3L5KA

The crystal structure of human haloacid dehalogenase-like hydrolase domain containing 1a (hdhd1a)
Total Genus 75
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
75
sequence length
233
structure length
233
Chain Sequence
LYFQSMAAPPQPVTHLIFDMDGLLLDTERLYSVVFQEICNRYDKKYSWDVKSLVMGKKALEAAQIIIDVLQLPMSKEELVEESQTKLKEVFPTAALMPGAEKLIIHLRKHGIPFALATSSRSASFDMKTSRHKEFFSLFSHIVLGDDPEVQHGKPDPDIFLACAKRFSPPPAMEKCLVFEDAPNGVEAALAAGMQVVMVPDGNLSRDLTTKATLVLNSLQDFQPELFGLPSYE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Haloacid dehalogenase-like hydrolase domain-containing prote
publication title The crystal structure of human Haloacid Dehalogenase-like Hydrolase Domain containing 1A (HDHD1A)
rcsb
source organism Homo sapiens
molecule tags Hydrolase
total genus 75
structure length 233
sequence length 233
ec nomenclature ec 3.1.3.96: Pseudouridine 5'-phosphatase.
pdb deposition date 2009-12-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13419 HAD_2 Haloacid dehalogenase-like hydrolase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.240 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 Putative phosphatase; domain 2 3l5kA02
3.40.50.1000 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold HAD superfamily/HAD-like 3l5kA01
2NO5A 3R4CA 2YMLA 1X42A 2QLTA 1RRCA 2R8YA 3U19A 3KBBA 3L1UA 5AM2A 5AIBA 2CN1A 4Y2UA 3M1YA 1RLOA 4UAVA 3WK9A 4ZEVA 3WKDA 2YY6A 4H1WA 5AKIA 3E58A 4XOUA 1RMQA 3IB6A 5AW3A 1XVIA 4AP9A 3AR5A 4F71A 5AKXA 3FZQA 2WF6A 1N8NA 3KDPA 4ZEXA 2WF8A 3WK4A 3ZU6A 3QUTA 1YJ5A 3OCXA 2MU2A 4HGNA 5ALLA 4Y3UA 1N9KA 2GO7A 5AM3A 3U7GA 3ZTYA 3QU5A 3NIWA 3E81A 4L6CA 5ALFA 4XE5A 3PGVA 2PKEA 3TLMA 5AKKA 2HDOA 1RMYA 3E84A 3KZXA 3L0BA 4EENA 2YMMA 2YJ5A 5IT0A 4KYTA 3SF0A 2ODAA 2I7DA 2B8JA 2RB5A 3KOOA 1Z5UA 1Z4NA 2Q4TA 3ZX4A 5AW1A 2HO4A 3SD7A 1LVHA 1Q91A 2RAVA 4F72A 1EK1A 2EATA 4YCNA 2ZBDA 4NABA 2Q4RA 2D2VA 5ALMA 3MPOA 2O9JA 1ZRMA 1RKQA 2YJ3A 2IOFK 4C4SA 3BA6A 1ZD5A 5AW9A 3N8GA 1U2TA 4MUMA 1AQ6A 2ZOSA 4BX2A 5ALKA 1CR6A 1XPJA 5ALVA 2G0AA 3OCWA 3BWVA 3ZTWA 2W43A 5AM1A 4BKMA 1Z4PX 4EZEA 4RETA 3EF0A 4YCLA 4HGRA 5ALZA 5AI6A 3AR9A 4UMVA 5T41A 2JAWA 3FGOA 4KX5A 3W5BA 2HI0A 4E88A 1TE2A 2FUCA 1ZD2P 4Y2XA 1L6RA 1F5SA 5AVTA 3WGUA 2B82A 4ZEWA 4HGPA 1ZD4A 3QU4A 5AICA 3A3YA 5AVZA 2G80A 2Q5EA 4BX0A 4J03A 2AUTA 1Z88A 2C8KA 3ESRA 3OTQA 3N1UA 4BNDA 2B1QA 2G08A 4EELA 4UW9A 2G09A 3AR3A 4QJBA 5ALYA 4UMFA 2JAOA 2YJ4A 2FPRA 1T9ZA 2OA0A 5ALEA 3CZ4A 2VKQA 4Y2SA 4Y2JA 4NV0A 5E0OA 3OPXA 4O8CA 2BDEA 1QQ6A 2FPUA 5AM0A 3K1ZA 4EX7A 4UMDA 1VJRA 4L6AA 4DW8A 1VJ5A 1RKUA 1U7PA 1NF2A 4XQ0A 2BY4A 4Y2QA 3QX7A 1Z4QA 5AI5A 1U7OA 1KYTA 2I54A 2R8EA 5AK4A 1RKVA 2GMWA 3OCZA 5JJBA 2YMQA 1L8OA 5AIAA 2MSNA 2IA5A 1MH9A 2YN4A 2HX1A 5ALTA 3J7TA 1EK2A 3PDWA 2BDUA 5ALQA 5AW2A 5IS2A 3FVVA 3R09A 3U7EB 3UM9A 4EEKA 4FE3A 4YIHA 2AMYA 3WGVA 1Q92A 3QU9A 3SKYA 2CFRA 2FUEA 3EF1A 2HHLA 2PQ0A 2HOQA 1Z4LA 4CNQA 3ZWDA 2YBDA 3AR6A 1J97A 3P96A 1O08A 3ONNA 5AKGA 3RF6A 2DQSA 1Y8AA 3L8EA 4UATA 3WK5A 2GHTA 2JARA 2P69A 1TJ4A 3MMZA 5AHXA 2CFTA 3I6BA 2GHQA 2FDRA 5AKZA 3KD3A 3QXGA 3B8EA 1RQNA 5AVWA 4GXTA 1ZJJA 3L5KA 4G63A 2GFHA 2EARA 2W4MA 2WF5A 3NALA 4B6JA 5AKLA 5AM5A 1L8LA 3ZI4A 5AK5A 3A1EA 3L8FA 3SKXA 1LTQA 3ZVNA 2WF7A 1Z4JA 5AVYA 3ET5A 1L7PA 4KNWA 5AVQA 4NAVA 2ZXEA 4BEVA 4FFDA 1CQZA 1QQ5A 4Y2TA 4AS2A 2OYCA 5AK3A 2G1AA 3I1YA 3FM9A 4DWOA 1RLMA 4HGOA 4DCCA 2YJ6A 3NAMA 3B9RA 1RQLA 5A3SA 1U2SA 3ET4A 1ZS9A 3EPRA 2OBBA 2FPWA 3QU2A 4OD0A 3U26A 5AW6A 4J2TA 2NO4A 2X4DA 3F9RA 1NRWA 1TA0A 3DDHA 3D6JA 4JB3A 4EX6A 4BBJA 3L1VA 1WZCA 3OCYA 4Y2YA 1TJ3A 4KN8A 3R9KA 3MC1A 1RC8A 4XPZA 1K1EA 3ESQA 2JAUA 1Z4IA 3DV9A 5A3RA 2ZG6A 3N28A 3SLRA 4JDPA 2R8XA 3WKEA 5AVRA 4YIKA 2RBKA 3UMGA 1SWVA 3U7FB 4UARA 5ALNA 2AH5A 1ZOLA 3EWIA 3L0YA 2IOFA 4CE6A 1L7MA 2B0CA 5FP0A 2I55A 3B9BA 1WPGA 4GIBA 3WKBA 3WK8A 1L7NA 3AR4A 3ZVLA 3PGLA 2ZBFA 4BYGA 1Z4KA 1SU4A 2B8EA 3DAOA 4BNDB 3L8HA 1JUDA 2C8LA 4HYTA 5AI4A 3ZUPA 5ALIA 3UMCA 1Z5GA 2NYVA 4FYPA 3QUCA 3FPBA 4RESA 4QQFA 4UAUA 3NASA 4OHFA 4DFDA 4CF5A 5ALXA 2G06A 3I28A 4PNHA 3QU7A 3N07A 3WK6A 3L8GA 3NRJA 2AGVA 2PR7A 2MU1A 1YV9A 3U7HB 2P11A 2JGAA 4Y2RA 2HEGA 3OCUA 3WKCA 4HGQA 1QYIA 1Z4MA 5AVSA 5AKJA 4UM7A 3NUQA 5AW4A 3QUQA 3ZVMA 1L7OA 1J8DA 1RPZA 1YMQA 5AVXA 5AM4A 3PCTA 1RDFA 5ALSA 2WFAA 1O03A 1WR8A 3ZX5A 1Z4OA 1FEZA 2HSZA 3AR7A 2P9JA 3A1CA 4Y2PA 3I76A 2C4NA 3S6JA 3UMBA 4IFTA 5AI9A 5AK6A 4CF4A 1TJ5A 5AKYA 5ALJA 1XP5A 3AR8A 4MWOA 5AVVA 5AI0A 4HAIA 5AW5A 2IYEA 1RMTA 2HCFA 3W5DA 4KNVA 4UASA 1U02A 3W5AA 2ZBEA 4I9GA 3FPSA 5ALGA 2QYHA 5ALUA 1NNLA 2WHEA 3SMVA 1VFPA 3RFUA 3QGMA 1S8OA 4C4TA 1RLTA 4NFLA 3M9LA 2WM8A 3W5CA 1ZD3A 4UM5A 4IG4A 4OFZA 3IJ5A 3L0CA 2W11A 3QNMA 5A3QA 4C4RA 3IRUA 3SHQA 4CF3A 2IOHA 5AI8A 4UU0A 5ALOA 2WF9A 2G07A 2FI1A 5AKHA 2OM6A 3CNHA 1QQ7A 4G9BA 2FPXA 3DNPA 3A1DA 3ED5A 5ALDA 3OCVA 3QYPA 4I9FA 5ALRA 2B30A 3QLEA 4AS3A 4UU1A 3E8MA 3MN1A 2I33A 1YS9A 3QUBA 1QH9A 1ZRNA 2HF7A 3GYGA 2FEAA 2FPSA 4YGYA 3ZW7A 2O2XA 1S2OA 3NANA 1YDFA 1WVIA 1PW5A 2B1RA 3HYCA 4BX3A 1YNSA 3HLTA 1IWOA 5AESA 5AKEA 3U13A 2C9MA 2I6XA 2EAUA 3WK7A 4YH1A 2YMPA 4YCMA 5IT4A 3WKAA 5AW8A 3ZWKA 2CFSA 3L7YA 4KX3A 4UMEA 5AVUA 4NWIA 2HF2A 3AR2A 3VAYA 1SWWA 2RARA 4BEWA 2R8ZA 5AW0A 4Y2VA 2C88A 3KC2A 2YFYA 4L57A 5AW7A 1T5TA 2ZBGA 3N5KA 5ALHA 5ALPA 2I34A 5ALWA 2P27A 1T5SA 4OCZA
chains in the Genus database with same CATH superfamily
4MW7A 1UBLS 3OKFA 4QEKA 1PUJA 2R6FA 1CB7A 3I30X 2ZJOA 3IXQA 3QBVA 1QH8B 4HEA1 1XVIA 3A4TA 2F17A 3WLAA 4FGUA 2BE7A 3RVBA 3WADA 3UUGA 1YZUA 4I5EA 4RNDB 2XRMA 1O96A 3B1XA 3PL1A 2RB5A 1UT8A 1Q19A 2B35A 1T0JB 4KVZA 1D4AA 3WZMA 1FFSA 2V9WA 2NAFA 4QBIA 4J8PA 1HT1E 3C5GA 3M6IA 1DLJA 4NABA 1II8B 2ZRLA 3ZKWB 4CMKA 4ZJUA 2GNPA 1YTLA 1T5HX 1SIBE 1JQLB 1L3UA 2YYSA 5FTMA 2I8LA 2WUEA 1JU4A 1TQHA 3M6AA 1L6NA 2CBGA 4TM7A 4O4HF 5MGBA 2OGSA 1C3LA 2NNWB 2RGXA 4QT4A 2FWIA 1KH2A 3SE0A 4K1LA 4F9EA 4QBHA 4QU9A 1X9HA 3Q8SB 3NDIA 1S2NA 5CYGA 5IMSA 3IAXA 1C81A 4C7JA 2A14A 3TJRA 3IQZA 1PDWA 1C7ZA 3HPQA 4NZPA 1NMQA 5DP1A 4OHXA 4AB1A 4LXQA 4NIMA 4OI4A 1BW9A 3IDAA 3W78A 3TE6A 1GGNA 3HADA 5ALQA 5IS2A 3I58A 2KKVA 2XCSB 3BGOS 2C98A 4QYWA 3S27A 1LGYA 1VYTA 1ECFA 1T10A 4QNNA 1FMFA 5C31A 2MYPA 2WAYA 4OYLA 1H2ZA 3VM6A 2P9GA 4IIVA 3AU6A 1N7GA 3B2NA 5I9IA 2Z6QA 5B37A 2X3UA 3KD3A 1B6GA 3P9PA 1WSWA 1ULBA 1K8XB 4RF5A 4BN4A 5K4AA 5B66U 3R41A 4OXRA 1OX4B 4K6OA 4NDAA 1SK8A 3BQNB 1BJKA 4NI5A 3GU3A 1RACA 2HBYA 1Z74A 4IUBS 2IF0A 2O8FA 2FGJA 2V7WA 4LJ4A 2BEWB 4NMLA 5I9MA 1U0NA 2OE2A 5JNRA 1QHIA 5DTEA 4GGPA 3C3JA 1XSLA 4JP5A 4BNLA 2VNHA 1OU4A 2HLNA 2W4IA 5ADVA 3PS9A 4KXMA 5TEWA 1OLUA 5IRCD 3PX6A 1PQWA 2H4XA 1LS6A 2Q2QA 3AVVA 4MKXA 3LBYA 5BSKA 3EZXA 1AKUA 3V55A 1V41E 4BMXA 2A9PA 1I6KA 1SXJA 2OD2A 3G0HA 2P8SA 2BIFA 4AWBA 3NASA 4UNNA 5A62A 3AJEA 4UEKA 5LMCA 3KT8A 3CU5A 3NYWA 2QAGB 2ZRKA 3UWKA 1MDFA 3A6FA 4FOTA 1XTTA 3MJVA 2GKGA 5KVSA 1T3TA 2ZULA 3GEIA 3LRXA 3OOSA 3M89A 4O4LA 3CNQS 2ZT8A 3DP7A 4JN6B 2PLAA 3W7AA 3QYJA 4IVQA 4XWKA 3K0CC 3OE1A 1PTJA 4PCVA 4LE1A 2O5VA 2W42A 4ADSG 1N7HA 3UO8B 3DD1A 3MOIA 4Z3KA 1MVNA 3GZ4A 1JJAA 2UVVA 1HT2E 3SS9X 1J25A 2O8VA 2PKQO 3NYQA 4OJOA 3UMRA 3AIIA 1RPAA 1AU9A 2NO6A 3F47A 1ILEA 5BVGB 2XJ4A 2AF3C 3TO5A 2V58A 5KFGA 3K16A 1FY2A 4RGBA 5JAQA 4TVSA 2C2GA 1R6AA 1N2SA 1KDOA 2C2XA 5H4GA 1YS9A 5KREA 3HVUA 1JPVA 2HRRA 1MQ8B 1X14A 4BNXA 1FW6A 1GADO 2FSFA 3S8YA 4RFSA 4MAMA 2XI9A 4UMEA 2JHAA 3WJ2A 4Y2VA 3CKMA 4L57A 5JU5A 1PFKA 1JI3A 1M1NB 4Y1FA 3DR5A 1TO2E 3KOMA 1Y8CA 4LWPA 3ZZNA 3QYFA 3TADC 3MXOA 3OU7A 2ZYIA 1DX9A 2OFWA 3C3CA 1TCAA 2OYRA 3T95A 4UTOA 3HB4X 1SXQA 3JRWA 3GELA 1DUSA 2YZMA 3W79A 5IM4A 3RYIA 2R85A 4J0EA 2DQZA 4YR7A 4GZ6A 5B3JA 1XD2B 3ZQJA 2H3FA 3UK1A 3FUVA 3V97A 2FW9A 3P4YA 5IXYA 2GYUA 1R3UA 4LYGA 5J59A 1T9BA 2XZOA 5KFRA 5LQSA 3W8FA 1GKKA 3A4YA 1FSSA 5KJ6A 1ABBA 4IQFA 5LA6B 3ID6C 1PVQA 3WLPA 1RP1A 4HN4B 3BIOA 4LXUA 3IPRA 1SCNE 1JFSA 5D6OA 1XCBA 4DR6B 2B4QA 1FZQA 4B75A 1ESDA 4MV3A 3BD9A 2MUTA 4TSRA 3THSA 1QF7A 5EZSA 4OFXA 2HMXA 1RYRA 2Q6OA 2E89A 1CDEA 2HAEA 5JFGA 1OVGA 1XTZA 1AO0A 3RV3A 1QQ6A 4HEA6 1DXHA 3NBFA 4IJUA 4PSVA 2ECPA 3CX3A 3U49A 2WB1F 1XEAA 2FN4A 4U2FA 1EIZA 4D9FA 3PXXA 4JYZA 2YMQA 4L9RA 4HSEA 4M76B 3QVGA 1ZGGA 1PZNA 4TKUB 2V59A 4WNIA 2FUEA 2O5RA 4YYZA 3T1QA 1NOIA 1GCGA 1KP2A 2YBDA 1PSZA 2HIAA 5FT9A 1EDEA 3E7XA 4LYFA 1ZQFA 4X85A 3ZGYA 1S3FA 1Z29A 2CNBA 1IQRA 1YDMA 3LLSA 5I4KA 1KQOA 4RJKA 4OBEA 4AY4A 3L8FA 3BS5B 4CWAA 3DE6X 4WOJA 5CM2Z 3QK7A 1JH9A 5DE3A 3WOHA 5J8YA 4YLGA 4DQKA 5G0TA 3PJGA 2FG6C 3QU2A 1YDGA 2NO4A 2GOLA 5HQJA 4N8EA 4ZVKA 1AV6A 5LPNA 3DHEA 2PKWA 1E5XA 1UDAA 4RDXA 4FTWA 2OHFA 1ADGA 3GOHA 4IUCS 3HW8A 3VR4A 3OJOA 5AVRA 1MHTA 3KPUA 2JFQA 1Z63A 4OHVA 1UH5A 1II9A 2IH4A 1W36B 4MSUA 3OQMA 1Z5GA 2BRUA 4X6UA 3O3NB 1YQWA 4P7BA 1ZK4A 3ZDFA 1FUKA 4AW9A 1CJBA 1TT5A 1J33A 2JGAA 2PWYA 3ZWAA 3LKDA 2KSOA 1QS0B 1G2IA 3AF1A 3H2KA 1ZJWA 3K0AB 2WZBA 3STWA 2RH9B 2CW5A 4ZOHC 3DMTA 2ISCA 1QRRA 4IZHA 2JAXA 1OWMA 2UVPB 3HWX1 2H5LA 1OC2A 1TK2A 1YE5A 5KBYA 1X2EA 3IE1A 2GWHA 2G36A 3PR3A 1P31A 3CW2A 4OI2A 1W4LA 4WN3A 2CL5A 5C51B 2GHIA 3IEPA 3FCYA 3K9BA 2FZKA 1WLSA 5FAXA 5I7EA 2XB8A 3IJ5A 2YIMA 3EEFA 2EFCB 1YIOA 4BVBA 2CCJA 2CHGA 4FR2A 4IJWA 1X9IA 4QOGA 4B84A 2A1JB 1RQRA 1PGOA 4P32A 5IAAA 1Y42X 2H9AA 5IWCA 1A1VA 8ICYA 3TVTA 2A5LA 2DWQA 3UH0A 3N9IA 3RTEA 3U7QA 1LDBA 5DTMA 5IG2A 4ZK6A 4NV1A 1VJCA 2XQVA 2A84A 1YT5A 2VA3A 1Z8HA 4F3OA 1UPXA 4EJMA 4U7FA 1J2RA 2ZSAA 2CZQA 2JFVA 3NHLA 5CBPA 5KX5F 4PC7A 2DPXA 2V03A 2IHZA 4U6SA 4RK5A 3PVZA 2WSSD 3S29A 2GTPA 4JJEA 1KR2A 4QDKA 1RPNA 2H5JA 1KBQA 3I9JA 3OZSA 4OH7A 2LM4A 4QOFA 4F0JA 1KI6A 1U2DA 3KCQA 4Q15A 1LSSA 2FFBA 2NSYA 5BSGA 3RSCA 2GEKA 3TLGB 4OA8A 3EDCA 2NXCA 5FBQB 6REQA 2LUOA 3JQFC 1AZWA 1M72A 1Z34A 4O2BA 2ZIAA 421PA 2OORC 2C20A 3Q88A 3JV7A 4EYIB 4PAWA 1G2PA 2C7RA 1EJ6A 3QF4B 4N3BA 1CY0A 1NE2A 1XIVA 4UNIA 1OBVA 4HQOA 3GLFB 5JOQA 4G1VA 2Q6LA 3FHLA 1FVHA 3AHEA 2R87A 2BHSA 4I5FA 4R2KA 3HY4A 1CS4C 1OUMA 3MIZA 3LRTA 1KK0A 4UBLA 4HC4A 4BZXA 1WOYA 1F6BA 2G9VA 4KACA 1D3AA 1Z88A 2IL1A 1OZGA 3QLVA 3HDYA 3JR3A 4QJBA 3VPBA 3REQA 4RLHA 1UK7A 3UAVA 3PUKA 4NV0A 1YZVA 4HVLA 5KQRA 5IAOA 1BDMA 4MI3A 1GA6A 1Y9ZA 1SUCA 1A96A 5IH3A 3SI8A 3LV8A 3WWPA 4S1VA 4PCAA 3RJEA 5KTOA 3Q85A 3EFOA 4FE3A 4J4TA 3TIXB 2UZ1A 1KZ6A 3UGQA 4AZ0A 3RWOA 1WW8A 3JD1A 2ZS8A 1WF6A 2UVUA 2ZZNA 4FB5A 3UA4A 3QWHA 4DC0A 4GSKA 1BN7A 4AJ9A 3EX7C 3FNQA 1Y48E 1UM9B 8ICJA 3B13B 1AUXA 1ZBQA 4N3AA 2UXBB 1RKXA 2PKXA 5H1YA 1PDOA 1ZQ9A 4YBRA 2CSUA 2CXXA 1UMKA 2I1VB 2ZXEA 2QW8A 3SAJA 1GAXA 2XWJI 3HCFA 3RJMA 3DWFA 2A0KA 2JLWA 1QSGA 3WX0A 2RQ5A 4AZ3B 5A5VA 1GUAA 1PNTA 3IEKA 3MGHA 4I2FA 2BR5A 1HDRA 3ODPA 3STUA 3GGGA 2C5AA 3L1HA 2NADA 2I3GA 4G84A 1SA0A 5EGNA 4C87A 2V9CA 2C1ZA 1PLJA 2N9UA 3DV9A 2DBYA 5HXAA 1WTCA 3PGJA 1ZYQA 1YT3A 2VCHA 2RBKA 1USIA 1BHSA 4FLMA 4H0FA 2QROA 1LCIA 4GIBA 3O26A 5H81A 4BNDB 1JUDA 1PZFA 3VYRB 4UHFA 3OQIA 1N5XA 4P0TA 2GTHA 4OYRA 2OZPA 1N63A 2PFGA 3O31A 1DBSA 5FBZA 5EWJB 1MRZA 1ZK0A 2WPDD 1L7OA 2E3TA 3TJMA 5AVXA 3DAPA 2R60A 2IIQA 3WL6A 5BSFA 1E7SA 3U48A 4EMBA 1U0HC 2WYUA 4G23A 4PH5A 3KS9A 4INPA 4AJNA 4IXTA 3X43A 3K70B 1TUBB 4UHCA 1NP3A 3LWDA 2IKQA 3GT0A 3GD5A 2GBFA 4UASA 1JX4A 1GV0A 1Z28A 4MS3A 5BQOA 4KODA 5REQB 3BE6A 2HRBA 4KDFA 3R7WA 3QMVA 1NF3A 4NKRA 2OV3A 4DUYB 4TMZA 1EVZA 3ZLBA 5DTRA 4L8GA 1NK8A 5KFMA 4JR2A 4B1FA 4LCEA 4QJ3A 4WVLA 1RHKA 1OWLA 2H11A 4HRAA 3JD0A 1ZRSA 1RWKA 4HDKA 4E2YA 2WVHA 1KO1A 2J0UA 4YMIA 3QLJA 4ZI2A 2OPHA 4F4HA 2GCNA 3R7DA 3PHIA 1PW5A 4BWMA 1SBNE 2ZSIA 4ABYA 3GZJA 1CUUA 3DWEX 3JYOA 4QRHA 1NTOA 3W3AA 3L07A 2IY8A 2GJSA 3EOAI 1K5HA 1P7PA 1F3LA 3NRWA 1D1TA 2V1UA 3HUEA 4IJ5A 3OMXA 3I0MA 2OFFA 3OQBA 3GCXA 5FULA 1I94B 3KT6A 1U9CA 4TKVA 2XNDA 2VAXA 1A9ZA 1OWNA 3KVRA 3DUFB 2WOOA 1V1JA 4XOUA 3IPLA 1BZYA 1VYUA 3KQOA 4L02A 3OAAD 4FCWA 4QZDA 1XE3A 1NKSA 3LMKA 1FLAA 1DX6A 1FE8A 3LT5A 1XZKA 3RH5A 4R2WA 1X7HA 4A1OA 2FG5A 1PZMA 4HWGA 3WRXA 3LCMA 4LQLA 1E69A 4FZ3A 4TLEA 1PJ2A 1RNLA 4Q7MB 2JL1A 2IYLD 1P1CA 1G8MA 4C0WA 5JTUA 3Q6IA 4QX6A 2PBFA 4P0QA 5B5SA 3OWXA 1YVUA 3LQKA 2IXEA 1NK7A 5DXJA 3H1EA 3KNZA 1SRRA 2FQYA 2I6TA 5FUMA 3OLCX 4WL0A 1MVLA 3ZXIA 3JQPA 2W2KB 5LQMA 1B4FA 5D86A 2G80A 2DTXA 1Z6PA 1RG6A 1R15A 2VC2B 2I29A 1W87A 2Y9UA 3PCXA 1MW9X 5JPCA 3WSTA 3P2KA 2CNWD 4YR3A 4HP8A 4RXMA 3HJCA 5HIAA 2DBZA 3C2LA 2VN8A 3UOAB 1V5EA 1B3RA 1Y9AA 4G4IA 3OSPA 2ZRJA 1SU7A 3T99A 4FS8A 3V6JA 4B9EA 2XDQA 1J56A 2E4YA 1Z9BA 4WECA 1C3XA 5NULA 2OLEA 2LR0A 3J7TA 1JHDA 2D8MA 3JZMA 4YRAA 1X2BA 4RVFA 3AKZA 1P4GA 3DKIA 4JDUA 1SVMA 4NONA 2I2BA 3PD0A 1VJ0A 5KNLA 5EPUA 4RMNA 4HX5A 3BMOB 3C4JA 5CDSA 1FUEA 4Q01A 4UZSA 4EG8A 4QTUB 1ZMBA 2J6UA 3P9SA 1BAPA 5K0BA 4Z9FA 3ROXA 1RJFA 1FFGA 5CFRA 3HVJA 4IXDA 1ANKA 1NKTA 4B7ZA 4P2GA 1NNSA 3ZUGA 4M9LA 4QULA 4EG0A 3ST7A 3O47A 3S2FA 2DKXA 1UFRA 2FSUA 3GEGA 1N2CE 4RABA 1WBBA 4CFYA 2QTFA 3NH9A 3RI3A 4DR7B 2IBMA 2WJVA 3D5TA 2JI6A 1MDBA 2QRUA 5KSPA 1F0PA 2GA8A 2R8XA 5KFKA 3TUJC 4C0KA 3T5PA 5DXFA 4L28A 5CFNA 1QCDA 2QS9A 1ZCFA 3ISJA 1YRYE 2YRFA 1X13A 3WKBA 3ETEA 5B6IA 1XRMA 2C99A 4UFPA 2FFJA 1A8HA 1G3QA 2VRBA 2N1MA 3RV4A 1E3LA 3ADBA 4RY9A 1EH5A 3H4BA 4N5MA 3L4KA 2O2YA 1JKJB 5AUNB 4XB2A 2JGDA 4AN1A 1XJWA 3QUQA 4P3KA 1V16B 3G9XA 3NHMA 3D8TA 1ZA1A 2RAPA 3IUPA 1UZNA 4YDHB 2TMYA 3QPVA 4PGMA 3S70A 4HB3A 1Y8QA 4J0CA 3HP7A 1PU2A 4GPD1 2GYYA 1N1GA 4K4IA 5BYJA 1D5WA 1CJUC 3WMRA 1T0HB 4K8RB 1OGIA 1RLTA 4J6FA 2QRGA 5FH9A 4E5DA 3ONEA 2QG9A 1QOZA 1U31A 4AURA 3AK4A 1R16A 2WKWA 3ELBA 1PW7A 2ID9A 4K2AA 3U3XA 3AYXB 1AURA 1UBGA 3NVAA 2C0QA 3ABOB 2GSWA 2Q2NA 5MHTA 2XB6A 3DF7A 2ZJ2A 1EGMB 1TTQB 3DC2A 4S1OA 4LV8B 4B3HA 5TRTA 4IDFA 3CB4A 1J7KA 2WKPA 3EZNA 2YMPA 3CW8X 4TQSA 3QA3E 3NVZA 4LDJA 2PMWB 4C0ZA 2WTXA 2MCFA 3BMNB 1MB9A 3CZ9A 2HMYB 3L82B 1YB6A 3V8QA 1RWQA 2FPKA 2D5CA 5CVVA 3HMKA 4MV1A 1XTSA 3BJIC 2ZDHA 1P1HA 2NTVA 3BXPA 4NV3A 2DUUA 3P97A 3FYDA 4O4JA 2X5OA 3P45A 5BR4A 4TWZA 4BMSA 3PNYA 1ONPA 2B69A 3ZU2A 1L1EA 2X0FA 1T3GA 3QQPA 3ICWA 3MJHA 5AW1A 3QXHA 3T61A 3IALA 1SL2A 3R3YA 1NA5A 4E4RA 1DIBA 2C5BA 4ACBA 3ENQA 4TVBA 4JD5A 1UBMS 1JG2A 1ZD5A 4DMCA 4YD1A 1QAQA 2ZJ6A 5J2HA 2J3QA 4EB6B 5EWLA 4H7PA 2KS6A 1YBFA 1AIPA 2JI8A 3CNEA 4RW0A 3V80A 3TR6A 5FQOA 5F2OA 4GC6A 1E2QA 4C7MA 1BOFA 3GEEA 3O93A 3ZNPA 1L7EA 4Y2XA 5FUYA 1LLQA 4IZOA 2ZS7A 4J03A 2HCTA 4RANA 2GEDA 4UDOA 2X15A 2CHVA 4M36A 4RQ3A 2QMHA 1S96A 5CX4A 3GLHB 1MTOA 5KJ1A 3CX6A 3L8YA 1JFVA 1TEHA 3NVYA 5TISU 4I50A 3S40A 2XD4A 3V9AA 3CLVA 1ECWA 4F1JA 4F2SA 4MZXA 1QPZA 4OK6A 2R8KA 3R8CA 1R4AA 3LYAA 3IMKA 3RAXA 4N3NA 3PP8A 3IT1A 3C8MA 4QPCA 2UKDA 3L8EA 2DMRA 4D0RA 3VNSA 5KJCA 2OSVA 3L8ZA 2UYCA 1AB6A 3LC0A 2XHZA 1Y5NA 3BREA 2HPZA 3GNSA 3JPOA 4D46A 1F2TA 3PWSA 5FWYB 4JKYA 4KV9A 3K92A 2RC6A 4RD4A 4KSCA 1RWMA 3UHOA 4LE2A 3IKTA 3H13A 3O8QA 1NJ1A 1LV8A 3C3BA 2F9FA 1X7DA 1XL1A 4OD0A 1FP1D 3OIGA 5FUWA 3D7MA 3G2MA 4RPLA 4AUMA 5EPEA 2NX2A 5TQ2A 4Y2YA 4BMVA 2C3UA 1O87A 3SOZA 1IEXA 4JWNA 3ZQKA 3VR1A 3HSSA 4P53A 5CJPA 1FP2A 2EG9A 1JWBB 3OJLA 4GPTA 4PHFA 5DGTA 2QB0A 9ICCA 3ELDA 3NAQA 3PGLA 2X0DA 3HILA 1QRSA 1S89A 5DB7A 4B4VA 1PEAA 1QB8A 4ATNA 4CTKA 1TCBA 5TQJA 4X9XA 3WGJA 4UPVA 2W9CA 3L8GA 1UXIA 2MU1A 5H02A 4UUMA 3REFA 4OQZA 1SUFA 1YQDA 3M1AA 3MFQA 2P3OA 1C0KA 4LY0A 4M1WA 1H4TA 2ADMA 1N3LA 3A1UA 2OZLA 5L1JA 1UKBA 3PNPA 1Q14A 1KSPA 5G4KB 1UODA 1U0LA 3HV0A 2YKGA 3LY5A 1R3DA 2PTHA 2NYAA 3RB0A 4R1UA 1B76A 1G6KA 2PZBA 3N7RC 1RAEA 4PRKA 1W88B 1VXRA 2C0CA 3GZNA 5ES3A 4NXMB 3H75A 2YN0A 1Z33A 2JCBA 3WA6A 2EOAA 3E05A 2W4QA 3H1FA 4NFYA 3IP5A 4IEIA 1Z39A 2KX7A 4E30A 1QQBA 4KK3A 2QEQA 3LVBA 4E1AA 3G0BA 5E0KB 2AJLI 4KITB 4FSDA 5FR2A 4DR1B 3LC2O 1RM3A 2JBAA 3E82A 1NYRA 2XQJA 1QFZA 2PH7A 2BFBA 5ICMA 1G9XA 3A4MA 5HZHA 2F3RA 3CC8A 2J6HA 2KVSA 5K3BA 3CRXA 4LFAB 2ZREA 4JYAB 3K31A 1Z6XA 2Y4OA 2H52A 4I9NA 1M5TA 3OUUA 4ZCLA 4UOZA 4Q34A 3IE0A 3DMHA 1HFJA 7ICNA 2AU0A 1E32A 3W4IA 1OILA 1AGPA 5FOSA 2I62A 4RXTA 4YY3B 3B6ZA 4QZIA 4PZCA 2G04A 3A36A 3E58A 4O5OA 2QL9A 1V35A 2C9OA 3NOXA 1R88A 5JMPA 1K3UB 4TXMA 1EX6A 3WS7A 2IOQA 1FFCA 5L9AA 4JOCA 4I81A 5CA0F 4NZZA 2FFHA 1WXWA 1ZONA 2PZJA 1P19A 1ZU5A 3H9JA 4IIJB 3K6SB 1ELOA 3EXFA 1W7AA 5THKA 2DQYA 3IQHX 3BSYA 4MV0A 1RYEA 3SX4A 2IS6A 4ND8B 3QFTA 2F8SA 4DQPA 3KR0A 5EXPA 3ZU4A 4C4XA 1EXNA 4Q66C 1WSBA 2OG1A 3R7SA 4E70A 1XPJA 4MLPA 1TYEB 2QZSA 5B1DA 3DBLA 3FNRA 3BQMB 4DPLA 1MN6A 1EDDA 5KUTA 3QWFA 1OC4A 5JHGB 5L51A 2AYYA 1ZR4A 5D46A 3FYCA 5EZYF 4NCAA 5BNIA 4YV7A 2EQYA 2JZCA 3C4VA 2XTZA 1YK1A 4H77A 2Z8ZA 4E7PA 2H59A 1QIHA 2HZ7A 1FNBA 2OHJA 4RKWA 4BQPA 4IJVA 4RIGA 1U3FA 2R79A 3EXHC 3VJMA 1VJ5A 5EJ6A 3C2KA 2G1UA 5JSFA 1HA3A 4DV1B 1BJRE 4BO7A 4DCSA 4NYJQ 1RI1A 1PFYA 1RADA 2YN4A 2FZGA 5A9SB 4KMSA 1S9FA 3HB9A 5EE5B 1TDJA 1CNFA 1VI6A 1DEXA 4DSUA 1K5OA 1CQJB 3D4PA 3TTSA 1XWLA 3W8RA 4TS1A 3H4TA 4C08A 3OC6A 4YJ3A 3DNFA 1NUAA 3ZI4A 4KNWA 5J23A 5TB5A 4QWWA 2HIGA 4JXZA 1WW2A 5DH9A 2V8OA 5D01A 1M6HA 3Q3JB 4J16C 1X7ZA 1DKRA 3K5WA 1RQLA 3OEHA 1IHUA 4KR9A 2YV1A 4PYNA 1TYCA 4Z99A 3IPYA 5IJ9A 4QAJA 3NEJA 2GD2A 1I4OA 1I80A 2C7GA 5KNDA 3CX7A 3R75A 3W8NA 4FONA 4EX6A 3INNA 2GPAA 3EA0A 4XEHA 1T43A 1YC2A 2CXUA 1WA5A 2JAUA 4K1XA 2HOIA 2J85A 1KL7A 2HRDA 1EWTA 2CFIA 2YB1A 2JIZD 3VAZA 3T1YB 4B5LA 2ATLA 4OUDB 2I55A 3LHDA 2A0WA 1L7NA 1FP6A 3H0EA 3F5SA 5J0TA 3EG9B 1FBNA 1V1MA 1NVBA 3JARA 4Q7QA 5L4NA 2Q2VA 1YV9A 2GJKA 4M88A 2A9OA 1FQJA 1NZFA 5TQ0A 3AUFA 4I6GA 1RVDA 5DYNA 5E6SB 2VCEA 3CLKA 1WU7A 1KRXA 4RMJA 2NYRA 5AT1A 1M8KA 2BMEA 4BATA 1EFUA 4RF2A 1O58A 2VP5A 1G1MA 2I6UA 4I4IA 3WNZA 3K35A 5HKOA 1LS1A 4PVCA 2VJ4A 3CG4A 1MOSA 1VYVA 5AW5A 2NO0A 4RCVA 1A69A 2FMIA 2ZUTA 2ODEA 5HUHA 2GCPA 4XM0A 1P45A 4LRQA 3A05A 3HNOA 3P4XA 1NJ2A 3HRDD 4BMOB 1NSYA 3GLGA 4FMDB 3CH6A 3FKQA 3OIUA 4KTVE 4TX1A 1IYZA 4TTQA 3GT4A 2B99A 2O6HA 3GFRA 4YHBA 3RVOA 3ZZ0A 3D8BA 1SXPA 2AX4A 2GSDA 4FFNA 1D1PA 1RM6C 3TRDA 4DLVA 4BBPA 3AVQA 4NFSA 1ZPDA 4CI9A 2R6CA 3BHIA 3Q3HA 2QQ5A 1DK3A 2OBLA 3HCOA 5AW0A 4DLZA 3UJBA 1G63A 1U48A 4F5OA 2HBJA 1ESCA 2MSEB 4X1KB 4BXOA 3BEOA 1PFVA 3E9QA 2FZLA 1I7PA 1XVVA 4BFUA 4MITA 4QW9A 1DO8A 2GQ0A 1L3CA 3PNSA 4NP6A 3CF4G 4H3HB 3ZDQA 3CV3A 5IFLA 4YROA 5JCOC 1YAJA 1FFAA 2B7BA 3NFYA 3K32A 3L92A 5F3RA 4JASB 2DPMA 5BN5A 3WAJA 3PHJA 3DYBA 2C8VA 5CURA 1THZA 1QO0D 1XZMA 2L82A 5KQSA 5EGSA 1ZUWA 4K9RA 4RULA 3B1FA 5F1KA 5BWBA 2CYAA 4BVKA 5KYYA 3GWZA 2R6ZA 2ZOSA 1HDGO 2JFHA 1D2NA 2X5KO 4DPKA 1JIIA 1O5TA 3M3HA 2UUBB 1C4XA 4C5AA 2GN2A 1QIEA 4RELA 5A5EA 1GG9A 1P8JA 2Q4BA 3OTGA 4ZHQA 2SKCA 4DOCA 2W6NA 3MGCA 5KAMA 1Q16A 5E9AA 4RL4A 5KDLA 2B1QA 2UVQA 1EUDA 2XKAA 4DOMA 2O07A 3PTZA 1UBJS 4DRXA 2WUGA 4DC9A 2VHWA 4Y2JA 1LDMA 2A1TR 1BMQA 4F5NA 4DW8A 4AJHA 4HWOA 1V9PA 1EA5A 1YC5A 1Q15A 3KHHA 2EEPA 2R8EA 1HYBA 1K3FA 1NT4A 4GXIA 3RK4A 2EG5A 2MSNA 5LCXA 2P35A 4J75A 4CGYA 2J67A 1D4FA 2UUOA 2ZUFA 3S44A 2J9XB 5K99A 3A6EA 3L0ZA 1O08A 1Y8AA 1T15A 4BO4A 1WDTA 3ICXA 3EIWA 3N4MB 3KZMA 4RZXA 1WSAA 2AGQA 2BH2A 2HK6A 3DT9A 1C3VA 4X5VA 2FJ6A 4G67A 4RSMA 5JEDA 2OV1A 1G8YA 3EUFA 1O8BA 1WUYA 4WLNA 3LYUA 4KVAA 4MIYA 1MNAA 2C7PA 3R40A 1IN6A 4QPDA 5HA5A 5AW6A 4LHWA 4W9MC 4PQFA 3I12A 1JR2A 1FJHA 1NVTA 2KVCA 5IIJA 5EA2A 1XD8A 4R1NA 2VP2A 1X8XA 2ISQA 5IJ0B 3UY4A 4JT9A 4GL2A 1QJCA 4DWJA 3WAKA 1JHRA 1U4SA 2FWMX 2JK0A 5CB8A 4PQRA 4NBTA 5IXSA 1R8XA 4XFJA 2WTFA 1ICEA 3VU1A 1UFOA 1P2UA 3LBIA 1MIOA 4CTJA 4MGIR 3UMCA 5JJ5A 1JI7A 4UAUA 5ER9A 2B4AA 1WU8A 1VKOA 4PHDA 3OCUA 5IYZB 4L8LA 4MMXB 1ZH0A 3D4LA 4BKRA 2J0SA 4PZ9A 1PT8A 3T9FA 1GGJA 3SWWA 1E0JA 5C5EA 4PX3A 4Z0TA 1BVSA 1I9GA 3ZYZA 4ZOQI 4XCVA 1QPGA 3IRVA 2C2YA 3EAFA 1Y37A 1EXWA 3MS4A 2P0AA 2W58A 4V0SA 1J00A 2XNSA 1SIOA 1ONBA 3L0CA 4D0NA 4O5CA 4URUR 3AF6A 4IYJA 3L4SO 5M2QA 3MJCA 1ZSVA 2K89A 2BCSA 4MEJA 4WCVA 3QBJA 2OFOA 2VL7A 3MN1A 1GSHA 3PGMA 1DQYA 3S8MA 1MP0A 5HYVA 3I01M 2XNHA 3T1TA 4OSOA 3S8EA 2SECE 3HYCA 4Q9DA 2HHHB 1OT3A 1DCMA 4I1RA 4KR3A 5EYPB 3ORQA 4DF4A 3C6ZA 3T7RA 4I1OA 1VKZA 3HM9A 4X7PA 5HILA 2NO1A 3M3PA 1NVVQ 5TXGA 4RVGA 3DEJA 1OR8A 4HOYA 1L4NA 3OZGA 4S2UA 1RT9A 1T5SA 5SV2A 4EW3A 4QRIA 2IDKA 1P5ZB 2IV7A 2R8YA 1H3FA 1GPAA 4UNRA 3L1UA 1QRAA 1W0CA 3DKPA 4YMWA 3ZCXA 5CRIA 1P7WA 1JXAA 3U16A 3MWDB 4KRFA 7ICOA 2YV2A 1TW3A 3DE4X 1QTNA 4FD2A 4BQFA 1RM5A 1QNLA 1JAXA 3AVTA 3KUUA 4L6CA 3MTBA 3HWWA 1E1CA 5CXXA 4QUEA 3N53A 5LD2C 4RGYA 5DCUA 2HF8A 3SV3A 4RMGA 3AFNA 3AQEA 3OZIA 4KZKA 4X95A 1NYTA 3FXAA 2F43B 4D45A 3U7RA 3JAWA 5F76A 4M98A 5KFIA 4MHVA 2R1VA 3BWVA 4BTEA 3BX1A 1A9OA 5KWVA 1X8LA 9ICSA 3VH3A 1E61A 1MKYA 1YQTA 1WUKS 5C8XA 1CQIB 4UDYX 5BW6B 5U1PA 2FV8A 3A2LA 5G53C 1SIJA 1G60A 3G5MA 3GX1A 1IV8A 4M8SA 5CG2A 1AXGA 2X42A 4NDNE 1Z26A 1LBTA 1V3QE 2WUDA 2NSJA 2PYDA 4Q1FA 4PSKA 4GAEA 1NVMB 3BDPA 2GVZC 2VPYA 1AUPA 1MF7A 1H4VB 4GX0A 1E0SA 4BQOA 1NXVA 2NT4A 4JGBA 2VP3A 3U31A 1PE0A 4GDMA 2A9FA 2ZUVA 2WG0A 3NTXA 5KTTA 5AVOA 1LW6E 1DOAA 2GFQA 2IFTA 2OT3B 4TZKA 5E4FA 3M5PA 2P5TB 1OGJA 2PQ0A 2XOXA 2AMVA 3RRJA 3BMCB 2R9VA 4IQ8A 3BF8A 3ZWPA 3QQ5A 4QWEA 1Y8RB 1UK6A 2I3ZA 3VQTA 3RAFC 4E7OA 4C29A 2AD1A 4K9MA 1KIAA 3WMWA 1X70A 3PRJA 3AH8A 4DG8A 4I08A 5MN5A 3SHTA 3RAGA 2GI4A 5FOQA 4EFDA 1QH0A 1I6WA 4O02B 5TPWB 2XZLA 2GJAA 1DHTA 4MIEA 3O4GA 2XGGA 3RTVA 3T0FA 2R96A 2FW0A 4Y6QA 4BBJA 1I1NA 2AZXA 4ZDJA 3LDGA 4GG1A 1AKRA 2V1XA 3L0OA 4G0QA 2VJOA 3AEYA 2DQ4A 3DOOA 1CUWA 2EERA 3C1TA 3RPEA 4REOA 4OHRA 3MEQA 1XFAA 2R65A 3USCS 2IHUA 4UHBA 1MQAA 2XB9A 2J1LA 1UQTA 1DCKA 3ESCA 3QM1A 4ZVTA 3IDOA 4ZAWA 3QUCA 4MW5A 4KUEA 2Z6AA 2DHRA 3VUEA 4H6VA 1KFDA 1M2VB 4K8OA 1BYIA 2IXDA 4QU8A 3CH5A 1KQGA 2C1EA 1VL5A 2QNIA 1VKRA 3GRCA 3UK7A 5AM4A 3KHKA 3ER9A 2H2DA 1XPUA 3HCRA 2VRCA 4JK1A 2H31A 1U3GA 3IS3A 1CRLA 4A2PA 1X8JA 3WBBA 2PMZC 2X77A 4MDYA 4M2LA 4X91A 3I4FA 3FBTA 3FG9A 2IZZA 1URPA 4EKYA 5C4MA 4RIEA 1XCMA 4U39A 1L7QA 2HQRA 1IXSB 1M7BA 3C5VA 3EZFA 4KLQA 3MD9A 1FSZA 1G41A 1XRJA 4ENSA 5DTJA 1G21E 4UU1A 5JAOA 1E3SA 4UEJA 1XHEA 3P9ZA 1O1YA 4EYSA 4OIMA 2W55A 3H2YA 2W2VA 2Q21A 2O57A 1UJCA 1KEUA 4M0UA 1MIHA 4EF5A 4AY2A 3AM9A 1NPDA 1ZQBA 1WB4A 1PT9A 2YS7A 1JQDA 5AW7A 2AG5A 1G20E 2X23A 1YZFA 2BT4A 3GDHA 1Q1BA 5KOHA 4CKCB 1X42A 1RRPA 4Z4CA 2ZUBA 2QARB 3Q9NA 2R97A 4BLWA 1O2DA 1EUZA 1FTYA 3IP8A 1ZH8A 3AR5A 4RKYA 3PO4A 1BDHA 3ZU6A 3QUTA 1IOVA 5LM3A 4WINA 1CX9B 3TQOA 1NRIA 4D8YA 3K4QA 1W49A 5AKKA 1C9MA 3VC7A 3H8VA 2B78A 1YVDA 1PKXA 1XEXA 2JGLA 3SX0A 3EFHA 3K9NA 4K3UA 2GR9A 2BUBA 4E14A 3E0XA 4ZQIA 3A1WA 4DOAA 2OZKA 4JY7A 1FS4A 4HN9A 1EU1A 1T9DA 4BL5A 1N8TA 2G1PA 1LEHA 3HBMA 4NYMQ 4CQNA 3H9GA 1CE8A 1S3GA 2ZWIA 1QGDA 3FNFA 2IPXA 4X8LA 3E0QA 4QPZA 3LF1A 4LNAA 1ISIA 3KPYA 3P19A 5L53A 3C14C 4EG4A 5ESXA 4KXFB 5FUXA 3U4QB 1K5GA 2WEKA 3UATA 2QRVB 5KOIA 4UMDA 4K4HA 3LDFA 4LJ6A 3S1SA 1UQVA 1MH1A 3MLEA 1P73A 2I3DA 5G1PA 4OO3A 4ECRA 3ROPA 5J2GA 1FX0B 4UOQA 5CLQA 4ZHSA 2WVJA 5K8IA 3V7JA 3H19A 2HMSA 5TT0A 1ORTA 2DX7A 2H5XA 4IPTA 1H6CA 2Q3FA 1SKBA 3BZCA 2GEJA 2Y0BA 3KFVA 4O3NA 3MSXA 3PFGA 1BXZA 3I34X 3QVKA 3O8CA 4HZUB 1B00A 2M9MA 4S0XA 3PDUA 1VDMA 2KLBA 5HHIA 2F76X 1YQQA 2Y1GA 4BQQA 2LGJA 1T4BA 3ACBA 5DGXA 1WDWB 5IT9A 2QD3A 3DQZA 2FLVA 4HH3C 3RH6A 2WF7A 5JAZA 3HFJA 3FOWA 1M2KA 3H04A 4Q3LA 4HL6A 2MJLA 4P3OA 3D6UA 3DTYA 3TEMA 5JXGA 4W7IA 5EUBA 2DUMA 2YWRA 1XZNA 4EG6A 5LQRA 4S1PA 1X40A 2C83A 1SCUB 3LZDA 5EJ8A 1ZQ1C 1H0RA 3NT5A 2IODA 2JJ2A 3AQIA 3FOZA 1UBEA 3WRYC 5DCLA 2IS2A 1SV0A 1AS3A 4QBTA 4PHGA 5CH5A 3GEPA 4MQ4A 2CNDA 2JPDA 4AN4A 4WFJA 1GTL1 3FVRA 4JFRA 4R2HA 1B0UA 4OXKA 5DN6A 1A5TA 4K0KB 1ZIOA 3WK8A 4N65A 3TL6A 2VDUE 4M1EA 3EZ5A 2E87A 1MGPA 4PZZA 2VHCA 4NXZA 4WLVA 1E92A 1KY2A 4EY4A 3N07A 1SOWA 3O9MA 3RS5A 1IBCA 3HY6A 1MA7A 4LF4B 2HVHA 2IU3A 4HPWA 3HGMA 3QTLA 4X8OA 1TAUA 2WHXA 7AT1A 4NYIR 2W9AA 1VTKA 2G9NA 2BM0A 4JVNA 4Z7OB 3RJ9A 1DAOA 1EQUA 4MUFA 3TL3A 1XXLA 4BN0A 1Y3HA 1HDCA 2A9QA 3EOBI 1CS0B 3K1TA 1ZQGA 3AFIA 2RHHA 4K88A 5EJ7A 4XRGA 2XCOA 5JG7A 2GPTA 1W59A 4LSMA 4BCBA 1VIVA 1NLUA 1B42A 4ID9A 4GWGA 2FI1A 2G1KA 3DNPA 4YUZA 4JX8A 2VPXA 4L75A 3I2FA 3O3OB 2E4AA 1XZFA 3ZN2A 1UXOA 4QDZA 1USGA 5F12A 1W46A 1N7JA 3SYZA 4KZPA 3IHKA 1W85A 2ORWA 2RGEA 1NQTA 4S0ZA 1VJ1A 1MAUA 3SQXA 2QUJA 2WSIA 3ISBA 1ZJ4A 5FL7D 1T5TA 4F9FA 1H8EA 3K1JA 2YVLA 3TPFA 4HQ0A 4J9MA 1ZCJA 4EATA 2QLTA 3W90A 3WVNA 3C41J 3KBBA 1NW8A 3PQ5A 3GV8B 5BMVF 1NV8A 3NTOA 3W2FA 5FO0A 1NJ8A 2J4CA 1NN1A 4XIJA 2GEUA 1GNSA 3F2CA 1JU9A 5B1EA 3WGGA 1GKYA 2BFNA 2BKLA 1N9KA 4K81B 1KKUA 3QUAA 3K0KA 1Q6ZA 3FOBA 2HK9A 2QTAA 3NV7A 5JZSA 1SVLA 4BP3A 4J1NA 3VZPA 1QIFA 2ACWA 3EIXA 3K9GA 1M10A 1LZKA 3HDJA 3JWGA 4PHTA 4ZV9A 1QGAA 3RU9A 2ZE8A 3N39C 3OCWA 4OP2A 2EJUA 1Y3CE 1FFDA 1FQOA 1YZKA 2X76A 2H2WA 2BI7A 2R62A 4ZPJA 4RVSA 3TVDA 3ULKA 1JQKA 3BQ0A 1G8AA 2BV3A 1WKBA 1VCNA 2HPHA 3ESRA 1T9AA 3HUUA 4EQ6A 4X1IB 5F7OA 4FUTA 4U7TB 2KZMA 4XYMA 1ABEA 3ETJA 4M0LA 1RAHA 5JMTA 3T7CA 1A5SB 2FP4B 1XZJA 2D74A 1OIVA 3MRVA 2JRZA 5KFXA 2I1WA 2CJWB 3HWTA 3OE5A 4Q19A 5IVPA 5ENZA 1BVYF 1SZHA 2E8MA 3FZEA 3S5JA 4WKCA 2O3SA 3PFIA 4M9JA 4O3QA 3ZDRA 3R09A 2X5JO 4H18A 3HDTA 1ZGCA 2P9BA 4AQ7A 1L5RA 1E64A 4HNAA 4ZD6A 2IYYA 2OGWA 2YHUA 3UNXA 2DQSA 2ZU0C 1YRQA 3HKDB 1EGAA 1ZSYA 1N4DA 2PX8A 2QLJA 2XXAA 4M9RA 3EQ7A 3A9TA 1DAEA 2H4HA 1TJYA 4RIHA 2CVQA 1V9CA 1G5HA 1W93A 4FGJA 3ADKA 3GPIA 1FYEA 5EJAA 1R5OA 3JASA 3VR5A 2BPOA 4DPMA 2O1WA 1W34A 5INTA 4JU9A 4MKHA 2RJ3A 3HKBB 2BKEA 4TL9A 4NENB 2IWRA 1KDTA 1Y8ZA 4UULA 1LK5A 4L2IA 3OCYA 3GVXA 2ZRIA 4W7SA 2I2CA 1VJTA 5J2KA 4QDJA 3N28A 3JRXA 4ZOLA 2FWJA 5GV7A 2ROQA 4Y6LA 1UMBB 3RAJA 2V7BA 1M1XB 3X2FA 2WJPA 1H3NA 4U5XA 5GTDA 4R6WA 5THXA 2HFJA 1I10A 1ED1A 7REQA 1PL6A 4C30A 5FCDA 5KCZA 4MJXA 4BVFA 4HR7A 4G26A 2PMZF 2AJ8A 1C2YA 3GJ4A 2CLLB 1DQSA 4IZIA 1L5HB 4PAQA 1RBZA 2JGKA 2G5TA 1JQAA 4UC0A 3TCNA 4KN4A 4JXKA 4AICA 1AHPA 3IV6A 2H5EA 4DBVO 1GNQA 5C7IO 4ZVRA 3ON5A 1T6YA 4R1MA 3RSOA 2NXJA 1BE6A 2A2ZA 4JEMA 4C3UA 5A1TA 3DSRA 3DZ8A 3WLFA 2WHPA 2WT8A 4L3VA 2ZUSA 1DUIA 4JBNA 5EKDA 3ZWCA 5J0SA 3JD2A 3SEIA 2O6LA 5CGQB 2IDZA 1KYYA 4JX9A 3NWOA 2B30A 3UJ7A 1YUBA 2VZ8A 1DC3A 1HIWA 1OXUA 4ZAXA 1LY1A 4X60A 1B22A 3WWDA 1L4HA 3ZHXA 5CA7A 2D5BA 2G5IB 4MB0A 4R5MA 1W47A 1Q11A 2CDRA 1D8BA 5TJHA 4N5LA 5KYGA 2FRDA 2BDPA 2XNCA 4ECVA 2QSJA 1OA1A 4RNCA 4Y1RB 4TROA 1R0WA 1CT9A 5CLJA 1B8PA 4CKEA 5EVCA 2OR3A 2P9TA 3GFSA 4PYMA 4CLOA 4EI7A 4PO9A 1IONA 3N86A 3HBAA 3CKYA 5ALLA 5IW8A 4UVGA 3GW8A 3MAAC 3JQBA 2OYYA 2DOKA 2AEEA 3C6YA 3GV0A 1YR1A 1DTWA 3TLZA 4PZUA 3EE6A 4PYQA 1EJBA 4MWGA 2CCGA 2EDAA 4EKNB 5JANA 1X3LA 4R01A 2DKZA 4M0EA 1DHRA 1B8OA 4HRVA 4DANA 5CM9C 4C20A 2OCLA 1IZ0A 3E53A 5DLPA 4E3WA 2V74B 1D8TA 1EB8A 2JVIA 1PG5A 4O1HA 1ZXBA 3UWOA 3UIEA 3TF5A 4KXXA 4P5EA 3U9SA 1FS5A 2QD4A 1K2WA 5GZ6A 1KYVA 4XVCA 2PS3A 3GDWA 3CZRA 4EHBA 3PX2A 1ZRHA 4BUGA 5AMXA 5CEFA 5CFLA 3U6KA 1HURA 5HF5A 1GTMA 4Q4JA 3M6MD 3U3DA 3IGFA 5DZSA 1DC6A 4FYWA 2UYQA 1W29A 4AMYA 1M0SA 4KFTA 3VHXA 3ZHUA 3OZVA 5JQWA 1SZDA 2RGWA 3ZWDA 5C1PA 2C4TA 2W9BB 3CNOA 5CEJA 1ZXIA 1IIRA 3WLJA 4B4UA 3IB3A 3A1SA 3L6CA 4ZAVA 1Z3IX 1E2NA 2R8BA 3HJAA 2DQKA 1QIJA 3AUAA 3DR3A 3PPIA 1R9NA 4PXYA 4AO8A 1Y63A 4EMTA 4H0CA 4IGFA 4V0QA 3CW9A 3QLUA 3ET4A 4H7KA 3EW9A 4B2YA 4OQEA 1PG0A 5G0UA 2H1HA 4MW0A 2RAFA 1IIBA 1E8DA 3ZHZA 4TUSA 3C5FA 4NCKA 1LW7A 5C0YA 2A1IA 4LZDA 4KGXA 5L7WA 5F33A 1F7VA 1GTSA 4ZJYA 5DQIA 1OAAA 4V0NA 3UFXA 2VJMA 2VHVA 1S2GA 1JQBA 1OV4A 4NATA 1BVRA 5EWMB 3ABRB 3QOWA 3WHLA 2PMEA 4R8LA 1CJVC 4IRXA 2NVOA 3I39X 3DWIA 5EZQA 1M0TA 2CLDX 4MR7A 1QR6A 4XUEA 3SQIA 1Q57A 3L05A 1EG7A 1RKBA 1X1DA 1GCOA 3KJHA 5B53A 2W7TA 5IC4A 5TS2A 3ZI7A 3FDZA 5BR7A 4OJNA 1M74A 4M3NA 1WNFA 4GR9A 4YO8A 1UK9A 5TGTA 3N2KA 2A86A 3BKXA 8MHTA 3PEUA 2ZLBA 3IQDB 4ARZA 1V38A 2QW1A 3P2IA 4EHIA 1WVGA 2DFKB 4U5QA 1Z75A 1A1SA 3RVKA 3E2MA 4AO6A 5EIAA 4B87A 3KUXA 1C1XB 4L5YA 4ESHA 1U1IA 1V7PC 1JR4A 3F8TA 4IKPA 1Y4AE 4WNAB 2QK4A 4TN1A 4KO8A 1FRZA 2VT3A 1N2BA 1JRLA 4QWCA 4C6HA 3TD9A 2GARA 5KJFA 5JS2A 3L9WA 1VKJA 2FR8A 1P2BA 3MR2A 2YRWA 5IHPA 3FSJX 4MYSA 1I2BA 1KLNA 3DM5A 5DGAA 3BTUA 3VH4A 4GBJA 1Z8FA 2EZTA 4WKBA 5JAUA 4H6PA 1K6IA 3V4LA 1BKYA 3M6KA 3GLUA 1HRDA 5LLSA 4QAQA 5LJIA 2I6XA 2H4ZA 2FEMA 4CTOA 3UJNA 2O8BB 3P32A 3VVMA 1FFWA 1T0PA 3D3KA 1V9SA 4RZ3A 3L01A 4EZIA 3G79A 4RHCA 4UTPA 5KC8A 3KG2A 4IEEA 2ZI7A 2FZWA 3H5LA 1X86B 5C5JA 3R4CA 5KFCA 3SLKA 1W2GA 3CGGA 3EVTA 5AJWA 1NKBA 3E15A 2Q2OA 4NAHA 2H48A 5EMJA 2J3MA 3AESA 5IKXA 2WYHA 5CIWA 2AFVA 4Q7KA 2FYTA 3CT4A 4A16A 5F4ZA 4NBUA 4A9AA 4CIXA 3GBSA 4M9NA 1RJ9A 3EXG2 3BL8A 5IK2A 1ACMA 1RRVA 2IUEA 3MGVA 3NDPA 2WAMA 2GZSA 4PFKA 2EATA 2H65A 3DFUA 3SS8A 4DNOA 1F4PA 2GKOA 8ICBA 4QUAA 1RC0A 5J1SB 2BZ1A 3GEMA 1IK4A 4FMPA 1U3WA 1QYRA 3ZLVA 2VYND 4KMOB 5IC6A 3AP2A 2JF0A 1AZTA 3ESAA 4HGRA 1E1RA 4OF4A 1K4MA 1LBSA 2VHZA 3L7NA 2WD8A 3RFXA 2XDYA 4UTVA 1NP6A 3DEHA 1M2JA 3QLTA 4C07A 4UMFA 3BM5A 1ZQHA 2OV6A 2NVUB 1DP4A 1N60A 4DMFA 2B8TA 4F5RA 3IHQB 3WLKX 1XCPA 1EGVB 3NDJA 2PFPA 3A4NA 3NVVA 1VMEA 4QZCA 4F12A 2C4MA 4D96A 3FGPA 2HLPA 4QO7A 5B12A 4C21A 5LXTB 1YVEI 4YV2A 1KIMA 2QSUA 3OSZA 3FVVA 2B83A 2WJIA 4O63O 3O4IA 4OJTA 4ALNA 4AMUA 3EA4A 2W6QA 3ONNA 3GHHA 4HAUA 2AC2A 3ZE8A 3HACA 2EDCA 1MA0A 3CEPB 4BJ6A 4E15A 2BOVA 2BN4A 5BV2P 3H5NA 4KQ1A 5AVWA 4GXTA 2J08A 4CL3A 1JR3D 4EO4A 3TNJA 1GO2A 5J4LA 4ZQHA 1JG4A 1CDDA 4GM1A 2F2AB 4LRSB 3GJYA 1ZK3A 1XDBA 3TG8A 3ZV7A 4C4YA 4LF7B 4RJJA 3AUOA 4QJ4A 2DT8A 2Q3JA 1JFFB 3Q1KA 3KWFA 3L4BC 4MQ6A 2PX4A 5G1NA 5B4UA 1JDPA 1YS7A 3IPAA 2WA2A 2ZRDA 1OWPA 3TQSA 6PFKA 2VF2A 2PYIA 3HC7A 4N7JA 4J49A 1U0BB 4MGHA 2Z4SA 1E0KA 2XB2A 3BZUA 2BTQA 4X6YA 4YCCA 1X19A 3OSUA 1E4VA 4XWAA 3TFWA 4EVQA 3WFZA 4JVLA 3A11A 2PRIA 3ZWMA 1QTIA 2WIJA 3VU9A 1L4BA 3EGXA 4I1UA 4O4IB 2DLCX 4PGHA 4QDOA 2IIPA 1YZ3A 3CMCO 3WHIA 2PXXA 4QSMA 3JQAB 4S12A 4CJXA 1JEQB 1MVOA 5JQGA 3R9XB 5TF4A 2B8NA 2XMPA 1TM5E 3E2IA 3D6NB 5TGZA 4DM3A 1RP7A 4P3NA 4MFFA 4C0JA 3RFFA 5I51A 1E2DA 3K0BA 3GCGA 2X6TA 4JJ6A 1L4MA 1O9HA 2P9FA 2ZU6A 2BP7A 1M75A 4B85A 1FIUA 4BNTA 2GESA 1RXUA 1T1SA 3SFVA 3K6RA 1K9VF 4US8A 2W11A 4F04A 1Q0TA 1KAQA 3TX6A 2ZB3A 2GRAA 4OH1A 4PGYA 2RHJA 3PPYA 5GONB 1HX7A 3ZC3A 4N3CA 2H8KA 2DHCA 1H2WA 4YAFA 2BUAA 4J9SA 3PNOA 1IM5A 4J0KA 1RZRA 4UEQA 4D3SA 4GS5A 3U13A 5KOJA 1CEXA 2ZIUB 5C7YA 2C5EA 2LI6A 4M89A 2W2LD 4WK0B 2ZIGA 2IIBA 4WN9A 4V0LA 1P5RA 3CNBA 3T06B 5FLYA 2JIMA 3RC3A 1E6CA 1K06A 4ED8A 3EMBA 2UZ0A 1L4KA 1JYFA 5DNDA 1WY5A 3UENA 1E99A 2XPCA 4QUBA 5JH7F 3GBVA 2HQBA 4EUEA 2R8OA 3OZCA 2I7TA 1E0DA 2LZ0A 3I2JA 3EQ2A 2UUAB 1DS6A 3IAHA 5IM5A 1TUIA 4MLDA 1ZW1A 3V6MA 3KOOA 2YC2C 3I6QA 1ZJNA 4LBVA 3UXHA 1YTUA 3MPOA 4PHCA 4LHEA 2QD5A 1RKQA 4L4YA 2GS9A 1NVAA 2CWWA 5F1OA 4LF6B 4I2DA 1S4MA 1SIUA 2WJAA 4E13A 2CBXA 3DV2A 2ZRQA 1F5NA 2D62A 1G1AA 1T2NA 2XOKA 3AI1A 3ZDAA 2A9RA 2W2NA 2J87A 3D64A 3L7IA 4IO1A 5GIPE 5F77A 4XVRA 3TIFA 2NRWA 4BMPB 1YJ8A 3DOIA 4ZKDA 4YCXA 2AV6A 4D79A 9ICKA 3HV2A 2PKRA 3MA0A 1Z6ZA 1NSTA 2P0YA 2YXLA 5ALEA 3QPBA 4EFMA 1EHCA 4OHYA 5J2UA 3LZ6A 1NASA 3ANLA 2OBNA 1SUDA 5BQPA 5J2CA 3AZQA 2IHTA 1XLTC 4MQMA 2QBYA 4ZXPA 1UOOA 2GRJA 3DKRA 4R2LA 1VE9A 4J0QA 1VMKA 4CF6A 3E2PA 1S97A 4R81A 4Z0NA 4QL3A 5CCDA 1C8KA 2VJQA 4FVTA 4ED0A 1R37A 2AN1A 3BRCA 2GZ2A 3B8HA 4ZVLA 4RPYA 2DB3A 4CCYA 1E6UA 4RA9A 2B7CA 2OQVA 3TZLA 3JW8A 3G5UA 1XNGA 2JJYA 4NBKA 2OQ2A 3ROGA 4D6PA 2JFYA 1MFPA 1KO4A 4G63A 1D8LA 2K4HA 4QUGA 4CLEA 3NALA 3A3OA 1T91A 5AVYA 1Z2OX 3C2MA 3CURA 3CGWA 1XRNA 4AS2A 4MXDA 1GYQA 3VSDA 4O59O 4H4DA 4IGEA 3RTDA 1U2SA 4FGLA 3RVMA 2Q27A 3C1ZA 4F1WA 2B4RO 3F9RA 1Q17A 1F2UA 4MK4A 4MVXA 3GFQA 3GIJA 2CZCA 3CVJA 3SLRA 1G19A 3F98A 3AYZB 1VBMA 3KE8A 3T1NA 3Q8LA 1E5LA 3AIOA 1EFKA 1U3DA 4U6NA 3HL4A 2LNDA 3LHFA 2HXYA 4JGIA 2J3HA 5FX2A 5HNKA 2W98A 2EJTA 5CTJA 3JWEA 2RGYA 5HDQA 1YRWA 4I5GA 1NN0A 4GMDA 4AK9A 4JC4A 1XK7A 2VAWA 3ZCPA 1T9GR 4E09A 1KJZA 1L5YA 1VLLA 1ZAKA 1XTIA 4OQLA 1L3VA 1WCIB 5IJAA 3THWA 3UMBA 2B20A 3FNHA 2F4NA 2AGPA 4QLBA 1FJGB 4J9NA 1NC1A 4WWHA 3C3WA 1OXJA 1EM8B 1U90A 3RFUA 4QZAA 3IN5A 4GYJA 4DKXA 3HXLA 2DE0X 3JWPA 3GA5A 2ZSFA 4EMUA 3ZXXA 3RB8A 1T9HA 3WG9A 4GBGA 4ZO6A 1KQNA 3CH7A 1NLZA 2ZM6B 3BKWA 1MAWA 5M7EA 3W5IA 2B25A 1H2EA 1SC9A 3GL9A 1EP3B 1DGSA 1ZIYA 4URHA 2JH7A 3O9VA 1YRAA 4BOYA 4ECTA 1RBQA 1VHTA 3AQFA 1DIAA 3WZLA 3IUNA 3R5TA 1X3SA 1YXMA 2UVDA 5KG2A 1SWWA 1JR3E 3CF0A 4M9SA 1Z0KA 3BH6A 4W82A 2YFYA 4W5WA 4FYIA 1UR5A 3HP6A 2BAGA 3LK6A 4HKTA 2HWYA 2BCGY 3O4HA 3GQVA 3O03A 2O1SA 5AUPB 4YWHA 1RMQA 3K9FC 4B31A 2JJ1A 1UAAA 3T6KA 3BTVA 4C1BA 1D09A 1P91A 1H6BA 1DXOA 3B52X 3KHTA 4K2HA 1XDGA 1T9KA 3OZAA 2YZGA 4WZAB 2OM2A 3CX4A 3MMSA 4G5RA 2D7CA 2VCYA 4U2KA 2YJ5A 4ZQBA 4G25A 2QTCA 2CXYA 2JCGA 1XRQA 4B83A 2B1JA 4K9PA 2ZYHA 4WGFA 3QF7A 1TF2A 2BM1A 5CVDA 4J3NA 1JHAA 2ZBQA 2WU4A 3QVJA 1U4OA 4MNTA 4GI7A 3AHCA 5ESWA 5EMMA 1YA8A 3SIXA 3QSGA 1Z08A 4HDOB 1LJ8A 5J0YA 4BV2A 5B2FA 1DRWA 1NOMA 4QOSA 5I4CA 3H5RA 5EZ5A 3K2IA 3TOCA 4USAA 1N48A 4X41A 4ASUA 1IAQA 3IELA 3ZDDA 3DBVO 2QU8A 5HF6A 1N5LA 1ODCA 4Y9TA 1I2AA 3NH6A 3EZGA 4MV5A 5B2EA 4FN4A 3NHSA 2VQFB 4F56A 2EKZA 2OC9A 3QBTA 5JVDB 5HX7A 3G49A 4ZP1A 3LGSA 3N6VA 2CKDA 2FA9A 3HZZA 3AGQA 2IXGA 4CIWA 2V7GA 1O95A 2CNLA 2NACA 2PL9A 4MVJH 2QRPA 2QNRA 3ZZTA 3Q7PA 4G81A 2REQB 1YB4A 1PVDA 1YL5A 3FYHA 4P4LA 3CLHA 4RNOA 4QXQA 5CHGA 1QR2A 2DYKA 3GLIE 2C84A 3OEYA 3V8MA 1ZOIA 1UBSB 2XR1A 4WOKA 3CWZA 1RQNA 3C3KA 3MF4A 4XYEA 4MVJI 5GJVC 5J2TF 3JQ6A 5BNZA 2ZK7A 4I2CA 5HK9A 3EXIA 4KE7A 4ZTUB 3HM2A 1KYXA 4R6XA 2C54A 3DMPA 2LD4A 4URWR 1TIPA 2A9JA 4JEUA 1QDEA 2HDWA 1S1CA 5LIPA 3GC6A 4XVQA 4URVR 4KGVA 3ELYA 5KYWA 3KJGA 4F85A 2OXOA 4C43A 3VXKA 4NARA 4FNMA 4LBZA 4IP0A 1UT5A 4OYHA 2ZYSA 1H05A 2DUYA 1NJGA 3OCCA 1R4NB 3O4FA 4WOBA 4D41A 1ST3A 3RT7A 1QHXA 3GRRA 1JVBA 1JHOA 1E3IA 3WKCA 2J5QA 4Z9AA 3BCHA 1WL8A 1FTWA 3UMSA 1OU0A 1KOJA 3VPXA 3PL5A 1JEYA 1CSEE 1FEZA 2X1VA 2BBTA 1HE5A 3HVHA 1KSJA 3DE5X 3B2EA 5CJJA 4YJFA 3F74A 4FXOA 4I9GA 5DB9A 1T3NA 3RVNA 5DQGA 4CETA 3K71B 5BQFA 1KI8A 2QZ9A 2YWXA 4JJAA 5I3ZA 2XQGA 2WILA 5K0CA 4BAZA 2C4VA 3ILXA 4TKZA 2R1TB 4P81A 4DV5B 3FPEA 2JAPA 3WIVA 5JRTA 4HXYA 4AS3A 4MYHA 1POXA 1XKXA 1E1KA 1CV2A 3D81A 3RS8A 1N4AA 4IZ6A 2PRSA 3SZ3A 2O0JA 4A6EA 1SGWA 2Y2UA 2EBHX 5L1IA 3H4IA 3WLOA 8ICFA 2R11A 3AGPA 2AMFA 4NPCA 1QH8A 3HHPA 1N2GA 1G8SA 4IX1A 5F9NA 2A35A 2I0FA 4M8LA 4E6PA 3TTWA 3UCEA 1NUTA 2VDRB 5DDYA 5IDWA 2JH1A 1FUIA 1I4DD 4BNJA 3T5JA 4H1WA 5AW3A 1UBNA 5CFOA 4UAZA 3UV6A 3PDIA 2ZUCA 5L3QB 4KQFA 4E12A 4LOIA 1H0KA 3IDQA 4ZCMA 1II8A 3ZKWA 2BPGA 1U2QA 3LQQA 4AULA 2FOXA 2VPTA 2IU6A 4WXPA 3CM0A 2QF7A 1Y4DE 1ORVA 1J5EB 2H0AA 2IHYA 3QHAA 4CI0B 3T3MB 4ON9A 1LV7A 3TB4A 2KKPA 3CT6A 3V8EA 9MHTA 2XVTA 3NWJA 3RUHA 4D82A 3VVLA 3LP5A 5H83A 2ZQYA 2PV0A 2GZDA 1BMDA 1T6ZA 1GRRA 1RI3A 2B6NA 3CO0S 2EZXA 1JNYA 1J8QA 4KGDA 2IVZA 5HQ3A 3QU4A 5CIQA 1SBTA 3NM6B 4M60A 1LSOA 1W5AA 4JLDA 4BO0A 5LB2A 4J1TA 1U1EA 5ALYA 1IDN1 5JAMA 1EFRA 2AT1A 3UWSA 4D44A 4Y2SA 2NZ8A 5E6RB 1I30A 4H4CA 2V6GA 5DW0A 2YYAA 2ERCA 1HOXA 2PX6A 3H8MA 1SPXA 1H2FA 2X8BA 2RI6A 1G9SA 4XD7D 4OXQA 4TQUS 3HCDA 3KOXA 5AK4A 1PJ3A 1C4WA 4AMZA 4F4ZA 1Z7YA 2XT6A 3AUTA 2NUTA 5AH0A 1QHYA 2WE8A 1UXKA 5AVKA 2FH5B 4HV4A 1HL3A 2QGZA 4BZPA 2JEZA 3PY8A 5BORA 5FUVA 2FKAA 1SC4A 5ECDA 4GZMA 4LZLA 1OX4A 1ZIXA 1H0HA 1Q7RA 2ADOA 4D3ZA 3MFIA 5CRXA 1VBNA 3IEUA 2Q07A 3KVYA 2LDXA 4JLSA 3TXXA 3VO1A 1O9BA 4KWHA 4M87A 1DKUA 1GT6A 2BEWA 3RK0A 3Q9SA 3LP8A 2BM8A 3EQ9A 3C16C 1VXOA 1EMDA 3RHFA 2XO7A 1THGA 1KEKA 2OYCA 5AK3A 5I7VA 3ER6A 4MRRA 3FM9A 2PLNA 2ZR0A 4JP1A 2ENUA 4BJHB 1RXCA 5TVKA 3K09A 3TB6A 4PLZA 4YP5A 3Q8XB 2EW8A 1GGMA 3FHCB 4ARCA 4BGIA 1DWQA 1P1JA 4A0GA 4IG9A 4X84A 1Z2NX 4IS7A 4OMFG 1K08A 3NRBA 2QTLA 3DWGA 5LYJF 4FEEA 5HRUA 1XZGA 2J7PA 2QAGA 2FN9A 1KOGA 5E7QA 1DC4A 5EHGA 5THQA 4EI8A 1SVSA 2B0CA 3E70C 3VZCA 3MD0A 4EKGA 1PGPA 3N0TA 8ICIA 4AL4A 3M1IA 4UEOA 4DL9A 3U80A 1BGVA 1Z17A 5A03A 2C5LA 1DIGA 5K6AA 1GZ4A 3HGQA 4KWTA 4IL6U 4S1NA 4RYLA 3SXPA 3UHFA 4J3JA 2O59A 3H5WA 4F96A 2FN7A 1JFTA 1TTPB 3MNFA 1CI4A 5G02A 3DMNA 4MTLA 1T3LA 4Y2PA 3KHGA 5K01A 2Q5HA 3HJFA 1H5NA 1FX1A 1EFDN 4I4NA 4JEHA 3VU0A 2WHEA 2B2CA 4GYKA 4AJIA 1CNEA 1O97D 2ZBVA 1FVOA 5L4SA 2WAQC 3LY9A 3JQQA 1CR1A 4KBGA 3E22A 2OY0A 1ORWA 5AI8A 4XI9A 3A1DA 3FOEC 4Q4CA 2RGBA 3UH1A 2OK8A 2NU8A 2HF7A 1PR4A 4D4IA 4G3XA 1J0BA 1KEEA 3FW1A 2OGZA 4RF4A 1M1NA 1ZSNA 1K6JA 4ML3A 1RI4A 1WB6A 1RI5A 2DRIA 2FMHA 5BOMA 4BS9A 3GDXA 4PYRA 2QR2A 2PMBA 2D5IA 4U7CA 1G9TA 2R8ZA 3QY0A 1RYZA 4JI8B 5KMGB 3UHAA 2BZ0A 4WUTA 1DGJA 2VF4X 3K05A 4JQYA 3HRKA 4DB4A 4OLAA 2IZ6A 3E8SA 1A4XA 3EDQA 1XD2A 5IIKA 1QCKA 1O7JA 4AU1A 1BCRB 4ZZ1A 3EAGA 2HTFA 1U7TA 4I4TA 3TCXB 4F4FA 2ZZMA 3PVSA 1V71A 2R8JA 4KO1S 4HH1A 5ELMA 2HMTA 1LLUA 3ZZMA 2CHQA 2RHDA 1NVKA 5B3KA 4MEBA 1TIBA 2QVLA 4YP9A 2ILVA 2HO4A 1QVWA 3OQ6A 3IJRA 1N1MA 3M2TA 4B3SB 2YX8A 1QH1B 2WWFA 1N2JA 1NQVA 2V9PA 1P72A 2WWIA 3N8GA 4CM7A 1ZM9A 4YP7A 5ALVA 1W0KD 1NK9A 2CXNA 5LWHA 3W6ZA 1P5FA 3HX0A 4LDPA 4PGAA 4U9UA 3FGOA 2OAP1 1PFQA 3DDUA 5HKKA 4M0KA 3E4DA 5BQ3A 2NP6A 1D8YA 3U09A 5BN4B 2DKOA 2XUAA 1E89A 2JKZA 1T6NA 4DM7A 3K3PA 2EKLA 3VTFA 4BIMA 1YD7A 1PK7A 1J2MA 1ST2A 4FQ8A 1JECA 2BCRA 4I9UA 4FYYA 1WCNA 2CV0A 2JS7A 5FTKA 5JT1A 1H8HD 1ZR2A 4D6YA 1J8MF 5CTAA 3SIRA 4Z49A 2NTYC 3I04A 2P7IA 1Q1AA 2W2MA 1XSPA 3QMMA 1CF4A 4N39A 1IY0A 2CMFA 4FXPA 1QYDA 3GEDA 2ES4A 1O94A 2X19A 3SENA 1FIQA 2FLLA 3INRA 3IP3A 2FQQA 3TL2A 2C2EA 4FZLA 1TJ4A 5F64A 3WSWA 4I27A 4PGXA 3CUYA 2DPHA 3QVLA 2OCYC 4CT4B 2RG7A 3O90A 3HNRA 1M1YB 2X5NA 1ZETA 3G1WA 1AKYA 2IDJA 5BYKA 3OZBA 2ZB4A 3QVTA 4W8GA 1E1QA 3BWDD 2QPAA 2YV5A 2DGZA 2JG3A 4BNVA 3L6RA 3JZFA 4U7DA 3G0OA 2JK1A 3JYHA 3RQIA 4UTRA 4O2AF 1CYDA 2PUCA 5ITWA 4DEVA 5JS8A 1SKSA 1PJTA 4KN8A 5HGJA 5KPJA 3GPLA 5JXHA 5A3RA 2H7YA 2WNIA 1M33A 4EY5A 2WJ4A 2FMQA 5A5FA 1V3VA 3LX5A 2AH5A 4K0RA 1V25A 2IXBA 4RVHA 4HRXA 3ND6A 4MI9A 4FHZA 4G0NA 1PK9A 1JZSA 4N9WA 3EBLA 3BORA 3P0HA 3M6ZA 4HQLA 2ZIEA 4BO5A 2P8JA 3BULA 4BQNA 4HUQB 4YXWA 1MA3A 2UVPA 3DEZA 1FS6A 3NNDA 5J0PA 4LY3A 2ZIWB 4JSRA 1UMDB 3I9OA 4HDQB 2H6EA 2XMDA 5CDTA 4F8RA 1U5AA 1CXZA 2BKVA 2BFMA 1D9DA 4Y9SA 1YZTA 4E2WA 4IJMA 1DO2A 3D0RA 1KW4A 1RWWA 1WRBA 1JRPA 4R2XA 2HU7A 5D3QA 2Q6KA 1HFWA 3EIUA 4Q3KA 3LVFO 4U2GA 1Z2PX 3RUFA 3CE9A 4OJYA 2A1JA 4FYMA 1QWSA 5ALUA 1YJCA 5NLLA 3JYLA 3OF2A 2R3SA 2IEAA 2IW1A 2Q99A 2JLVA 4N1AA 1T0BA 2OCPA 1P0MA 5ULLA 3W77A 3E3OA 1IRIA 1JLLB 2Y1KA 1WMBA 1SVIA 7ADHA 1L5MA 4G9BA 4DCTA 5ALRA 2PY6A 4BP1A 4U2EA 5JNLA 2D1TA 3SAHA 5HFAA 1RYSA 2ZVPX 1V1RA 3G2HA 2YWHA 3P9XA 4JEIA 4ALMA 4C4OA 1CLUA 3UUWA 4Y7DA 4M83A 3OBBA 5IKOA 4ECSA 4IIDA 1L4GA 4EUFA 1CG6A 4J9VA 5EY5B 5BSUA 4A8PA 3Q5DA 3OC0A 4C7VA 4KIFA 4MVCA 4XFDA 1HSOA 3KE9A 4RAQA 4EUKA 5FFMA 4KQCA 5ENVA 4OGFA 5CFQA 1UC9A 2GN1A 3C29A 4I1VA 3QNWA 3KQVA 4KVGA 1E3EA 1SXJD 3PZRA 5CXQA 2OFXA 5M04A 1QVVA 3QF4A 3D2QA 4LXIA 3KZXA 3GLFA 1ZUHA 1SRQA 3WQBA 2IPLA 2EF1A 5BXYA 3IP9A 3JSAA 3TKYA 4MA0A 1QV6A 2QMQA 3TMYA 1QE3A 3MAGA 1SK9A 1QU3A 3UVEA 4E5YA 4II2A 3GJSA 3KYCB 4YAJA 4P35A 3LE8A 8ICCA 1OD6A 3HU3A 1EFVB 3ENVA 1UDWA 4Y9UA 1B6TA 3DKVA 3N8DA 5T4FA 3VDNB 1KY4A 3TBHA 2Q6TA 4CKWB 4I7EA 4XTRA 1IC6A 1TE2A 2AYZA 2O8DB 5JZBA 5CLLA 5EINA 1EDZA 2HV8A 1DEKA 5KI6A 4EUSA 1K5PA 1W2WB 1Q46A 4F8EA 1PRYA 2FMSA 4S05A 1AUOA 1ZMTA 3WYBA 4JI2B 1K68A 2AKEA 4O8CA 3IO5A 3FN4A 3F97A 4HDAA 2JLSA 1WMDA 1VJRA 1OCEA 1OW3B 3S1AA 1RKUA 5KG6A 4CKYA 5JHHB 1A7UA 4WIAA 2QJWA 1J8VA 4JAVC 2PO7A 3K0HA 2Z8YM 1FXWA 2PGXA 4WBNA 5JJBA 2KHVA 5WRFA 3NORA 3E0FA 3AU8A 3IA2A 5FBRB 4ED6A 3U3OA 4XGQA 3NATA 3PXUA 4INAA 4EEKA 1BOOA 5AUOB 2FLWA 1B8NA 2HJHA 3NGDA 1GL9B 1P0IA 5ELXA 1KFJB 4HI0E 3UWMA 3EYWA 1OW5A 5JCZA 1E7MA 1NW9B 3PENA 2JGNA 1CP2A 3KCNA 3TSZA 5T4BA 1QLHA 2ODQA 4HATA 1NBHA 5JJLA 4OOEA 2ONYA 3R8FA 1N92A 3OQNA 2SHKA 1F6WA 3KV3O 3AVWA 5KQLA 4F45A 5K0NA 2JGJA 2FSHA 1LDGA 3GMDA 1BH2A 2X7HA 2E9SA 1CQZA 5I01A 1JHYA 2W6MA 1T34A 2PL3A 2Q8NA 1W4CA 5JLAA 5H80A 4EM6A 1C9NA 3B89A 1AGYA 4TYQA 1KFBB 3DDHA 1Q44A 4L4ZA 4G2TA 5FBKA 1SC1A 1YQGA 4XM2A 3OE7A 2Y8EA 2PX3A 4OGLA 4PQYA 2KIVA 3R0QA 4R51A 2VR1A 2ZCUA 3PQEA 1U11A 3DO6A 5HE8A 3T7SA 2BGUA 3L0YA 3EC2A 3SXUB 1TKAA 4A8JA 5EWJA 4HF7A 3P9YA 9ICWA 4RKFA 3L8HA 5TQVA 2PUGA 1CUDA 4L73A 3OLQA 4XFKA 3GIMA 4S2EA 3F2DA 3L77A 1AQJA 4PX2A 1UFQA 1F1BA 3K20A 4DIUA 2HBLA 3DMRA 3JX9A 3USZA 1KBOA 3BILA 1TUBA 5K0FA 1OGYA 1DBQA 1WMFA 3UAZA 4TLLB 3MAJA 1GQYA 3GD7A 2XQIA 4X62B 3E03A 4ZTBA 3V9PA 4D4LA 3IHWA 3OZWA 4ARSA 3QP9A 4D4HA 1GQOA 2PFKA 1OLSB 4IFTA 4BFWA 4YJDA 4MWOA 5AI0A 1YL6A 5KQGA 3TNDA 4I55F 4IICA 3PFCA 5KX5B 2XUHA 2R6AA 4NXNB 2JFFA 5FV4A 2ZI6A 2ZJYA 3G13A 1U28C 4KPEC 3H9BA 4CMIA 2QR3A 3ZBUA 2R6DA 2H0QA 2PWAA 3WLHA 3GMTA 4JNKA 5C52B 4B3GA 1DK2A 2A59A 2DH5A 4BMYA 3VPDA 3NVKI 3OOEA 1FCJA 4KK4A 2O1XA 3DO8A 1RZVA 1SCKA 2I7XA 5A06A 3CRNA 1LLFA 5LP6A 4L72A 4IHJB 4AAYA 1N5DA 3I37X 2Z95A 1YJXA 1E6LA 4BP8A 3KHLA 4BEJA 2P40A 1SB3C 2WWVD 2JLYA 2AG0A 4ZDKA 1FPQA 1V45E 5AM2A 7ICSA 4ZI7A 2PWBA 4LWQA 3VR4D 1NMYA 3BQ2A 3GRUA 3MIIA 3QKUA 4H16A 4ETWA 3OCXA 2Y71A 1M7GA 1KJQA 3M8KA 4AY3A 3ZD6A 2WKQA 2I2XB 3PGVA 2A3VA 1QHFA 4WZZA 3V6KA 4MICA 1I4WA 3OIVA 4R98A 3RLFA 4JLAA 2FZEA 1XC9A 2H2AA 5KPDA 2QMYA 2G6BA 1BN6A 1W1WA 4Y1GA 4GM0A 2I9KA 3B0XA 2ZYRA 5J0QA 1P5HA 2W2KA 3SVLA 2YBEA 2ZM5A 1EHYA 1JPNA 8ICMA 1EBBA 4LIPD 4JLVA 1HEYA 3WMEA 2BFFB 4F5WA 5CK5A 3KKAA 3BJRA 3VSBA 1E3JA 2FSVA 1YR3A 3BCUA 5JD6A 5IIOA 3QPDA 1Q20A 3OOHA 3DGEC 4TL8A 3ORRA 1TOAA 2X8JA 2JGIA 4G97A 1QMPA 5A71A 4C2AA 4WW0A 4Q9AA 5FI5A 1KH3A 2WKSA 2HA4A 4KAJA 1HYEA 1KARA 1I3LA 2ACEA 4H1UA 1DCFA 3OPVA 3BMOA 1BEZA 5L8VA 2F7SA 2GLUA 1R4MA 4FKMA 3SYNA 1FA9A 2YZ2A 4RHYA 5CA1F 2ISPA 2F8KA 3ZH9B 1XCLA 4TYPA 1BYUA 4NCIA 1GT91 4FDLA 3P96A 2ID7A 1GOTA 3ZH2A 3M3DA 4KQ6A 1MABB 4WCDA 4H1HA 1TCVA 4Q02A 3B8EA 3BVPA 4HB0A 1FLNA 1HNZB 4IGAA 4ED3A 1RYBA 3BERA 3OIYA 3ONFA 3PUWA 2PX5A 3LW7A 4ARIA 2J9RA 1V8PA 1ADYA 1T5OA 4FB4A 2C4WA 1VP3A 1OJ7A 5DG7A 1CUEA 1CZUA 1LK7A 3U4GA 1RBMA 3S1LA 4JYBA 2QQGA 2FX2A 1GIAA 1IB6A 3R6LA 2AFHB 4ZYWA 5DO9A 5DBB