3L5KA

The crystal structure of human haloacid dehalogenase-like hydrolase domain containing 1a (hdhd1a)
Total Genus 75
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
75
sequence length
233
structure length
233
Chain Sequence
LYFQSMAAPPQPVTHLIFDMDGLLLDTERLYSVVFQEICNRYDKKYSWDVKSLVMGKKALEAAQIIIDVLQLPMSKEELVEESQTKLKEVFPTAALMPGAEKLIIHLRKHGIPFALATSSRSASFDMKTSRHKEFFSLFSHIVLGDDPEVQHGKPDPDIFLACAKRFSPPPAMEKCLVFEDAPNGVEAALAAGMQVVMVPDGNLSRDLTTKATLVLNSLQDFQPELFGLPSYE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The crystal structure of human Haloacid Dehalogenase-like Hydrolase Domain containing 1A (HDHD1A)
rcsb
source organism Homo sapiens
molecule tags Hydrolase
molecule keywords Haloacid dehalogenase-like hydrolase domain-containing prote
total genus 75
structure length 233
sequence length 233
ec nomenclature ec 3.1.3.96: Pseudouridine 5'-phosphatase.
pdb deposition date 2009-12-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13419 HAD_2 Haloacid dehalogenase-like hydrolase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.240 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 Putative phosphatase; domain 2 3l5kA02
3.40.50.1000 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold HAD superfamily/HAD-like 3l5kA01
4YGYA 1L6RA 3ONNA 4OCZA 4C4SA 2DQSA 2HEGA 3QLEA 3U7GA 1Q92A 1U02A 2I7DA 4YCLA 3AR4A 3R09A 4PNHA 4NFLA 3E58A 1SU4A 2D2VA 3SLRA 4UMVA 3WGVA 3UMGA 1CR6A 4BEVA 5ALZA 2I33A 3SMVA 4AS3A 3IRUA 4Y2YA 3NAMA 2OA0A 4BNDA 1K1EA 2CFRA 1XP5A 5AVQA 5ALRA 1TA0A 2YY6A 2I54A 4NAVA 3L8FA 3RF6A 4UMFA 3WKCA 2C9MA 5AK6A 1ZRNA 3WK7A 3L1UA 1VJ5A 5IT0A 4CNQA 2YJ6A 3NALA 5AW6A 1TJ4A 3L7YA 4UAUA 3L8GA 3W5BA 1YDFA 2WF6A 4QJBA 2CFTA 2YFYA 4XE5A 3WGUA 2YJ5A 3ZVMA 1YNSA 1Z4QA 5ALXA 3SHQA 1RQLA 4C4TA 4DW8A 1IWOA 2NYVA 2ZBDA 2VKQA 4YCNA 2ZOSA 5ALFA 2EATA 1Z4MA 5ALHA 3AR9A 1Z4LA 5AI6A 2FPUA 1LTQA 3QU4A 3OPXA 3P96A 3SF0A 2I6XA 2NO5A 4Y2PA 2PKEA 5AM0A 2FPSA 1S8OA 1U2TA 3WK8A 2FPRA 2FPXA 4L57A 3ESQA 2JAUA 2G09A 2CN1A 1T9ZA 1WR8A 2B82A 3PGVA 1FEZA 1WZCA 3L8EA 4HGPA 1JUDA 2HX1A 2W4MA 2CFSA 2HOQA 5AI5A 1VFPA 3L0CA 3QYPA 4EZEA 1Z4OA 5ALUA 4KX3A 4L6CA 3N07A 5AVVA 3N1UA 1QQ7A 3QU2A 3WK6A 1T5TA 1TE2A 5AVUA 3K1ZA 3F9RA 1QH9A 2ODAA 1MH9A 4NWIA 1RLMA 1Z4KA 5AK4A 2WF8A 5ALLA 3L1VA 4NV0A 1QQ5A 3N5KA 1NF2A 1T5SA 2HF7A 2YJ3A 5A3QA 4GXTA 1RMTA 2P69A 3UM9A 3WK9A 1ZS9A 2G80A 2YBDA 2B8EA 3AR2A 3PCTA 1VJRA 2R8EA 3WK4A 3SD7A 4QQFA 5AKKA 3AR6A 1AQ6A 3KDPA 3ET5A 1U7PA 2EAUA 4KNWA 4HGRA 3ZX4A 5AHXA 1Z4NA 4UW9A 3U13A 5AKJA 2WFAA 1RKVA 3QGMA 1RRCA 3MC1A 3L8HA 4OD0A 3E81A 3ZVNA 3NASA 3N28A 1L7OA 5AW4A 3NANA 4XPZA 3ZVLA 4H1WA 5AVTA 5AKHA 3U7EB 3TLMA 1U7OA 3OCWA 4Y2UA 4MWOA 2B1QA 5AKLA 3SKYA 4HGQA 2JGAA 5AI9A 2GHQA 4OFZA 1SWWA 3WKAA 2B1RA 1L7PA 3R9KA 3AR7A 1O08A 5E0OA 4BX0A 2O2XA 2AMYA 1NNLA 1U2SA 1Z4IA 5ALWA 5AM3A 5AKEA 3OCVA 2B0CA 2G07A 1ZD2P 3QU7A 3B8EA 2G0AA 2B8JA 5AVZA 3NUQA 3N8GA 2O9JA 2C8LA 5AM5A 4I9GA 3FPBA 1RKQA 2HSZA 1CQZA 3KD3A 4RETA 4EX6A 5ALVA 2GFHA 3QUTA 1KYTA 2HO4A 1XPJA 3QX7A 3QU5A 3I1YA 1YJ5A 1NRWA 4YIKA 1Z4PX 2ZG6A 4Y2JA 2ZBGA 3EF0A 3EPRA 3RFUA 2WHEA 3W5CA 3FM9A 3OCYA 2B30A 3ZTWA 5ALEA 4IG4A 2ZXEA 1WPGA 2P9JA 4CE6A 4JB3A 4CF3A 4J2TA 4C4RA 4KN8A 2PQ0A 3ZW7A 3KZXA 3QU9A 2R8ZA 2BY4A 3QNMA 5AKIA 3E84A 5AI0A 3CZ4A 4UM5A 3ZI4A 5AKZA 4YCMA 2HF2A 1L8LA 2JAWA 2ZBFA 2R8XA 1L7NA 1Z88A 3NIWA 4JDPA 3SKXA 2MU2A 3W5DA 3DDHA 5AKXA 4HAIA 4BX3A 3EWIA 2IYEA 3CNHA 4UU1A 5ALTA 1RPZA 5AVRA 3D6JA 1RC8A 3FGOA 4Y2TA 3BA6A 1Z5GA 5A3SA 5AW8A 5AW5A 4I9FA 3M9LA 4BEWA 4UATA 2OM6A 3OCUA 3MN1A 2FDRA 1RLOA 1ZJJA 2OBBA 1RKUA 1YMQA 3A1CA 3ZU6A 2FUCA 3ZWKA 1TJ5A 3R4CA 2G06A 4UAVA 3OTQA 1X42A 1PW5A 5AVXA 3U26A 5AICA 4DCCA 1L8OA 1RMYA 2RBKA 2YMQA 4MUMA 2MU1A 2C88A 5ALKA 4UARA 2Q5EA 4G9BA 3QXGA 4HYTA 4BBJA 3A1EA 4EEKA 4KX5A 3GYGA 4GIBA 2HCFA 4Y2XA 3BWVA 3DNPA 3UMCA 2IOFK 2QLTA 4EENA 2MSNA 2BDEA 2RARA 3NRJA 5AIBA 5AK5A 3S6JA 3ESRA 2WF5A 3U7FB 4EELA 3HYCA 3HLTA 2P27A 3WKEA 2I34A 4NABA 5T41A 3ZUPA 5ALQA 2G1AA 4ZEXA 1RDFA 2G08A 2X4DA 5AVSA 4RESA 1ZD4A 1L7MA 3AR8A 5IT4A 3J7TA 1J8DA 3ET4A 2GMWA 3WKBA 5ALMA 2EARA 3QUQA 3DV9A 2YMLA 4Y2SA 5ALIA 5FP0A 3OCZA 4L6AA 2HDOA 3KOOA 3DAOA 3ZX5A 3KC2A 5AM1A 4UM7A 3A1DA 4F72A 5AW3A 1SWVA 1XVIA 3ZWDA 4YIHA 2AGVA 2YJ4A 4CF5A 3PGLA 3I6BA 4IFTA 2QYHA 5AI8A 2ZBEA 3I28A 2FUEA 3AR5A 4UU0A 5AKGA 2FI1A 3FZQA 2NO4A 2IA5A 4ZEWA 5AVYA 3L0BA 3QUBA 2W43A 4HGOA 2PR7A 5ALNA 2WF9A 3MMZA 3OCXA 4FFDA 4HGNA 2HI0A 2YMMA 5ALPA 2R8YA 4B6JA 2Q4TA 2WF7A 2GHTA 3E8MA 4O8CA 1S2OA 1Q91A 2FEAA 2IOFA 2YN4A 3B9RA 4E88A 5AW9A 5AK3A 1YV9A 3W5AA 2W11A 2RB5A 2P11A 2JAOA 2C8KA 4DWOA 1Y8AA 4KYTA 5AW2A 1QQ6A 3ZTYA 1N8NA 4FYPA 1ZD3A 4J03A 2AUTA 4YH1A 5AM4A 4BKMA 5ALGA 4XQ0A 4UMDA 2BDUA 4EX7A 1RMQA 1WVIA 1J97A 2JARA 4Y3UA 4G63A 4XOUA 1N9KA 1QYIA 5AI4A 2I55A 1YS9A 5AW0A 1O03A 4AP9A 3M1YA 5AIAA 5ALDA 3IB6A 3B9BA 4Y2RA 2Q4RA 3U7HB 4CF4A 5ALOA 4UMEA 2OYCA 4KNVA 3KBBA 5AESA 1EK1A 2C4NA 2RAVA 4BNDB 3WKDA 3PDWA 5AM2A 1LVHA 1Z5UA 2IOHA 3L0YA 4UASA 1RLTA 1ZRMA 5ALYA 5ALSA 3FVVA 3VAYA 3WK5A 4FE3A 2HHLA 2GO7A 5ALJA 4AS2A 3A3YA 3FPSA 4OHFA 5JJBA 3AR3A 3IJ5A 2FPWA 3MPOA 1TJ3A 5AVWA 2WM8A 3I76A 5A3RA 3QUCA 4DFDA 5AW1A 1Z4JA 4BX2A 3ED5A 5IS2A 4BYGA 3L5KA 5AKYA 2AH5A 1ZOLA 1F5SA 3EF1A 4ZEVA 3U19A 1RQNA 3UMBA 1EK2A 4F71A 5AW7A 1ZD5A 2YMPA 4Y2VA 4Y2QA
chains in the Genus database with same CATH superfamily
4P8RA 1GSHA 3N2GA 1KMCA 4RK4A 1DBPA 4GW3A 2Z9DA 2KOBA 5CDUA 1N5MA 2EKPA 1LVGA 1UC8A 2WTEA 4ZH4A 4RHYA 1YNOA 1G7CA 3HCWA 3RT9A 2M9NA 4QSMA 1SKWA 1I8TA 4J1QA 2OCEA 1HWYA 1X1RA 3R6TA 5FL3A 4QM6A 3QPWA 4EOGA 1WE2A 2ZT8A 4MP3A 3D2SA 1G8SA 3RRJA 3PLNA 3LPAA 4HO1X 1G6OA 3QEMA 3WXBA 2PMBA 2VTEA 2Y1WA 2IPNA 3LWMA 3H17A 3LCMA 4EY8A 1FSZA 4EJSC 3Q8QB 4YECA 3W4IA 3EAFA 1QCDA 1HETA 1Z0AA 3GJ8A 4J0DA 3FSRA 4UEWA 2YY6A 4NLLA 4CUZA 2OFWA 4JJZA 5SICE 5E3HA 1DK3A 2WAYA 4O1HA 5AK6A 1C4KA 2IZOA 1PEDA 1F2UA 4NZPA 5CP8A 1Y3BE 3SSNA 3V9PA 4I4IA 1KEPA 4HATA 4C0HA 3RRFA 1WCIA 3LHIA 5CB1A 4B3TB 4P4TA 2AQ4A 4UAUA 1OWLA 2OQ2A 2JFPA 3G3EA 3IP3A 2VXCA 5JANA 1RZ3A 1AK9A 1FDSA 2CFTA 2G7MC 2IEAA 3B6IA 1T25A 4MVJG 3PXGA 8ICCA 1QPGA 4DQPA 1ZXBA 2NOAA 1NBAA 3OO1A 2HGZA 4X85A 1U0SY 3HW8A 4BV8A 2PGLA 4C6TB 2PXAA 2B5WA 1CY2A 2D7DA 3G1WA 1C81A 4RZQA 5EIAA 4A36A 2RMKA 2PUVA 2C61A 1QJ4A 3T0IA 4YN3A 2VJAA 5HM8A 2VR1A 3OBIA 3ED1A 1G5QA 1M1NA 4RIGA 3LDAA 3N39C 3CPSA 4QE3A 1GZ5A 1AK1A 1H42A 3GIWA 1S8OA 1CRWG 1J0XO 3SG0A 1F1JA 2B8NA 4EHKA 2ZU0C 3QQ5A 4L57A 4MEYA 4I19A 1KRHA 1IY2A 2CJWA 4HWKA 4U6SA 9MHTA 2ZXIA 1GQQA 2F43A 3HJBA 4B6PA 4DL9A 5G0TA 5TNXA 2QRGA 1ZQTA 4LTNA 3RG2A 2A1JB 3WSVA 3LPNA 1FEZA 4RO0A 4KLIA 2P4HX 2VJDA 2VF5X 2NSDA 3O91A 3SU8A 4S05A 4OQZA 3KXPA 4EUNA 2I76A 2EXXA 3E4CA 1LRLA 2ZRGA 2OD9A 1GUDA 3FPHA 1NW8A 3I37X 4JLBA 4OJYA 2IV2X 3UY4A 4BQOA 5AUPB 1H23A 2LPMA 3LVBA 3NG1A 1HRKA 4KX3A 1QDEA 4IGIA 1EXWA 4DLNA 3OZVA 3MWGA 5KFEA 4N5LA 1ZX1A 1IUNA 3NTUA 1BPDA 4ENSA 2H17A 2G9VA 3TI7A 4LYFA 1O97C 1CUIA 2ODAA 3GQBB 4K05A 4BGVA 4YRFA 1WCIB 1CG6A 2JCSA 4WOBA 2QROA 1QG4A 1K8ZB 2AFIE 2CE2X 4UUNA 2UZIR 3PFBA 4EQ6B 4JVLA 4P0QA 3I72A 1XU4A 2PX2A 3NMUF 2COKA 2V54A 3N5KA 3VYVA 5HR7A 1FXWF 2A5DA 3THXA 4ALNA 3HTXA 3NNNA 4BFSA 4PAOA 2H3ZA 4F93B 1PZHA 4RY9A 1ATZA 1EIZA 5E1OA 2A92A 1GADO 3H4MA 1AHPA 3K6SA 5CUQA 3UM9A 1T8PA 4FGSA 3TTWA 5H68A 1V7ZA 1XN1A 4QXMA 5JDIA 4OIFA 3IIKA 5E6UA 1WF6A 3R3YA 4C06A 4CXMA 2YHIA 3RSLA 3D5TA 3OF5A 1FYFA 2F2AB 3BJYA 5FNZA 3Q87B 5AXBA 3TQSA 3ZBQA 4MVJE 4N54A 4C2BA 1YQTA 2RKBA 3AZPA 2CK3D 4P4LA 3OPMA 3T35A 1FB5A 4JQYA 5I7VA 1W85A 4LYAA 5FKJA 5KC8A 2RDJA 1L5VA 1NRIA 1T35A 2RBGA 1M2VB 3QGMA 4R2WA 1HOTA 1NATA 3TQIA 3JVUA 4Z4FA 2FVXA 1ZQRA 4A0SA 1TZMA 3RNLA 3VR0A 2FJ0A 3L3FX 1Z47A 4AQ7A 1XLUA 3JZDA 4MCHA 5FPSA 1SXEA 4EKNB 4ALMA 5E9WA 2H4HA 2AB0A 4PGHA 1L7OA 4B79A 5DPMA 4OM8A 4KC0A 2O23A 1BAPA 2I62A 3B9JA 3I4CA 3GJQA 2WVAA 3LW8A 4MI1A 2CNOA 3CCFA 2V7EA 3H9BA 4L8GA 3SZOA 4GC6A 3UH1A 2C3MA 2XUZA 2GPNA 3F2IA 4A1OA 2IUSA 4F4DA 1QE5A 4NCXA 3UWMA 4IGAA 4ZQGA 1CVIA 3WRYC 1HE3A 4E4RA 3TKLA 1CNMA 4OFZA 4AB1A 1GQ2A 1QRRA 1PT8A 2YVLA 2XT6A 1GV1A 5FPKA 4LXHA 2J6BA 3DZKA 3E7WA 3KTDA 4OVKA 3OX3A 4EUSA 2AMYA 4W9NA 5KFCA 4O4HF 1Y3CE 1R6DA 4U8GA 5ALWA 1OI3A 3N58A 2XMSA 5CNMA 1OFGA 3T5GA 5AM3A 1EGVB 5A03A 5JTTA 3COWA 2J59A 3OCVA 1SU8A 5KFDA 1J0AA 1EB9A 1RWPA 3DW1X 3LUPA 3KYCB 3S81A 3FPCA 2JG3A 1ZN8A 3ESCA 4WLUA 4PZUA 3ELBA 3IUPA 5GGXA 1V5GA 1DS6A 2H3FA 3N9IA 3OZIA 4A16A 1EVYA 1KI6B 3WBBA 1JPUA 1KAEA 2EC5A 5BWOA 3VHXB 2O9JA 2Y1JA 3GAZA 3I09A 3P97A 4HN9A 3V5NA 3EWNA 4W4TA 1XQ6A 2I03A 3PXCX 4EPRA 4MGKR 3KD3A 3R7SA 2Z98A 5LR6A 3ZHZA 4AVYA 2ATLA 3BIWA 1BD3A 5JROA 2ZEJA 4PZYA 3QUTA 4QGHA 3H8WA 2HO4A 6Q21A 4F38A 1MJ5A 3I1YA 2W9AA 4MWCA 4EMTA 2PQ6A 1DI0A 2FSVA 3E5RA 3TRDA 3WB1A 1Q5PA 3UQYS 1ZIXA 4D57A 4DTCA 2QN7A 5B7PA 3VO1A 4MR9B 4RNCA 3HV0A 4LV6A 5ALEA 3WAKA 3NM4A 4AF8A 2UZ0A 1JFFA 5J3JA 1WPGA 1R8QA 3GL9A 5CX1A 1KHHA 4RGBA 3ULKA 2OXCA 1XLWA 3BXZA 2VP4A 5AWFC 2EYUA 3K5WA 4BBJA 3SAGA 2J87A 4FTWA 1F9EA 1OFUX 3MERA 4RMHA 5GVRA 5LQSA 2UVVA 2YNMA 4II2A 4ZCSA 3M7IA 1OVMA 4C89A 3GZTB 4MAAA 2IU4A 2XQFA 3MCZA 5ELXA 4MHVA 3M6LA 1LLQA 1U31A 4R69A 3NIWA 3T5PA 3V6KA 2RSLA 3SKXA 2ZJ1A 2UUBB 2VUUA 1NAIA 5ETJA 4ZVVA 1DIAA 1KH1A 4EYOA 4RQBA 4Y98A 2W8LA 3R5FA 2FEKA 3LQRA 4HGYA 4LXIA 4O33A 1BDIA 1NW4A 1ZFNA 2NXEA 4MKXA 1ULUA 4EM6A 3MTGA 2RAUA 3EZGA 4ZOQI 3CRMA 5AFSA 1DBSA 1I0ZA 3QQPA 4K81B 4BGEA 2ZTSA 3G5TA 4L4YA 2J7PA 1EFAA 1WXXA 3HEMA 4JUIA 5FPTA 4EW6A 1MJFA 2MUTA 4USAA 3P0FA 3QM1A 2KG5A 4FFSA 3BA1A 2GD6A 1NLFA 5J2TA 4NL4H 4GLXA 1LTKA 4DSZA 3GUVA 1RKUA 2EJVA 2HA3A 4LFAB 5DBCA 4ZVNA 4GZ6A 4TTTS 1DWOA 2ZDGA 2DPIA 1P1IA 4OJLA 3LRXA 5LYJA 3GCWA 2AW5A 4CZ2A 3H5AA 4Q4AB 2R7LA 3OVMA 4TUYB 1HOXA 1AKUA 1YB4A 2L0XA 4DIUA 3PXXA 3JYPA 3F5FA 3PRJA 4BZPA 4NBUA 3WL3A 3FYUC 2J31A 4ESVA 4CEIA 1DU4A 1CUEA 3GCDA 4EB6A 1U04A 1W2HA 3BDVA 4RJ2A 3REQA 1EFRD 1T8RA 1PDWA 4HNAA 3BAZA 1P1KA 4J0KA 4P7JA 3LVRE 2OUKA 3MJRA 3OJLA 4PFKA 2QM3A 5A1JA 3O93A 1JEAA 4NC9A 3BAFA 4DE5A 3QXGA 4YK7A 3PVXA 2ZZMA 1M1YA 2PVSA 5HE9A 2H2FA 1WHTB 3FUUA 3EZNA 3LUCA 4Q7QA 4ZI7F 1Y5NA 2XD9A 2ACVA 1COZA 1THTA 4INJA 3TTVA 1ONOA 2JLWA 4RGYA 4J3FA 4DXAA 5CH3A 1E9AA 4FN4A 3HSKA 2AN9A 4JENA 2BCUA 4P82A 2J3MA 3GIMA 2WW8A 2WZBA 1N1MA 3Q6MA 3PRKE 4PHGA 4IWNA 1XCPA 3UV3A 1HTBA 1BCRA 2O7SA 2UV8A 4WNCA 3WQQA 4AZ3A 4C21A 3LECA 5CT9A 2KS6A 2CDBA 2OE2A 1YZKA 4HWPA 4EKGA 5FH9A 4DSFA 1TF7A 2CLEB 2XQJA 3Q1KA 3H0KA 2I2CA 4TS4A 2J41A 1FDOA 3P9KA 2MAXA 4NABA 1QAMA 3K94A 5DWDA 2XO7A 2DUYA 4A7PA 1JDUA 3BSWA 1M83A 2JFHA 1C7FA 1A9ZA 4ENWA 1ESDA 2V6IA 1TD1A 3GQVA 1WP9A 1KF0A 4M0PA 4P54A 5DGTA 2YJZA 3CBQA 1ZQNA 3SX2A 2QLNA 2HAEA 3RU2A 1L7MA 3PNVA 1YH3A 5JAQA 1QHIA 3QPBA 4KACA 3SHOA 3EDQA 1GZUA 4C7KA 1OB5A 2FG5A 1CJKC 2ZS9A 2EARA 3QUQA 4D9KA 4F8RA 3COPA 2AYXA 3JQ9C 3LL7A 4AJKA 2IXAA 1HBJA 3BDIA 3ESBA 5LQJA 3WQBA 1DJOA 1N5OX 1W581 1GVNB 2QQFA 5B66U 4FHGA 4M7WA 4X8HA 3RUCA 2YZ2A 1K6EA 3JSXA 4UTPA 5H4GA 2W2TA 4MQMA 5KFJA 1Q15A 4PG4A 5C5DA 3HA3A 4O5KA 3WA7A 5L95A 1XRPA 3LWBA 5J0YA 3G8CA 1BROA 1U9IA 1UUFA 2AQ8A 2HQSA 3HN2A 3BD6A 2YN2A 3WA6A 3W5JA 4YIHA 2DB3A 4GBED 3ZHTA 2C7PA 5JI2E 1XA3A 1X40A 4JLPA 3UHAA 4QELA 4C76A 1L5HA 2F8SA 2FFAA 2KNJA 2HK6A 4IHAA 4KQEA 1GPLA 1CQJA 3H5IA 3SE0A 2ZTHA 3AEYA 3WRWA 3C5CA 5FV4A 3G7NA 4CV3A 2BJVA 3AZOA 1Y6QA 4IZHA 3PVZA 5K0SA 7ICVA 2NO4A 1I3NA 1C7IA 4RH3A 3RANA 3C5FA 1NU6A 1U48A 3SI8A 3H6GA 1NJ2A 3PKZA 4GG1A 1F20A 1XWLA 5D3MB 3OAAD 3V7KA 4LE1A 2ZYSA 2VT6A 1YHZA 3EGEA 3L7AA 4RMIA 4OH1A 1HFKA 4CTOA 1DCFA 1ZQVA 1G8PA 3FZYA 1T1EA 2XQGA 3LXUX 2C4VA 2YYZA 3JQFA 4UB3A 4MUGA 5KFFA 4BV9A 1ZQEA 4QGSA 4XDGA 4BIMA 5H81A 3IT3A 1G3IA 1BTOA 4ZO9A 4WJ3B 1GPNA 5A62A 1ZQZA 3FBWA 1T3HA 1WIWA 3QMMA 5E7IA 1OH5A 5EJGA 2I99A 4E88A 4YP6A 4W6QA 5AK3A 5IDQA 4YP1A 1NDUA 1L0BA 5COBA 5F3DA 2JEFA 3GJZA 2C2YA 3TZ6A 3CPHA 2XCPA 1B4DA 1FUEA 3QEAZ 2V4MA 4DNFA 3TXXA 5AW2A 5KTYA 1JSLA 3GPCA 4DS3A 1H3EA 3WNDA 1N8NA 1NVWQ 4PIMA 2HR1A 1T3TA 4CM7A 4HAXA 4YCAA 3BJZA 4B87A 1JIHA 4Q6WA 2V4ZA 3WMGA 3LG2A 3LSYA 1I3OA 4MYRA 4E7OA 1FQKA 4TYPA 5A4KA 4BKMA 1G4HA 4JEMA 1D6SA 3DT9A 4O5CA 4P92A 3TZHA 3RR7A 4G0XA 3R6WA 4EW2A 3K8QA 4FMDF 4UAGA 4NL9A 5EMHA 4ZV7A 3X1MA 2HWKA 1K4YA 3K70D 5LD2B 1M2OA 4MLDA 2HKIA 4HUTA 5FDFA 5KG2A 3D3WB 3QKSB 3TLCA 4YRJA 4AJ2A 5AI4A 1E7QA 1W47A 1TYCA 1RM3A 1G5PA 1A7JA 1X9MA 2EG9A 1FX1A 1KC1A 4MMXB 2OQVA 1LPSA 1G4AE 2WA1A 2WDZA 2WHYA 4OKSA 1RJ9A 3AEXA 1OUMA 3I5AA 3MR3A 1FVOA 4JVMA 4UMEA 5JZMA 4EBFA 3DP9A 2QVYX 1FRZA 1CV2A 2EERA 2J0EA 3FGNA 4EK9A 1P45A 3ENWA 5JRDS 2W7PA 3RI3A 5GQSA 5TPWB 5BW5A 3ZBTA 1YZ7A 4B31A 1ZQMA 1S9DA 5JZ9A 3DOHA 3UG7A 2KFZA 2ZRLA 1UPHA 1FS4A 2BZ0A 3RC9A 3WFJA 3EISA 1JECA 1YAJA 3JQ7B 3TZCA 3BMCA 4HDNA 5CLHA 4MGYR 2IYPA 3AI7A 2HY7A 4HNUA 4D2IA 1YVPA 3C29A 1MTOA 3EIUA 2A86A 4IDCA 2Z3WA 1Y33E 4C8NA 1EM8A 2AUNA 2OZEA 4L5YA 3W8NA 3WWZA 1TI7A 2W6MA 3NW9A 3TACB 1H6AA 1PL7A 2IRWA 1WY5A 3MILA 3PTZA 1DV2A 5J5CA 4DMLA 4G67A 1VLVA 1ZA2A 4U7CA 3R8FA 1E2BA 4AJNA 3EXG2 3G1UA 4EHBA 3EGCA 1IHOA 3EF1A 2XTJA 1VRCA 4LWQA 1KBUA 3OZWA 3P9QA 4WA8A 4DREA 2YWJA 3F2BA 1NIJA 1DKQA 3GD5A 2VWHA 4I2GA 3I6QA 3NWJA 4I5EA 4LDRA 5JWHA 3JAWA 2PL1A 4WD3A 2AVNA 2V7PA 3FRJA 1FMJA 5J2TB 1N77A 2ZXUA 3J7AC 1YVDA 2VTBB 2CJWB 1N1GA 1ZLYA 4FHZA 2ZRNA 3ONNA 1KWKA 1L4YA 3PX7A 2OWEA 2PYDA 1A5TA 5JJCA 1FDIA 3UJ3X 1NDQA 1X13A 2I7DA 3UA3A 3MJ4A 3KSMA 5DBHX 5CA0B 1R0RE 5CVTA 4ZALA 4TWAA 3QXCA 2FOXA 8ICBA 1SH7A 4PRLA 3AVYA 1W5AA 2RJNA 2CYAA 1UZMA 2OAGA 4PNHA 5AVOA 4K8OA 3GPDG 1AGXA 3BE6A 2D2VA 3CLSC 4JVSB 4MI6A 4TV8F 1Z8FA 3T3NA 1WD7A 1P9LA 5EP4A 4BMOB 3PQ2A 1QKKA 3FNQA 3D0RA 3UXPA 5B3JA 5BORA 5F9LA 4PGXA 1AO3A 1YKSA 2GNOA 5DB6A 1SUWA 2XCQA 3IX7A 4O4JF 4FLEA 3GLFA 2PKQP 1SN7A 4UOZA 1RWKA 2Q5IA 3WWOA 1DX4A 1XJQA 3A1VA 1IYZA 2SHKA 1EVJA 2XD4A 1NQWA 1VG0B 1YACA 2VUTA 3FH0A 4M6WB 2I22A 5EXEA 3N7TA 5AVQA 1F5NA 1WXQA 2Y99A 1XZMA 1U8EA 4CQMB 2NLOA 4V1CA 1HQYE 3EUB2 1YTLA 2I2FA 3I9NA 4IHQA 4AT1A 3KV3O 2AKEA 5JSZA 1ZMBA 3OGUA 2WICA 2CVQA 2OCPA 3EOAI 1PZGA 1FTWA 3PSHA 1JL3A 2ZPAA 3AX6A 1B0UA 4CWAA 1JG6A 2WKRA 3ZW9A 4G0QA 4F9TA 2IEZA 4CNQA 2LVBA 3ENZA 3R5JA 3M5PA 2QR5A 2BCQA 4JSTA 4AJ1A 3D7LA 3RHFA 1M66A 3L8GA 2B37A 2JIMA 1S0VA 1PK3A 2JGDA 3NNSA 4A0FA 2HO5A 4DADA 3GIJA 1G1AA 4TMZA 2JEGA 4FIDA 1R0WA 4LRWA 4D9HA 1O4WA 3C8ZA 1TUBA 2PZ8A 2QRQA 3K9WA 4NBWA 4CR7A 5DISB 1YB2A 4HEJA 2P9ZA 4LX8A 4B9LA 1U8XX 4MVJF 2C20A 2XAAA 3LBIA 3UANA 2V5VA 3A9SA 3PV8A 3MGGA 1PR1A 2DHEA 1PFWA 1ODSA 2P2CA 2R1VB 3OX2A 1NK7A 3MFIA 3DZHA 3L06A 3T7EA 3O8QA 1D4FA 2CWDA 5FNVA 2N3ZA 2GA8A 2IZ5A 2UZ4A 4JXXA 2QGNA 2GZMA 3CNQS 3TUJC 1P81A 5L1KA 3PNOA 2XPCA 5FI3A 2JH9A 2GETA 2AG1A 3HDGA 4ASUD 5I7RA 2FZGA 1XDWA 2QM7A 1G20B 2WJIA 4GNRA 1VDMA 5FTJA 5JECA 2OLKA 2P9FA 2V03A 1T9HA 3HP6A 1PJBA 2PTHA 4PLPA 4F5YA 1C9YA 1EE2A 4QHSA 5EXPA 3K9FC 3IR7A 3TDMA 2GBCA 4B7XA 4NYIR 3KLNA 3B2QA 4JJEA 1P5FA 1RBYA 3OLYA 4I5DA 4WZ6A 3EDCA 2JKVA 2Q8PA 4RT3A 1S8NA 3PQFA 4D9FA 3DMDA 5KNCH 1YR6A 4QU0A 1Z0DA 1BMFA 1ZM9A 3B2NA 3KR9A 4D6XA 2XRZA 4GH5A 5KFNA 2JJ8A 4WN9A 4NEGA 4RPGA 3ZHOA 2IYUA 1LDNA 9ICUA 3N1UA 5EEHA 2ZW9A 5BT9A 4FW8A 2YINC 2N1RA 3KQPA 3K1ZA 3M9MB 2R7AA 1KFBB 3L3BA 5C4MA 2NRZA 1VIMA 2LCQA 4E2FA 3DONA 2O2ZA 4TT3A 4BUJA 4DIDA 1Q21A 1G6KA 5BV8A 5LXTB 3E5MA 3WMWA 4DMMA 4E1VA 2E48A 1N48A 4R65A 1E6EA 3DE7X 4R4JA 5F12A 1CDOA 8ICMA 2KSOA 4MRAA 2QI9F 5E79U 1FNBA 4ZEMA 1DP4A 1JF8A 4WTOA 5CIQA 2FMKA 4FZJA 4OK5A 4BFCA 1UWCA 1SIBE 4TRJA 2BAGA 4Z99A 3V1LA 3SC2A 1VIAA 4JLOA 1HT0A 1J2TA 3GT0A 4ED8A 2UAGA 1ZS9A 3BL5A 4EMSA 3PCTA 4QLOA 2CD7A 4JBGA 5M7EA 4GYKA 5E38A 1IBSA 1RD4A 5EE5B 4A5OA 4YAGA 5EZ5A 4BNKA 2W2OA 3SE7A 3WIUA 4DBVO 3KTFA 2EANA 1R0ZA 2EAUA 4CG3A 2ZJ5A 4DJJA 1BCSA 2JLRA 1JFFB 3IYLW 4BKPA 2GFIA 4AXXA 2WU0A 5KUTA 2AVDA 1BGVA 4L0DA 3HM9A 4ID3A 5KTKA 3NGDA 1OIWA 4KPGA 3JYLA 1KS2A 3FNEA 3B8HA 2VTVA 5B1IA 4RIHA 3D6HA 2P2SA 4I1OA 4FFPA 3KOMA 3CURA 2X4IA 1C9KA 1FQJA 2X13A 3SFTA 1YA6A 4ARUA 2Z6QA 1OR8A 2ODBA 2BCGY 3H9QA 4PZ9A 3S2SA 4KWHA 3C21A 4R71A 1LJ8A 5KAIU 2UYGA 4FYXA 4LKRA 3WC4A 1OAKA 3IP8A 4Y1EA 4FCWA 1HURA 4E2WA 1PEKE 5AVTA 5AKHA 2H2HA 2KVCA 2Q2OA 3DL0A 1MORA 3OEHA 4RHUA 2XHZA 3W8FA 5IKPA 5L53A 1M8GA 2OG2A 2O2DA 4OYHA 3T9FA 2CT8A 1ZYQA 2CV2A 2AMJA 1Z6XA 3C1TA 5FORA 3SKYA 1HDRA 2GEFA 4R2HA 1V1RA 1C80A 2E4WA 2R5FA 3FB1A 2D6FA 3U5ZB 4RPZA 3PR5B 1OTHA 2PRKA 2ZUVA 4J0QA 3VGPA 4RY0A 2UVPA 2QU7A 2VCHA 3KALA 5E9QA 5JS2A 3W2TA 3BVPA 4IMIB 4RZXA 2E82A 4CCAA 4J9RA 1MG5A 3CF4G 4Q4JB 3LPLA 1U2SA 3RYHB 2ZRDA 1R8XA 2JH1A 3VR2A 2E5FA 3G8YA 4FDVA 3ZE0B 4DQXA 4Y1RB 4QXQA 4TV9F 2E8NA 1UK7A 2ARKA 3KO8A 4AY6A 4AWXA 2QP3A 2ZI6A 3C2QA 5ADUS 2WNSA 2JGFA 2QLFA 1JSXA 2J0UB 2PRZA 2M0NA 3GEHA 3ZJTA 4CKBB 4WZAB 2PZAA 3FBGA 2G9RA 4TTIA 3NUQA 3NYWA 4M1YA 5ENZA 3IOEA 3TOVA 4ZMBA 2A8YA 3D0OA 5J4HA 5AM5A 1DPGA 3N75A 3FY4A 1M5UA 4ZTBA 2ZZKA 2YRWA 4QYSA 5FFNA 2VC2B 4WKBA 5BP7A 1Z16A 3AU9A 2BPFA 2GFHA 4RPHA 3IKTA 3NVAA 4OSOA 3K1JA 1R74A 1TO1E 3PUXA 2IU6A 1HTTA 2Z57A 2YY5A 5LBUA 4AP5A 3U62A 4LVNA 4CIYA 5EZ6B 3H2YA 1GZDA 4MVJM 2UYCA 5HGJA 4KRFA 2WU4A 3X2SA 3IJEB 3RM3A 2QVCA 3ESYA 3E0XA 3EF0A 4JUCA 4W5JA 5ULLA 5JOQA 2BGGA 3KTAA 2G88A 2NU7A 4NJEA 1QYWA 5HJ5A 4LK2A 3T1TA 4BVLA 5KFYA 1FTSA 3ETDA 3KKQA 5B7QA 1HE1C 4JU8A 4OJ6A 1IJKA 1RWMA 3ELDA 4JLAA 4L3OA 1P7WA 4JI6B 3ZIUA 4DCGA 3WMEA 4YY3B 5JALA 3PEVA 1JN3A 1E9BA 2B98A 1PJ2A 3DNFA 3OQHA 4ZD6A 5LDGA 4BZWA 3FW1A 3NRBA 3R7DA 2Z1NA 2B1JA 3SV4A 1GPAA 1LWOA 2PQ0A 3HADA 4XJXA 3R74A 4Y0AA 5CA1F 1VPDA 2ZTUA 4QBTA 5DM0A 1THZA 2CD9A 5KKAA 3ZKWB 1R0YA 3QNMA 1VIDA 2FQXA 3D2CA 4NCHA 4BO6A 4E6PA 3TEMA 5AKZA 1MG0A 4YCMA 2Y0PA 1WB9A 1T4GA 3L0PA 1R6XA 1TECE 3IBFA 2B8TA 3VPGA 1MX3A 2HJVA 1E7WA 2DFPA 4BB6A 2G1JA 2IH5A 4BX3A 4Q9NA 2XJ4A 2D59A 1GM5A 4CCSA 5KPJA 3MK31 3AY6A 4S0ZA 4JI5B 2WSSA 1HGXA 4KR0A 5CA1A 4Y2TA 2QNIA 1NWCA 3OPYA 2H3EA 3CGGA 3ZH2A 2VEDA 2QB1A 4XM2A 4UBMA 3EH1A 3EIEA 5LP1A 3IAM6 4PX3A 3TQFA 4BEWA 1CQXA 1DUVG 4BLOA 4D3FA 1ZISA 5J1TB 4M98A 4MKGA 1EZ4A 1PD1A 1J1UA 3OJXA 4FKBA 1T5OA 4HH1A 1QAOA 1B6GA 5HM6A 2PBFA 4AMBA 2LIPA 1LY1A 4O3QA 2XMGA 1HF3A 2Z1MA 3Q5GA 5EWLB 4RD1A 5EERA 3VPFA 3T94A 4M47A 5JS8A 2J5RA 4MGZR 3EODA 4JZYA 5DIZA 3IAXA 3PITA 3R3XA 2JJ2A 4MEJA 2XXAB 2D8AA 2NTEA 4N3BA 1KL7A 1IAQA 2SKDA 4MW0A 4IWYA 1PSZA 4COOA 3KCNA 4G9BA 4C8OA 1UBCA 4XCXA 5K4LA 1E3QA 3NHBA 1RPJA 2DHCA 4HYTA 4J29A 2HXGA 2V6MA 3EA0A 3E3AA 4IIYA 4IIJA 1H9BA 4K1XA 2VQEB 1FJXA 4KLDA 4RA6B 5BSGA 1O1YA 1T4CA 2WUFA 3T3OA 1NUUA 2VNIA 1IXRC 1C9DB 3BSSA 2QMZA 1SXQA 1EJ6A 3KP1A 4NNPA 1CEXA 4QNMA 2GD0A 4Q7MB 4D4LA 1PJAA 3E53A 1LPPA 1GTZA 3GILA 2QD4A 2YL2A 4DOAA 3EULA 1EHCA 3NIGB 1Q6YA 2XMQA 4QODA 2EX0A 2BPGA 2QE7D 3BDAA 2CL5A 1FDUA 3A3NA 1Z33A 2PD4A 1TZ2A 2GM4A 1W8DA 3FJOA 1HK7A 2HBLA 4M9SA 4BPBA 2C82A 5KX5F 1CIVA 1F3OA 1B26A 3BS5B 5F2NA 2J9XB 8ICUA 1GTJ1 4MULA 3H5LA 1OU0A 5JATA 2X4DA 3DEEA 2OO5C 5CEHA 3V6LA 3BILA 4MMZB 1WQ4A 4C0QC 5HXAA 1FRFS 3BOSA 3PNYA 4ZVOA 2ZTMA 4FX5A 3ROTA 3ET4A 1XD2A 2XZTA 4Y9SA 1JHPA 3ND8A 5FP0A 3T3GA 3AIOA 4Z7OB 3KOOA 2BBWA 3R3ZA 2XXJA 5B36A 3EMDA 1UXHA 2DPJA 1YVEI 2YXEA 1CI4A 3ESXA 3D4NA 1QSLA 4UDNA 4B44A 3JQAD 5K3EA 5KQGA 1SWVA 2EH9A 2LKDA 2FJ6A 2OWOA 4H7HA 2XCAA 4QOIA 1HE8B 4RK6A 3D7NA 4XGIA 3PS9A 521PA 3CWQA 3ZD6A 4K28A 4HG2A 2ORYA 3GRZA 4OHWA 2ZSBA 4XYLA 4FI3F 3I28A 4MICA 3ISBA 5B58C 3SXUA 1UDWA 4NQRA 1J6UA 1GPDG 3GHYA 3M6AA 1DGJA 4R64A 1OXVA 1SGWA 2PKYX 3RVOA 2GBFA 2EKBA 3GLQA 4XYEA 1AV6A 3SYZA 1B16A 2O4UX 5LWQA 3TJRA 1VMEA 3HR7A 3I53A 4GWGA 1QH8B 3B78A 3EHEA 3F8WA 4CKEB 2HB6A 1LRJA 2I6TA 2K4MA 1JPVA 3NP9A 2BFWA 1R4MA 4DEXA 1GUBA 2GOYA 1RQRA 1XJWA 4LRTB 3RKSA 1V96A 3NDBB 1I7QB 2WAQF 3AL0C 5AUQA 4EI7A 4KLSA 2ZM5A 2KMDA 2IY9A 4Q66C 1SAYA 1YWGO 1W73A 2ONCA 5CVCA 1NSFA 2GHTA 3GY0A 3O0FA 3LNTA 3DD5A 1FFVA 1S2OA 3TW6A 4UTRA 1EXDA 3RRHA 4MK4A 3WYNA 2AF3C 1ZNWA 4K1LA 3T9CA 1IPEA 4D9JA 4MI3A 1W1IA 3ADDA 4HFJA 1YV9A 2VJMA 4GBJA 3HH8A 3NETA 5CFQA 3MT7A 1ZL2A 5I4CA 4IJ5A 2B4RO 5IU6A 4FOOA 1S97A 4PLTA 1K5OA 2WYVA 2C8KA 2ZJOA 4PNPA 4WNAA 2W6JA 3ICWA 3M81A 4RMNA 2HK9A 4K6HA 4RQTA 4URWR 4QJ4A 1Z5WA 2W98A 3K73O 3ZTYA 1FNSA 1T6BY 2CXSA 4J3NA 4CKBA 4UVDA 1MENA 2AHOA 2W6ZA 4OQFA 3ZGYA 4D42A 3PX3A 4DIMA 2QX7A 1SOMA 4N0MA 1KL9A 1DFHA 1G64A 4C03A 1Y81A 3ELYA 3GVIA 4C3OB 1MRSA 2LDBA 1KMQA 2VDQB 2HCTA 4FEAA 4ARBA 5CIWA 4LF7B 3UOAB 4L28A 5L3SB 4DS4A 2EFDB 3IPCA 4ND4A 1VLZA 3LTEA 2WD9A 3MOIA 3TIIA 5HWSA 4X71A 5THKA 1K97A 3RU7A 3PY8A 3QKRB 3D7KA 1KI3A 3HDTA 1N2SA 1GRNA 4PR3A 3EJWA 5H82A 4BRUA 1VLBA 4Y6RA 4TQRA 4F04A 4N41A 3AL0B 1RPNA 2V59A 4E32A 1AKVA 1YB5A 3B5EA 3HI6A 3VZCA 5HUHA 3CX4A 3CA8A 4DQIA 1A4UA 3EMBA 3HZHA 2GBGA 2DPHA 3JQAB 3Q8LA 3FA2A 1BXKA 1L5ZA 3NR2A 1E2KA 5LA6B 3ROFA 3WL4A 4CKEA 5EHZA 1ACJA 5FUWA 1XVVA 3FSJX 4ES6A 4F97A 4YRPA 3H4IA 4K40A 4FFNA 2XWPA 4IDAA 2WJAA 3M1LA 1L5GB 5ES4B 1M76A 4CCWA 2YWFA 4BP8A 5JR3A 1MIOB 2JD2A 3Q3CA 9LDTA 3BJIC 2OHIA 4KEAA 4LYDA 2QORA 4BC0A 1P75A 4JL5A 1P7VA 3H2KA 4XLLA 1UFQA 1XZEA 2Z6VA 3JU3A 9ICXA 4G41A 3V7WA 1ZD1A 2VJYA 3N2KA 3NHUA 4AN0A 3GC6A 1U28C 3GCGA 3H2JA 4N6GA 3Q8MA 2OGTA 1J0CA 4RV5A 3UZUA 1QV7A 1Y7PA 3IELA 2HHLA 2VPYA 4I1UA 2AXTU 3O4FA 1P8AA 2H6EA 1PZEA 2BHLA 2CWWA 3IULA 4JBXA 4LSZA 4MW6A 2OFFA 1QKIA 5BRAA 3G02A 1QGUB 2VRCA 5K6TA 1Z7YA 4DJDC 2ACEA 5CA1B 2DHRA 9ICMA 2KM1A 2VP5A 1SCAA 3ZNQA 3NS1A 4LXYA 3T3HA 1C3JA 1Y34E 3ZWAA 4C20A 4N3CA 4DUPA 4C0KA 2YOGA 1T91A 2ZRMA 4A2CA 2WG0A 4N0DA 3B1VA 2A58A 4G26A 2CJPA 4ND7A 3E5HA 4AZVA 1QZZA 2MMGA 4FDMA 4HWRA 2IPMA 3EEIA 3HXLA 3WYGA 5DCYA 3K5HA 3AGPA 3I3OA 1VP9A 5A5FA 5EPUA 2ZRIA 4CKXA 3KKMA 1T9BA 3RBVA 5JMPA 1ZCBA 3X1YA 4Z1MD 1GEGA 1XKQA 1YCHA 3A4MA 1IFXA 3GNTA 4R98A 3V4OA 4A8JB 5DHAA 2FTKE 4LXTA 4AZ0B 4EFNA 4YCLA 3KTOA 4JH0A 3C5HA 3SICE 2WQ6A 1PHRA 3PD7A 3SMQA 4DIKA 1FSSA 3FOZA 1VKJA 4PN3A 4IKPA 3IUSA 3CH4B 4F4ZA 1WS6A 5A7GA 3BT7A 1SIJA 1E1QA 1YRHA 4QA9A 1Z19A 4MR9A 3SC3A 1XDDA 2WWTA 3DXZA 4KK3A 1AS2A 1M3SA 3V3KA 2IHUA 1XMQB 2VYNA 5BR4A 1NF8A 4UCFA 5JFOA 5T4BA 1L3CA 1L1FA 3MINB 3O4VA 5CEJA 1EYZA 1FRQA 2QSZA 4GPEA 1RIIA 3QY0A 1KH3A 4MJ7A 3AY7A 4K9NA 3K96A 4MUFA 1JPNA 5BSFA 2MUTB 8ICEA 2GCGA 2R3SA 5DTRA 1M7GA 3EIQA 4LYGA 2BQ3A 1HYHA 1U0FA 1DMSA 2D06A 3LFTA 4L8WB 2AQIA 4NVRA 3UAWA 2OWDA 3DXYA 1JSRA 1U0TA 1FS5A 4ALIA 4EEXA 5DNUA 5DTMA 1JE1A 2H0QA 2O52A 4PHAA 1YQEA 2B34A 3WMXA 3ZXSA 2JLVA 4Q3BA 4HS9A 4PXAA 1XZPA 1YDFA 4ICAA 4XE5A 3M83A 4CG1A 3LPCA 1T34A 2ZIEA 3AINA 3B6JA 4DFMA 4LVSA 3QLVC 1GGJA 2I6FA 1W94A 4DLAA 4IV0A 2DQNB 1OX6A 2BKAA 2G4VA 2QMOA 5F9NA 1NT4A 2QN2A 4I08A 3ZY3A 4FKZA 1SGGA 1BPXA 1J5XA 1PO7A 2WJ3A 1E6WA 4OUKX 2IS1A 1BRMA 2PV7A 1IEVA 4E13A 4HRXA 2UUAB 2IJGX 2P78A 3UMSA 4HQKA 4MB0A 1F9AA 1WUTA 3LC7O 3PTLA 1N78A 4XB2A 1NHGA 4CKCA 1NULA 1NN0A 3OPXA 2GH1A 3NO4A 4PNEA 2XRYA 5DG8A 1NFRA 5AM0A 1WL8A 3P2KA 5LBTA 1XPRA 1C1DA 2A0UA 3CVWA 3NBZC 2WNHA 3FLMA 4A15A 1OH7A 5JNUA 2VSXA 2BIFA 3DBHA 4UTNA 1Y5RA 4X94A 4D9BA 5AD1A 2EP7A 4RJTA 4I9HA 2YYYA 2KHQA 3O94A 3L6RA 4OLFA 4LZPA 3CLTC 3WIVA 3WYAA 4B34A 1NK8A 4EEYA 3Q40A 1XTRA 3MTEA 4KQFA 3VKGA 3A9TA 4PX5A 3T7RA 4I2BA 1PNQA 4DNOA 1SY7A 5JPCA 4KN7A 1BXRA 3JQRA 1DL5A 4YPFA 1RZTA 1TUIA 3H1AA 1MA0A 3VRHA 3KAPA 4MHTA 3PC4A 1EGHA 3MWYW 4GMFA 2VDLB 2D2EA 2Q8QA 4BVKA 1XS9D 3HRIA 2PUFA 1RXSA 1MNQA 4CL2A 3J81A 1KK2A 1FL9A 3GN2A 1V3TA 4HAWA 1JIJA 5I5EA 4EA6A 1BJTA 4RQNA 4CMKA 2P41A 3HPOA 5TQJA 3MLBA 3RWBA 4DA7A 4YMVA 5EKSA 4XGRA 1G8AA 2C2OA 1TM2A 4DLSA 4MS4A 5LOVB 3ZZTA 3RJHA 5IM4F 3TLEA 1P1RA 3RFAA 3NAZA 1Z5OA 3BF7A 1RJDA 3LLCA 4Z6KA 3AN1A 3EZ5A 3M5CA 1IUOA 4MRMB 4UCWA 2DM6A 3L5OA 3RH0A 3AR2A 2X0IA 1NWHA 2F9MA 2A67A 4ZP1A 4MIOA 4MEBA 3IC5A 3W5UA 4K2HA 4PL1A 3WK4A 3SIXA 4HI0E 1JTEA 1X39A 4QUJA 3REFA 3TQOA 1FFAA 2A9VA 3GDWA 3OOWA 4X5OA 4IMRA 3UJAA 2OGWA 4TQ9A 4L6IA 3AVQA 4PFSA 1JDPA 2JBWA 5K3AA 3J81k 3ZY2A 3ZX4A 1DRWA 1UKAA 4I5FA 3ZC3A 3FE2A 2DBZA 4B4OA 4IIFA 4E51A 2P5YA 1E9DA 3GJ7A 4B3FX 4RENA 3BQ0A 2SNIE 2WABA 3CUKA 1OKKA 1SUEA 4DL2A 1XK7A 2WU1A 4YPVA 4RPJA 3K53A 4FN5A 3THYB 1HQKA 5KYYA 3H18A 4R3NA 1IN7A 1YQGA 1UHUA 3CT6A 1JHVA 1ZK1A 3IS3A 3UK2A 1PQ4A 2JVJA 1UC5B 5UKDA 1E6KA 3V1TC 3LP6A 2YYSA 2PFGA 4OAOA 1VBNA 3E8SA 5G40A 2E49A 4Q3OA 3SQDA 1VJTA 1M6NA 3BXGA 3LQ4A 1NVVQ 4MRVA 1RLUA 4AICA 2JGAA 2F3NA 3SLGA 3CPJB 4PIPA 1ZO8A 3EXIB 3AG6A 4RACA 5FOWA 2ZUTA 5BQXA 8ATCA 1OU4A 4ARIA 1AMNA 4BUGA 2FG7C 1QZ3A 1J1ZA 2DFVA 5DWQA 2QSUA 3OU6A 4IS7A 3A25A 4BZZA 4DG5A 5E1BA 1L7BA 5J63A 1FRVA 4BE7B 1NRJB 3U3OA 2A0WA 4RDHA 3IAEA 5KU7A 2P3LA 4LTMA 1ZD9A 4XEUA 2ADFA 1GUAA 3SQOA 4B5KA 5KINB 1JR6A 4IV5A 4IOMA 4ZC8A 5C52B 5EHQA 1V45E 1MAUA 2WBLC 2WQ7A 2A59A 2PDAA 3WGNA 2VJQA 4O4JB 1B42A 4TMWA 3LZCA 1JBEA 4LMPA 5KOHA 1DJPA 1W4RA 3KR0A 5IEJA 4HLCA 2OKCA 1DRKA 1E63A 4PHPA 5REQB 3OEWA 4V02A 1LUAA 2PMEA 3FWKA 5ED4A 3WV4A 4JV5B 3KUXA 5ALVA 1EFPB 3FX2A 2JJ2D 1XPJA 1YXMA 1K6MA 3HMKA 2PGNA 3UWOA 2DUNA 3GUYA 4KQMA 4M8KA 4B84A 1E96A 3MFQA 4NYJR 1YFZA 2J32A 3DMTA 1KZ1A 3MELA 4IDHA 5K0TA 3U3ZA 1R66A 4WCDA 5J2TF 3UPDA 2QTVA 1TW3A 4HB2A 3EGDB 1F0YA 2W2KA 4K9MA 2FRDC 3RRYA 4Q15A 1LTHR 1VHTA 4QGAA 1TB4A 2PGXA 2J9RA 1CY8A 3NTOA 2XVZA 2DTXA 2XKBA 3BB4A 3UMYA 4FYHA 2AC7A 2VNJA 5C2JB 1CJCA 1PI3A 1DQPA 1VPVA 2GS9A 2RHHA 4MQ4A 2PZMA 4X1KA 3GT7A 4FNOA 1SZHA 1WZIA 2NXJA 1MB9A 4QRHA 4NLNA 1HE2A 3VSDA 3IQXA 5IAEA 5KQSA 1TU3A 1BMQA 4HRAA 2JIQA 3VU8A 1KTIA 2XZLA 2IV7A 4Q93A 1WNTA 3AM5A 5B30A 2FPPA 1QK4A 1JLHA 3PW7A 4QOGA 3K5IA 5CBKA 1PG0A 2VH2A 2WSMA 3KYJB 1ZIDA 3MWEA 1GRQA 2QDKA 3CNHA 4F91B 4ZWNA 3EOZA 4JT8A 5LMUB 3TZLA 3DE4X 3D6JA 1CFJA 1ZJ4A 4DB2A 3U31A 5CCDA 4ED1A 2HHCA 2XF2A 4FO6A 1D5WA 5A3SA 3KPWA 4BZQA 5AW5A 1DC4A 1CSEE 2ZE7A 4AYXA 5LD2C 2ID8A 3TOXA 2E1PA 3HYRA 2W04A 4IEEA 1QQBA 5KNDD 1SK8A 3A1CA 1PKXA 1ZK3A 2ERYA 2ILVA 2OXRA 2OXEA 2Z3VA 3ZWKA 4N0PA 4NMLA 4OH7A 1BVSA 2G06A 2ETVA 3DDUA 3NNDA 3RUPA 4DQLA 5B7NA 2BQRA 1P5RA 3D6UA 3IMFA 2D1TA 1UC4B 5F35A 5JD5A 1PZXA 3C41J 1JDZA 3FKSD 4R7GA 5ADVA 1Z63A 4OM7A 3L02A 1DTEA 5AXDA 3SXUB 3FFXA 1L7DA 2VS1A 1UQVA 2YMQA 1JKJB 1O96A 4NV1A 4QUGA 3AM9A 3ZK8A 5IDWA 4LXXA 5A1TA 3FHLA 1PWZA 3MS2A 2CBXA 3L1JA 4RZHA 5EN4A 2N75A 5B2FA 4HDKA 2PQMA 3F5MA 3G8BA 4HCJA 2XXAA 4QZEA 3AI1A 3C8UA 1Q1ZA 2FQYA 3FUCA 4C8KA 3NBQA 1FFEA 1MC5A 1XHLA 3IMGA 1OQAA 1V71A 3HJEA 4JEHA 4RD2A 2I4NA 4ZREA 3O7WA 5JYCA 4ZAVA 2ZT5A 3V97A 3GLGB 3PEUA 3VC8A 1K88A 2F3SA 1C8LA 4F6CA 4HB4A 2IHJA 1KI2A 3EFBA 3EFEA 4MUNA 1F06A 5LL6P 2ZSAA 1DOZA 4DOBA 4TZTA 4FGWA 1Q1AA 1K8RA 4XGKA 3LZ6A 2FV8A 2L18A 4EELA 1GQSA 1Q3TA 2J3DA 5HS4A 1OWNA 2Y6UA 2RHWA 3F7TA 4FQ8A 2BMWA 2Z2KA 1GTMA 4FSHA 4Q3EA 4B3CA 1NMEA 1YRBA 2GZAA 5CK4A 1BA3A 1N6IA 1V3QE 4R2XA 1RQGA 2H8KA 2QI9C 2O7VA 2EHDA 2JRCA 4ZAGA 1FX0B 2CV1A 1QV9A 2HJRA 1G98A 1YJBA 4Q18A 3WKBA 5EA2A 3FD8A 1E5XA 3UPUA 4DVGA 1ZSVA 2UZ1B 4FFRA 2FSSA 4N0QA 1NG9A 1KPIA 2QE6A 2VDRB 3UMRA 5KYNA 3S2EA 2TMYA 3KHKA 4IBOA 3ZDBA 5JNLA 2WIKA 4KDEA 2GYYA 2VDVE 5CGZA 3WOVA 5BNWA 2DCMA 1W76A 1D4AA 1TVEA 2F1KA 2ONKA 2D7JA 2EFYA 3TIXB 2RIPA 4Q9IA 2C5FA 3LK6A 5KTTA 3BD8A 5BSRA 3P1JA 1GR1A 2I66A 2OSBA 1EFVB 4XPIA 3ZDYB 1I0LA 1F8UA 1ZVJA 3BTUA 3DVRX 4I6EA 3IP4B 4IXNA 2YIDA 1N3BA 3UUGA 2BFEB 2G76A 3WHLA 3X43A 5CXQA 4EYQA 5BSHA 1HNXB 2QBYB 3DL7A 5HR5A 1FXWA 1R4ZA 5DGHA 5CXUA 2BBTA 4IO0A 1LQTA 5TX7A 1FXSA 4QAJA 1C30A 2X2EA 3LHDA 4FSDA 3COJA 4QZ9A 2IUFA 4YC7A 2DLCX 1ZYUA 1NI3A 3JWHA 1UMKA 1D0IA 3UOGA 2FX3A 1IE3A 3QA3E 5LFAA 1PS0A 4NIMA 1VGRA 3EQ9A 4PSKA 3R9WA 2AG8A 5DX0A 2XWJI 4BS9A 5EXTA 1QYDA 2A1UB 2NU8A 3D4LA 3JZAA 4H1VA 3N7SC 1O8BA 3I2GA 5T6BA 1RYNA 2PR7A 2ZI4A 2XA2A 4PHEA 3K4QA 1EFHA 1N2CA 1FSGA 3A0UA 1QP8A 4LRXA 3HCCA 3KFXA 3PI6A 2B2CA 4JQSA 2INGX 1H6BA 3OLCX 3IA7A 3WV5A 4I2AA 2LWIA 4OL0A 1W88A 3ISVA 1G8JA 3EGWA 5LQUA 4C5BA 5IYZA 1PK1B 2VWPA 2R8YA 4PC6A 3S2FA 1SO8A 5FBKA 2AOTA 4HGZA 2ODNA 1NKTA 3WLLA 4XQGA 2FSHA 5B12A 1XZJA 2WHRA 2IBMA 4O4LA 4UBIA 5KHAA 3UT5A 2H3QA 1AURA 3OY7A 4A8PA 4R0MA 3PSAA 3U44A 4QDTA 1DC8A 1WLSA 2ZJYA 3GN1A 1GAJA 3PC8C 4UB2A 3STHA 4YRRA 3I39X 4YXWD 4MS3B 1NLMA 5LP6B 4BDPA 4HH3C 5C32A 2BCSA 1LI4A 3JQBA 3PENA 4AF7A 1ZM3A 4PYNA 4RX1A 4CV2A 3G2KA 2UZ1A 2XGOA 3G6WA 4QSHA 3TEFA 4DDVA 3G2LA 2O7QA 3HB4X 1QIFA 1QORA 4GXNA 4N9WA 2C0QA 5FNVF 5TQ2B 5TQ0B 3A1NA 4QX6A 1IZ8A 1CKEA 4JXJA 3HEBA 4FZRA 3K9LA 4YJFA 6CHYA 1A9TA 2MSEB 4OMFG 2QNBA 4TUYF 5HHIA 2H1HA 3I6MA 3SBOA 3K75D 4MWZA 3HJUA 3KLMX 3TG8A 4BU0A 3WQHA 2DPMA 1T2EA 4CLRA 1W44A 4DZZA 1XTZA 4NOMA 5SZIA 3UUEA 3DYIA 2VPXA 1H3NA 3PNSA 1QYIA 4Q5IA 3OQ1A 3X0DA 5C35A 3WU2U 3IR6A 2LP4Y 4LW8A 4KK4A 4PBTA 3CVXA 1KE2A 1J24A 1U8FO 1MRZA 2GX6A 3V8VA 1ISHA 4QLBA 3M1YA 1LS1A 3B9BA 3L7JA 4CL0A 4DLKA 4GI1A 2N1BA 5KSPA 4D8XA 3ETCA 1SCUA 5D6NA 2ASJA 4UC0A 1NKEA 1U0GA 3KBBA 4R8SA 4EWLA 1XZ8A 1NP3A 3ANSA 2OAEA 1W49A 4U2FA 2ZM6B 3SR6A 1TIPA 4OG2A 1BNOA 1SHUX 1XQ1A 2Q1YA 3QX9A 4L5IA 3VU0A 4FR2A 1EP9A 5CK5A 4X97A 1MAAA 4A73A 1IXZA 1KJIA 1M8PA 1QIDA 2H2DA 4J2HA 4L78A 2OXOA 5ALSA 1NPDA 1YASA 3HPQA 1PR2A 3ILVA 3JYQA 3RBEA 5DNCA 2GAIA 5KOJB 1Z07A 5J2CA 1IXKA 1PGOA 4FHDA 1IN1A 1S8AA 4WZAE 4MKHA 3MPOA 5DKFA 4WWHA 1C1XB 4FS2A 1FY2A 1MJNA 4PTYA 1HT1E 4P38A 4QUAA 1GO3F 1Z8NA 4KMMA 2FU5C 2O2CA 2GBPA 3W2GA 4ZEVA 2G0TA 4BVGA 1EHIA 3GLVA 4YA6A 4XW2A 4CUJA 4TUPA 2P9BA 2BR4A 3FFTA 2FB9A 1P1JA 1N5RA 5ES3A 2QN1A 2WJWA 2IODA 3Q9NA 1RBQA 1A2BA 3HUDA 4ZHQA 1RLJA 3IDOA 4Y2VA 1VJ5A 2Z8YA 4HQOA 5B1HA 2RHBA 2QW8A 4B4KA 2B4TO 1T10A 2RGXA 1ZZGA 2BEUB 3SN6A 2KIVA 3K1AA 3A6DA 2ZYHA 2B9EA 4GP7A 4L7QA 1D7OA 1UAGA 1Y1PA 5BVHA 4DXHA 2JA2A 4N5MA 5DN6D 3FRIA 2J48A 3PQ5A 4ZU3A 2R7NA 2RHOA 1JYFA 5A2GA 4MS1B 1XQYA 2HBRA 1HFEL 1XCGB 2HXSA 3GCXA 4W5WA 4BWJA 1H8HD 3UAOA 5ELMA 4EJFA 1SKYB 4Z54A 3Q8PB 1SXJB 1X86B 3C5WP 3ZQ6A 4RJLA 4YR3A 2ZWVA 2WT8A 4HWGA 4RAOA 1D6MA 1E3WA 5JAHA 4UAZA 1U5CA 1FJHA 4MUHA 5IX8A 1BQ3A 2AU0A 3TFWA 1KZYC 1JIVA 2QYTA 3L0OA 2XUJA 3R5SA 1SRRA 3L9WA 4MV9A 2UXCB 2AE2A 4X7PA 4LHEA 1RBMA 1BE1A 3ZOZA 2X1LA 4MS4B 3DLPX 5LOVA 5A4DA 1ODFA 3HDJA 3IP7A 1UMDB 1QFZA 4GMHA 3D8NA 2H4ZA 1K5GA 4D9GA 3SNKA 3VR3A 3CNEA 1EVZA 4YRSA 3OMXA 5GJVC 2CNLA 5CJ2A 4YUVA 4AKEA 1OJLA 3C3MA 3RBZA 1EJBA 4XWKA 3F1LA 1TJ4A 3DMRA 4O1MA 4R6WA 1PFGA 2RAPA 1KEKA 2WI8A 1D2MA 2YVKA 4G1MB 4G0UA 4LXGA 2P2NA 4JGGA 2O8FA 2O50A 4FHFA 4AL4A 1EWTA 2VPQA 3S55A 5JVDF 1NPTO 1P7YA 3VTAA 1JG2A 1DQRA 2XR1A 4EPXA 3JZIA 3F6PA 2QHXA 4JL8A 5C1DA 3CEPB 3RVBA 1KMIY 4N5NA 1I7PA 2Y71A 1I7LA 4WSOA 2SECE 2FNAA 4HJXA 1ECLA 2C7BA 3CMMA 1LC3A 3ZGNA 1YR2A 3RO7A 2X0EA 1JEYB 4U63A 3KFUF 1LDYA 2MYTA 2Q41A 1ULZA 1CQIA 1ENOA 3GT3A 2ZE8A 2VT7A 3KWLA 4LWPA 4R1NA 4X1YB 5CIYA 3FUWA 4C5AA 4KO1S 4RKWA 3NV7A 4D0GA 1YDMA 2JJ1A 3LOPA 2BISA 2O2YA 3IP6A 1L7AA 3TYXA 1MGPA 2F62A 3EHDA 3E22B 3MSXA 5B3AA 3NXSA 5HZGA 3LUAA 1NQ5A 1M8FA 2O3SA 1CUZA 3ORYA 1OFUA 3V7NA 2IHYA 3LVQE 2BEKA 3BZWA 1JUDA 1GCAA 9ICGA 3WO1A 4OREX 4KPYA 2NV2B 2AZMA 5IVPA 3TANA 3JPPA 1D9DA 3D54D 3C1ZA 3UWKA 1VFPA 3SAHA 1JA1A 1FU7A 4XSVA 3VCBA 4EZEA 2YWEA 1MVNA 5KT2A 1TKBA 1UKBA 3K0AB 3L9XA 3N07A 4L4SA 1JIIA 4ZU1X 3RFFA 2B6NA 3BM5A 3EK2A 2Y0SF 3G5UA 3MG9A 4B48A 1TCVA 3SR4A 4O1IA 4OA8A 5JY1A 1YK0A 3NYQA 2H1RA 3F9RA 2Q27A 3K70C 3KDAA 1TF2A 1M5RA 5CA0A 3LBAA 4JAVC 1SCBA 1EFRA 2IH4A 2O7NA 5AK4A 3MJDA 4U00A 3OEEA 3U61B 4PSAA 4Y9UA 1JR4A 1PYDA 3F3KA 1RLIA 2PUWA 2JK1A 2NUBA 1QGED 4J1TA 2G5PA 1U6IA 3I5XA 3GMSA 1NF2A 1UKEA 3OOEA 4IJWA 4TROA 3LIIA 3U37A 2H3IA 4DSNA 2PSEA 4Q47A 4BLUA 2P9CA 3JX9A 1Z1VA 1H2BA 3I9JA 5DNYB 3CW9A 1P8JA 4L08A 1F0NA 4YONB 1T36B 2BW0A 2V3VA 3TRFA 3LDUA 5DNDA 2VQDA 2OESA 4QQFA 4ER7A 1G8KA 1FK8A 4E5DA 1IMJA 4IC9A 4C7ZA 3E7FA 3OESA 3H7AA 1YK1A 4ZMRA 4AP6A 3SAJA 1DAHA 2W2KB 4K86A 1DPFA 2HSWA 4P86A 4Q7JB 3CV3A 1YRAA 7ICIA 1XWFA 5IXJA 1UZNA 5FULA 3TL3A 2PUCA 1OX4A 2LMRA 4OD0A 2D0PB 1TJNA 3MGBA 3O9VA 5FOQA 1NC3A 5JMTA 4C5CA 2EZZA 1RC0A 3AP1A 4P4SB 1T0JB 2GAFA 4Q3NA 2QYSA 1R4NB 1EWRA 2EEPA 4G2NA 4DA9A 1R0LA 2XZDA 3FG9A 5KFLA 4PEVA 5ESXA 1V9SA 1SBHA 1XZKA 3EZYA 2XCSB 2YNMD 4A3SA 1VRWA 2B1QA 1JGTA 2XWBF 4OP3A 2BF7A 3GA5A 3JD3A 3PQEA 4IIEA 3LKZA 4M76B 1IL0A 4M9RA 5KX5B 2ZUSA 2JAQA 4PVCA 4RKRA 4O5OA 3ILYA 1Q2XA 1GEEA 5IIIA 1UP4A 4KPUA 2EKZA 5F2OA 2FQWA 4FGKA 5B5SA 3L2OB 4MI9A 5DM70 1QPZA 3PU6A 2QS9A 3ITNA 4A2QA 3PW0A 1LRKA 1W6UA 2AS0A 2FGKA 2Z3ZA 1MO4A 1X9IA 1KK0A 3FWHA 2WM9B 3GUHA 3L4PA 3B1XA 3UJ8A 3G13A 5PNTA 1UJCA 3AONB 3MTBA 3W77A 4DHWA 1KDTA 3PC8A 5D7BA 2B25A 4OA5A 4DO9A 1BH6A 1N6OA 2Z9CA 3DF9A 4OGGA 2W4IA 3VNAA 5E2AA 2GEJA 2P91A 3CCCA 4BGIA 4ZO6A 2Y1KA 3AKYA 3ZU4A 3DV0A 1WU7A 2PFNA 1JLRA 3LXMA 4M8SA 1JS1X 1QANA 2XNDD 3NT5A 1Y4SA 3ORQA 3H13A 4ZVSA 3QX3A 3AESA 1HUQA 1W9HA 3FPBA 3LY8A 4HDAA 2HSZA 2GK4A 4Y6OA 5GOZA 1PCXA 1JEEA 1ZR4A 4MP8A 3GP5A 4P2HA 5HUJA 4KE9A 3P9ZA 3WLOA 1N2JA 1XT6A 1Y4DE 4U39A 1WV1A 1E4YA 3R7BA 3TWOA 1JLLB 1HFJA 1YJ5A 5DGDA 3ZD7A 4MUIA 4TOIA 3CVYA 1QH0A 1FUIA 2NT4A 1SHZA 4L3WA 5F78A 3RYFA 3VDRA 4NXZA 1NMZA 1M6WA 2ERXA 2GN6A 3M4ZA 2H3HA 3VOAA 2AFHB 4GVPA 4TTAA 3UA4A 3FM9A 4C2AA 5IZCA 5LKRA 1ND6A 5C8XA 3F7MA 3RQIA 2PV0A 1IUPA 1W4CA 2JI9A 3T7DA 3V8BA 1QH1A 1UBMS 1YR7A 2PIAA 4D8VA 5BW8A 1JG3A 4QNLA 4MFFA 1P1CA 1PDOA 4GR5A 3MXTA 5AJWA 4EO4A 2AKAB 3RARA 5K8CA 3FNIA 2V7VA 2AFVA 4YJ2F 4QDXA 4LF8B 4GE0A 4GOMD 3RSQA 5KX5A 8ICVA 2C2BA 3SJAA 3ZI4A 3AJ9A 1RXWA 1G21A 1UOQA 3FCYA 2YICA 1S2MA 3O9MA 3OM0A 1NIPA 3CSUA 3PF8A 4ND6A 1RQPA 1HLFA 3H05A 3LCJA 4DA0A 3GDGA 4JI4B 2HSJA 3X1KA 2CLFB 1BKYA 3RR2A 4BJ3A 4CR8A 4F6LA 3PJDA 2GN1A 1VXRA 1U2DA 2ZB7A 5JWRA 1IIBA 4PTZA 5JH7F 5CBPA 1XDZA 1PSDA 1W2WB 1BPBA 4PLHA 1D07A 1VGVA 3FOFC 4RC9A 2JI6A 5CLFA 4P4UA 4P0PB 1CYDA 4H3VA 4X6UA 3IE0A 4KR6A 3RS5A 1GYPA 4IDOA 4AW9A 2GUWA 1IQUA 1TKAA 4HLUC 3X3HA 5JRJA 1E9EA 3MN1A 2VHJA 9ICPA 4MKRA 4UVGA 4P84A 2Z4RA 2XDQB 2TYSB 1S3GA 3I9V1 3CC8A 2Q6KA 1FLNA 2F3RA 4AUNA 5I8WA 3D0QA 5JU6A 3WAGA 1NVAA 3X44A 5E7QA 1JWBB 1UINA 2PD3A 3K5PA 4I8IA 5JNVA 2O8FB 3PC2A 5F9FA 1W87A 2VJPA 3RJZA 3OTQA 3ID6C 1JQAA 1EM6A 4B81A 4BZXA 1JEYA 1P18A 1A96A 2AZ4A 5I9BA 5IJ0A 4ALKA 3A1FA 5EJ7A 2OP0A 2PGDA 4R1QA 1CFZA 2A2ZA 3VSEA 4I9NA 4GOKA 3GEIA 5L4LA 2CZQA 2V5AA 2EX1A 2ZREA 1TM7E 3A6KA 1FNCA 1T26A 1U11A 1AA9A 1ISPA 4JP3A 2BCVA 3N97B 4HRYA 4WZAA 3WRYA 1RAEA 4XYMA 3OLQA 4MW7A 1G5FA 3TNJA 1TNDA 1U47A 3N7UA 4QXOA 2QAGB 4DQKA 3O82A 4I7EA 2PMDA 4NARA 4RCYA 1OA0A 1TMYA 1C0PA 1UOPA 3RSHA 4TYYA 3GJYA 4IIHA 2FRVA 4RY8A 1RXUA 4J7AA 4Q9AA 3QLJA 3UMCA 1IY1A 1ZQ1C 1D04A 3CZRA 4N0EA 4EENA 3B3GA 4ECWA 1P3JA 3GRYA 3TZQA 1VGQA 1STOA 1GRVA 3BB1A 5G5HA 4ZQBA 3VHLB 1CE8A 3GEEA 5DXAA 1BQ4A 1AF4A 1SHLA 1GCGA 4EHHA 1SBQA 4PBSA 4Q12A 4EGJA 3WDLA 5LP6A 4TN5A 1OD6A 1WUKS 2QUIA 1KDVA 4C04A 1WSAA 1K4KA 3EXHB 2D62A 4I4TB 1UANA 4IZ6A 2PMKA 2OBNA 1AV7A 3KL2A 1NW9B 3MR2A 2JFVA 2QJRA 3MGCA 2K8AA 1RZUA 2GPWA 3Q6IA 4L4ZA 2G63A 2FQQA 1PRYA 3JY6A 3EFHA 4M1MA 1AHNA 4NDZA 3TLAA 4D8UA 2ZTEA 3KHRA 1E5QA 4ISCA 5AHWA 4UNSA 5I3ZA 4UB5A 1QQAA 1ZZEA 4JMLA 3A4VA 3HRDD 2E1EA 1E77A 1KEUA 4RL4A 5I7WA 1R6BX 1SG6A 2HA4A 3HFGA 4FBLA 1ZM2A 1II8B 3H1TA 2RFLA 3W79A 4E4YA 7MDHA 1IM8A 4GP9A 4KQHA 1J0BA 1MJHA 5CHGA 3K9HA 1V4BA 4NAHA 1WXWA 5CXSA 4MJXA 4UHEA 2HWXA 1YQ9A 4F4CA 2VEOA 1GD1O 5COAA 3LO8A 1RWBA 3KQYA 1W52X 4M1ZA 2BFDB 5DXFA 3HJCA 5E4YA 4A0HA 4Z5XA 5LIRA 4MPDA 1DEHA 1UPFA 2GWRA 3I6BA 4D8YA 1KLNA 2W2LA 2HIAA 3F7OA 3IILA 5HP4A 4GPAA 5EHNA 1CP3A 3UK0A 2XITA 5DTJA 1NX6A 1JDJA 4Z0TA 1HMYA 4GF5A 3PJGA 1T6ZA 4LGCA 2BFEA 3C8MA 5C81A 4KMRA 3Q41A 1A5AB 1WULS 1CF2O 4NFYA 1P7PA 7ABPA 2R86A 5B7GA 1SXJE 2WZCA 5DLEA 1ZQXA 5L7TA 4XIYA 1QH1B 3OHMA 4GMXA 4DL7A 3KYBA 3TRJA 4JC8A 4OJMX 4X6LA 4TURA 1WVGA 5DSTA 5BSWA 5J2UF 1QLNA 4NBVA 1D6JA 2BCRA 3K4PA 2Q3FA 1T0HB 1DXQA 2N9UA 3NEYA 1PJSA 4HK4A 1RADA 1SQ0A 2R8JA 4PPXA 4MTCA 5EWJB 2L19A 3C3CA 2PS1A 3I9LA 2PSJA 1YJCA 2WV7A 1A9XA 1YZLA 1XC9A 4CRXA 3I73A 1ZUNB 3ZDZB 5DGCA 3CR8A 2IZ6A 4OSEA 3BK2A 3DBVO 3U1BA 5EESA 3MUNA 5L4SA 2ABWA 2MSKA 1NXTA 1A9OA 5CW2A 4DDKA 1Y8AA 4WXPA 1HEKA 1POXA 2VH1A 3O8QB 1NK6A 3QVLA 1CX9B 3M0EA 3PHBE 4QXRA 1BGXT 1E7YA 5BOLA 1R0XA 2OB1A 1FW6A 3MMSA 1QRTA 2VP2A 4RA9A 4PQRA 4TKVB 3IBTA 5I4KA 1RM6C 5H80A 2VIIA 4LJRA 5ALGA 4DVJA 3P4YA 1CY1A 4EQZA 4DYVA 3E3LA 1RFGE 2V7TA 2IHKA 2VK8A 3QZ8A 4YJ3B 1NLYA 1J2NA 2R60A 3RF7A 1AY0A 4EIWA 3PW5A 1O97D 1KE1A 1KMHA 2JARA 3PWKA 3COYA 4G9EA 4MVJP 4L16A 1DJNA 1ZKMA 2IHVA 2QTRA 1J0EA 3FCUB 1WV0A 3FNBA 1O03A 2F17A 4ESOA 3KQOA 3CO0S 4DSKA 2IHTA 2JAPA 2ZYWX 1DG1G 2C1EA 3F96A 1UDAA 2HIHA 4PSCA 4WVLA 2WP8J 1MEEA 1S1MA 2GPSA 2SCUA 5ALOA 1HTWA 4PZAA 1GILA 1R8YA 4UBLA 2HL6A 1MOSA 4N12A 4JT4A 5EPOA 2Q1WA 4F5EA 2ADOA 4JUZA 1J9EA 3ESZA 1QR6A 1OLUB 4C7BA 2Y92A 3BJRA 2H51A 3HR8A 3PE4A 4IJ6A 5B2ZA 3ZZNA 5FEUA 1Y8QB 3G0BA 4UJ3A 1C0KA 3LYLA 4UASA 3W2IA 1ZM4A 4EP1A 1KJZA 2X15A 4DLXA 5KCMA 2MJLA 5DT2A 4A6PA 2VK2A 2W5UA 3TO5A 2VNKA 3QYJA 2KX7A 4BO7A 3CUEF 3NWPA 4ZJUA 3H4VA 5ELLA 1PVRA 4E30A 3FPSA 5AXAA 1ISIA 4CEJA 3WQRA 1VCHA 4PX2A 4DBLC 5LLDA 1Z12A 1TJ3A 2IXDA 1E2GA 4LF4B 1NBWB 4CM9A 4LI3X 5IKOA 1L9XA 3IEVA 1II8A 3JPTA 5CPFA 5BXYA 1QM5A 1MO2A 1P9RA 5AKYA 2I4LA 5IIKA 5DGAA 2LXNA 4Q37A 3S5UA 3BMQB 4LE2A 1T7PA 3FPKA 1JR3D 3AUAA 5LUAA 3B1JA 4AN1A 1DLIA 4IH9A 1R5BA 4KR7A 3IAUA 2OY0A 3Q88A 1Q20A 1XEWX 3GRUA 4EECA 1GGFA 4IIVA 1ETUA 1WMAA 4KTTE 3S2YA 2AEFA 1A2OA 5HIJA 1IVSA 4HAVA 4I46A 2LI6A 1L3UA 3K2QA 1XLVA 3RBXA 1U5BB 1IB0A 1KWGA 5DDMA 3GO4A 1GDHA 1LVUA 4FSXA 4IUYA 4MGEA 3VJLA 1Z2DA 4EA8A 4TWBA 2REOA 3TGPA 1BOOA 1E2JA 3U81A 1NE7A 3FPGA 1AO0A 3GARA 1CB7A 3TN7A 1UQRA 3OO0A 2R62A 5DHQA 5IZ4A 2R6CA 1JKMA 3T7IA 3QSYA 4FOSA 1GNVA 4FE7A 1AQIA 2OAQ1 1XYGA 2F1HA 4R0VA 3HVHA 4I1YA 4AMUA 3V1NA 4C01A 4DOMA 3RJ9A 4AJEA 2WJVA 2RC5A 4NX2A 5BXQC 4O2BA 1V5EA 4YQFA 2Y2VA 4Y2YA 1TEHA 3NAMA 4YQYA 3ND5A 1DUSA 3IOBA 4OUDB 1ZQSA 4CU2A 4J9VA 4TKUA 4HVLA 1YBMA 4TWRA 3WMRA 5BVGA 2PO5A 4BX9A 1L5MA 4MWDA 5BOMA 3BK1A 3PFIA 1JRPA 1CUWA 1XSEA 3JR3A 4C87A 5IASA 4NAVA 1N2EA 3U16A 4UMFA 4ZMSA 4G86A 4RUAA 1BVRA 5FR2A 1B8UA 4TQUS 3QFFA 1AGYA 1WW8A 1L7RA 4ND1A 2OV2A 3OD5A 3W9SA 4KMOA 4LJ8A 1CDEA 3JALA 3JQDA 4FDUA 1Y3HA 1JHUA 4Y6PA 4DLRA 1BHSA 1F6WA 8OHMA 1ZGGA 3VR5H 1V6AA 2LYBA 9ICTA 3HA7A 5EP2A 1MABA 3AFMA 4W82A 3SVTA 3STXA 4F1JA 4ZT7A 1FDVA 1YNSA 4C4YA 1Z74A 3ZGOA 2P6PA 4DWWA 2C99A 2JI8A 5AHOA 3BEOA 4D96A 1UXJA 3Q3IA 2NV3A 3RCBA 2NYVA 2QAIA 3BH0A 3UMVA 2ZBDA 3O0TA 3LZDA 5EMKA 3FC4A 3GFOA 2EKDA 1ZDMA 1YHNA 4IOKA 3B85A 4D99A 2Q99A 3H97A 3RJ5A 4PHCA 1DARA 2R6HA 3A14A 3STYA 2WAOA 1CZUA 4MV3A 4HNTA 1JAIA 1SG0A 1XJ0A 2OUIA 3ZI7A 3LDHA 3PFGA 3RTVA 3ZCQA 1DDOA 3WRXA 4CTKA 4W5NA 1XQ9A 5K8VA 3HL4A 4FEEA 2QJOA 4DKJA 2FPXA 1QGUA 3CUYA 1NF3A 1SCDA 4NPAA 4DBZA 3C4QA 1GGNA 2DBRA 2A35A 1SZDA 1T9ZA 2JCVA 3DMNA 2FYTA 5J4VA 5NULA 2HA5A 1SU7A 4TKVA 4OGWA 1TM3E 2CFIA 3OQ6A 1N5IA 2VRWA 5JQGB 1Z2EA 2AFIA 4C7YA 1Z45A 3EMKA 2XOKA 4GGMX 3FTFA 2VHQA 3GXBA 2PGOA 5TJHA 3ZJ5A 2GQ0A 2RP5A 4RHFA 4WXEA 2J8ZA 5LQNA 1GUZA 2IT1A 2WFMA 2BEWB 5DLPA 2VZ8A 2RE8A 1EBUA 5DQHA 3F71A 3F2VA 3SZMA 1EP3B 4GLLA 2RH4A 1QQ7A 1L7EA 1U2PA 4I5GA 1RJ9B 3V33A 3K05A 3VFDA 3VU9A 1KYVA 2LGJA 3WGKA 3HG7A 4I6JA 1QH9A 4PAWA 1UJ6A 3DLTA 2FEWB 2NQ8A 1I24A 2P2GA 3BN3A 3CLSD 1G38A 2QG9A 1ZQFA 3CRZA 1JX4A 3ZDQA 4B6OA 2FR0A 4Q16A 4A92A 4DR1B 1MJGM 2Q07A 5AO9A 3A6PC 1V3UA 2O4CA 4FEGA 4NV0A 4EBEA 1N62A 5DB8A 1IK4A 2DX7A 5K4GA 4ZCLA 2C4WA 2GTIA 4I8XA 5BWCA 1RG6A 2ES4A 1Z1BA 1WUYA 4QDZA 1D2CA 3NC1C 1RFLA 1VFNA 4N3NA 2W93A 1H3FA 3L0SA 3IUYA 2QP9X 1YE8A 3TRHA 1LNZA 5JO9A 3VGJA 4ZZ1A 5LQKA 3M9OB 3IHLA 4E1AA 5TRTA 3E3NA 2O8DB 2OGUA 2XGSA 2CXNA 4FMPA 3DT8A 3ELWA 3KJXA 1YOVB 3V8RA 4M55A 4OHYA 2X0RA 4YRNA 2B4YA 2D00A 2W8KA 1X7ZB 3KKPA 1NBMD 2RJOA 1WCWA 2ODWA 3GHHA 2A5JA 2YX1A 3KUKA 3UMJA 1YZNA 5K09A 4JYAB 3N28A 4C8MA 2H8GA 4F3TA 4ZARA 5I51A 2I4MA 1H8ED 3PHGA 1OX4B 4YMTA 1JA0A 1ICIA 2P30A 3BMOA 5SY4A 3NANA 2WZQA 5T14A 3DZGA 3RIHA 4D4MA 5AYVA 1KYYA 3DMHA 3C39A 3ANLA 4MPJA 3VZQA 2O0MA 4RLSA 6REQB 2JCBA 4ROSA 1ORHA 4MLZA 1GSIA 4F11A 3K1RB 1B1CA 2W83A 1Y3AA 4BATA 1MSWD 2QN8A 2VJ4A 3SS8A 2ZSUA 3CUWA 4H08A 4XB1A 4Z8XA 2AUMA 4M0FA 3GRFA 4WECA 5NLLA 1XTKA 3VH4A 2V58A 2I1VB 3INGA 3V6JA 1HIWA 3QFCA 3R2JA 5I8ZA 3UJ7A 5CFRA 4K6CA 4CKWA 3HJTA 1KEJA 1KJ9A 4XLTA 4CMIA 3O8NA 4P53A 3IODA 4RIFA 4OY3A 2X19A 3GMTA 5J4YA 2B61A 4NRDA 1RHMA 1Z4IA 3TTYA 1E6LA 2AXNA 2P9YA 2EW2A 3QVSA 2NRXA 2QT1A 2JS7A 3HWWA 4RVFA 4UM9B 1YI8A 1W25A 4GI7A 3B8EA 3BTOA 1E64A 4DDMA 5BMOA 2HA2A 3HA2A 3TBFA 4DMCA 1YTUA 2DR0A 4HPWA 4ZOHC 3QPUA 3SEIA 3UT6A 4Q1DA 4L0CA 2AR0A 5GY7A 3LQFA 2ZIWA 4X8OA 3JRXA 4DIFA 5KAPA 4MKZA 5HDQA 3BQ7A 2FLWA 5DLFA 1CQZA 3KHLA 1ZMRA 1ZW1A 4I66A 2DULA 2JW5A 4IEIA 3W7VA 1ADCA 5D5QA 4KAXA 4CCYA 5L3QB 5G5GA 1JAHA 2RONA 3N2ZB 4L2IB 3AESB 4GLJA 1O9GA 1Q83A 2O14A 3QJYA 3TLZA 4OXQA 4PWZA 1IULA 3BMCB 4HDNB 4OXKA 1P9OA 4B8WA 2XGJA 5HZKA 3ANTA 1GNRA 4G5SA 4UCXA 2AOVA 1G8HA 5DCLA 1P4GA 2ZBGA 2WHEA 4I2NA 2RDIA 2JFXA 2M32A 5H9WA 2P7HA 1PVQA 1AS0A 5ICFA 3UB2A 1E20A 1IHUA 1ZJYA 4PYKA 5A05A 4MHOA 3IPRA 1Z0IA 1ITZA 1FU8A 1KDYA 2Y1IA 2QRNA 3AIMA 1JJ7A 1KYZA 1O5IA 2ZR8A 3IP9A 3O90A 4YS6A 5LMZA 4JB3A 1NFQA 2W6QA 3BCUA 3EXHC 1P0CA 3KSDO 4YJ3F 1A2KC 1G42A 1UFOA 3BCRA 3GLFE 3SEZA 1A0OA 1KVQA 1U4BA 2FHPA 2DTEA 1KSFX 1UBGA 4YP9A 4PW0A 3IQGX 3WYFA 1EG7A 3NPMA 4X0EA 3ZV5A 2FK8A 2IEDA 4MVCA 1DCMA 2GASA 2XYVA 4I55B 4L27A 1E2HA 5TEWA 3WNCA 2HN9A 5FO1A 4BN5A 2ZRBA 3BQMB 4J9PA 3HCOA 2J3EA 5J1SB 1L4LA 3W5DA 4FS3A 1E6MA 1TMOA 3EF3A 1P3DA 4J94A 2BR0A 4TRNA 3UTCA 4DCTA 5JAUA 4NLCA 1X1TA 1SUDA 4POAA 1WHSB 3TQTA 5BRJA 1D9ZA 4BMCA 1V4VA 3QVWA 1C9EA 3ZOKA 2TECE 4M89A 1V11B 1GPBA 3LKVA 1NBOA 5K3FA 4BP3A 1T9CA 5CX1B 5KFSA 1FDRA 1XZQA 2VAMA 3M3HA 1I1OA 3M6FA 3ND9A 1NXOA 2H07A 5EJ5A 3OZ7A 1KQ3A 1SIOA 2B35A 3HWRA 1RLOA 4P2GA 4WL0A 2MSLA 3DKRA 4NBTA 4FKMA 4MRSA 1U94A 4MKFA 3RAGA 5CB8A 4LZGA 1YL7A 2O7RA 1SUSA 3LTNC 2BEUA 5GM1A 3IO3A 2Y1CA 2G28A 1S4QA 2Y1OA 2X1HA 3IURA </