3L5KA

The crystal structure of human haloacid dehalogenase-like hydrolase domain containing 1a (hdhd1a)
Total Genus 75
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
75
sequence length
233
structure length
233
Chain Sequence
LYFQSMAAPPQPVTHLIFDMDGLLLDTERLYSVVFQEICNRYDKKYSWDVKSLVMGKKALEAAQIIIDVLQLPMSKEELVEESQTKLKEVFPTAALMPGAEKLIIHLRKHGIPFALATSSRSASFDMKTSRHKEFFSLFSHIVLGDDPEVQHGKPDPDIFLACAKRFSPPPAMEKCLVFEDAPNGVEAALAAGMQVVMVPDGNLSRDLTTKATLVLNSLQDFQPELFGLPSYE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The crystal structure of human Haloacid Dehalogenase-like Hydrolase Domain containing 1A (HDHD1A)
rcsb
source organism Homo sapiens
molecule tags Hydrolase
molecule keywords Haloacid dehalogenase-like hydrolase domain-containing prote
total genus 75
structure length 233
sequence length 233
ec nomenclature ec 3.1.3.96: Pseudouridine 5'-phosphatase.
pdb deposition date 2009-12-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13419 HAD_2 Haloacid dehalogenase-like hydrolase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.240 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 Putative phosphatase; domain 2 3l5kA02
3.40.50.1000 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold HAD superfamily/HAD-like 3l5kA01
3QUBA 3CNHA 5E0OA 4L6AA 1U2TA 1RDFA 3N5KA 4DFDA 5ALSA 3QU5A 2IYEA 1RC8A 3NUQA 3P96A 3L8HA 2HOQA 2P69A 3SKYA 4UAVA 5AKIA 4YIKA 4YCLA 2IOHA 4E88A 5ALGA 2RB5A 3U26A 4Y2UA 4XQ0A 4CF5A 2I55A 3A1DA 4Y2SA 2I33A 4HGQA 2CFTA 2HHLA 3W5BA 3QUCA 3L8FA 5AW3A 3EWIA 5ALPA 3KD3A 1TA0A 1Q91A 5A3RA 2OBBA 3DNPA 3K1ZA 3WK4A 3U7HB 4KX5A 2WF9A 2FPRA 4Y2PA 4RETA 4UAUA 1TJ4A 1WR8A 4BX3A 3ET4A 5AI9A 3NRJA 2WM8A 3L1UA 1ZD5A 1U7OA 1L6RA 2NO4A 1ZOLA 3QUQA 1NNLA 1RRCA 2Q4TA 2VKQA 2RBKA 3L1VA 4Y2YA 2NYVA 2GHTA 2ZBGA 2RAVA 2HEGA 4O8CA 4HGRA 3ZX5A 3NAMA 3L5KA 2QLTA 4UARA 5AW2A 1PW5A 4OD0A 3L0CA 3ONNA 3OCZA 4ZEXA 1L7MA 3QX7A 3AR5A 2PR7A 2G07A 2GO7A 1Z4KA 3NALA 1YMQA 5ALHA 4L57A 3OTQA 4J03A 4C4RA 5AK4A 3ZVMA 5AKKA 1J97A 3D6JA 1Y8AA 2AMYA 1YV9A 2WF8A 3NANA 2PKEA 1Z4PX 4UU1A 1WPGA 3AR8A 5AVTA 3QXGA 3UM9A 3PCTA 4OCZA 4NV0A 4MUMA 5AESA 1Z4MA 5AI6A 2JAWA 2G80A 3KOOA 2JAOA 5IT4A 4HYTA 1O08A 3AR7A 5A3QA 2YMMA 4AP9A 5AICA 1T5TA 5ALZA 4UMDA 3WKCA 1RMTA 3U7FB 5AW4A 5ALIA 2FUEA 4NFLA 2I54A 4KNWA 3RF6A 3SLRA 3UMGA 2ZOSA 4NAVA 3FM9A 2YJ4A 2D2VA 2B8JA 4MWOA 2ZG6A 3QU9A 3U19A 2CN1A 3ET5A 2RARA 3ZUPA 1VJRA 3E8MA 3GYGA 1JUDA 2R8ZA 1SWVA 3WKDA 4G9BA 1N8NA 3CZ4A 3BWVA 4XE5A 3U7GA 3L0YA 4BBJA 2BDEA 3TLMA 5IS2A 5ALJA 1Z4NA 5ALQA 4XPZA 1Q92A 4QJBA 4BKMA 5AI4A 2P9JA 4NABA 3NIWA 4YCMA 5AI5A 4UASA 1CQZA 4CF4A 4H1WA 3OCWA 1RKUA 5AVUA 4FYPA 3W5AA 2YFYA 3ZTYA 2FDRA 3WKEA 2FUCA 2I7DA 4CF3A 3MN1A 1LVHA 4GIBA 3PGLA 2HF7A 1ZRNA 4OFZA 1NF2A 4OHFA 1FEZA 4Y3UA 4EZEA 3AR2A 5JJBA 5AM0A 2GHQA 4BYGA 3WK7A 3WK6A 1ZRMA 3L7YA 3ZI4A 2C8KA 3L0BA 2HCFA 1LTQA 2WF7A 1YNSA 3DV9A 4PNHA 4FFDA 3DDHA 3ZVNA 3U7EB 5AM4A 3OCXA 3EF0A 1RMQA 2EATA 4UMFA 2B30A 3ZWDA 2WFAA 4AS2A 4UM5A 2R8YA 3M1YA 3HLTA 5AM5A 3ZVLA 3OCUA 2OA0A 5ALTA 2Q5EA 1N9KA 2FPSA 1RLOA 1ZJJA 5AKJA 3ED5A 2AH5A 2W11A 4Y2VA 1RMYA 3BA6A 5ALLA 3DAOA 3ZW7A 5AVSA 1Z4JA 1XP5A 2B8EA 2JAUA 4EEKA 5ALEA 4BEWA 5AM3A 2IOFA 5AM2A 3I6BA 1CR6A 2I6XA 1RLMA 1Z4QA 2YMPA 3ESQA 4Y2JA 3ESRA 3N8GA 4EENA 5AVQA 3IRUA 2MU2A 3E81A 2B0CA 3IB6A 2OYCA 2W43A 3ZU6A 1RQLA 5AVWA 2Q4RA 3I28A 1KYTA 3B9RA 5AW0A 2HX1A 1Z5GA 4ZEVA 3QU4A 1ZD3A 2OM6A 2HF2A 3OCYA 2I34A 3QUTA 3I76A 1SU4A 2HDOA 4CE6A 2B1QA 2HI0A 2NO5A 4CNQA 5AK6A 3SKXA 1QQ6A 2ZBDA 4KX3A 4QQFA 5AKZA 3A1CA 4IFTA 1NRWA 4DCCA 4UMEA 5AKHA 2EAUA 5AIAA 1K1EA 3QYPA 3E84A 5AW6A 4BEVA 3SD7A 4HGPA 3A3YA 2BY4A 5AI0A 3QU7A 4Y2XA 3UMCA 3WK5A 1RPZA 4I9GA 4YH1A 2G1AA 5AHXA 3AR9A 3A1EA 2C8LA 1XPJA 4DW8A 1EK2A 5AW9A 1S2OA 2W4MA 2CFRA 5ALRA 4HGNA 5AKLA 2R8XA 3U13A 2GMWA 5AW5A 1YDFA 1TE2A 3FPSA 2FI1A 3J7TA 5ALYA 2P11A 1T9ZA 3EPRA 4KN8A 2FEAA 3F9RA 3I1YA 3N07A 3WGVA 4FE3A 2G06A 1Z4OA 2YN4A 2PQ0A 5AVXA 4DWOA 3L8GA 3QU2A 3W5CA 2MSNA 2ZBFA 3PGVA 2IOFK 3MC1A 4HGOA 4C4TA 4ZEWA 4YCNA 3WKBA 2BDUA 5IT0A 2ZBEA 3KC2A 5T41A 4UU0A 5AI8A 1U02A 2R8EA 3SF0A 4HAIA 2YMLA 5AVZA 3ZTWA 1O03A 5ALUA 3OCVA 5AW7A 3FGOA 4JDPA 1Z5UA 2CFSA 4EX7A 5A3SA 3FPBA 2P27A 2JGAA 2YY6A 5ALVA 2GFHA 3FZQA 1ZD2P 1F5SA 1VFPA 1L7NA 1AQ6A 1TJ5A 2X4DA 3B9BA 2IA5A 5ALXA 5ALNA 1X42A 1S8OA 4UATA 5AKYA 1YS9A 1ZD4A 5AK5A 1RLTA 1Z4IA 3RFUA 4UM7A 2YMQA 4J2TA 5FP0A 4UMVA 2C88A 1L8OA 1ZS9A 2O9JA 2QYHA 3EF1A 4BNDB 1QQ5A 4YGYA 2MU1A 5AVYA 4B6JA 1XVIA 1QQ7A 3AR6A 5AW1A 4Y2QA 1T5SA 4F72A 2C9MA 1WVIA 3AR4A 2WF5A 3R09A 4EX6A 3KZXA 4KYTA 2G09A 1QYIA 4G63A 2FPUA 2B1RA 4YIHA 5ALOA 3B8EA 1IWOA 2HO4A 5AKEA 1Z88A 4XOUA 2HSZA 3WK8A 3VAYA 5AM1A 2O2XA 3SHQA 2AUTA 3R9KA 4AS3A 3R4CA 2B82A 1SWWA 5ALDA 1TJ3A 4NWIA 4Y2TA 4Y2RA 3FVVA 3HYCA 3AR3A 2FPXA 3MPOA 2C4NA 3QNMA 3M9LA 3WK9A 4IG4A 4BNDA 3PDWA 3S6JA 3SMVA 1RKVA 5AVVA 2YJ6A 3ZWKA 1J8DA 3NASA 2YJ5A 5AKGA 1Z4LA 4UW9A 3W5DA 1L7OA 2YBDA 3OPXA 1U2SA 1U7PA 1EK1A 2DQSA 4C4SA 2ZXEA 4I9FA 5AVRA 5ALFA 5AIBA 2EARA 3L8EA 1YJ5A 3MMZA 4JB3A 1RKQA 5ALWA 1QH9A 4KNVA 2G08A 2WF6A 3N1UA 1MH9A 5ALKA 4GXTA 2YJ3A 1RQNA 5ALMA 4L6CA 4BX2A 1L7PA 3IJ5A 4BX0A 5AKXA 2G0AA 5AK3A 3UMBA 3N28A 3QGMA 1WZCA 2AGVA 2ODAA 1VJ5A 3WKAA 2FPWA 3E58A 2JARA 3QLEA 4F71A 4RESA 3ZX4A 1L8LA 4EELA 3WGUA 5AW8A 3KDPA 2WHEA 3KBBA
chains in the Genus database with same CATH superfamily
2OD2A 4IG9A 5HTKA 1Y81A 1BCRB 2RIPA 1JWBB 3S28A 5H0IA 3EZ2A 5CDGA 5KS2A 1DAFA 5ILQA 3TLZA 2ZJ6A 2ASJA 1ELOA 1YZ3A 2R8IA 2CJXA 4GR4A 4H08A 3NEYA 4QU9A 4H7EA 5L3QA 3AEVA 1E3WA 4CL8A 3H19A 4FQ5A 2YVUA 4OI4A 5G4LA 1ZN7A 5KTRA 4RV5A 2A35A 2BFAA 3GD5A 4WV3A 5JQGF 4TT3D 1NBMD 4CEJB 2HQOA 4DPMA 1N3YA 5KFKA 2O3TA 3KU1A 3U26A 2HC9A 2PT9A 4RZSA 3INGA 4Z0TA 3N76A 3ZDBA 1T36B 3ZLVA 5KQPA 1IFXA 2GB4A 3PQ7A 4DHWA 3QW2A 3MWJA 421PA 3MOIA 2BPCA 4GXNA 2XIJA 4C0LA 2R4QA 5F2EA 3VX4A 3EVDA 3AF3A 1NVTA 1KRXA 4WZZA 1NLFA 4PU0A 4CMAA 3H05A 2QX4A 4WNYA 5F4BA 4KVAA 2ZRMA 5A3RA 1PG2A 3IALA 4O5AA 4KKXB 2FGJA 5FUXA 3EWAA 4WCDA 3COJA 1XTKA 2HF8A 5KSWB 1FW6A 3H1FA 1ZCAA 1J0BA 1ZQCA 1O95A 3EIUA 3JWGA 5KHAA 4ER7A 4CM8B 2GBFA 4K26A 3H4DA 2ZKLA 3E82A 3S55A 1N60A 3OMLA 5CD1A 3JARA 3P45A 2J85A 4RE5A 4FC6A 4EG3A 1MCZA 1W5AA 1S1MA 2O0MA 5JROA 4XQCA 4U3JA 3ZBUA 3X2EA 3SEAA 3OQIA 1JGTA 3I2KA 1SBYA 1AT1A 1ZMBA 3LFHA 1GL6A 3HCDA 3ZE1B 1RRCA 2IYUA 2CLDX 3D5TA 1XU4A 3LXRA 4YJ3A 3RS5A 4HXGA 1GRQA 4ILEA 4URZR 2E8PA 5J0PA 4EYEA 3ORFA 4J9PA 4HVAA 4B9AA 1IQUA 5CD9A 3ANTA 4P34A 1AROP 2Q6TA 2QGFA 1H0KA 3WYFA 4KXWA 1NQWA 4ECQA 3R7BA 4ELTA 5A4IS 2C2RA 2Z2IA 1L7MA 1ZA2A 2V7QD 1FLNA 2GN4A 6GPBA 5IUNC 4EHAA 1TM2A 4CHGA 1QB8A 2O6HA 2D54A 3KRTA 4A4DA 2GO7A 3NALA 1P1KA 3SKVA 3ZW8A 3GIMA 1C9NA 4Q48A 2UUBB 1M73E 3M89A 1R0LA 4X65B 1JAXA 4HEHA 3OZAA 3IL2A 3Q4GA 3JQPA 2NZXA 1TC2A 5JNRA 4U9HS 1KNXA 3DBOB 3C7TA 3NHYA 2JLYA 1H9CA 3BFVA 2BFPA 4QDKA 3AU2A 1CR1A 1P1RA 4QWEA 1DV1A 2WWIA 4CLRA 1V5EA 2WWYA 2JEYA 3C6MA 4PIPA 3WBFA 2VFAA 2CNDA 5BW8A 1SUEA 1W88B 3G2LA 3ILXA 5C2JB 4EOGA 3BQNB 4MK4A 1WLYA 4F9GA 3GJ4A 8ICKA 5CU7A 4K9DA 1KTQA 3NBKA 3D7SA 1ACMA 8ICMA 2X7XA 2ONCA 1SIUA 2PMWB 4JVNA 1XE3A 2XT9A 4BMYA 4HT3B 1W87A 4G25A 4MR7A 1F7VA 2OCBA 2LW7A 3BHNA 1X7WB 3TZQA 2YWDA 2BDPA 2G3YA 4ZT7A 4B3HA 1ESEA 3FCOA 1TFUA 3RJFA 4G6ZA 4GRAA 2C4UA 2JZBB 2M6RA 5K4LA 5DGIA 3DEIA 5F5NA 1MO3A 1UJCA 1IY1A 1J39A 4JLAA 4A1OA 3A4TA 4DR1B 1UPHA 3JQFA 3QY0A 3RH0A 4Q8FA 1DQPA 5FPSA 1DBSA 2PBLA 2OC9A 1VG1A 2P7IA 3DE3X 3DD5A 3DFIA 3EUFA 1NMYA 3BMQB 3SR3A 1EA7A 3F1LA 4EI9A 4X7RA 2CLSA 5EWMB 1VB5A 2BFBB 4DA4A 4MPTA 3RF6A 2VBCA 4K6KA 2W4QA 2RP5A 2BR4A 2Q0HA 4NAVA 1U0NA 3EPGA 4RU9A 1BHJA 4EY3A 1SD5A 1ZQ9A 3FLEA 4WDRA 3FNGA 2ZULA 3FYUB 4IIJA 4KGXA 3GVHA 4XX0B 5DBIA 3T5PA 4DQXA 4Q05A 1SK8A 1TNDA 4TN1A 5B37A 4A5OA 2CN1A 3H2IA 2IQIA 3RU9A 1DHTA 4YQEA 5JBQA 4CV1A 3L4PA 3NVYA 2H07A 5BWNA 2RGWA 2PX6A 2QUAA 1KJ8A 3HS3A 4FNAA 1JEAA 4YO8A 4BNNA 4DJ5X 3GRZA 4L5BA 5EWEA 2O06A 1GNSA 1O4VA 4K5QA 3CZ4A 2E49A 4MS4B 3OLCX 1GGFA 3QMVA 4I2DA 4ZICA 1XMXA 4DCJA 3EUEA 2CEKA 2BDEA 5KG1A 2P9HA 3C8HA 5ALJA 4KLFA 2VG8A 1G64A 1SHKA 1XDBA 1YR3A 4Y1FA 1I6WA 4ABYA 2GZDA 2I2BA 3NIWA 4K6OA 4R31A 1ZRHA 5DSTA 3T7JA 1P7VA 4FB4A 4OJYA 4PRKA 1BXZA 3FUWA 4NBNA 3E4DA 5JUMA 1T8TA 2AN5A 3EIFA 4EJMA 3CVVA 2QB0A 2R3SA 2YUIA 3JRXA 2KIVA 3QPBA 2JLSA 1BD3A 5EG5A 1XZEA 2JI9A 1W4ZA 2W2XA 3GMIA 3GCGA 5CG1A 3QMPA 4QE3A 3GEHA 3LL7A 1P1IA 5KYWB 4FD2A 1YQTA 3MN1A 3NXKA 3O38A 1QGDA 5FB3A 3TW6A 1VJTA 4EQ6B 2GJ4A 1ZQSA 2IL1A 3AY6A 4UUNA 4TKUA 1FEZA 1M34E 4OGGA 4QUGA 2Y9UA 4UAWA 1CK4A 2WPNA 3CN9A 4XI9A 3BN3A 3QHQA 4RV4A 2PLRA 2L0XA 3RJ9A 3V80A 4AUNA 3H0MB 1J20A 1QIIA 2I1WA 2PSEA 3GNQA 4P35A 4F21A 1BPZA 1IBRA 5JCOA 5JMWA 5CLHA 8AT1A 4J91A 4D41A 2P4HX 3HGMA 3TM5A 1OJLA 1WVMA 3DM5A 5LQUA 1AKRA 1Z5NA 1E63A 2EG5A 3LWDA 3PKZA 4RQTA 3OF2A 3DPIA 2WF7A 1C9JA 1JVSA 5ECDA 3V4SA 1FFUA 5C7IO 2JS7A 1N8KA 5J0XA 1TDJA 3ESCA 1N0WA 3OQJA 5IXJA 4P0QA 1NXWA 1XVVA 1Y89A 3QVGB 1NQ5A 1NMEA 2REOA 4OIMA 3NIGB 1CZUA 1P5HA 3E2IA 3LOQA 5CM9C 3UWOA 3QXXA 4L73A 2F44A 3GHYA 3V9PA 2PM8A 4ZAXA 1C3OB 3AMZA 1QE0A 3BDPA 2XNKA 3KU4A 1HEKA 3VJKA 1DWOA 2YZNA 3UA4A 1W36D 3QTLA 2WIAA 1RYRA 4P3NA 4RK1A 3EUWA 3ICVA 3IJPA 3GAZA 1U9LA 1SIWA 3GFPA 3T06B 2KJ8A 4XASA 3IV6A 1Q0PA 2FPSA 4WOKA 3K70B 4F4YA 1XROA 1SC4A 5ELMA 1H9AA 5CB1A 2C2ZA 2W8BB 1NK0A 2X41A 4FFLA 4PLCA 5EFOA 1GCGA 1GZ6A 3KKPA 4XTCS 2X40A 2DQKA 2VJPA 2ZUUA 5LA6A 1OU0A 1TU0A 4TZ6A 3SGLA 1IXZA 1KJZA 2F62A 3ZKWB 2B8EA 3W4JA 5LNK6 4EEKA 1Q2XA 5IARA 2HSDA 2R87A 2WB4A 2CYBA 1V37A 1KEJA 4GI2A 3OZGA 4FMBB 5CLGA 2B7BA 3ZTTA 1XO1A 4CLHA 1DAMA 3DPSA 3P5BA 3PW0A 5FX2A 2XCQA 1NVKA 2DB3A 2NWQA 1XJWA 4NONA 2XY4A 2OZPA 2QARA 5FUWA 3VZSA 3RWBA 2C5AA 2D1YA 1ZISA 1Y4ZA 2HHJA 3BHIA 3IULA 5BT8A 3ANMA 1J0XO 4OQYA 1G5TA 1L4MA 2DLCX 5LMUB 2QV7A 1FFXB 2VHXA 3L4BC 1VLZA 3PL1A 3Q1KA 3TAUA 3W90A 4ALIA 3KUDA 1E0SA 3VX3A 1P1JA 2R2GA 4FZLA 3D1JA 4RFLA 4B8WA 4RTRA 1PNVA 4G81A 3NWPA 5DXAA 4ZT5A 3ZCXA 4AKTA 2O8FA 5GJBA 2QD3A 2HRZA 2XCSB 4PONA 1LC0A 3FJ1A 1SU4A 3O31A 2DL0A 2QLMA 1XCLA 3OQBA 1UP4A 3IE2A 3PQ5A 4R5MA 1C0KA 4RSMA 3B7GA 4JBNA 3AF1A 3KETA 2XB4A 3DQQA 4UHEA 1BPDA 1YRAA 1C29B 4YLYA 2PGDA 2XBLA 3MFIA 3I04M 1BH2A 1G0NA 5C1IA 5T4BA 3UCEA 4AZTA 2BTOA 2BVNA 4HEQA 4OQNA 2Z3ZA 3B3AA 4ERNA 4TRMA 2QYOA 2NACA 1PO7A 2OTCA 2X4IA 1NRWA 3G82C 1JXMA 2VDJA 1V9LA 2CCKA 2WG1A 1C3JA 5D84A 3ZUGA 3WU2U 3GOQA 3WIOA 2CHFA 3KB2A 3DVQX 3GEMA 4INPA 4PO9A 4XYMA 2AQHA 5CMLA 3FOWA 4FCVA 2YXEA 4N5IX 4Q5IA 3VO9A 4EJSA 5FYDA 3UG7A 3DDSA 5J29A 3PNLA 3DTVD 4RLHA 1CJTC 1XR3A 4JWNA 4QPCA 4Y9RA 1B42A 1BA3A 1XZAA 3KT8A 5B3KA 2QZSA 4NK4A 1XRJA 2CXNA 4CHTA 1C8VB 2Z57A 2AOTA 4CTOA 2CNLA 2F8KA 5ITSA 1J5XA 1OTHA 3LWZA 3MUFA 4J75A 1QLJA 2PBZA 1U90A 3L7IA 4Z0HO 1X1DA 1P1BA 3NHZA 1K3FA 1SUWA 4NLGA 2P2NA 3EXIB 3R40A 4GSKA 4O02B 2DBVO 4IQ0A 4TROA 3TB4A 3PIDA 4OMUA 3N6XA 2K8AA 1O6GA 3GBSA 1P0IA 2RG1A 3UV7A 2NU7B 4TMVA 5ALYA 1F38A 3QHPA 4TL6A 2UAGA 3TECE 4KBFA 2VDWA 3TADC 2DKXA 1DBRA 4FE3A 1RXSA 2Z1DA 4QAQA 5TQ2B 2HHSA 2D1SA 3OE4A 3A6PC 3VJRA 1GR0A 1N4AA 1V1MB 5SZHB 1KDTA 3NAGA 3AJDA 3HMKA 4LXTA 2H6EA 1FMCA 3C8MA 3EEIA 1CI4A 5FR2A 5CDHA 2ZUWA 4AQYB 1UH5A 3H2BA 3V1NA 5FBRB 2B69A 2J45A 4DEXA 3O91A 5H68A 4AULA 1EUYA 3RUPA 3LX4A 2H4ZA 1SBHA 3LMKA 1P0FA 2P79A 4PWZA 5KVQA 3SF0A 4PTYA 2BJVA 4TXNA 1LEHA 3GJ0A 4H7IA 3ADBA 3VDNB 5DGXA 1HNNA 3U44B 1BPEA 2GOLA 4D9EA 1JEYA 2ILTA 5CT6A 4RYLA 4DV5B 5E6RB 4RQBA 2O1XA 3AZOA 2BSQA 4RACA 4YAWA 2ZRCA 3UYLA 5A7FA 3DCIA 2GEUA 1N33B 1DEKA 4L0MA 1EESA 3C7CB 3BEDA 2ASDA 4PF1A 1U3DA 3GPCA 5JCPA 4KQ1A 5E4FA 1L7NA 3AC0A 1A5ZA 3H5LA 1Y5RA 2RDMA 4HN4B 5M3BA 3IOMA 4A6PA 3OZCA 4EL0A 1C4OA 3TEFA 1T3NA 3RAFC 5LXTA 3LC7O 1DAPA 4YJHA 2IU0A 1HGXA 5CFNA 1YE5A 5CFOA 1AUXA 1U9YA 2IU4A 4OFWA 1Q1BA 1WCNA 2WW8A 2FJ0A 2ZVQX 3EGCA 2VPQA 3GVCA 4H35A 2ZXFA 1ULZA 4GZ6A 4C0SA 4UTPA 2YMQA 1FZTA 1FYVA 2P9TA 3DMDA 1ISSA 2ASLA 1WPXA 1ZS9A 4IXNA 4YAFA 2Q29A 5IVDA 5CA0A 4BNDB 1SY7A 2R1TA 1QF9A 2R25B 3OUTA 3Q8RB 4PBTA 1ENOA 3HUTA 4WKCA 3FOAA 3REQA 3HJAA 1CEQA 4FYWA 3X1KA 2D5CA 3N53A 3RYFB 3U37A 1ZH4A 2ZZMA 4GR9A 4EY7A 4YRNA 3DGEC 3IYLW 3KZXA 5CLFA 2SICE 3RJGA 5ICFA 2GPTA 1GTVA 4AURA 3I1FA 1V11A 4U6PA 4FHCA 3A9CA 3OZRA 5T5QA 4QOHA 3W8FA 4D82A 4YRBA 5JBNA 1GHTA 5DHUA 1F8YA 4I9NA 2B0JA 1J2RA 2CZGA 5EPEA 2CSUA 4W5NA 1ZGBA 3GPBA 3OJLA 4JLUA 1W7AA 3FSEA 1QGYA 2FF5A 3GG9A 1Q1EA 3GJ7A 8ICRA 2R7NA 4GP9A 4XWOA 1AXRA 3CZCA 3VR2D 1DRJA 1BGWA 1EHCA 2Q0ZX 1IVYA 4GPZA 4YROA 2P5YA 1JEEA 1RWQA 3C8ZA 1JR3A 2B82A 3EC7A 1EK5A 3L0PA 4OGFA 2GXAA 2A92A 4D25A 4EA7A 4MR8A 4BWVA 1NJ2A 1RC1A 2V5UA 2XUFA 1WHTA 4J16C 2IV2X 1XCBA 3W2EA 2OMEA 3VU9B 4RTPA 4LF6B 2HWYA 3RT9A 3I5XA 5KJFA 1JIXA 4I5IA 3TCXB 1I2BA 1AKVA 4QZGA 3L1JA 5BUSA 1HUQA 1ZQYA 1J24A 2PBRA 2X6RA 4OKNA 3U2QA 3SQIA 3VM6A 2O8EA 3BTUA 2IZOA 3RM3A 3ZK9A 4G26A 3ONVA 1LF5A 2AK2A 4GXIA 3B3FA 3TRDA 5KWEA 1OOEA 2CL0X 4RT2A 3BMOB 4QNNA 3DEFA 3P0IA 3H4VA 3A3KA 3MJSA 4D8TA 4F4JA 1NM5C 1ZK3A 5KFBA 1YIAA 1ZM7A 3B8HA 2TRSB 2F1KA 4D45A 1MBZA 3UJ3X 3U6KA 1Q20A 2BP7A 4YGXB 2JCSA 1Z2AA 1W36B 3A3NA 2IYAA 2X0RA 5L1KA 3S3TA 3SYKA 3WSVA 2KBFA 3P94A 4GU5A 4OYHA 1ZM9A 3C6QA 3KALA 2PVPA 3ONEA 4J9KA 2OH2A 1WU7A 4JUBA 2LCIA 1U0FA 5AIBA 3P9IA 4KHZA 3ZWVA 3E22A 2CT8A 4XJSA 1X8KA 1GV1A 2WE7A 1KSPA 2YBEA 3RVSA 4QRDA 3KQQA 4OU4A 1QH9A 3JASA 5TB5A 4UHHA 1AK9A 1CCWA 3PSPA 4YJGA 1QIFA 3ZWAA 1IV8A 1JPVA 1R16A 5A0TA 2HDWA 4RYDA 5CVEA 3NEAA 1KC1A 1F9AA 1LW7A 2FUG1 3MGVA 2B2XA 2CNOA 4DJTA 2C3UA 1T5IA 1L7PA 5DB8A 3AOEA 1K6MA 1QX4A 1UKCA 2IYQA 2G0AA 1Z7YA 2XJ4A 4UPVA 1X9GA 1D2RA 3QGMA 5CAEB 3MUEA 4I5GA 2ADOA 2B36A 2BEWB 1AGNA 2HRRA 1JAZA 4FNMA 5JVDA 4HQKA 4HAUA 4HQLA 3U5TA 4OJTA 2JIQA 3BF8A 4NECA 1BC5A 2NXJA 2PA0A 3AUSA 5AJYA 2Y4NA 3HZHA 4BBZA 3L5OA 4B84A 5JH7A 5HNKA 2BFNA 4XVHA 1NRJB 3K0CC 3O8LA 3QVSA 4V1CA 1ZQJA 5EQJB 3UVEA 2CL7X 2F43A 5IJ0A 4JT4A 4CIDA 5AOCA 5EA2A 4BP9A 4DMGA 1YFJA 2NTNA 5JEDA 1XZKA 1JEQB 2HJSA 4J0HA 3ZBTA 1P33A 3FKJA 3IEKA 2RK6A 2YTUA 1SELA 2BE9A 4BC0A 4TXMA 4CDRA 1W2WB 3K70C 4ELVA 221PA 2ZWMA 2YY7A 3PPVA 1EVJA 4Y6RA 3U7RA 3AH8A 4V03A 1NBHA 2ZT6A 4D9KA 1QK4A 5KCZA 4ZTBA 4I4TA 4TWZA 4E7PA 3FOBA 4EB0A 1FJHA 5AOBA 2BHNA 1PSZA 4DFMA 2LM1A 1F2TA 2X5KO 2ZW9A 1HKHA 3L84A 4OSPA 1HK7A 5E6UA 2RB5A 1N6LA 4M0MA 5B4VA 4MQUA 2GS9A 4LJRA 1ZK2A 2NZYA 3UHFA 4MVJF 3DL4A 1KEVA 4OL0A 4QSHA 2GXUA 2WT9A 4ZGBA 9ICCA 3C48A 5HR7A 2INGX 2HT1A 3DC2A 3MRTA 4JENA 2R5FA 3CLRD 3USZA 4QYXA 2D0IA 3EDRA 4GVLA 4UTZA 3CX7A 3LPAA 1RJGA 4IQTA 4J9RA 1NI4A 4CCYA 1FLVA 2Z83A 4L07A 1E3LA 5IH3A 2ON6A 5K99A 1FUYB 1JR4A 1O77A 5CA1F 3DNPA 1QZZA 4EMSA 3V1LA 3ZGVA 4FOSA 1JPUA 1M2KA 4AJ2A 1X2EA 2X58A 5CDSA 4ZEMA 5LXTB 1HZZC 4RETA 2OVBA 5CHEA 3UK1A 1JJIA 3W5IA 1FU7A 3Q7EA 1ZWLA 4RA9B 1FXWA 5IIMA 4JEHA 4XGIA 1GLGA 4B0OA 4RABA 2IBSA 1QR6A 1U4SA 1VSQA 1KY5A 3C3KA 5KG7A 1YS1X 4EG0A 4BKUA 1U65A 1E1DA 1C4KA 1XG5A 1ZQHA 3FDFA 1ZD9A 3EXG1 3SZLA 4QWWA 2BSXA 4WWHA 3CE6A 4FIZA 3WZMA 5FUYA 3A4NA 2NVUB 5BY2A 2XOKD 3FGPA 4PSCA 1YUMA 1Z74A 1KJWA 4GPEA 2X9LA 3A9TA 1OAOA 1PW5A 4JT2A 4BB5A 5J0UA 5H83A 3WO1A 4QU5A 1CZKA 3MW8A 5KZMB 3TBKA 2ZCJA 1A2KC 1ODFA 4BNKA 4L8FA 3O3MB 2A9OA 3A04A 1XU7A 5JQWA 3BM5A 1Z75A 1P8AA 9ICGA 1NAIA 1PNTA 2RKWA 3NDRA 1UINA 2RK4A 3OTHA 2P4QA 3QE0A 4NHOA 1DBWA 4F7DA 4FSHA 4OX9Y 4I27A 3GD7A 1HTWA 4Y98A 2ZAYA 4ZZ2A 2JLBA 2WHPA 1JHRA 4CF6A 1V1MA 2WM3A 5GMOA 3VR5H 1SUDA 2AMYA 4PV7A 5AP9A 3ACBA 1WXEA 1EUDB 1FP4A 4BJ5A 3RSZA 1XHLA 4YB8A 3H3FA 1JMYA 3I53A 5EUMA 3KB6A 1A9YA 4UU1A 3N58A 5DTMA 1L5KA 5KT3A 2J6HA 5JS7A 4OTZA 1TKBA 4US1R 3AETA 2WK1A 4FZMA 5DX1A 3CRQA 2ZRLA 3H3XA 3P32A 4G9EA 3DBLA 3FXAA 3D43A 2V3CC 1TT7A 2Z8XA 4Q44A 3SR0A 3MGBA 1JLLA 5AI6A 1ZN8A 4BVKA 4Z7JA 4MYCA 5FF9A 2IH2A 1U8ZA 5KYUA 5KFIA 3BE4A 3NGXA 4B3BA 4DY4A 2DUNA 3LP8A 1OBHA 1W6UA 3K32A 1YQWA 2EZ8A 3MT8A 2YMMA 4DANA 1NU6A 4DV0B 4HB3A 2BFMA 2X0IA 1KETA 1PFVA 2W7OA 1U5BB 1FCJA 1V7PC 3D6AA 3DT6A 4EG7A 4DUGD 4UBOA 2P1RA 1E79D 2FCAA 5FO0A 1PHPA 1F44A 3WNBA 4IDHA 4DKJA 1SUSA 3RO7A 1KY2A 2YDXA 3DDNA 3AM1A 5MHTA 4WAUA 4WDQA 2BM1A 2RFLA 1V85A 1J42A 2ZM6B 4C7JA 4HF7A 1RXUA 5H80A 4AMGA 1DFHA 1XHFA 1ZWKA 2CKDA 4DYVA 4PSUA 4FS8A 2CJWA 1DIBA 5FNVB 3VHXB 2JRLA 2NPOA 1R6VA 3TZBA 1DKRA 1WV0A 1P31A 2E5WA 4UEOA 4IS2A 2IXAA 1II9A 2OP1A 4R2WA 3ZUPA 4C2TA 2CLFB 2ZWVA 4XD7D 5DLQC 3QUAA 1TEXA 1Q0LA 1IM8A 1GNRA 1YNOA 3THYA 3EG9A 2JGLA 4KI0A 2VP9A 1KARA 2FKNA 2KTQA 3U4CA 4Z2YA 3LT0A 3LSTA 1JI0A 1W35A 4NG4A 1YMUA 4KPGA 4NY1A 4BQFA 4CKCB 1A71A 3TO5A 1FP6A 3DCYA 2PX3A 3RTAA 3DQPA 4RQ3A 2Z0MA 4RWZA 1GCIA 1I32A 1ZNWA 3L43A 3ABZA 2ZUCA 4ZQFA 1IJBA 3P4XA 1GG9A 2H85A 2Z5FA 3ZGLA 4Y2GA 1MDFA 2PMEA 1SEPA 4RZ3A 2WFMA 3ZGOA 3R9IA 4YALA 4D9GA 2P6RA 3GCXA 1S5PA 3W5AA 4W1RA 4JYPA 2NRXA 1OXMA 1Y6JA 4I5FA 3GFOA 5J4YA 1TIPA 4CV0A 1V38A 3HILA 2M6KA 1U2DA 3EEFA 3HX0A 1QJ4A 3GDFA 1UMBB 3MR5A 4RZUA 4ZJUA 5B66U 1DQZA 4IV8A 1NVXQ 3ZHBA 1MT3A 2WLTA 4IKEA 3TUIC 3F3MA 4IM7A 2AIRA 4D4MA 2IYXA 3V33A 4RF3A 3PK0A 4TXHA 3AR2A 1BHO1 3B53X 3C14C 5E6SB 3PFCA 5AM0A 4GXKA 1JIJA 3I45A 1GKKA 3IT1A 4U9UA 4X3OA 2DBRA 5KCMA 3K1JA 1X92A 3EH1A 4UBBA 4XD2A 1MNQA 1ZQVA 1P62B 2LPMA 4YXWA 2C5GA 4GX1A 4UB6U 4JYZA 1Q1ZA 4PXYA 1V71A 1YRWA 3O4GA 2V7WA 4E94A 2A5FA 4FFVA 3MWKA 1N0HA 3DV9A 3CF0A 2EL7A 3AKZA 1A8IA 2JL1A 4DJDC 3CYMA 3JCZA 4FMDB 2L69A 3TLCA 4G8BA 4WVFA 1RI5A 4Q4JB 5K05A 4IJ6A 4A8PA 1E1KA 3EF0A 4YWJA 4YRTA 1CEZA 4J9NA 3F5MA 3I9FA 1HI9A 5C9ZA 4NZNA 4F97A 1N2EA 3KSBC 5LFAA 2QARB 4QUEA 5ITVA 2YZ2A 1DC6A 2HSGA 3FF1A 4JKIA 5TQJA 2QS9A 3U80A 1CF2O 1SPBS 1V4VA 3M1YA 4JV0A 3OSNA 1RRGA 1TCCA 1AK2A 2DFDA 2GLXA 2IZZA 3Q0IA 3USES 2QY6A 2W2LD 2XTJA 2CUNA 1KPGA 4YQZA 5HYVA 4K6MA 4AMZA 1VIMA 5LXTF 1YUBA 3RROA 1PLKA 1QRTA 1ZQMA 3WBJA 1C1YA 3ZW7A 4EYSA 1X19A 5MFZA 4PTZA 4YMIA 1PSWA 4WK4B 4YAJA 4UPEA 2HDHA 1E2KA 1T3LA 1LQUA 1US8A 4M9UA 2KN7A 2IZ7A 3F7NA 4PC3A 2I6XA 2XMDA 4HRVA 3T1VA 3ZWXA 3MJHA 4JP1A 1Z63A 1SBIA 2AFIA 4IGIA 2YHAA 4NE7A 2CNWA 1BRTA 1O3YA 3T5KA 3PTZA 4LE0A 1VLBA 1DJLA 4PHGA 1TQ8A 4JVMA 3TFWA 4CNBA 5IPFA 1J8VA 1JSRA 2ZYWX 4TXJA 1LKYB 3KPWA 1PL8A 3GQBB 1BKDR 5AVWA 1RQLA 1BXRA 3O2NA 4KN5A 821PA 2VJAA 3I28A 2EHJA 1SQFA 1KOGA 4GZMA 3KQPA 3D64A 4ZVQA 2P77A 3UWSA 3O4HA 1SU8A 2QUHA 4BU1A 5D46A 2RAPA 3C15C 5J2TB 3EAGA 4JUZA 1MO2A 2HF2A 2ZYSA 5J5VA 3BQ2A 2NN3C 4LBZA 2ZJ5A 2HIHA 5B3JC 1NZBA 1HWYA 4EDFA 4CE6A 1EFVB 2QI9C 3A6HA 4BO1A 2HI0A 3IVCA 3ENZA 1GV0A 3K2EA 2PJUA 4J8PA 3RJKA 4PYMA 4Q39A 2XITA 3ZE8A 4TKUB 5K7SA 1I0IA 3GPDG 3NBZC 1WXIA 2XPCA 3JVDA 3DHEA 2R4UA 1RHRA 1XTRA 5AKZA 5JDCA 5KG2A 4MVYA 2IUYA 4UMEA 3WJ1A 2O3JA 5DYTA 3ACCA 3WP1B 3N39C 1C0PA 3PQFA 1RQXA 3FUVA 1R3UA 3MILA 5J0QA 1B76A 3RWOA 3EGDB 4D92A 1ZQPA 4G97A 4URVR 3EMBA 1OXBB 1RAAA 1H2RS 1JZQA 2FW1A 2JASA 3BQ7A 2PJDA 2Y67A 4JJIA 1J7JA 2E5LB 2JV3A 1SV4A 1NUPA 1LLCA 1MJGA 3NU1A 5A9SA 2A1TR 4FXPA 4PRLA 2V7QA 4QBIA 3EOAI 2NU6B 1LLQA 1ZJ4A 1VIVA 1E4EB 1A2QA 3NTVA 4LHEA 3MJVA 3HDTA 4NR0A 3W1VA 3FFTA 4BKRA 1XMOB 3CEHA 2R8OA 1TUEA 3OOJA 3ZQUA 7ICJA 4HGNA 3UMFA 1IEWA 3W3AD 2Q6LA 4BDSA 3NFRA 1X8XA 3KJGA 4BMZA 1KFTA 2GYWA 1X9IA 4YYEA 1TE2A 4FI3C 5HMLA 1XZ8A 2B9VA 3FDJA 3L06A 4J2HA 2Q5CA 1ODSA 5TEVA 1E9BA 2FRDA 2P3LA 1OFUA 2B5OA 4QBHA 4GC5A 4YDRA 1DO0A 3DLTA 5DKWA 4BNHA 1WUTA 3NHLA 3M3PA 4KIWA 5IHPA 2A9PA 3VJLA 1YSCA 2AR7A 3B78A 5ARBA 4ZH4A 1RJFA 1Z7BA 3W5CA 1P9OA 1SVKA 2GBIA 3AFNA 4ENPA 4YI5A 4YMOA 1MVLA 3D4PA 1OHHA 1U2PA 4S2EA 2E48A 5ED0A 3OEHA 3BRQA 4B47A 4B35A 4EYGA 1NDUA 1PE0A 4HZGA 3OSPA 5CVCA 4DLXA 2FDCA 5JOQA 1F12A 5ENZA 4EATA 1JEJA 4Q1CA 2P6OA 1W0JA 2AEFA 1G66A 2HN9A 1X9MA 5DYWA 4AKSA 5HS4A 1Y9EA 3VH1A 2XUPA 1SGGA 2YYYA 4I5DA 2W7TA 4URXR 3OCVA 2JDIA 1CUXA 1WDTA 2OBFA 2YWEA 3I3OA 4Q3OA 4JDPA 2D5LA 3HQ4O 3AEZA 5TC4A 3AONB 2BGRA 1MENA 4B4UA 4C89A 1MN6A 1UBKS 1U7TA 4UUBA 3AFHA 1R6BX 2VAWA 3PXEA 3GLIE 1X40A 1CVLA 2FWRA 2J7PD 4ISCA 5C7YA 2ABWA 2QT1A 5ALVA 1BGVA 3GN1A 2A8YA 1QG4A 3WLEA 1O7JA 1PU2A 4BQEA 5B12A 1LB2B 4I4TF 4JL8A 4FHEA 1D8AA 4AX4A 3V7LA 4NC9A 2V54A 3ZC3A 4CTKA 4DG8A 1NXVA 3ZS9A 1PJ3A 4ND8B 1EGMB 4FILA 1LVGA 3K9GA 3M33A 1YB4A 2IFTA 4M86A 4O4JA 1EWKA 3ZGZA 5DK6A 4H7FA 5C5IA 4WERA 4NXZA 1OC4A 3FMGA 4DMCA 1ARZA 1W46A 4XCQA 3SV4A 1JA9A 3BZUA 5F1KA 3U3XA 3WLNA 1BXKA 2V97A 3KQMA 2W2QA 3FCEA 4WCFA 2BFOA 3LA8A 1BYUA 5GM1A 2X3FA 2FZCA 4PZOA 5HILA 4DA6A 3M70A 3JALB 4CV3A 1JZSA 2EEPA 1WVIA 5J47A 2LP4Y 3R09A 2R7AA 4JVLA 3T7TA 1DXOA 1QFYA 4M1WA 1V9SA 1QB7A 2UYGA 4P3PA 1CY6A 4BWGA 3F6EX 3QXSA 3RW9A 2A0XA 4QXOA 3LCJA 5B1YA 4URWR 1YBFA 3CR7A 1CIVA 2CLLB 2JFOA 1PQWA 4BNGA 4OA8A 2HA4A 2MR6A 3D5QA 4NMLA 2R7LA 5J2CA 1TYEB 2F43B 3OQIB 3H0RB 3CEMA 1VBKA 2EZYA 1GXSA 1SV0A 5CW2A 4WBNA 4K9LA 1YS2X 3JARB 3EVTA 3G9XA 4FW8A 2MOKA 1KLNA 3KSRA 4GI3A 2C0PA 2VA9A 3A0BU 4FX5A 4LKOA 2CWWA 3C1UA 3DCJA 3FKSA 3PLRA 1BCSB 4LDNA 5BRAA 3IAAA 3HTXA 1LFDB 3Q7QA 1RYUA 2WJ6A 1M5TA 1YE8A 3O2JA 4PLWA 1P6UA 1QFMA 2XNHA 2DTXA 2YJ6A 3DKPA 2IHNA 1LBTA 2BEVA 3ESZA 1EYZA 1PV1A 3JRWA 3NPMA 3HGTA 5AKGA 4IIXA 3HL4A 4J76A 1ATZA 3BSFA 3PYXA 2VXYA 1GVHA 1PTJC 2OB1A 3OZXA 4Q7JB 4YRLA 4A7PA 4F93B 3E9YA 3TIFA 4DARA 4DQLA 2H5JA 4BX8A 4PH5A 2RI6A 4A0QA 5KYYA 1FMFA 1U0HC 1Z1BA 3WE7A 1CS4C 3GUYA 1FRNA 5KEIA 4RQ5A 2PKXA 2RAFA 4BLPA 1PYGA 4OHPA 3T3GA 1T8UA 1EG2A 1J1IA 5DB9A 2QTFA 1FW8A 1LWNA 1U2DC 2XQGA 5GV7A 1I3KA 1RZVA 2XRMA 4JQOA 3TTXA 3RAQA 4PNEA 1HRKA 1MMFB 2XUGA 1XFDA 3M2PA 1NHWA 1NR5A 3MWGA 3GLQA 4TUYF 4B45A 3K5WA 4CKBB 3GLIA 1H3EA 3PR3A 3OMXA 2I1QA 2CXUA 3UJ9A 1EUDA 4Z4FA 2ZBUA 1XEAA 2HHWA 1S0UA 3ADCA 3BL6A 3MAAC 3U16A 4I50B 5DDYA 1R0KA 1MKYA 1JLSA 2C57A 3D2QA 4GF5A 3QKRB 4YC7A 3TTUA 1E3DA 3FY4A 4PPQA 2EKQA 7ADHA 1G5PA 3OZDA 4RD6A 1XO0A 4XTRA 4BWYA 5C18A 5DI3B 5GIOE 4EW2A 1ZQFA 3M6KA 1JH9A 1RHMA 1XVAA 4TRRA 2AGVA 2KHZA 3R24A 4II7A 4KB5A 3W2FA 5AWFC 1VJ5A 2P91A 4X64B 3E58A 3E7FA 3K0AB 4RL6A 4LXGA 4MS3B 1WO8A 2XDWA 3O3CA 4G24A 4RESA 5B7GA 3KWFA 1T25A 1WWKA 1SH7A 1X3LA 3A6DA 2WJIA 3JQGB 1PFGA 4B6PA 2DHCA 1Y3AA 2ZSEA 4OP1A 1ZHHA 1L8XA 3CZRA 3MZ0A 4LA4A 1M9NA 3FZEA 2YVQA 4N5HX 1MA7A 1DKLA 2I2AA 3BIOA 3D2AA 2HCRA 3RRZA 3IBYA 3AVXA 3SHWA 3G1WA 4J0IA 5AH0A 4DC1A 3KXLA 1Q7BA 3CZPA 2Z4SA 2E4YA 1XX6A 2FNAA 4BLSA 3ZJVA 1IMOA 3N0XA 2WSYB 4BJ1A 4LOLA 1DOZA 2PLAA 1TPYA 4PAQA 2HBMA 4HTFB 4LE2A 4CKWB 2JH1A 3N59A 5DHFA 4GC9A 1W0CA 5JSZB 3ME5A 1RLUA 3NJ4A 2DFKB 2X6QA 2PNFA 2ZIEA 3Q85A 3SHFA 1EGHA 2CKMA 2HFJA 1NNSA 2GAOA 1YR8A 1U28C 1G55A 1R18A 3IUSA 1L1QA 1XEXA 3ZGYA 2BV3A 4KQFA 3P2EA 5J2TF 1LK0A 2Z04A 1HQDA 1QVRA 1PDVA 1UOQA 4FQ8A 3TD2A 1EINA 3TAQA 1USKA 3L8FA 3T1HB 2O23A 2QW1A 3ED1A 2BMJA 3KD3A 3ETHA 3HP1A 5GIPE 2JFWA 3CLTC 3BG5A 4C43A 1TOAA 1VSUA 3PX4A 2ECPA 4H7HA 3ZYZA 5IANA 3WGHA 3D7LA 5F2KA 1OH6A 1YCHA 2WWVD 1IMJA 3V4PB 1L5VA 5B4UA 3SWWA 3AYZB 2JPDA 1MC1A 3ET4A 1IY9A 3C7DB 3CONA 1TVEA 5KOYA 1X0XA 3SG0A 4E2YA 3OCCA 2WBLC 2D5AA 4DQIA 1Z8DA 1IG0A 1YOBA 2O52A 5EZQA 4ZI3A 2IS2A 2NO4A 3GEIA 5EJ2A 3PU6A 4M9CA 5LZ4A 2NV3A 2O2ZA 1PJ2A 2YASA 3QKUA 2DHEA 4FOLA 4OH7A 5L9XA 1FDOA 2B9EA 5AJZA 3T0GA 4J0JA 8ICNA 2BKAA 5CP8A 5CXXA 2PQ6A 1I51A 2XVMA 4G1FA 2JGMA 4EDHA 2Q4EA 3ZDYB 1WBBA 2YH2A 1LI5A 3I2IA 4JEMA 3ZDDA 4GKBA 4H3SA 2XYHA 3L02A 1CP2A 1FRFS 3ONNA 1TQ4A 2TYSB 3OCZA 4WY2A 4IMIB 3AUXA 4GM1A 3VO1A 2C95A 5KOJA 5JVDB 1T29A 4YFYA 3ISVA 3K0KA 5H9VA 5JSYA 1RWXA 2DFPA 2HWUA 3C85A 2XUHA 3UJNA 4OQMA 4K8OA 3LY9A 1VKZA 3D0RA 2UVPB 5AK4A 5AXDA 2GVDC 2JD2A 2MR5A 2PL9A 3NP9A 4GQBA 3ZVMA 4UREA 2AN1A 1VCOA 4PZUA 1Y3BE 3Q6NA 2ZTCA 1MQ9A 4QNLA 5EOZA 1DAHA 5ICMA 3HW8A 1WQ1R 2CV0A 4DPLA 5LP6B 2A57A 5EZYF 1FPMA 2B3DA 5EWJB 4NJEB 2XUOA 1LPBB 3RH5A 1KRPA 1GPYA 1M34B 2PRSA 3LXUX 4L85A 4BFSA 3E6AA 1QSLA 3O95A 1YRBA 1KK2A 2GM5A 1MHTA 3C4QA 2PFNA 1E2GA 1TGYA 7ICOA 1MO6A 3BICA 3DWIA 4GO1A 3L07A 5BOSA 4IUCS 4ZREA 4MUMA 2ATIA 5L1JA 1Q7EA 1V47A 5H2FU 1XTPA 5K3CA 5AUPB 3H2SA 1NZFA 1ODIA 4WNAB 3IP8A 3LS2A 2NQ2C 3DE4X 3G79A 3HLYA 5LBTA 3ZU3A 4EI2A 1BEUB 3I2HA 3OKCA 5TQ0B 4HWSA 1GGJA 3QW4B 5EXSA 4H0CA 3THRA 2G83A 4LTDA 2HCTA 3TL6A 5ENDA 1JDZA 1TD9A 3PQEA 1W0JD 2WE8A 1PT6A 1MTZA 4K03A 5BPHA 2XICA 1J8MF 4PYIA 2LGJA 3H1BA 1E66A 1Z2NX 3IQXA 4K46A 2Y3IA 4AY4A 3SAFA 1QS0B 2D2FA 4M22A 3ZIAD 4UUOA 1BAPA 5F5LA 4ZMRA 1M1XB 4MWOA 1CQJB 2IYTA 3GGPA 2YWBA 2YYZA 2YHIB 3BXOA 3UJ7A 3CNNA 3FJOA 2F4VB 5F64A 4BFZA 3RIHA 1AO0A 1KJQA 5EIBD 2IBMA 2WKSA 4NBUA 5HCIA 1QAQA 4AO7A 2ZJ2A 1XP8A 3M6UA 1S5LU 1K2WA 3DKKA 3GDWA 2XQVA 4G4SO 5CK5A 1QWOA 3UAGA 1C2TA 4MARA 1JUDA 2KB0A 1B8PA 1WXHA 4E30A 5J2BA 1F17A 4A0HA 4QUAA 4C8OA 1RYEA 1P7YA 4NOJA 1XPUA 4NYIR 3RHFA 3I9KA 5J2UA 5IASA 4Q4AB 1U3CA 5E4TA 2SCUA 3BIFA 5KFNA 4RSGA 4FR0A 1MB0A 2HAEA 3NGMA 1TTPB 4V0KA 3RS9A 4HYKA 3VV2A 4A0RA 1W75A 3CGWA 3E2EA 4CDGA 9ICLA 4CF4A 4EHHA 1H6DA 1V1RA 4DLGA 3NYWA 1JHPA 3QWIA 4RU1A 1PUJA 4JOCA 4R6XA 3TAHA 4I50A 2W6MA 2A3NA 1UEIA 4QLOA 5FLEX 3FTEA 4OQDA 1VYHA 4DSIA 1Z0JA 2O07A 2YXLA 4X90A 3T5MA 1DLJA 4BO5A 2FDRA 3KUKA 1SOVA 1VMAA 3R20A 1Y5IA 1Z3IX 2XNJA 4NH0A 4LY9A 2GCNA 5A9TA 3M3DA 3TK1A 5BMOA 4CFSA 3EXHC 3IC5A 4QELA 2O1SA 1DIAA 3OMWA 4AJIA 1I24A 4H4CA 3C28A 1W94A 1FF9A 3BERA 1DIGA 3IUEA 4MA0A 3U48A 4EKDA 4TKVA 2QZJA 1G17A 1SD2A 1ZH8A 3ZK7A 1CZOA 1FDRA 3P26A 2QLFA 1PFUA 2P1DA 3R8XA 2VDQB 1CRQA 2GHIA 2A4KA 3I62A 3M1IA 3CVJA 1FY2A 4V0QA 2R8HA 3FNFA 3C5EA 2C8KA 4ZAVA 3O1LA 1ODJA 3O4FA 2DLNA 3RBVA 4BMCA 1IPEA 1KQPA 3KXDA 2D7DA 4BCBA 1SNYA 1LLFA 3QZ8A 2YOGA 3DYVA 5K45A 1YONA 3SZGA 5KMGB 3ZVNA 1Y1PA 4PFKA 2WUVA 1TQ6A 5BN4B 3EVNA 1ZQKA 1ZJ5A 1U04A 2FH5B 3LZDA 3QUSA 4K9MA 1UBOS 1MABB 1EPUA 3QBJA 2AHOA 1PFQA 4OL9A 1A9SA 2JFPA 4F3RA 2GF2A 2HJVA 1YR7A 4PGGA 2BGWA 4H7PA 5EGSA 5K8VA 2PJRA 2R5NA 3QKSB 4DCTA 4XDGA 3HKBB 4LHZA 3WLKX 5B55A 1NQAO 1W9MA 3GHHA 2OYRA 2R4TA 4RPLA 2PUGA 5EVCA 5KYWA 3SIWA 1XJ0A 1A5TA 3BE6A 3C1YA 1D2HA 2AYZA 3AEKB 4UNPA 4XPIA 2J6SA 3ZEIA 1ORHA 3VDMA 2C42A 2JGJA 4RQ7A 4NYIQ 1GGMA 5AVSA 1NYTA 2HTFA 3GQBA 3M6IA 4OQ4A 2WTAA 1OZFA 1I0ZA 2EGHA 1L6IA 5EKSA 3OPMA 5KAMA 5CFQA 4HDRA 3PJFA 5AM3A 4IV5A 3CO0S 2AOUB 2HO5A 3RRYA 3WBBA 3ZQJA 3BTVA 4G1MB 4OB8A 4IFEA 1JHMA 2OR3A 1CFJA 4RDXA 2O0LA 1SXPA 2JGNA 3MJ4A 2ZS9A 3BA1A 4K4IA 3TNJA 4D4IA 4MDFA 1UK7A 3FPGA 4TTPA 4GQIA 4Q1DA 2EX0A 3ZLUA 5FI3A 5KREA 3GJ5A 4QHYA 4GVXA 5LP1A 3O8RA 3M8RA 1IDN1 3EG5A 3B2NA 2B20A 3KB1A 3P0RA 5K2MA 3RSLA 1VB3A 3S8MA 2BT4A 1XVLA 2IC5A 3SHTA 5JZOA 4TMZA 1E6WA 1JJFA 1YI1A 3A6EA 4CQMD 4LC0A 1KKMA 3ZHZA 1K9SA 4TLBA 4DBLE 3H9BA 1K97A 5HIJA 1ILEA 4R54A 3RBDA 4UB1A 4OO1J 1MGPA 2XY6A 3CRXA 4OJLA 2ORYA 4M1SA 3P52A 5CDFA 1KIMA 3OOWA 3TLYA 2MSKA 3V8BA 1CY2A 4DHEA 5C80A 3ZDZB 3OJWA 3I5MA 4CL2A 1KFDA 5CEJA 5JQGB 1E5DA 2VDVE 3I32A 4WBNB 4UAZA 2SKEA 3WMWA 4E7OA 2Q1UA 4Y30A 3HSYA 1H5UA 3A9VA 4F2SA 2OPBA 3LBHA 5BQFA 3ZXIA 5FUQA 1I3MA 3O4JA 1NTRA 4HKTA 5DRTA 1D8BA 1MAVA 1OAAA 5DQHA 1PBTA 1WOMA 1J2UA 3H8MA 2XY5A 1JJAA 3CW2C 1K1EA 2AG6A 3ABOB 5HKLA 2NSYA 4Z49A 4YA6A 4NLKA 2OQRA 3MA0A 4JB8A 5CEHA 5CGZA 1WX1A 4MQLA 1ZINA 5JR3A 2BY4A 1QP0A 5AI0A 2Y0EA 3TADA 4HRXA 4LN1A 3CPHA 3OT5A 5DHTA 3PR2B 4RFSB 1NKTA 4EYOA 1OPRA 5IAAA 3CS3A 2Y0SF 1FSZA 3DXXA 3NDJA 3OZTA 2JGDA 4V0ME 2GPBA 4YWHA 1ZNZA 2OORC 4OQQA 4IJUA 4RVUA 4L9AA 1N2XA 1LBIA 2M6LA 4MW0A 2QMQA 3L7BA 3LLCA 3DSRA 4RZHA 1FBTA 1TVMA 2VUUA 1DPGA 2ZBVA 4YRJA 3BGOS 2OEPA 4N3CA 1GSIA 3VHRA 3NX4A 4MYSA 1UBJS 3OLWA 4DWOA 2G72A 2VF5X 4LXUA 1R0WA 2ISSD 4PFSA 2Z56A 4BNUA 3M3HA 4TYPA 4AYBC 2IOFK 2EBHX 5BSRA 5LBIA 3RIEA 3ULKA 4MP6A 1NF8A 1XLVA 3MF4A 4ZCMA 5LJLA 3G5MA 4KO8A 3R41A 1C3OA 3I01A 3SAHA 2QRKA 2R00A 4MRNA 4RLQA 3WMEA 1GUYA 2J4DA 2XADA 3SJZA 4C87A 5IT0A 2ATCA 2IZ0A 4M4SA 1ISHA 1ESDA 2FMIA 5EMNA 3T38A 2DX7A 4CKEB 3SOPA 3NLLA 3J7AC 4UXJA 1M1UA 1KI7A 4X1KA 1NK6A 1U0OC 4NFYA 3F73A 2MSWA 2NAPA 3BQMB 5HQJA 2Q6IA 5K5EA 1TI7A 3RSQA 3K30A 5KBYA 1AZWA 1NFQA 2G0TA 3SJUA 1SOWA 4W8HA 4A0SA 4CKZA 2UVWA 3H5RA 2ES4A 4N0PA 4C78A 4E4RA 4EFMA 3OY2A 5LDHA 1RRVA 4DOMA 4UHJA 5JQGA 5KQSA 2AQ0A 1WTCA 2FRVA 4A6EA 3M83A 2P67A 1SC6A 2HHCA 2XBUA 3FZQA 1ZD2P 1BVUA 3NRCA 3TTVA 3HXLA 3N0TA 1XNGA 5JV5A 1XC7A 3COPA 3ODPA 2IXGA 2I7CA 1S3IA 1YS9A 3OAAA 1W2HA 1JHVA 2C00A 1JIHA 2G8NA 1M8FA 2PTGA 3HFGA 4JUAA 1SULA 4KQMA 5C8YB 4N0EA 2YV4A 3LP6A 4OXXA 1UFRA 3KQWA 4UHDA 3VZQA 3JQAA 5PNTA 3P0FA 2EQ5A 2P30A 1QQ5A 4Q12A 4CI9A 4HWTA 2H0RA 1Z0AA 2HXGA 2VDNB 3A2KA 3OPYI 2PI5A 1XVIA 4YR0A 3DBLB 3OU7A 2LHTA 4J0CA 5ERYA 3HVHA 4P3KA 1A76A 2PSSA 1T5SA 2Q1WA 3LVQE 5CTJA 3VR3A 4DCMA 1U3VA 1XAIA 3S1AB 3SU8A 4PYJA 4RHFA 5A4DA 2NO9A 3UQ0A 4GW3A 1NLMA 4YPOA 3QJGA 5A6SB 3NTUA 4PPXA 2VAMA 4FDUA 1E96A 3EGDA 3SE0A 1UDRA 5CFPA 3HUDA 2HSZA 1IJFA 2QM3A 3SSMA 5A3JA 3R6LA 1WZEA 4MW2A 5AM1A 2F8MA 3FSJX 4QIHA 4LJKA 4IR7A 3HSKA 1PTKA 1LSUA 1NYQA 4LJXA 1TZBA 3HCPA 3K7EA 4S1WA 4B4DA 4BNIA 5AR1A 1ZXLA 1EH5A 2BMFA 3H7IA 2PV0A 5CCDA 1EVZA 4GX0A 3WGMA 4S0XA 4I1VA 4I7EA 4IJQA 4ZAGA 1PQUA 3AFOA 3FYUA 4IIJB 1CG6A 4PLZA 4XX0A 4Y2TA 5EEGA 1MABA 1GU0A 1H42A 2ZRAA 5WRFA 4MX8A 4PL1A 2HL6A 3BHJA 1J2EA 4WNCA 1V9PA 2Q0SA 4YK7A 1GZ3A 3GQVA 2DGZA 5BN5B 2Y9TA 3WFZA 3Q8KA 3PEYA 4IYJA 2G71A 2CUKA 3S6JA 4KVZA 5DF1A 3A70A 4DL6A 2PFGA 4F2PA 3FDIA 4QU0A 3EX7C 4GKKB 3N2ZB 3OG9A 4US0R 4ALNA 2WNHA 3KWJA 3HVRA 4DDTA 5INTA 5KDOA 5BNFA 3A1SA 3VC3A 1I14A 3FYUC 2BR3A 1C3LA 4F50A 3CKKA 3L3BA 2RCYA 1ZC3A 3A8TA 4MJ3A 1PR9A 3AMVA 2WFLA 5CJ2A 2A1UB 1R4NA 3EB9A 4ES6A 2BMWA 4LW8A 1SQ6A 2WY2D 4EAQA 4YAIA 1L5HB 5CBPA 4RUKA 3Q8QB 3M7DA 1X8JA 4ZQEA 3TFQA 2EARA 3L8EA 1WWUA 3RGGA 3VR0A 4DR3B 5BYBA 4QICA 3WAGA 2KW5A 1DQSA 1RKQA 4LC1A 4RCZA 4PBSA 5E38A 3TACB 3STWA 1JYEA 4C3UA 1JWLA 1P7ZA 3KKLA 4AZ0A 1MZPA 5KFEA 5I7WA 1OR8A 1S77D 1QIGA 2KMLA 5D01A 4DMMA 1BFUA 1VRWA 3B13B 1PEDA 1R15A 2YJ3A 1GCOA 1KDRA 4QZHA 3ETEA 2WJZB 1JHQA 2DECA 2W90A 3GK3A 3N7TA 2XNDA 4KP7A 3W05A 5TT1A 3W3AH 3WGYA 3RLIA 3WV4A 4PHAA 4MUJA 2JB9A 4LX0A 4UOZA 1Z0ZA 2QYTA 1ZD1A 3ASZA 3QPCA 3TXYA 4I1PA 4IMRA 1B41A 1D4FA 1UXJA 2Q9CA 3N6RA 4INJA 4OFXA 4MS1B 4EKIA 3HYTA 2OUKA 3OE7A 3NBYC 4OHOA 3S2IA 1A9PA 4EFNA 5L7TA 5I45A 3DMNA 4QEKA 3RVDA 5KYGA 3KR0A 1Q14A 3AUKA 4MEAA 1IUNA 2A9RA 2IDJA 3HYNA 5IBPA 3EGVA 4AUEA 3JPPA 5AW3A 2FW0A 4AJEA 3QUBA 1XZDA 2PIAA 3B3JA 5HF6A 2JVIA 1AZLA 1C0LA 4EHBA 2RHMA 3PIIA 2BM0A 5KVVA 1BJKA 1PHRA 5IKEA 2XCRB 2HADA 4DFDA 1OIVA 8ICGA 1G5RA 5EKTA 3LWLA 1K68A 3VI4B 3GA0A 4B76A 1L5LA 1WPRA 4OVKA 7ICIA 1S7GA 1TM5E 3MWDA 3CMMA 5CX1B 3CPJB 2HOQA 2ID4A 9ICJA 1W4RA 3SKYA 1BKSB 3H40A 4UU8A 3S0JA 5JPIA 1UMBA 1OXVA 2IYFA 4N9WA 4DR4B 1GN9A 2XE7A 4KLEA 1P4JA 3KO8A 4LSMA 5JIBA 5B7PA 1AA9A 1HFJA 2Q5IA 3FMIA 1USGA 3PE3A 2I4NA 3HWTA 1LV8A 2O8DA 3LY5A 1TK3A 3N2EA 4LTMA 5REQA 4EJ2A 4TURA 5C4IA 3TRHA 1HQKA 3N5CA 2Q5HA 3VU3A 3L0OA 3ICCA 4F2GA 3LT1A 1BROA 2R86A 4ZT2A 3BDVA 3G8BA 3VPSA 1SBCA 2V9ZA 5HW0A 4WCVA 1E5LA 5JZVA 1RWWA 2HBLA 2A78A 3B51X 3SC2B 3SLKA 3VOTA 4G5FA 4KODA 3WK4A 3W6ZA 3DEAA 3LUAA 5A4FS 1XK6A 3U7HB 2AOXA 1X39A 2WF9A 3HN7A 4LS3A 5K0EA 3C7AA 3NH6A 5KX5A 1DPFA 1OGIA 4LVNA 3WY9A 3EDQA 3PFHA 4XQEA 4UAUA 4GUDA 1VPWA 1C4XA 5EXPA 2X2FA 3IMGA 1H5QA 3Q2IA 4J16A 5SZKB 3UK2A 5DEIA 1MEOA 1WP4A 1E3WB 1XOIA 1GZSA 2PLFA 1NIJA 1KOJA 2ADMA 3QRWA 3O2QB 1FVFA 4UNIA 4DXHA 4E5VA 4IIDA 1A7KA 2ZSDA 3D2LA 4JJEA 3W8RA 4EYKA 4WZAA 3ORHA 4ZDWA 3W9BA 3U1BA 4DCPA 2BFFA 2IGTA 2IV3A 3D2CA 4I2CA 4KQGA 1EEHA 2AX4A 2PK3A 1D5CA 4ZYTA 1XJCA 3E7PA 4DNQA 4G65A 4HDKB 4HGRA 3QI2A 2E4WA 3NAMA 1PYDA 3CLTD 1RWMA 1CNMA 3U3MA 3VU9A 4PCVA 5HP4A 2DFVA 4HEA6 4HOYA 3FHOA 2ZAMA 4PAGA 1XALA 3OGUA 2QAGA 4Y7CA 4U7PB 5J0WA 2RONA 3KIPA 3H75A 4HWGA 4BAGA 1W76A 2REQB 3ZD9A 3JQ8B 1Z56C 3H5VA 4OBWA 4DIDA 3ROKA 4BU0A 2ONYA 1Q3KA 1XDZA 1D8LA 2OUIA 4F1WA 5I5EA 3TLGA 1QQAA 4RVCA 2ENWA 4JELA 3IUYA 3TN7A 2AG1A 4KNYA 4JLJA 3P9CA 1VHQA 3MFQA 3I6ZA 1QHHB 1S96A 1HURA 3NKVA 2PFPA 4JVOA 2I6QA 4XYLA 4JJGA 3IV9A 1M0WA 4DSTA 2JNWA 2WKWA 3ENKA 1GLVA 3MINB 5AJVB 3LVBA 5EHQA 3V4ZA 2G5HB 3QKWA 5IZCA 1RM3A 3UXYA 2IUUA 2IUSA 4RTKA 3C21A 1XZIA 2WQ7A 3NDIA 1O5OA 2YQZA 4COKA 4UE3S 1VLMA 3PG5A 7ICRA 5SYAA 1P60A 3LPLA 2W4IA 3FDZA 3QTTA 4OM7A 1QLNA 1MW8X 2UVVA 1NL3A 3O8NA 3PNBA 4D44A 4HLDA 4QWMA 4WLEA 2XXAA 1I4LD 8ICYA 3DDZX 3G9ZA 5DLDA 1OVGA 4ALJA 3I04A 1P1CA 1NT4A 2E3JA 4QOJA 4AP9A 1EQ2A 6REQB 4TTSA 1ONPA 3EWSA 1UXKA 1T5BA 1FRVA 4FS1A 1GNPA 1NXSA 1AGXA 3N7SC 2HK7A 2QTRA 1M1YE 4HPXB 4XWYA 5BORA 2BHLA 3OFVA 2CCJA 3HJTA 1KFEB 1WHSA 2NRVA 4PJ0U 3SLRA 1PR6A 3DMGA 4XDZA 4AZVA 2Q5OA 3SHVA 3DM9B 2M9NA 4MB6A 4C7OA 2YV5A 4WL0A 3CRMA 3M9MB 4RMHA 4FKZA 4TM8A 1XTZA 1K9VF 4LBYA 3RBZA 3SFVA 4UB5A 2FMPA 5BV8A 1Q2UA 1L7XA 1QYVA 3OZBA 3WQSB 4JHLA 1FDVA 4L5YA 4BGIA 1D09A 3VDRA 4DFPA 2UUCB 4X7MA 4INZA 3WB1A 3HDVA 4WTOA 5A4AA 3DNMA 2WA1A 4HDOB 1MDBA 4IPTA 4LRUA 2JCVA 5JD4A 2VHVA 4P7JA 4YVFA 3SS7X 2GCIA 3PW5A 4AMBA 4CJXA 5JSFA 5KQGA 1AV7A 4J4BA 2XCIA 4MKFA 4UULA 2DPLA 2Q2OA 2R7KA 1CC1S 4NF2A 3FPAA 4TQGA 3FOZA 3L6EA 4AFNA 1P2TA 3F47A 4BQOA 3FRHA 3KCQA 1I1HA 3RVQA 2AGOA 5KTPA 4QJBA 4JL6A 5AI4A 3LK7A 4Z9XA 5M04A 2QTTA 4ZHQA 2Y92A 3H18A 4F5ZA 3W77A 1V9CA 3AI7A 4G2NA 1CQZA 2NNWB 2Q3MA 2RIRA 3BMNB 5B2ZA 1TF5A 4AMVA 3ZHCA 1FP1D 1CIPA 1QKKA 1TIKA 2D3WA 3OX4A 3T9CA 4C6TA 3OCWA 5I7VA 4LRYA 5MGNA 3TQ1A 1PJCA 5SZJA 3MDAA 1MX3A 3IDFA 4U2BA 2C28A 3RSGA 5L1LA 1OMOA 3T1OA 1T4GA 3HACA 1QGUA 1CUGA 2WYIA 2OXEA 1TXGA 4WW0A 4YJGB 4ZOLF 1LS1A 5DO9A 5JSHA 1DJOA 3IH5A 2MSLA 3WNDA 5KX5B 1HBJA 3ZZ1A 1Z8HA 1SXEA 2WVJA 4MROA 2F3NA 3Q11A 2LYAA 4QU8A 3REOA 3TR0A 2ZJ3A 1QRUA 3F5FA 4Y1GA 2QMEA 2ATVA 3B5EA 3KVRA 3LY7A 4OHFA 1SXQA 2WT8A 1OW5A 4EZEA 2QRPA 5BN1A 1FUEA 3G13A 5JJBA 1H69A 1XLTC 4WFIA 2I65A 5CFZA 2AW5A 1FNSA 1LX7A 4I2NA 1HH4A 3MYRA 5I7OA 1SL2A 3C8UA 4DLAA 1G16A 1C7RA 3F0TA 1Y82A 4Q6WA 4F84A 5IJ0B 2H7VA 3WIUA 2HWKA 4LNUB 3QNWA 1ZOIA 1Z12A 3KJEA 4M9LA 1NZDA 3M9XA 1OLOA 4B81A 1VKJA 4ZVLA 1E7WA 3RVRA 3U7EB 1XTTA 1YVEI 3MR6A 2HSWA 2OQIA 2QD4A 3NEJA 3PPWA 4IIEA 1GT6A 4C5CA 5GVRA 2VWPA 3EPLA 3KHTA 4MV1A 3C23A 2RGNA 4EF5A 2H17A 1XZNA 4DSLA 4FJ1A 4KQ2A 1IZYA 2P9BA 2XB6A 1ZVMA 5IAEA 3V2HA 1FYDA 4Y6QA 5CA1B 1X9HA 2ODWA 1JLRA 3Q7TA 5A4MS 2LKYA 1AQLA 2XTZA 3GZJA 4M87A 4MRPA 3ZCSA 1MX9A 2O05A 3G5TA 3KLPX 4LYFA 2FLVA 3UH0A 4EJ0A 2JLZA 4P4NA 3VPHA 1EP1B 4BXOB 1U0SY 2OFFA 2JAUA 3TQHA 5I6DA 4Y1EA 4MWSA 4GBJA 2NUAA 3B3GA 4UZEA 1A98A 1BG6A 2W6NA 1YZ6A 3L7JA 3NRBA 4PHPA 4DS4A 4NLZA 2X5OA 2K4HA 4PSKA 4KFRA 1D6NA 2XDYA 3ESQA 4ZDJA 2RH9B 4UQGA 4EENA 4JBLA 4TRNA 1XSLA 2VTBA 1EFAA 3THVA 1MOSA 4YRCA 4C3VA 5BWLA 1LC3A 1N6RA 1X1RA 3ENNA 3OEEA 2FWJA 1M74A 4MVCA 4HLUC 3H2JA 1N61A 1Y33E 1UQVA 4KOAA 4LXYA 3T7RA 1XEXB 3VUEA 4BX9A 4DOBA 2I6GA 2WV7A 1XZMA 3GFBA 1M1YB 2QAJA 1SO8A 1X7DA 1PR0A 4KRYA 4D8YA 2WJHA 2VI5A 2EF1A 4KRFA 1FOEB 2QVCA 3HVJA 3M9WA 2EIHA 4MGZR 5K8TA 1Z45A 1YVDA 3U0VA 2VYQA 3FDSA 1B6RA 2P9EA 1W4BA 1XSEA 1CJMA 3AUJB 4B7UA 4XWWA 2SBTA 4JZKA 2UZ0A 3D2BA 3DT9A 1RBMA 1HTTA 4QDTA 2ZIWA 1TV9A 3C8DA 2QRGA 3E5RA 2I7TA 3MMNA 5BSHA 3FFAA 2PXCA 2PYDA 3CLVA 3EIOA 3FTFA 2FE9A 3AFMA 3AX6A 4TGLA 4KX3A 1D04A 2YCBA 4QQFA 5KFQA 3H8VA 3O0DA 4X44A 3SDBA 1DU4A 1UFKA 3A6KA 2BBWA 4Q37A 4JMUA 4IQGA 1QFJA 3AILA 3T4UA 3VZBA 3N05A 5FWAA 3W9SA 5AIAA 4LJSA 3BWXA 1TRKA 2PKYX 1U3FA 4CMEC 4DQVA 1ZICA 6NULA 3T7AA 1NOMA 5CXQA 4Z6FA 3HB5X 1PK9A 3ZOZA 3QU7A 1FPQA 1HR0B 2AJTA 2HIMA 3L7MA 3UMCA 1XRLA 5CA7A 4DR7B 3D59A 3JS5A 2WD7B 3EFOB 3G6XA 2XCUA 3B12A 3I4CA 3X2FA 3C4VA 2C9ZA 4B3GA 3PUVA 4C4XA 4TL8A 4LOIA 3I9MA 2QF7A 4X6XA 3QJYA 1FDUA 1RXEA 1KMHB 3FNEA 1PWEA 4HFNA 4LPKA 4WZAB 3F98A 5LDGA 3ETDA 1NXOA 4FB5A 2QV0A 1HDCA 2V7VA 1A0OA 3GLHB 1GEGA 1I5RA 3K2QA 5I3ZA 1T35A 1XZLA 4JH0A 1KEZA 3AT1A 4AL4A 2Z8ZA 4DIKA 5EN4A 1CE8B 2D6FC 1BE8A 4DEZA 2VSOA 2WMNB 4JB2A 4ZI7A 2CDBA 3DXYA 4MWZA 3PRJA 3TLBA 3WGVA 2R1UA 1K8ZB 2KE7A 3AUFA 4LYYA 1KFKB 2V1UA 3HKEB 2AQ4A 4LZAA 1A7UA 4GP6A 2Z6QA 4WJKB 1SCDA 3N2YA 3IAS1 3OEHD 3J81j 3R23A 3JVVA 2HU5A 3RUIA 2MCFA 1L1RA 3HDGA 4UEWA 5FYQA 2K89A 3WSTA 5B1SA 2O6LA 1K8YB 3GU3A 5TVGA 3ROEA 5NLLA 5IBRA 1N6OA 3ANLA 2KKVA 4HAIA 2DBQA 2R7MA 1U63A 1S01A 4Y0AA 1P2GA 2VJBA 2FPPA 2QMZA 5AYVA 5KFVA 1IE3A 1UZUA 3MT7A 3D4IA 1M33A 2C8VA 3FIUA 4NIMA 4MAFA 3TLAA 2DY0A 1AMUA 3THWA 2NZJA 3AQFA 2YUTA 1HL7A 4I1SA 3V7WA 2PUBA 2UXBB 3LPMA 3AKEA 3UB3A 2H8KA 2LI6A 5IJAA 1WQ3A 3E7WA 4JIMA 5E7MA 3M6FA 3ZHYA 5C5EA 3BOSA 4KEAA 1HY3A 1TPZA 4YRGA 4G23A 4BFXA 4TS9A 3TDMA 4D6YA 1YZUA 4KLLA 3BH7A 4ZDKA 4UAGA 1QIKA 1I5OA 2LTAA 3H3JA 1OBCA 2FSUA 4TZTA 2CRXA 3O9ZA 5YASA 5EEHA 4EITA 3HU5A 4RPKA 1C8KA 5AK5A 5CB4A 2GI4A 3B60A 1F0MA 3TYXA 4UQPA 4CKEA 2HBZA 1BKYA 1XKQA 3H13A 4GH5A 4MVJP 3PMNA 3SI8A 2A5JA 2GO1A 4D9JA 3CW9A 9ICTA 3LP5A 3DAPA 4Q9LA 5DBBA 3L79A 3F5SA 1AUVA 3T5CA 3A9WA 5EI5A 4DF4A 3B1FA 3TS1A 3T7EA 2AOTB 1TCUA 4PZLA 2HGSA 1LJLA 3AGPA 5B30A 3OIFA 1E99A 2B6GA 3OX1A 1Z6ZA 3PX3A 5CXSA 2OORA 1K6JA 1U7UA 1D8TA 2GX6A 3RB4A 2HMAA 2WKRA 3SHOA 1ZHOA 1B0XA 1ZQBA 1UF9A 2R6R1 4LX8A 2RHCA 3MG9A 5I5GA 4BO7A 4DDMA 1I36A 5ALOA 2XZTA 1W5BA 2PU5A 2XE6A 4HQRA 1RCUA 4D4KA 4DGSA 3COWA 4QJ4A 2I67A 3UGKA 1N9GB 1Q7GA 4XOUA 3OEWA 5LA6B 3WLRA 4F3YA 4UBKA 5LR6A 3VAYA 4YTEA 3TBHA 3KWLA 4UKDA 3AEYA 1N5LA 1SA0B 3IUQA 4RMJA 3UUGA 3IKTA 1M0TA 3BCSA 3ONFA 3SOZA 2IP4A 2O5EA 1KSFX 3M4ZA 2E2WA 4N82A 2F67A 3DC7A 4E0DA 2WTFA 5J0OA 1GKIA 2FR8A 2WSIA 1ADJA 1Y9JA 3GGDA 2WIDA 1UWKA 2DUJA 5AHWA 3X1WA 2XVZA 1HNZB 1ZXXA 1J07A 3FUUA 3NVZA 2JJMA 2X5JO 4IDOA 4JN6B 1F2UB 1DOQA 4J4TA 3IAXA 4E15A 5BV7A 3UW3A 1D1TA 5KFGA 2HHTA 4M89A 2P41A 1H05A 1YJQA 1ZHFA 3AIIA 3K0FB 2C94A 1AZTA 3VR5A 1H8HD 3VSAA 1THMA 4DEVA 3JXEA 4DNFA 5LOVB 4L95C 2QTHA 5COBA 3FB1A 1CQWA 5EJFA 5ANRB 1WXQA 3R3XA 2PX2A 4BEJA 3VHQA 1J23A 3ER9A 4Y0VA 3T7SA 1TX4B 1HDEA 3FNQA 4MF2A 5AXCA 2KJQA 3KDAA 1QQTA 3GIJA 1CUJA 2P5SA 5F7JA 3WRYC 1EX9A 5DM0A 1TKAA 5HCNA 4N5NA 4JV2A 4EABA 1NW7A 2W2LA 3L9WA 4JP2A 1A27A 2F6RA 4Z9AA 3EZFA 3V7NA 1XKTA 1DG3A 1THGA 5IIJA 4H15A 3PQ2A 3EPHA 2I8LA 4NYJR 5GZ3A 2XW6A 2WZDA 3QLVA 1VKNA 5EC8A 3LRXA 3OHAA 5KI6A 4AZSA 2KSOB 1W49A 2DRIA 5JDIA 4R41A 5BR8B 1V6SA 2OYYA 5LQKA 1T4BA 2ZJ7A 3UKOA 3E9DA 1UBHS 3DZIA 3MS2A 2W71A 4Z8XA 1D2AA 1G8KA 4W7IA 2IYOA 4OY3A 3VA7A 3C6KA 5FEMA 2W8BA 1ZCBA 4Y1RA 3NXSA 2AWNA 1OBFO 4IX1A 2ET6A 3PXDA 3SJ7A 3UC5A 3L8DA 2P4EA 3MWLA 4WCFC 4CR8A 3RKRA 1YJ8A 3KAJA 3DO6A 2VBGA 1ZKDA 3AVQA 2R79A 3CX4A 3DYIA 4OQEA 5EKUA 3A28A 4U6NA 1B0ZA 1R8SA 3FOCA 1N62A 5COQA 3M82A 4PE5B 1ZK0A 5E8RA 2EZTA 2KM1A 5FO1A 4D1YA 2VNIA 3IVAA 1QTQA 2AC4A 1Y5NA 2RH5A 4XIJA 3T0FA 3VFDA 1TZJA 5T7BA 2QB1A 2PA3A 4EELA 4OLFA 5C8YA 1KI8A 1N3IA 1A97A 1DKNA 2AKAB 4KAAA 5IBCA 5KSOA 2PYZA 1ECLA 4RQ1A 4MI1A 4R1MA 1W5SA 4P4SA 2VHTA 1JFVA 5E0OA 3EUAA 4UJ5A 1RDFA 3LA6A 5CR9A 3Q88A 1Y1RA 2FR1A 2YN2A 4MV0A 1F4LA 1G98A 1SFRA 1LRKA 2VJ4A 1PVVA 1REQA 3AHHA 4FE7A 4LRXA 2PUCA 1PAUA 3U44A 3GA5A 1SAYA 1OROA 2H08A 4L28A 2IVZA 1VG8A 1SUAA 2QRUA 4M3NA 2ZJ0A 1QE5A 2KS6A 1JECA 1FE8A 1ZH0A 2JIOA 2XCOA 4MO2A 5FA8A 3WFJA 4WZBE 4DM7A 5JAHA 1MTOA 1PKXA 2J5RA 4ZVPA 1Y1TA 3TFRA 1LTHR 1YZKA 4IAOA 5BYJA 2P6UA 3A1DA 5KYUB 1YI8A 1OC2A 3QTBA 3VSBA 3I92A 4I5EA 1L4HA 1FXSA 4PC6A 2CYCA 3W6PA 4RIEA 1E2BA 2I3ZA 3ICXA 4IDBA 5HIIA 4HLUA 4FGZA 4HR7A 1J9GA 3OP4A 2ISQA 5FI1B 2ORED 4AN1A 4QODA 3AP2A 5EERA 4BGVA 4QGAA 1J8YF 1HLDA 1TA0A 2HQSA 3F4BA 1SKUA 3FUTA 4MEJA 2RCNA 3NDPA 2EGUA 5BO5A 4M21A 3K1ZA 4BE4A 1M1NB 4O4LF 1B7GO 2OZLB 4ZI7B 3U3JA 1Q3TA 1KEPA 5SYMA 3LCUA 4UVHA 4LMRA 1CR0A 4JGGA 2DF4B 2O0JA 4QNRA 4OGLA 4P22A 4CI0B 4JASB 4EBCA 1WF3A 4TTQA 2JI7A 4UMVA 3TOSA 4ZZIA 1LPPA 2ZI6A 5E9JA 1GUZA 1MB3A 2H7CA 1DIRA 2DCMA 2KX7A 3ICWA 3PC2A 1RWNA 5DHQA 4P4PA 1U48A 4O9MA 1J1ZA 3WDMA 1A77A 4LQDA 1Y3IA 3OPNA 2ZZKA 5G0WA 1NJ1A 4PZNA 1XRPA 2QORA 4JI2B 3MMXA 1DTSA 4BCDA 3KV1A 3A58B 1G6OA 1Z7GA 4UE6A 3RREA 1ADFA 1FQOA 1RYDA 3OJFA 4FZRA 2PKWA 2AD1A 3Q98A 4F3KA 1KW4A 1I9GA 2HNAA 4MQ6A 3ZCVA 4US2R 1QRDA 1NPYA 1V45E 3T1TA 2XWBF 1S8NA 1J2MA 1VQ1A 1W0KA 1NYLA 3H4MA 3GVPA 1PK3A 3NC4A 1QOQB 4MCHA 3SSOA 2H57A 3WZ2A 1L5QA 2CL5A 3KZVA 4MYUA 4J3FA 2IXEA 3FFXA 3GDGA 1NI3A 4EZ6A 2GASA 4JP8A 4F6RA 4MDEA 4DSZA 1ZUNB 4BO2A 3B9JA 2FW8A 2G5PA 3Q6IA 4O5EA 2C04A 4KLHA 2J87A 3LHKA 4P4LA 1SOAA 1XXLA 4X6UA 5EYPA 4EY6A 3TANA 1Y8AA 4TRJA 5G0VA 3RRFA 3ZU4A 4BN5A 3RE1A 2ETXA 1HJPA 3W06A 5F3DA 4QZ8A 3DB1A 4I9UA 4NE2A 1R5BA 2FGKA 3CUTA 3EIQA 3BTOA 5UKDA 1NJXA 3B7WA 9ICVA 2M98A 2WI8A 4D0GA 1OJ7A 2L42A 2WILA 1F8UA 3QXJA 5I4BA 4MB0A 1TVKB 2GXSA 2PMZC 2ZSHA 2OHJA 3P0EA 3R0QA 4KJXA 4HATA 1Z8NA 4W5HA 3ZE6A 4EFKA 4DLUA 4NV0A 1RWBA 2J9FA 4BLWA 3SAJA 5KQRA 5C52B 4WNAA 1Z4MA 4HTAA 1CUUA 1DAEA 1E3MA 2J4FA 2EDUA 3BDIA 1X2BA 4EARA 2WYWA 2R96A 3EZ5A 7ICTA 1HF3A 3I0NA 1ZAYA 4EUKA 3UXHA 2AQIA 3B3QA 3KPUA 5SY4A 4BMSA 3CB4A 2ACKA 2YB1A 2BFDA 4KREA 4LDRA 4BLUA 1IZ9A 1F2TB 1B6SA 1MV5A 1I2AA 2CDNA 4IW3B 3NVKI 5GONA 5JU6A 4UUAA 1FSFA 5B3AA 4QZBA 2W70A 5LP6A 5JLJA 3G6WA 3BCRA 3OF3A 1ZQRA 4NFLA 3WDSA 4KLCA 3COSA 5K8UA 4RTSA 3K1RB 1IK6A 3A9SA 2KFZA 1ICEA 1K3TA 4IQWA 2PRZA 5J2TA 1G20E 1QE3A 3L49A 1QXSA 1QYCA 4G1VA 5AOAA 2Z95A 4F7WA 2W42A 1T1EA 1ZESA 2DPYA 1UZNA 4GHWA 2UVQA 1T0IA 4ZKEA 5KKNB 1FNMA 3DFZA 3TJZA 3LCVB 4HDQB 3M6ZA 1JX4A 1IOWA 2VHUA 1XMJA 3IHTA 3TXAA 3WOHA 3OPYA 1XXHA 4YNBA 3AESA 1S6YA 5FXMA 3UJBA 1Y7TA 8LDHA 2RSLA 1XYGA 3H8JA 1SWVA 2D0OB 4WESA 1JVBA 1N8NA 3WVNA 3VNQA 3EVGA 1TKCA 2OWOA 1LCIA 3FI9A 2I7XA 3L0YA 4IDFA 1VE7A 4L7QA 2O7QA 1GQYA 3KYDA 2OENG 3TLMA 5LPNA 4LNUA 2E4AA 1Z4NA 1KEEA 4MUYA 1G59A 3QFCA 3X1XA 3KKZA 2I4MA 1KMCA 2I6UA 1CYEA 5KNBH 3AL0C 2RDIA 1UAYA 2HGZA 5A4KA 3Q0TA 4OG2A 3UHOA 4ER0A 1H2EA 4IQ4A 4MP3A 3DMYA 2ZAGA 1IN4A 5IULC 3A4VA 3OKFA 2HIAA 3RRBA 4M1TA 3PW2A 2C0QA 3AFIA 1YB6A 1USWA 2EYUA 3QLJA 3GZNA 2FUCA 3E35A 2O7NA 4Q7MB 3SF8B 5K0GA 4CEJA 1A0PA 3OSZA 3TZEA 4QWAA 3GRAA 4ANFA 2X19A 2D3DA 2PUWA 3PIRA 4Y3UA 3WLIA 1G9SA 5E95A 4CL0A 3D7NA 3F6SA 5L3VA 5KYXB 2L18A 4MZDA 1NASA 4S04A 2ZI4A 4DSJA 3HP7A 4M83A 3HO1A 3AVWA 4L8LA 5JHGB 2OV2A 1SCJA 4LY3A 2RD2A </