3L5KA

The crystal structure of human haloacid dehalogenase-like hydrolase domain containing 1a (hdhd1a)
Total Genus 75
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
75
sequence length
233
structure length
233
Chain Sequence
b'LYFQSMAAPPQPVTHLIFDMDGLLLDTERLYSVVFQEICNRYDKKYSWDVKSLVMGKKALEAAQIIIDVLQLPMSKEELVEESQTKLKEVFPTAALMPGAEKLIIHLRKHGIPFALATSSRSASFDMKTSRHKEFFSLFSHIVLGDDPEVQHGKPDPDIFLACAKRFSPPPAMEKCLVFEDAPNGVEAALAAGMQVVMVPDGNLSRDLTTKATLVLNSLQDFQPELFGLPSYE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Haloacid dehalogenase-like hydrolase domain-containing prote
publication title The crystal structure of human Haloacid Dehalogenase-like Hydrolase Domain containing 1A (HDHD1A)
rcsb
source organism Homo sapiens
molecule tags Hydrolase
total genus 75
structure length 233
sequence length 233
ec nomenclature ec 3.1.3.96: Pseudouridine 5'-phosphatase.
pdb deposition date 2009-12-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13419 HAD_2 Haloacid dehalogenase-like hydrolase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.240 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 Putative phosphatase; domain 2 3l5kA02
3.40.50.1000 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold HAD superfamily/HAD-like 3l5kA01
2GFHA 1YJ5A 1QQ6A 2IOHA 1J97A 2HO4A 2FI1A 5ALSA 3R4CA 3SKXA 3RF6A 1IWOA 3K1ZA 5ALRA 2JGAA 1Z4OA 4HGRA 3ET5A 3MPOA 1RLOA 5ALJA 2D2VA 3QX7A 5AW9A 3A1DA 2O9JA 3KOOA 2W43A 5AVQA 1RRCA 5AW0A 3PDWA 5AI9A 2B30A 2HOQA 2AH5A 3MC1A 1NRWA 2Q5EA 3N1UA 4RETA 4Y2PA 5AI6A 4DCCA 1XPJA 3L8HA 3AR8A 5IS2A 2IOFA 2YJ5A 3BA6A 3ZX4A 5ALEA 3QUQA 1L8LA 3DV9A 4L6AA 1ZS9A 2WFAA 5IT4A 2ODAA 3L8EA 3I76A 3AR4A 4J03A 3WK4A 2AUTA 2ZG6A 4XOUA 2R8EA 5ALTA 1XVIA 5AVYA 1RKUA 2JAOA 5ALLA 2HF2A 4UM5A 3IJ5A 5JJBA 1Y8AA 2CFTA 2C8LA 4C4SA 1RKQA 5ALYA 4UMFA 4YH1A 4Y2SA 1TA0A 3QNMA 4YCMA 3L5KA 3GYGA 1Z4MA 3L1UA 4H1WA 5AHXA 5AI0A 3M9LA 3OCXA 4NV0A 1ZJJA 1FEZA 3HYCA 3NAMA 2G07A 1SWVA 4C4TA 4ZEVA 4FE3A 4UMVA 3WKCA 3L7YA 1ZRNA 1QH9A 1YS9A 2FPXA 1T5TA 2ZBDA 1L7PA 5AICA 4BKMA 5AKHA 2RB5A 3M1YA 3VAYA 1Z4NA 2HI0A 4IFTA 1QQ5A 1O08A 3OPXA 2MU1A 4EX6A 4UMEA 3PGLA 1PW5A 1L7OA 2I7DA 3SKYA 1NF2A 5AKXA 4ZEXA 3NRJA 2IOFK 2W11A 2B82A 2NO4A 3ED5A 3ZWKA 3AR7A 1T9ZA 1YMQA 2FPSA 5AKGA 5ALHA 4KN8A 1ZD5A 2PQ0A 1JUDA 5AKYA 5ALNA 4MWOA 5E0OA 1Z4PX 2GHQA 2I55A 4AP9A 2R8ZA 5AW6A 4Y2VA 1RLTA 5ALUA 5IT0A 2HSZA 5ALVA 4BBJA 3EWIA 2P11A 3P96A 2WF5A 3UM9A 5AW8A 3BWVA 4OCZA 5ALPA 3ZTYA 5AVRA 5AM5A 1U2SA 3QU7A 2W4MA 4Y2RA 4CE6A 4Y3UA 4BX3A 2O2XA 5AVUA 2YMQA 5AKJA 2P27A 5AM4A 5AM2A 5AVTA 3ZTWA 2QLTA 4UARA 3FPSA 3U26A 1L7NA 3SD7A 5AI8A 3QUCA 3U7HB 4KX3A 4UAVA 2FPWA 4BNDA 5AW2A 4O8CA 2YJ4A 4XPZA 2WF8A 5ALQA 2EARA 1Q92A 1O03A 2C88A 3NASA 2IA5A 5AVWA 4QJBA 1TJ3A 4DW8A 4GXTA 4HAIA 3OCZA 4CF3A 2AGVA 2OA0A 3R09A 3EF0A 3R9KA 1LVHA 1NNLA 2CFSA 4NFLA 4Y2UA 4I9FA 3OCWA 3QLEA 3L1VA 4PNHA 2GMWA 1F5SA 4EZEA 1TJ4A 2YJ3A 3ZX5A 1RMQA 3WK7A 4CF5A 2FPUA 5AVSA 3N5KA 1U7PA 1SWWA 3OTQA 3ZWDA 3E58A 1ZD2P 3CNHA 4KNVA 1WPGA 3AR6A 2CN1A 3SMVA 4BNDB 4EELA 4BEVA 4FFDA 2YBDA 2WF6A 5AM0A 3SLRA 4KNWA 4ZEWA 2JAUA 3WK8A 4HYTA 1RMYA 3DDHA 2BY4A 3NALA 1Z4KA 2I54A 4JDPA 4UU0A 1RC8A 2YMPA 3DNPA 3QXGA 5AK3A 4Y2QA 1QYIA 3DAOA 3KD3A 1TE2A 4BYGA 3PGVA 3AR3A 4F71A 2OM6A 2NO5A 4EX7A 3FZQA 3F9RA 5ALXA 1EK1A 1X42A 1ZOLA 2C4NA 2C8KA 3QU9A 5A3QA 5ALWA 2YFYA 3KC2A 5ALDA 3IRUA 4GIBA 3RFUA 2HF7A 2WM8A 4G9BA 3KZXA 1L7MA 4UU1A 2B0CA 4UASA 3OCVA 3HLTA 2WHEA 4HGNA 1J8DA 2GO7A 3FM9A 1L8OA 2R8XA 4YCLA 4BX2A 2I34A 4UAUA 4XE5A 2YMMA 3WKBA 2WF7A 5ALGA 1KYTA 5AKKA 3WK5A 3A1CA 4B6JA 1U02A 4OFZA 2MSNA 3UMCA 5AIAA 2MU2A 2FUCA 3TLMA 1CQZA 4MUMA 1S8OA 3W5CA 2JARA 3B9RA 5AW1A 1Z4IA 5ALOA 3ZVMA 3UMBA 2G08A 5AKEA 3KDPA 3W5AA 4Y2JA 3WKEA 2G09A 1Z5UA 3NUQA 3KBBA 3WK6A 1YNSA 1ZD3A 4HGOA 3E8MA 3EF1A 1RKVA 2HDOA 3QGMA 2AMYA 3WGVA 2FUEA 3L0BA 2ZBEA 5ALKA 3I1YA 3AR2A 2Q4TA 3U7GA 1YDFA 4G63A 2I33A 2P69A 4I9GA 3I28A 4KX5A 4UMDA 4EENA 2B1QA 5ALIA 4E88A 1Z88A 2CFRA 5ALZA 4UM7A 3OCYA 3U19A 1CR6A 5ALFA 3ESQA 1WZCA 2DQSA 5A3SA 3ZVLA 3D6JA 3EPRA 5AW7A 4NAVA 3ZW7A 3U13A 4OD0A 1VJRA 5AVXA 3W5DA 4QQFA 2G0AA 1Z5GA 5T41A 2PKEA 2B8JA 4DWOA 4YIKA 2PR7A 3QYPA 2X4DA 3WGUA 2ZOSA 2I6XA 1U2TA 2RBKA 4CNQA 3SF0A 3AR5A 5A3RA 1WVIA 5AIBA 2NYVA 2FPRA 4JB3A 1Z4QA 3L0YA 1Q91A 3ZU6A 1SU4A 4Y2XA 2EATA 1N9KA 1QQ7A 4YGYA 3QU2A 2YY6A 4YCNA 2G80A 4NWIA 3UMGA 3OCUA 3QUBA 3N8GA 3IB6A 1S2OA 5AW3A 1RPZA 1RQNA 3ESRA 5AKZA 4HGPA 4FYPA 1L6RA 4C4RA 1WR8A 3WK9A 2HEGA 2ZBFA 5AK4A 3CZ4A 5AI4A 4DFDA 2EAUA 2P9JA 5AM3A 4EEKA 3S6JA 4L6CA 1TJ5A 2RAVA 3N07A 1YV9A 5AVVA 2B1RA 1MH9A 3U7FB 1XP5A 4UATA 2G06A 4UW9A 2HCFA 1VJ5A 1RLMA 3B8EA 3PCTA 3QUTA 3QU4A 2YN4A 1AQ6A 2YMLA 3ONNA 4KYTA 3I6BA 2R8YA 2JAWA 3NIWA 2HX1A 4CF4A 2B8EA 3N28A 2BDEA 3NANA 3AR9A 1U7OA 4AS2A 4YIHA 1RMTA 3ZUPA 4BX0A 4L57A 3QU5A 3ET4A 3A1EA 2FDRA 1ZRMA 3L8GA 4Y2YA 3J7TA 2WF9A 3L0CA 2OBBA 5AK5A 5AVZA 3L8FA 1RDFA 2YJ6A 4Y2TA 4BEWA 1Z4LA 1VFPA 3FPBA 1N8NA 5AW5A 2OYCA 3FVVA 3A3YA 2IYEA 4F72A 4AS3A 3B9BA 3FGOA 4NABA 2FEAA 1EK2A 3SHQA 1K1EA 2G1AA 2HHLA 4RESA 5AESA 1RQLA 2RARA 4HGQA 2VKQA 5AM1A 1LTQA 5AW4A 2ZXEA 5AKIA 2BDUA 4OHFA 3ZVNA 4IG4A 3E81A 5FP0A 2ZBGA 1ZD4A 3U7EB 2C9MA 4J2TA 5AI5A 4XQ0A 3W5BA 3WKAA 2GHTA 3MN1A 3E84A 5AKLA 1T5SA 5ALMA 2QYHA 3ZI4A 5AK6A 3MMZA 3WKDA 2Q4RA 1Z4JA
chains in the Genus database with same CATH superfamily
3VAAA 2XSZA 3NVVA 5TV2A 3TXXA 3RF6A 3UH1A 4B4DA 1ZMRA 1OOEA 3HXQA 6CHYA 2EF0A 2B61A 5CDFA 3QX7A 5EIAA 5HOQA 5L1KA 1ZC3A 3O84A 1X9WA 2I5PO 2GZHA 2IF2A 3EBOA 1JJBA 5DW0A 4LBZA 3IQFA 2R68A 4MHTA 2FMHA 3OF5A 1Q77A 1T6YA 1Z0UA 1LJ8A 3F9IA 5AVYA 2CNLA 1BQ4A 3VH3A 5K05A 4IZOA 3EG9A 4BWMA 1V96A 5HRUA 1AN9A 4KLZA 3PB3A 1RXSA 3BHMA 1FYFA 2LWIA 4CKBB 3UJ8A 5JLJA 1TK8A 1RI3A 1N4AA 3I9OA 4PHAA 5TZVA 3V4OA 2IYVA 3F7MA 2Q8PA 3JPWA 3FTQA 1K68A 2LBPA 4ZEXA 1JLMA 1DMSA 1JDBB 3OZGA 2ZYSA 4FEYA 3U1BA 1VPVA 5C8ZA 1WUJS 2EZ8A 4LZLA 3OLWA 1XZFA 4J3FA 1U28A 4N5MA 3NM4A 4NYIR 4UUBA 1QR2A 3NJRA 4LXUA 1F0NA 2MAXA 4LJKA 4OXRA 4NLZA 3EYZA 2OTCA 2AT1A 4BO1A 3PE3A 4CE6A 2PRZA 5KNCA 4DDVA 2EKZA 1CVIA 1GCAA 1L8AA 4LS3A 3E4DA 3FNRA 1FPQA 1JDZA 2F00A 5FUBA 3W04A 4KR2A 4DL3A 3DOCA 4EFLA 1KTIA 1WKVA 3D6MA 1UC8A 1N3BA 3T4PA 1CYDA 3M1LA 2VDNB 3C6BA 5B3JA 3CNHA 3KKLA 1P72A 3WFZA 4A23A 3G0BA 5FBZA 3R5XA 4LX8A 1BE6A 3AUKA 4YCSA 2P30A 2FSVC 1XJ5A 2QLBA 3CHYA 4PX5A 2YRFA 1HO3A 2AZDA 1TTPB 4X0EA 1N9ZA 4Z2YA 1JBKA 4TYYA 1V41E 4ECWA 4IR1A 4LGVA 1BZYA 1XHEA 2VJDA 4ND8A 3AVXA 3RNLA 3ZE7A 1PEKE 3EG9B 1ESNA 2R66A 5CEFA 1NW5A 3ONEA 2NM0A 1KA9H 2QV0A 2FLVA 3KR0A 1QGDA 4RY9A 3O4GA 5LB2A 4FSDA 3VRHA 2QLNA 4ZI2A 3DEJA 1MAHA 2YDXA 4CDNA 4BQRA 2LBOA 3U0BA 2O7SA 3W2TA 3DEFA 4KAJA 1KSJA 1MUUA 3VC3A 2GN8A 1J25A 1AUXA 1JA1A 5J2UF 4LXQA 1UFQA 4A3SA 5AQ1A 1ARZA 2QXUA 2A3RA 1E5DA 2AQHA 3DHWC 2C94A 4WOKA 2GD2A 4CV1A 3RJIA 2VSQA 3RIGA 1JIHA 3N8IA 1C3XA 3IVAA 3PXXA 4ZCMA 1YOVB 4QFDA 1ZQKA 5B4VA 3W8RA 1SU6A 3D81A 3AKDA 2JCGA 1Y88A 1D07A 4Y2XA 2QPAA 1QQ7A 4D80A 4C7OA 4YCNA 5G0SA 3TR0A 1L3UA 3IB6A 3PC8C 3NIDB 1STOA 4PIPA 5DGAA 2FSSA 1JIKA 3IUQA 5KIAA 2BGGA 4IDEA 4OQPA 5U4QA 3G8BA 4NFYA 1IN7A 3WYEA 1QX4A 4Z8XA 1GGNA 3NIWA 4KPGA 4CF4A 1CJCA 3M8RA 3WV5A 4H60A 4FOOA 1WD5A 1TZ2A 5JAOA 4CI0B 3LVRE 3R6WA 1HE4A 4OLAA 5AK5A 3A4NA 4WY5A 5B66U 3BMOB 2IUFA 1N0IA 3JQ9A 4ZICA 3TFQA 4BCBA 4DG8A 3ZOKA 4WLVA 3Q8XB 4OQNA 3ETLA 5BUQA 2GKSA 2P9TA 1Y1PA 1P1IA 4UHBA 5JR3A 1JLRA 3IDWA 2IEZA 4QEKA 1JKIA 4X20A 3BWBA 1CG6A 1V6AA 2ADFA 4ZO6A 4OBWA 4LJ6A 3RO7A 2FWIA 4WBSA 3H8JA 2P1DA 4O2BA 1ML3A 1F14A 4ZXPA 1UMDA 3MPOA 4CG2A 4R9RA 1BH6A 2V74B 4U39A 1SUDA 1J8FA 4F2HA 5CW2A 2PS0A 5EKXA 1NKTA 1L8LA 2ZTVA 4RC9A 1JIVA 1ZM3A 1GU7A 1KFCB 1US8A 3IUNA 2H5IA 4I5DA 5IZCC 2VK8A 4O25A 3VDRA 2G36A 2PZMA 2OB2A 3T41A 3GN2A 5AHXA 3N0WA 1YR7A 3QWBA 2A0YA 1KBUA 4RY0A 2F9FA 4DIDA 2VDUE 3D4IA 1AKQA 1G8KA 4C7XA 5DM0A 4IIHA 2HMUA 5F77A 2ZR9A 3HDJA 1O96B 2BUAA 1FSGA 5MGNA 1BD3A 3R4VA 2JAPA 1SXGA 3FNBA 4QBHA 5DGCA 3NDIA 1ZH8A 2ZB7A 1P5ZB 3BWDD 1QHXA 1EEHA 1UKYA 4PC7A 2EGHA 5IC4A 3DAYA 5H81A 2JAXA 4X24A 3FR7A 1S1CA 2XDWA 3THWA 4D6XA 2HB6A 2OO3A 1NG9A 3SD7A 1S6YA 4A7PA 4B2LA 5EWGA 3LGXA 2OCBA 3PSPA 1J4AA 1MN8A 5J58A 2FN7A 3GV7B 2ODBA 2E89A 4HMOA 4IQ0A 2IYTA 3GGOA 1ZZGA 4P7GA 4DARA 3WL5A 8ADHA 5HRAA 1HYQA 4TWAA 1JVSA 2PUGA 2UZ1A 2XVTA 5HCUA 1YU6A 3LZ6A 3QFFA 3WZMA 2QR3A 4O2BB 1UMDB 3P94A 4MS3B 4HEJA 3QKIA 5AK3A 3MDCA 2GA8A 4QL3A 2I71A 3EJ6A 2DUWA 2JEOA 2PX4A 3KJXA 4FN5A 3H0KA 4R01A 4DR1B 3LLCA 3BXXA 1US8B 4BKQA 4W1PA 3N39C 4YLEA 1YASA 2OBLA 1Z74A 8ICIA 2OCPA 3MWEB 6LDHA 1SELA 1I5RA 2Q2NA 2WIJA 4LRTB 1ULHA 4J75A 2J3MA 4A0SA 3LNTA 2HBYA 1DQPA 3K35A 3T3DA 1X70A 4TS4A 2H1FA 1SXJA 2V55B 4I2HA 4LF9B 3I64A 1GN9A 1EESA 5ER9A 5H9WA 4BIIA 1MNAA 1FZTA 4MDYA 1JEYA 3TB6A 5K51A 2EWVA 2C8JA 2QT0A 4C0AC 4D8WA 3H0MB 1DGQA 2XTMA 1E1QA 3OQIA 1JVNA 2QK4A 2V6FA 3C24A 2R47A 5D8DA 5FV4A 5EJ5A 2CMKA 2AC4A 4LOAA 4X84A 3AMVA 4FZ5A 1THTA 4ZQIA 3AVUA 5EMHA 1L7QA 1SIJA 2YXPX 1KI3A 2HLHA 1CVLA 3V6KA 1Y8QA 4B3FX 5E7JA 3T1HB 3IG5A 4CVNA 4D0NA 3GFBA 4D97A 4REQA 1BOFA 3ZU4A 2DBYA 4UE6A 4N7BA 2MIIA 1RWKA 5DSTA 3QXCA 2N75A 4RQAA 4ME6A 3BL6A 4CMBA 4F21A 3S6JA 1B0PA 2LRHA 1JE0A 1F8YA 2BISA 3N07A 3PSTA 4XYGA 1OJ7A 1O94C 2JIZD 4F4IA 3GVCA 3QKRB 1SBZA 2UUPA 1KNQA 1GO3F 3AV3A 4DMGA 1Z6AA 3CUVA 2EAPA 4F5WA 1U7OA 3HSYA 1QAMA 4QICA 3U17A 3NCHA 2EFYA 4FDTA 3EQ2A 4RK1A 3AFMA 1YJ8A 4F3CA 4DA6A 2SKCA 1VRVA 3KUXA 5DIFA 3DBOB 4DA4A 2ZRCA 3PEYA 4I4LA 3LBNA 4HTFB 5BO5A 1YDWA 3TR5A 4M7OA 3MWKA 9ATCA 3IV9A 3M9XA 4BE4A 4D0LB 2DU8A 2A9VA 5AFSA 4B9SA 1SXJB 1L5MA 1L7DA 3DC7A 1OVMA 3H9EO 3MN1A 4G5HA 2A4KA 1JHVA 2IDMA 4K4IA 3WIEA 1XMOB 1JEYB 2IK8A 1TNDA 2A1TR 4NOMA 3B6ZA 3U44B 3PVSA 5T6MA 3Q2KA 5E3HA 1E61A 3GJTA 2ZI7A 2JIMA 4UNPA 5JMTA 1SK9A 3NT4A 1ZQEA 3LFHA 2GN4A 5HQJA 5C1OA 2GETA 1FDRA 3H9BA 4L85A 1T8YA 3EULA 5K4HA 1Z1BA 1KI1A 4EYSA 5KNDA 1Y4SA 1FF9A 4LI0A 3DUFA 4UUAA 4CLEA 3PHLA 2O7NA 4REQB 4HUTA 3R3YA 3QI2A 1LWNA 4RK4A 3VR0A 2HDNB 4UMVA 3GAFA 1EVKA 4ENRA 2J5BA 3M3DA 2PH1A 5IKXA 4HADA 1UADA 2QN7A 4KQXA 1XZDA 3HDYA 1U98A 2P78A 2WMYA 1F0MA 5DO9A 3ZHCA 3GEPA 5KTSA 3TI9A 5DULA 4JJ4A 2WLSA 3EZ9A 2VPQA 4EG4A 2PLWA 1NLYA 1CUCA 2HRZA 3ORYA 1RLTA 3P0EA 3ACDA 3V6JA 5U9CA 4DM3A 1SVOA 4JI0B 1HT2E 3AEKA 2VDVE 1GEEA 5EP4A 4JGGA 2Y93A 2I1WA 4KC0A 3JD1A 1G5IA 3OI7A 4MVJG 1RHMA 3CZQA 4QZAA 2RMKA 4CCAA 4RL6A 1QXSA 3PFHA 9GPBA 2X19A 4GLXA 1AKRA 3V1TC 3OJOA 4YD1A 3RREA 4ZMBA 2X9QA 5HUHA 1BOOA 3GIIA 4H3SA 3OX3A 2B5OA 5CVVA 4FDVA 2Z9BA 1YDGA 4B7ZA 2QARA 4R1MA 2FN9A 4K03A 1SULA 1XP8A 4RDCA 3ZE8A 2PT9A 1XJCA 3QXGA 2IRWA 3AF4A 2V45A 3GROA 1X7YA 2YYAA 1HZJA 4W8GA 4HQOA 1K63A 2RHHA 2AYYA 4KQ1A 4BAZA 4PFQA 3T9BA 1LV7A 1GARA 2JFFA 3M9WA 3QF7A 4JXXA 3C8MA 3V7JA 1AUOA 1KAMA 2XWPA 4ZQBA 1MW9X 1ZQMA 5JH7A 2AOTA 3A1UA 1T5DX 3ZZUA 4JIGA 4B33A 1NN1A 4PLGA 4RD0A 4A8TA 2F1JA 2XVYA 4US9A 3HKBA 3O2JA 3EYAA 3MCAA 4DQUA 1QIMA 1KY4A 1GUFA 1CYEA 5CEEA 5MN6A 3DE0X 3FLEA 2E55A 4RHFA 4WFKA 3VZQA 3FNGA 4HWSA 5I45A 5E2BA 4YJ3A 4Q93A 2VPZA 3HJRA 1KTQA 4TS3A 3TZHA 1T7PA 1M8GA 2GBLC 1FW8A 4F5QA 1LNSA 2I3ZA 1EWTA 3C14C 3FTDA 4UJ5A 2UU9B 3LBAA 2BEVB 3VZDA 1ADBA 4TZ0A 1W75A 4KDRA 1VBKA 1UJCA 4YI5A 4RKWA 5AVJA 3ZJTA 2NMVA 1Z7EA 1OBCA 4KODA 3IUYA 5KTOA 1Z2PX 2G4VA 4K05A 1GTZA 1VL5A 2OCGA 3DS8A 1P1RA 1YBAA 1NRIA 2Y8EA 1OBOA 2ZETA 1JU9A 2W4IA 4OU4A 2WUEA 2QYSA 3AL2A 1GPWB 3JD0A 2ZYTX 3RTDA 3ZKWB 2NT3A 2OCLA 4GRDA 3KLBA 4R2JA 1EGQA 2JH1A 1WW2A 4EHIA 3OJWA 3G59A 1DG1G 5JISA 5ICMA 4LNUB 2X5KO 4HNGA 4KI0A 2HNKA 5TQ0A 1NP6A 3I8SA 1R6VA 3COYA 2OGTA 3PW7A 621PA 3BRQA 4REMA 1UFKA 3KFVA 4Y2TA 2X0NA 2QD5A 1JG7A 4X61A 2AE2A 3DL0A 3TAUA 5EESA 2UYYA 2JL1A 2FEKA 4NY1A 2O59A 3EXG2 1MPTA 5JH7B 3KQYA 1J2EA 3FWPA 2QM7A 5ENVA 3GLIE 4UCXA 1GITA 1VE5A 4GPAA 1IFXA 1X6JA 1IBRA 3NOXA 3O9ZA 1U49A 2BM1A 3HACA 4FHZA 2QTVB 4D9GA 3HKBB 1I7DA 3T9AA 1BNCA 4B2YA 2Q4RA 1U5AA 4KXMA 1ZQQA 5KOIA 3LPNA 4P82A 2BCSA 3SR6A 1DXSA 2HCBA 1C0EA 3KSRA 1CHDA 1UDAA 4M1SA 3R7LA 4DLPA 1PKEA 4K9SA 5CFRA 4LQ4A 1I4EB 5A7FA 1B8VA 4C1BA 1WCV1 3KJEA 2RJOA 3P0FA 1NSTA 3UT5A 1J2RA 4NBRA 1IUPA 4NMMA 1JR2A 3CR7A 1U0SY 5JI2E 3QKUA 4KVFA 2ZSHA 1QHIA 1C0LA 4WD3A 2V9ZA 5T5QA 4PG8A 1NMSA 4EATA 4H0CA 3S55A 4BOYA 2PY6A 3V8NA 4MEJA 4RNMA 3NGMA 5E4YA 3REFA 3RJ9A 1D2AA 4US0R 2X8JB 1DTEA 1VHJA 9ICKA 4ETMA 3CRQA 4XGIA 2OBMA 1NVTA 2HDHA 3T7KA 1F17A 3G8YA 4JEIA 2ZJ5A 1SQ5A 5AM4A 4IDNA 3H0EA 2FFQA 1TF5A 1BMTA 5F1YA 1M2OA 5KDOA 4FD2A 3ALRA 1UC9A 2V98A 2ZJ3A 3SF8B 4BFXA 5IIIA 3D5TA 4DUZB 1NXWA 2B69A 4CGZA 2C9CA 4CEHA 4OBBA 3ELYA 2Y1DA 3NVMB 3KQNA 4ERNA 1X9GA 4EY8A 2M1ZA 2G88A 2ECPA 1WCIA 4XASA 3M6XA 3AVPA 3ICQB 1XZQA 1KETA 5JCXA 5AXCA 3OWHA 2RKOA 5G41A 3I5XA 1ISHA 3STYA 3WMEA 1ZD1A 2WNIA 1XA4A 1YUNA 5ILGA 4G5GA 1AQLA 4I55A 5CM8B 2V7TA 2YMMA 5EAIA 2VNIA 1GL6A 2R2AA 2YC4C 3B8HA 4LQDA 4BNZA 3D2AA 3U61B 1KQFA 3N8DA 2NUAB 1YRYE 1NAIA 5EHZA 1YB5A 2IOYA 2O8NA 4RSRA 2Q2VA 3WOHA 4KX5A 2HO5A 1G66A 1ZQAA 3M2PA 4P83A 2BGTA 3A25A 3N0RA 5CPFA 1E3QA 2KQUA 2X1HA 3CCCA 1UM9B 5KKAA 2ZE8A 3FI9A 5ITWA 3M1AA 5BVHA 5DGDA 3PR1A 1QSLA 1AQIA 1OKKD 1CK4A 1M2OB 1IZ8A 4OMCA 5E0KB 1D4AA 4WCFC 2DT5A 5I8ZA 4TKLA 1I36A 4LDAA 1G0NA 4IQGA 4Y6LA 2D59A 1OGJA 2V59A 1G6HA 4F3YA 3U9TA 2ZJ2A 3H11A 4EPTA 5AUPB 3UUFA 1Y8CA 3PQ8A 4QLOA 4Z0HO 1UT8A 1WLSA 2I2WA 3TRFA 2FWBA 3QTBA 2ET6A 5ICSA 3BERA 3BQ9A 1IZ7A 1XLWA 3FLBA 3CB2A 4LOHA 3AHFA 2VYFA 3B52X 8GPBA 1ZRMA 2OZEA 9ICQA 5G4KA 2YQEA 2FE9A 2PUAA 1A2BA 3BXFA 1O9BA 5HSGA 3KTAA 2CBXA 3QVOA 3G5MA 1JRLA 1O57A 3WC4A 4BQIA 1Z2OX 3OJFA 4WN9B 4ZO4A 3C7TA 3A9TA 1P8AA 4L8WB 2A14A 4WKBA 2D3DA 4KR9A 5I6DA 1LBQA 2KFZA 1NJ2A 1ZW1A 4F4JA 3NV7A 1GY8A 1TKBA 1JVBA 2P6NA 3QE3A 2HFJA 4ED7A 2VHTA 5K3BA 3RTVA 4PXSA 3UMJA 4Y1FA 4RTPA 2GHRA 2R1VB 2X1MA 4YRLA 4NY8A 5CB8A 3EEFA 4INOA 1P3DA 1F48A 5BVHB 1MRNA 2BFNA 1HE5A 2OO5C 1W52X 2P6OA 4OJTA 3GDGA 4QTZA 4RVHA 4TXMA 1GNVA 4H1WA 1BHSA 3K1AB 2PQMA 4Z0NA 2D7CA 3A26A 1M6NA 1D03A 1QPGA 4B6FA 2NO6A 3LFTA 1N25A 3A6GA 3OF2A 2UYQA 3R0JA 4MEBA 2AZMA 4XDGA 5F9NA 5G5HA 9ICRA 1EE1A 4ZP1A 1F0YA 3H2KA 1TEVA 1XMXA 1RKBA 1E9BA 4CQMD 1YT5A 3UUWA 1NK0A 4H0NA 2FPSA 4EA7A 2EP8A 3QHAA 4DWIA 1QG4A 2OV8A 1KMHB 1Z12A 3OA2A 3B9PA 4Q02A 3HWRA 4YPVA 3K94A 2SBTA 3DXXA 2NP7A 4M4SA 1ZVVA 2VRWA 1OLUA 2DYKA 3LW8A 4BN4A 2HMVA 1SQ0A 3OZRA 1DDGA 9ICFA 3KTAB 1G2IA 4EO7A 3SEQA 4K4GA 2DL0A 5L3QA 1KY3A 2F8TA 2BZSA 1O03A 4Z9YA 3WGZA 3IUSA 2I2BA 1Y5LA 3DE6X 3C2KA 2FCAA 2EBHX 1SD2A 3V4PB 4GMFA 4X9XA 3E5MA 5FWNA 1KK0A 1MCZA 5C8DA 4LZOA 3K6SA 2C96A 2R25B 4HF7A 2YC2C 2WU4A 1IBLB 3N2GA 1UXIA 5HE9A 4B3IA 1P9LA 1ST2A 1HQDA 1IU9A 3SEFA 2HPVA 4JMPA 4GR4A 1G20B 4TLMB 4WXRA 3PVZA 2R87A 2GM9A 2WHRA 2RGEA 2ANCA 4TV9F 1PF7E 1L7MA 2DOKA 4H15A 4X44A 5HZKA 1ZQIA 1IL0A 5DX1A 1CY2A 4XE5A 2XNKA 2E49A 1Y7PA 2WHYA 3FAHA 2VDPB 4N3NA 3ZV4A 2AF3C 4BYMA 2FUCA 2C61A 2H00A 1GFWA 4JOSA 3O5AA 5ABPA 1KOFA 3QVGA 1UBUS 3EZ2A 1PFQA 4KIWA 2PM8A 4J0IA 3PI6A 1SKQA 5IM5A 2XZOA 1P2DA 2GM5A 4UTPA 1IHXA 1ZCAA 2CE2X 3DD1A 1RAIA 5LQUA 4II2A 1DRWA 4NDZA 1EJ6A 4I4IA 5M3BA 2YBEA 1E3JA 2GPAA 3TWOA 2W6JA 4ED1A 1FZQA 1KP9A 3BL5A 4ZDIA 1J9EA 4V0OA 1QO0D 4PYJA 4JYMA 5L3QB 5JCJD 3EH2A 2FLPA 5KL8B 4DNQA 3OCUA 3S7ZA 3B0XA 4XJSA 3IP6A 4R6XA 4YUAA 4F9EA 2YICA 3SP1A 3ZLVA 3ESZA 1SM4A 4I3HA 1HI9A 2I4OA 4J94A 3O1LA 3O73A 3WU2U 2MTBA 5BN4A 3TI0A 3PGKA 4P5PA 2KW5A 4QG3A 3OHPA 3EPJA 1WDLA 4LVSA 4C8KA 3FRJA 4M7PA 4EG3A 2QLLA 1FUUA 2NV0A 1VI6A 3RV4A 1JQLB 3DA8A 4AK9A 1KPGA 2RDIA 3UV3A 1GZ6A 4Q39A 5IASA 1IY0A 4NCAA 1JT9A 3ZXYA 5LP6A 3I23A 4P4SB 4R2WA 1DPFA 1P81A 2WTXA 2CLKB 3H0LB 3I6MA 1JEOA 4HYQA 5A0VA 1DO0A 7MDHA 5FTWA 4QWBA 3BICA 1J09A 2LP4Y 3ET5A 3BQ0A 2M98A 3GLQA 3JPSA 1F38A 3CR8A 3PPVA 3TCXB 3FSGA 5REQB 3OT1A 2Q5EA 1Q1BA 2QL9A 2YJ5A 8ICUA 5JFOA 3HCPA 1VE7A 4GKJB 4MVJD 2NVUA 4L73A 1NFQA 2NXEA 1ZGBA 4Z53A 2JAOA 3GHHA 3VOSA 1BEZA 4K0RA 3LZDA 3DLCA 4DV2B 2NTEA 1KEJA 3ZH9B 1E79D 4CU2A 2H11A 3DAHA 3GYGA 3O2NA 1MV5A 3AONB 1TYCA 3U6BA 4X3OA 4I9HA 1J9ZA 3JQFC 4UQOA 2J3EA 2YQ5A 1QU3A 5GP1A 3WRXA 4NYMQ 1Z4NA 4DREA 1XNSA 3II6X 1WZ2A 2CHFA 3ER8A 4X92A 4JWMA 4RKRA 1QDLB 5IULC 4L1KA 4KN8A 1M1YA 4IL5A 1PIWA 4BQFA 5DHAA 1JUDA 4H27A 2ZYGA 3P97A 2PH3A 3CURA 2JANA 5K7SA 4HWGA 3T1TA 4AQYB 1HUZA 2QD2A 3HL0A 4G97A 2HOIA 4U7TB 4IDOA 2WUGA 3GXBA 4RZ2A 3D4OA 3H84A 4W63A 3SZUA 2BQRA 4QJBA 2IEGA 1YIDA 1CEXA 8MHTA 4M38A 3BAFA 1MB9A 2HF8A 3D4NA 4JVSB 3THYB 1G8HA 3HH8A 4CLOB 1F51E 1XPOA 4IJQA 5FWYA 3RS2A 3OE1A 2RK6A 5DW3A 1MXHA 3JARB 4PPFA 1WLYA 3F4KA 2OM6A 1GKYA 2NO5A 4N54A 5KNDH 2RE8A 1PU2A 1F3LA 4Y0AA 3GRVA 2NRVA 4MPDA 4IYRA 5FYDA 4ER7A 4XB2A 1N7IA 5CTJA 1S0UA 3DBIA 4ZWNA 3N2ZB 4NR0A 2M6LA 2C7RA 3KHKA 3WL8A 4OHWA 2IXDA 5K9ZA 1FNBA 1BN7A 1QBKC 5CDSA 3HL4A 4B84A 3ACCA 5ALOA 4KOAA 4URFA 1Q44A 1OMOA 4IHQA 1KC1A 2IYXA 2Z04A 1OTHA 4FJ0A 2DECA 3HBFA 1P2TA 1ZI9A 4TQSA 1LWOA 4LC0A 1VOTA 1X6IA 4M36A 4Q1DA 5DRTA 2QUKA 4B3TB 5JZSA 2JA2A 1TQ6A 2BFPA 3W9SA 3EGDA 4GM0A 1VG9B 4YALA 2XWQA 1D1QA 3BD6A 2XA2A 5BSWA 3SQDA 4RHUA 2LYHA 2DPIA 2FP3A 4GOND 4XGKA 4A91A 1Z07A 4XJXA 3X1ZA 2JLYA 3N2LA 2PSDA 3SFVA 3SIPA 4QZCA 4G86A 1M73E 2PZ8A 3ROKA 1GPMA 1VL1A 1C0KA 3OOYA 4U7FA 4KXWA 1LQ2A 3OEHA 1R0CA 3RJKA 2H8KA 4BJ3A 1H1LA 2O2HA 1SCNE 3KZOA 1EP2B 2QYTA 4ZPXA 2MOKA 4V38A 1G98A 4RPCA 4OXXA 4FD3A 3GJXC 4MP8A 3ZH2A 2OXIA 1YZLA 3UAOA 5JRJA 1ORIA 5FA6A 3MWJA 4DLNA 3OTGA 4OJ6A 1DIHA 2EZTA 2WJAA 4DCUA 2R8JA 3M82A 4HSGA 2EFDB 3ZXIA 1QTQA 1YGYA 4M0MA 4O4LF 2VQFB 4G0YA 4M89A 5BWLA 4IXMA 2Q1WA 4F93B 5IT9A 5BW5A 1X9MA 4JGIA 2XUFA 5EP2A 4FHGA 4OOEA 2EJTA 2QYHA 3RB6A 3HYTA 2NV6A 4XUEA 4P4OA 2GFHA 5JD3A 1MFPA 1J97A 3ZCUA 1G60A 1H5QA 4M99A 1SMKA 4HQNA 1SKWA 3AG6A 2VBIA 3PWKA 5BYAA 1R8YA 1UC5B 5T4FA 1GT91 3LFUA 1H23A 3ETCA 3TAHA 5CXQA 1U48A 3TOSA 4BZZA 3S8YA 4UTOA 4AJPA 4GLOA 1MABB 2C4MA 2HF2A 3OP1A 1UBLS 1Z0SA 1GTL1 4CKCA 4TWBA 5EOZA 1G7TA 1K7SN 3MOGA 7ICIA 4LOIA 5BP7A 2UZ3A 2K4IA 1H1LB 4HAUA 2FX2A 4L5AA 5CX4A 1INLA 2LMRA 5HMLA 1R4ZA 1S3SA 1YZVA 5A9SA 4H4CA 1PJRA 2CLIB 3AQFA 5IYZF 2UKDA 3NVZA 3A1NA 3HA3A 4KO8A 2W3RA 1JG2A 3W05A 3FCXA 3IEUA 1CFJA 5J1SB 4Q5IA 2JEGA 3O90A 4JKOA 1JKXA 3SX0A 2GASA 3EFEA 4M1TA 3A2MA 4AY6A 4XA8A 1RRFA 1JRPA 1OXXK 3C15C 1J8VA 5AVTA 5KU7A 4AAYA 4H3VA 1V1RA 1R3UA 3E53A 2HW3A 4KIFA 4MITA 2O6KA 4I1YA 4P81A 1C1DA 1VDVA 3ABRB 1E9SA 3CLVA 1U99A 4ZYTA 2H2AA 5E4FA 4IIJB 1KGSA 3BFKA 4J9OA 5K5EA 4UAWA 2H5EA 2D2EA 4CYMA 3EXEB 5KJ6A 3WAGA 2QRGA 4DJJA 2B36A 4NAHA 3I2IA 3QKSB 1UXGA 2FA9A 2D6FC 1HTWA 4LF4B 1TE2A 1MV8A 1S2GA 3IP3A 1VHQA 2ZIWB 4BB9A 2E48A 4C06A 1KN5A 1OGIA 3BHJA 3ZHBA 4WXEA 1YS2X 3RVOA 2ZYHA 4GIBA 2ZIGA 3VR5A 1NMEA 3LQRA 4DS5A 2VK4A 4IDFA 3WFIA 2NU6B 4ZGBA 5K6TA 1U02A 2JHPA 4ARZA 2BBTA 3F7OA 5IRCD 3TE6A 1LDYA 4GI2A 2PUVA 3QVSA 5A9SB 8ICZA 3SK0A 4R1TA 2FG5A 1JG3A 4OK3A 3KXKA 1SIBE 3ICXA 3IOMA 4QOJA 3RU2A 5JE8A 4TKVA 1ZNWA 4O5AA 3UHFA 1JEQA 4L0MA 4C0JA 3A2KA 2DERA 2B1QA 1DKMA 1E1KA 3A6DA 4FGLA 3IMFA 5ITZA 1XVLA 5HFNA 4NATA 3UK0A 4OAPA 2XNHA 2NPFA 3W0LB 2OP0A 3DGFC 5IJ9B 1C81A 4P3XA 2YHIA 2NAFA 5DLFA 2WUFA 3P2JA 1V1RB 2A1JA 2D5CA 2QN9A 1CJVC 4MW4A 4RGBA 2KWIA 2VHXA 1MGPA 4LHEA 3QG5A 3WMGA 3HO8A 3NWOA 3C8UA 2AXPA 4R9UC 4MP3A 3A1TA 2W48A 3RH6A 2QTNA 1Q0RA 2JFYA 2KBEA 1SXJC 4N12A 3LL7A 5CD9A 4TMXA 3NT2A 1DUSA 3PRYA 3UGQA 2B8EA 3Q9NA 3M9MB 4BKRA 3EZXA 2WFLB 3I30X 5BNTA 3KOYA 1KS2A 5FJIA 2RQ5A 4CG0A 1ZQJA 4GH5A 4QM6A 4OL0A 3QRWA 3FKQA 3OX4A 1U7ZA 3LXRA 4QTXA 1WB9A 1MA7A 3RU9A 3FMGA 3HJHA 3A3YA 1Z38A 4DQ0A 1M1NB 3T34A 5J59A 1V11B 1Z75A 2WP0A 1K1EA 3DBRB 4ED6A 2PX3A 4E5YA 1TEZA 4FK8A 4IFBA 1Y4UA 3RS9A 3RG8A 3L8DA 2DFLA 5FP0A 3CINA 4UBIA 3HJEA 4AWBA 4QDOA 2DPMA 4E1AA 1SZJG 3A8TA 1PJSA 4IRUB 4CL0A 1FYDA 2X0EA 2BPFA 3KUDA 3QFHA 1M6HA 4UZSA 3EXIA 4F2WA 2EFHB 1IWBB 1JEQB 4N5IX 3DOHA 1IY2A 1RQ2A 4D9CA 2AUNA 1IHPA 2VT3A 1UANA 3SR0A 4ZCQA 5CB4F 3LPCA 2ZS7A 4NEGA 5H0IA 1JLLB 2WFAA 5ALTA 4UM5A 1NFFA 3BE5A 2RHTA 1RCTE 5IIJA 2GHIA 1KF0A 1VECA 5JBQA 4C4PA 2JJ8A 3GUZA 1HRDA 2H5JA 1RZVA 3A6FA 4XYMA 4RZUA 1AK2A 1UBHS 2V4UA 1KHTA 3OPXA 1RPJA 3LHDA 2GEBA 4IVNA 1YVRA 4A82A 2PBZA 2BMEA 5E0OA 2ZVPX 4RHEA 3F6CA 3UM9A 1R3DA 2G77B 3GLKA 3V7UA 3E7PA 4WOBA 1UDBA 1TKRA 3AWDA 2HMXA 3D7LA 2Q3FA 5FI3A 2WVAA 4RPYA 3FWHA 3CEPB 2Z43A 5KFKA 2HSWA 3HC7A 1ENPA 2Y2VA 1GT6A 3FOEC 1Z7GA 1JPJA 1YRHA 2EEPA 1KO5A 3K5IA 4EHBA 4GXTA 4N41A 1K86A 3QEOA 3B51X 3JQ6A 5AHOA 1M34E 4JNKA 4PGFA 3E61A 5LC1A 4ZEOA 4FOLA 3C5HA 2W42A 2Y66A 9ICHA 2JZOA 1SCJA 3UJ7A 1Y1TA 4H6XA 3EVNA 3EXIB 2GZ3A 3IUMA 3GJ8A 4UAYA 1E69A 3T9DA 4REOA 1X2BA 1U0HC 1ZK2A 4GOOD 2J33A 4RZSA 3SEZA 1MX5A 3S28A 1TYDE 1YB4A 4CM4A 4L76A 2QRKA 3RU3A 5DGXA 2NUTA 4BX8A 3HGTA 5KBYA 4LRSB 1C9NA 5KSPA 4OP3A 3D5EA 1C7IA 3NEPX 4AKSA 3TUJC 1WDWB 3RTEA 1NBEA 4AXBA 2GA9A 5EWJA 3T9CA 1M0EA 1OFIA 2AQ0A 2EDCA 2JRCA 3OM1A 2ZYUX 3KHSA 4ND8B 1HLGA 1EK5A 3WK6A 3AQIA 2HLDA 2BDPA 2Y1KA 3VNAA 3EVDA 1HDZA 4EB8A 1W36B 4AMUA 4HUJA 2EJCA 3EXFA 1ODCA 3HFRA 1E20A 5CH5A 5I7WA 2VNHA 4D3ZA 4NE7A 2QRZA 3TZLA 2K89A 1C9YA 3U3OA 2CGEA 3TL2A 4ASUD 1ZXIA 4CIBA 1KJWA 4LYDA 1E7RA 1VKHA 2KV2A 2ZUFA 3AP3A 3DDWA 1T4CA 1Z15A 2AJ8A 2WYUA 3QY0A 4WZZA 3FF4A 1GL3A 1TA4A 3R23A 4KU4A 4P5DA 2LE0A 3WNCA 3O7WA 3VO1A 1Q91A 1VRCA 3A1VA 4MYDA 1S97A 4DSNA 3OFNA 4EJ0A 1DI0A 3IOBA 5AW3A 1T2NA 4FYPA 3TJRA 3QEMA 4Q8FA 4C07A 3D4BA 4JZKA 1HBJA 2JG3A 1N2OA 2AB0A 5CYPA 2PFGA 2COEA 5BWMA 1QLNA 5BOLA 5KG7A 1MORA 1MVNA 1PLJA 4QJIA 2XNDA 4QUKA 4JQCA 4C7OB 2ZU0C 4LDJA 1ELOA 2V97A 1B16A 5JYEA 2QRMA 1EFCA 3RLIA 4U7CA 2J1LA 3PEEA 1AQNA 3NEAA 5A4AA 4LZDA 1OH5A 2XKJE 4Y30A 3HV2A 4J0EA 1Q7TA 1FOEB 1OVGA 1II8A 1JQKA 2FV8A 3VZCA 4DL6A 1JZSA 2HMYB 3F6EX 3URKA 1ZUNA 4R64A 2GT1A 1SU7A 3DO6A 5AESA 1TRKA 5CT8A 2FZ4A 2PFOA 3TKYA 3KT6A 3KXPA 5EWJB 2RDMA 2VHQA 1NXTA 4FFMA 1S02A 3PPXA 4R65A 4OHOA 1NBHA 5GJCA 3NBUA 3RWMB 1T9GR 4IY1A 4QZHA 3B1VA 5TARA 2E8NA 3EXFB 5JANA 5AW0A 2AXNA 5FPSA 4IDBA 3EZYA 1C0IA 4TWZA 1BDIA 3R41A 5JC8A 3DMTA 4X20B 1JBQA 4TMTA 3C5WP 2ODAA 2WKWA 3H1PA 5J2EA 4M8LA 1SUEA 1YJBA 3IMGA 2OB1A 8ICPA 4G4IA 1JG1A 2CJWA 3LOPA 1GWNA 3CF2A 1NJ8A 2OC4A 5DB7A 1IUNA 3MFIA 2NO1A 4L02A 1FEZA 1ADFA 2RHLA 1I13A 2IT1A 1DOAA 3HJFA 3BGWA 3RJEA 1XTIA 2GD0A 1GDHA 4UNSA 4GNKA 1HZZA 2FEOA 1L4EA 4KWHA 4X5VA 4BMZA 3ZWVA 4FLMA 1MOPA 4PSAA 3PJFA 1WP4A 1IULA 2AZ4A 1NKBA 2QVGA 3B70A 1T9ZA 2Q7DA 3U4QA 1GDDA 3T54A 3JD3A 2FW0A 2XGJA 3UC9A 2ZPTX 4FHDA 2I55A 5KREA 4RQ3A 4I50F 4C7VA 4MUEA 4QWAA 3EYWA 2YN0A 3HG7A 3DE1X 4EL5A 2ZIAA 5DM60 3UJBA 4CT5A 1G64A 1Q95A 3KEMA 3LXXA 1E0SA 1FFXA 1VI5A 1ZUNB 4KMRA 4BATA 3NASA 4IIDA 3VGJA 2WY2D 3YASA 1MC5A 1X92A 1LU9A 1OB5A 4UEOA 3WFJA 3FYUA 3QYAA 1P7VA 4IRKA 3D7RA 3THWB 4FC6A 4ELVA 3PWTA 4B3DA 1VL6A 2ES6A 5IM4F 3E58A 4QUGA 5E4JA 3LK9A 2I62A 2O5CA 2WF6A 1ZJ5A 5ESWA 5BQPA 3SSOA 1T0HB 4HS9A 4HAXA 1GUYA 3OFSA 4QTYA 4BYGA 1Q17A 3BHIA 4BO3A 3DZIA 1EK1A 2B2XA 2CXQA 4BUZA 2UZ1B 4YBZA 2W6QA 2N9UA 2FF5A 1E2FA 3ZHRA 3C43A 4Q4AA 1JXEA 1VE6A 5DCUA 2D2XA 2GVZC 4GRAA 1GAEO 1UM8A 4MJXA 2CHGA 4HB0A 3L49A 4GOJA 1G5QA 3DE2X 3IA7A 2PUEA 2FYTA 3MHTA 2EFJA 4FW9A 1CS4C 1TK0A 6YASA 1KL9A 1GRVA 4FEEA 1NZBA 4II3A 1M0TA 4LKRA 4RX1A 3HJGA 1QLHA 2XTAA 2PUDA 4BV8A 4K28A 1F6DA 1K6MA 4HATA 4BPRA 2V0GA 4MI1A 4P98A 2WU3A 4FXOA 2GRAA 2PGDA 3J80A 4B6OA 4BLPA 1UPUA 4A27A 5HIJA 1A4RA 2X86A 3U1VA 1VG8A 1NTRA 2C07A 1R64A 1Y5NA 3D2QA 1TI7A 3OQIB 1C7JA 1LW7A 4RA9A 1QH0A 1TD1A 4LSWA 4C21A 3FTCA 3AR5A 3ZC3A 4GBGA 3IN5A 1FFXB 4P5EA 3OETA 2V6JA 3ENWA 2OAGA 2PL5A 2DVMA 1S2OA 3ICWA 1I2MA 4OLBA 3VJRA 3HCOA 3GUCA 3IV7A 3L7LA 3MBIA 3RFXA 5DP2A 5ELMA 4AUNA 1Y8QB 3V8PA 3CF4A 2PUJA 4LVUA 5A3VA 5HJ7A 5A0LA 1UBOS 1JAIA 4OQLA 5F3RA 1Z8DA 2P0YA 2XMGA 1A8QA 3S2IA 3GY0A 3WRYC 2FPKA 2R7NA 2J09A 4ND6A 2Z4TA 4JLBA 4PAGA 5C3MA 2GAIA 5DBFA 1C3VA 5EKUA 4MO2A 1PTKA 1JA0A 4ZC8A 4PC1A 1E2QA 2XYQA 1E0AA 5IT5A 3FPEA 5JV5A 3GJQA 3TRJA 3KJHA 2XR1A 3DE5X 1AUVA 1X15A 3P26A 2B9VA 4F38A 1PCXA 1HQCA 1IOLA 4JLAA 4ZODA 1YB2A 4RK7A 1SC6A 4MEXA 3PGMA 4IQTA 4URVR 3HDTA 3DVRX 4U63A 3R4CA 1P9WA 2ZGVA 4D45A 5K1ZA 4G5SA 3S40A 2ASJA 2HXSA 4PWYA 5GIOE 3R7NA 4J9QA 1N5OX 4IWXA 3K73O 4EMTA 1AQUA 4EBDA 3H5WA 4D82A 1WX1A 4E2XA 1JROA 4M7RA 1WVMA 2H3QA 2JI6A 3I53A 4CMJA 1CR0A 3LDUA 1BX3A 2VJAA 1GD1O 2IV3A 1V9LA 3RRGA 4XDZA 3FBWA 4RHYA 5GGYA 1D9XA 3F98A 3W6PA 2RB5A 3VAYA 2PIDA 4YCXA 5FD8A 5LLSA 3R9IA 4OL9A 2EHDA 1OT5A 4JQYA 5AKXA 1NVFA 3DUFB 3T7AA 2IOFK 5D3QA 4E11A 1LVGA 3OIWA 1V97A 4MJ7A 3M6UA 2PX5A 2OAP1 1UAAA 3OE4A 4WN3A 5CP8A 1K1SA 7ICKA 2ZRHA 4X8MA 4E12A 3TSOA 2X0DA 3M7DA 5FI1B 3OMXA 2Q8NA 4BN5A 3W7AA 4KVGA 3WZ2A 4JASB 3E0XA 1DGSA 3WIVA 1EKXA 3GFGA 3IE0A 2WDPA 4DM4A 1EH5A 1Y6ZA 5HYVA 1UWKA 4JB8A 5BQOA 1EG7A 2ZI4A 5JCZA 4BZWA 4GQBA 3AEKB 1JL3A 3ROPA 1YJCA 3WAKA 2QROA 3OQ1A 2DKFA 4LHVA 4P3KA 4L5CA 2F4NA 4A2CA 4PZLA 1KAOA 3R0ZA 2IUEA 3WBFA 2ISQA 4GMHA 4GXRA 3ICOA 4CN9A 4B3RB 3AUJB 2ZTDA 2PMDA 2GKGA 1MVOA 5H16A 1OJLA 3FJOA 2XH8A 2QARB 3WGOA 2AG5A 4KQIA 2DHQA 1V5WA 2YY5A 2EAMA 3NONA 3RHTA 1NYTA 4OQXA 4PR0A 3I12A 1X7YB 4F56A 5KEIA 5DASA 2MSNA 2XMPA 4ZZ1A 4WKPA 4QWCA 4GI5A 4YO8A 3ITDA 9ICLA 4P3OA 3L0ZA 3MT9A 3EGXA 1Y9JA 4FBLA 1K4YA 2PWPA 1NW9B 3IB3A 1K7FB 3KBBA 4PRZA 1C3JA 1ZMOA 1PR1A 1FYVA 2AOTB 1VZ3A 1O7JA 3KHUA 5DWQA 3K7EA 4R1NA 3QXJA 2GPJA 3TH5A 2VYVD 2XQJA 4MVJE 3R0QA 4RPKA 2BCRA 2G6BA 3IHTA 2XVMA 1FJXA 4PC2A 1DUIA 3IPLA 3GJRA 1R6AA 3A4TA 5HCNA 2R84A 3C39A 1N8SA 5B6IA 5LQRA 3WMRA 4BNLA 5C1BA 2KD1A 3I9NA 1FDVA 1UDCA 4YJ3B 1TIPA 2CYCA 1JSLA 3KOZA 4X8LA 5B7PA 2H1RA 1T4DA 2W6CX 4PQGA 1M1ZA 2ZAOA 2O2CA 1GZ5A 1DO8A 2G9ZA 2YQ4A 1RJGA 4FINA 3I5UA 1KAGA 3RE1A 1R0WA 3NFYA 1H9AA 4Y1EA 3TVYA 2R48A 1KDYA 1Y89A 1S8AA 3CYFA 3NANA 3B1YA 2P9HA 5CVEA 4KPEC 4A2QA 1G21A 3LCRA 3NATA 1VL2A 4Y9RA 4M46A 4RM3A 1EFAA 4B73A 1U6JA 2ZYAA 1K7CA 2EFGA 1TZBA 4FYYA 1X8XA 4Q03A 3TEJA 3R9WA 3RW9A 1VKJA 1DDOA 5F1OA 5TQ0B 5IAAA 1D5CA 3X1KA 5DSZA 3EGXB 4F5YA 1JG6A 3R3VA 4ZYLA 1GUDA 1R12A 4UD2A 4Q1CA 4K26A 2ZXUA 2ETVA 2JGAA 3A7EA 2VTBA 4KTQA 2OKGA 3U6KA 4MF2A 1Y6FA 1BYIA 2N46A 1XKXA 4D8UA 1QK5A 1ZN8A 3IQHX 3L3FX 4US1R 3UOWA 4K9QA 3AINA 3HYNA 3C7CB 4P7JA 4JITA 3UV6A 5JPDA 3E9EA 4XOUA 3CNLA 4BDSA 3UKJA 2X7XA 4LXYA 2LD4A 521PA 3KQMA 1QF7A 1GZVA 4B45A 1IDN1 1SURA 5PNTA 5DHSA 5JXWA 1UKEA 2X15A 3SNKA 4D5GA 3D8UA 2ZBDA 1VKZA 3LWNA 4XH9B 4DJFC 3HKZF 4JFAA 2OQ2A 3SSMA 3L4BA 3UOGA 3BTSA 3ZDDA 4QWMA 1AIPA 4OKSA 3UT5B 1QM5A 1RWOA 4X1YA 4AB1A 1TQ2A 5IJAA 4A92A 4CCSA 3KKAA 4L3WA 4N48A 4BBJA 4B6PA 3QP9A 4U02A 5HM6A 3UPDA 1KP2A 4PTYA 4DF3A 4M0CA 4JGBA 2R62A 3T4UA 4CDMA 1KC3A 3HU2A 1NXSA 3OLXA 3NHZA 2F77X 4XD7A 2GS9A 4BDPA 2VTVA 1DP4A 1OASA 1RIIA 2ZSEA 2ZS8A 4OHVA 4F3KA 5KNCH 3IUEA 1FJGB 3EFHA 2AGVA 5CJJA 3I0MA 4KUGA 3GLHE 1VDZA 1A69A 2AFHE 5JG7A 1AS2A 3AGPA 2WWYA 4ED9A 3ZU2A 4TTRA 2F1KA 4XA5A 2VTBB 5EERA 3WRXC 1ZJYA 4NU0A 3DYVA 2ZB4A 6ABPA 4EZ9A 3DNPA 4FFOA 1LJLA 1LW6E 1E89A 1YCDA 1K0UA 1GZSA 5K0BA 3ZDYB 4CEHB 5L51A 5IAKA 1G5HA 5KYTA 1D2GA 4IIUA 2B0CA 4QUHA 2C3UA 3BDVA 1WCIB 3L0OA 5JSYA 2BBSA 1BVYF 1XDUA 4YRDA 1T34A 4YDQA 4EY5A 5DQHA 3KNZA 2OPHA 1E6MA 1CUHA 3WLAA 1V43A 2II6A 1TTQB 5L8VA 4PHCA 4Q7LA 3UUEA 2BM9A 3PG5A 4I55B 3A0BU 3NYQA 3PRHA 1K27A 3WLEA 2AFRA 4MCIA 3L43A 4PL2A 1WWKA 4UCFA 3I28A 4X1YB 4TQUS 5CA7A 1QV6A 4UM7A 2E18A 1E7SA 2HMSA 2ERCA 1KDTA 3C5FA 4PZUA 2IV2X 4PGQA 1SBNE 2ZJAA 5JQGA 2CL0X 4DY4A 2W8BA 1GN8A 5GIPE 1ULUA 5ADVA 2Z6UA 1EXNA 2HL6A 1AHIA 2MSCB 4BO0A 1JHUA 1FXWF 4HGZA 4GG1A 3PWZA 3H5RA 3WG9A 1CLUA 4DPMA 1DRKA 4ON9A 4DLTA 4DT1A 4PEVA 2VHZA 2X40A 2G83A 1IG0A 4IQFA 4WIAA 4R40A 3MF4A 1RLMA 3E70C 2B8TA 4W5JA 2RGNC 3WL7A 1T3QA 3ENQA 3QLUA 3H11B 2NP6A 4I1UA 1ZQOA 5DHUA 1XBTA 4RMHA 4IV8A 4C8NA 2W90A 3WNQA 5TF0A 1H9BA 2MSEB 4A0HA 1N5KA 3OU6A 1J06A 1ULSA 4PG7A 1QZ3A 2OSVA 4I2DA 2H48A 1EK2A 3NXSA 2OEHA 4YRZA 4F50A 5B2FA 1WW8A 1E1RD 1PVVA 4G67A 3WXBA 5SZKB 1ZCFA 5G4KB 3VPGA 1V4VA 2IHUA 1HE2A 1T9KA 5GVSA 5K8JB 1J9GA 1XZKA 4EJFA 3EARA 4MKFA 4PE5B 3T1OA 5DWVA 1GYQA 1R0LA 3IYLW 1OLOA 1Z2CA 1SCQA 3D59A 3P8ZA 5AVQA 1X1BA 1L7AA 4RD2A 5C8XA 4JEUA 1RKXA 1KQPA 2R00A 3G79A 1N6PA 2AOWA 5ETJA 4EHAA 1RS0A 5EEGA 2BJHA 3ZGLA 4Q7JB 4QDUA 4URYR 3WL4A 2QNBA 4NNJA 1O6CA 3RBEA 1I8TA 4HH0A 3H05A 1F0KA 1K92A 4S0XA 1SEVA 3LBHA 3T61A 5K2OA 8ICAA 4ZOLA 4ZAWA 4WKCA 1JZTA 3CNNA 3AFOA 4FE3A 4IOMA 1ZK0A 3FPGA 2QAJA 1OLXA 3GNLA 4GYWA 2JGDA 3E9RA 3KOXA 3LOUA 4DDHA 5F2OA 1L7OA 1KSFX 3U37A 4CMEA 8AT1A 3QEKA 4JLWA 3AI3A 3LC2O 4PRKA 3U3JA 1TF2A 5L4NA 4FGUA 1AZLA 4LRWA 2IUSA 1PR2A 2F3TA 2G70A 1T9CA 4B3MB 2O3SA 1WMBA 2YTUA 1P2FA 4KX3A 2Z8XA 3JYOA 4ZRNA 5IKMA 7ICFA 2HU7A 3E9ZA 2F44A 3GT3A 5T3YA 5EE1A 3K0CC 2G04A 3WHIA 3KHTA 3PT5A 4IDQA 1MENA 2PMZF 3WZLA 3AUYA 3CNQS 1OLUB 4AURA 1SUBA 1OYOA 2VJLA 2FOIA 4G84A 2DE0X 1T8WA 3M6VA 4US2R 1J0DA 1FRZA 4KJXA 4DBZA 5AVSA 2QMUA 1Y3DE 4FOSA 1GAXA 3S1AA 1UBFA 2HQRA 4M6WA 3I52A 4ZQGA 5F2KA 3MT8A 5IVHA 1QAQA 1FDSA 5LA6F 4YAEA 5ILQA 3FCYA 1MB2A 3WGGA 2WJGA 5HHHA 1KJIA 4JC5A 3UICA 3ONFA 5ICEA 2Q1YA 1AM4D 4R2LA 5HKKA 2C4NA 1M2KA 4WBXC 2OFFA 3K6SB 4WBNF 3CX7A 4WXYB 5TF4A 4YN4A 2X6TA 2NACA 3V7NA 3N2GB 2WF7A 4HB2A 3TNFA 4LYFA 2R751 4B40A 2OCXA 1LX6A 1RYHA 3PUVA 2XCSB 3PXCX 1U94A 2OZKA 2ILTA 3L41A 3BK7A 5DRYA 4TUQA 3NUQA 4DSOA 2HD4A 1UP6A 2LUOA 1TX4B 2HZBA 3MR3A 1WM1A 4NMLA 2I4MA 4ZVUA 4BB6A 3RG2A 4XR4A 5FRDA 3R7AA 1OXTA 2EZZA 4I9GA 2C4KA 4UOEA 2KTQA 2Y6VA 4LYGA 2REBA 2W71A 1FX1A 1UK6A 3RVMA 1ZX1A 3BK1A 4N0PA 2WRZA 5AVXA 3L8YA 3QVGB 5AXAA 3GCGA 3QYPA 3BSYA 2J6BA 2PEYA 4W9RA 1NRJB 5LLDA 3GGPA 5G53C 3INTA 4CIAA 3PNKA 4DQRA 1R5BA 2EGUA 3S8EA 4HOYA 5J0XA 5BMVF 1JDBC 4JT9A 4MKZA 4O6VA 2TSYB 2DLDA 1FTNA 5DM70 2IS1A 4RVCA 3G0HA 1NGSA 2QE7D 4TYWA 5KU1A 3NBAA 1YHNA 4MS1A 4PGHA 4CI9A 4INZA 4M6WB 2CLSA 3IX7A 3FOZA 1RWMA 1GZHB 1VJ5A 2JIPA 4JI4B 5IK2A 1CUUA 3GWZA 4RS3A 4N5NA 4YRQA 4L22A 1WSAA 2C5LA 4D8XA 4AI6A 1NURA 1TUEA 1QRTA 3TNDA 1QO7A 4W5HA 3Q3CA 1JX4A 2CJPA 4OFBA 2QVBA 1JMYA 2G6TA 1ZQLA 1Q15A 1EUDA 4F72A 2WVHA 1V9PA 5BN4B 5JNWA 5KVVA 3D9QX 3LY7A 3QELA 1D2EA 5FOWA 4C6RA 1GPUA 1V3VA 3OTIA 3V55A 2X2PA 4BTVA 3LY5A 1TU4A 5EOVA 3SPXA 1HK7A 1XTSA 2XE8A 5DXJA 1GG8A 4CMGA 4ERXA 3TB4A 4HC4A 5LP6B 2BKVA 1LNQA 1XXLA 4MDHA 3V3KA 1TQHA 1XPJA 5KVAA 3KFXA 2XNSA 3U2QA 2K6GA 2RHJA 4GX5A 1U8YA 3ZV3A 1R7RA 3DZFA 1ZS9A 4J4BA 5TMDA 3RADC 4RDHA 2PJUA 3OO1A 1JJ7A 5J23A 3OVMA 4FOTA 5KG6A 3IEIA 3OT1B 3D8BA 2GERA 1Y7LA 5E1MA 5K6AA 3H8SA 2JR5A 3W8DA 2ZUDA 3M9LA 1EVJA 1SG0A 1NJWA 4L0QA 1Q50A 2NVUB 1JR3E 5MGBA 1HG1A 4OGLA 3EBPA 1T2AA 1XRMA 2NYRA 2PPLA 3DEYX 4IGAA 2P7HA 5DM2A 4URWR 1U28C 2FAXA 1D6JA 2OXEA 5DNAA 1GPNA 3GVPA 5BRAA 2WYWA 1K4KA 3UK2A 1P4SA 2PQ0A 4DKJA 2GAAA 1D6MA 4JV0A 4HNRA 4HYKA 2VWQA 4PS0A 2J46A 1N36B 1T3GA 1M0WA 4BASA 4AFNA 3QHPA 3TZ6A 3FUUA 1EUDB 1M1YB 1EB9A 4TKUA 4BO4A 3GUYA 3G9TA 1IZYA 4ZXFA 3F96A 3ME5A 4N4AA 5BV0A 5B3JC 1ULZA 3S68A 2RGGA 2CVPA 4XWGA 3RUFA 3GZ4A 5H83A 9ABPA 4RJJA 3MWLA 5I7UA 1WU8A 3RAFC 4JR0A 1JAHA 2UDPA 3GARA 4MQEA 4NU5A 1AKMA 4GPZA 4TXHA 4KH0A 5DVZA 1IJEA 2K4PA 4J7UA 1ZXBA 1B14A 4B7CA 2OV6A 1RHJA 3ABIA 2RGWA 4M54A 1U9JA 2PI4A 1QIHA 3E9NA 4DNOA 2ADOA 2D0OB 4MGIR 1W36C 2DLNA 3VPCA 5D7BA 2KG5A 1ZBQA 1MZPA 4PGXA 5CNIA 5ERYA 4IXTA 3A06A 4ZQFA 1KI4A 5FWYB 3H9QA 5EP3A 5CLIA 1BPZA 3TQIA 1GR0A 1H8ED 1O94D 3BMNA 1AK1A 3FPFA 1WULS 2X13A 3UTCA 2ZIUA 2REXB 5KVQA 4KVZA 1VMAA 1E2BA 1SGGA 1DRUA 5DX8A 3FW1A 1LX7A 3ROMA 5ITVA 1SZPA 2ZCVA 2AE1A 2OYYA 3MSCA 3TECE 4DLAA 3KEGA 4IDGA 1DJOA 3MB8A 4PLYA 1KSGA 2RBEA 3TE7A 1E3EA 1U1CA 1ZGJA 4H2DA 3GUHA 1NJXA 1KQNA 3IGFA 3KS9A 4O0LA 1U1FA 5C5CA 5A3SA 1ZXLA 1G2QA 5EGNA 3O3CA 3GU3A 4QELA 1DAMA 4LNAA 4Q9LA 4GU5A 4Z0TA 2PQ2A 1N77A 3UF0A 1TAMA 2JFXA 3SVTA 2LYAA 2AZTA 3O95A 4BFWA 1U0NA 3EGDB 3LT4A 2RCYA 3EQ6A 3HZOA 3MR5A 4KLCA 3G8DA 2H07A 1TAGA 2JH9A 1WR8A 1ZO8A 2HSGA 3O03A 5AI4A 2RAPA 3B2QA 4IVPA 1LFAA 1KHHA 2JLRA 3R20A 2XCPA 2VT7A 3C3KA 4Z9BA 2XVXA 4L9RA 4WRRA 3B9JA 4B9EA 5KG4A 4DWWA 2HRCA 5A04A 1OA0A 3JQ9C 4BNMA 2W4QA 3A6HA 5LDGA 5JC1A 4L57A 5LQSA 2ORWA 4KXVA 1CUIA 4TSFD 5L95A 3C3DA 5DV9A 1OXBB 3C1TA 1PWZA 1VFPA 3ZE0B 2ZBRA 1LSOA 1NPTO 5FUWA 3NB0A 3W6ZA 1NV9A 4GEKA 1NC1A 5LBTA 2K2WA 3I8OA 3M9OB 4EDHA 1LVUA 4L8YA 2XUKA 2PAFA 4DXAA 4QBIA 3C48A 4C76A 1FA9A 5J0OA 3DBHA 4W5TA 4F45A 4WQMA 4CMAA 1L5NA 4ZZ3A 4ZAVA 4D9JA 3MTEA 1IM5A 5JD5A 5GY7A 3E2IA 1IWOA 3NMUF 3UK1A 4EA8A 2NRWA 4B0OA 1Y6QA 1NQTA 4G0MA 3U4IA 2MMGA 3VYVA 1QZZA 1M8PA 1P1CA 3FBTA 2X0JA 3DXYA 4RAQA 3KUKA 2C2KA 3UWMA 3EG5A 3TLGA 5KYGA 1ZWLA 3LCUA 5LM3A 5C32A 1CY1A 1NZPA 3ZS9A 3GJ6A 3OKFA 1BE8A 4L9AA 1PJQA 3MXTA 1KMMA 5KSOA 4YJKA 2G5HB 1ZQXA 1CB0A 3M7IA 5K0SA 2UUOA 1FFBA 4KMUA 4DJDC 2VDWA 4B82A 2NO0A 4CKCB 4P0QA 1M7HA 4OQFA 3SOZA 2J4FA 2D1FA 5DLDA 4WZBA 1HDEA 1DEKA 2B82A 4AJOA 1L3TA 2BZ1A 2NUPA 2OBFA 1GV1A 3VR4A 2EX0A 3PL1A 1VHWA 3MQ4A 5JNSA 4ARIA 5JASA 2DFKB 5A3JA 3TRIA 1GXSA 4Y1GA 1ATZA 3UMYA 3SBDA 1TK3A 3LH5A 4GZMA 4U1RA 5LDDC 4F6LA 1WF6A 5J29A 5AKJA 1RXVA 4A0QA 1A50B 4YPFA 1BJKA 1ZI8A 4UAVA 4RMIA 1R6DA 2QHXA 1XGKA 4OHCA 1YI0A 4HHEA 5IANA 3EF0A 3UA3A 1SCIA 1YR8A 3NYWA 4HDKA 4BZQA 1DQZA 1R27A 3WK7A 3DBHB 1LDNA 1M6VA 2AYZA 4RBNA 4R2XA 3NIGB 5HIKA 1FFGA 5IG2A 1XMVA 2G71A 1IIPA 1APBA 4DL4A 1C7EA 2BPCA 4ES6A 1TV9A 4FKMA 3DPIA 1C1DB 4UU0A 5LYJA 2QP3A 2J4CA 1N6OA 4MW9A 5EHNA 2OLJA 1CT9A 2GCOA 3FFAA 5F5XA 2OCDA 4ARCA 1NW6A 2Q5CA 2EEZA 3EGWA 4RVDA 3ICCA 2ZT6A 1RYRA 1WMFA 1JGTA 4PGGA 3JPOA 5IN5A 1FXUA 2O8CA 1ACMA 4YP6A 4IIVA 5B4TA 5B2ZA 1N0UA 2WTEA 4IRCA 2PBFA 3FTFA 3ZQUA 3DZKA 4DOMA 4RH0A 2EKBA 2VPXA 5B5SA 4B2PA 1DCFA 2G76A 1G5RA 1BFDA 2VDWB 4B44A 4L2IA 2H1OA 2P77A 2VTDA 4RTMA 4P0QB 3BGVA 4OM7A 1LFDB 4P35A 4B6QA 3EIFA 1RQGA 1RABA 4IIBA 5AVOA 3BXGA 3U7QA 4ECUA 2G8LA 3V6LA 4ARZB 2QL7A 4N6NA 1GXSB 1GR1A 1NPDA 2XE7A 4AO7A 1JI3A 5KJCA 4PCLA 4DQVA 2FDCA 4N03A 3BZUA 3DKKA 3DZGA 1U7HA 2PT6A 4L0DA 4TKVB 2GLEA 4QPJC 4NU8X 3FRHA 3HLYA 3WLNA 4S24A 4HNSA 4ER5A 1H38A 5ITZB 1H69A 2HEGA 4KQCA 2HIGA 4NHEA 4FXPA 1JIQA 1UMBA 2YHIB 1ZVKA 3VBEA 2A0FA 1M6VB 3P27A 1XZJA 8ICXA 2Q29A 4ROSA 3GDFA 2I65A 2AOUA 2A1JB 3VJLA 5CXSA 4KFUA 1SXQA 2AXQA 2EKQA 4M8IA 3STVA 4YXFA 4JJ7A 4TURA 4OK5A 3OPYI 1EUZA 2LPMA 4R8MA 2KM1A 2AGOA 4M9QA 4EG0A 3OIDA 2AOVA 5ICCA 1KFDA 4ZVOA 5CDFE 4FCVA 1YGPA 3EUEA 4UOQA 4M88A 5BSGA 3RUAA 1RZRA 3G5UA 4DLLA 1K5GA 4ZREA 4QU5A 1N6IA 5JRTA 4OG2A 2RARA 3E9MA 2B25A 2TMGA 3LCVB 2P68A 2WTAA 1MP0A 3FKSD 4MLPA 2NG1A 1TW3A 1Q7EA 1YZTA 1YS4A 3V1YA 1T5SA 4Y9DA 2GSWA 4AMYA 1TQ8A 1IN6A 2EFCB 4N18A 3FYSA 2HCRA 5FV7A 2GK4A 421PA 1N0HA 1GRNA 4HGRA 2WQZA 4MVJF 5BQ3A 1NXXA 3VFDA 1LTKA 3R3WA 2Z1MA 2QY9A 5PGMA 2Z2ZA 1T13A 1P74A 2EBFX 2QQFA 2G82A 4TT3A 3G2NA 4AN0A 3E8XA 1YB6A 4RKYA 4KGDA 1ORVA 3O4VA 2Z56A 2E0IA 4YXWD 2EBUA 1QZUA 1SZHA 1M83A 1BMDA 1USUA 4YUXA 1KMCA 1SRRA 3VUFA 4M0AA 4JK3A 3QVLA 1Y7IA 3SDSA 3QWIA 4F04A 3ZXSA 1JHRA 1UMBB 1CUEA 1DKQA 4F5OA 1H1DA 3CRRA 2AOUB 5C5EA 3NRJA 1T1JA 4W1RA 2IP1A 1BVSA 1HQYE 4KO1S 1BWRA 3ENNA 4TL7A 2HSZA 3DZJA 3P9RA 1A72A 1JR3D 4XLZA 5H02A 2WMOB 3LBFA 4V0ME 1PZHA 1JI7A 3DM9B 1GIAA 4G37A 4G41A 4O8CA 1UXJA 3TL6A 1X8KA 1YCGA 4RZHA 2PKWA 2VYQA 1SUPA 5FL7D 4BS9A 2C9ZA 8ICVA 2B7BA 3GLGE 3H04A 3ZGXA 5KX5A 4IHAA 5HZHA 1E2PA 3GLSA 3GCZA 2EQBA 1XHFA 1V5GA 4V0RA 4KNWA 3KR1A 1O95A 4NI5A 2EH9A 4IHKA 5KHAA 4KH1A 1VDMA 3EGVA 1NZJA 5JNVA 2W2VA 2AG1A 3FPAA 1UDWA 2HF7A 4PYQA 5FOSA 1K6EA 3U9SA 5EZ6B 3QQ5A 3WKBA 1WWUA 1O1YA 2WD9A 4R9NA 4CGYA 1DFGA 3E3NA 1JIJA 3TDNA 1K7YA 4CM4B 2JKVA 5CEJA 5P8WA 3WYNA 4EJMA 4UTXA 1U8CB 2X4GA 2NUTB 4AIRA 3HRIA 3LS2A 3FROA 3H2JA 4JBYA 2OHOA 1B7GO 4NCNA 3EF1A 1XZGA 1Y9DA 1BVHA 3QVWA 2VTKA 1UBNA 1DB3A 1ZISA 3D4PA 3TBKA 3BE4A 1QIDA 1G8FA 4Q7EA 1PKXA 1DBVO 3ZW7A 2O8DA 3GEBA 2XDYA 2QQGA 1IN4A 3IMEA 1FCJA 1CULC 3UXOA 4CLRA 1RRVA 4JSTA 3R2JA 2FPRA 1DKLA 4H7KA 1A5ZA 1YZGA 1VGRA 2PNFA 1KP3A 1NKEA 1COOA 2EC5A 5BWCA 1WXDA 5H4GA 5J3JA 4RVGA 4FEAA 5AK4A 3ZY5A 5KX5B 1T4CB 1X7DA 1XSPA 4UJ3A 2P9JA 2G1PA 3NBXX 2BZFA 3AUUA 5J4HA 2LDBA 5C7YA 1RP1A 4N7RA 3DEEA 4DR7B 4ZCIA 4B7AA 3RVJA 1NJSA 3RB3A 4EUFA 2FLKA 2IIQA 3IBYA 3T4EA 1GL9B 1CIJA 3QEMB 3C6ZA 2IWHA 3MLAA 1J2MA 3NBKA 4DXDA 3VHQA 1E1YA 3SNHA 4F4ZA 3BPSA 1N1GA 4ID9A 1ZYUA 1LDEA 1IJBA 5ED4A 5KB3A 3L1KA 1XI2A 3WP0A 3ZHOA 4H7PA 2G1AA 1P6UA 2VKQA 1L4LA 4TYQA 4DJTA 3RC8A 2W5UA 3G23A 4U5QA 2E4ZA 4QDTA 3ZD8A 2RK3A 1II8B 1F7VA 3ROQA 3ZWPA 3CBGA 1U31A 4EB3A 5BSKA 3S5UA 2QG6A 3M81A 3OPVA 1NZDA 1A71A 4AMGA 4BLWA 3LP8A 4QZDA 5AI6A 1KLNA 3AY7A 2H2IA 1UBEA 2Y0CA 3FSEA 1ZKMA 2R6HA 3I45A 2P41A 7ICJA 1Q0LA 1S01A 3BJMA 2CE7A 1RKQA 5G40A 1GRRA 2BT4A 4F60A 2HHXA 5SICE 3MFQA 1LD3A 2WUWE 4EI8A 3TIIA 3TO5A 2MSKA 1ZRNA 7ICNA 3SS8A 4J9RA 1A2QA 3CA8A 4AJ4A 1ZY2A 4BBAA 4ARSA 3UZUA 2IZOA 4PF1A 3QVTA 5EXXA 2CJWB 1BPEA 2YTZA 4JBLA 3WTCA 5TPZD 3S2UA 4UUOA 4GW3A 4HFRA 1D4ZA 2W2LA 2FZEA 1XKQA 2ZXIA 5LNK6 3Q7SA 4ZD6A 1C8KA 3MFHA 4AZWA 3D6UA 4OMUA 1KZ4A 3TW4A 5IDXA 3RVLA 2F55A 4DMUB 4MB6A 3GQVA 4KAFA 5F78A 2NAPA 4Y2RA 5IBCA 1T3LA 4K9DA 1L7NA 3U4QB 3C2QA 3CF0A 4O1HA 4BNDA 2F1OA 5G4LA 2VG8A 1NVAA 1L5KA 5IKPA 4UEKA 3D8TA 4G1CA 4CMHA 4AJJA 5L45A 4MVJM 4US8A 1Z25A 2PFQA 2G5CA 3RRXA 5FOQA 4KK3A 4KLSA 2Y6UA 4W5WA 3QMVA 4DVGA 1KORA 4QOIA 5K3SA 4YUWA 4KV7A 1G42A 3OOEA 4ARBA 1XJ0A 3FWKA 2GO1A 1QCKA 1SXJE 3CR3C 2H3HA 2VPIA 2R97A 3FYUB 1TADA 4X97A 2IH4A 2BHSA 1E63A 3FZQA 1I7SB 2G4CA 3PHJA 3ONVA 4OMDA 2IYSA 3UXHA 1WUDA 4OJOA 2O1EA 4E21A 1IPHA 3RFUA 3VX3A 1J20A 3BCHA 1SH7A 1V71A 4A16A 1I33A 4YCLA 1G16A 2D5IA 3C6YA 5LQAA 5EUCA 3WK5A 2NYUA 5JJKA 3ML1A 3KP1A 3QKTA 3E03A 1F9AA 4Q4AB 3WNVA 3JR7A 3ID6C 3N2KA 4RLSA 3QSYA 2D1TA 3SHFA 4DCNA 4AULA 3Q40A 1KFKB 5SYNA 1Z73A 5DOVA 5L4SA 4GPIB 2FPPA 1AB6A 4PV7A 3ONWA 1R88A 3NOQA 2CLDX 3P4XA 4JOBA 1X19A 2NO7A 5DBOA 4MV0A 3W5DA 5FUQA 2J9YB 3TNYA 4KLQA 3WQQA 4J76A 4DSFA 1JNXX 5HX7A 5KQSA 3WGUA 3H97A 1PFKA 4GNRA 1RBZA 3SQLA 1NF9A 2VYCA 1CVRA 1I1QB 3THXA 4A6PA 3L7CA 1WQ3A 5FFNA 3EA4A 3KO8A 4YYEA 3DZHA 2FGJA 2A9RA 4KMMA 4ML3A 4R5HA 1UDRA 4G5FA 5EJ2A 3MERA 1FBTA 3FMVA 4OVKA 4RA9B 3ROFA 1MW8X 4WGFA 1FU4A 3HSSA 1WQ1R 1LRJA 2G06A 1P1JA 3PCTA 2QN6A 2IPLA 3H86A 1MBZA 3Q6MA 3OCJA 1EM8A 3AO0B 4FB5A 2IYFA 4ZQCB 2AK3A 1EFRD 1EWQA 4X63A 4E4RA 3ETNA 2QMOA 2C0QA 1V39A 1TO1E 3FOCA 1WMEA 2IPMA 4GHWA 5CLGA 2G25A 4QTTB 5F5LA 5K8VA 4LUCA 2XSZD 1PV4A 1BKDR 2DM6A 3KQKA 1FW6A 3I2HA 2HO4A 3NVWA 1ZH6A 3ES9A 3PHCA 1W73A 1WKCA 2P40A 4LQLA 1FP2A 2UVUA 1PL7A 2JLSA 5I7VA 2XYGA 1KDHA 5LD2B 4LC1A 3ABZA 1WUIS 2PGJA 2XIJA 2ZUUA 4IILA 5FL3A 3KVYA 1XVUA 2P2YA 5EP1A 2I3DA 4Q47A 2J5KA 1P39A 4K9MA 2JLWA 1O58A 2ONYA 3UQ2A 3H1EA 4BKPA 3THXB 1TA0A 2BMJA 2H52A 2WTMA 2P6UA 3WLHA 1VZ2A 1Z0AA 2VQEB 2G07A 3T5TA 4ZEVA 4WVLA 2HHTA 1LSJA 1Z13A 4RJTA 4I8IA 5LNK1 1KO4A 5LMCA 3HCEA 4ZVKA 3ZWMA 2N42A 2ZRIA 2W9AA 1R66A 1EZZA 4TRNA 1DV2A 4QTUB 4KQHA 4D8YA 4DA0A 1OTXA 1XRRA 3OJ0A 3VOTA 4M0UA 4V02A 4LZZA 3MUNA 4DQIA 5F9LA 4RK6A 1DNPA 4R1QA 5KNCD 1MVLA 1KJYA 4ZN6A 2XGQA 1DJQA 1KZ9A 3G2LA 5KFMA 3T3NA 1VLLA 1DQSA 4KLDA 2QTAA 3S1SA 1HG0A 5KYVA 2J67A 3WB2A 2A9OA 4OIMA 3ZE1B 2WQ6A 3U3KA 1F60A 4GMKA 3F73A 2ZI5A 1NK9A 4PC3A 4TL8A 1ZQFA 4Q45A 1KH1A 3Q87B 3RS0A 3NM6B 5BSRA 2TECE 3E3AA 3CFYA 1B41A 3EDYA 5FFFA 4GP7A 4U6QA 1XZBA 1E9FA 2EF1A 1C1HA 3H9GA 1CCWA 3GO4A 3AR6A 4KN7A 3CLUC 2F1IA 4N1AA 5G5GA 2JLZA 2RGRA 2JI7A 4A6DA 4FX5A 1TCBA 4UZFA 1ZVJA 2IMWP 2Q5HA 2ZRQA 3RRZA 2ENUA 1BCRA 1OZFA 3VNBA 3U5TA 4ECZA 4URXR 2J5XA 2FRXA 2ZULA 2DHEA 1Z26A 3F3YA 3H42B 1M10A 2VLIA 4RPJA 2BGJA 4G2TA 2E85A 4RTNA 1J5EB 1W36D 1FUEA 1T3HA 4UM9B 1FFHA 2QKQA 4YR0A 5EVJA 1B74A 4KWIA 3IP4B 5LOVA 2EAOA 2J41A 2ISOA 1KYTA 3SY8A 2MYUA 5M7EA 3M9NB 3VR5H 3CSUA 2JASA 3A4IA 2NW6A 1GFSA 4J91A 1EDDA 3VR4H 2W7PA 5JARA 4KACA 1JIUA 2CF5A 3D2SA 1KEPA 5ALKA 3I1YA 1EWYA 4KAAA 1ZZEA 1QYXA 5CA1A 1AROP 3ND8A 3ZJYA 4I7EA 4TGLA 3OPYA 3DM5A 3QA3E 3MW8A 3T3MB 1VIAA 1JALA 2DHDA 4MJ3A 4C8MA 2Z7JA 1U1EA 4RZQA 5CJ2A 1WVIA 3ZXXA 4ZVMA 1V6CA 3E35A 3IKJA 1UOEA 5ERGB 3SOPA 1GGHA 3E48A 2XF8A 3N0VA 5EINA 1KWKA 1YZNA 1OE0A 1WF3A 2I76A 3HYLA 3VPXA 5ECGC 4O2RA 5CLQA 4Q1AA 3OSZA 3HXOA 1ENYA 4YRMA 3MCTA 5P21A 3UWSA 4GKAA 1PGNA 3M89A 1BCRB 3TQCA 4S1PA 4UXJA 3NRCA 5BWBA 4KXXA 4JV1A 5F21A 2WF9A 3KELA 3O8LA 5LP6C 3L8FA 4GM4A 2FX3A 1R10A 1PR5A 2CCJA 1OI4A 3EVEA 1KFTA 4PLFA 4TTIA 4WI1A 2AG8A 1I10A 4W82A 1YR6A 2VQ6A 3ZVNA 1Z5WA 4IG4A 1G21B 2ZBGA 4FJ1A 4QYMA 2W9XA 1IBMB 1CY6A 3RR8A 3ISCA 1W48A 3OJEA 4R6WA 4ZI7F 4DL2A 5DBAA 4QGGA 3ESCA 1TPYA 1GSHA 4A15A 3K0KA 2V58A 5EIWA 1Y3CE 1IH8A 2CXNA 1CEYA 2VHUA 3K9QO 1CZHA 2ZI3A 4ZDKA 2UVPA 4JJAA 3KK0A 1PR6A 3OPYB 2EQAA 1SD5A 2I87A 3MAAC 2OOSA 3M5WA 3AFNA 3GWGA 2GJ8A 2FLWA 4XR9A 3MBOA 4ALKA 1EGAA 1T4BA 1HX7A 3ONDA 1U9IA 4FKBA 1BE0A 1RJ9A 5L4LA 4RVFA 5EJ6A 2NX2A 4RQ1A 3VC2A 3F5QA 3PQDA 1KKXA 3ZYZA 4HI0E 2DSNA 1VB3A 3WGNA 3LTEA 4II7A 2TRSB 2YHSA 2J08A 4IEIA 3G5AA 1E7MA 5EUQB 1TW2A 4EY3A 5EXSA 1D1SA 2VJYA 3CUWA 4UNNA 1WY7A 3PPWA 1G63A 3L0PA 4D4MA 4BMDA 3N8HA 3EISA 5DB9A 1ZH0A 4F2PA 4MV1A 2XCOA 5SY4A 3RB8A 2VXBA 3GP8A 3NORA 3E05A 4NCBA 4QJ4A 4EGCB 1T36A 4AKGA 1FU8A 3K1TA 5FULA 3FE2A 5DTRA 5A5EA 4BNGA 3TSZA 5A06A 3NC1C 2FN4A 4P9NA 3WISA 1G17A 4D5EA 2CFSA 2VEOA 4D56A 1B1CA 5J2IA 4CFYA 5K6AC 3DAPA 1Y48E 5U1PA 3LHSA 1U2RA 4UTZA 1Q12A 1WUKS 3OTQA 4DOCA 1ORTA 2HHUA 4UFPA 2FW1A 4DR5B 3GLVA 2NRZA 3EN0A 4JDPA 5K8LA 4LE2A 1F2VA 4BNJA 2KZ3A 4L4ZA 4AUKA 3OTOB 4AKEA 2DR0A 3W6NA 2OHVA 2QLJA 5E95A 3UFBA 2PWYA 4C8LA 2QNRA 2J9ZB 5KJ1A 2ORVA 4EAAA 3AV0B 1E9RA 2H2DA 2YJGA 4KJZA 3OOHA 3N7RC 3K2BA 1DXYA 1SXJD 5CFQA 2ZTLA 1X13A 2Y76A 3B36A 5J8YA 2REOA 1RJ9B 4GX1A 2RH8A 3AL0B 4PZPA 4UBNA 4NCIA 4OHBA 1NOMA 2H63A 2ACVA 5LQMA 3GJ4A 3KQHA 1E1QD 4RZRA 4RPLA 4P4PA 4ABYA 1HYGA 2HDOA 4DR2B 3ZW9A 5E9JA 3EC7A 1H66A 1F8UA 4RKFA 3P52A 1KARA 1C30A 3P9ZA 5BPHA 3FTPA 1ZG3A 1KK3A 4MV3A 1KJNA 4C89A 2QQEA 3CLTC 3U7IA 1E5VA 3ZLTA 4XQ8A 3V34A 2MHCA