9 A;  2BHN A;  1ARO P;  4RQ5 A;  3RJF A;  7ICH A;  4RQ2 A;  2WF6 A;  5KFJ A;  4YR2 A;  3PSP A;  2ZTC A;  1KN5 A;  4U6P A;  1XO0 A;  1SV4 A;  4DL5 A;  5H2F U;  3WK7 A;  3WKE A;  3RJJ A;  2KZM A;  2B6G A;  3UQ0 A;  2NRX A;  1BGX T;  3AMZ A;  4YMN A;  4K4I A;  4CF3 A;  3T5L A;  1X6I A;  3T5H A;  2W7O A;  2DGZ A;  1ZJN A;  4USA A;  4F4W A;  4KLH A;  2VKQ A;  3AN1 A;  4DSK A;  2EZX A;  5KFH A;  2V4Q A;  4GC6 A;  3SEI A;  2B0C A;  5KFY A;  4P0P A;  2ISO A;  4P2H A;  9ICM A;  2VIX A;  2HHV A;  1VDV A;  2YX8 A;  1X9W A;  2E8P A;  4M6W A;  1H38 A;  3KHG A;  5KFS A;  3Q8P B;  1CUK A;  5KFP A;  3J81 j;  2J6S A;  4KLF A;  2A19 A;  1O03 A;  3T5K A;  5KFF A;  1V85 A;  3PZP A;  1NZB A;  5HMM A;  4LZG A;  2F77 X;  2G07 A;  8ICR A;  2JR5 A;  4ED8 A;  3IM1 A;  5DBC A;  3H0R B;  4QWE A;  4QIW C;  4F5N A;  1MQ3 A;  2I9G A;  3BDP A;  3H8W A;  3GV7 B;  1QQ5 A;  3PSF A;  7ICK A;  3NTU A;  5KFU A;  1TVA A;  7ICJ A;  1MC8 A;  1IV8 A;  1FO4 A;  2PI4 A;  2W9M A;  5AKE A;  4RNN A;  8ICN A;  2WAQ C;  3H7I A;  1BPY A;  9ICC A;  3KHH A;  3ORY A;  3KTQ A;  4I2J A;  3MC1 A;  3QE9 Y;  5AI5 A;  1O08 A;  3EW9 A;  4CCH A;  3HPO A;  4YFK A;  3IG5 A;  4RT3 A;  5CWR A;  4IRD A;  1WCN A;  2FJ6 A;  1XO1 A;  2ZJ5 A;  4KTQ A;  4ED1 A;  3C23 A;  3RRG A;  2KIV A;  2HBM A;  2W3S A;  1QSY A;  2K60 A;  1XS9 D;  1LV5 A;  4NM1 A;  4PGY A;  4B9S A;  1ZQM A;  1URJ A;  4DQP A;  4ICA A;  9ICR A;  5KL1 B;  2Y1I A;  5L9X A;  1OUQ A;  4KLM A;  1EXN A;  1COO A;  1F0M A;  1OXJ A;  5ALL A;  1L5U A;  4UAR A;  5KG3 A;  5IIK A;  8ICI A;  1TAQ A;  5IIM A;  4CDG A;  2WB1 F;  3MGV A;  2C2R A;  5DQG A;  1ZQH A;  1NJY A;  4Q8F A;  4O3N A;  3MGI A;  4BUG A;  2C22 A;  4J9R A;  4XRH A;  4Z6C A;  1Q46 A;  3QEA Z;  1NK5 A;  2ASL A;  1JIH A;  5EE1 A;  5J2H A;  7ICT A;  2K89 A;  2BPG A;  4KLJ A;  1SIJ A;  2HSZ A;  2E8O A;  1DOQ A;  2JEJ A;  2CRX A;  3PW7 A;  2XCA A;  5AI8 A;  4GLX A;  3D2Q A;  3F2D A;  3BZK A;  4QZG A;  3M6Z A;  1C7Y A;  4KX3 A;  2KVS A;  2PMZ F;  4C4R A;  4B9N A;  2ZIV A;  2F1J A;  8ICM A;  7ICM A;  8ICW A;  3UM9 A;  2E5S A;  5HP4 A;  4FZN A;  1ZQQ A;  2EZZ A;  4KLU A;  1KTQ A;  2WF5 A;  2DL0 A;  5AKJ A;  5DB6 A;  2YTU A;  2BGW A;  2NRW A;  2J6T A;  5DDY A;  3Q8M A;  1T3Q A;  5AM2 A;  1U45 A;  8ICJ A;  3GV5 B;  3F2C A;  4KLG A;  3H4D A;  2KG5 A;  4Y2S A;  5AKL A;  2JHD A;  5KFZ A;  2ES6 A;  1CEZ A;  2HHS A;  1ZQU A;  5HR6 A;  1PVP A;  4KLD A;  2UVR A;  3BJY A;  2XCP A;  3FAH A;  4JUZ A;  9ICJ A;  1P7D A;  5KFO A;  9ICQ A;  4EZ9 A;  9ICX A;  2B21 A;  3MR5 A;  1JRO A;  3HWT A;  3ISB A;  3Q8S B;  2C2E A;  1X9X A;  4RQ1 A;  2JEI A;  1PK1 B;  4Y2U A;  2HOF A;  4B9M A;  4BXO A;  4ECV A;  4O5C A;  2WF9 A;  4F50 A;  3C1Z A;  4ELV A;  2FMS A;  3PSI A;  1HJP A;  3CYM A;  4RQ3 A;  4F91 B;  4OO1 J;  5J8Y C;  3OJU A;  3K1R B;  5CRX A;  2ASD A;  4GXJ A;  2EZY A;  5ALP A;  4F5O A;  3SZ2 A;  3G6Y A;  1A77 A;  5ALW A;  1KQQ A;  1TAU A;  2JXJ A;  4CRX A;  5AM5 A;  3QUT A;  4J9M A;  4YCX A;  5J2A A;  5ALZ A;  4F4X A;  4YR0 A;  4NWI A;  4OJL A;  4DSF A;  3TQ1 A;  7ICF A;  5ALN A;  4IL6 U;  2LYA A;  2JZB B;  1SKW A;  5KFN A;  2Q0Z X;  2OXO A;  4NM2 A;  3RTV A;  4TUR A;  3HIL A;  3WU2 U;  1NKB A;  3QYP A;  4DF8 A;  2PXI A;  3M7D A;  4J9L A;  2XIC A;  2CN1 A;  2BQ3 A;  2F3N A;  4C4T A;  1ZQP A;  1BNP A;  1ZQY A;  1D8B A;  5KFE A;  1NI3 A;  4DQI A;  8ICH A;  5AI4 A;  1RXW A;  2MAX A;  1Z1V A;  2P6R A;  4O0I A;  3BQ0 A;  1MQ2 A;  1LKY B;  7ICO A;  2LM1 A;  5L1L A;  2HHT A;  2YB1 A;  1Z3E B;  1S97 A;  3L5K A;  8ICX A;  3RJK A;  2KHQ A;  4P4P A;  2IA6 A;  3SAH A;  4ELT A;  5AIB A;  3RB0 A;  4IS7 A;  2BQU A;  5AHX A;  2FPM A;  2E1E A;  1Z1B A;  4CGZ A;  5TIS U;  3MGH A;  5EE0 A;  4US8 A;  4EEL A;  4ECU A;  1N63 A;  3HKZ F;  1SL2 A;  4FS2 A;  1N60 A;  1TAM A;  4NLC A;  1UT5 A;  4R64 A;  3ETR A;  5KFI A;  1S0O A;  2W54 A;  3WKB A;  2W8L A;  3H0L B;  2HI0 A;  2XI9 A;  9ICS A;  1DRG A;  4EBD A;  3C21 A;  4FBT A;  2G06 A;  1U9L A;  2FMQ A;  2QB0 A;  3IP4 B;  3B9J A;  3TAD C;  2DFL A;  2ZUC A;  3V72 A;  1NOM A;  5KFR A;  5BPC A;  4IQT A;  3MFH A;  5L1J A;  4B6J A;  1ZD2 P;  4IQU A;  2OEH A;  2VJ5 A;  5ALG A;  5J2D A;  5J0X A;  5J2J A;  1RYR A;  4NLZ A;  1ZOL A;  5J0W A;  9ICP A;  3AU2 A;  1ZJM A;  3M8R A;  2HVH A;  3H4B A;  2FMP A;  4QZE A;  1IXR A;  2I1Q A;  4MEX A;  2AH5 A;  4PGX A;  8ICY A;  4EEY A;  5B5E U;  5E79 U;  2W11 A;  1NK0 A;  4K4H A;  3FM9 A;  2D6F C;  2R8I A;  2EH9 A;  4MF8 A;  3NS1 A;  1WWU A;  2LYB A;  4C8M A;  4DEZ A;  3F5A A;  3ONN A;  2DPJ A;  3NVY A;  5KG2 A;  3E0F A;  4BX9 C;  4KLT A;  3ZDD A;  1HUZ A;  3AQF A;  9ICI A;  3WK6 A;  1KEJ A;  3EYZ A;  1RG6 A;  3QZ7 A;  5DDM A;  2ZIW B;  3Q8L A;  3TFS A;  3Q8Q B;  1GO3 F;  5KFL A;  4J9S A;  2H3F A;  3BQT A;  4NL9 C;  7ICQ A;  1SV0 A;  3MFI A;  4RZR A;  5L1I A;  4Q45 A;  2W9C A;  2AJQ A;  9ICV A;  4GC7 A;  3QXG A;  4YVZ A;  1HIW A;  5DB9 A;  5C0Y A;  3I76 A;  3PST A;  4PHD A;  2JGA A;  2K4E A;  4C7Z A;  2LMR A;  1KW4 A;  1L8O A;  4DWI A;  4AP9 A;  5J0O A;  3JPR A;  5KG1 A;  4EBC A;  3KZX A;  5CJ7 A;  2A1J A;  3WKA A;  2EAN A;  3F2B A;  4O3P A;  2RDJ A;  3TAP A;  2A1J B;  3BQ2 A;  2V4R A;  4JK1 A;  3EUB 2;  5DQH A;  4F2S A;  4FS1 A;  4GFJ A;  4QWC A;  3UXO A;  4BWM A;  4EX6 A;  8ICP A;  8ICA A;  4EEK A;  1U48 A;  4I2I A;  1V97 A;  2H3V A;  3JPS A;  5A0L A;  3H40 A;  3DDH A;  2A1A A;  4DCC A;  3H0M B;  3AQE A;  2IMW P;  1X66 A;  3RH6 A;  4J03 A;  4QNL A;  1ZQX A;  5T14 A;  4PJ0 U;  2P6U A;  5AKK A;  1ECW A;  4O9M A;  9ICG A;  4O3R A;  2YMQ A;  3D6J A;  4DL7 A;  1L3U A;  2K4H A;  3FDS A;  1BPB A;  1N61 A;  1JRP A;  3M6K A;  2VA2 A;  3RB6 A;  3C28 A;  2ZJ8 A;  2GO7 A;  2JH7 A;  2H3Z A;  2RDI A;  2Y1J A;  2QB1 A;  4QZA A;  3PML A;  3V7J A;  2ISP A;  1FFV A;  1QQ6 A;  2EAM A;  1K5O A;  2HBK A;  5KFM A;  3MR3 A;  7ICR A;  2IHN A;  2AGP A;  2KVC A;  3PX4 A;  2PFP A;  4IRC A;  3NVW A;  5HHH A;  1CRX A;  5CA7 A;  2YN4 A;  5AK3 A;  2XY7 A;  5KFK A;  3CW2 C;  4ECQ A;  1D8L A;  1F44 A;  5J8Y A;  2NYV A;  8ICQ A;  1NZP A;  2M0N A;  2P35 A;  5KT3 A;  3GIK A;  1ZQZ A;  4TUS A;  4Z6D A;  5KG4 A;  5AKH A;  2E8N A;  1WYG A;  2WHE A;  5AKY A;  3M9M B;  4FBU A;  4YN4 A;  4NLN A;  5ALF A;  5HML A;  4C0Z A;  2BR0 A;  3TKA A;  4UAY A;  2KTQ A;  4UAS A;  5KT6 A;  1B0X A;  1N2X A;  1FIQ A;  1BPD A;  5CB1 A;  4J9P A;  3U26 A;  4BXO B;  2C28 A;  4ZOH C;  2K4I A;  2FLL A;  3SV4 A;  1ZQ1 C;  5KNI A;  1IIP A;  1YZ7 A;  4G3I A;  2XY6 A;  2AQ4 A;  3T5J A;  2LM4 A;  1PVR A;  2JMG A;  1ZXI A;  3PNC A;  5DBB A;  2BDU A;  2KFZ A;  1M6Y A;  3PO5 A;  3UMC A;  3MAB A;  3LWM A;  4DL2 A;  1K1Q A;  2XID A;  5KL8 B;  3LVW A;  4RQ6 A;  1WWV A;  3QUB A;  2J6U A;  3RF9 A;  4P0Q B;  5KFV A;  2IOF K;  4C8K A;  4LVS A;  5ALD A;  1BPX A;  2R8G A;  4RNM A;  1TKD A;  1D8Y A;  8ICV A;  1L7P A;  1DXS A;  3NRW A;  4PHP A;  4ACO A;  2KP7 A;  4DSI A;  1ZQV A;  4UB4 A;  4ECW A;  4DS5 A;  3AU6 A;  3WK5 A;  1PVQ A;  3AUO A;  4M9H A;  2KK0 A;  1L3S A;  4Y2J A;  4GXK A;  4KLQ A;  1SXE A;  5J2I A;  4RQ4 A;  4RPY A;  2PKE A;  1ZQO A;  5K4L A;  4Q43 A;  3I1Y A;  4C80 A;  5AKX A;  3SAG A;  3EPG A;  2LI6 A;  4KN4 A;  3QX7 A;  4NY8 A;  1LKY A;  3PR5 B;  1Z4O A;  2F8L A;  4MFF A;  4KLL A;  2DUY A;  2M9N A;  1QSL A;  8ICL A;  4FZL A;  3ZD8 A;  4KLO A;  1PK1 A;  2ZTE A;  2H3I A;  3IRU A;  1T7P A;  2KZZ A;  4DL3 A;  2KV2 A;  4FZM A;  3MDA A;  2BQR A;  1VJ5 A;  5F3X B;  4IC9 A;  1B43 A;  4P4O A;  3ALR A;  3QEB Z;  1SWW A;  3BQ7 A;  4MHV A;  1S5L U;  1F5S A;  3V7L A;  3K75 D;  1Q3U A;  1SGG A;  5IIJ A;  3PY8 A;  4OD0 A;  1ZQJ A;  4UB5 A;  1L3V A;  2GWS A;  5KAI U;  5DG8 A;  1TV9 A;  8ICF A;  3PO4 A;  3F5E A;  4R65 A;  1N56 A;  3SR6 A;  1J2M A;  1ZRN A;  3DEE A;  4Y2P A;  2KJ5 A;  2XY5 A;  1XSP A;  2YY6 A;  3NGD A;  3JPQ A;  4DQQ A;  1ZQW A;  1XC9 A;  1X9M A;  2BPF A;  5IIO A;  8ICO A;  2E3T A;  5KT5 A;  4J9N A;  9ICL A;  1KKX A;  4ED6 A;  1Z4N A;  1QTM A;  2HHW A;  4F72 A;  4UBC A;  3BQ1 A;  3RBD A;  1KFT A;  3V6H A;  2MRL A;  4EBE A;  4OJ6 A;  4UB3 A;  2ASJ A;  4I2B A;  4ECR A;  1PZN A;  3IDW A;  2BKE A;  2ZXI A;  2QAR B;  4JV2 A;  2QKQ A;  2EDU A;  4KMU A;  1DK2 A;  1RYS A;  3CRX A;  4UAZ A;  4P0Q A;  3H8J A;  4RPX A;  3SEN A;  2W9C B;  3TFR A;  1Z19 A;  4KN7 A;  4F4K A;  5J2G A;  4UQG A;  4R66 A;  4KLI A;  3OTQ A;  3PR4 A;  4X5V A;  8ICT A;  2F8K A;  1SWV A;  3T79 A;  5AKZ A;  1NJX A;  4AYB F;  1S76 D;  1CI4 A;  4PH5 A;  2ALZ A;  1RM6 C;  2IOF A;  4Q8E A;  3WK9 A;  4PHE A;  3AL0 B;  1BPE A;  3KOO A;  3N28 A;  4C8L A;  2MSN A;  5JRT A;  2KJ8 A;  2VA3 A;  3GIJ A;  4NJ8 A;  4PGQ A;  9ICB A;  1OW5 A;  5CR0 A;  1DGS A;  3G6X A;  2CXY A;  2W9A A;  4PL2 A;  2W03 A;  4P0P B;  3BS5 A;  4KLE A;  1JXE A;  3QU5 A;  5ALO A;  3RAQ A;  1YZ6 A;  3NVZ A;  2W9B A;  4PHA A;  2ZUD A;  1KRP A;  1B22 A;  3RRH A;  2R18 A;  3ISD A;  3V6K A;  1ZQA A;  4PPX A;  4RT2 A;  2PFQ A;  2F1H A;  7ICV A;  1JMS A;  3C2M A;  3OPX A;  3B0X A;  4BJQ A;  4DFP A;  4YP3 A;  3WK4 A;  2WB1 C;  4QZB A;  3F53 A;  2LKY A;  2DWQ A;  5CEH A;  4O5E A;  2RHF A;  2I5H A;  3H8S A;  2LPE A;  2WFA A;  2JZB A;  3RH5 A;  1ZRM A;  3SAF A;  5AIC A;  4P4M A;  1Z00 B;  2ATL A;  2C2D A;  4WJ3 B;  4J9Q A;  3ZI4 A;  1SZP A;  1ZQC A;  4YG2 A;  3SMV A;  3ETL A;  1V38 A;  4C4S A;  4RPZ A;  2DKX A;  2NRZ A;  4OJO A;  4QJF B;  1ZQI A;  7ICN A;  4I2A A;  1ZD4 A;  1UT8 A;  4DLE A;  3JPP A;  2W8K A;  1K1S A;  4ED3 A;  5CHG A;  4J9K A;  1U4B A;  3VC8 A;  1N5X A;  5J0Y A;  4QZF A;  1SKR A;  5KFG A;  4ED2 A;  5ALI A;  4EEN A;  5DBA A;  4GIB A;  2FPK A;  3RB3 A;  3N7P D;  7ICE A;  4C7Y A;  4TQS A;  9ICU A;  2VAN A;  2WAQ F;  3OJS A;  3GU3 A;  4M47 A;  2MA1 A;  2HCF A;  3ZDC A;  2F44 A;  2RRD A;  2NRT A;  1C20 A;  5J2K A;  4IRK A;  4Z6F A;  5JTI A;  2W3R A;  5JU5 A;  1X40 A;  3NVV A;  1S8O A;  2HBJ A;  5GTI U;  5KFX A;  2W43 A;  2AXT U;  2FDR A;  3PW5 A;  5ALU A;  8ICE A;  8ICB A;  2XVT A;  3QZ8 A;  4DLG A;  5AI6 A;  2DQN B;  1Y88 A;  1Q3V A;  1X9S A;  2R8J A;  2D8C A;  3UQ2 A;  2E8M A;  3C5F A;  4QWB A;  2KKV A;  3GZF A;  1RZT A;  1JX4 A;  5IIN A;  1TFR A;  4O5K A;  4I2G A;  3RR7 A;  3RH4 A;  1T4G A;  2GH1 A;  4RQ0 A;  2ESE A;  3TAN A;  5C5J A;  3OHB A;  2CPR A;  4Y2T A;  2AU0 A;  1PUZ A;  5EWF A;  4HYK A;  4O3S A;  5KFB A;  1XSN A;  2IBK A;  4NLK A;  1ED1 A;  4MFC A;  2BPC A;  4IQW A;  2VA8 A;  4PL1 A;  5EWE A;  5J0T A;  3MBY A;  2LHT A;  8ICC A;  5AK5 A;  3RR8 A;  1NJZ A;  1WCL A;  3A0H U;  4Y2Y A;  2HOI A;  1S10 A;  4EZ6 A;  4F5R A;  3OSN A;  2Z7J A;  4CF4 A;  5KFQ A;  4EYI B;  1HEK A;  7ICI A;  1N48 A;  3S6J A;  4I27 A;  2NO4 A;  2JV3 A;  1NK6 A;  3Q8K A;  2PI5 A;  5D46 A;  5J0R A;  2ZXH A;  1S0V A;  1TK5 A;  9ICW A;  2NV3 A;  5ALV A;  5ALM A;  3N7S C;  5J2F A;  4JMU A;  3HT3 A;  1KDH A;  4CNQ A;  2NRV A;  5AI0 A;  1Q8K A;  2JH1 A;  4B9U A;  2ZUB A;  3O0F A;  5DB7 A;  3QU4 A;  4BWJ A;  1L8L A;  4M9N A;  3UXN A;  2IOH A;  1S0M A;  5ALH A;  4JB3 A;  3MDC A;  5DGB A;  5F9N A;  4I2D A;  1FEZ A;  1UA1 A;  4R8U A;  1AQ6 A;  4ZH4 A;  1S0N A;  1L6N A;  5EOZ A;  4B9T A;  3ICX A;  4O3O A;  4RQ7 A;  4DOB A;  2BCV A;  2MUT B;  4KX5 A;  5F9L A;  9ICO A;  5DB8 A;  2KN7 A;  4DL4 A;  5D49 A;  4UB1 A;  2WTF A;  2W9B B;  5AM1 A;  3KHR A;  4KIT B;  3JPO A;  2ZIX A;  1D9F A;  1KFD A;  5JUM A;  2F76 X;  4ECY A;  5KG6 A;  3N4M B;  2W04 A;  4NV0 A;  2Q4T A;  4UB6 U;  4ECX A;  4QW9 A;  1N62 A;  1RPL A;  4F8R A;  2XC9 A;  1JXL A;  3H8M A;  3IV6 A;  2GLE A;  2KIW A;  4ELU A;  2DF4 B;  4DQR A;  3E58 A;  1X42 A;  4J9O A;  2HMX A;  2FLN A;  3RJI A;  3QUC A;  5IIL A;  2EAO A;  5ALK A;  3KZI U;  4Y2Q A;  1QSS A;  4QZC A;  3PW4 A;  5BOM A;  3SYZ A;  1SL1 A;  4BDP A;  4NLG A;  2G09 A;  3V7K A;  1ZQN A;  2JEF A;  1VLB A;  1SKS A;  2G5H B;  2WF8 A;  3GDX A;  4JV1 A;  3QU7 A;  5DQI A;  3IHQ B;  1ZET A;  5GTH U;  1MA7 A;  1L7N A;  1KSP A;  4I2E A;  3WKD A;  3N7R C;  2IHM A;  3WK8 A;  3THV A;  1SXD A;  3NAS A;  2JEG A;  3HRD D;  2BCQ A;  3TAR A;  2QAR A;  2OWO A;  4E0D A;  4DFJ A;  2YMM A;  3NRZ A;  2K8B B;  4DOA A;  1KL9 A;  5KT7 A;  3ZDE A;  3N97 B;  4UW9 A;  3HJE A;  4ECZ A;  5TZV A;  2AHO B;  3E2E A;  3SD7 A;  1XU4 A;  4F92 B;  4C8O A;  2RP5 A;  3MR6 A;  7ICG A;  4UAT A;  4AYB C;  5KFW A;  2KSO A;  4PZN A;  5BOL A;  5AK4 A;  1ZYQ A;  5J2E A;  4CF5 A;  4JWN A;  2BCS A;  3GFK B;  3AEV A;  4DL6 A;  1ZQG A;  2ZIU A;  4DS4 A;  9ICK A;  7ICU A;  4O3M A;  4YXM A;  5DG7 A;  2YML A;  3OGU A;  3CNH A;  3PW0 A;  5AM4 A;  5J0U A;  3GQC A;  1QQ7 A;  5AM3 A;  4I2F A;  3RFA A;  1RDF A;  9ICF A;  4YMM A;  5D4B A;  2AGQ A;  1NK9 A;  5EE9 A;  4Q44 A;  3SV3 A;  4YMO A;  5ALE A;  4R8U B;  3M1Y A;  4KMO B;  3TAC B;  5ALR A;  2BCU A;  2ZTD A;  3BZC A;  2UVV A;  2JRZ A;  4F5P A;  2OCE A;  1NNL A;  2MUT A;  1JI7 A;  4NXZ A;  4QZD A;  1MN8 A;  1QH9 A;  1XWL A;  2Y9U A;  4OJ5 A;  2UVU A;  3KFU F;  4GXI A;  1NK8 A;  3HKZ C;  3LDA A;  3RJG A;  1X2I A;  4DSJ A;  1JAL A;  3ED5 A;  2HDO A;  4TUQ A;  2FPL A;  1XNS A;  1TK0 A;  5ALT A;  4I2C A;  2KE7 A;  2ODG A;  2KIC A;  3LVV A;  1SZH A;  4DSE A;  3RJH A;  2G5I B;  3AM9 A;  3GV8 B;  1UA0 A;  3RB4 A;  4RNO A;  7ICS A;  1KFS A;  1JUD A;  4QZ9 A;  1PK3 A;  5KG5 A;  2DPI A;  4IQV A;  5L1K A;  4M9J A;  4IR9 A;  3WKC A;  2QLT A;  2R8H A;  4FO6 A;  1S77 D;  1RYU A;  4F5Q A;  4M2Y A;  2XGQ A;  3LYS A;  2A3V A;  2ZJA A;  1A6S A;  1QLN A;  3IN5 A;  4QZ8 A;  1LVH A;  1UHU A;  2K8C B;  3M9N B;  2HHU A;  1NKE A;  1ZQS A;  2FE9 A;  2KNJ A;  2HW3 A;  1NJW A;  2KKP A;  3FYH A;  4QZH A;  5KFT A;  2BZF A;  1UCV A;  4TQR A;  2H5X A;  7ICL A;  1U47 A;  1DK3 A;  4C8N A;  3UMG A;  3TAD A;  4YD1 A;  2RLT A;  4PZO A;  3QUQ A;  2HOQ A;  1V9P A;  3A0B U;  4FE3 A;  2KEY A;  8ICU A;  3T3F A;  2K8A A;  4RQN A;  4B9V A;  3HP6 A;  5AK6 A;  1ZQE A;  2AGO A;  4XA5 A;  3KBB A;  4ECS A;  2W55 A;  2EQY A;  4F2R A;  1YT3 A;  3G6V A;  3QU9 A;  9ICT A;  1RQN A;  3EPI A;  4O3Q A;  4QIW F;  2D3D A;  1WG8 A;  1ZQB A;  1LB2 B;  4DFD A;  4OCZ A;  2HHX A;  1SL0 A;  1NKC A;  2NO5 A;  2G0A A;  5ALS A;  2W7P A;  5J2B A;  3UXP A;  4QZI A;  2ZIU B;  1Z00 A;  4FFD A;  4F4Y A;  4DQS A;  2H3Q A;  5DLF A;  9ICA A;  1L7O A;  2KZ3 A;  3JPN A;  5J29 A;  2Y0S F;  5HR7 A;  2OYY A;  1ZD3 A;  2Y9T A;  4RQM A;  1U49 A;  1KBU A;  2HVI A;  2ZIV B;  3R9K A;  5DG9 A;  2LBO A;  2O6K A;  1NK4 A;  3V6J A;  1BPZ A;  3PV8 A;  3C2K A;  3KHL A;  5J0Q A;  4UAW A;  1J2N A;  2HBL A;  4YR3 A;  3PVX A;  2F1I A;  5G5G A;  4CE6 A;  1D9D A;  2GOL A;  5FP0 A;  4BGD A;  5J0P A;  3PX0 A;  1SB3 C;  4XUS A;  4XQ8 A;  4LJX A;  5AM0 A;  8ICK A;  5KFA A;  4DSL A;  4UAU A;  5DKW A;  3HX0 A;  2Y0S C;  4Z6E A;  4RU9 A;  1ZQL A;  2KSO B;  2FLP A;  2KJ9 A;  5ALX A;  2K4P A;  1J97 A;  2XGP A;  1COK A;  3TAQ A;  2V9W A;  2ZIW A;  3L3F X;  2I6X A;  5KT4 A;  4U7C A;  1B4F A;  4UAV A;  2AQ0 A;  3KD3 A;  5AKG A;  1L3T A;  4I2H A;  4NLB A;  1RQL A;  3OHA A;  3OSP A;  2YMP A;  3ZDA A;  2E1F A;  5ALY A;  4MFA A;  1IG6 A;  3C2L A;  2ZG6 A;  1X6J A;  3ISC A;  4Y2R A;  3IG8 A;  1HUO A;  5DLG A;  1RXV A;  4JWM A;  9ICH A;  1UQV A;  3FC4 A;  3ZD9 A;  5III A;  4HAI A;  2R8K A;  4F3O A;  2PFN A;  2YB4 A;  2BDP A;  5KT2 A;  1T3N A;  4K4G A;  1N5W A;  4RQ8 A;  4IR1 A;  9ICE A;  8ICZ A;  1IM4 A;  3EWA A;  4DFK A;  5KG7 A;  3JPT A;  4M6W B;  2PFO A;  4RUC A;  5ALJ A;  5DGA A;  5J0S A;  4ED7 A;  3BS5 B;  4EX7 A;  1S9F A;  2DKZ A;  3HW8 A;  5HNK A;  1NK7 A;  4B9L A;  5G5H A;  4QWA A;  4MF2 A;  2PMZ C;  1DGJ A;  1ZD5 A;  2EAP A;  4I28 A;  5KAF U;  3QNM A;  1ZQK A;  4I29 A;  4YD2 A;  3LWL A;  2HHQ A;  1QCK A;  8ICG A;  3MR2 A;  2UVW A;  5HHI A;  4TUP A;  2F2A B;  3NUQ A;  3GIM A;  4M9L A;  5EWG A;  4RUA A;  4EYH B;  1MSW D;  4UB8 U;  4NL9 A;  5AIA A;  1T8E A;  4A8E A;  4ECT A;  3K1Z A;  1BVS A;  2L5Y A;  4R63 A;  4DO9 A;  5J2C A;  1XSL A;  3D2N A;  4QW8 A;  5L1M A;  5KFC A;  1ZQT A;  3SQI A;  2MU2 A;  3PW2 A;  3D2S A;  3UMB A;  4UBB A;  1ZQD A;  5CP2 A;  5KG0 A; 
#chains in the Genus database with same CATH homology
 5IIL A;  2BCR A;  3C5G A;  4UB2 A;  1ZQP A;  3UPQ A;  1BNP A;  4QZC A;  3V7L A;  5BOM A;  5IIJ A;  8ICH A;  4M9G A;  4KLS A;  1ZQJ A;  3V7K A;  2P66 A;  1ZQN A;  4UB5 A;  2GWS A;  1MQ2 A;  1TV9 A;  3GDX A;  7ICO A;  8ICF A;  8ICS A;  4M0A A;  4R65 A;  4I2E A;  2IHM A;  3PMN A;  8ICX A;  3RJK A;  3B0Y A;  2BCQ A;  3RJE A;  4DOC A;  1ZQF A;  3MGH A;  1XSP A;  3LK9 A;  4DOA A;  3JPQ A;  4M04 A;  2BPF A;  4LZD A;  5IIO A;  8ICO A;  9ICL A;  4R64 A;  5TZV A;  1ZQR A;  4UBC A;  9ICS A;  1BNO A;  7ICG A;  2FMQ A;  5BOL A;  7ICP A;  3V72 A;  5J2E A;  5BPC A;  4JWN A;  4UB3 A;  4IQT A;  4I2B A;  2BCS A;  9ICN A;  1ZQG A;  9ICK A;  7ICU A;  4IQU A;  3OGU A;  5J2D A;  5J0X A;  5J2J A;  1DK2 A;  4NLZ A;  5J0W A;  5J0U A;  4UAZ A;  9ICP A;  3AU2 A;  4I2F A;  1ZJM A;  9ICF A;  4YMM A;  5D4B A;  4RPX A;  2FMP A;  4RQ5 A;  4QZE A;  3RJF A;  7ICH A;  4RQ2 A;  4YMO A;  3TFR A;  5J2G A;  4PGX A;  8ICY A;  4R66 A;  4K4H A;  4KLI A;  4X5V A;  8ICT A;  2BCU A;  4MF8 A;  4F5P A;  3RJJ A;  4PH5 A;  3UQ0 A;  4NXZ A;  4KLT A;  4QZD A;  1HUZ A;  4YMN A;  4K4I A;  9ICI A;  1KEJ A;  4PHE A;  1BPE A;  4GXI A;  3RJG A;  3TFS A;  1ZJN A;  4TUQ A;  4I2C A;  4KLH A;  7ICQ A;  9ICB A;  4PGQ A;  3RJH A;  7ICS A;  9ICV A;  2ISO A;  4QZ9 A;  4P2H A;  9ICM A;  5DB9 A;  4IQV A;  4M9J A;  4PHD A;  4FO6 A;  4KLE A;  4PHA A;  4KLF A;  4F5Q A;  4M2Y A;  3ISD A;  4QZ8 A;  1ZQA A;  4PPX A;  4RT2 A;  5J0O A;  2PFQ A;  3JPR A;  7ICV A;  1JMS A;  3C2M A;  4LZG A;  3B0X A;  8ICR A;  1ZQS A;  4QZB A;  5DBC A;  4F5N A;  4O5E A;  4QZH A;  1MQ3 A;  2I9G A;  7ICK A;  1TVA A;  3RH5 A;  7ICL A;  7ICJ A;  3UXO A;  8ICP A;  1DK3 A;  8ICA A;  4I2I A;  2W9M A;  4YD1 A;  3JPS A;  1ZQC A;  8ICN A;  1BPY A;  9ICC A;  8ICU A;  4RPZ A;  1ZQE A;  4I2J A;  4XA5 A;  1ZQI A;  7ICN A;  4I2A A;  3RH6 A;  4RT3 A;  3JPP A;  5CWR A;  4O9M A;  9ICG A;  9ICT A;  5J0Y A;  4QZF A;  1ZQB A;  5DBA A;  7ICE A;  9ICU A;  4NM1 A;  4PGY A;  1ZQM A;  5J2B A;  4M47 A;  3UXP A;  4QZA A;  3PML A;  9ICR A;  4QZI A;  4KLM A;  3V7J A;  5J2K A;  2ISP A;  4Z6F A;  9ICA A;  7ICR A;  3JPN A;  5J29 A;  2PFP A;  8ICE A;  8ICB A;  5IIK A;  1BPZ A;  8ICI A;  5IIM A;  3C2K A;  5J0Q A;  5HHH A;  1ZQH A;  4UAW A;  3MGI A;  3UQ2 A;  3C5F A;  4Z6C A;  1RZT A;  8ICQ A;  1NZP A;  5J0P A;  4XUS A;  5J2H A;  5IIN A;  7ICT A;  4O5K A;  2BPG A;  4I2G A;  4KLJ A;  8ICK A;  3RH4 A;  4TUS A;  5DKW A;  3HX0 A;  4Z6D A;  4RQ0 A;  4Z6E A;  1ZQL A;  4QZG A;  4NLK A;  1XSN A;  4YN4 A;  4NLN A;  4MFC A;  4IQW A;  5J0T A;  8ICM A;  3MBY A;  7ICM A;  4UAY A;  8ICC A;  8ICW A;  1ZQQ A;  1BPD A;  5CB1 A;  4KLU A;  4I2H A;  4F5R A;  7ICI A;  5DB6 A;  4I27 A;  5DDY A;  5D46 A;  8ICJ A;  4MFA A;  5J0R A;  3PNC A;  4KLG A;  9ICW A;  3C2L A;  5DBB A;  5J2F A;  3ISC A;  1KDH A;  1HUO A;  4JWM A;  9ICH A;  5III A;  4KLD A;  5DB7 A;  4RQ6 A;  4M9N A;  3UXN A;  2PFN A;  9ICJ A;  4K4G A;  4RQ8 A;  9ICE A;  8ICZ A;  9ICQ A;  4LVS A;  3MDC A;  9ICX A;  1BPX A;  3JPT A;  4I2D A;  3HWT A;  2PFO A;  3ISB A;  8ICV A;  5J0S A;  4RQ1 A;  3HW8 A;  4PHP A;  2KP7 A;  5EOZ A;  4O5C A;  4UB4 A;  4RQ7 A;  4DOB A;  2BCV A;  4MF2 A;  3AU6 A;  2FMS A;  9ICO A;  5DB8 A;  4RQ3 A;  4I28 A;  5D49 A;  1ZQK A;  4I29 A;  4YD2 A;  4UB1 A;  3AUO A;  4M9H A;  4GXJ A;  8ICG A;  4GXK A;  4KLQ A;  5J2I A;  4RQ4 A;  5HHI A;  4RPY A;  4F5O A;  1ZQO A;  4TUP A;  3JPO A;  4M9L A;  4NY8 A;  4MFF A;  4KLL A;  4YCX A;  5J2A A;  8ICL A;  4R63 A;  4DO9 A;  7ICF A;  5J2C A;  1XSL A;  4KLO A;  4NM2 A;  1ZQT A;  4TUR A;  3MDA A;  4UBB A;  1ZQD A;  3RJI A;  2PXI A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...