3L5KA

The crystal structure of human haloacid dehalogenase-like hydrolase domain containing 1a (hdhd1a)
Total Genus 75
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
75
sequence length
233
structure length
233
Chain Sequence
LYFQSMAAPPQPVTHLIFDMDGLLLDTERLYSVVFQEICNRYDKKYSWDVKSLVMGKKALEAAQIIIDVLQLPMSKEELVEESQTKLKEVFPTAALMPGAEKLIIHLRKHGIPFALATSSRSASFDMKTSRHKEFFSLFSHIVLGDDPEVQHGKPDPDIFLACAKRFSPPPAMEKCLVFEDAPNGVEAALAAGMQVVMVPDGNLSRDLTTKATLVLNSLQDFQPELFGLPSYE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords Haloacid dehalogenase-like hydrolase domain-containing prote
publication title The crystal structure of human Haloacid Dehalogenase-like Hydrolase Domain containing 1A (HDHD1A)
rcsb
source organism Homo sapiens
total genus 75
structure length 233
sequence length 233
ec nomenclature ec 3.1.3.96: Pseudouridine 5'-phosphatase.
pdb deposition date 2009-12-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13419 HAD_2 Haloacid dehalogenase-like hydrolase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.240 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 Putative phosphatase; domain 2 3l5kA02
3.40.50.1000 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold HAD superfamily/HAD-like 3l5kA01
4CF4A 3GYGA 1K1EA 3N8GA 1LTQA 4HGOA 5ALRA 4IFTA 2WM8A 4UM7A 5AIBA 3W5AA 1N8NA 2WF8A 5AW9A 2RB5A 1L8OA 1RKUA 2ZBDA 5AW6A 3W5DA 3L7YA 3WGUA 3ZI4A 3ESQA 3ZVLA 2B8EA 2YJ4A 3AR3A 3ZWKA 5AKLA 5AVUA 1QH9A 4YCNA 5AW7A 3ZVNA 2YJ3A 1T5SA 2EAUA 2BDUA 4BX3A 4ZEWA 4Y2SA 3TLMA 1Z4QA 3DAOA 2OBBA 4XE5A 4FYPA 5AK6A 4XOUA 1RKVA 4DCCA 3UM9A 3BA6A 2WHEA 1F5SA 2C8KA 3N1UA 2FDRA 3S6JA 4CF5A 3SKXA 1Z5UA 3L8FA 3E84A 3L0YA 2O9JA 4KNVA 3J7TA 3QUQA 4BEVA 3NIWA 2X4DA 5AW3A 1QQ6A 5AM2A 4YCMA 4O8CA 3NALA 1TJ4A 2GMWA 4QJBA 3W5CA 1Z4KA 4Y2XA 1T9ZA 3UMGA 2OA0A 3M1YA 4YCLA 2P27A 3BWVA 4OHFA 4C4SA 5ALYA 5ALHA 5ALNA 3IJ5A 2GHQA 2WFAA 3I1YA 3QUTA 4JB3A 4UW9A 5AW0A 2WF7A 2R8YA 2C88A 4OFZA 2G08A 2CFTA 5AI8A 5AICA 4AS3A 4DWOA 1Z4JA 2NO4A 3QX7A 2R8EA 1L7MA 2YMLA 1Z4IA 3QUBA 2I54A 5ALFA 2CFSA 5AKEA 2AMYA 4Y2YA 2NYVA 3WK7A 3P96A 4EENA 3R4CA 5AKHA 2CFRA 1U02A 2PKEA 3QU7A 4CNQA 2YY6A 3QNMA 1WVIA 1NNLA 3AR9A 4DW8A 4YIKA 2FUCA 5AVXA 3MN1A 5AKKA 1Z4PX 4EX7A 5AHXA 4NABA 3WKBA 2QLTA 1ZJJA 2GFHA 2YMPA 1U7PA 3QGMA 2ZBGA 3L8HA 5AVZA 1S2OA 5AM4A 3SMVA 2YN4A 2HHLA 3MMZA 3OCWA 4OCZA 5ALUA 2RAVA 5ALWA 5ALTA 2ODAA 4BNDA 1SU4A 1YS9A 3PCTA 3E8MA 3FZQA 4NAVA 1L7NA 3L5KA 1VJ5A 4CE6A 4HAIA 1RQNA 2C4NA 3OCVA 3QU4A 4L6CA 3U7FB 4UU1A 4FE3A 3A1EA 1EK1A 3CZ4A 2GHTA 5AI0A 5ALVA 4Y2QA 2Q4RA 2YJ5A 2B30A 3AR2A 2I6XA 2FPUA 4YH1A 2EARA 4NV0A 2HOQA 3ONNA 4UATA 4XPZA 1O03A 3SLRA 4YGYA 4KX5A 1S8OA 3QXGA 3ET4A 3F9RA 3N07A 4Y3UA 4MUMA 2G09A 2YJ6A 4KNWA 5A3QA 4C4RA 2MU1A 3ED5A 2G1AA 1YDFA 5AIAA 2R8ZA 4GXTA 2Q5EA 5AKXA 4AP9A 1ZOLA 1ZD5A 4Y2JA 1J8DA 3QUCA 3ZUPA 2ZG6A 5AVVA 2RARA 2D2VA 2HSZA 2IOHA 2OYCA 1Q91A 4Y2VA 5IT0A 5AK4A 1FEZA 3VAYA 2W4MA 4NFLA 5AVWA 5AVTA 1MH9A 3EPRA 5AI4A 4EZEA 1L7OA 5ALXA 4UMEA 4BX2A 3U26A 5IT4A 3WGVA 3OCYA 2JARA 2O2XA 2Q4TA 4G9BA 4YIHA 5AI9A 3N5KA 2NO5A 1ZD4A 3M9LA 3L0BA 1Z4NA 2YBDA 2FPWA 2FPSA 5AW2A 1RLOA 3ET5A 3EF1A 3ZVMA 4NWIA 1TA0A 3QLEA 1SWVA 5T41A 5AVRA 1WR8A 5AKJA 4KYTA 1QQ7A 2ZBEA 2FPXA 4BBJA 3MC1A 3QU2A 3I6BA 5ALLA 2HF7A 3ZWDA 2I34A 3FPSA 3AR8A 2JGAA 5AK3A 3RFUA 2HO4A 1Z88A 3A1CA 1RPZA 2WF5A 2HDOA 1LVHA 2JAWA 5JJBA 4GIBA 4BKMA 3L1UA 3OPXA 4JDPA 4IG4A 3SF0A 4BEWA 5ALZA 3OTQA 3KBBA 2ZOSA 3FPBA 2BY4A 1Z5GA 5ALIA 3B8EA 2DQSA 3EWIA 3WKAA 2IOFK 3E58A 4BNDB 1ZRNA 2PQ0A 3WKDA 1SWWA 3WK9A 4UAVA 5AVYA 2G06A 2P69A 1RMYA 2HF2A 1YV9A 2BDEA 2I7DA 3AR5A 3KOOA 5ALSA 2RBKA 5A3RA 4Y2TA 1NF2A 1RLTA 1U7OA 1ZD2P 4BYGA 1VFPA 2G0AA 2R8XA 5AK5A 1AQ6A 4UARA 5AM1A 2W11A 3NAMA 1IWOA 4I9FA 1X42A 5AKZA 2WF9A 5AI5A 1L7PA 3B9RA 5ALDA 2WF6A 5IS2A 2YMQA 3L8GA 1Z4OA 2GO7A 5ALQA 4F71A 1L8LA 3PDWA 2HCFA 1RDFA 1RLMA 4CF3A 3DV9A 4DFDA 1WPGA 3PGVA 5AW8A 3ZU6A 2FI1A 2IA5A 1XP5A 5E0OA 4EELA 1RC8A 3D6JA 2G80A 1VJRA 4L6AA 4J03A 3QYPA 3SD7A 1RKQA 1CQZA 1TJ3A 2VKQA 2B1RA 5AI6A 1N9KA 3NUQA 4Y2UA 2YFYA 1ZS9A 3HLTA 5AM3A 3OCUA 4HGNA 3SHQA 3B9BA 3KDPA 5AVSA 4UAUA 1XPJA 2I55A 2B0CA 1ZRMA 5ALJA 1Z4LA 2MU2A 1O08A 3UMBA 3WK5A 1TE2A 1WZCA 1YNSA 4Y2RA 2C8LA 1Y8AA 4EX6A 2FPRA 3FM9A 4UASA 2AH5A 3A1DA 4UMDA 2JAOA 3I76A 2I33A 3ZTWA 3RF6A 4EEKA 1EK2A 1XVIA 1ZD3A 1KYTA 5AKYA 2PR7A 4Y2PA 2AUTA 3KD3A 1NRWA 3UMCA 4F72A 3QU9A 2AGVA 5AW5A 3U7GA 3EF0A 2CN1A 1CR6A 2QYHA 1Q92A 4HGQA 1JUDA 1RRCA 5ALGA 3U7EB 1RMTA 4B6JA 4XQ0A 4E88A 3ZX4A 4H1WA 3IB6A 4HYTA 5ALEA 2ZBFA 3U19A 4I9GA 3FVVA 3W5BA 5ALKA 3L0CA 3IRUA 4FFDA 3MPOA 1U2SA 1YJ5A 4QQFA 3ZW7A 4BX0A 3AR7A 4RETA 3I28A 3WK6A 4ZEXA 1Z4MA 3N28A 2P9JA 3KC2A 5AKIA 3CNHA 3WK8A 3L1VA 3QU5A 3E81A 4AS2A 4OD0A 1J97A 2HI0A 5FP0A 3NRJA 3R09A 2C9MA 3A3YA 5ALOA 4HGPA 4KN8A 4HGRA 3AR4A 3R9KA 2MSNA 5AVQA 2FUEA 4UM5A 3SKYA 5A3SA 4PNHA 2G07A 2ZXEA 3L8EA 3WKCA 3FGOA 1U2TA 3K1ZA 1RQLA 2B82A 5AESA 4J2TA 2IOFA 2IYEA 3ZTYA 3OCZA 1YMQA 2JAUA 3ZX5A 2B1QA 2YMMA 2P11A 1QYIA 5AM0A 2HX1A 4RESA 4C4TA 4UU0A 5AM5A 4UMFA 4L57A 1PW5A 2EATA 2FEAA 5AKGA 5AW1A 1TJ5A 2OM6A 1RMQA 3AR6A 5ALPA 3WK4A 3NANA 4KX3A 4UMVA 4MWOA 3PGLA 4G63A 3WKEA 3HYCA 3U13A 3DDHA 1L6RA 2B8JA 3OCXA 3U7HB 1QQ5A 3DNPA 1T5TA 4ZEVA 3ESRA 3NASA 3KZXA 5ALMA 5AW4A 2HEGA 2W43A
chains in the Genus database with same CATH superfamily
4URYR 1Z5VA 3N8GA 4D25A 4PLCA 4KLNA 3GI1A 3AVOA 5D1HA 2C5LA 4DLVA 4DL9A 4YB8A 2I1WA 3TIGA 3BCRA 3CX4A 1P1CA 1WB4A 2NU6A 2W6PA 3AF3A 2KMDA 1CS0A 4PRKA 2JHGA 3FVRA 4U5QA 4A1OA 3UVEA 1UJBA 4MWCA 2R66A 4E3WA 5CMLA 2BR0A 4YAUA 4K9PA 4E51A 4MMYB 2EX1A 5FHRA 2PWYA 4AMZA 2DAPA 1X80B 2JEIA 2GJAA 4IYRA 3RRMA 2GUGA 1GCOA 1DQSA 4XYMA 1ODIA 4EYIB 2HCRA 1OUMA 1EGVB 4ZQBA 4AKSA 1IVNA 2ADOA 1L8AA 3DE5X 4E5DA 1X9HA 4OQZA 5IAEA 4DEXA 1XP8A 1JJAA 4B3CA 1ABFA 2H5XA 4MKIA 1BS1A 5JC8A 3RAPR 3R7SA 4CKCA 5DLFA 3G0CA 5BP7A 1ZQCA 1X1TA 1VYHA 4CF6A 4JGIA 1NY6A 3K31A 3VU0A 1E9EA 1VG1A 1XZBA 5J0YA 3OHBA 3WXBA 4MQ4A 5FPPA 4RVDA 3BWXA 3MRXA 4XUCA 2NAFA 2G4LA 1KQPA 5M34A 3A6JA 3EZLA 3ITDA 3OU2A 3WLRA 1E1LA 2QX4A 5A9SB 4KWHA 4KX5A 4F3TA 3HYNA 1D2GA 5C51B 1YACA 3VTAA 1PFQA 4PZ9A 1SAYA 4WK0B 4GECA 4WV3A 5CX1A 2DERA 7ICRA 2IYQA 5DHQA 4IS2A 3IPLA 1RJGA 1KO8A 1LLFA 2IOHA 1XZNA 4RNOA 3VAYA 4PX3A 1MH9A 1MVOA 5J47A 3H97A 2A86A 1M2VA 3L0BA 3PJFA 2AQ8A 5EZSA 4XSHA 3IDWA 5F21A 2PE5A 7ICJA 2HQOA 4FHCA 3W6OA 9ICVA 1RPZA 1PUIA 1UT5A 2OO7A 3VPDA 4WBNF 5ISMA 4H35A 2EDUA 5JLJA 2XT6A 4LGMA 1IATA 4JJAA 2FN7A 3WWPA 2CKDA 1CDEA 3BQ2A 1Z75A 1GJRA 1XQ1A 1BAPA 8ICZA 4JA0A 5A3RA 1TCCA 1RLTA 4D02A 4TQSA 2W37A 2GAIA 1HEKA 1IEVA 1NMYA 2G5GX 1Y3CE 1ZESA 2O3TA 4XRRA 1GSIA 2NZXA 4BX9C 2WNHA 4KW7A 5EMLA 3GIMA 5TGTA 5KYGA 4KWIA 2CV2A 1QGDA 2XCQA 2I6GA 1I13A 3M6MD 5A9RA 3DR5A 4DQUA 3WWEA 2B0CA 2IHUA 1KFSA 3D6HA 2ZRMA 2XY4A 2B1GA 3ZXSA 4CTKA 3GA7A 4X92A 1JLRA 2IC5A 1UODA 4E1BA 1M8GA 1U98A 4EO9A 1H4TA 3OOSA 4ZT7A 5K6AA 3UK1A 3P26A 3JQFA 3IBCA 3TD2A 5JJKA 4C08A 4F5QA 3UCEA 1XNQB 4WXEA 4E88A 4MIEA 2ZIGA 3GRZA 221PA 1ZQUA 4GLFA 3LWZA 4U3JA 1XMQB 4S04A 2H16A 1FDTA 2QB0A 4V1CB 1EWTA 1YC5A 3RB8A 3GUUA 4Z0PA 4EJFA 2HLDD 1OYYA 2NU9B 3RVOA 4AUKA 5HQJA 5AESA 1ECBA 3UFBA 4ZDKA 4MUAA 2WJHA 1II9A 1E64A 3FZGA 1W87A 1RQXA 4OA8A 2HHXA 3X1YA 3MD9A 2SECE 2PJZA 2HWXA 4O2BB 1KK1A 4KL8S 4N9QA 1E6KA 2VOEA 4WEQA 4FUTA 2XYVA 1LCIA 1E6WA 4URZR 2TMYA 1ZQHA 3O21A 3C4JA 4DM4A 2AN9A 3LQ4A 1QH9A 1CZUA 2JC3A 4RIFA 3BMCB 2BDUA 5IKEA 4Y2SA 4LXGA 1UQRA 3OOJA 3P9YA 3GZNB 1I2ZA 1FTNA 1X7YA 1TVCA 4Q39A 2OYYA 1V2GA 4CBVA 4YVZA 2REXB 3H6HA 4ZV7A 5AM2A 2W42A 3AL0C 4R6XA 1UC5B 2R25B 4WACA 1U3UA 2G9ZA 3OQ6A 4ESVA 2GVZC 3MGCA 1TJNA 2WU3A 2B5WA 3QPDA 5HR6A 4M9QA 1SD2A 1HOXA 5HJ2A 2IEZA 3EJWA 4IQWA 1DVRA 4RVCA 3WMEA 2X8WA 4OKSA 3JPWA 4TXJA 1FVFA 4J7CA 4ER7A 3A4NA 5HSGA 4C8NA 2GF0A 3Q1LA 2XUZA 5DU2A 1JIXA 2QUJA 2ZULA 1T34A 2JHDA 5CXXA 3A9SA 2G3YA 2DUMA 1X1BA 3DCYA 2AG5A 3M81A 2AOWA 3QWFA 5KG7A 2ZWMA 3ZDDA 5JPDA 3RRXA 4XRGA 2LDXA 3HDVA 4A8JB 3CUTA 2Y0EA 1NG9A 5HBGA 3OQ1A 5F5XA 3KU1A 4OBBA 2WAQF 5K2OA 3TADC 5ER6A 1HDGO 2JCYA 4LS3A 1LA2A 5ICCA 3I72A 2R8ZA 5FQNA 4R68A 1N9GA 3TM5A 1P9NA 3JASB 5AUNB 3SDBA 5CFMA 1ZD5A 3SYRA 5JS8A 2XXBA 1RYZA 1FFYA 5AOCA 3RLFA 2Y66A 1J2EA 3IPYA 1U80A 1JQ3A 1J24A 2RONA 4WFJA 2AQKA 4YBZA 1C2YA 1GTJ1 1T29A 5JADA 1I3LA 3ME5A 2SKDA 5KSYA 5IT4A 2OG1A 1HQYE 1H3EA 2ZRFA 3ZQUA 4G0PA 4GU5A 2VL7A 5J4YA 1C8VB 1P0PA 5KFCA 3GP5A 2R8JA 3VGPA 2YVLA 4DM7A 2R1VA 3AHFA 5F73A 3VKHA 1RNLA 1SG9A 4JC4A 4LZAA 4JBYA 1IY0A 1JSLA 3EPKA 1XVLA 1J0CA 1IAVA 2WD8A 1ZK0A 2G40A 3BQ0A 3OF3A 2CL5A 4A0GA 3F6PA 4EEYA 3VNBA 1UJCA 1GNTA 2Y1EA 4TUPA 5LBTA 2XTZA 2WUFA 2GZ3A 2X3FA 1ECGA 3HACA 3K9CA 3DFZA 2HMTA 1QIHA 1LFDB 1C30A 1I6MA 4IJKA 3LTEA 4Q37A 4M9JA 4I55B 3RK4A 4I4IA 5MGNA 4P3YA 2XUAA 2G67A 3OM8A 1XT6A 3LWNA 2AFRA 1B43A 2RHCA 2BQUA 1SKQA 3NKFA 3DGEC 4CL2A 4OP2A 1ZS9A 4B80A 3MAAC 3G8YA 3P2MA 4DN6A 2AH5A 3G2MA 4B5LA 5C37A 2PRZA 3ISTA 1JMVA 5KG0A 5DI9A 3NAGA 3Q0TA 4ESOA 1SL0A 2V9ZA 1OW5A 2RH5A 2QD1A 3EXAA 3BIOA 4O2AB 3ORRA 3G3EA 5DW0A 5IF3A 1UC9A 5A0TA 2CNLA 5GIOE 4E33A 3CPEA 2FA9A 4M9RA 3GXOA 1VLVA 3NHSA 1N3LA 3MXTA 4O1HA 1Z4MA 2AF4C 5C34B 2R68A 2P9QA 2BR3A 3RYIB 5IZ4A 1OA1A 4JUZA 1T6YA 4WOCA 1ONOA 4TM8A 4S24A 4EJMA 5LDGA 2AFIE 3IXLA 4I2NA 3C74A 2HX1A 1U2RA 2NQTA 3ESAA 3OH8A 1DTWA 2Y76A 4RKYA 1L7XA 3AB3A 4RF4A 1I94B 5LM3A 2C2MA 1N7GA 4KXMA 1NVVR 4PINA 4CUKA 4QRDA 3O95A 2NSJA 4DCGA 1YR3A 4RJJA 2XEDA 4LZOA 3V7WA 3AUKA 3I2IA 3TQFA 3QQ5A 4EVIA 3O7MA 3WA6A 1OFUX 3L7LA 3PUXA 3ZS9A 2FMQA 3WB2A 1Q3KA 2FHPA 1OLSB 3MWGA 2HK8A 1O89A 1GQOA 4Z54A 4GM1A 1JYEA 4KLEA 1LLUA 3QUQA 3KLBA 4US2R 1IG0A 1JIVA 2WWWA 3L4EA 1LDMA 1CY2A 4LOHA 3GGGA 3RH6A 5B58T 4NENB 2G9UA 2J48A 4FXPA 4BASA 1NJYA 4PFQA 1G21A 2DFNA 8ICYA 4TMWA 5IW8A 5L3SB 2BUBA 1YXMA 1VLJA 5JFTA 4B74A 2OH2A 1UBRS 5EUBA 2OBNA 1AGNA 1KP3A 5H4GA 8MHTA 2INGX 2AR0A 1L5YA 3LBHA 4HUJA 5KFKA 5ECGC 1K5HA 3K0FB 3BQMB 5DBOA 4O5CA 1EP2B 4GKJB 5FYQA 2BFFA 4WVFA 3EYWA 4IUYA 2QTFA 3J81A 3OJFA 1BXGA 1VJGA 3EEFA 3KHGA 3VZCA 1YD7A 3ROZA 3GCWA 2EYUA 3W1WA 2I80A 4Z9XA 1V3TA 2RHDA 3VR4D 4ER6A 5ALWA 1TYEB 2NSHA 2HADA 3L05A 5JOQA 2GNAA 2QTBA 3SOZA 4CE6A 3RD5A 1U0GA 2BFNA 3NYRA 2CXOA 2O4UX 1S4MA 2KN7A 4Q3EA 3CZQA 1XKQA 2YWFA 1K3UB 4HR7A 2X6QA 1W2GA 3VNUA 3DOUA 4P4TA 1K3TA 5DYYA 3VR6A 4AFNA 5ELMA 3RT1A 1UHUA 4A0SA 3C3DA 4A16A 2WTNA 5LC1A 5LQUA 5DE3A 2W6ZA 3F5EA 2UZ0A 1JKFA 1IIBA 1ESDA 4QNLA 4RK0A 2IYRA 1FQJA 3W04A 4V24A 3ZCRA 4CQMB 5D2CA 5AO9A 4Q0MA 1T2CA 3OE1A 1Z4NA 3C8UA 3B6JA 3NCTA 4P98A 2HA3A 2QQFA 2PL3A 2AW5A 1W34A 3I3SR 1PBTA 4D57A 2ISQA 2PGOA 5HZMA 4M8IA 2IPNA 4GS5A 1KY2A 4FFRA 1P17A 2DL0A 5J23A 1L3UA 1TTQB 2AHOB 3BRWA 4NBWA 1SWWA 3ONWA 3A7DA 4QUKA 5CH5A 3DDNA 2Z5VA 3HWRA 1YI1A 3U1TA 4TLBA 3HCBA 1WDMA 1RWNA 3R7WB 2P5UA 1Q15A 2ZRQA 1JTEA 1RYHA 1ZCFA 2IFTA 2VRCA 1B6SA 3WLAA 1QIFA 5A1JA 1N1DA 5L4NA 3PQDA 4KFUA 2CJWB 5KVQA 1WXXA 1GUBA 2FXVA 3HY6A 2XKAA 2PANA 4L8YA 1JE0A 3R7BA 5HZHA 4FZNA 3VSEA 4D9NA 4LCEA 2HU8A 1P4AA 5IAJA 3UPTA 3NGXA 3ORQA 3HP7A 4MPRA 3I05A 4ECQA 4B45A 4H7JA 2V9WA 1EHIA 3A6KA 2BFDB 4O2RA 7ICQA 4CUJA 4BMZA 3OT5A 1WCYA 3DFFA 1ADJA 3IUQA 1V6SA 5EA2A 4XLTA 3QBVA 4JB2A 4HVTA 4WQMA 3F6SA 3OEEA 4BWGA 1PK1B 3HDTA 5JSKA 4ZO8A 2PMFA 4AMUA 3T9FA 1EG7A 3IEPA 2RC6A 5A1TA 1U4NA 3TMKA 4ER5A 3OD5A 5DGXA 3AL2A 3N2ZB 1TAHA 3EFHA 3ZV5A 2FFRA 1U8EA 1SIOA 3PTZA 4EA7A 1TKRA 3OLCX 2EAMA 1B8VA 4Z7NB 3TI9A 4IILA 3TW8A 3PEFA 1VIAA 3N74A 5EJ5A 3T7TA 1M10A 5C46F 1SVNA 4BXOA 1YZLA 2ILTA 1PKXA 1RYUA 5JDIC 3MOGA 4XB2A 2WJYA 4JU9A 4DIOA 2PRJA 3EFBA 1VRWA 4FWTA 3EVBA 3AJRA 5CJ7A 3S29A 1UMCA 3JD4A 3FTEA 1V5GA 1PNTA 4PYMA 4N48A 1TT5A 3BHJA 2E2WA 3SNKA 3FW1A 4IBOA 1U49A 3V7KA 5ED4A 3GJ3A 3CF4A 2KB0A 3SC2A 1MRNA 1NVUQ 3UA3A 8OHMA 5L53A 4JP8A 4K1XA 2AJDA 3TSAA 5LJLA 1TEVA 2KLHA 4C4SA 2QY9A 8ICKA 4UPVA 2J9XB 4BOYA 4MUGA 5EP4A 3WRYA 3KTQA 3KZVA 1UPCA 1MJ5A 1JH9A 1NOMA 1ZN7A 4C0SA 1S7CA 2R6CA 3DMFA 4CM4A 3MGHA 1XS9D 2GGSA 2WBLC 2AXTU 1VL6A 3O8RA 1YA6A 5LKAA 4B43A 4MV1A 1MDFA 5IT9A 1USKA 5A62A 2N42A 2CK3A 1UOEA 2OHVA 1MA3A 2J4FA 3W5UA 1L7RA 3PLNA 2HHLA 2YZ7A 2FJ6A 1A2BA 1X8KA 3W7BA 2ZUVA 3CUKA 3PWKA 2AMFA 1Y7PA 3DL4A 3WQHA 3SMQA 2VPWA 5I45A 4RIEA 2VWPA 1IXRA 2GN9A 4ADSG 2R7AA 4CEHA 1GTL1 5DGDA 4UCWA 4S12A 2PBFA 2GZSA 4CCHA 4CKBB 2IK8A 2FPKA 5E0KB 1D2MA 3HWSA 3FI9A 3T99A 3T5CA 4LHEA 4PR0A 2W00A 1HT1E 1VI5A 3EZ2A 1Y7HA 1SKYB 3E7PA 5FLKA 4GMKA 5FLXA 2CNWA 1VC2A 2IDJA 3WYEA 4WN3A 2VPIA 5KKNB 3DZDA 1U7HA 1IWBB 1GLVA 3P1JA 3M6IA 4U9HS 4E6PA 5KFZA 1GAJA 1PWXA 2JH3A 4Y8VA 1DCKA 3H2YA 4PRLA 4P3XA 1HYBA 5CIWA 3DBLA 3ROGA 1MIOA 3ORYA 1TMKA 3WX0A 3ZCSA 4R5MA 4BMOB 3FG9A 4J9RA 2NO6A 3FE2A 3KKMA 2H5EA 3MJCA 4ZEMA 1R0KA 1R8JA 4FGKA 3LF2A 4N18A 4COOA 2AZMA 3KQTA 5SZKB 2GBPA 2AGQA 3X0DA 1T2FA 1MO2A 3PDWA 2YC4C 4LQLA 5CLHA 4ZCMA 3RAQA 3LBIA 3NTXA 1EQAA 1ZP6A 4NE9A 2IEBA 2B1RA 1GNQA 5GJWC 4LHZA 2MMCA 3DDCA 2O50A 4C1NA 4PPXA 4EIWA 5C0YA 2I55A 3P71T 3M4NA 4J9UE 2VNKA 1TE2A 3QVTA 1PL0A 5KC8A 1XRPA 1XD8A 2CVOA 1ML4A 5KG2A 3SBXA 4YRZA 5JCJD 2R62A 3AERB 3I2YX 4U63A 2F62A 3U3KA 1V1MB 3OQPA 5L3QB 1YTLA 2O3JA 1CUGA 4LMAA 4YMUA 3AUTA 2XRZA 2HVHA 4P08A 2JJ8A 3A32A 4CR8A 1RXVA 2ZRCA 3FCEA 3GHYA 3BXEA 2QUAA 5DKWA 4CLRA 1MFPA 2P9JA 4L08A 3HKZF 3WK8A 4ZDWA 4KV7A 4EB3A 3AEQA 2XQIA 1P3DA 4X8LA 1NOIA 1X7GA 2VDVE 4KR3A 3FGNA 2H3EA 2QT1A 4RZ3A 4IJ5A 4C7MA 1RWBA 4MEXA 1G1MA 5J8YA 4N12A 4QBHA 1MX9A 4UVHA 2K8AA 4V0NA 4NRDA 2CWDA 1R00A 4TTSA 4P2GA 2Z6AA 2ZROA 2GEJA 4N0EA 3ZHXA 1E2LA 4MGIR 5BYAA 3BMQB 5AK0A 4RGYA 4TLCA 2RGYA 4C29A 1KMNA 2D7DA 3TVTA 4LECA 2BCGY 4LK3A 5AYVA 2EFJA 1B2RA 2NZWA 1NNEA 1VPDA 2BFEA 5AKLA 1HEYA 3EBPA 2W0MA 3TLGA 5C3UA 3K9GA 4P4SA 5L6LB 3LT0A 2PIDA 3OESA 4PQFA 4EG7A 2WYOA 4AP5A 3UW1A 2IXBA 4R3WA 2HHCA 3VR3A 2W9XA 4MWDA 4LZWA 1NW4A 3PPVA 1U28A 4UEOA 5CM2Z 4WY5A 4PXYA 4MQUA 3LYUA 3OQIB 4G1EB 8ICVA 2IP1A 4HTFB 1V3UA 1V11B 5JNWA 1J1ZA 1P1HA 3H8VA 1Y8QA 2GEKA 2H48A 3TB6A 1J1IA 1PR2A 3OZWA 3O92A 5KNIA 1X8XA 3C3EA 4TQGA 5HKBA 3UA4A 2BIFA 4M8LA 5KFSA 5HDQA 5AJYA 8ICRA 1NNSA 1W4CA 1FS4A 4YJDA 1YJBA 2RGNA 4RK4A 4GRIA 3H0MB 4YRPA 4LJ6A 1L5NA 2H1RA 4WBNB 2ZUUA 5I7HA 2F9MA 3JYNA 5SZHB 3KTOA 2V58A 2D4HA 4D4MA 2L69A 2UUOA 2EEPA 3OZRA 4X6XA 3LRXA 2JLZA 1CZKA 1XSNA 4LGCA 2B1IA 3DB2A 1PVRA 1VZ3A 1Y8CA 2D6FC 5I51A 1C4WA 2B9VA 2R1TB 1H9BA 4CG3A 3DMGA 5H3LA 2CLKB 4FS3A 1DQRA 4X8MA 5LPNA 2QD5A 1NVWQ 4RNNA 3GDFA 5JTUA 4LFCB 3RUDA 3EH2A 4NOLA 4Q12A 1R4NA 1NF9A 5ICFA 3NHFA 5I9TA 2QTAA 3IAM1 3KSRA 1O94A 2I34A 4AZTA 3TFWA 3VR2A 4J43A 2JJ1D 4I55F 4IF4A 4ZC8A 1XCLA 3BTSA 4R9SA 4FZRA 4BZWA 2FEOA 1WE2A 2Y1LA 4Z0HO 4BFTA 4N03A 1N6IA 4RDXA 3EXHC 4WERA 2YIMA 1I3MA 4EZ6A 2GTIA 3O8OB 1DXSA 2YINC 4D8YA 4EKDA 3B53X 4L0CA 4DJEC 2WWGA 3QVXA 5DB7A 1FYVA 5IZCC 1KY3A 2QOEA 2OAQ1 3VI4B 4AYXA 4K9NA 4EQ6B 4KXUA 3BFPA 1YL7A 3PFCA 2E4AA 5DLYA 1GL6A 1PD0A 4YV1A 3HEBA 2JH8A 1TRHA 2XE4A 4JQOA 1NUTA 4HZIA 1WZCA 2KS6A 2W03A 1R5NA 3ONVA 3RH4A 4QUHA 1AO3A 3M4YA 4G4IA 4AZSA 4YAJA 3ESZA 3DOJA 2XQFA 3AMZA 1MXHA 3MGKA 5I9NA 2QM7A 5BMOA 4F72A 4XQ9A 5KFWA 3W77A 1AB5A 4E5NA 3QLJA 1U3VA 4PU0A 2YVUA 4OIMA 3GK3A 3IUNA 4N5DA 1G9TA 2VN8A 2ZSAA 3NZEA 2C5BA 3ETNA 1G59A 2GPYA 5EL0A 2A9RA 4C5BA 5ICSA 5CWRA 2WWRA 4GGOA 3SBDA 4Z7QB 4G5HA 1CPYA 1Q3VA 5FNZA 4DUGD 3RSQA 3USZA 2WEKA 3D6AA 1W0KA 3PEWA 4G81A 3FUVA 5ABPA 1Z68A 1WMEA 1V1RA 4BO5A 4B9VA 1C9DB 1XLUA 2F48A 4F3YA 1RCTE 1UBSB 1MO6A 4L4RA 4NONA 4JUCA 3WV5A 4Q21A 5F2OA 4QBIA 5KWSA 3QWAA 4RAQA 1PZNA 3L43A 1F5NA 2BKUA 4DOCA 9ICAA 1ORWA 5ADUS 3RROA 1M6EX 1AQNA 1DE0A 1GZHB 4ISCA 3VPBA 3C85A 3RUFA 1I7QB 4D6PA 4IRMA 2JGRA 1XXHB 1ZM2A 1SXGA 2ZJYA 3KTAB 8ICWA 3AHCA 4BE9A 5LXTF 3OJEA 2G4VA 2PMEA 1X2EA 3STWA 4NJMA 2NTEA 1JROA 2AOUA 3HKCA 2QENA 3QVMA 4LMPA 1JG6A 5CT4A 1A9XA 2OY0A 2HYDA 4JEIA 621PA 2VQFB 1ABEA 4BVLA 1CR2A 4GMFA 4GRAA 3WY9A 4TKUB 4MWSA 4M0PA 4NYIQ 4KAXA 4I46A 1WY5A 3N3BC 2LWIA 4BJQA 3YASA 2G82A 3T35A 4PWYA 5DTEA 5IVHA 1C7FA 1FX0B 2VJMA 1IH8A 1XLTA 1E7QA 4IMIB 3UGJA 2ZR7A 4KO4S 1U90A 3HWWA 2ZDHA 4YYEA 1PNQA 4EENA 5K0EA 3KPWA 4DPKA 1CY0A 5FPSA 1IUPA 2A9VA 1CK4A 3JQGB 2GCNA 1O0CA 2CLMB 4X84A 2WP8J 3MTQA 4UCQA 1NUSA 2AQHA 2REBA 1NI5A 2WWVD 1AMNA 1YDWA 1E2UA 4N1AA 3ER9A 4TKLA 4YMOA 4J2OA 1H8HD 4P4UA 3CZ4A 3W3AD 4OX9Y 3RR2A 2ZU0C 5LFAA 4WLOA 3SVTA 5D6NA 3D2NA 1ENPA 4H6VA 1X86B 2AZXA 2ET6A 3WBJA 9ICWA 2DU8A 3DAYA 1RM6C 3DCIA 3CRVA 2HRDA 3U3ZA 3TRIA 3PXBA 3SQLA 3GFFA 1KFKB 3DZCA 2GBGA 1OH7A 4Q4JB 2P3LA 2ACEA 5IM4A 2OFPA 2BISA 2PLWA 4PZ0A 4Q47A 4HDKB 3BZWA 1U3TA 1U3CA 4QWWA 3AKEA 1KO1A 3SIWA 1TA9A 5ITZB 2QMQA 4A15A 2BGKA 3N5KA 2WIAA 2FETA 5J0QA 3SAFA 2ZIZA 1YQXA 5HRUA 1KNXA 2H3QA 3BTUA 3TZLA 4B6SA 1ENYA 3GR6A 3Q7QA 1QGED 3O1HB 3RFCA 3CBGA 5IBPA 1WU8A 3PQ8A 3B8EA 4PBRA 1AHIA 2R5WA 4NHEA 4QZAA 1DO8A 5DM1A 4DT1B 1Q12A 4RD0A 2I3ZA 2O0JA 4UARA 1C9NA 3KT3A 3VHRA 4YD2A 3BKWA 2ZTEA 4NR0A 2GPBA 3AIKA 2W6QA 3QOFA 3LY7A 1I5EA 1RBYA 3FUUA 4FEEA 4JXJA 4E1AA 1GOTA 1ETHA 2YVAA 5K0CA 2PO7A 4UAUA 2XADA 3B7GA 3TBHA 4FZ3A 1R6TA 4OUKX 2YIDA 1S2LA 1QP0A 2F1KA 3SQNA 4ZXFA 4BRZA 3BDPA 3X3HA 1KZ9A 1SKAA 2JEZA 5SZJA 3F6YA 2V1XA 3PNSA 3R3JA 4MEBA 1JSCA 2FOLA 4IF6A 4KJZA 2P8JA 1SXJA 2N1BA 3X43A 2HC9A 1NJ6A 1TO2E 1M2OA 1TQHA 3RRNA 2QL6A 4I14A 5JPIA 4M6WB 5TX7A 1N6PA 3A6DA 3GELA 4RMGA 2WT8A 3RQSA 1D2CA 2Q7XA 1DO2A 4DHWA 5IN4A 3QVGA 4L8GA 3BH7A 4QXOA 2WYHA 2R8IA 4YT4A 1Z5WA 1RAFA 4M0KA 4PGYA 1NW6A 1CLEA 2V7PA 4D80A 4L9RA 2P7HA 2O8BA 4GMGA 4GGMX 1WOMA 1YMQA 4XLLA 3D3EA 3BHIA 4FCCA 4HWGA 2A1AA 2XTNA 1YONA 1W8IA 2RHOA 1RRGA 1NX9A 1E89A 1GRVA 4JI5B 4ZAXA 4BV8A 2ZATA 3B3AA 1VXRA 2Q5CA 4K6OA 3W8DA 2C7GA 3DLPX 4X1OA 1ZONA 1RYNA 2HMAA 3IAS1 4IS3A 1E3WA 3ITKA 3G7SA 1GSOA 3FOWA 3D59A 3T34A 4Z4CA 3BEOA 1ZH6A 1KFDA 2R84A 3JQBC 3DMDA 4JOSA 3LT1A 4RKEA 4C0WA 4F4HA 1DGQA 4I4LA 2N9UA 3DCJA 3KB1A 5CD1A 3UMJA 3EZ9A 4D5GA 1O96A 1PHPA 1RI4A 1USVA 1B15A 2TMKA 2DWQA 4GL4A 2UVPB 7REQA 1VP3A 3ZE8A 2VP6A 1SUAA 1HUOA 2YCBA 1CUVA 1Z5PA 3I01M 2Q0ZX 3ADCA 5D7BA 2F1HA 2NYUA 3FSEA 2XVAA 4QOGA 2DT5A 1U3FA 1Z4IA 5B36A 3WIUA 4JAVC 3T9AA 1SURA 1NKVA 3P96A 3II6X 4KMUA 2VSOA 3KEGA 4BMYA 3G0OA 1CP2A 2O3RA 1TQ8A 1R0XA 3DLBA 1LBHA 1FXSA 4W82A 3N7RC 2D8AA 5DP2A 4DMLA 5HA5A 1QGAA 4LWOA 3V4ZA 4CV1A 2Y92A 1ST2A 1XRMA 4IJVA 5GZ3A 2CF5A 4J9QA 2VJQA 2V0NA 5DGTA 1K9VF 4B3GA 3OM0A 3TIXB 3A1NA 3E05A 1DFHA 2EZ4A 3PEVA 4BAGA 1T2UA 1LY1A 2QEQA 2QRKA 3IP6A 2VT3A 3BULA 1TUBA 1NM5C 4ZOHC 4ZVQA 5HKKA 3PQEA 3ZI0A 2W6MA 5JWRA 3Q5EA 4DXDA 1TT7A 2OCEA 1Z83A 3T5GA 1LRLA 2OAP1 1A7JA 2ZIWA 4G65A 3RJEA 3AEUB 4KPGA 3GEGA 1KH1A 1DHRA 3ECCA 2EGHA 4JLMA 1N2CA 1TVKA 4C03A 3IEUA 4JB0A 1MC8A 5F3DA 1SOMA 3NEYA 4MKXA 5KL8B 1BO6A 4O4JA 1K2WA 1WUKS 4IDDA 2PKRA 4QKQA 4DSKA 3IAUA 2ZSUA 4IG4A 1XZEA 7ICIA 4AY5A 5JEEA 2E5FA 2KSOA 3E58A 3FSGD 3M1LA 2ZUTA 4LDRA 2AK2A 4FYKA 3BD8A 3MGGA 2I7DA 1Y1PA 3A27A 3AY0A 2R8XA 4WI1A 4Q44A 3AFMA 4F6RA 2W22A 4YRAA 2I3BA 5FL7D 4B9EA 4M9LA 1CB0A 3A0RB 4GZ6A 4KLDA 1DPGA 4OKIA 4DMGA 1OYWA 3BYZA 4I2DA 5LUBA 1EFRA 1ZQAA 2RP5A 1H5NA 4RPHA 4J75A 1MT0A 3AVTA 3ZV7A 5DGIA 2LYAA 1GARA 2DFTA 4UB5A 1MQ8B 4RGVA 5K01A 4RULA 2CXYA 3IFSA 4JJ6A 3TZBA 5JCOA 4HH4A 3OCCA 3BRCA 2ZE6A 4M9HA 2J85A 1E0JA 3R8FA 4EX6A 4UASA 1O77A 4GX1A 4GW3A 1QFSA 5E8JA 2GEUA 1A5BB 2P0EA 4CDRA 4DCMA 3ZOKA 3E03A 5JYEA 1ZJNA 2XPCA 1GYQA 1Z6YA 3VTZA 4AP6A 5IIOA 1GUDA 4HGQA 1I0ZA 1F4LA 4KVZA 4PLYA 2CDAA 4D3XA 4U2FA 3ICEA 1FYFA 1VDMA 5LUAA 1XWIA 3LSYA 3EXIA 4B32A 1N2BA 4PSVA 2J31A 4ZT2A 3G82C 3MFYA 1ZIYA 2G9NA 3WLIA 1GXSB 1TMGE 5HZKA 3P9ZA 3UQZA 3HT3A 3RWOA 4G0QA 4RQUA 3TW6A 2FRVA 3TLYA 2J9YB 2AU0A 3V8PA 1U8UA 2XCAA 3D9QX 5C7IO 3AIOA 5A5FA 2KZMA 1Z3EB 2H3HA 5E9AA 3VU1A 3LDFA 1T4CA 1YQEA 2GTHA 2I6SA 5K3BA 1X1CA 1MN6A 1F38A 4PG4A 4UAZA 1RLUA 1E3JA 2YXDA 3VO8A 4O0LA 2VJKA 4UJ5A 5GTHU 5I8PA 1LB1B 2Q0QA 4X44A 4GVPA 1DKMA 5DKFA 2PT6A 1PSZA 5L3VA 4ZEWA 1FXWA 2VF5X 4IIUA 3HXLA 2X58A 3ZIDA 4N47A 3Q2OA 5H2FU 1SCKA 5IUKC 4I8XA 4DE5A 3B51X 5MGBA 4JLWA 4MVJD 3M7IA 2XMRA 4O3FA 3ZNPA 1B0XA 1N6HA 1ZUD1 2GHIA 2R4QA 2VLBA 3AKDA 2CZCA 3AEYA 4PX5A 2A4MA 5CNJA 2H65A 4BE4A 2W6ID 3K4HA 4IUCS 7ADHA 2HCJB 2NO4A 1BXRA 4MQBA 4XJXA 1EI9A 4EF6A 1X40A 4EA9A 2V7BA 5D86A 5B3JA 1ZNQO 1XCMA 2QRPA 3CF6R 3HDQA 4YUWA 3NDIA 5DB8A 3G2PA 1FFUA 1P1JA 5LB4A 1ZBQA 3EOZA 3EARA 5BSHA 1QH8B 2GDJA 2XYRA 1E9DA 3KE9A 1QIEA 1CG6A 1PVVA 4BNKA 4JCOA 1J2MA 2FNAA 1Z00B 4AQDA 4PAQA 1YH3A 3LK9A 1IY9A 3T61A 3TSZA 2HPAA 3ZE0B 1G20E 4H18A 1LJUA 5LZ2A 4RS4A 3OM9A 1J06A 3Q2IA 1T13A 2PUAA 1YJ8A 4P2HA 1P44A 1K6MA 3WGQA 3CUEF 3O83A 1EX9A 4X60A 5DT2A 4XUDA 4BFUA 5K20A 1V5WA 3T94A 2FKNA 1K1SA 1K5PA 3BL5A 3I83A 1C3OA 4HQOA 3R7FA 1A2KC 2WW8A 1P8AA 3P9KA 2OV3A 2CXXA 1JHZA 4PVCA 4R84A 4EJSB 4V0OA 2WF5A 4R4JA 2BE7A 4FBLA 2DF8A 5DCUA 3L1HA 5E9WA 1JNYA 3VHXA 1N3BA 1SQGA 2KFZA 3KKLA 3UKJA 2HT1A 4W5RA 1ISJA 4OJMX 4YVFA 3L6DA 4OHMA 1RQPA 1QIJA 4I9FA 5JNRA 3QHQA 5AI5A 5G53C 4C9BA 2Q3HA 1V3QE 1HT0A 3CHYA 1L8LA 2W6JD 5GZ1A 4QZGA 5L40A 1LDEA 4DSFA 2A9QA 1FP4A 2YV2A 3H8SA 3C7DB 2BGTA 3VJLA 2RGDA 1TJ3A 1C8BA 3IVGA 4RKQA 1INLA 2EBWA 3C5EA 4MULA 3G6KA 2C2OA 1IEXA 1Z63A 3A70A 1B73A 3DT6A 2QL5A 3PF8A 3GZFA 2HOIA 1SM4A 4GZ3A 2EF1A 3CTMA 3PHCA 1JDPA 3CLUD 3DCNA 3EZFA 1FFXB 4K3UA 4C8OA 3VSCA 1CR6A 4ZRMA 1OB2A 3L0ZA 4ZV9A 5JIBA 1GPBA 3QTTA 3IQXA 3DW1X 3MS2A 1E32A 1E3SA 1YJ5A 4WECA 4ARIA 2BCUA 1I2MA 3J7AC 1DXQA 3UANA 4AO8A 4D3ZA 2HA2A 1WABA 2OV1A 4OBWA 2Q4OA 3EH1A 2OPHA 2I4MA 3SV4A 2H07A 1YB5A 3SKYA 3STHA 5EKXA 4PBTA 1EVJA 3HR7A 4A91A 2GPSA 3LA8A 5DNDA 2AX4A 3OCZA 4CEIB 1OSNA 2PH5A 3LQ2A 1NPTO 4XJSA 3IOYA 4BX8A 4F8YA 3ES9A 4KX3A 3ZH9B 4DQIA 2YYZA 4YXFA 5ENZA 1VLMA 2J3HA 2XTAA 4J16C 3JRWA 5DHAA 3WHLA 4UM7A 2XZTA 1P5ZB 4P36A 1NP3A 1KKMA 4BQPA 1S3SA 3G2HA 2FE1A 4BKOA 3NYWA 3DZFA 4BX3A 3H2IA 1E2PA 2OBBA 3DTNA 2WRZA 4DJTA 2B7BA 3VR4H 3AMVA 4AMGA 3EUB2 3S6JA 1T2AA 4YI3A 2CLCX 5FEMA 3WL3A 2QX7A 1TPZA 2ZIAA 5JISA 1W96A 2XCOA 4D81A 2G5HB 3HWX1 4UE3S 2KJ5A 4R65A 2ZR8A 4JB3A 2F44A 1NLMA 3V2HA 5DWQA 4JK1A 2ZJ6A 1LPNA 4Z8YA 3G0BA 4Q9LA 4NYJR 3V1NA 4TWZA 3RSSA 1M3SA 3RANA 1GAWA 1OXMA 3BPSA 3PQ7A 1E96A 4GDFA 4A6XA 1KVRA 4ANFA 3TAQA 3G7UA 1OH5A 1S3GA 5JALA 3CVVA 3UHAA 3QVUA 3NAZA 1E1MA 1IOZA 4ZCPA 3G59A 4ECYA 5BMVB 5CPBA 4XARA 4U7HA 2CLSA 1QFZA 4C4RA 1ITZA 3T0GA 3NIDB 2ENUA 2N46A 4JKYA 3P4UA 3NBQA 4F45A 2AFHA 1N2HA 3JS5A 3FR7A 2J3EA 5JTTA 1WXFA 1YRHA 5AVVA 1YA4A 4RY8A 3ZXXA 5KFTA 4C4ZA 4FJ0A 5AVTA 1J2YA 1LBQA 1DEKA 1RAAA 4J8PA 1WSAA 4BRWA 3N5CA 3L7MA 1P9RA 2R9VA 1P77A 2J87A 1GG9A 2O1EA 4WXHA 3ASZA 3V32A 4BGDA 2F43A 3SDZA 4GE3A 3S68A 2C5AA 3IIEA 4EYKA 2KNJA 3TQQA 2W90A 2F8SA 4COKA 5JMPA 3ZCQA 5B57C 2G76A 2JZNA 5I48A 1BFKA 5BRJA 1JSZA 3CE9A 3F53A 3ICVA 1Q57A 4BEWA 4BMVA 3IUPA 2L2QA 2R00C 1W6RA 3Q5DA 3TRDA 4I1UA 5H81A 3WBFA 2C2GA 3DMRA 5FOSA 2FP4B 4BYGA 4JQYA 5L9AA 2GZDA 2Q1WA 1JDBC 2LDBA 4BL5A 5CFNA 1OAOC 2VTBA 2D62A 3D3WB 2OO3A 2W55A 5CYFA 4BS9A 4P3PA 1SG0A 1VRVA 5ECYA 3P45A 4GXKA 2NV6A 2HPVA 1FSZA 5K3OA 1NZFA 3U7QA 1R9JA 2WT9A 1UFQA 2XRMA 1DJMA 3UHOA 4FFMA 3I64A 4CXMA 3P9XA 3TJZA 3KZIU 4QGSA 3UKDA 2FZGA 1Y8RB 5BQ5A 4BNHA 1BKYA 3CIOA 3PKIA 1YZHA 4MA5A 2JD1A 4Z6EA 1LU9A 4ZZ1A 4LRSB 4L3VA 4UUNA 5LXTB 5CFRA 1URJA 4F50A 4BC1A 2UVRA 1SC1A 4JYAB 3MSXA 1OYOA 3QXSA 2BFPA 2JCSA 1FTSA 1QK5A 5K8VA 1GZUA 4PNHA 1RG6A 3L8EA 4LF7B 1PGJA 2PMZF 3ZHZA 1RXEA 3PDCA 4J29A 3SS9X 4V0MA 5TQ0B 2WWXA 2QLBA 3B1FA 4MB2A 3HCEA 1I2DA 3NIGB 3KYCB 2IP4A 4XYBA 1KARA 1NVMB 3TSOA 5HE9A 4RMHA 1GZSA 1FDIA 4DIDA 5ALRA 1M2HA 1IOLA 4JQSA 4ZQEA 6REQA 5FUYA 5HOQA 4JBWA 5KFMA 3TR5A 4G0NA 3MR2A 1RP1A 3EVGA 3B6KA 1L0BA 3M6WA 4DKXA 4MQ6A 5BSFA 5BURA 5JY1A 3RBXA 4H4EA 1XQ6A 1WP4A 4US0R 2OC9A 2AR9A 3M8SA 4KKXB 3ROEA 2XUQA 1NQAO 4LEIA 1N6KA 2QSUA 1EUCA 2OA0A 3KR0A 2VTKA 1EFDN 4DKJA 2PUCA 1EWVA 2OXCA 3ZLTA 4BRSA 2KP7A 2UZIR 3WISA 1QE3A 2GASA 3OLWA 2VXYA 2WAYA 2MYUA 3R75A 1N48A 2ZBPA 4UVGA 3THXA 1BZYA 4OYYA 1OLUB 4FU0A 4UAGA 4N6OA 4HHEA 5C1OA 1GO3F 4HAVA 3ESBA 5H3CA 4P6VF 1KW4A 3E1KA 4B6QA 4E30A 3JPTA 3BJIC 3U9TA 4RY9A 1Q0ZA 1NVKA 1QIIA 3NGLA 2B69A 3IHWA 4ZYVA 1QHNA 1DKRA 2D0OB 1GFZA 2XYPA 4B6PA 1U04A 4QYMA 3OE4A 1X9SA 1SC9A 4X7PA 4DL5A 3ADKA 1QYRA 3W3ZB 1I7LA 4HO1X 1XQ9A 3LKVA 4RHTA 4F06A 4IEIA 2R3SA 3PITA 4YMSA 4G5RA 1IHOA 1T36B 3ED5A 4XGKA 3SXUB 2JJ2A 1S3IA 1SG6A 3M70A 2DPIA 5ICGA 2ODWA 3K9HA 1MP0A 3HILA 4EI7A 2Q9AA 3ZHRA 4CNBA 2I6FA 2YJGA 4GLLA 1FJHA 2XC9A 1T5BA 2VYFA 3GVIA 4EGJA 4OM8A 3C4VA 4NXZA 3V6HA 2GH1A 2PLAA 1OXJA 4F38A 4KUEA 2FPPB 3ENQA 2BTQA 1Z5ZA 3MHTA 2Q3BA 5HVNA 1TVEA 5B5EU 3I6BA 4FFSA 4RC9A 4C6SA 5DBHX 2IH5A 2FVXA 3PMLA 2NW6A 1A4UA 5F9NA 2V6FA 2HHHB 4JVSB 4N54A 2I71A 1TAMA 3H2JA 2FFJA 1U0FA 2E5SA 3KT0A 3AY6A 3E2MA 3FYUA 3UJ3X 1QSYA 2COUA 2GEDA 2FSVC 1XWWA 1ZD2P 4WVLA 1VHQA 5AOBA 1E59A 3OZUA 1PCXA 4FB4A 3F0TA 3EXEB 3OEYA 3VX4A 5HUHA 1JR2A 4FFBB 4YRDA 1EGHA 2P6OA 3TG2A 1A72A 5DMXA 4YJHA 4ZODA 2QN2A 3FBGA 1I01A 3VYTB 3OPVA 1W4AA 1E1RD 4EELA 3K0BA 2Q7OE 1CEYA 4IY1A 2IW3A 1T2VA 3DV2A 5KB3A 2O3SA 4C7VA 3HBLA 5FI5A 4W6ZA 3BMOA 1YZYA 2Q1UA 1F0MA 1P0QA 4K40A 2R6DA 2YJNA 2B5VA 1OQAA 1KK0A 4NCAA 3ETDA 1NJSA 1X7WA 2Y93A 1VFNA 1HQCA 1EJ6A 1CJVC 4EO7A 2O2YA 4G5OA 2O2IA 3AFOA 1XHEA 4G5GA 3JD0A 3N39C 1U0HC 4D4JA 4M8SA 1WPXA 3CO5A 2JLXA 3AF1A 4H7DA 1DRJA 1AKVA 2W9AA 1HE3A 4QQFA 4X63A 5B2EA 1Z0UA 4O4LF 1VI6A 3TVDA 4AJOA 1HZZC 2RRDA 3B3JA 1W5BA 2H63A 4I2IA 5JI3E 2E85A 1KVSA 4PE5B 1AHHA 2C9MA 2NQ8A 3LLCA 3RU9A 2FUEA 3NW9A 5HF5A 3E35A 1V41E 1YS7A 3L82B 1FFSA 5DN6A 2H0RA 1ILWA 1NMXA 3CVJA 2B4TO 1PW5A 3ABZA 1W49A 2IH4A 4EPRA 2ISCA 3TACB 1TJ5A 4RH3A 4JCCA 2QZPA 2ASDA 1T0IA 3QENA 3ZCPA 2ZI7A 4K9DA 3OCXA 1XEWX 3VYWA 1WY7A 1KZYC 3OSNA 5A4KA 5HF6A 1UEXC 1U6IA 3DQQA 2ODNA 3QEBZ 2O8VA 4MGHA 4ECEA 1OX6A 1DK3A 2J32A 1NC1A 3UUWA 2BGMA 3AM9A 1RPJA 5J40A 3T3OA 4LCJA 3I2HA 4KXYA 3UHFA 3T1NA 2ZEJA 1A7UA 3EFOB 4QJIA 1Z0KA 4DRZA 1TEZA 3RYHB 2R48A 2JIZA 5KFJA 2N1MA 2HSEA 4JXXA 1E1QD 1W30A 4GLBA 2AN5A 4F5ZA 1TVAA 1KZ4A 4WKGA 2ZDGA 4YG2A 5HIJA 4TKVB 4LV8B 4PQGA 5AW0A 1X87A 1DDGA 3MJRA 3AUXA 4BJ3A 3AJEA 3PY8A 3FOEC 5EY5B 1NMSA 4WH0A 5DYWA 2EFEB 5BV1A 3QY9A 1L3TA 1DOAA 4N7RA 4BZXA 1VGVA 2O7VA 5DSTA 1N2EA 3BILA 4MYRA 3MT0A 4MPJA 2AKAB 1VBNA 4XR4A 4KR7A 3HVIA 2ZUDA 1V26A 3QLUA 3ER6A 3HCCA 2O1WA 2R1ZA 1YHYA 5IPFA 5JC1A 1E99A 3HA2A 5AVZA 4AJJA 4XTRA 1JJBA 3JARA 4KE8A 2PKQP 4HEHA 3V00A 2XCPA 1ZO8A 2WMOB 3EUAA 1B4DA 1ZXBA 3REQA 1IAQA 5BSUA 3STUA 3BA1A 5BUQA 4KBFA 1JMSA 2ZSEA 4XIJA 3TLXA 3SLRA 4Q7LA 4R16A 5G4KA 2ZAOA 4YUVA 5M3BA 2IHMA 4EBBA 4C80A 2IBTA 1SL2A 2MU1A 1MB4A 1E2KA 2Q5EA 2Q7DA 1HF3A 3THRA 2CC2A 1L3BA 3CLRD 4B84A 1DAMA 2BFMA 2QD2A 5IWCA 3F8SA 3OJCA 4B33A 2OYCA 1EM8B 1T1RA 3AI7A 1QQBA 4KXFB 4D8TA 2QVZX 1V6AA 2Q4TA 1JVBA 3CEMA 2KQUA 3QE4A 3D8SA 1ZQVA 3MEQA 3TL3A 2BE9A 2QROA 2H2HA 2QU7A 4C0JA 4E11A 3L5OA 3I01A 3K73O 3ONEA 4TLMB 4PIPA 3S4YA 4O2LA 1E3TA 1IK4A 1WW3A 3KKNA 3L0OA 3BE8A 4RYDA 2WAQC 4EYGA 5EWGA 1FUYB 3HFGA 2HWWA 1K7FB 4JSRA 4ALKA 3FNQA 3G5MA 2XCSB 4JROA 3U4QA 4F9TA 4ZTZB 3FMGA 4RVGA 4IV8A 2D5CA 4CQMD 3NG1A 4BBZA 2VPXA 3RKRA 2H1WA 2ACKA 4H16A 2ZYHA 3CPSA 1CR4A 3GD7A 1E66A 1STOA 4JD5A 1V96A 3L7BA 3GV5B 5M2QA 4QIHA 2JBHA 1Z8DA 4RADA 4E12A 3PWZA 4G5FA 3MINA 4WFQA 1M73E 1VCHA 4UE2A 3D0KA 1Z0JA 4JI1B 4DVGA 5COQA 4JV5B 4YECA 1UA1A 1II8A 2I67A 2ES4A 2IIQA 3B36A 5TGDA 2PUHA 1QAOA 3NTVA 1JEAA 2KZ3A 1K63A 4DBZA 4WCVA 1GZ6A 1GM5A 3KD3A 2J5XA 1VLZA 4LTNA 1DJOA 1CIVA 1TCAA 3EA5A 2IMWP 3I6QA 1RPAA 2PA0A 4YA6A 4RPJA 1TD9A 1QO0A 4RVHA 1OXBB 4KVFA 4EGFA 3L0CA 4U7CA 2H08A 3BGSA 3VBEA 3CB4A 1XWLA 4MKZA 3OLYA 3K16A 1JKMA 3ND5A 1CE8B 1CUAA 4QXPA 2JLQA 3O1IC 4LV5B 1E1YA 5JARA 3UT5B 4K9MA 1BTOA 2VVTA 5BW8A 1BH2A 4NPHA 1ZAYA 1I33A 1TRKA 5D49A 2Q1YA 3AXTA 3JALA 5F77A 4XWKA 3MABA 1E4EB 4OJ5A 3WAKA 1T0JB 2Y6UA 1RMQA 1JHPA 1F51E 2CJPA 1D5CA 4KXXA 4BFLA 3L7JA 2V7TA 1ZY2A 4GMHA 2FSPA 4EYSA 4HUQB 4QODA 1G16A 2F4NA 4F21A 2QMEA 4DJJA 5KG5A 1AA6A 2BM9A 1TZBA 2CXQA 2FJPA 4H7HA 3DDOA 3K6SA 5LOVA 2XY6A 4XWTA 3GEMA 2AUMA 4RNCA 2CV1A 1A7AA 3DVRX 4PW0A 4B6GA 4GWLA 3RPEA 4X6LA 4RQ7A 3QWHA 1HEUA 3TFSA 3FOFC 4YC7A 3OFJA 3CEHA 1QS0A 3W3AH 2CMGA 2A7QA 1LKYB 3GDOA 1I5RA 1XTIA 4O5AA 3QVJA 1ZQLA 3OPYI 5DNCA 4MUXA 5J0PA 1YUMA 3PF9A 6CHYA 2C88A 5CA0F 1S0NA 2FFQA 4IQFA 4JJIA 5BSVA 5KOIA 2ZVDA 4OQLA 3AOEA 1OXXK 2BI4A 4XAQA 3ZQKA 1DHTA 2Z98A 1HDRA 1K06A 4E0BA 3LC0A 4F11A 4QD3A 3DLHA 3H4TA 3VOSA 5BMVF 1E3DA 4FBUA 5KTMA 1K5DA 1T0UA 1CHNA 3G1TA 1VKNA 1Z13A 4RWEA 2F3TA 3HXOA 3SJUA 4GZLA 2QJOA 2P4UA 2VO1A 2CYCA 1SVIA 4CKXA 1RXYA 4XUEA 2EZXA 4PLHA 4F1KA 5KMGA 2VUSA 4ZKDA 1BDBA 3MMNA 5EGNA 4NLLA 1DL5A 3RK1A 2UVVA 1I3KA 2W6OA 5F7JA 3LY5A 1ZMOA 1CDZA 3HABA 2G04A 5G5GA 1V37A 2UYOA 3W90A 5K4GA 3PE4A 2YKGA 2IODA 1I36A 1XJWA 2R97A 1NXXA 1H3NA 1XDUA 2Z2JA 4JZKA 4G9BA 4O5EA 3MCWA 2N1RA 4JL5A 2R11A 1H6BA 2CL0X 2Q1TA 4H59A 1T8EA 2KJ9A 2FK7A 2YR0A 4MYUA 5CK5A 1SOWA 3A4VA 4BNMA 4UBIA 1EGMB 2C2HA 1E7YA 5GM2A 4BP1A 1X39A 3TSWA 1HE1C 1JPUA 5CURA 3HZOA 2HYIC 4ZU6X 1DOQA 5JRZA 5GY7A 4B9MA 4PYNA 4LXIA 4UBJA 2WTAA 3AFIA 2ZJ5A 3H5VA 2OESA 3TXAA 1VFPA 2PI4A 1PEDA 2Q46A 4D8UA 5CEJA 3OT1B 1UM9A 1RDFA 4FHGA 3FPLA 1VSQA 4Q4HB 4N49A 4ETWA 2P6MA 3G8AA 5DHTA 3PUIA 2BZ1A 3U62A 4PQYA 3CSSA 3CLUC 1FS6A 1RSZA 2ERYA 1BEZA 4M0CA 1HIWA 3RJFA 4NFSA 3GRAA 3QVLA 2R18A 1QR2A 1PR1A 3KXPA 3L04A 3NDBB 2GR9A 2NVUB 3I0ZA 2FQ1A 1ZNYA 2QM8A 4JUFA 2Q5QA 1RCFA 4RVOA 5EQDA 2OK8A 1S8FA 3OAAA 3FRJA 1LPAB 4GP9A 5CJJA 2QUKA 4G85A 2F7SA 5CH3A 4LF9B 9ICBA 4OL9A 1TM2A 4KIJA 4DC1A 4F4DA 5KT6A 5KFVA 1KEEB 3ZYCA 1FJGB 5U4XA 3ZGXA 1E4VA 3GOQA 3H5AA 3VR5D 1W7AA 5BSGA 2GPNA 4HDRB 3QW2A 3DLIA 1Z06A 2P11A 2PGLA 4F3NA 1CUUA 1PTJA 2QTVB 4MV3A 2ANBA 3ORFA 3TQ1A 1A4RA 2XUGA 2X9VA 1L4EA 2VP9A 3FROA 4Q4CA 1YAJA 2O48X 2ZCUA 4D56A 1YK0A 2VYQA 2O7QA 4BFVA 5FL3A 1JZSA 3TKYA 5L1LA 3T3HA 3VZSA 1ETUA 1RKUA 1W52X 2AMJA 3D8TA 1Q19A 2R6FA 3CVYA 1NMEA 2DCUA 3V4FA 4U2KA 4QVKA 1WRBA 4R9VA 4ZH4A 4DTIA 3GMDA 2BAGA 3RVNA 3KELA 1OFIA 3ILHA 5KT4A 3PFWO 4U5XA 5IC4A 4IFIA 1QR6A 2D1QA 3UTCA 5REQB 4YCLA 3THWB 4TVOA 2I0FA 3LUDA 3OP1A 4KBYA 2O8EA 1P18A 3EG9B 4PCAA 4QIWF 1EHCA 1T24A 4L2IB 4RQ1A 3GLUA 4D0LB 5I7FA 3CH6A 1HKUA 4PLPA 2M1XA 3MELA 1H4QA 1RI1A 4TSFA 3E3MA 1XDZA 3KB8A 1CQIB 2YY6A 3O93A 4R9NA 1KEUA 3NVYA 1GSAA 2W2VA 1DC4A 2B78A 3BUSA 2ZYGA 6LDHA 3FF1A 1F8XA 1Q1EA 4KR6A 4DWJA 1ZQPA 1EAMA 1US8B 3S99A 3PD0A 1HNZB 3G2LA 4S1WA 5JY6A 1S2DA 1JKJA 4CKWB 1A9QA 3E23A 3G9TA 2UUCB 2DZDA 4ALLA 2HW3A 1NK5A 3EGWA 5JTIA 2H52A 5C8ZA 2NU8B 3JRNA 4K05A 3T7DA 5JZ9A 1OLXB 3E8XA 4PYKA 3PIRA 4NV1A 4MZDA 2YZKA 1JILA 5G4LA 3CW2C 2VK4A 1CRWG 5TQ2A 2G17A 1Z7EA 3L7OA 2J6HA 1SXJE 1EFVB 4F3KA 1CW2B 4ZGBA 3O1JC 1XZFA 1SBTA 2G28A 4OY3A 1W88A 2XVXA 4JELA 3GIWA 2YH2A 3S2UA 5GVSA 3M2TA 3PNOA 3QLEA 1KC1A 5F1OA 4OLFA 5DFAA 4CQLA 1H66A 3KL2A 2BI8A 3QHPA 2WTEA 1X7XB 3QU2A 3LH5A 4X24A 1MOPA 4KK4A 1P4RA 1DINA 5C31A 2QPLA 1NKBA 1ZA1A 1NY5A 5KYXA 1RHUA 3VVMA 2QE7D 2WSYB 5DTMA 1JQEA 1H8EA 2W2LD 4HNVA 3G9UA 4U7DA 2FR1A 3GF4A 1ORDA 3UW3A 1RM3A 1JV2B 4CPDA 1EKXA 2PKXA 1YIOA 5BWOA 4RKRA 2BCVA 4DR7B 4AJ2A 3NAMA 2GNPA 8ICQA 4OXYA 1DU4A 5FNVA 2ZTLA 2ZXHA 2EWVA 4MRVA 3I5XA 5K9ZA 5AMXA 4V03A 4FDLA 1UXGA 5IYZF 2AJBA 3U3XA 4J94A 2YZMA 2FTKE 2HSGA 1JQLB 4GR5A 4WW0A 3R77A 1BG6A 4B0OA 4N82A 1S77D 2ECFA 2JI6A 1PGQA 3EW9A 4NLNA 4DLXA 4JWNA 3UICA 4DBLC 1G8GA 3IEIA 2CMKA 4RLQA 2V3WA 4MPTA 1ECFA 4ZAGA 3QPWA 2GLTA 5CFPA 3A9VA 1GYPA 4YMMA 4M8KA 4DHEA 2K87A 1PK3A 3UNXA 3FPCA 4LISA 3EZYA 4UE6A 4JP3A 1EXWA 2JZBA 1DV1A 1NU6A 3ASVA 5KTYA 1QH1B 3SKVA 2EWWA 2GZ2A 4CFZA 1CQJB 1ZITA 1A97A 1K2VN 1QF7A 4MVJH 2O5VA 2R8PA 4FX5A 2AOTB 3T7AA 3PC2A 3VO9A 1YGYA 5KOHA 3QMVA 4FI3F 2WKSA 1Z62A 1R5OA 3W4KA 2W71A 4IHKA 2QP3A 3R41A 1YL5A 1DTEA 3ETLA 2X1MA 3GFVA 2W43A 4JKIA 1JT2A 1RWQA 3BAZA 3DC7A 3FDJA 4NC9A 2WM8A 2WK1A 3GCDA 2C77A 1OX4A 4ZOAA 3C2KA 5AW6A 2H85A 4AKGA 3VC8A 2VDNB 3HKZC 1JFTA 4NMLA 3C98A 2D00A 3GV7B 3PXCX 3T4PA 1SOUA 3B6IA 3HJGA 1ZEJA 3FHTA 4J1SA 1M2GA 1PZHA 2VP4A 3BA6A 2NN3C 1B3RA 3C6YA 1G3UA 4M47A 2WG1A 3RG8A 2OR3A 3KR9A 4KO2S 3VPFA 4QJBA 4M0DA 1EXDA 3HCDA 1HY3A 6AT1A 5IP5A 2M9NA 2JIMA 2JK1A 1MHTA 3TI0A 3D54D 2DSNA 1UKVY 4D1YA 1FU4A 3TBKA 5D3MA 3QYFA 2Y3IA 3NHZA 3I30X 1RXIA 2W2NA 1M1YB 4HNTA 2QYOA 3ETEA 3I6YA 3FTPA 2D06A 1N2IA 4R8UA 4RMJA 2Y99A 2EFHB 3QVSA 3JATA 5J4HA 1UA0A 1RXCA 1NYRA 3IA7A 4KB5A 1T94A 1XNSA 4K88A 5J4VA 5LP6A 4QYWA 1XSEA 3ETCA 3BERA 2Q41A 3CCFA 1NUHA 3NNDA 3OCJA 4NL4H 4QNMA 4NZOA 4RD3A 1W36B 1MABA 1V9CA 1A0OA 1SCBA 3U4HA 4WOJA 4I2EA 2H51A 2YJ5A 3PLAE 2GCPA 3IVRA 3GP3A 3MA0A 4H7PA 4NOKA 4DIKA 3CX3A 2G09A 1OV6A 2QB5A 4XD7D 2IUUA 3RJIA 2JI8A 3T95A 3SIRA 1KRHA 2JLVA 2IP2A 1OC4A 5BQXA 4A8JC 3EHEA 3KDAA 1D9XA 1JHDA 1V71A 5KNDD 1QHYA 4I1PA 2OWOA 2ZT8A 3C21A 4Y2VA 1CX9B 3OM1A 1ZI8A 1NUQA 4Y7CA 1Z56C 5EFOA 5IC5A 2ODQA 4C5CA 3OI7A 4MV8A 3A1VA 4U2DA 3UJ6A 3ACDA 2XWQA 1DNPA 2ZQZA 1BPEA 2H7VA 4IRXA 2CDNA 4DQLA 1EFPA 4RJIA 1A2OA 2PFOA 1G5FA 4V38A 1QSLA 3C6QA 4PG7A 4G89A 1MOQA 4ZGGA 1Y89A 1VSTA 1W581 3MBIA 2YWHA 4CMHA 2APJA 2XGSA 5DHSA 1PL8A 3BIWA 3A4MA 4HN2A 3NT4A 5H7XA 3QNUA 3L4SO 3WQRA 4F91B 2V7EA 3X1KA 1E2QA 1QF9A 2F59A 2OCYC 1JU4A 4NNPA 2O6HA 5FEUA 3BREA 4XYEA 4O4LB 1LWNA 2JAXA 2H3VA 4ZVNA 2XCLA 2VNAA 4IXNA 4TT3D 3MS4A 3H9EO 3QMWA 2AJLI 3R5TA 3OHMA 2O6LA 3WHKA 4KSBA 4MVJM 1T9KA 3DHWC 4RSGA 1YFKA 1BX3A 4KTTE 5BW4A 1D2NA 5EKUA 3KDPA 4CIBA 3EMKA 5DASA 1YKFA 4UULA 1D9DA 3COVA 1M6NA 5A7FA 3WFJA 3R6GA 4EG5A 4J9NA 3GUYA 3V46A 5DNWA 5FTMA 3PGMA 3A9UA 4YQFA 4XX0A 4LJXA 2LUOA 3R5FA 1BKSB 2GJSA 2P2ZA 4OIFA 4XGNA 1VBKA 4YRFA 2WD9A 3KYDB 1NZBA 2EGGA 1M0SA 1U2DC 3JY6A 1I3OA 2KM1A 3GFOA 2VJDA 2J07A 4MLZA 3RLIA 1TW3A 4DR2B 3CY6A 1WD5A 4OD0A 2E6KA 1OZAA 4LVSA 2JPDA 3NOVA 4W1RA 2ZJ3A 1U2TA 5TE9A 1RRFA 3GAMA 3SC4A 2XLCA 4MUYA 1KH2A 4JJKA 2RMKA 3G9XA 4TWRA 4M22A 3TX2A 3WV4A 2C7VA 2FPGB 2HLPA 4XWOA 1FIUA 2PTGA 4P4LA 4EK9A 2ZYDA 1F2UB 3H0RB 2H4FA 2R7NA 2OZPA 3MT9A 2ZIUA 1W5EA 1NAIA 1V35A 4C78A 4EJ2A 3WMRA 5J2BA 2YOHA 5IFLA 2R4UA 1SXHA 3BJYA 4KXNA 4F4FA 5D3KA 1N63A 1WSBA 2NVOA 1U9ZA 1LRKA 1QFMA 4LE0A 3OSZA 1X8JA 3GGOA 4YMVA 1Z25A 4JUAA 1EDDA 2OGTA 2GK4A 5EUMA 5C2JB 3ABOB 3I12A 3V8VA 4UHBA 1Q0PA 1KFCB 2QMHA 3ORSA 2E3TA 1QGZA 3T3MB 5IX8A 3W9YA 6PFKA 4ZT4A 2ZUEA 4Q03A 5DYTA 3H1FA 2IHZA 2IEGA 4PG6A 4UQLA 1XAIA 1BCRB 4NBVA 1KXJA 5U9CA 3NAQA 1MQ3A 1JAYA 2A57A 1RAIA 3A8TA 2FZWA 4DV4B 3HYTA 4MS4B 1IZZA 4BX9A 5LYJA 4AKTA 4UB8U 2Y1OA 5AQ1A 4TTJA 1C1YA 1UT8A 1NA5A 1U48A 2E8MA 1XCPA 3OEHA 1S1MA 4LOJA 1TZKA 2HN9A 2W7OA 1FFDA 4DPMA 3KCQA 5CBPA 2FMPA 3CLRC 3EASA 4A82A 1GZ3A 2WU8A 2ZTHA 4YLEA 3BT7A 3H2GA 2QTZA 4JFAA 4LHSA 1K5GA 4PLZA 3SX2A 3AHEA 3QKRB 1M6VA 1D8TA 5JEDA 3W7VA 3H1PA 3OJSA 3FYTA 1RI5A 1N5RA 3V3KA 4ASUD 1W85B 3QV1A 1PFYA 1T6BY 4MGZR 4JEMA 4KN5A 4X1KB 4ENTA 3C6KA 3WGNA 3LOUA 4IS7A 3L1IA 3A36A 4LRQA 3USES 1L7VC 1WR8A 1QCZA 3E53A 2HF7A 2ONKA 1OH6A 2XKKA 2FSFA 1G8HA 1VMAA 4P1ZA 4Q1CA 4D0NA 2RCYA 4R0VA 2C9CA 8ICPA 1E61A 4QM6A 1O97D 5EHZA 3SE0A 5JRJA 2YDYA 2XDQA 3I61A 2FEXA 3WADA 3EVNA 1X7ZB 1P4HA 3ZNNA 3EIFA 2FN8A 2WT4A 3SQXA 5P8WA 2QR2A 5GWXA 1TGYA 3TTYA 1GZ5A 3Q3HA 4RBNA 1DFGA 1ISMA 2ZE7A 4ZEOA 5K09A 4FX2A 3FDSA 2Q8PA 3R9WA 3IC5A 4R66A 2FUG1 4OV6B 4OTZA 5BSKA 1QK4A 1VL8A 5CR9A 5L51A 4Z4QA 1XMVA 4EPVA 4NS4A 1TTTA 4C4PA 2X19A 1ZRHA 3EAQA 5I4KA 3OX3A 2PFPA 4MW2A 3NH9A 3UJ7A 3S8EA 1G8AA 3ZK7A 1RZRA 3G5TA 1I5OA 4FDTA 2ATVA 1YRQA 4FSDA 1QP8A 1RPNA 4RT3A 4MVJG 3V34A 4HS4A 2HHVA 4B6RA 4JI7B 2CMHA 2JFYA 3PQ3A 3PBKA 3N28A 1FL9A 1BN6A 1H6AA 4KREA 5IIKA 2N3ZA 1WBJB 5LIRA 2LRHA 1ZQMA 2PWZA 2D3WA 2FPIA 5TS2A 4X71A 2RHGB 4HGPA 4UZEA 4DCVA 5IAOA 4N8EA 5HG0A 1JEQA 5E2AA 4B9TA 2C31A 4MVYA 2X0NA 1NQVA 3HHEA 5IH3A 2J59A 3LK6A 4L74A 1ECCA 3GQBB 5CA0B 2J09A 1LS6A 1YZQA 3C28A 1XC9A 4F5EA 3G9ZA 5BXYA 3GJZA 1Z18A 8ICSA 4HDQB 5JLAA 3TADA 1LTQA 1T6ZA 2C7BA 3AYXB 3PE3A 1HDOA 2IYLD 4RS3A 3WL4A 2C7QA 4FK8A 2C5HA 3UWDA 1I6LA 2QG9A 3QQPA 2ODGA 3ADPA 3IBSA 3WBBA 1JZQA 1VB3A 1MHPA 2IBMA 1Z2EA 1HPLA 1E2JA 2ZS7A 5THXA 3VUEA 4PZAA 2HGZA 2QTRA 3IR7A 3ENWA 3FWNA 3LS2A 2MIIA 5JE8A 4ZQCB 4YP3A 2X4DA 1SC3A 1NJ8A 2FLKA 4F60A 3DE6X 1R8SA 3I23A 1BNCA 4D8VA 1Z4KA 1XZ8A 2IZOA 3LZDA 3S2YA 4FZLA 1A2QA 4EZIA 4QNNA 2H7XA 3A1TA 3NR2A 3V4PB 1ADCA 4I3HA 3IV6A 5FWNA 2Q8QA 1UFKA 1EJ2A 1J25A 3EGVA 3NTOA 4WKPA 1ZNXA 3N8NA 3DTVB 4E22A 2POQX 4KXLA 3EDYA 1RE0A 3SNHA 3TEFA 3SS7X 5BV2P 1TCVA 3LCVB 4EX7A 4ITUA 4Y6QA 2GFIA 3C8DA 5D46A 1FP6A 1U7PA 3V72A 5BNWA 3C3KA 2P9CA 4FMPA 2Z4SA 4BVAA 3OQJA 1SU4A 1U8FO 3F73A 1ISIA 1ZK4A 2YXPX 3R20A 3JQRA 1L7BA 3A10A 2YBEA 1YHZA 3T3PB 1SGGA 3H4MA 2PRIA 1FXUA 4G23A 1MJNA 2C92A 4HY3A 4KQ1A 2O8DB 1UJ5A 1XTSA 3G6WA 1FQWA 1WVGA 4Y2JA 1ZMTA 9GPBA 3AN1A 1VHWA 1ZQKA 5FOUA 2W5UA 3STVA 2J3DA 1O1YA 1DCFA 2IYPA 1GUAA 1ZYUA 2JBAB 5IDQA 4CDGA 5JO9A 2HWYA 3WGVA 1T4MA 3K72B 1G21E 5EE1A 1LNQA 3Q7PA 1MBZA 1EGAA 3F5AA 3JR3A 5J9FA 4ZO6A 4DA0A 3JYHA 4S0ZA 5K8IA 3VSBA 4FR0A 3L2OB 1FPMA 2X5KO 3RFUA 3A1CA 4N0DA 1MVLA 3ROMA 3QBJA 2VHEA 1M34B 5JMOA 4FS1A 1H2HA 1V3VA 1XZLA 4P5DA 3N97B 3U17A 1U45A 3G8BA 1NC3A 4N8SA 2VANA 4LW8A 1PUZA 4R05A 4R98A 4C1BA 2RHLA 1QCDA 2XVTA 1KA9H 3HPRA 2QVCA 1IM4A 3OWHA 3C1OA 4A9AA 1UJMA 2ZUFA 5B1DA 1ENOA 2D2EA 3A1SA 3RU7A 5DT9A 1F2TA 1WHTA 4REOA 2VZ9A 1VLBA 2V7WA 1TZJA 3EOBI 3L6BA 3U4AA 1P7ZA 4UU7A 1V48A 3DO5A 4JR1A 1SR8A 1PR3A 3R6LA 2Q27A 2QTCA 2JAOA 4A3SA 1NV9A 3QZ7A 1MXFA 3A3OA 3KT8A 4PAMA 4HWSA 3SZOA 1P6QA 1PYGA 3RC8A 2IYXA 1AKQA 4GL2A 1IV8A 4MEYA 1M7GA 7ABPA 4N3BA 3E3AA 1KH3A 2GD1O 5C7YA 1RLIA 4CODB 4RA6A 3DLAA 1ZQIA 5ALKA 4JQCA 3OFSA 4KLMA 1FRFS 2PZLA 3W34A 3UB2A 1Z12A 3PGA1 3Q8RB 3NLLA 3PENA 4EL0A 3FJYA 4B79A 4EA8A 4KWTA 1GRQA 3ZG6A 1U8TA 1GV0A 4PLGA 2I65A 1M83A 4ROTA 3R7LA 1AUOA 3KV3O 2GSWA 4BFWA 2EZ9A 5ITSA 3VHLB 1L4GA 1W4BA 4OHWA 5T67A 1GT91 4ED7A 4CMGA 1E69A 3H5IA 1BPXA 5AR1A 4MNTA 1CY7A 4EBCA 1Z38A 1BYIA 2RIPA 1NVVQ 4GLOA 3A7EA 1CC1S 3HU5A 1FU8A 5C8XA 4M7OA 5KNCD 1J0AA 4OU4A 3U1VA 5B1IA 4CEJA 3FFXA 3MWDB 1RAHA 1BU5A 1UADA 4WLFA 5EEGA 2RH4A 4MDEA 2HA0A 4C7XA 3WDKA 1ACJA 1EDOA 2W2KA 5EPOA 1U8AA 3DVQX 1ULTA 3LUBA 3SSOA 1ZN9A 1DRVA 1Q0QA 1QNFA 3UJNA 4QL3A 3HHPA 5IM5A 5G40A 3FCSB 3QV2A 5KPDA 4DPLA 5FWXB 3HMKA 4MRMA 2HQSA 1F3LA 5DTIA 2VJYA 5TPZD 4N5HX 3QOYA 1JHVA 2JDIA 4FKZA 5KYNA 3QUBA 4CG1A 4L73A 3GJTA 1YJCA 2OZVA 3QX9A 1R0YA 1IHPA 4CLOA 1ULZA 1YR1A 2QQEA 1ZSYA 4L27A 3A11A 1AZWA 5DLDA 2FWIA 3VU9A 4RD4A 1DC8A 1ZNWA 1QBKC 2YMPA 4OO1J 1RTTA 2P6RA 4F4YA 2AA3A 2IY9A 2AGPA 3BH6A 3ZC3A 2X1LA 3DONA 2D5AA 2IE0A 2Y9TA 2IY8A 2RJOA 1NW5A 2VP3A 4MGKR 1Z7GA 2B4YA 4UATA 2MSCB 2FMKA 5HM8A 3VTKA 1QJCA 1C50A 4KTVE 4WPGA 1TKDA 3WFZA 4PX9A 4PZYA 4QZDA 4YPOA 5G02A 1CRLA 1M1UA 1NDHA 4DLAA 5IYZB 1E9VA 1E1DA 4L3WA 5CA7A 3I9OA 4I0WB 4JU8A 3T41A 2QTHA 1TTPB 1Q16A 2I29A 4IOMA 1PW7A 4IZHA 4YRIA 1WCXA 5A4AA 1WXHA 4YRKA 2VWHA 3VM6A 3CKKA 1UXHA 4MPDA 3WDLA 1X13A 4LNUA 5IARA 1Q0UA 1UKAA 4YP5A 2ATXA 5F5LA 1YNOA 3PICA 1CJKC 2Q07A 3O75A 4NV3A 3IAXA 1GFSA 3G1UA 1CRPA 2RG1A 1YIAA 5CAEB 4K6KA 3GJ5A 4D4GA 3E15A 2EKPA 2HJRA 3VU3A 1CF2O 3NVKI 2JLCA 2G0AA 1Z2PX 3MG9A 3I0MA 5JDIA 1IWOA 1L8XA 2WF6A 2H4HA 1Z7YA 5ALQA 1NK8A 2WINI 3FTDA 4MLCA 2XOXA 4GC6A 4TMKA 4RVUA 3BZCA 1QPBA 3K5WA 5EKTA 4ZAZA 4G0MA 3WGIA 4WIAA 2EYQA 2AW3A 3RHTA 3S0JA 5A0FA 4WESB 1R6UA 1UPBA 5EWJB 2C57A 2G1KA 3HGMA 3U3MA 2VYVD 1GR0A 2NU7B 3NTQA 4PIVA 3S3TA 2V45A 2CV0A 1KGSA 1QOQB 4ND8B 5T4FA 2II6A 4RORA 4F6CA 2C29D 4PC1A 2O07A 2YC2C 1MB0A 5EWLB 3UGKA 1TO1E 1CETA 1X0XA 3MWEB 2WTFA 5IJXA 3VYSB 4MFCA 4EUFA 3GLFA 3FVVA 3BHMA 1NU8A 2PXIA 3OPYB 2PV0A 3IQGX 1TB4A 3OZ7A 4JC5A 2WA2A 2ZBRA 1AQUA 2WTBA 3VO1A 1E7SA 5FO0A 1I80A 2I4LA 4H1VA 3NC1C 5DBGA 4TWIA 5LLSA 1HLDA 1M8PA 4H1UA 1VYUA 4BNTA 4WXRA 2VBGA 2YX8A 1KPGA 4YJ2A 3KU4A 5JYCA 3GLQA 3S2ZA 3TUIC 3RT9A 3D3QA 5CDSA 3KYIB 3NT2A 4RXUA 2ZRHA 1KE2A 5B2ZA 4PO1A 5ES3A 5B37A 3TI7A 4FEGA 3R5XA 1AGRA 3VZDA 1K6XA 1OBOA 3RIYA 5CFZA 1T10A 2DUWA 2J3MA 4CN9A 3H5WA 2QRHA 3DMPA 1I4EB 3L7DA 3C3XA 5FORA 4LWQA 2X0FA 2OHXA 3PR1A 3DAOA 1DJPA 5KCZA 3VZPA 2VCYA 3PB3A 5DQHA 1WG8A 1ZOSA 3D5TA 3NWOA 1OFUA 4BEVA 3CSDA 3CLSD 2O2CA 3KV1A 3FN4A 2VXBA 4QOHA 3JQ7B 3R23A 4Q93A 2CYBA 1EH5A 1LV8A 2CHQA 5LQSA 4MRSA 2XJ9A 2G0NA 4DCJA 3IVCA 1L4MA 1TM5E 2R8EA 2Z3VA 4NF2A 1BWRA 1SHJA 2BONA 4ACOA 1VPWA 1HFJA 3O84A 4UFPA 3IELA 4JBNA 3RFTA 4BTEA 1CTQA 4J2HA 3GZJA 3DBHA 5DLPA 3OBIA 4D42A 2G72A 2H8GA 3NM4A 2HBZA 5ALUA 5ALTA 1J5EB 1RU3A 3EQ7A 5DHPA 1E92A 2G36A 4ZOEA 3QPAA 4L6CA 4DDKA 3L0SA 2ENWA 3ECAA 1BSVA 1PX0A 1OBCA 1HNWB 4Y6RA 2B30A 4IOLA 2ZVQX 2O2HA 3EAGA 3FNFA 5KYWB 4A6PA 3HJNA 3W9SA 1P61B 4HTAA 2N47A 2H4ZA 4KPYA 1UC8A 1D4FA 3EZXA 2FCAA 3PEEA 5ARCA 2IXTA 3Q6MA 3INRA 1J8DA 3N59A 3OFKA 1EZ1A 1G3QA 4BMSA 2XNSA 2E82A 3H19A 2PMBA 3BF8A 4MWGA 2BDPA 2BGWA 3GLHA 5DTJA 5AK4A 4YN3A 2RJ3A 2WILA 1E6LA 5CT5A 1ZBDA 5JECA 4IH4A 5ERGB 3U4CA 4ARAA 4LE1A 3IPRA 2Z56A 4I2BA 3CW8X 5CFLA 4J0JA 2VLIA 5C9ZA 2PU7A 4PTLA 2Z8ZA 4BVEA 5JR3A 1BN7A 4I4CA 1SH7A 3HL4A 1DCTA 1NBIA 3SWWA 1YGPA 5FPTA 5FO1A 2X8JB 3EDMA 3TZ6A 5B3LA 4IUBS 3BMNB 3F96A 3UXNA 3IT2A 4BNDB 4HNGA 5ADVA 4W5WA 4YALA 4AECA 1I7SB 2XICA 2R60A 1RM4A 2IZ5A 4GPIB 5CVVA 4K4IA 2RJNA 4F9GA 2G0TA 2M6LA 2OORC 1RZ3A 2PQ6A 2OB1A 4AG3A 5SY9A 4YMHA 3C3CA 5E0OA 3X1MA 5CRIA 4FOOA 1BHJA 2BZFA 2JF0A 4WJZA 3VR5H 1Z6ZA 1HC7A 2YFYA 1VPVA 1YDEA 1YR2A 5JSQA 2GZAA 2C2EA 4EDHA 4X6YA 2B94A 1U11A 3FLAA 3K3PA 3M89A 1L5MA 4X8OA 1I10A 4IMPA 5AVOA 3ZTWA 5IG2A 1S0MA 4ENRA 1GGMA 1SZCA 2K7ZA 4P92A 4UBBA 4XZ3A 4C7JA 1E4YA 4E7PA 1IEWA 5JAIA 2NUAA 1P2TA 1D2RA 4MUIA 3GZTB 1NW3A 3SX0A 4BMXA 1F0KA 3I2GA 3U19A 5EYPA 1ZHOA 1OD6A 4TYQA 1NKCA 3D3KA 3IP1A 4JNCA 1UK7A 3EIXA 4U1RA 4KPUB 3PI7A 5BSRA 1SUBA 1ADFA 3MT7A 2C8JA 1XZKA 4MAFA 3C2QA 1KP9A 3BMXA 3P27A 4MQMA 4V39A 4BDSA