3L5KA

The crystal structure of human haloacid dehalogenase-like hydrolase domain containing 1a (hdhd1a)
Total Genus 75
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
75
sequence length
233
structure length
233
Chain Sequence
LYFQSMAAPPQPVTHLIFDMDGLLLDTERLYSVVFQEICNRYDKKYSWDVKSLVMGKKALEAAQIIIDVLQLPMSKEELVEESQTKLKEVFPTAALMPGAEKLIIHLRKHGIPFALATSSRSASFDMKTSRHKEFFSLFSHIVLGDDPEVQHGKPDPDIFLACAKRFSPPPAMEKCLVFEDAPNGVEAALAAGMQVVMVPDGNLSRDLTTKATLVLNSLQDFQPELFGLPSYE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The crystal structure of human Haloacid Dehalogenase-like Hydrolase Domain containing 1A (HDHD1A)
rcsb
source organism Homo sapiens
molecule tags Hydrolase
molecule keywords Haloacid dehalogenase-like hydrolase domain-containing prote
total genus 75
structure length 233
sequence length 233
ec nomenclature ec 3.1.3.96: Pseudouridine 5'-phosphatase.
pdb deposition date 2009-12-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13419 HAD_2 Haloacid dehalogenase-like hydrolase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.240 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 Putative phosphatase; domain 2 3l5kA02
3.40.50.1000 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold HAD superfamily/HAD-like 3l5kA01
4UW9A 2HX1A 1RLTA 3ZX5A 4CE6A 4XOUA 3WK9A 2W43A 1S2OA 2HCFA 5ALRA 3M1YA 5AI9A 3OTQA 1QH9A 4IG4A 3E8MA 2B1RA 5AW8A 2QYHA 4YGYA 3L0CA 3OCYA 5AVXA 1NRWA 2B0CA 3HLTA 2PKEA 4NV0A 4I9FA 2OBBA 3QGMA 1SU4A 3L1UA 1Z4IA 2WF6A 2GFHA 2P9JA 5AIAA 5AI5A 3L7YA 4Y2QA 3BWVA 2FPRA 3PGVA 3WK8A 4NABA 3SHQA 5AW7A 2GHTA 3WK5A 3QU9A 3F9RA 1J97A 3OCVA 5ALSA 1RRCA 2G09A 4HGQA 3ONNA 4BEVA 1WVIA 3I28A 1N8NA 1L7MA 2O2XA 4C4SA 4L6AA 3ZVLA 4H1WA 4OHFA 2NO4A 1Z4MA 3EPRA 2G0AA 1ZOLA 2FPSA 4BX3A 4YCMA 1VJ5A 1QQ7A 3WKBA 3VAYA 4Y2VA 2G07A 4Y2YA 4YIKA 5AVQA 4UAUA 2VKQA 4OCZA 1Z4KA 3L8HA 3QU7A 3RF6A 2AMYA 5AVVA 3ESQA 1CQZA 3PCTA 2OYCA 4UMFA 3AR2A 1O03A 3ZTYA 1Z4OA 3IB6A 5AIBA 2RARA 4O8CA 2GMWA 4BEWA 4YIHA 3S6JA 3UM9A 3B9RA 1RMQA 4PNHA 3ZVNA 1RC8A 3L1VA 4UASA 3WKAA 3M9LA 1EK1A 2AUTA 5AW1A 1SWVA 1L7PA 1F5SA 2I6XA 3CNHA 1Z88A 4F71A 4HGRA 2CFRA 3ZI4A 2HO4A 4KN8A 5AM2A 1RPZA 2EARA 1RLOA 4Y2JA 3U13A 3U7EB 2ZBGA 3W5BA 5ALKA 1YS9A 3AR6A 2YMQA 4Y2PA 3MC1A 2YMLA 1K1EA 1Z4LA 3E81A 3OCUA 4NFLA 3SKYA 3QU5A 1L8LA 3FVVA 4Y2SA 2JGAA 2P27A 3NRJA 1ZRMA 3KOOA 2W11A 3QU4A 3FGOA 5ALVA 2P11A 2O9JA 3R9KA 4J2TA 2YY6A 4G63A 2D2VA 3PDWA 1RQLA 3SKXA 1TE2A 5AVSA 2IOHA 4YCLA 5AW0A 2IOFA 3QNMA 1MH9A 3EF1A 4DWOA 3EWIA 3ZWDA 2WM8A 3FPBA 3NANA 3PGLA 2R8YA 3ET4A 4HYTA 5AW3A 3NUQA 1FEZA 1TJ3A 2EATA 1YMQA 2HF2A 2GHQA 2G1AA 4Y3UA 3U26A 3WKEA 4JB3A 4CF4A 1RKQA 5AI4A 5AKZA 1XPJA 4EX6A 4ZEVA 4FFDA 3I1YA 4CNQA 2YJ5A 3D6JA 2MU1A 3QUCA 3KD3A 2I34A 4KYTA 2HHLA 1Q91A 3MMZA 4HGPA 1O08A 1L7OA 5A3QA 3W5DA 2FI1A 1NF2A 5ALQA 1NNLA 5AK5A 3IJ5A 2ZBDA 3ZU6A 5ALHA 2C9MA 2C8LA 3KZXA 5AK6A 3W5CA 3E58A 4HGOA 4EX7A 2HDOA 4EENA 1YNSA 4QJBA 4UU0A 4YCNA 4BX0A 2Q4TA 3CZ4A 2ZOSA 1U7OA 4XQ0A 5IT0A 2MSNA 2AGVA 3N28A 4UM5A 3MN1A 3TLMA 3AR7A 5ALMA 1U7PA 4EELA 3QUTA 1ZJJA 2G08A 2BDEA 3L0BA 1IWOA 1L7NA 4MUMA 3U19A 3NAMA 4DCCA 2ZG6A 3L5KA 4B6JA 3NASA 5A3RA 2HEGA 2WF7A 2DQSA 5JJBA 2WF5A 1J8DA 3AR4A 5ALOA 2B8JA 1U2TA 3NIWA 3ZX4A 4HGNA 3A1CA 3WKCA 1RLMA 1Z4PX 3A1EA 4G9BA 1U02A 1Q92A 3RFUA 4MWOA 2FPWA 5AHXA 3OCWA 3BA6A 4ZEXA 2R8ZA 3L0YA 3U7FB 5ALJA 2AH5A 1KYTA 5AW9A 4XPZA 1Y8AA 1VJRA 2PQ0A 3N8GA 2B8EA 4Y2TA 2YMMA 2RBKA 4GIBA 5AKGA 1AQ6A 1XVIA 5AESA 5AW5A 2YMPA 2Q4RA 3AR8A 3I76A 1Z5GA 2PR7A 3SD7A 5ALZA 1JUDA 5AM5A 5AVTA 2HF7A 4UMEA 2I54A 4KNVA 3R4CA 1ZD2P 2C88A 5FP0A 5T41A 4Y2RA 5AK4A 5AKHA 3DNPA 4I9GA 5AVWA 4OFZA 1T9ZA 1RMTA 5AKEA 4BYGA 3L8FA 3A1DA 1CR6A 5IT4A 4NAVA 2GO7A 1XP5A 4BBJA 2Q5EA 3WKDA 5AK3A 3WK7A 5ALUA 3ESRA 1T5TA 5AM1A 3KBBA 3WGVA 4CF5A 3NALA 5E0OA 3WK4A 3L8GA 3ZVMA 3QU2A 4FYPA 4AP9A 4EEKA 1ZRNA 1TA0A 1TJ5A 1Z4JA 2FUEA 1TJ4A 2IA5A 2ZXEA 5AKXA 3B8EA 3OCZA 1WZCA 1YDFA 2JAWA 1L6RA 1LTQA 5ALIA 4KX5A 2B1QA 3KC2A 5AVYA 4BNDB 4DFDA 5AVZA 2B30A 1RDFA 2R8XA 3QUQA 4L57A 3B9BA 2RAVA 2RB5A 3WK6A 1RMYA 1T5SA 2OM6A 2HOQA 3N07A 3ED5A 2ZBFA 3QUBA 4IFTA 1YJ5A 5ALDA 1RQNA 5ALFA 3UMGA 1ZS9A 5AW6A 3KDPA 4UU1A 2ZBEA 4L6CA 1VFPA 2CN1A 2C8KA 2CFTA 5AM4A 3SLRA 1Z5UA 2I33A 5ALGA 5ALEA 4AS3A 1N9KA 3QX7A 5ALYA 5AKYA 2WHEA 3E84A 4UM7A 3EF0A 5AM3A 2JAUA 3K1ZA 2I7DA 1ZD3A 1EK2A 2YN4A 2IYEA 4EZEA 4UARA 1PW5A 3MPOA 3FZQA 3OPXA 3SMVA 4CF3A 4Y2XA 5AW2A 4RESA 3DV9A 5AKJA 2EAUA 2FPUA 1QYIA 3J7TA 3I6BA 2C4NA 3SF0A 4DW8A 3N5KA 3OCXA 1WPGA 5ALPA 4AS2A 3QXGA 2JAOA 4FE3A 4KNWA 4ZEWA 2HI0A 3R09A 4UAVA 4NWIA 2I55A 5AI8A 5ALLA 1YV9A 4F72A 5IS2A 2FEAA 2JARA 1WR8A 5A3SA 2FPXA 2QLTA 4C4RA 4YH1A 3QYPA 5AKKA 4Y2UA 1S8OA 3IRUA 2FUCA 3ZTWA 2P69A 3HYCA 5AI6A 3ZWKA 3ZW7A 4OD0A 4UMVA 1X42A 3FPSA 3W5AA 2CFSA 2W4MA 3AR9A 2YFYA 3U7GA 4BKMA 3WGUA 3FM9A 3AR5A 5ALTA 1L8OA 2MU2A 3DDHA 2YJ6A 4BNDA 2WFAA 5AM0A 2B82A 3QLEA 3U7HB 1RKVA 2YJ3A 4QQFA 5ALWA 2BY4A 5AICA 2ODAA 2G06A 2BDUA 2YJ4A 3L8EA 1QQ6A 5ALNA 5AW4A 5AVUA 3UMBA 1ZD4A 1ZD5A 2WF8A 5AKIA 1SWWA 2YBDA 3ET5A 5AKLA 2HSZA 2IOFK 1LVHA 2R8EA 2FDRA 4C4TA 2X4DA 4HAIA 3N1UA 2WF9A 4GXTA 3A3YA 4BX2A 1RKUA 3GYGA 2OA0A 4JDPA 3P96A 4RETA 3DAOA 4J03A 1QQ5A 1Z4QA 2G80A 4UATA 5ALXA 5AVRA 3ZUPA 1U2SA 5AI0A 4E88A 2NYVA 3AR3A 1Z4NA 4KX3A 4UMDA 3UMCA 4XE5A 2NO5A
chains in the Genus database with same CATH superfamily
4UW9A 3Q6MA 4ZO6A 2C58A 1OYVA 4UEWA 3DEIA 2XEXA 2QT9A 4RNOA 4N3BA 4MB0A 2HB6A 5F2EA 4EY3A 5HIKA 3VR4H 2FKNA 1UBRS 5KHOC 4R0MA 1KH3A 4ED3A 4F1KA 5AI9A 1W0KA 2PS0A 1KXZA 1V7CA 4M9RA 1QV9A 5TMEA 1JL3A 1V9PA 4GR5A 3RB0A 1GQSA 2B1RA 4IG4A 4YDSA 4JWTA 4EI7A 5A3VA 1W96A 2DPYA 4X97A 4FBGA 3E3OA 1H3NA 3DUFA 1XJQA 2OV4A 1EWVA 4GT1A 4IW3B 1K06A 3WLRA 1QF6A 3ZE7A 2WLSA 2OHXA 2WZDA 3BVPA 2FZEA 4DNQA 2XOKD 1D0SA 5F9LA 3ISCA 2GERA 2GAOA 4ZT5A 3V97A 4AO6A 3O4RA 2CUKA 4ROTA 2X7HA 1X7XA 1U5CA 3HVJA 4TV8A 3AJ9A 3RI3A 1IBCA 4CIWA 1IOWA 3V4VB 2N75A 2Z57A 4J16A 3NVKI 1XLVA 3DZBA 4P7GA 1ENOA 4B47A 3L4KA 2II6A 2BI7A 2VR1A 5GIPE 1MB9A 4W8GA 4DTCA 3AKYA 2ATVA 4A8JA 4Q48A 3W1WA 1J9EA 1U4NA 2H2DA 2NXWA 2PJZA 1Q22A 1OH5A 4M0LA 3HHEA 1PUZA 3F9RA 1ZH4A 5B2ZA 2FLPA 2XB8A 4D42A 9GPBA 5ALSA 2JW5A 4JYBA 4NAUA 5AYVA 2GPBA 4KPEC 2JR5A 1I33A 2DOKA 3G9XA 4HGQA 1VE3A 5PGMA 2HBZA 2XGQA 2DLNA 3MVEA 1N8NA 1L7MA 4N54A 4Q82A 1TCBA 4RH1A 3W3AA 3TZLA 4F5EA 1BROA 4FCWA 3DZIA 3J80A 3K8QA 4HXFB 1XA4A 2J1LA 5ESXA 4RU1A 3INNA 3GJRA 4OHWA 4HDSB 4OA8A 3SYTA 4E5KA 1DTWA 1ZI6A 2KW5A 1ZOLA 3GJ7A 4BGDA 1NJ2A 3EIFA 3L1HA 5B1DA 3VVMA 1JHAA 3NP9A 2BFCB 2C2OA 4OQDA 4EATA 4YCMA 4OJYA 2QUHA 2V7GA 2FE1A 1MP0A 3O4FA 4FCVA 3GPBA 3JQFA 4GICA 1HLFA 4DQRA 4CGYA 421PA 9ICFA 3C5WP 3LPCA 2EX0A 4RLHA 1Z68A 4IILA 2P5UA 4EHHA 5CFMA 1JTVA 2RCYA 3DWGA 2BPFA 1I2BA 2W8ZA 3AF1A 4DDUA 2XRYA 4JJ8A 2OCPA 1F2TB 1Y0BA 2NZWA 2G6TA 4LG1A 1NSYA 4WXHA 5FA8A 4O4HF 3X1DA 4ZV4A 3NOQA 1T6YA 3BIJA 1ZJWA 2PVSA 1UBLS 5KYYB 1DTSA 1Q3VA 4ED0A 5CT4A 3R7LA 2QTFA 2E5FA 3AVOA 4K6KA 1WZIA 5SICE 2WMNB 1KDHA 4PZOA 1EI9A 4OGGA 3OZAA 3C6KA 3WGHA 3PUJA 3GIJA 4LISA 1GCIA 3H3JA 4NICA 1SL0A 5A05A 3ZCSA 2N0SA 1C3JA 4FQ7A 5H3CA 3HB4X 1YOVA 2R8OA 3GFSA 3NT5A 4F5DA 2F8SA 1GSAA 4KN8A 1UWVA 2BMJA 4RDIA 5D86A 3V2IA 2YVUA 2PZKA 1WZ2A 2ZWIA 3KK0A 3FE2A 3IC5A 3D54D 3OT5A 3PGMA 4JJGA 1ZKMA 5EZ6B 2ZT6A 3E3NA 4KNYA 1YJCA 3AHHA 2PAFA 2IC5A 4P38A 3WNQA 1UDRA 4OMCA 2QAIA 1JQBA 2FF5A 2IYYA 1R3DA 3RBAA 1NV9A 2QN9A 2J0EA 4FHGA 2ISOA 2WUFA 4O0MA 3QU5A 2H3FA 1E1QA 1DLIA 3H0MB 2QRKA 4QWBA 3WC4A 5KFOA 3QVJA 3Q11A 4AYXA 4EYHB 1GAQA 1ZC4A 1N56A 2VC2B 3OCJA 4AMBA 9ABPA 2E9SA 3M0EA 3UKJA 1WZEA 4G97A 2J6SA 4A2QA 4WZAE 4O3OA 4W1PA 1HUZA 2C4TA 4K1XA 3M7DA 4OHKA 4AROA 3Q7IA 3ETLA 1XSLA 1Y8RB 2AR0A 5M04A 1N3BA 1TYZA 5AVSA 3OX3A 1D2RA 3HM9A 4RNDB 4QW8A 3EDYA 1X74A 1E5QA 3L2OB 1EEXB 3ZU3A 4XI9A 4D9EA 3I4CA 4D4MA 1MH9A 3TMKA 1J5EB 2Y9PB 1BOOA 3JPSA 4DL9A 3MB5A 2OORA 1TK2A 3W8EA 2IYRA 4OXYA 4V2IA 1NVVR 4KK4A 5KYXA 2P79A 5EJ2A 1LA2A 4A23A 2JCXA 4UHFA 1PTJA 1SXGA 2QL5A 4KPUA 3FHJA 4TQUS 3T06B 1JW9B 3F6PA 1U7HA 1PK1B 1X7HA 3IIKA 3SZ3A 3VPAA 3GAMA 2IMWP 5BYJA 5CTAA 4BU0A 5HGXA 2Q99A 4BJQA 3CR7A 3GAAA 1RBYA 2GHQA 3SC2B 2QN6A 1JQAA 2M6LA 5M5BA 1CZKA 5DKWA 2JH7A 1L4LA 1WLSA 1WCWA 3TAHA 4D3DA 5A9SA 5IC4A 5L9AA 1JGTA 1H23A 4RNMA 2A0KA 3D7LA 2VRWA 4QYWA 1XC9A 4K1LA 2GN9A 1YZVA 1PR6A 4G25A 1WXWA 5DNAA 1FFEA 5HE9A 2D0PB 3RU9A 4V02A 2P9CA 3CO5A 3OJWA 2XJ9A 4CMEA 4F85A 2QY6A 3GLSA 5B7PA 2C2YA 2WRZA 4Z9XA 4PANA 4TZ6A 1MSWD 3ZUGA 1UCFA 1OAAA 2FA9A 5H3LA 2YKGA 3VCBA 4OOEA 5GY7A 1L7OA 1QGYA 2VUHB 3C3KA 3I9NA 4GLLA 3CKYA 4URFA 1AN0A 5I9TA 1RVDA 3QE0A 4MZXA 3ILXA 3B1KA 5ALQA 5EUBA 2PGIA 2XNCA 2P2GA 3BHNA 1UMBA 3LUCA 3QNWA 1XTBA 4H1VA 4MR9A 3RRNA 2IX3A 2C9MA 1KOJA 1JJBA 1VL8A 4RVNA 1TW2A 3EEQA 4HGOA 1V4VA 4PX9A 2A84A 2HADA 1RM6C 2TRSB 1U1FA 5IT9A 1N2IA 1U2ZA 2YXBA 5HTKA 4XIIA 2O2GA 4J0HA 3EYAA 2HCTA 2FEMA 1LWNA 2H65A 3GAZA 2EJBA 2PX8A 3BREA 1JFLA 1J06A 5EESA 3KD2A 2VDOB 3WTCA 2VYVD 4FC6A 1YZUA 2DU8A 4QDZA 2VIIA 3ST7A 4BNXA 4NZPA 1MRSA 5K8VA 1BNCA 1XNHA 1XTZA 2BDTA 2HTFA 1GUYA 1DRVA 4YJ2F 3L4EA 3VHXB 4AX8A 1NKEA 4RGQA 1KJNA 2IS1A 3AEZA 4PSAA 7GPBA 2R5WA 5DTRA 1I7SB 2IU0A 1N77A 4MUMA 3U19A 5A4JA 1EQ2A 3EZ2A 5KDLA 4P08A 3AVTA 1WXEA 1HQKA 2YHAA 1QGZA 5IK2A 4JUZA 3QFFA 2ZBPA 1MO6A 4WXMA 5EHGA 5BRAA 1EFPA 2IH5A 1NDQA 4BNGA 5P8WA 4L76A 221PA 3AR4A 3CX4A 1Y33E 2HGSA 4MH0R 3RIHA 2OXRA 4HXYA 3R4VA 1KRPA 2VP4A 3F4BA 3VMFA 1KAMA 1XAHA 2RK4A 2XVXA 4R1TA 4RVUA 2C77A 1RYMA 2KMLA 3DAPA 4ND7A 4V0ME 4WZBB 3ZD6A 5F7JA 5IASA 2PUBA 4N5LA 1CUDA 4G3IA 1AKYA 2VYNA 4YFKA 1NP7A 3B6JA 3I8XA 2BFBB 3H0CA 2QVGA 3PLRA 3MGVA 4O3SA 3L4JA 1SXEA 4DB2A 3DUFB 1JE0A 1HL3A 3H2SA 5ALJA 2XUAA 2G83A 2RHRA 2UYQA 4BZQA 1KDOA 5C5EA 1Y8AA 1IEQA 2GM3A 2AF3C 4O02B 4D43A 3L0DA 4R2WA 3WSVA 1T3HA 4AJEA 3THYA 1VA5A 3IAS1 4WZ6A 4GIBA 2VNSA 4KIGA 4RAOA 4EMSA 4JCOA 5JXGA 1XDUA 2ZJOA 5SY9A 1KSGA 3IPCA 1C9MA 2WSIA 4LWPA 5KMGB 2C5AA 4G01B 1ZBDA 5HQ3A 4A0RA 2ZRHA 4ESHA 3I9LA 3ZJTA 1OI2A 3JWIA 3PXXA 4LY3A 1JLKA 2G25A 3BQ0A 3CR3C 3PYLA 2UXDB 1WZNA 3WL3A 4YR9A 4UMEA 3WWPA 1HI9A 3A9SA 2MYPA 4XRGA 1C3OB 2I54A 5K7SA 1J8VA 1XZIA 2L0XA 5DSZA 3UGQA 4F6CA 1NJ1A 3GUHA 4I3GA 2HU2A 2LKDA 2Z2XA 5IAGA 4QZAA 1NX6A 3Q88A 4W99A 1Y6GA 3QE3A 4NCNA 1JYEA 2FLWA 3JQEA 4MWDA 3Q87B 5F52A 2C2WA 3W1EA 3QPWA 1M5RA 2PX6A 4G23A 4I2VA 3RJMA 3SHTA 3GLGB 3AFHA 4GYKA 5TT1A 3SCZA 1IN6A 2B1IA 1S76D 1N1MA 3TEMA 1W5AA 1KSJA 2I4IA 2YXDA 1KFCB 2Q2OA 3MXOA 1R5NA 3G2OA 5TY0A 3AESA 2Q62A 4JJEA 3TNYA 4J9OA 3M7IA 2YQ4A 2YRXA 2N47A 3TOSA 4CF5A 1VYHA 1KE1A 3Q9NA 1N5LA 3L8GA 3D64A 2QRUA 1AUXA 1KFEB 3WFIA 3WL5A 5HF5A 4AMUA 1TJ5A 2ZB3A 5AJHA 5GIOE 1J7KA 3G0OA 3P0RA 1CUAA 1CFJA 1FLAA 1VI5A 1N5MA 3PDHA 4F04A 2H7VA 1QFYA 2DX7A 4XD7D 3GEHA 2FN3A 3E27A 1QIEA 1BH2A 3COSA 2XCTB 2I71A 5IM5A 2H3HA 3CH7A 3I4LA 1VCMA 2E82A 1RAEA 4I2IA 2WK1A 4JT9A 3JQ6A 4BVBA 4YAGA 4YTEA 3N0XA 4YMLA 1UBMS 4Y6OA 1M8JA 2YWHA 3E2MA 1OIVA 2GEKA 1QYRA 1ZYUA 1S0VA 1TU4A 5EAIA 5ETJA 1VRCA 2PFQA 5A5GA 3RVNA 1FDOA 3Q3VA 2HO5A 3K4QA 1XEWX 1NVGA 4FYKA 4KJXA 5DXFA 1JQJC 5I6DA 2WVAA 4TYPA 1BD4A 4NFYA 1U2QA 1YUBA 2Q07A 1SUSA 4FJ0A 4DAEA 1FNNA 1IJFA 3UMGA 1ZS9A 4MTCA 1U3TA 3C5HA 2VANA 3CKMA 4UU1A 1U0BB 1C30B 1YR1A 1WHSB 1MIHA 1WABA 1EFRA 3OZBA 1R9GA 4JKYA 4KWIA 4LXUA 4MW4A 3TQOA 4BZWA 1ISRA 1Z5UA 1N7HA 2BR4A 3K5PA 4YECA 3ZDFA 4JR1A 4LF6B 3G9TA 5ALYA 2GUGA 5LJIA 5D5HA 1GZ6A 3P0HA 4DM3A 4DREA 5B6JA 3TRHA 3PZPA 5YASA 1XNGA 3G79A 4QZ9A 3DOCA 3NT2A 4TUQA 1ZJYA 2HYDA 4WVFA 3AZPA 2NXCA 1EK2A 4I50B 4G67A 5HF8A 3GT7A 2ZXHA 7ICSA 5BW5A 2IH4A 1ECPA 1YHNA 2IYEA 2HBQA 3AFNA 4J1SA 2W3RA 1K4KA 3B1VA 4FMDF 5K0NA 1NIJA 3OWOA 4U7JA 3LPLA 1F9AA 2JJYA 4KR9A 2BR0A 3OPXA 3GLHA 5J0OA 4U6PA 2EFDB 3O1LA 1LF5A 1Q7CA 2QLFA 1MO2A 1YZKA 2W6PA 2Y0PA 1W5FA 5ULLA 5BSHA 4H4DA 4LTNA 1K63A 3DEHA 4BECA 2AEJA 5IN4A 3ZNOA 1KL7A 1JLLA 4CTJA 4ZOQI 1JXLA 3I09A 4PZUA 3VVCA 5AXBA 4D0RA 3J7TA 5CDUA 2C4NA 3W7BA 1JMVA 2I8AA 4EBEA 1NBME 3DDCA 1I10A 1YVEI 1ZOIA 1YAJA 2NT4A 3DE2X 3PHCA 4ZRMA 5BXYA 4O6VA 5ALPA 4BCBA 2GBCA 1RYYA 2IYQA 2XNDA 3QHQA 5DO9A 1V5WA 4DSEA 1T0PA 2V7BA 1UBNA 3E03A 4YRZA 3HY4A 2HI0A 3HRKA 4UPVA 1R0WA 4JBGA 3AI7A 3PJFA 5A9SB 1WMSA 3CLRC 2F1OA 1QHEA 3Q1KA 1V97A 2G70A 3QV1A 4LTMA 4NZNA 4H7EA 1H5UA 4Q9IA 2JHAA 4E5PA 4ZT7A 5KYKA 4PLZA 1THGA 1GCUA 4F92B 3QYPA 4AI6A 1MOPA 1YZQA 1P6XA 3V4FA 2HHSA 1N6HA 1D2GA 3REQB 3TQ1A 1DBPA 1DEHA 2DUMA 2GJKA 2ZWAA 1SULA 3HY6A 4FB4A 2OFWA 1Z0DA 3ZWKA 3K70C 1BKDR 3GLTA 5IBCA 4X6UA 3D6AA 3T5CA 3DAYA 5FOXA 5LOVB 1ECJA 1WE2A 2X8JB 4OB6A 1BDJA 4GVLA 3O8CA 1F3OA 3EYWA 1DC5A 4NDAA 3JYQA 1I51A 5E9AA 1I14A 3CW9A 3FNEA 4Q12A 2O8VA 4KN4A 2CVPA 2O52A 1E2QA 2PEZA 2V6FA 2XVYA 2P78A 3N8IA 4G5GA 4UBIA 3VR5A 4OGWA 2AFIA 1NUUA 4RF2A 1OLUB 3V4PB 3VR5H 1YVDA 1QRUA 1GZSA 1NBWB 1M8FA 3PF8A 2M1XA 1M2KA 1L5ZA 2BIFA 2BY4A 1KI4A 7ICKA 1HYQA 3L9WA 4TTAA 1N36B 3O4IA 1JJAA 3O1HB 3E5HA 3VH3A 5CJ7A 1RJEA 4B74A 7ABPA 1NJYA 5A7HA 1MG0A 3EHDA 4ZARA 3BCSA 2ZCJA 5BWCA 4BDTA 2A9PA 3GCZA 2UZAA 4B9SA 3I01A 1ZNZA 1LSOA 4NPAA 1ZQYA 2NUAB 4OX9B 3W5HA 3BXGA 4H6VA 4LSWA 3GA0A 2VF2A 4QXRA 3PWZA 4AN1A 4BV9A 1N3LA 3RT9A 1PHPA 1SL1A 4P4MA 1T8TA 3LPMA 4NM1A 3EUAA 4RPGA 1K6MA 2AT1A 4Q1CA 3RODA 2IYAA 2IBMA 4GWLA 5J0UA 2NM0A 5FUYA 1E2HA 3LPNA 5B58T 5TPWB 5IDXA 3F90A 2LW7A 3N58A 1Z8NA 3UT5B 4MQFA 4LK2A 3AW9A 3WO0A 3ZE6A 1S0OA 4IX1A 4ETNA 3B48A 3ZHZA 2QQ0A 2G1PA 1HV8A 3O91A 1FIQA 4PZPA 3DEEA 3HEMA 3HACA 4X1YB 4BP8A 2BUCA 5LVAA 2Y3IA 5LKRA 3O84A 1KEJA 4OSPA 4Q3NA 5E79U 3DT8A 2EAOA 2QTZA 1XMPA 3EMBA 5JC8A 5KYXB 2HRQA 1NHWA 4NBVA 4Z7QB 3BA1A 4JS0A 1YULA 4X8LA 2XWJI 4FYVA 4V0QA 1M2OB 4K2HA 3KUKA 4WJKB 2KHZA 4PXSA 4XD7A 1JR4A 1K7EB 1Y34E 1DWPA 3RVSA 1FLDA 3R41A 1NBIA 4FR0A 1L5VA 3MBIA 4UFNA 3MR6A 2R2AA 2X0KA 4LNUA 5KWSA 4NLGA 4JMLA 1GJRA 1FS6A 3M1LA 4TLAA 3TIXB 3VR4A 3MCWA 1UOEA 3R5TA 5JFOA 1V26A 2FXVA 1YR9A 2HPAA 4OIMA 3GUZA 3HZRA 1T2EA 4ODIA 1RYBA 4OHVA 1HUQA 4E30A 3JAMA 5EJEA 2XBLA 3ZCVA 1T1IA 3BICA 5LDGA 3ZEIA 1MZVA 3L0PA 4WZBE 5BMVF 3CKLA 5AW8A 3ZXUB 5ADVA 2X3UA 3LBAA 1FRFS 2C82A 1A9OA 2X0NA 1QP7A 4CETA 1AKWA 3I2KA 3OHMA 2AOTA 3C2LA 2PGLA 2MT9A 4G9EA 5KG1A 9LDTA 4QTUB 3UKOA 1DELA 5SZKB 1LDEA 3EFBA 2H85A 3IODA 3A4IA 1CERA 4IBOA 4OBXA 2K89A 1F6BA 2DBVO 3FWZA 4P53A 4CIAA 3CINA 3VAAA 5KBYA 5ICMA 5MHTA 5SZJA 2KP7A 3VKFA 2P2CA 4LQLA 2OK8A 1YT3A 1R12A 3EFHA 5A4AA 2A7XA 1KOFA 1OY1A 3ABSB 1E92A 3BH6A 3ZH2A 5D6NA 1C7FA 3ECCA 4RYDA 4EG0A 1WYGA 1MX1A 2Z2YA 3NEAA 1CHDA 3IP4B 2V5VA 4BJ1A 1I1NA 3HRHA 5AXAA 1EB9A 3GILA 1BA2A 3TR6A 1WVIA 3NGLA 1V5IA 2YV3A 3KZIU 4QC2A 5KOIA 4WKBA 1SO8A 1GNLA 4B6GA 4AF6A 2IJGX 3UOGA 4IXMA 3KR0A 1S2MA 2VT2A 3MAGA 2YXLA 4JWMA 1SU7A 2PWBA 9ICJA 3BRCA 3ZGXA 3U6BA 3QE2A 1XEXA 3ROXA 1TCCA 1UP7A 3PVCA 1AE1A 1JG6A 2QJRA 2OP0A 1QNLA 5EJ5A 3MT7A 4QSMA 1DJMA 4ER7A 3RRXA 4R9NA 3V7NA 4QOJA 3PQDA 4Y98A 1T2AA 2G88A 2J30A 1QIIA 1USUA 2RH8A 2ZETA 1PL8A 1A77A 2PX0A 5DHRA 1SQGA 1Z00B 3PX0A 1SHZA 2E1FA 2O3SA 2XUHA 3FJ1A 5CVVA 3KTFA 2E18A 2H3QA 1C8KA 1E6WA 2X7XA 3UGKA 1O0CA 4RKQA 1KBZA 5IM4A 2VJAA 4O2LA 1AY0A 2ZUSA 3DBLB 1V85A 4KR0A 1GNPA 1QSLA 3EZNA 4AULA 2AQ0A 2H00A 3RGWS 1BKYA 1CS0A 4DJDC 4YIHA 3OD1A 3AOEC 5JD6A 3IULA 1RMQA 2A1TS 1PV1A 3MD9A 5AD1A 1NBMA 5DB7A 1RR6A 4DOMA 2ZVPX 4I2CA 2G82A 3T9FA 2P8JA 4KXNA 4O4HB 3OJFA 4PYMA 4J0JA 2BONA 1DFIA 3IKMB 3NX4A 1DDGA 3O6VA 1TLLA 4I4CA 4BFZA 1E7WA 1GSIA 5E7IA 2HWWA 3LKVA 1TM7E 2RH4A 3RU7A 3LUJA 5I8PA 1Y7LA 2QUIA 2O3TA 2X5XA 3PNLA 3F6RA 4C05A 1JXAA 4KLNA 4EF6A 2PMWB 5ILOA 3AWDA 2C78A 4IR7A 1RACA 3QW4B 4JEMA 1HXHA 1YS9A 2NO9A 5DTQA 4XA5A 4QHSA 4B7AA 3QTTA 3WBJA 3AY7A 4PAWA 3IIMA 3X2EA 4J6EA 1XK6A 1OIWA 1D8LA 3QX8A 5CJ2A 3LC2O 3VUEA 1PJZA 1YI1A 1C1DB 4R9VA 1ZRMA 4BFWA 4BKUA 4QT4A 3M1IA 3GW8A 1UBUS 1SOAA 1ID1A 3A9UA 2EZ9A 1RJDA 1GQOA 3I30X 4LAFA 5IZCA 1MQAA 1D6SA 9ICRA 4O5EA 1RXCA 2EVWX 5JU6A 3EDMA 4CWAA 3D6FA 3OM0A 1RQLA 1LTKA 1WW8A 4YCDA 1TNDA 3UT6A 1TJPB 1DMRA 1EUCB 2HLDD 2MRLA 3I83A 3RB3A 4BV3A 2C2RA 5BQPA 1SR8A 3FCUB 2QZ4A 4AYBF 5A03A 4O5OA 5DLFA 1XTUA 2AN9A 2YOFA 3SZLA 5AVOA 4WJLA 5LZ4A 3CPHA 3EIHA 2RKBA 2AZDA 4YMMA 1V5EA 4YCXA 2A88A 3JYNA 3MW8A 3ZWDA 1SXJA 4NXNB 4IG9A 1W35A 1YBAA 4WA7A 4CDMA 5LU8A 3U4HA 3WMFA 4B80A 1U6JA 2IW3A 4X62B 1SKSA 4A0HA 5A9TA 1FEZA 5J9FA 1YMQA 4ELUA 4FN5A 2QAGC 4HO1X 2ZAGA 3KR2A 3SXJA 4CRWB 2G3YA 5E9WA 1P1IA 3O26A 1DEXA 2VHUA 4BJ5A 1XVVA 4DPLA 1UAAA 1IATA 1OPRA 2CJFA 1LZLA 3SFVA 4ALJA 4CF4A 1ZQHA 1U1GA 2UVDA 3MMSA 4JLDA 4LRUA 1G42A 1T8UA 4A6XA 1K66A 2YJZA 4QBKA 4WSOA 1CHNA 1JKXA 3UWDA 5EWLB 4OB8A 3INYA 4G0PA 4I2FA 5H9VA 1WF3A 2MU1A 8ICPA 4J94A 4R3UC 5LQUA 3HBJA 2ZJ6A 3OP1A 2VUTA 5TZVA 2I34A 4JBIA 1QAOA 2RRDA 4EB0A 5DRTA 5DW3A 3S55A 4DDWA 4YACA 4CMEC 2VWQA 4H6PA 4L2IA 4XVCA 2NSDA 3TW8B 3MR3A 2LIPA 1F6WA 1IFXA 3KWJA 3O3OB 4I1PA 1NOKA 2SICE 2IZ1A 4IUDS 1YRQA 2GZ2A 4UE3S 4O2RA 4JXJA 3GPIA 4IDOA 4MUFA 1ZQMA 3SJUA 1FPMA 4TS3A 5AK6A 4XW2A 2E2WA 1NP3A 2NU9B 4C3OB 1AUVA 4ZREA 5F7OA 1QQBA 1MZPA 3NHYA 2CUZA 4ZICA 4LGCA 1GILA 2XO7A 1YNSA 1H6AA 2W4QA 2WJ6A 4UVEA 5EJGA 2AZXA 1TKCA 3L7CA 3E9DA 2C22A 1NK6A 2UZ1A 1G6OA 2GHIA 1QZXA 1P7WA 2RC5A 2WC1A 3QZ8A 5KFGA 1A72A 2HNBA 2PIAA 2R2GA 2WAAA 3PI7A 4GKAA 4BNZA 4CN8A 2C8VA 4IQGA 3DC7A 4JYZA 3QUTA 3NH9A 3ORSA 5ARBA 2VDWA 2DUYA 4MTLA 4CM8B 5KG7A 2P5YA 3H4VA 4I8XA 4RTKA 5IBRA 2O5EA 1T91A 2I7VA 4R41A 3ZOKA 3D6UA 1NW7A 1AVTA 3VVBA 3EQ8A 5EE1A 3W2EA 5HHTA 3PXBA 1FPQA 3RJJA 3QHPA 1R37A 3LT1A 4MQMA 2XHEA 3RH0A 4TV8B 4EHDA 4IMPA 3FSGA 1M5UA 3COVA 2ZQ5A 1VKHA 2J6TA 2QV7A 3L7KA 4G1EB 1J8DA 1Z5OA 1FNBA 1FP7A 3PC4A 3NDIA 1SXJB 3V6LA 1COWA 4LVUA 3RYFB 4GM1A 1VOTA 4TMZA 1MQ3A 3WKCA 2A67A 3GZFA 2JJMA 3E9ZA 3U0VA 1Q77A 1F12A 1GXSA 1E7SA 2VPQA 2XWSA 1PO7A 3B8HA 4PQYA 4QYTA 2Q49A 5K3BA 2VPWA 4G9BA 2GEBA 3M4XA 5I5GA 4U2EA 4ZGBA 1KJ9A 3K0AB 7ICIA 1E3LA 3SLKA 1IN4A 1BQEA 4PONA 3L43A 3L82B 4RHTA 1NVTA 2WB2A 4DV6B 2HBLA 1NL3A 1KNXA 4KLHA 2Q8NA 2OMKA 3SN6A 1N0HA 4HRAA 4FZVA 3GH1A 4Q3KA 4RZRA 2ZAMA 4ZVNA 4ESVA 4IR1A 1P4HA 1EXVA 1R4AA 2XI4A 1NQWA 2G8LA 3MZ0A 4WWHA 1K7XB 1PQUA 2BSXA 2W2KB 3JZFA 4CVNA 3WGZA 3THWA 3SE0A 4Z54A 1PJQA 1N5IA 2WA2A 3ORHA 3V42A 1JTFA 1GFZA 3IKTA 3WP0A 3VNAA 2XMCA 3FBTA 2C7QA 1EDEA 4XJXA 4BMNA 1J07A 2OAEA 3CVUA 4H7JA 2W2MA 2PR7A 2J0UA 4L22A 5ILQA 2EGHA 1V37A 4NYMQ 3KTAA 2VSQA 2HK8A 3JQ7A 1NP6A 1ZJZA 1G9SA 1H94A 1TVMA 1KY4A 4PAGA 1VPLA 5BO5A 2XE7A 3UV6A 4NJMA 1I4EB 2XUIA 3FFBA 3ZGNA 5L3ZA 1U3CA 3KYCA 1FJXA 3MJSA 1D9DA 3HP4A 3VO9A 1EHIA 5JHHB 4YR2A 5DTMA 3LCCA 3T54A 2Q45A 1CTQA 4M9SA 1KBOA 1F44A 4QWAA 3MJ4A 3ZWAA 4ZYVA 1CUIA 1F14A 1EP1B 4GZMA 4Q6WA 4LDRA 4BBJA 1UODA 5CBKA 3FX2A 1HBJA 1LS6A 1JA9A 1QLNA 3C87A 3DZ8A 3IOMA 4N7BA 5EEHA 4GWGA 4KW7A 4EJMA 3WNZA 5BUZA 4IKEA 5LYJF 1KR5A 1QFMA 3JU3A 3L1KA 1JIIA 2VRBA 4LOIA 1J42A 1MO3A 1J7JA 2OM2A 3B6IA 3U1BA 3CVVA 2GCPA 1MGPA 2O0MA 1J24A 2YNMD 3FLBA 4UBCA 3HNPA 2HMVA 3K1YA 1NVFA 4YAOA 3RVRA 1GQYA 5DNVA 1COOA 2DTDA 3K4HA 4MPDA 1W47A 4DUGD 3THRA 3B3GA 4I9HA 2IP2A 4RS4A 5EP1A 1I3OA 3RFFA 1ZD1A 1NW5A 2WM2A 3W6PA 4KLLA 1SZCA 3SZRA 4I1SA 1G2QA 3CLUD 2XE6A 4HXGA 5DQIA 4OXXA 5ALIA 5BURA 1UXIA 5C51B 2C3YA 2XMRA 1Y1QA 5SY4A 2KLBA 3QUAA 3WISA 3DZHA 2VUUA 3PQ4A 2PAAA 5FPPA 3FPEA 4LZDA 4D4GA 5JECA 3Q41A 2O14A 3HRIA 4HNGA 4B35A 1C14A 1JAXA 2FEKA 2I80A 1C2YA 2RB5A 3DHYA 4HDKB 2F1JA 2BR3A 2IZOA 1NA5A 4I4LA 1ZFNA 2QEQA 3OZSA 3NTVA 4GU5A 3QY9A 4CUJA 5I4KA 4C6TA 5CCEA 4L5CA 1EM8B 3E82A 1COZA 1CY2A 1O57A 2EW1A 2FN4A 3MBOA 2DE0X 2GETA 1N61A 3EAGA 3QEMA 3TX2A 4J1TA 2ZBEA 4L6CA 4OAOA 2JLXA 1ZJMA 2HSWA 1MJ5A 3WGTA 4JX9A 5J0WA 1AKRA 4YHHB 3VTKA 3KZKA 3PIIA 5LQJA 1PP4A 2M6RA 3EQ2A 5D1NA 1G16A 2F90A 3HJRA 4W9NA 3E7DA 3D4LA 2YHIA 1W9HA 4G0ZA 1BW9B 3SG0A 3L6RA 3IELA 4JQCA 5KFBA 3ZK9A 1KC3A 4M83A 1Q0UA 4V1CA 3RSFA 5HSGA 4RTMA 2QX7A 3AUOA 1H69A 3PD7A 1QU2A 4LMAA 4EY4A 1JHPA 2NX2A 2H1IA 2XKAA 3IUEA 4O1IA 2MYUA 3F5SA 1FZQA 4EI2A 3LRPA 2JZBB 5JEEA 3WNDA 2GUWA 4TYQA 2WFZA 4ZOLB 1YRHA 1X2EA 5KTRA 3DSRA 1JF8A 4L8GA 2KBEA 1XROA 3LFTA 4W82A 4HN2A 3NVWA 1MOZA 2B3TA 2P4UA 1G3IA 4N5HX 1JSZA 1RQPA 5LB4A 3UXNA 2VBFA 2V4RA 4IEIA 1MDBA 1E2MA 4GLOA 2XVTA 2ZRNA 1DBRA 5G2OA 4HVAA 2L69A 3IP6A 4HYQA 4J9UE 2EAUA 4X8MA 3IG8A 1I1QB 1U7WA 1K8YB 3SF0A 4S1PA 3H1BA 1PJ4A 3I2FA 5JAIA 3DZCA 2ZANA 3HJEA 1NZBA 2G7ZA 5DB4A 2C2EA 4FR5A 3RC9A 3SR0A 3GP5A 2JKVA 4QJIA 4YAJA 4B84A 4KRFA 4ZEWA 1H0RA 2D5LA 3B1YA 4KBYA 4CIXA 2O8EA 1ZQSA 1ONBA 2DQYA 4J9KA 2A5GA 2HPZA 4MVJM 3ZBPA 2BCUA 2VAWA 3L02A 3MFYA 4MAFA 3VXKA 2E4YA 1AS2A 1JAZA 3NWEA 4P35A 1CUJA 2QRPA 2EAMA 4PJ0U 1NXWA 3EXG1 4F12A 1W2WB 4EY6A 4C4RA 1FYWA 5E6SB 4ZCRA 4K8RB 1RCUA 1CJCA 3OO0A 3WB2A 1JFTA 1VC2A 4OU4A 4C76A 4OJPA 3ONFA 5FF9A 3LWMA 1LDBA 4O59O 3BCRA 4PC2A 5I9IA 4QOHA 3EUWA 2H5JA 3OIFA 1B1CA 4GXKA 2V1UA 2W93A 4WCFB 3L7IA 3VU8A 3EVNA 3QWFA 4JVLA 2QT1A 3RYHB 4NNJA 2X15A 1O1YA 4V1CI 4BB5A 3GGPA 1KMQA 2W6JA 3NTOA 5FQOA 2ZM6B 3EPIA 2AE2A 4R71A 1VCHA 3OIYA 3QYFA 4EB8A 4EO9A 5KVSA 1N0IA 1N4AA 3NETA 5ALWA 4RM2A 5KJEA 1J5PA 6YASA 2MSLA 1UIMA 3FKSA 1UH5A 2DAPA 3ISBA 3PYMA 1YOBA 3TVDA 5BR1A 4ZHQA 1EFAA 2I9GA 1GTSA 4TKLA 1OLUA 1ZCBA 4L73A 3WGMA 1PJAA 2WVJA 3H5TA 2LYAA 3N70A 5E4YA 5AVUA 1K97A 3VI3B 1ZD4A 1A8IA 4ZN6A 3F7MA 3D8BA 3KOMA 4R2XA 4OI1A 5DP1A 2ACVA 3EFOA 1EVYA 4HFNA 3GMTA 3GOHA 3VYSB 3ROFA 1MX5A 4ROSA 4CKYA 3NGDA 3V4OA 5CHGA 1CE8B 4TTPA 1PSZA 1JQ3A 1UA0A 2IV7A 3U1TA 1WMFA 3NAGA 3JALA 4HWPA 1VGRA 4LVCA 1JMYA 4HTAA 4KC0A 3OAAD 2IPXA 2K4EA 2HXYA 1MJNA 1BS1A 1XJWA 1S2IA 2KMDA 2IHVA 2OZLB 4YEDA 3VPFA 1NN1A 4BFSA 4BZZA 4D6XA 5J2EA 4GYYA 4BQSA 4NF2A 3CZCA 3FTQA 4B3MB 3N4MB 2GA9A 2TMGA 3IUJA 2VJDA 3FMPB 4OJMX 4AP5A 2Y27A 5T64A 5CFLA 3QKSA 821PA 1PLJA 4GO1A 4N7MA 2IHYA 3D7RA 4MRAA 1RADA 5IUJC 4E2ZA 2VYCA 2AOWA 5F5NA 3H8VA 4DSAA 4HSGA 2NO0A 2JIOA 3MYYA 3OZXA 1LW6E 3OZDA 2Y1JA 1VJCA 4KR3A 1JVBA 2QF7A 4MWGA 4RE5A 3ZX5A 4E09A 4MDEA 3CUWA 2HHXA 2GR9A 2QE6A 2Z8XA 2YIDA 3H7AA 4LN1A 3WLTA 5KFMA 3Q0TA 2W43A 3ODGA 3MGHA 1DKNA 1BWPA 1NBAA 2VHEA 2YN2A 3LF1A 4R1MA 1EG7A 5CDFA 5IP5A 4P2BA 1YE8A 3SZOA 5TR9A 3D6MA 1UFRA 4MV7A 1J0CA 2MJLA 1DRKA 3TEFA 3JYHA 1DO2A 3IUPA 4DO9A 1CJMA 1X8JA 3GBPA 1M2VA 1RKBA 1KVRA 3CX3A 3KE8A 2QOEA 3N2ZB 4C29A 3GJ0A 1P1HA 3OQPA 2ACWA 1SG6A 4AWBA 1I0IA 2ZBRA 3FTPA 2H3VA 2PUVA 3HDHA 2ZCUA 2W9BB 3PC8A 5H4GA 4IIJF 1OJ7A 3TTSA 1THZA 4NV0A 4NHEA 5C1OA 4US8A 2PMBA 2I2AA 5IUKC 2UYCA 3LSTA 5HMLA 2XE4A 2DFKB 5DCLA 4F60A 4MEBA 5D6OA 4FC7A 1U8FO 4TTSA 1II0A 4XSGA 4RA6A 5LQRA 1DAEA 1A8HA 2ZYRA 3K75D 1LPPA 4M3NA 2YZKA 2VTVA 2ZIFA 1MLDA 3OJLA 5F5LA 5FL3A 1K88A 2FGKA 4U2BA 1YR8A 5IDYA 3MINA 1V9LA 3F3MA 4RLFA 3LCVB 3ZDZB 3EXG2 3F6CA 3LIPA 4HDAA 4CMCA 1FL9A 2WJGA 3I2JA 1RLJA 1T9AA 5JFGA 2BFDB 3CISA 4CM3A 2Z8YA 4TM8A 3UMSA 4L6AA 3A37A 1NUTA 4TWRA 2OG2A 4GOLD 5EPUA 1OWLA 1T9DA 4H2DA 2D5AA 5JLAA 3RTCA 3S4YA 3SJBA 3WBBA 1USWA 3WLEA 3EPHA 3GPCA 3GLUA 1QFZA 1ORIA 3UAGA 3TJZA 3A6ZA 4ALIA 3AYXB 2BRUA 2P2SA 3PXUA 3C45A 2R6AA 1SC4A 3VZRA 4RPJA 4DQXA 1VJ5A 1NNSA 1W2GA 3WJ7A 5BNTA 2GJSA 1YQEA 1T2FA 4EPWA 2WFMA 3L49A 3LXUX 1ZVKA 4MDHA 4B3GA 5KFYA 5FO0A 1DPFA 1K8QA 3N2LA 2QZ9A 4YIKA 5CLFA 1SZJG 2EBHX 1J90A 1T34A 3IP9A 1T36B 1ISGA 1Z4KA 3QU7A 2RI0A 4NY8A 2REBA 4P81A 4P36A 2X14A 5IXYA 2AK2A 4HJRA 1H2YA 1EDDA 4CLOA 3G8YA 1JI3A 4NBUA 4XM1A 2IQ5A 1VJ1A 2JA2A 2LUOA 5FR1A 3BMNB 1R8QA 1SM4A 4GQIA 3W9UA 5K0FA 4JJ6A 3AFMA 1W4LA 3Q8QB 3DFMA 4LZNA 4A16A 2PUTA 3R9WA 3DR5A 4MV9A 3HWWA 3ZU2A 4A03A 2AN3A 3TBKA 1J1UA 3PPYA 3U3RA 2FWJA 3D6VA 3E9QA 1V2HE 3HA7A 1DQZA 1PYGA 3P19A 1G8AA 3JPNA 3TS1A 1A5BB 1X1SA 5CB1A 1IB6A 1XK7A 2OHHA 2ZXUA 2E21A 5J2GA 6NULA 2FFHA 2FMQA 1BCRB 4KAAA 1X6VA 4DM4A 3JZDA 4A27A 5C7YA 4EYIB 2CMDA 2VPTA 5EIWA 3TD9A 3U13A 1HYHA 4M98A 5BUCA 4W5TA 3DXFA 4N6OA 2DFLA 3KYDA 2YMQA 1JBEA 2X86A 4TM7A 4HH1A 5C5IA 2B7CA 3MWJA 2KEYA 2FPGB 1NVUQ 4RUCA 4H3SA 3NHMA 1VE7A 3AY3A 4U6NA 4AUKA 3FNRA 1Y5LA 2CXPA 4PRKA 3SR4A 1Z33A 5TJ9A 4CIBA 5LSAA 1X3SA 3GRZA 2DUJA 1GTRA 3G9ZA 1XDWA 5F51A 2XMDA 3RVKA 1Z19A 3O4JA 1FVHA 2KSOB 3HKCB 1OTYA 2O07A 4BTVA 3B1ZA 1G20E 3FZEA 1HKHA 1TEHA 1X7ZB 3MQFA 4IGEA 4IDHA 4J2TA 4JLKA 3WYAA 3JRWA 2QE7A 1PWYE 3O82A 3D1LA 1IM4A 1HSOA 3ANMA 3CF2A 4RA9A 4FCTA 4EMTA 4YQFA 1JILA 1V11A 4IHJF 4YCLA 1RIIA 3CB2A 3QA3E 2AU0A 3BD6A 3EXHC 4ND8B 3EGVA 4TUYA 2KSOA 3HKCA 4EY8A 1W76A 4FILA 1D0VA 3BTUA 5L7YA 3B3FA 3U81A 1P7PA 4U3JB 1L4KA 5J1SB 4MEJA 3DMDA 2Q5QA 4Y1RA 1ABEA 3UJAA 3U9LA 3F98A 3OQBA 3SZ2A 1P2GA 1P5HA 2OHVA 2E1RA 2ZEJA 3I42A 2PJDA 4NECA 4DWIA 1UOOA 4XSVA 1D2MA 3FMIA 3O03A 1SCIA 1JROA 3JASB 4FCCA 1PV4A 3V8QA 3M5DA 5EZYA 3QSYA 5EJ7A 3A70A 2HHJA 4K6OA 3RJFA 1MAVA 1ZK2A 2CMKA 2GPNA 5KMGA 2GXUA 4QWWA 2Z5GA 1DBSA 4P8RA 3SC2A 3EIWA 1KN5A 2BGRA 1P8AA 2J33A 2AK3A 3HDYA 2OAQ1 1A97A 1J2RA 3SI7A 4UQOA 5DTIA 1KYYA 2JCGA 1UP4A 3O83A 1Q3KA 4GXQA 3H9EO 1IZ8A 2P1ZA 1ZWKA 2ZQYA 4MVJF 1I4WA 2RGNA 1MF7A 1RAGA 4Q3EA 1T4CA 4FYWA 4E5DA 4ESEA 3FR7A 1NK4A 1PKEA 1XZFA 4G9GA 2ICAA 1LPNA 4L16A 4WRRA 3ZJYA 1Z0UA 3VA7A 3H4TA 3NM4A 5ECYA 2X3FA 1QGED 3AM5A 4CCWA 4CKEA 4BATA 1LXCA 4KYTA 2PI4A 4DR7B 2V98A 4LGVA 1OXXK 4HGPA 1JHDA 5F78A 3SNHA 4DMMA 3PHHA 4WKOA 1NF2A 1NK9A 1Y3AA 2DHQA 4OQNA 3FETA 1NY6A 2WU1A 3BOSA 4ZYTA 1H2EA 3AF0A 3PJDA 1YL6A 3N2YA 1RQ7A 4L8WB 3BMQB 4EB6A 3IBYA 3E58A 1OLSB 1ZP6A 4EX7A 2AC7A 3CF4A 2FEPA 1E4EB 2VT6A 3IMEA 3M6AA 2ZSKA 4CIDA 4EPTA 3PQ5A 2FU5C 3LUKA 4R1NA 1P19A 4TS4A 1YQQA 3W6ZA 4DXDA 5FUQA 4QZGA 2ZSIA 2WICA 1K9SA 3RVJA 3U4DA 3KEMA 4J07A 4QJFB 4LJ5A 3A6GA 4B3BA 2ZIVB 2AW5A 3TAQA 2OO7A 3IDAA 1FFUA 4DDHA 3QVGA 4Y7CA 4I4TA 3VX3A 4W1SA 1IXYA 2G08A 1JZQA 3CEHA 3OJCA 4ENSA 2RI6A 3CYFA 3QW2A 3HK2A 4F2SA 4EZIA 5HR5A 2VDUE 1OR8A 1EAMA 1OX5A 1KEWA 1P33A 1UZUA 2OECA 1WQ4A 2OCLA 3F0TA 4Q4HA 3EPLA 3BRQA 1LSSA 4YJFB 4RZHA 4OHRA 2G1KA 4BZXA 1R0BA 3KL4A 4ZC8A 4D9FA 1U0HC 3JQ7B 4NOKA 3LPDA 4N01A 1I6LA 1XWLA 5IN5A 4EA6A 3DLHA 1SVMA 2OHOA 4MAAA 4DA8A 4AX4A 4K9OA 1RWKA 3DG9A 1I2ZA 1MJFA 4YP7A 3ZY3A 3E9YA 3QPCA 1V3TA 2GS9A 4YLYA 2AFRA 4FYIA 3KAKA 4G0VA 4L9WA 2PKXA 9LDBA 4BE4A 3OJUA 2ODTX 2XSZA 2XYRA 5DOVA 3VR3A 2B9VA 4KTTE 3BL5A 2NXNA 4G26A 5BSFA 1FFGA 4OAQA 4KTQA 4N47A 3G2HA 1QBKC 2Q6TA 4B2IA 4FOLA 1VG8A 4DBZA 3U4MA 2VYND 1FTSA 2X40A 1NOMA 1U65A 3U7RA 3G5LA 3HXQA 1SOWA 3OQNA 2AGPA 2R18A 3EXIA 4OQQA 2WTUA 1HRKA 1DDOA 3KJGA 3FRJA 2CWWA 2G40A 8AT1A 1U0NA 5LFAA 1RZRD 4ZYLA 2RGUA 2VHCA 1FNMA 2J85A 3SP1A 3T7SA 2YMMA 3U80A 2PL5A 4XQCA 2A8YA 4RHXA 4MO2A 3R5XA 2BD0A 1GLGA 3HPQA 4ITUA 4GZ3A 1B43A 2YMPA 1XVAA 3EXAA 1F0YA 2Q4RA 1OE0A 3MMXA 4Q0MA 5E6UA 3II6X 3VOBA 3URMA 4FDAA 4RV9A 1Q0LA 2YZGA 1C0IA 1RZTA 1E9VA 2OCIA 3IQGX 5L8VA 2XWPA 1RI5A 2W42A 3M4ZA 2SKDA 5TX7A 4JD5A 2Y67A 3AVXA 1T3LA 3JQRA 8ICOA 2G4CA 4IVRA 4BGUA 5C53B 4WGFA 1WXIA 1NM5C 3T0GA 4LY6A 2QP3A 4AT1A 3KPWA 4RMHA 2NVUA 1R10A 2BCVA 5AKEA 1UEIA 2RBEA 3FPAA 3NW9A 2H18A 4BVEA 2CNNA 2EQAA 2VDWB 1NXSA 4LF8B 1DIBA 2WYWA 4NAVA 1SVWA 3COZA 2BCRA 3RUFA 1OD6A 4G07A 1LDYA 5J0SA 2DKOA 2ZIVA 3FCOA 3AKZA 1T5TA 4US0R 5ECDA 2J5KA 4TMWA 4AKEA 4TQRA 4CM9A 8ICGA 1A8PA 1C29B 3HXLA 3JALB 1QH0A 4PIPA 4QEKA 3PNCA 4U2DA 5DYTA 5THKA 3J81A 4M1EA 2WZBA 1IHDA 4Q24A 5BQFA 2NXJA 4IJKA 4PG8A 2FWPA 1Z0AA 4QZCA 1KK3A 1V48A 1WCYA 2OV8A 3NR2A 1NN0A 1YASA 1T3QA 1V9CA 1FYFA 1QK5A 1UOQA 2P41A 2V65A 3P9YA 1XWFA 4QHTA 5K3EA 3UMFA 5AKXA 1CXZA 1E9EA 2IL1A 1Y8QA 2WMOB 4M8IA 5JRDS 5JZ9A 4GKKB 2W9AA 1IXSB 2QJOA 5EMKA 1JP7A 1IZYA 1DJOA 3TZKA 1PQWA 5I48A 3TLAA 1QCYA 2RLTA 1C3XA 1M0TA 1M1NA 4KQKA 3G6XA 1REQB 1Z2OX 2AFHA 4K9NA 1FOEB 3NO4A 4K6GA 3EPPA 2AI2A 4L57A 1EB8A 1IH8A 3S27A 3EJWA 4DOBA 2C03A 1ML3A 4J1QA 5FI1B 4B7UA 1B15A 4YUZA 4QGGA 4LFAB 3GNTA 3RDPA 5F73A 1GPH1 3N86A 2LXNA 2VK8A 2AI3A 3BGIA 3RYCB 4F5PA 3EZXA 5IHXA 1H2RS 1DQPA 1JKJB 3OHAA 3DZFA 3JQGB 3PU6A 1AKMA 4KQEA 3T9DA 3AQEA 4G5FA 2QB0B 5FD8A 1KF0A 4R9RA 3S2EA 3AKEA 4O2AA 4C7JA 1VXOA 1RWWA 4KH1A 1XALA 2GEFA 3H11B 1C8LA 4KBFA 4M0MA 3E9NA 4H16A 1P0QA 3K0KA 1WKBA 3QEMB 4FJ2A 5FFFA 4C9BA 3CIFA 3OTGA 2BUBA 3V6MA 5ALEA 5K20A 5IJAA 2GD2A 3EWNA 4RIEA 5IBPA 4BFYA 1NVDA 2MR5A 4U0JA 3A7EA 3BGDA 3HPOA 4JA0A 5B37A 1EFLA 3GFOA 4MI9A 5EGNA 3WB1A 2JAUA 3K1ZA 1U81A 1BX3A 2OWDA 2QQ5A 1ZD3A 3HLYA 2HLDA 3IP3A 3MWKA 3NG1A 1M6YA 4IIGA 3TPFA 4HQNA 3I2GA 3M81A 4FMBB 3I34X 1HORA 2H06A 3IMCA 3Q7TA 3RGGA 4M1SA 4PO8A 3A0UA 5CWRA 2D8MA 4YRBA 1V8OA 3AQ4A 1R5JA 8ICMA 4MHVA 3BMOA 3E3LA 1OHHA 4CQLB 2GYVA 2WG0A 1MC5A 1TCAA 1TD9A 3CH6A 3WDKA 2G36A 1NI4A 1LZKA 1QH8A 2XDYA 1GUDA 1W5EA 1TUIA 2PT6A 4C30A 2NUTB 3BQTA 4UULA 3EJ6A 3I45A 2RCNA 3MCVA 3SEAA 1JHVA 1U5BB 2GESA 4DW8A 1KLNA 4WFJA 3WS7A 4BLVA 2IUUA 1F38A 5K01A 5EEGA 4J7CA 1AJEA 3KLPX 4V0KA 1NI4B 1LI5A 1NKCA 5ITZB 4FMPA 3LT4A 4W5RA 4R2JA 1TKDA 4FE3A 3IRVA 3W8DA 4DUPA 2R6CA 3RFAA 2WYUA 4C0WA 5FRDA 3ZDRA 1KGDA 1UCVA 2PEYA 2R3SA 4P4TA 4TWIA 3O9VA 4XUGB 4L9AA 5KNBA 1UR5A 5EJ4A 1QVVA 1BWQA 1JEDA 5HJ2A 3IBCA 9ICVA 4WXPA 3PR4A 5UKDA 2XEDA 2GVZC 3CLHA 3Q98A 2YB1A 4XVUA 2XCSB 1SCNE 4O3QA 4KAFA 1VMAA 1UQUA 1SNYA 4KRYA 4M1QA 2CDCA 1USIA 1X7WB 2XRMA 4XIGS 2NP7A 2AWOA 4K03A 3GJ3A 3RV3A 2GJ9A 1ONNA 2WHRA 2JXJA 3S8YA 2EGGA 1SUFA 1VQ1A 5CH3A 3G1WA 3FHCB 5JWRA 3ADBA 4IS3A 3OFJA 1YR7A 2VNJA 2VOJA 2XCUA 3NHJA 4KGDA 1PZEA 3KKPA 1Z6QA 2QB0A 3LYSA 1ZGHA 1QK3A 5T3YA 1TIBA 5EKXA 5JTUA 1E20A 3DDHA 2C2KA 1ZQ9A 1AXEA 1VSTA 2YJ6A 1E3WB 1DDIA 1GUFA 4XWWA 1NW3A 1UKCA 2B82A 4WZAB 3UAYA 4XAQA 5KFLA 2RGXA 1LDMA 4F5ZA 4CIYA 3S2UA 4KXXA 1GD1O 5JZVA 1ZM4A 4CU2A 1HQDA 2V55B 3C3BA 2WUDA 4OQYA 2IZ0A 4EB3A 3BF7A 3KXLA 2G63A 5C8ZA 4IV8A 4DMCA 2VDKB 4WFIA 3QMPA 3LSYA 4W5WA 3GEDA 4XLTA 3I0ZA 5BN5B 2AR7A 3V9PA 2VZLA 1QONA 5L3RA 3GFTA 1MC4A 2YBDA 3G2IA 4QAJA 1Q84A 5FB3A 1A95A 5DIFA 1B22A 2J5BA 1TQHA 5MN5A 2B20A 4GECA 3WLJA 4BMYA 3FMVA 4NCKA 5K03A 3IN5A 4Y9SA 2JFGA 2YQEA 1EH5A 5CA1F 4HAIA 4H0FA 5BNWA 5LL6P 4WASA 2DFDA 4RJKA 1W5BA 2X6RA 2JPDA 4UBNA 3H04A 3BRSA 3QY0A 1RJFA 2ZRLA 4W6QA 1ZNQO 1JDSA 2DP4E 3CZMA 3ELYA 3TXXA 2ZAOA 3K71B 4J03A 3SQIA 1EIZA 1TZ2A 3JD4A 2B5WA 4PZCA 2HV9A 1K5DA 1F6DA 4QU5A 3P4UA 3WIEA 1AMUA 4XX0A 3QXXA 1CR2A 1H0HA 2EV9A 3NHWA 1NW6A 2VJKA 1EDZA 3JPTA 3NOVA 4BRSA 3IILA 5C8YF 3JVDA 5C1IA 1HTWA 3BFKA 2QRVA 5T5QA 4AN0A 1LQ2A 4MQ6A 4PLWA 1Q7GA 4Y1FA 3VFDA 1IL0A 4FGJA 1D7AA 3FMFA 4HPXB 2BV3A 4D3XA 1HEUA 3G0CA 3H6KA 3H8JA 3FTDA 3KTOA 1RRVA 5EWJA 3RHZA 3KKOA 3RU2A 5FWNA 2Z3VA 5TS2A 2UUBB 2YBEA 3AEUA 2W00A 1P2UA 5KFTA 4KP7A 2XNHA 2HWXA 4GYJA 1JVSA 1N4DA 4Z86A 1QHHB 4QWDA 2OCDA 3B3QA 4TV9F 3MLBA 1RYSA 2I6GA 1N3IA 2OD2A 3F7NA 1TRKA 4BCDA 3F3KA 1ZIXA 1NQ5A 3MS2A 5JSYA 4RSRA 1OXBB 2HA2A 3KEOA 4WZZA 4HZUA 3H3FA 3H8SA 4MVJH 1WSAA 2PIDA 3MJHA 2GPSA 2Y1FA 3Q9SA 1L5YA 4K05A 4PYOA 4PSVA 1ACLA 1E0SA 1WMAA 1FBTA 1NRWA 4LXHA 3T15A 2G5TA 1XWIA 1KVUA 3E0FA 1HDCA 4NE9A 4NOJA 4WKGA 4WXEA 5BOMA 5D46A 3V2UA 4JLVA 4WOPA 2E7ZA 2HT6A 5AIAA 3FZGA 4CLRB 3CU5A 1NX9A 4G1FA 4XGQA 1N1DA 4KTVE 3DBOB 1QHXA 3PO5A 1FSZA 4D4IA 4DFMA 1I1HA 3PNMA 2A3RA 3PEUA 2LVBA 1VRVA 5H82A 5IK2D 4BFTA 1MD9A 2A4MA 3O2NA 3R0IA 1J97A 1H05A 5H4HA 2R11A 3TNJA 3WY9A 2HSJA 2JFYA 1MQ2A 2IPNA 1OFTA 3HCNA 1OPXA 4IH9A 4DUYB 3D8UA 4GF5A 1CQWA 2CUTA 1M7GA 1OKKD 4UB8U 3IBSA 1PJRA 1ECFA 4X84A 5H70A 4B4VA 1EUCA 3DJYA 3ISTA 5JDCC 4GXRA 4NZ9A 2NO4A 1TPYA 1XTPA 1QGAA 2OK7A 4G8DA 4EW2A 1KEKA 1U28C 4GKBA 4R69A 3DLIA 4FE7A 2FPSA 4Q3OA 1MCZA 2GWSA 2J3IA 2P3SA 3D81A 1U8TA 1WEHA 1QQ7A 3M6ZA 1M3SA 2H29A 3RC1A 2W6ZA 4F46A 4LDAA 2GNOA 4D6YA 4PZLA 3QOWA 4KXLA 4PR0A 1XXHE 4Q4JB 3RS0A 4DMFA 1ZAYA 5JNVA 4OLBA 1CEYA 1WV0A 5J0TA 3HU3A 1FXUA 3HXOA 4K7JA 3TUZC 3IEPA 4V38A 1K1QA 4EKYA 5I4CA 3H2BA 2CGEA 4FHDA 2IELA 4HZGA 3WLKX 4EQ6B 1Y8QB 4J9PA 2IPAB 2WILA 1LTHR 2ZRMA 1DADA 1G2OA 3DAFA 2VZ0A 2DY0A 3KSBC 1YONA 4JCCA 1FMFA 4ZU1X 1Z4OA 2D3TA 1TFRA 4P3XA 4F7DA 1F5NA 1FTYA 1XEFA 2J6IA 2GMWA 3NPAA 3CB4A 5EMNA 4PZ0A 2ZAIA 3K9NA 4DL4A 3SU8A 4A6DA 3L1VA 3L6EA 4HWRA 5EJFA 1Y1LA 2ZIUB 4Z6EA 3DBRB 5ERXA 3D5QA 2HRRA 3OUZA 5F3DA 2IYOA 4BFUA 4BQRA 4UXIA 5A7GA 4F71A 2F43A 4CMHA 4WFQA 1RQRA 3PPWA 4J43A 1WUYA 2ZIZA 3FHOA 3S99A 3WIBA 4YMWA 5LMZA 1BMQA 1QYCA 3GLFB 1MNQA 4P4LA 1QANA 5AOAA 5IBQA 2PUHA 3DCNA 5D5QA 3VDRA 3LCJA 4JP2A 3ZKWB 2Q3DA 5EZYB 4NATA 2CSUA 4P6VF 3BGVA 4XYLA 2D2EA 2ZVJA 4G0XA 1PVQA 2JLRA 2IKQA 3MC1A 4JB2A 1FU8A 1M1YB 1E7MA 2CFIA 2VYQA 3HWSA 4QRHA 4XR4A 4DSTA 5C8YB 2I4NA 1U0RA 2UKDA 3HYSA 1EINA 1PZGA 4QNLA 1U5BA 1X1CA 3H9CA 4DWJA 4L5JA 2OCEA 4ZYYA 3KFXA 4JQOA 1ZQ1A 4NYJR 4Z8XA 3RW9A 2HHTA 1N78A 3ICCA 1DGJA 3QLTA 2EQYA 2FJUA 4KFSA 1D6MA 3V33A 4R8MA 4CCAA 3VR6H 3DAHA 5FBKA 2P11A 4BKQA 1MBZA 3MIIA 3LK9A 5C7LO 2ZIWB 5L1MA 4I29A 1JIKA 3CN7A 5FKJA 1AK9A 1ST2A 2NO7A 3T38A 3TL2A 1UKVY 4WLNA 1BGWA 3DYVA 4ED6A 1TE2A 1XVUA 1PIWA 3KO8A 5KB3A 1YFLA 1KQQA 1X7ZA 2JFZA 2BGKA 1ZA1A 2D3DA 1QH8B 3ICWA 3LO5A 3Q8SB 2W5UA 2RK3A 1KL9A 1Y48E 1LPAB 4RDCA 3ZU4A 4WEQA 3R3SA 1TZJA 1T3NA 4MYSA 3U4QB 3C85A 1GN8A 4RDHA 4YBRA 3GBVA 3OLXA 4P3PA 3RTGA 2CZQA 1AQJA 1XL1A 1O4WA 3OOEA 4O63O 3HFRA 3U7JA 4E5SA 3PNBA 1C4KA 2BHRA 2UZIR 4ED8A 2P75A 3GQVA 4ERXA 9ICCA 2W6IA 2ZJ3A 1OXMA 2EG9A 2H4YA 2QVXX 3ZCQA 4L3WA 2C1EA 4KSYA 1E2NA 2O2YA 2AOTB 1PR9A 2A94A 2CD9A 3WRYC 2XXAB 4LE0A 2PRSA 4V3CA 4DG5A 5L4SA 3A2LA 1VE1A 4F8RA 4EECA 4CUKA 3OA0A 1G0NA 1OTHA 4EGFA 3QMVA 4PZZA 1DRWA 2F9FA 5JTIA 3LUGA 6PFKA 5JMTA 1JA0A 2IE0A 2VRNA 4KPYA 2VJLA 2Y1GA 1J2TA 4BNKA 1SBYA 2ZK7A 4ZEVA 2W4IA 1HETA 4ZEOA 3I1YA 4LOJA 3U17A 5CVDA 3W5UA 4P7JA 3A10A 1JIJA 4O0IA 3VR3D 4A8TA 4EWLA 4MLZA 8ABPA 5J2UF 3LDGA 3FPGA 2I6UA 2O20A 4PBSA 5JZBA 4YR7A 4IIXA 3WMEA 3AUSA 4Q7MB 3SXUB 4QICA 4FX2A 3GVCA 1GCAA 2VQSA 3DVQX 2JLAA 1J70A 1RHQA 2H54A 3ONVA 4GUDA 2XYPA 2Z04A 1SXDA 1AOXA 4LZZA 4XWYA 2BHLA 4B4WA 1W0JD 3BDAA 3B6ZA 3U60B 4Z4FA 4G1CA 1BXRA 1RD4A 2JAQA 1US8B 2VJMB 3A1UA 6ABPA 1W5TA 3U3MA 1ND5A 1U4BA 3PITA 4D9HA 4DZRA 1SV0A 4QWCA 3LGAA 4EENA 4NZOA 4RQUA 3I5YA 4HQLA 4U2KA 1G8KA 4BX0A 4DXHA 4PHCA 4NXZA 1U7OA 1SFRA 2AN1A 2D1YA 5KG3A 2P7IA 4TWJA 5DEIA 5ANRB 4ND4A 2XMSA 2OQVA 3TCKA 3ZCRA 1GUZA 7ICRA 3RVMA 2PVPA 2JGRA 1U7PA 4EHIA 1GLNA 5FR2A 4DLSA 1XX6A 2Z9CA 4H7FA 3G9UA 1YUMA 3GWZA 2V97A 4CCYA 4ZMBA 3Q3CA 4AY2A 3OLZA 4RY8A 4C14A 4HQ0A 1L7NA 2QRHA 2QRVB 1OUMA 3WLSA 3P9IA 1ZR2A 2AN5A 2WTAA 1H0KA 1CETA 1F8XA 4KQ1A 3U9TA 4AU1A 4EUSA 5IF3A 2CUNA 1QPZA 2M32A 1PUIA 3PPVA 2Q3HA 4FI3C 1DAKA 2WF5A 1Q3UA 1XIVA 3A4TA 3H5NA 4KQFA 3TH5A 4YN3A 1JH8A 2BLNA 3MJEA 4RJIA 1K1SA 1L5MA 3IPRA 4K26A 5ER6A 4A1FA 1NKBA 2VQDA 5L1LA 4Q4AA 4KACA 1LLUA 1VP9A 2ATIA 4IGKA 4CDRA 4DCUA 3BJEA 1EYZA 2GD1O 1OFVA 1QO7A 3A8TA 5DWDA 4YRIA 3WRWA 1KE2A 4MUHA 1K6XA 5DX0A 1Q92A 4JGGA 1Z0FA 2A19A 2ON6A 3HV2A 2IYSA 4RZQA 5E95A 4Z8YA 5FBRB 1NZJA 1Z75A 3CLKA 1NU8A 3O8OA 4K0RA 2VSFA 3L0YA 4K86A 2QX8A 4MUYA 1S3SA 4O2BF 1EBBA 4F5RA 4DQLA 2HQOA 1FFDA 4PHAA 3STHA 2Q1SA 3L4SO 1ZINA 2I6TA 2Q4EA 2P3OA 3RCBA 1PNOA 3ZW9A 2V4ZA 4WE3A 4ER6A 2NO1A 3EXIB 4BC1A 5KG2A 4AUMA 2ZROA 2YX1A 1EP9A 2D06A 1J39A 2MTBA 3HB1A 4HWTA 4OQXA 2FJPA 3F4LA 3MPUA 4I1RA 2PA3A 4Q5IA 5KYWB 8OHMA 1WBDA 3B6MA 1P2TA 1SJ9A 1G7RA 3N2KB 3GJZA 5ALZA 5DYGA 4PNPA 4KMUA 4KXWA 3PLAE 3FI9A 1BVYF 1KW4A 5BVGA 1JZSA 1PSWA 2NLOA 1JZTA 3FLEA 1VSQA 3QKWA 4ON9A 2E8MA 1C0EA 3V6HA 1CUXA 1I3NA 1XCBA 3K8ZA 1BPZA 1U1EA 1JVNA 4IRUB 4KO4S 1FFHA 3I5MA 4S2UA 5AVWA 1QU3A 1DT3A 2A3NA 3QZ7A 3L8FA 4PGYA 1U8UA 4DLEA 2YCLA 3LQYA 4I8IA 1RZUA 5FUXA 1U90A 2VH1A 1Z0SA 5BVGB 2PGJA 4U7PB 5BYAA 1FBNA 1D9ZA 1OSNA 2OB2A 4E2YA 2H5IA 3Q2IA 5AK3A 1WPXA 8ICQA 4X44A 3ZXXA 5ALUA 1RXIA 3EY9A 3R6DA 4JI4B 2CNBA 3Q8LA 1L1EA 2NAFA 3ID6C 1VJGA 4BNYA 1U45A 2PS9A 2WKWA 4DSNA 3A1FA 3OLWA 3OEYA 1S9HA 1KMHB 2RI1A 3HBAA 3RUDA 5F1PA 4BVAA 1EFRD 5CH8A 5BWMA 3UICA 1TA0A 2VUIB 1FUUA 1S2DA 2PQMA 3PHBE 3PXAA 1WB6A 2L2QA 4O3FA 2PMFA 2RAPA 5B55A 2XYHA 3UWOA 1EXWA 2CVOA 2ZB7A 4KLMA 1P4RA 3C3PA 3BE6A 3DXXA 4TL7A 2VT7A 2YC4C 4MSUA 4TXJA 4F4UA 2DFPA 3OCZA 3QG5A 5EHNA 5KTNA 2DT5A 2JI4A 1NYQA 1L7EA 4RLQA 3C2KA 4TN5A 3IQIX 1FYEA 2BFFA 4UAWA 1OXUA 4WK2B 4YUAA 2IV3A 2GOLA 3KWFA 3L7DA 1GKYA 5CG1A 3A32A 2QX9A 1PK3A 4OKSA 3L7BA 3VH1A 1U7DA 1YACA 2G8NA 3KSMA 1BVHA 4ECSA 2PD4A 5KX5A 3OFSA 1T0JB 3P20A 2OH2A 2XQVA 1M66A 2OVBA 1ETUA 2AEFA 3LOUA 4NEQA 2B8TA 1KJIA 2H4JA 5HKOA 3RR7A 3N07A 5I51A 4N82A 5H8WA 3H2IA 3AB3A 2BEKA 2OQRA 2RGNC 3WNBA 2E8OA 1SA0B 3RFCA 1V16A 5CITA 2FHSA 4A0FA 4XB1A 1ACMA 3QVXA 3RYCA 3KDPA 1IIBA 3HJFA 3U62A 1BS9A 3P71T 1EBUA 2CFTA 3PSTA 1KI1A 1YBHA 5KAFU 1G3QA 1HR0B 1ORDA 5ALGA 3GFRA 4M21A 1N9KA 3IA2A 3U0BA 1Y42X 1YD7A 1KJ8A 3R7FA 1F60A 3E5MA 4HRVA 4TGLA 5G53C 3I53A 3OZGA 3OPMA 3TZHA 3IQWA 2JBAA 2QQGA 3HCCA 4RY2A 3OSPA 2QKYA 4TKZA 5KKCA 4PN7A 3MQ2A 3A6HA 4ARIA 3PFIA 1ZUNB 4MLCA 1FXWA 4NV3A 3RE1A 3THSA 3WYCA 4CM1A 2I62A 1ZQOA 1QAQA 1USVA 4F9GA 2R68A 5A71A 3IQDB 5CDHA 1WNTA 1WY5A 3MPOA 3O8DA 4O2AF 4QQ8A 2XLBA 1CP3A 4CDNA 2KWIA 1MX3A 3SX2A 2GCOB 4PRLA 2C0PA 2FPIB 3ASZA 3FN4A 1R88A 3OBIA 2J8ZA 2QRLA 3KJIA 1QBGA 1CE8A 2GN0A 5I7AA 1CCWA 1D1TA 4E94A 4UDXX 1QYIA 4KE7A 2O05A 4LBYA 2HHQA 1RS0A 1NPYA 3MGBA 2J7PD 3N6VA 4UBJA 3TBHA 4D92A 1IXRA 5ES4B 2WAQF 5KWEA 3T61A 4Z2AA 2Y0EA 1WETA 2BGNA 4I14A 1Z56C 3GGCA 2FQQA 4MV3A 3DOUA 3CGGA 3ELBA 4X0EA 1YS2X 5J4YA 4MOWA 3HUTA 2QGFA 3W9BA 4F4CA 2IZZA 3UFBA 3X1KA 3ANXA 2VP9A 4IDBA 5C18A 3AHJA 1A04A 1R5OA 1ZN2A 3R8CA 4R01A 3OM8A 1NR1A 3EA0A 1FP6A 2QLTA 1ZMBA 2QORA 2YJNA 4QRDA 4J7AA 4KV7A 3ZWPA 4AKGA 4HDMB 2GLTA 2XIJA 1XTKA 4DNXA 4ND8A 3O4HA 4HAUA 1JR2A 1PV2A 2H3ZA 2I7TA 4J0FA 3OG9A 1T8WA 4K9DA 1Z07A 1PJLA 5JMWA 3OEED 4QZVA 1NMEA 1J49A 4CCSA 2N46A 3ABRB 3OHPA 4KQMA 1VSUA 4UB3A 4X3OA 3WO1A 3GT3A 5BPCA 2PVCA 4E7PA 4HMPA 1U0JA 2HLPA 4ZQIA 3MBKA 4WACA 2WAXA 2ZR9A 4FO6A 1DJPA 5JZMA 1LRJA 4PGFA 3DMRA 2ZTCA 4KHZA 2JG3A 1Z00A 4AUNA 3JQQA 4EEZA 1A0PA 2AMLA 3ZWXA 1P5ZB 1PWXA 3DLPX 3F8TA 2X9LA 1YE5A 5EJAA 2HBYA 1XEWY 4QBFA 1P0PA 4BO9A 4C08A 5FWXA 2Q0XA 2G06A 3M1AA 4EGSA 2PZFA 2BDUA 1O95C 1JIVA 3L06A 1PT7A 4FT4A 4PPYA 5TLSA 5LMNB 5TRTA 2BFEA 3HCWA 1ZYQA 5DBEX 1CZUA 3ANYB 1QG6A 4MYHA 5EWJB 1SQ0A 2FZVA 5C8YA 3UHAA 1UT5A 2IA6A 1GQQA 5GWXA 5AKIA 4OYLA 1CUBA 2YVKA 4OYYA 5J2BA 2HZBA 1D2NA 1WXQA 3KHKA 3MCAA 4MF8A 5KT3A 4ZVTA 4Z51A 3ESYA 3DLBA 2FDRA 2JDIA 2HJVA 1R0YA 4W5NA 3MINB 4WN9A 1BXZA 1CR0A 1F4VA 2FE9A 3GYGA 4GC7A 1O97D 1TKRA 2ONZA 5GONF 4CTKA 3KQHA 3AOEA 5IKMA 3PD0A 2Q1XA 4MWSA 3ZY5A 2QYOA 2IYVA 3OECA 4AY4A 5CDFE 3HZOA 4DFPA 9ICOA 1XKLA 1UJCA 4J4HA 5ESRA 1L8XA 1PL6A 3DVAB 3IEUA 2H07A 2WKRA 4D8UA 1BXGA 4UATA 4G84A 5IIJA 2J3KA 3PW2A 3D4IA 4E51A 3PLNA 5CYGA 3MR2A 4TX1A 3AR3A 3P26A 4JU8A 1RCTE 5ADWA 1Y4SA 2B5VA 2ZZKA 4PQGA 4BEJA 4U7DA 2QENA 1E94E 4P4NA 3DKPA 1QB7A 4ZIRB 4XE5A 1R16A 3C2MA 1YB5A 1TVKA 4N6NA 5FOUA 5LQNA 5HQTA 2GPAA 2EKZA 3ITDA 2LNDA 1P73A 2ZRKA 5FLXA 1G21E 2YS6A 2I1WA 3O73A 2GDJA 4E1BA 1RRPA 4PX2A 4I5IA 3WGOA 1S2OA 4X94A 2R5FA 3TLEA 4DR2B 5HTOA 4OLAA 4D4HA 4W5QA 2AGQA 4DS4A 4PG4A 4Q9JA 2BTQB 2WIFA 2QW8A 1ZH0A 1AKEA 4JUIA 4P7KA 5C81A 1QE3A 2VDRB 3RFTA 4CFZA 1KMCA 4QYMA 3QQ5A 1CJVC 3KEQA 3H4MA 3BHMA 1MC8A 1AB5A 1O95D 3IMFA 3L0CA 5HP4A 1OXSC 2VHXA 3E2EA 4ILEA 4Y1GA 1FJGB 4MVJP 2W83A 3NJ4A 1EEHA 5LQSA 2IV2X 5D87A 4B82A 1UKBA 3OJXA 3ESZA 4GOMD 2JH1A 1DKQA 4L4SA 4AG6A 3L1IA 2YS7A 3KHRA 1TM5E 1ADGA 1G5FA 1CUHA 3F97A 4E21A 2FN8A 3PQFA 5BORA 5LWHA 4TPKA 1J1ZA 2E8NA 1V1MB 4V0RA 4B4DA 3AI2A 2CDAA 3MWLA 4QWMA 1MT3A 4MV1A 3RR2A 2V59A 3V2HA 4JUFA 1Q44A 1Z6AA 3C3WA 5CH5A 3NB0A 3WK8A 1E60A 1B41A 2GVDC 3L07A 4HQ6A 1JI0A 4L5BA 4ER0A 1KO7A 2E1EA 1YB4A 2W2QA 3QVMA 3SM3A 1IIRA 2GHTA 2I1LA 1KVQA 4A82A 3E18A 4Q9AA 5HUQA 2EZUA 3FF1A 1WSWA 2JGDB 4JC4A 2AE1A 1TB4A 2V7EA 2YASA 3DTVD 2ZR0A 3O5AA 4LBZA 3ONNA 1BZYA 1SCQA 1WOMA 2A9OA 2PSFA 4P5DA 4U8GA 1AZLA 5AWFC 3YASA 1PSDA 4F4IA 3NRZA 1EDBA 4TMTA 4KR7A 1G55A 2P9EA 4BKRA 2WIKA 4M54A 1UPFA 2BKXA 5F4ZA 3AUYA 5AFSA 3FOBA 3Q5GA 2UVUA 3R8XA 3UOWA 4YMNA 3EXFA 3KHTA 3L6OO 5DLPA 1BDMA 1Z13A 2VPYA 2WEKA 4IQFA 4Y67A 1L4UA 1XG5A 2OWEA 5E1MA 1WVGA 2XNSA 4HF7A 3T4UA 5JNRA 1ZX1A 1ZLYA 5KL1B 1HZZA 4OXRA 3WQSB 5KU1A 9ICTA 2H3EA 1OGYA 2G76A 4S0ZA 3BULA 1K5GA 1P9WA 2W0SA 5JXIA 1JX6A 1T8RA 2W9XA 2BEJA 3OQHA 4UAYA 3E05A 2C8JA 3MUEA 1M0SA 4N5MA 3ZGOA 2OEHA 3Q72A 2ZZMA 3ESQA 3A6JA 5CVEA 1CQZA 3CO0S 1RAHA 3PCTA 4MRVA 5T3UA 2F3PA 1FUEA 4JQYA 4KLRA 1DE0A 4Q3AA 3WIVA 3R9XA 4QL3A 2VYFA 2H9AA 2A9RA 2J6UA 2VDMB 5EWMB 1G21B 2WQZA 4ZYWA 5H3HA 2KTQA 3VYTB 3RIEA 1K86A 2GKGA 5COBA 4JMPA 2A57A 4FZRA 2WFLB 4QYSA 1L7DA 5E3JA 5LQAA 3B1WA 2QT0A 4M53A 4IJUA 2AQ8A 3GO4A 1D0IA 5D5PA 3H4DA 2LRHA 3GUYA 3ORRA 4GX2A 3X1YA 4RXMA 2QXUA 1K8RA 4DC0A 3KB6A 4HOYA 1Z08A 4LZLA 3WDSA 4CLRA 2NVBA 3ZH9B 1CY7A 1II8B 2FZWA 5A4KA 2GD0A 4J9RA 1IHYA 1X1TA 3DZGA 4NH4A 3IESA 5EE3A 1E6MA 1E69A 1N2OA 4EHKA 4WCFC 3JPQA 2AYXA 1FQKA 3ZEAA 4OYHA 4YJ2B 2PLWA 3C2QA 3FDFA 4C7MA 1CY0A 4K81B 2R65A 3AR6A 3CZ5A 1HE3A 4F5YA 1KSPA 5E4FA 1G3RA 1V39A 1R6AA 5C1BA 1RBZA 5E6RA 2ZTLA 4RABA 3TTUA 3KG2A 3U31A 3QHAA 1PG2A 4D8YA 1E6CA 2GZRA 2OUIA 2D1RA 3KVVA 5AOVA 5LP6B 4N18A 1CBUA 3CRXA 2P6UA 2V4QA 3EZ5A 1GT6A 1PX2A 1Z5PA 2R7MA 3AIIA 4J3JA 3ZBUA 1L7BA 2BI8A 2X5OA 4XOIA 3WWCA 3V32A 4CLOB 5EWEA 2XQJA 4IVPA 4XDHA 3T3MB 2VAXA 1SEVA 3IUMA 4YRDA 1KDYA 1VCIA 3TIIA 2BN4A 4UVIA 3H1PA 4B7XA 1Z25A 1UXKA 1K89A 8ICAA 4PICA 3TOZA 3OO1A 4ENRA 3KB2A 5I9LA 3D1JA 4L3VA 3PGXA 1N9GA 3EZ6A 1T2VA 1J20A 2FZLA 3ZWOA 1GYRA 5JS2A 3GV8B 1CK4A 3L41A 4OHPA 2FFQA 2QXTA 2JMGA 3EF1A 4L0QA 3UV7A 2NU7A 3N7UA 3LWZA 3PTLA 2QVZX 1EGVB 2G71A 3NKFA 5GGXA 4BJHB 4XYMA 1XHLA 3PW5A 4WCVA 4P7FA 2W22A 4C0SA 1NK5A 1BHO1 1MTOA 1NPTO 1RBQA 3CG4A 4PYRA 3VJKA 2VHZA 1A7JA 1C1XA 4O4LF 4B7ZA 3V1LA 1ZNWA 2O7VA 3GFQA 2JIDA 3JPOA 1GSHA 3A6EA 4YD1A 4S12A 3UA4A 5THQA 4L8YA 4DCJA 2ZB8A 4HADA 2W7PA 1LK5A 4AECA 3LC7O 2NV2B 2BJHA 3UC9A 1ESEA 1RAAA 3K9BA 4FFNA 5FPKA 2WINI 2DPGA 3HN7A 5CCBA 2FSHA 1DCKA 3SAHA 1VLLA 3JD1A 3A06A 4IIEA 4QPNA 4U0KA 1RKQA 1VL0A </