2NRVA

Crystal structure of the c-terminal half of uvrc
Total Genus 75
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
75
sequence length
218
structure length
218
Chain Sequence
RGLRKEALEELMKLLNMKDFPYRIEGIDISHLQGKYTVASLVVFEDGFPKKGDYRRYKIEQDHPDDYESIRTVVKRRYSKHPLPNLLFVDGGIGQVNAAIEALKEIGKDCPVVGLAKKEETVVFENREIHLPHDHPVLRLLVQIRDETHRFAVSYHRKRREKESLRSVLDNVPGIGPIRKKKLIEHFGSLENIRSASLEEIARVIGSTEIARRVLDIL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Structure of the C-terminal half of UvrC reveals an RNase H endonuclease domain with an Argonaute-like catalytic triad.
pubmed doi rcsb
source organism Thermotoga maritima
molecule tags Hydrolase
molecule keywords UvrABC system protein C
total genus 75
structure length 218
sequence length 218
chains with identical sequence B
ec nomenclature
pdb deposition date 2006-11-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF08459 UvrC_HhH_N UvrC Helix-hairpin-helix N-terminal
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.20 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 5' to 3' exonuclease, C-terminal subdomain 2nrvA02
3.30.420.340 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Nucleotidyltransferase; domain 5 2nrvA01
4Q8FA 4I2EA 4TUPA 5J0QA 2FLNA 3LDAA 3RJKA 5KFKA 9ICHA 3PNCA 1RYRA 4K4GA 4QZAA 1U45A 3C5FA 1ZQGA 2HHVA 4DLGA 3ORYA 3OGUA 2ATLA 2OWOA 9ICCA 5DQGA 1ZQYA 2AGOA 2ISOA 2F1HA 4M04A 3BJYA 3EPGA 5IIMA 4R64A 2VA2A 2HVIA 3SI8A 9ICFA 4HYKA 2MUTB 3GFKB 2BCRA 5KFGA 4QZ8A 4RNOA 1D9FA 5DGAA 1TKDA 5KFXA 4F92B 4DLEA 5J2EA 3C2KA 5HMLA 1XS9D 3ZDBA 2IHMA 3RJGA 4EYHB 4XUSA 1JX4A 4YXJA 5KFLA 1ZQQA 4C8MA 3RH4A 5IINA 4B9NA 4ECXA 3RR7A 3QEAZ 4DQIA 4NM1A 4YMNA 5KFVA 5DQIA 1PZNA 2ZJ5A 1CEZA 1ZQDA 5KFTA 4YQWA 4J9QA 3RH6A 4Q44A 2KFZA 2W9CB 4GXKA 1JMSA 1ZQVA 3IM1A 1U49A 1ZQTA 3ZDAA 1A77A 4JV0A 1S9FA 8ICMA 5J2JA 2KFNA 1SKWA 3K4GA 5KFEA 2C2RA 1MQ2A 3ISBA 2RDJA 4IRDA 5KFCA 5DB9A 4Z6CA 4DL3A 4PHAA 1KTQA 3PMLA 4EBCA 4UB2A 5J2FA 9ICPA 3BQTA 2XY7A 5J2HA 4EBDA 3RB6A 1WCLA 1XO1A 2ASJA 4C8NA 4YMOA 3LK9A 3RJIA 1SKRA 3ISDA 3EZ5A 3ZDDA 4MF2A 2BHNA 4P2HA 5DG8A 3MFIA 4F4YA 2FMQA 5DBBA 4FS1A 4I2DA 5CA7A 4J9NA 2PI4A 5BOLA 1KEJA 3MFHA 2J6TA 3JPQA 1ZJNA 5DGBA 1X9SA 2Q0ZX 4O3QA 1Z3EB 4KLMA 2XO7A 4O3NA 3N97B 4ELVA 3MDAA 2ASDA 9ICNA 4RPZA 2BPFA 8ICNA 2IHNA 2KZZA 3C1YA 3ISCA 2KN7A 4QWCA 3K75D 2M9NA 1IM4A 4KMUA 5EOZA 3IHQB 4QWBA 1NJXA 4I2HA 4DEZA 2VA8A 3PVXA 3M9OB 3B0YA 4FO6A 1TK0A 4KLLA 7ICLA 1ZYQA 4NLNA 4YP3A 3BQ0A 4DOCA 4QWEA 4F50A 3OHBA 3TARA 3GQCA 1NKBA 4YR3A 1QTMA 4BDPA 2HHXA 4I2AA 9ICSA 4ED6A 1NK8A 1UT8A 2H5XA 8ICIA 3PW0A 3MBYA 4M9HA 2KZMA 4Z6FA 4YD1A 4TURA 4YFKA 5J0UA 2NRTA 1X9MA 2XC9A 1ZQEA 1SL2A 5J0RA 4MFCA 3HT3A 4F5PA 1ZQJA 4IRKA 4M9LA 2BQUA 4LZDA 4NLKA 8ICCA 4RQ1A 4UQGA 4G3IA 4QW8A 8ICBA 1KLNA 3E2EA 4XA5A 3Q8QB 3JPSA 5KG5A 1S0OA 1ZETA 2IA6A 7ICRA 3EYZA 1QSLA 4MEYA 2PXIA 2C28A 2FPKA 4J9LA 3RBDA 5J2IA 1QLNA 8ICKA 2R8KA 3SZ2A 2BGWA 2NRWA 3V7KA 4J9MA 2XGPA 2AGPA 1BPBA 2W8LA 1T3NA 2ISPA 1L5UA 2XY5A 2W8KA 4FBTA 1ZJMA 4EZ9A 5KFAA 3PX6A 2UVUA 4EZ6A 7ICQA 4ED2A 4LVSA 2AJQA 2R8JA 4ECWA 4RPYA 3OJSA 4K4IA 3T5LA 3HPOA 4QZFA 4O0IA 9ICAA 3UXPA 1NJWA 1RXVA 1ZQWA 4KLIA 3PW7A 5KT5A 1ZQUA 5IILA 1CUKA 4F5RA 2UVWA 4KITB 1H38A 5CHGA 3JPNA 1B43A 3PV8A 3V72A 4DF8A 3BDPA 3HX0A 2FLPA 8ICSA 9ICVA 4K4HA 2VANA 1RYSA 2A1JB 2HHQA 4B9MA 5DBCA 4KLJA 5HHIA 1NOMA 8ICWA 5DG7A 1D9DA 4F2SA 4I28A 3H4BA 4JK1A 4R8UB 2XY6A 4KTQA 4F93B 4YN4A 4KLQA 3MR3A 2FPLA 3SYZA 1UA0A 3TFSA 3SV4A 4DL4A 1U47A 5HMMA 3ZDEA 1TK8A 1ZQSA 3UXOA 7ICSA 3RB0A 2JEJA 1X9WA 4MF8A 2C2EA 2W9BB 4I27A 1S77D 3EWAA 4RT3A 4Z6DA 5KFNA 1TAQA 1ZQZA 2AQ4A 4I2FA 5DB7A 2PFOA 5J2DA 8ICRA 5D4BA 5DQHA 4RUAA 1D8LA 5BPCA 1RZTA 8ICXA 4KLEA 2R8HA 4RQ7A 2PFQA 4EBEA 4KLSA 8ICAA 5DG9A 1ZQOA 3AU6A 4IRCA 7ICGA 1LV5A 3RBEA 1NK6A 4QZHA 1S0MA 4QZBA 2I1QA 3PY8A 4O5EA 5L1IA 1UT5A 2BDPA 4R8UA 2ZUDA 3FYHA 2JZBA 4M47A 5KFMA 9ICWA 2Y1IA 5KT6A 4IQWA 4YR0A 2C22A 4RNNA 4BWMA 4J9RA 3GIMA 3RB3A 1S10A 1ZQMA 4GC6A 1XSPA 4DWIA 1UA1A 2F1IA 4ECRA 3OSPA 1XSNA 5DB8A 3GV8B 4UB4A 1SL1A 1C7YA 2J6UA 4PHDA 4F5QA 2AGQA 4F91B 1ZQIA 3QEBZ 3ZDCA 4IQVA 3V7JA 2ALZA 4RT2A 4RQ5A 1L3SA 5L1LA 4LZGA 4NLGA 5HP4A 2Y1JA 4UAWA 3NTUA 1JN3A 3V6JA 1T7PA 4B9VA 2HW3A 9ICXA 4P4PA 3T5HA 3PW5A 2XGQA 4F5NA 8ICGA 3MDCA 3JPRA 4JUZA 2W9CA 4QZEA 3MR2A 8ICQA 4ED3A 2I9GA 2HVHA 3N4MB 5KT3A 1JXLA 3RJJA 4C8KA 3H8WA 1ZQPA 4JV1A 5CP2A 3GDXA 2JEIA 2AU0A 1NKCA 5KG2A 2NRVA 3H8JA 4I2JA 9ICOA 4PGQA 4NXZA 3UQ0A 1TK5A 3RAXA 3RJEA 3QZ7A 3FDSA 5J0PA 2NRZA 4F5OA 1RPLA 1XU4A 1KDHA 4XRHA 2HHTA 2ZUCA 2NRRA 7ICUA 3JPOA 3C65A 1MSWD 7ICPA 8ICTA 4RQ4A 5KFYA 4Q43A 3NGDA 4ECTA 3JPTA 5KG0A 4DFPA 3RJHA 4DSFA 2ZJ8A 1ZQRA 4ED1A 4YG2A 4CCHA 8ICHA 7ICTA 4DL5A 1NK7A 5KT2A 3PR4A 2V4QA 4XQ8A 4I2CA 3PX4A 4F3OA 1KFTA 1ZQCA 3OHAA 5IIIA 5J2AA 4I2IA 4ECSA 3TAQA 4DSJA 1NKEA 2P6RA 4QWDA 3LWMA 5J0TA 3EPIA 4DSKA 5KG6A 5J29A 4RQ6A 1BPEA 5TZVA 3QE9Y 1HUOA 4F8RA 4UBBA 3C1ZA 4R66A 3Q8RB 1S97A 3M9MB 4F4WA 3HP6A 4DQSA 4YMMA 2BQ3A 4QZDA 4RU9A 5CWRA 4DFMA 1L3TA 5HHHA 3UPQA 3ETLA 4UB1A 5KFBA 4FBUA 3BQ2A 5J0YA 3PW4A 5KFQA 2BCUA 9ICJA 3MGHA 1ZQHA 9ICKA 9ICGA 1N48A 4EYIB 3EW9A 5DDYA 5EWFA 7ICJA 4DSEA 3GIIA 3LWLA 3ZD9A 3TQ1A 4Q8EA 1S0VA 1Z00A 4B9SA 1MQ3A 5KFJA 2FPMA 4PHEA 5KFIA 2KZ3A 1IXRA 2JZBB 4IQTA 4PH5A 2JEGA 4F4KA 4EEYA 2VA3A 5CB1A 4ELUA 5CJ7A 4ECQA 4JV2A 2RDIA 4DL7A 1ZQNA 5DKWA 1ZQAA 4GC7A 5CR0A 1RXWA 4ECZA 4KLTA 5IIKA 3H40A 1SL0A 2F1JA 1ZQLA 1DGSA 2B21A 4GXIA 3C2LA 5KFZA 4NY8A 2ASLA 2R8IA 7ICVA 2PI5A 3SV3A 9ICRA 3KHRA 4ECYA 4O3OA 2MUTA 5J2GA 2IBKA 5L9XA 4B9TA 4I29A 5IIJA 3V6KA 2HHUA 7ICOA 2BPGA 9ICEA 4I2BA 3H7IA 4DL2A 4DF4A 7ICEA 9ICLA 4KLUA 1BVSA 5D49A 5DLGA 4KLGA 1ZQBA 3PO4A 1ZQXA 4YCXA 3Q8PB 3M8SA 4M0AA 4MFAA 1BPDA 5KG4A 1DOQA 4M9GA 5L1JA 1SKSA 4UB5A 2DPIA 4TQSA 4TUQA 1KFDA 3GV5B 3RTVA 3TFRA 2NRXA 4DFKA 2FLLA 2GWSA 4IQUA 3Q8SB 5DDMA 4KLOA 4X5VA 8ICEA 2W9BA 5BOMA 1N56A 3PW2A 4O3RA 9ICQA 5KT7A 5J2CA 4Z6EA 2BCQA 2FMSA 3THVA 4DS5A 3RAQA 2DFLA 1AROP 2V9WA 9ICUA 4BXOB 1BPYA 2P66A 4BWJA 3T3FA 1S0NA 1QSSA 1HJPA 3M8RA 1K1SA 3RRGA 3KHGA 3T5KA 1ZQKA 3MGIA 2HHSA 3GILA 4KLFA 2R8GA 2V4RA 4QW9A 2PFNA 3T5JA 4FS2A 7ICIA 4DOAA 2C2DA 8ICYA 4GXJA 8ICFA 3PMNA 1JXEA 2XCPA 5EWEA 4DFJA 7ICMA 4DSLA 4Q45A 4NLZA 3C2MA 3OSNA 4M6WB 4QWAA 3HWTA 3QZ8A 2W9AA 2AQ0A 5F9NA 1TFRA 3RB4A 4QZGA 3C5GA 4J9SA 4M2YA 2KTQA 1BPXA 4RUCA 5KG1A 4F4ZA 3G6YA 3BQ1A 5KFHA 4KN4A 5J0OA 3RH5A 1X2IA 1EXNA 4ECUA 2IMWP 5D46A 9ICTA 4IR9A 4MFFA 3TI0A 3B0XA 5DLFA 3Q8LA 4MEXA 2UVRA 4RQ2A 4PGXA 2MAXA 2P6UA 4DL6A 4F2RA 8ICLA 4R65A 4TUSA 1XSLA 4J9OA 2J6SA 1T8EA 2BPCA 5KT4A 4ED0A 3G6VA 5J2KA 1K1QA 2UVVA 7ICNA 1TVAA 4DQRA 4QZIA 3AU2A 5IIOA 4DO9A 1TAUA 5KFUA 4NM2A 5KFWA 4J9PA 3ZD8A 4ED8A 4E0DA 8ICUA 7ICKA 2WTFA 4RNMA 5KG7A 3C23A 5J2BA 3V7LA 4PHPA 3GV7B 2BR0A 4C8OA 3M9NB 4RPXA 4B9LA 4PGYA 4M6WA 3GIJA 4UAZA 1XC9A 4BGDA 4ELTA 8ICZA 4RQ3A 4ECVA 1U9LA 3TANA 5C5JA 4TQRA 3JPPA 4GLXA 5KFRA 5KFSA 1LB2B 3MABA 4O9MA 4O3SA 3HW8A 4JWMA 4C8LA 1XWLA 2BCSA 4P4OA 1JIHA 4YD2A 2BQRA 1L3UA 1NK4A 4DSIA 5DB6A 4O5KA 3G6XA 4UB3A 4DQQA 8ICPA 4BXOA 4J9KA 3PO5A 3KHLA 3UQ2A 8ICJA 5KFDA 1SZPA 2BKEA 4M9NA 3RR8A 2ZTEA 5DBAA 2LYHA 1D8YA 4DQPA 4M9JA 1KFSA 9ICBA 1Z00B 2PFPA 1ZQFA 4RQ0A 5L1KA 3PR5B 2BCVA 4O5CA 2ZUBA 2HHWA 3PX0A 2ZTDA 5KFFA 4RZRA 3AUOA 1U4BA 3MR5A 3GIKA 1HUZA 1MC8A 5J0WA 9ICIA 1TV9A 2A1JA 5KFOA 2JEFA 1A76A 2W9MA 1U48A 1NK5A 4ED7A 2FMPA 4YXMA 5J0XA 4DS4A 4UAYA 2ZJAA 1NK0A 3RRHA 3KHHA 1T4GA 4KLDA 4RQ8A 4B9UA 5F9LA 4JWNA 4YVZA 1B22A 3UXNA 3C21A 1Y88A 2DPJA 3OJUA 8ICOA 4IR1A 5J0SA 1BPZA 8ICVA 5HNKA 1WCNA 4YR2A 2XCAA 3KTQA 4DOBA 1NK9A 4KN7A 1BGXT 3MR6A 3RJFA 1L3VA 2ZTCA 1S76D 5KTQA 4ZH4A 3TAPA 4R63A 5KG3A 1NJZA 1NJYA 3H4DA 1COOA 4O3PA 1V9PA 4KLHA 7ICFA 4P4MA 1KRPA 9ICMA 7ICHA 4F4XA 3H8SA 5JUMA 4I2GA 4QZCA 1QSYA 4QZ9A 3Q8KA 4UBCA 1KSPA 4PPXA 5KFPA 3Q8MA 3V6HA 5EWGA
chains in the Genus database with same CATH superfamily
4Q8FA 5J0QA 2FLNA 3LDAA 3RJKA 4QS7A 3VQ7A 2UXBK 1RYRA 2LMRA 2ODGA 1NGDA 4QZAA 1ZQGA 4NV0A 3OGUA 4CJ4A 1KCFA 9ICCA 2E2PA 2QWNA 2F1HA 1HJRA 3GG4A 3SI8A 1NG9A 4FJ7A 5KFGA 4N56A 2LPEA 3VENA 1ASWA 1TKDA 3QX7A 4F92B 5HMLA 3RJGA 3KOOA 3WEEB 4H0VB 5AFUH 3EKUA 2IAJA 4YXJA 4ECXA 3RR7A 5GTHU 4DQIA 1S5JA 4DR7K 2QWOA 3VTHA 4A5AA 4OX9K 1I39A 1PZNA 4FPBA 4IG0A 5KFTA 4J9QA 2FC0A 3SBTA 3VQ6A 1E4FT 3D2SA 2W9CB 4KHYA 1JMSA 3IM1A 3QBWA 2KEYA 3KLEA 2KHOA 4FZXC 3SR6A 1S9FA 8ICMA 5G5HA 1TKXA 3I28A 3SPZA 2ATQA 3ZSXA 4W5RA 4KAZA 3IG1A 3IP4B 3M6GA 2ZF5O 3JSMA 5JMVA 5KFCA 4IFEA 4PHAA 1RBTA 5GINA 3EZWA 9ICPA 5AKZA 3LDSA 1W2BM 5FPDA 1XO1A 3CNHA 1X40A 2ASJA 4JN4A 3EZ5A 4P2HA 2GV9A 3E9LA 5DG8A 4CBXA 4X66K 4OJ5A 4WE1A 2PBDA 2EZYA 1X3MA 1O13A 2ZD1A 3JPQA 4ZHRA 4Y2JA 3HL8A 4RQNA 1T05A 4O3QA 2QB0B 1JI7A 3VOVA 2XO7A 4AP9A 3DJCA 4FLVA 4B3RK 4FJJA 4J03A 2ASDA 5ADXA 4RPZA 1XNQK 2IHNA 5AKKA 3C1YA 1HIWA 1WWVA 1P90A 3VPZA 3TWHA 3G4SN 4I2HA 3K5MA 2YI1A 2VA8A 4H0YB 3M9OB 1RDCA 4FO6A 3K5OA 1HX1A 4Z4GA 4FOIA 2VJ4A 2D4WA 4QWEA 3TARA 2B6AA 3L4IA 4YR3A 1LCUA 3R6MA 8ICIA 2IGIA 3QNNA 3D0PA 4TURA 2PMZF 1U6ZA 2HCFA 4O3MA 1ZQEA 2OANA 3HT3A 4F5PA 4CZEA 4M9LA 3OYHA 2GUPA 5AQOA 2W6KA 2Z1IA 1RM6C 1RDWX 1S0OA 1DRGA 2KKZA 2K4HA 7ICRA 3ISNC 5JS2A 3E9OA 5KPRA 5MLCQ 1XMQK 4XIUA 2JR5A 1QLNA 2X78A 3AQFA 4AH9A 4HTLA 5B8HA 3TTCA 2UUCK 2W8LA 4PJ0U 1ZD3A 3G10A 3OBYA 2ISPA 3GOIA 4DFDA 4LF7K 4DHYA 3PX6A 3DLKA 4FJKA 4LFAK 4ED2A 4LVSA 2AJQA 2R8JA 4B1ZA 4ECWA 4NXMK 4K4IA 4BVPA 3QNOA 3HPOA 4O0IA 3M7DA 2Q0RA 3AO4A 4KHUA 3SUQA 3PW7A 4GW6A 2Y9TA 4BR0A 4FZLA 5KT5A 2MA1A 4JEPA 3T1AA 1YJNN 4F5RA 2UVWA 3ICXA 4FLWA 1VQON 1NM1A 4DF8A 1HUXA 4PUOA 3VTIA 4KI4A 4ISFA 2YMPA 4OGEA 2KSOB 1J54A 1L7NA 4CK1A 1LOTB 1RDFA 4LY7A 8ICWA 1NOMA 5DG7A 3O6WA 4F2SA 4I28A 4KTQA 3U3YA 2XY6A 2YMQA 4CW7B 4FWMA 3MR3A 4L3QA 2E5LK 3TFSA 3SQIA 3THYA 3DXMA 3ZDEA 3CJ9A 1TK8A 4IO9L 2DKZA 3OS1A 2JEJA 5AQMA 3D45A 4M3WA 1OUQA 2W9BB 1OW5A 4CF4A 3TSQA 4KPYA 2KJ8A 3H0MB 3DOLA 5AQFA 2AQ4A 4I2FA 3AARA 4DTMA 4OPJA 2PFOA 2QXFA 4FW2A 5D4BA 2EANA 2P9SA 5ALLA 4RUAA 2KIVA 2JGUA 8ICXA 5AK3A 3HPHA 3CMAN 2R7YA 2PFQA 4RQ7A 5L1MA 4LC9B 4BRGA 1YTAA 4RWTA 2O8EA 5DG9A 1ZQOA 3AU6A 4DKWA 3DMJA 1LV5A 2EX3A 3MWPA 1NK6A 4FWKA 1S0MA 4DMNA 2WF9A 2WAQF 1BI4B 1WSHA 3D2EB 1RT5A 5KT6A 2FE9A 2C22A 4RNNA 3UIQA 3RB3A 3GIMA 5AZJB 2O8FB 1ZQMA 5HRNA 1XSPA 2G08A 3OSPA 1ZBLA 5DB8A 4FZYA 3GV8B 1WUAA 2J6UA 1ZD4A 4NJ8A 4F5QA 4CEZA 4JRQA 3QEBZ 4IQVA 3V7JA 2ALZA 1QQMA 3O4WA 4GV3A 2OYQA 3DYAA 3HI0A 3CC2N 2G8UA 1VQ8N 4JS4A 2IOFK 3ZT4A 3RF9A 3ZEUB 4CECA 3K9KA 2X6SA 1EWQA 3V1RA 4JV5K 4F5NA 8ICGA 4E89A 3VQDA 3VGMA 2OZSA 3MDCA 3JPRA 3CCMN 4RG8A 3PIPL 4LF4K 1JCFA 3RJJA 1JXLA 1MU2A 1GLCG 2HBJA 4CFBA 3AVKA 1N5XA 4JV1A 4JI7K 2OH2A 4KREA 1A5XA 3OTQA 1FFVA 3LM9A 3SAFA 3U8XA 3UQ0A 3RJEA 4FJNA 1ASUA 3KLFA 2NRZA 5C12A 1HNWK 2Y9UA 4ID1A 3CJAA 3ASMA 4CGIA 3O9QA 1N5WA 4OO1J 3AVBA 4X65K 4EENA 5KG0A 1BUPA 4M3ZA 3NVKA 1ZQRA 2KG5A 4ED1A 2LYAA 4IFYA 2PFUA 4FWSA 2O8EB 5KT2A 2YJEA 3MN9A 2YNFA 2V4QA 4EX6A 4C23A 2Z1HA 2IVNA 4KI6A 3ENOA 3CPWM 4JD2A 1Z4NA 1C1BA 1RDAA 2FJ6A 1BNOA 2KV2A 3L3UA 2HF4A 4DSJA 1NKEA 1F21A 4QWDA 4JKFA 3LWMA 2PY5A 2YMMA 5AM0A 5EE3A 5KG6A 5J29A 5F2RA 2YB4A 1U2VA 2QWMA 2WOMA 1F0MA 2OTJN 1NOYA 3M9MB 4R5PA 3HP6A 3HRDD 5ALGA 5CWRA 5HHHA 3UPQA 3L6QA 1C0TA 2YX6A 3PW4A 3VESA 1BQNA 2P9LB 1JUDA 2KE7A 1FXXA 1NGIA 1F5SA 2QARA 5I42A 9ICGA 3QLHA 4A59A 3AVCA 3EW9A 3EO3A 3IV6A 1RBSA 3EN9A 3DM2A 5J2QA 3LWLA 3ZD9A 3TQ1A 1S0VA 3AO2A 3ZETB 1Z00A 4CZHA 1S1XA 5KFIA 2GLEA 1SIJA 4PHEA 1VRTA 4Z94A 4PQUA 5CY4A 2JEGA 1WSJA 2JHDA 5AQXA 4CK2A 4FLXA 1ZBUA 3C6HA 2RDIA 1YIJN 4KMOB 3C28A 3LANA 4CJPA 2LKYA 5DKWA 1QZ5A 2CRXA 4ZTFA 1ZQAA 4CJKA 1ZQLA 4FW1A 1A5VA 4DV1K 3HJFA 1S1VA 5K14A 2LM1A 4NY8A 4KTWA 1Z19A 4FZMA 1MWKA 1K5OA 3M6KA 1OVQA 1WUDA 9ICRA 3D2FB 5C2DA 1XMOK 2D0BA 3V9WA 5KGXA 4KHSA 2CGJA 2W40A 4BRAA 2QI2A 3SLCA 7ICOA 4CESA 2YKMA 5J8YA 3HTVA 2OA8A 1KBUA 1JLEA 4KLGA 5DLGA 4DUZK 3A5OC 1VDVA 3PO4A 1QQ5A 5AFUA 3ZEUA 4MFAA 4M9GA 1DOQA 3C6TA 5LY3A 5KGWA 4DTUA 4CHPA 3TFRA 3RTVA 3Q8SB 5DDMA 5FDLA 4UATA 1N56A 3PW2A 4O3RA 2DL0A 3LYSA 1HNIA 1Z25A 5BRHA 2DFLA 1LWEA 4BXOB 2W11A 4JKEA 4USAA 2AH5A 5SZTA 4A5BA 1RBVA 1K1SA 4HUEA 4CGFA 1ZQKA 1N63A 4YDUC 4KLFA 2ZE2A 1NGCA 4DR2K 2V4RA 3B9JA 4FS2A 1T3VA 4BG9A 4GXJA 2IDOA 2K8CB 3ZT0A 1JXEA 4JB3A 1Z1BA 1RBUA 4WYBA 5M1OA 4DFJA 4W5OA 1HLUA 3C2MA 4QWAA 3HWTA 3NCIA 2YY6A 1KAZA 3TAEA 4LSNA 4Z4HA 4QZGA 1VSMA 5KRTA 2KTQA 1BPXA 5KG1A 3FZKA 1LWCA 4G1QA 2Z1JA 3AVLA 3FE1A 1X2IA 1VQ4N 2IMWP 5D46A 4MFFA 4M41A 1V97A 2EH9A 5EE0A 4KX5A 2EAOA 3B0XA 2VJ5A 2UVRA 4RQ2A 3OS0A 3O8MA 4DR6K 1T8EA 4CJSA 2D3DA 1UPHA 2O4IA 3AGKA 4BE2A 1QQ6A 4C7YA 3G6VA 1IKYA 2UVVA 4N5SA 1MN8A 2D8CA 4Q5VA 4FYDA 4N47A 2NO5A 5IIOA 4HWIA 1TAUA 5KFUA 5AKIA 3ZD8A 1DGJA 7ICKA 5J2BA 4H0XB 4AF1A 4C8OA 4BX9C 4PGYA 4M6WA 5H1SQ 3HOTA 8ICZA 3NS1A 1SAZA 2JWKA 3O3FA 3TANA 5C5JA 2H3QA 3A0BU 4YOWA 2VQEK 1YT3A 4CZMA 2OPPA 4IOAL 2EAPA 2GX9A 3FGUA 4JWMA 1XWLA 1YAGA 4B3SK 3CD6N 5HOOA 4P4OA 4H03B 2H3ZA 3FM9A 1NK4A 1L3UA 4DSIA 5HR7A 3IAYA 4DQQA 2O8DB 4Y2RA 3S3OA 3KHLA 4Z4EA 5KFDA 1SZPA 2BKEA 1OXJA 2E1YA 2G8VA 3TAMA 5DBAA 2HB5A 4DQPA 2KKVA 2W03A 1Z00B 3WKDA 3C29A 1BG3A 3BEXA 4CIEA 3PX0A 1VSDA 2ZTDA 5KFFA 4RZRA 1U4BA 1CLQA 2PZSA 1YVUA 2K8AA 5J0WA 1TV9A 2KLAA 5JLFA 3U9DA 4FWRA 4UARA 3O9SA 4XEIA 3CJCA 5SWMA 3K57A 3VA3A 1M90O 5ALRA 2Q4TA 2RP5A 3NUQA 3OYIA 4DS4A 3NRWA 3GDQA 1W7AA 4FE3A 3RRHA 4YFUA 2GWJA 2O6KA 1T4GA 4KLDA 2QWLA 4OPAA 4JWNA 3AAQA 4UB6U 3ID8A 3ZLJA 3T69A 5F1XA 1RG6A 5AQTA 3O80A 2DFEA 4BRNA 2XCAA 5BPLA 3THWB 4EHUA 2P35A 2W42A 3QB0A 4AQYK 1ZQ1C 1JXBA 4CZLA 4DV3K 5BR8K 3WQUA 3FAHA 4NWIA 1Q18A 1V9PA 2KVCA 4KX3A 3ZX0A 1KRPA 4Y1CA 4KHWA 1BCOA 4F4XA 1NNLA 1OH5A 2YB1A 3Q8KA 4CEQA 1XI1A 4CGDA 3SJHA 3VETA 5JVHL 5EWGA 3SUPA 4QAGA 4CF5A 2FF3B 4IKFA 4TUPA 4TSXA 4H8KA 5KFKA 3H45C 2O8FA 2OEHA 1U45A 2HHVA 4I9QA 4DLGA 3ORYA 2ATLA 2V7ZA 2FDRA 2OWOA 1BL3A 2V7YA 5DQGA 1Q82O 2AGOA 2Z1GA 2HVIA 3UE5A 3UMBA 4HYKA 4CE9A 5AI0A 3THWA 2IOFA 4QZ8A 4RNOA 1H1VA 5LMNK 1M1KO 1SGGA 5DGAA 1XUPO 4DLEA 3FC4A 4B1VA 1Z4OA 4BR4A 3T1HK 2P9NA 3CQYA 1RYUA 2IC3A 3WKBA 5AQHA 4X64K 1X66A 3LAKA 3NVYA 2RKIA 3P39A 4C8MA 4B1UB 1Q9YA 4B9NA 4OVLA 3QEAZ 4NM1A 3NF8A 5DQIA 2ZJ5A 5KQDA 4ILJA 4YQWA 3HILA 5HL7L 1G99A 3DWLA 4JI5K 5HR6A 2WFAA 1ZBHA 1Q46A 1U49A 3ZDAA 3WK8A 3OYNA 3WXIA 5J2JA 5CRXA 4DR5K 3K4GA 4NO7A 5KFEA 2WC9A 4BRKA 1MQ2A 2K89A 1EO1A 4DR4K 3C7NA 1J97A 5DB9A 4DL3A 4YHHK 3O9RA 3AVJA 4QIWF 5AQUA 5BRFA 3ZI4A 4EBDA 3RB6A 1JKHA 1WCLA 2HNDA 3LK9A 3RJIA 3ZDDA 4MF2A 2O8DA 3ISDA 4BROA 1IKXA 2BHNA 1S8OA 4CZJA 2FMQA 3IMXA 5KL8B 4FS1A 2F2AB 3ZSZA 4I2DA 4J9NA 4DV0K 5BOLA 1KEJA 3MFHA 2JXJA 2PAVA 1ESVA 4RW8A 1VHXA 3CCQN 4DTOA 1X9SA 4JI2K 3QFPA 1UAXA 2OZMA 3H1QA 2BDUA 3F2CA 4W5NA 2BPFA 2ZIUA 1SV0A 3C95A 1C0UA 2KN7A 1VSHA 3CCUN 3MEDA 1GO3F 3K75D 1NJIO 3I76A 3IHQB 1HKBA 4DEZA 3OYAA 1TK0A 1N61A 3B0YA 2QXLA 3LP0A 3S3NA 3SAHA 2ZIXB 4NLNA 2EZZA 3KZXA 1ECWA 2HDOA 4DOCA 5ALVA 3D2NA 3GQCA 5H2FU 1OH8A 3NGZA 3I8DA 4ED6A 1UT8A 1RT1A 2KIWA 4BRDA 2E6MA 5J0UA 1HMVA 1SL2A 4CD3A 3L2WA 4MFCA 5DK5A 4IRKA 5BN8A 2BQUA 1WBBA 2GTDA 1XNSA 3KWIA 2ZIVA 1BA0A 1KLNA 4DTXA 3ZETA 3OTOK 1RBRA 3UKUA 1TAMA 1JL2A 1ZETA 1KAXA 4BGAA 1XO0A 3EYZA 4JRPA 3KD5E 2ZIUB 1N2XA 1W97L 2OPSA 2YHYA 3AO1A 2FPKA 4J9LA 3AMZA 5J2IA 4CZFA 4CF9A 5M1KA 3SZ2A 2NRWA 3ID6A 4YDUA 4J9MA 5AKXA 4O5FA 3P83D 1V4SA 4M7YA 2ZWHA 4LFBK 4OJOA 3CFRA 1LWFA 3S6JA 2W8KA 1VQ6N 2O8CA 2DFFA 3CC7N 1U04A 2I5HA 3KD3A 4P0QA 4EZ6A 1SZ2A 1WAFA 4IDHA 3K1ZA 3T5LA 3QUBA 3ZSVA 3MDQA 4AHSA 4FL9A 3LVVA 3MK6A 1CUKA 3MCPA 4KITB 4YNQA 3OYDA 5CHGA 1B43A 3VC8A 3FZHA 3QUCA 5EVZA 1C0MA 4YOVA 4K4HA 2VANA 3J7YP 3QU7A 3PLAA 1ZD5A 1HYZA 3ZT2A 2P9IB 5DBCA 1UWBA 4KLJA 4BUGA 1D9DA 4U6PA 1NGFA 4JK1A 5AKYA 4AHRA 2W7OA 4F93B 2DPNA 3SYZA 4BR5A 2G8KA 3WXLA 1C0FA 4MO4A 4EX7A 1Q3VA 3NF9A 2IVOA 2C2EA 4I27A 1KKXA 4RT3A 2HOEA 4H0TB 3SQ2A 5KFNA 3OW2M 3ZSOA 1ZQZA 4H5TA 2NLXA 2QKKA 1KN5A 1YZ7A 8ICRA 4RCHA 1WYGA 4FLYA 5DQHA 1RZTA 3KLIA 4OKJA 1DTTA 2R8HA 4KLSA 1JLQA 2YCHA 8ICAA 1X9JA 4E19A 4Z0UA 1VSEA 1HQUA 3L5KA 4PL2A 4QZHA 3OYJA 4AYBC 1GLBG 4RW9A 5HRSA 3AN1A 4O5EA 1UT5A 1MDUB 4OLBA 4UY8O 2JZBA 4M47A 1RTDA 9ICWA 3LPUA 1HQEA 3THYB 5AZJA 3OVNA 1NMNA 4FO0A 2KD1A 1HYVA 2F1IA 2HBMA 1M6YA 4ECRA 1EWRA 3QU9A 5M1FA 3LZIA 3BZKA 2X74A 3SQ1A 1YJWN 3P4IA 1TKTA 4V19S 1DTQA 4FWNA 3ULEA 2AGQA 5ALZA 3E01A 5TKWA 3M5RA 5IWAK 3QEVA 3EE8A 3QIOA 5CE3A 4NLGA 4AHVA 1NGAA 4QS9A 4UAWA 1JROA 3MEEA 4FJ9A 1IH7A 1T7PA 1EX4A 4B9VA 1RDBA 2HW3A 3CFOA 4BC2A 5AR0A 3R1XA 2ESEA 3F5TA 3PIOL 4E7KA 4UAVA 2XGQA 3ZX2A 5C15A 3BP8A 3HK2A 1L7MA 3VF2A 3F53A 3QUQA 4DCHA 1NI3A 5KT3A 3N4MB 2UUAK 3H8WA 5CP2A 2CH5A 2E1ZA 2AU0A 3CCJN 1UQVA 5KG2A 4H4MA 4I2JA 4PGQA 4NXZA 2YJFA 2MRLA 4CDGA 4IDKA 2IIRA 2O8CB 5E26A 2CN1A 3HP9A 5J0PA 2FI1A 1RPLA 2A6AA 3VERA 3TSUA 4XRHA 2HHTA 2ZUCA 1CXUA 2NRRA 2ZG6A 2OHFA 3TPQA 3C94A 2EZXA 1TL3A 3H1VX 5LJVA 2P5GA 3JPTA 4DFPA 2ZGZA 2W6LA 4DSFA 7ICTA 8ICHA 4CCHA 4NL9A 4YG2A 2E88A 4YORA 5ALFA 3WK4A 3DXKB 4Q0BA 3CETA 2H3GX 2GO7A 4I2CA 4H5WA 1WB9A 2FBYA 4F3OA 3GL1A 4DV6K 2F8LA 4JD2B 3D2QA 2OPQA 4LJXA 4I2IA 3QU2A 5LL6Z 3Q7BA 3KIOA 3KZIU 3HOSA 2P6RA 3MCAB 4JKBA 1SWWA 1X42A 1KVBA 5EU7A 4DSKA 1IJJA 2I7NA 1SV5A 4CF0A 5AK4A 4UBBA 3C1ZA 3WQTA 4K25A 4R66A 1IG9A 3F9MA 4CF3A 4DQSA 4YMMA 2BQ3A 4QZDA 4RU9A 1NOZA 3LALA 2NV3A 4FBUA 3BQ2A 1DK2A 2WONA 3DRRA 2P9LA 3M6ZA 2BCUA 5FRNA 9ICJA 1TYQA 1ZQHA 1QQ7A 1QE1A 3NVZA 4Y1DA 1AQ6A 1XHZA 4DSEA 1J9AA 2DBYA 3GIIA 4OKKA 4CF2A 1N8RO 4Q8EA 4EP4A 1ATRA 3WXJA 4EELA 5KFJA 2DTUA 1YITN 4F9OA 4CBUA 2JZBB 3PSIA 4IQTA 3DRSA 4IJAA 4DR3K 2DF4B 4EEYA 4GVEA 4F71A 4CRXA 3R9KA 4DL7A 1ZQNA 5AQPA 1VQMN 3DXMB 4B3OA 1BHLA 5CR0A 5IIKA 5AM5A 1SL0A 3O1WA 3N7PD 2ETJA 3KK7A 4E3SA 3C2LA 1KLMA 1N36K 1K9MO 2R8IA 5AK5A 2PI5A 3SV3A 4O8KA 3V9SA 4O3OA 2MUTA 4I29A 5C10A 5IIJA 1Z26A 1TGOA 2HHUA 1X6IA 4OGCA 1IBMK 2XI9A 4CFAA 4DL2A 9ICLA 2OM6A 1RTIA 4ZTJA 4KLUA 1IG6A 5D49A 1BO5O 1BU6O 3ALYA 1LKYA 1QQNA 4ILHA 5CEHA 1ZQXA 4GV6A 3VQBA 3AO3A 4CK3A 5L1JA 4FVUA 4UB5A 3CHWA 3J7AP 4K8XA 4BRQA 2NRXA 1FW6A 4IQUA 3GU3A 1ATNA 4X5VA 4LD0A 1VSLA 8ICEA 2W9BA 5BOMA 1K6YA 9ICQA 2D0AA 3ITHA 5KT7A 5J2CA 3NF6A 3ZSRA 4Z6EA 1KVCA 1FO4A 4CHNA 3D6JA 4DS5A 3THVA 3CPEA 1IKWA 4FJHA 1WNSA 4US9A 4PZOA 4BRLA 2HBLA 5AQNA 4BWJA 2ZJRL 3D2FA 1HJPA 4FLUA 3M8RA 3KWGA 3V9ZA 3RRGA 4BDYA 3C6UA 2G0AA 3MGIA 1HNZK 3KLGA 5C24A 3DLHA 2X6NA 3V81A 3IRUA 2PFNA 3T5JA 4FJ8A 4DR1K 8ICFA 3PMNA 1BI4A 3A0IX 3AY9A 7ICMA 4W5TA 2G8HA 1CI4A 3T7ZA 4FM1A 4Y2PA 3OSNA 3AVIA 3M3ZA 4ISGA 5LJWA 3QZ8A 2W9AA 5K4LA 1TL1A 1R0AA 3NMUA 4GKJK 5C0YA 3AQEA 4DTPA 2YKNA 1REVA 3CCEN 4IEIA 4CHYA 3THXA 3BQ1A 3SPYA 5AM4A 5J0OA 2FXUA 3FFIA 9ICTA 1S1TA 1VJ5A 2GWKA 2CH6A 3TI0A 3Q8LA 4Y2QA 4MEXA 2AP1A 2A3ZA 5J2NA 2YNGA 2MAXA 1D8BA 4BRMA 1XSLA 1URJA 4J9OA 3CIPA 4IFVA 4CJLA 1SUQA 1K1QA 1LVHA 2MU2A 5AI4A 4Z4IA 1HRHA 4DO9A 5J2PA 2WF6A 3V4IA 5C42A 4US8A 4J9PA 3KK1A 3S3MA 1N5YA 5AQJA 2ZIVB 2WTFA 3AVFA 3ULDA 4GMJB 3C23A 3GV7B 4FM0A 2KVSA 2BR0A 4KTZA 3U3GA 2K8BB 4DU3A 4CIFA 4O44A 1QHAA 1XC9A 2GBZA 4JNEA 3IRXA 3EEQA 5AQVA 3IDWA 4RQ3A 4ECVA 1U9LA 4B1WB 5GAEP 3JPPA 3LP2A 2Q36A 1A0PA 4GLXA 2QTDA 5KFRA 5KFSA 1U2VB 3LM2A 4HTUA 3NH1A 4U67L 3MWTA 3QIPA 1LB2B 4O9MA 1DKGD 4JKAA 2QKQA 4O3SA 2P9UA 2VGNA 2KHQA 4O0JA 1L6NA 3D7EO 2DKXA 4YD2A 3HPGA 4QJFB 3O9TA 4KB0A 4UB3A 8ICPA 3U4LA 5TKYA 2O8BB 4KKOA 1N34K 3UQ2A 8ICJA 4CJRA 4NLBA 2AXTU 3RR8A 2XY8A 3K9JA 1VQ7N 2LYHA 4OJLA 3TADC 1KFSA 2BGGA 1ZQFA 3WKCA 3PR5B 3VQAA 2P5OA 2EAMA 4MLEA 4P0PB 3N7RC 3GIKA 1HUZA 1MC8A 4M63C 1ZBFA 3VEWA 5BREA 2F9TA 3EE9A 2A42A 4IEEA 3WT0A 5IT9O 2F8TA 3CW2C 4B1XB 1VSFA 1A76A 2W9MA 4U7BA 1U48A 4CJUA 2A1AA 1DXSA 5J0XA 2FMPA 1HNVA 4A2AA 2QLTA 4UAYA 3LPTA 4CZIA 3MXMA 1W9HA 4ACOA 4RQ8A 4B9UA 2NNWA 1B22A 4OKEA 3UXNA 8ICOA 1Y88A 3I0RA 2WTUA 4JAXA 4CJQA 8ICVA 1ED1A 1WCNA 4YR2A 4FOEA 4I2PA 4KN7A 1BGXT 3RJFA 1RDDA 1S76D 2W55A 4ZH4A 2B0CA 4R63A 5KG3A 3S9HA 5HLFA 1MA7A 4O3PA 2QARB 3OYCA 4KLHA 1WSEA 2A41A 5AQYA 4IS7A 4P4MA 1NZBA 1ZBIA 4I2QA 4I2GA 1C20A 1QSYA 3KKAA 4QZ9A 4JYAK 1KSPA 4PPXA 1HKGA 5E79U 5ALKA 1Z05A 2YV0X 4BJQA 4I2EA 1VSJA 3VQ9A 4BRFA 3QEIA 2HMPA 2Y0SF 3C5FA 4KH5A 4M3RA 4CIGA 1C1CA 1TV6A 4NL9C 4J2AA 1ZQYA 2ISOA 4M04A 3EPGA 5IIMA 4R64A 2VA2A 3ULEB 3ED5A 3GFKB 1GOBA 3CI5A 1EETA 5KFXA 4OPHA 1VQ5N 1XS9D 3SMPA 1WG8A 3H0LB 3ZDBA 3DV9A 4Y2TA 4K43A 4CEDA 3NAEA 4EYHB 1NGBA 3LDPA 1JX4A 2Q1NA 4DU4A 4QCLA 4FLZA 1ZQQA 1DGKN 3K0SA 1VAZA 5IINA 1PVPA 4CI6A 5AQZA 5AQGA 1BA1A 4I6MB 4CJ7A 3WKAA 1CEZA 1ZQDA 4JKDA 5I9EB 1HYSA 4H0OA 4DU1A 2KFZA 3AAPA 4GXKA 2JMGA 4K42A 1ZQTA 1GLAG 4JV0A 2FBTA 3QICA 2KFNA 1SKWA 5ALWA 3WK9A 4JI4K 1RT6A 1PUZA 4IRDA 2KNJA 3ISBA 2RDJA 2ITMA 4B08A 3CCLN 4Z6CA 3IFRA 4BG8A 3DI6A 3PMLA 2HOQA 3SQ0A 4UB2A 1CZAN 3BQTA 1GOCA 2CXYA 3NVVA 1NBWA 1SKRA 4C8NA 5TISU 3QNMA 3A8YA 2UYTA 4JK8A 3NH2A 1VQKN 4CHQA 2G8IA 2IVPA 2GUIA 4UB8U 2OYYA 3MFIA 5DBBA 4F4YA 3M1FA 3SD7A 1KVAA 1D4XA 2ZJQL 4DV5K 2J6TA 1EQYA 1ZJNA 5DGBA 5EE1A 3DXKA 1CZBA 1Z3EB 1QVGM 1PK1A 2JV3A 4WJ3B 3N97B 4EIAA 2F96A 1J5OA 1PVQA 4JMUA 2RHKA 3MDAA 9ICNA 2CGLA 8ICNA 2WUSA 1IKVA 2ZIWA 4QWCA 3WK7A 4KMUA 3KKRA 4M7XA 3GBTA 3PVXA 4KLLA 4CEEA 2ZIXA 1DLOA 5AQKA 3VCBA 3BQ0A 1NKBA 5AQRA 4DQ8A 3OHBA 1QTMA 4OD0A 2E6LA 4XH1A 3WXMB 4I2AA 1SWVA 4KH4A 1NK8A 5E84A 4PL8A 2H5XA 2GH1A 3OBWA 5F0XA 2KZMA 3L2RA 4YFKA 1Y64A 5FROA 3WXKA 1X9MA 2XC9A 2YTUA 2DFHA 3ETRA 1T03A 4LZDA 4B8CA 8ICCA 4RW4A 1ZC6A 3UKRB 4RQ1A 4UQGA 4CF1A 4NCAA 4E7HA 3EUB2 1ASVA 8ICBA 4CVNE 3PSTA 3KFUF 3DLLL 3O0FA 4XA5A 1QQCA 3MECA 2VIXA 2OCEA 4AHUA 1NWKA 4GFJA 2PXIA 2C28A 2P9IA 3RBDA 1KQQA 3SUOA 2R8KA 2BGWA 4Y2SA 2QM1A 3F2BA 4CJTA 3PZPA 2I7PA 3I1YA 5JVGL 4M3YA 3CMEN 2HI0A 1J53A 3CQ8A 3OYBA 4F3TA 2XGPA 4DG1A 2AGPA 1WSIA 2VWJA 2VWKA 3V6DA 3VN5A 1SV4A 4K41A 4FBTA 1HR0K 4A61A 1ZJMA 4EZ9A 2UVUA 3P38A 5KPTA 4FCYA 1YUWA 1WBDA 3KVGA 4P0QB 3KZBA 4BR7A 5AI5A 1A5WA 1BIUA 3OJSA 4NCGA 2GEMA 3F5AA 1JRPA 3UXPA 1ZQWA 3AVHA 4CJEA 2FSKA 4RTFD 4KHQA 5HRRA 3KK2A 1FFUA 3G25A 3PV8A 3V72A 1NLVA 3HX0A 8ICSA 1UHUA 9ICVA 2A1JB 3MX5A 1PK3A 1MWMA 4PHTX 3H8MA 2DWQA 2ZIWB 5HHIA 4WF9L 1QVFM 1V85A 2VG5A 4YN4A 1BIZA 3L4QA 2QKBA 1U47A 5HMMA 1JLBA 1N62A 1RT7A 1X9WA 1SS6A 2FSJA 2V52B 5AQLA 4Z6DA 4U7CA 2EQYA 3WKEA 5DB7A 5J2MA 1QH9A 5JS1A 2ZXHA 2P9NB 1O08A 3L3VA 3HVTA 4KO0A 4KLEA 3CM5A 5I3UA 2BH1A 4I7FA 4EFHA 3IG8A 4IRCA 3CQXA 3L8BA 2YNIA 2VGMA 3T19A 4C1NK 3RBEA 2K4EA 4IC9A 2I1QA 3A0HU 3PY8A 4FVMA 1GLEG 5KRSA 2A19A 5L1IA 2BDPA 3KHYA 3DDHA 4ZOHC 4R8UA 3FYHA 4GY2B 3SMVA 4IQWA 4YR0A 3J81j 1C0GA 4CJ5A 4BWMA 4J9RA 3G0ZA 1S10A 1NGHA 4GC6A 2D0PA 1XSNA 1SXEA 4KHPK 5J1EA 1N6QA 2E4LA 3DAWA 1C7YA 3SUNA 2K60A 2CGKA 4E7LA 4E7JA 1ZQIA 4BE1A 3ZDCA 3RWUA 4PL1A 4EAHD 4KB1A 4RQ5A 2HOFA 2P9PA 2KQ2A 5L1LA 1S6QA 5HP4A 4Y2VA 4CZKA 2VCPA 3NH0A 3HKZC 3VQPA 1JN3A 4DTNA 4BVOA 4FZZA 9ICXA 4P4PA 3T5HA 4RQMA 2H3FA 3PW5A 1LW0A 4O5BA 2W54A 3AM9A 3MN6A 4JUZA 4EEKA 3MR2A 8ICQA 4JI8K 5ALMA 5B66U 1WAJA 5BRDA 2OTLN 3FZLA 3RMCA 4C8KA 2YHXA 5GIOA 3QU5A 3CXCM 4MO5A 2RE2A 5GADP 2QWQA 3NDKA 1TK5A 3LP3A 1R59O 3VGKA 1JLFA 3QZ7A 3BS7A 3FDSA 3LZJA 2XHBA 3L0QA 2NUBA 7ICUA 3JPOA 3C65A 1MSWD 7ICPA 4ECTA 5KFYA 4Q43A 2HMIA 2FSNA 5M1NA 1S3XA 1NK7A 4GV9A 3PR4A 4BRPA 3V9UA 4MFBA 2YHWA 2G5HB 3PX4A 1S1UA 1S1WA 3TU5A 1HNXK 2ZXIA 2PYLA 4OJPA 1RGIA 4BE0A 1ZQCA 4A8EA 3OHAA 4ECSA 3TAQA 2E2OA 3CP8A 5AI9A 5J0TA 3VEOA 4JKGB 5T7BA 2XVTA 1KL9A 3JAMO 3K58A 4CERA 2YQEA 3H0RB 1NNEA 4PKIA 3MMVA 4DV2K 2E1EA 4LH4A 1L3TA 5ADXH 4DFMA 1D5AA 5KFBA 2XICA 3E9PA 1TE2A 1B4FA 5KFQA 4LSLA 3CJ7A 4IJNA 3V9XA 3MGHA 3O4QA 2EDUA 1YVNA 3S41A 4BR9A 7ICJA 5EWFA 2ASPA 3LVWA 4CGZA 3CM6A 1CZ9A 4B9SA 1T94A 3WEEA 3QERA 3SCXA 5JTIA 2FPMA 2KZ3A 2JH7A 3MC1A 3HM8A 1LKYB 4CBWA 1IXRA 5AHXA 4PH5A 1XC3A 4F4KA 1RCHA 2F8SA 5ALHA 5EXWA 5CB1A 3DOKA 5CJ7A 4Y2XA 3VQ5A 3VF4A 3O3HA 5ALNA 4YOYA 1JLAA 3SJJA 3P1GA 3TAFA 4ECZA 4KLTA 3WUHA 3CFPA 2ZJPL 3WNFA 2F1JA 4CHOA 4C4SA 4AM7A 2ASLA 1ZRNA 4YOXA 1VQLN 3OYEA 4M3TA 4C7ZA 5AZIA 3DLBA 3WNHA 1IG8A 4PL7A 5CHIA 3SAGA 4WCEL 3KHRA 1E3MA 2ASMA 3N28A 2IS3A 2IBKA 5L9XA 4B9TA 3CG7A 4BC4A 2R18A 1ZBSA 3V6KA 2A40A 4FJMA 1VSKA 3N4QA 3RVCA 3UKUB 2KHVA 5ALQA 2BPGA 1SZHA 1L8LA 2JGAA 4I2BA 9ICEA 1BCMA 2P9PB 3AGRA 7ICEA 4UW9A 1L7OA 1WSGA 4E1MA 1ZQBA 1P7DA 1MA9B 4YCXA 3Q8PB 3M8SA 4LF5K 1XHXA 4BRHA 4JI6K 1BPDA 5KG4A 1GLFO 4CJFA 4EP5A 5FRMA 2EWSA 3WK5A 5BPMA 2DPIA 4TQSA 4IOXA 3HJEA 3GV5B 2A3VA 2RRDA 2G5IB 4KLOA 4H5RA 4O4GA 3N4PA 4JK9A 1NGJA 1HEKA 2WB1F 4IBNA 4KFBA 2D6FC 4E1JA 1HJOA 2IOCA 1X3NA 2W3SA 2E20A 4N76A 3AEVA 1AROP 2V9WA 4J8FA 3EY1A 5B5EU 4C4RA 5AK6A 1BPYA 2P66A 2WF8A 5CZ1A 1S0NA 4ISEA 1QSSA 3L2VA 1ILYA 3KHGA 3T5KA 1XQSC 4QS8A 3AVMA 2HHSA 2WFBA 3IDHA 1S72N 1Y97A 4IXCA 3CF5L 3U9ZA 2KICA 1W0HA 1B9FA 7ICIA 2C2DA 2V51B 4DSLA 2HMXA 4Q45A 2P9KB 5E41A 2QB0A 2AQ0A 5F9NA 1TFRA 2B6GA 2FBVA 3C5GA 3FFKB 3VEXA 4E1NA 1WLJA 5C25A 4W5QA 3NVMA 4RUCA 3RMAA 2Z7JA 4F4ZA 5ALXA 3G6YA 5KFHA 3DLRA 4KN4A 1FKOA 4BQLA 3G71N 2OXOA 1J2NA 1EXNA 5GAGP 2Y0SC 4LF8K 5AKEA 4PGXA 3K59A 2I6XA 5AZIB 2P6UA 1ZD2P 2JH1A 4DL6A 4K8ZA 1F44A 2HF3A 5FPNA 3B6OA 3F2DA 4LFCK 3NE6A 3U6FA 1YJ9N 5J2KA 3QYPA 2F76X 1IBLK 2UU9K 7ICNA 1O03A 4DQRA 1TVAA 1N60A 1Q3UA 3AV9A 3AU2A 4QZIA 3AA2A 4N41A 4NM2A 5KFWA 4FJIA 2D0OA 2YX8A 4M3UA 2D5RA 2QK9A 8ICUA 2E2NA 3D6RA 3WNGA 4RNMA 1DEJA 2F8KA 3V7LA 4PHPA 2E8MA 4RPXA 4P0PA 5HRPA 3GIJA 1WOQA 4JKGA 3C0BA 4UAZA 4O8UA 5ALSA 4BGDA 2A5XA 4BY9C 2WHEA 5JRTA 2KSOA 3VQQA 1OVYA 3DRPA 3LDNA 3J8AA 3MABA 3P31A 5A0LA 4C8LA 3ATVA 5KAIU 3PUFA 1JIHA 2BQRA 1BNPA 4E7IA 5DB6A 4O5KA 2I5JA 5EY4A 4DCCA 4BXOA 2VYPA 3PO5A 3I56N 2KK0A 1S22A 3QUTA 3CJ1A 3HRGA 1RTJA 4KV8A 4J2BA 2ZTEA 3B6PA 3FZFA 5C2FA 4M9JA 2PFPA 4C4TA 2RF2A 2BCVA 4BQZA 2XIDA 4FK2A 3AUOA 3DEEA 3D2EA 3ATUA 2RPIA 9ICIA 4MDBA 2A1JA 5KFOA 5LMUK 1BOTO 3BF3A 4B6JA 3TKAA 1HPMA 3SMSA 1GLJO 4ED7A 1V4TA 4ICAA 5AQQA 1VQNN 1NK0A 4WQ4A 1NGGA 3KHHA 5F9LA 4NCBA 2QWRA 1VLBA 4YVZA 5D3GA 2WF5A 3C21A 5HBMA 3QINA 4LF9K 4EHTA 1LAVA 3L2UA 2KMDA 3VEYA 2FBXA 1TYQB 4M45A 5ALUA 1FK9A 4DOBA 1NK9A 4CE6A 1L3VA 3QMLA 2M0NA 3TACB 3FZMA 4F72A 4Y0WA 3WK6A 2KOBA 2G06A 7ICHA 4GKKK 4MHVA 5BR9A 3CYMA 2P9KA 1E4GT 3IN5A 2IOHA 3H8SA 3PSPA 3BQ7A 5KNIA 3BZCA 5J8YC 1GLLO 1P8ZA 2HNYA 4UBCA 3I33A 2ES6A 5KFPA 3V6HA 1L7PA 2H3IA 2VG7A 9ICHA 2YHBA 1NMDA 3C6AA 3PNCA 4K4GA 3VQ8A 1YZ6A 3ZSQA 3F9KA 2BUPA 2ZQBA 2Q97A 3QEXA 3K5LA 1LAWA 4FXDA 4QIWC 3BJYA 2WBNA 9ICFA 4BC3A 2DUYA 1UCVA 3NRZA 2BANA 2MUTB 2BCRA 2QW9A 1IV8A 2W43A 1D9FA 1T6CA 1RILA 4RW6A 4M42A 5J2EA 3C2KA 1WWUA 1NGEA 4A57A 2IHMA 1RTHA 2P9SB 3OYGA 1YTUA 3MXJA 4XUSA 4PKGA 3V1QA 5HP1A 5KFLA 3AA3A 1SXDA 3RH4A 1S9GA 4FJGA 4WQ4C 4YMNA 5KFVA 2G8WA 4JI0K 1YF5L 3RH6A 5GTIU 4Q44A 5M1PA 1ZQVA 4NYFA 2VWBA 1A77A 4WQ5A 4A62A 4NXNK 1JLCA 3B8AX 2C2RA 2AA4A 4J2DA 4CEBA 1SV0C 4HUFA 1KTQA 2NO4A 3U26A 4EBCA 2JRZA 5J2FA 2QWPA 1ITGA 2XY7A 5J2HA 2BTFA 3VA0A 2XRIA 5DM6L 4YMOA 4XH4A 3QESA 5AM1A 3SENA 1EXQA 3FLCO 3ZX3A 5CA7A 3R8EA 2PI4A 1SB3C 4OCZA 3M1YA 4BR2A 1Q81O 3HKZF 2QB1A 1JLGA 4C80A 2Q0ZX 2L5YA 5ALYA 4KLMA 1VRUA 3CERA 1X1PA 4O3NA 3H6EA 4KH6A 1OH6A 4ELVA 1PK1B 4I6MA 3OYMA 1N32K 3AO5A 2WAQC 3A2FA 1GOAA 2KZZA 5AM2A 3ISCA 3H3NO 3IS9A 2E8NA 2M9NA 1IM4A 5EOZA 4B3MK 1NJXA 4QWBA 2K4PA 3SQ4A 4BC5A 1TUYA 7ICLA 1ZYQA 1YXQA 3BY5A 4YP3A 1WN7A 8ICKA 4F50A 2KP7A 4BDPA 3UMCA 2HHXA 9ICSA 3K2PA 5T14A 4FWPA 1I94K 1V38A 4FWQA 3PW0A 3MBYA 4M9HA 4Z6FA 4YD1A 5BN9A 2HSTA 2NRTA 3F2KA 1VQ9N 5J0RA 5AKGA 1ZQJA 4NLKA 4G9ZA 4JHDA 3K1RB 4G3IA 1FKPA 4QW8A 1C1AA 2H3VA 2ZGYA 2KJ5A 4CGJA 3BGRA 3GE1A 2E8PA 3E2EA 3MX2A 3Q8QB 3JPSA 4HHTA 2J4RA 5KG5A 3K5NA 3ZT1A 2IA6A 2KW4A 3O5BA 3L2QA 5KL1B 2E1FA 4MEYA 1QSLA 3ZCMA 4FK4A 1BDGA 1B92A 5EE9A 3V7KA 5A2QO 2KKPA 4CJ3A 4ILGB 1BPBA 4A2BA 5AKLA 3F73A 2O8BA 1T3NA 3OHRA 1BQMA 1L5UA 2XY5A 2E8OA 4Y2YA 2F9WA 4PA1A 1Q86O 1FEZA 5KFAA 3T79A 3J7ZO 4FJXA 7ICQA 4MLHA 1X9XA 5AM3A 4RPYA 3AVGA 9ICAA 4QZFA 1NJWA 1RXVA 4KLIA 1EP4A 5AKHA 5ELZA 1ZQUA 2W7PA 5IILA 1H38A 4AM6A 3JPNA 1TKZA 1Z1VA 3BDPA 2FLPA 3ALRA 5KQ8A 1YI2N 1RYSA 1UOCA 3TAGA 2HHQA 4B9MA 1KXPA 2W04A 3NVWA 5F3XB 4DTJA 3QU4A 3H4BA 1B0XA 4R8UB 1CRXA 3J80O 3CRXA 2LBOA 4KLQA 2FPLA 5CYMA 4CF8A 1UA0A 4PKHA 2UUBK 3SV4A 4DL4A 1S9EA 2JWLA 1ZQSA 2RLTA 3UXOA 7ICSA 3RB0A 3MGVA 4OPKA 3VQ4A 2OPRA 4MF8A 4B8AB 1S77D 3EWAA 5KI6A 1T6DA 4CJVA 4LF6K 1TAQA 1QQOA 3BF1A 4X62K 2NRHA 1ZXOA 1TUUA 3OYFA 2UXCK 5ALJA 2Q31A 5J2DA 1RFQA 2VG6A 3T1YK 1JCGA 3NGIA 4JLHA 4JHDB 1D8LA 5BPCA 4JI1K 4EBEA 1DK3A 4BREA 2LYBA 4FWOA 4J2EA 7ICGA 4FK0A 4CD1A 4QZBA 5ALTA 1HPZA 3O1BA 4YOUA 2A1RA 5FPMA 3KKSA 2ZUDA 3J81O 3HSTB 5KFMA 2Y1IA 5AQSA 4JI3K 3IG5A 1KD1O 5JICA 4DWIA 3ZSWA 1UA1A 3IUCA 4FZNA 3W0LA 1T44A 4KHNA 3VF6A 2Q2RA 1KW4A 3HZ6A 4QNLA 3RSEA 4WFAL 4NB4A 3EL2A 1SL1A 2PKEA 4UB4A 1JCEA 4PHDA 5KAFU 4F91B 2Q0UA 3VEVA 2A1SA 5FLXO 2PMZC 3ENHA 5EOYA 5JU5A 1RT4A 4RT2A 1T3QA 3M8QA 3R3LA 4CZGA 1L3SA 4LZGA 5CZ2A 4JKCA 2W3RA 2Y1JA 1FIQA 5BPNA 3NTUA 5GAHP 2E5SA 5ALDA 3V6JA 1PVRA 2QEXN 1I3AA 1SQKA 4FM2A 4AYBF 1C6VA 4H4OA 4ID5A 3W3DA 5KPZA 2JLEA 2G09A 4QZEA 2W9CA 4ED3A 2I9GA 2HVHA 4AHTA 4YY3K 2HOIA 1J2MA 2GOLA 4B9QA 3RMDA 4GIBA 1HKCA 4NYNA 1ZQPA 2RQ5A 3GDXA 2JEIA 1IBKK 1NKCA 2E8AA 3RFAA 2NRVA 3H8JA 4DV4K 9ICOA 3Q7CA 3QETA 4B3TK 3KK3A 3RAXA 2RN2A 4OLAA 4F5OA 3ENBA 1XU4A 1KDHA 3ONNA 4JK7A 1COKA 4IZ9A 8ICTA 4RQ4A 3NGDA 5AI8A 1IIPA 3UKRA 3RJHA 3LDOA 1OH7A 2ZJ8A 1IV0A 5AIBA 3JS6A 3AVAA 4DL5A 4GVMA 2LHTA 4CEFA 2HSZA 4HUGA 4XQ8A 2P1JA 3TTDA 4CGHA 3QEWA 5ALOA 1KFTA 3E1YA 3HM9A 4FLTA 1RDUA 5IIIA 4O55A 5J2AA 1KC8O 4H5VA 3EPIA 3CCVN 1Q8IA 2G8FA 1RNHA 1QCKA 5AIAA 5CYQA 4RQ6A 3OS2A 4PWDA 1BPEA 5TZVA 3QE9Y 1HUOA 3LL3A 2O4GA 4ICLA 4F8RA 5AJ3K 3RSEB 1OKJA 3Q8RB 1S97A 3VQEA 3CJBA 4F4WA 2WB1C 5G5GA 3ETLA 4UB1A 1VSIA 4FSVA 4C0ZA 5J0YA 2RHFA 2N1RA 1JJ2M 5EX5A 2D1KA 4DB3A 4HAIA 4CEOA 3R9PA 5CR4A 9ICKA 5GIPA 3NGYA 3OYKA 3QFUA 4BDZA 4L8RB 3KBBA 4EYIB 5DDYA 1N48A 3MN5A 1Q7YO 4WQ5C 4AILC 3O4NA 1EKEA 3LDLA 3VEZA 3N7SC 3CCRN 1NZPA 1MQ3A 4DTRA 4KBOA 3F5EA 2ITGA 3OA9A 2D0CA 5HROA 3H08A 5DMRA 2VA3A 4CHZA 2AHOB 4ELUA 3HYFA 4JV2A 4ECQA 3LAMA 1K73O 4GC7A 1RXWA 3TTFA 3SI6A 3H40A 3NF7A 3G6EN 3RMBA 2P9UB 4RW7A 1XNRK 1DGSA 2B21A 4IL6U 4GXIA 5KFZA 4UAUA 3ZSYA 3HBTA 3JYTA 7ICVA 1ATSA 2E3TA 1K8KB 3C7NB 3MXIA 3O08A 5ALPA 3CC4N 4MQ3A 3I55N 1RQNA 4ECYA 4H5NA 3ZYYX 5J2GA 2NYVA 3OYLA 3MEGA 3BUZB 2F77X 3H46O 2E2QA 3LP1A 3H7IA 5FP0A 4DF4A 2LM4A 1BVSA 1A6SA 4PZNA 3NASA 1QS4A 4JS5A 2P51A 4BRCA 3QEPA 4M0AA 1Z6RA 3DLEA 3AL0B 1SKSA 4DUYK 4BGBA 4TUQA 1KFDA 2FLLA 4DFKA 2F3NA 2GWSA 4K0KK 2F44A 1ZOLA 5AQIA 4WFBL 2F7TA 2W41A 2BCQA 2FMSA 1O1WA 3GZFA 3RAQA 1J5EK 3OPXA 9ICUA 3HVRA 4FJLA 4CNQA 3T3FA 5AICA 3NBPA 3SNNA 3KD1E 3GILA 3PSFA 4Z4FA 2R8GA 4QW9A 2EHGA 4C1NI 2K4IA 3NHGA 4DOAA 8ICYA 3O9UA 2XCPA 1BISA 3VQCA 5EWEA 3WNEA 1YHQN 4NLZA 2B5JA 5FPEA 4M6WB 1TVRA 4IO8A 2LSNA 1QZ6A 3WU2U 3RB4A 4J9SA 4M2YA 3HSCA 4IOCL 3SEIA 4B1YB 3AA4A 4Z4CA 4IWVA 3RH5A 3H3OB 4ECUA 3BS5A 3L4PA 4IR9A 2QA4N 4KRFA 5DLFA 3ZT3A 1ZXIA 3TSPA 5M1QA 1N33K 1K8KA 8ICLA 4F2RA 4WFNL 4R65A 4TUSA 2UXDK 2J6SA 3KJVA 4PY5A 2BPCA 3E66A 3E0FA 5KT4A 4ED0A 3L3FX 2ASOA 1G15A 2GELA 1VQPN 5ALIA 3QDKA 2HBKA 3QO9A 2G07A 3MN7A 4ED8A 4E0DA 3NFAA 3TABA 3IKMA 5KG7A 4UASA 4CJWA 2FLOA 4OJRA 3M9NB 4B9LA 4MDAA 3TADA 4BACA 5AQWA 4HCBA 2VKQA 3V1OA 3HO1A 1RT2A 4ELTA 1DT9A 4OJ6A 3QXGA 4TQRA 1VK0A 3SK3A 1FJGK 4LH5A 2LI6A 4R79A 4DTSA 4IG3A 2HNZA 3SBGA 2NZTA 3HW8A 4HCCA 4Y2UA 2BCSA 3EKSA 3BS5B 4CFCA 1ZRMA 4FFDA 3FR0A 3UMGA 3G6XA 4H0PA 3UB5A 2F4VK 4J9KA 3I0SA 1Q9XA 4CGGA 2ZM6K 2KJ9A 5AKJA 4M9NA 2YNHA 4FWLA 2Q3SA 1JALA 1D8YA 2DQNB 9ICBA 4RQ0A 5L1KA 3HXMA 4HVJA 4O5CA 2ZUBA 2HHWA 4YOTA 1B9DA 5DM7L 1LW2A 1KAYA 1L8OA 3M8PA 3MR5A 4AHCA 1J6ZA 4GNIA 3DLGA 1BWFO 3QBXA 2JEFA 3VMFB 1S6PA 1NK5A 4CFDA 4NLCA 2BZFA 4YXMA 1JL1A 3OY9A 3LDQA 2ZJAA 2HHHK 1Q8KA 1GLDG 3KKAC 3THXB 2YHAA 3I8BA 1IO2A 3KLHA 3A5MC 4FPAA 1WSFA 4BRIA 3CCSN 1S5LU 5ALEA 1K8AO 2YN4A 2DPJA 3O3GA 3A5LC 3OJUA 4QOZB 4CEAA 2DGZA 4IR1A 4M3XA 2DY4A 5J0SA 1BPZA 2B4JA 3P5JA 2YMLA 3MAQA 5HNKA 4I9LA 2VQFK 3KTQA 2PYJA 5AI6A 4XH5A 4FJ5A 1X6JA 3MR6A 1NU0A 2FF6A 2ZTCA 2CPRA 5KTQA 1CXQA 3UM9A 3TAPA 5JLHA 1KQSM 2WF7A 4JKHA 4DV7K 1NJZA 1NJYA 3H4DA 1COOA 3AA5X 3E58A 7ICFA 9ICMA 2BE2A 2MSNA 4G9BA 3TR8A 5JUMA 3AVNA 4QZCA 3JXUA 1QHTA 3A5NC 3Q8MA 3VGLA 1RT3A 1RQLA
chains in the Genus database with same CATH topology
4Q8FA 5J0QA 2FLNA 3LDAA 3RJKA 4QS7A 1RYRA 1NGDA 4QZAA 1ZQGA 3OGUA 9ICCA 2E2PA 2QWNA 2F1HA 3GG4A 3SI8A 5KFGA 3VENA 1TKDA 4F92B 5HMLA 3RJGA 3WEEB 4H0VB 5AFUH 3EKUA 4YXJA 4ECXA 3RR7A 4DQIA 2QWOA 3VTHA 4A5AA 1PZNA 4FPBA 5KFTA 4J9QA 3SBTA 1E4FT 2W9CB 1JMSA 3IM1A 3QBWA 2KHOA 1S9FA 8ICMA 3M6GA 2ZF5O 5JMVA 5KFCA 4IFEA 4PHAA 5GINA 3EZWA 9ICPA 1W2BM 5FPDA 1XO1A 2ASJA 4JN4A 3EZ5A 4P2HA 3E9LA 5DG8A 4CBXA 2PBDA 1X3MA 1O13A 3JPQA 4O3QA 3VOVA 2XO7A 3DJCA 2ASDA 5ADXA 4RPZA 2IHNA 3C1YA 1P90A 3VPZA 3G4SN 4I2HA 2YI1A 2VA8A 4H0YB 3M9OB 4FO6A 1HX1A 4FOIA 2D4WA 4QWEA 3TARA 3L4IA 4YR3A 1LCUA 3R6MA 8ICIA 4TURA 1U6ZA 1ZQEA 2OANA 3HT3A 4F5PA 4CZEA 4M9LA 2GUPA 5AQOA 1RDWX 1S0OA 2KKZA 7ICRA 3E9OA 5KPRA 5MLCQ 1QLNA 4HTLA 5B8HA 3TTCA 2W8LA 3OBYA 2ISPA 3GOIA 4DHYA 3PX6A 4ED2A 4LVSA 2AJQA 2R8JA 4B1ZA 4ECWA 4BVPA 4K4IA 3HPOA 4O0IA 2Q0RA 3PW7A 1YJNN 4BR0A 5KT5A 4JEPA 4F5RA 2UVWA 1VQON 1NM1A 4DF8A 1HUXA 3VTIA 4ISFA 1LOTB 8ICWA 1NOMA 5DG7A 3O6WA 4F2SA 4I28A 4KTQA 2XY6A 4FWMA 3MR3A 4L3QA 3TFSA 3DXMA 3ZDEA 3CJ9A 1TK8A 4IO9L 2JEJA 5AQMA 2W9BB 3TSQA 5AQFA 2AQ4A 4I2FA 3AARA 2PFOA 5D4BA 2P9SA 4RUAA 8ICXA 3CMAN 2PFQA 4RQ7A 4LC9B 4BRGA 4RWTA 5DG9A 1ZQOA 3AU6A 4DKWA 1LV5A 3MWPA 1NK6A 4FWKA 1S0MA 3D2EB 5KT6A 2C22A 4RNNA 3RB3A 3GIMA 5AZJB 1ZQMA 1XSPA 3OSPA 5DB8A 3GV8B 1WUAA 2J6UA 4F5QA 3QEBZ 4IQVA 3V7JA 2ALZA 1QQMA 3O4WA 4GV3A 3HI0A 3CC2N 1VQ8N 3ZEUB 3K9KA 4F5NA 8ICGA 3VGMA 3MDCA 3JPRA 3CCMN 3PIPL 1JCFA 3RJJA 1JXLA 1GLCG 2HBJA 4JV1A 3LM9A 3SAFA 3U8XA 3UQ0A 3RJEA 2NRZA 5C12A 3CJAA 3O9QA 4OO1J 5KG0A 1BUPA 3NVKA 1ZQRA 4ED1A 2PFUA 4FWSA 5KT2A 2YJEA 3MN9A 2V4QA 4C23A 2IVNA 3ENOA 3CPWM 4JD2A 2HF4A 4DSJA 1NKEA 4JKFA 4QWDA 3LWMA 5F2RA 5KG6A 5J29A 1U2VA 2QWMA 2OTJN 3M9MB 3HP6A 5CWRA 5HHHA 3UPQA 3L6QA 2YX6A 3PW4A 3VESA 2P9LB 1NGIA 9ICGA 4A59A 3EO3A 3EW9A 3EN9A 3LWLA 3ZD9A 3TQ1A 1S0VA 3ZETB 1Z00A 4CZHA 4PHEA 5KFIA 4Z94A 2JEGA 5AQXA 3C6HA 2RDIA 1YIJN 5DKWA 1QZ5A 1ZQAA 1ZQLA 4NY8A 1MWKA 9ICRA 3D2FB 5C2DA 2CGJA 2W40A 4BRAA 2QI2A 3SLCA 7ICOA 3HTVA 4KLGA 5DLGA 3A5OC 3PO4A 5AFUA 3ZEUA 4MFAA 4M9GA 1DOQA 5LY3A 3TFRA 3RTVA 3Q8SB 5DDMA 1N56A 3PW2A 4O3RA 5BRHA 2DFLA 4BXOB 4JKEA 4A5BA 1K1SA 1ZQKA 4YDUC 4KLFA 1NGCA 2V4RA 4FS2A 1T3VA 4BG9A 4GXJA 1JXEA 5M1OA 4WYBA 4DFJA 1HLUA 3C2MA 4QWAA 3HWTA 1KAZA 4QZGA 2KTQA 1BPXA 5KG1A 3FZKA 3FE1A 1X2IA 1VQ4N 2IMWP 5D46A 4MFFA 3B0XA 2UVRA 4RQ2A 3O8MA 1T8EA 3AGKA 3G6VA 2UVVA 5IIOA 4HWIA 1TAUA 5KFUA 3ZD8A 7ICKA 5J2BA 4H0XB 4AF1A 4C8OA 4PGYA 4M6WA 5H1SQ 3HOTA 8ICZA 1SAZA 2JWKA 3TANA 5C5JA 4YOWA 4CZMA 4IOAL 2GX9A 3FGUA 4JWMA 1XWLA 1YAGA 3CD6N 5HOOA 4P4OA 4H03B 1L3UA 1NK4A 4DSIA 4DQQA 3KHLA 5KFDA 1SZPA 2BKEA 2E1YA 5DBAA 4DQPA 1Z00B 1BG3A 3BEXA 3PX0A 2ZTDA 5KFFA 4RZRA 1U4BA 5J0WA 2KLAA 1TV9A 5JLFA 3U9DA 4FWRA 3O9SA 4XEIA 1M90O 3CJCA 4DS4A 3GDQA 3RRHA 2GWJA 1T4GA 4KLDA 2QWLA 4OPAA 4JWNA 3AAQA 3ID8A 3T69A 5F1XA 5AQTA 3O80A 4BRNA 2XCAA 5BPLA 4EHUA 3QB0A 4CZLA 3WQUA 1Q18A 1V9PA 3ZX0A 1KRPA 4F4XA 3Q8KA 3SJHA 3VETA 5JVHL 5EWGA 2FF3B 4TUPA 5KFKA 3H45C 1U45A 2HHVA 4DLGA 3ORYA 2ATLA 2V7ZA 2OWOA 2V7YA 5DQGA 1Q82O 2AGOA 2HVIA 3UE5A 4HYKA 4QZ8A 4RNOA 1H1VA 1M1KO 5DGAA 1XUPO 4DLEA 4B1VA 4BR4A 2P9NA 3CQYA 5AQHA 3P39A 4C8MA 4B1UB 4B9NA 3QEAZ 4NM1A 5DQIA 2ZJ5A 5KQDA 4ILJA 4YQWA 5HL7L 1G99A 3DWLA 1U49A 3ZDAA 3WXIA 5J2JA 3K4GA 4NO7A 5KFEA 2WC9A 4BRKA 1MQ2A 1EO1A 3C7NA 5DB9A 4DL3A 3O9RA 5AQUA 5BRFA 4EBDA 3RB6A 1WCLA 3LK9A 3RJIA 3ZDDA 4MF2A 3ISDA 4BROA 2BHNA 4CZJA 2FMQA 3IMXA 4FS1A 4I2DA 4J9NA 5BOLA 1KEJA 3MFHA 2PAVA 3CCQN 1ESVA 1X9SA 3QFPA 3H1QA 2BPFA 2KN7A 3CCUN 1NJIO 3K75D 3IHQB 1HKBA 4DEZA 1TK0A 2QXLA 3B0YA 3SAHA 4NLNA 4DOCA 3GQCA 4ED6A 1UT8A 4BRDA 5J0UA 1SL2A 4CD3A 4MFCA 5BN8A 4IRKA 2BQUA 2GTDA 3KWIA 1BA0A 1KLNA 3ZETA 3UKUA 1ZETA 1KAXA 4BGAA 3EYZA 1W97L 2YHYA 2FPKA 4J9LA 5J2IA 4CZFA 5M1KA 3SZ2A 2NRWA 3ID6A 4YDUA 4J9MA 4O5FA 1V4SA 4M7YA 2ZWHA 2W8KA 1VQ6N 3CC7N 4EZ6A 1SZ2A 4IDHA 3T5LA 3MDQA 4FL9A 3MK6A 1CUKA 3MCPA 4KITB 5CHGA 1B43A 3FZHA 5EVZA 4YOVA 4K4HA 2VANA 3PLAA 2P9IB 5DBCA 4KLJA 1D9DA 1NGFA 4JK1A 4F93B 2DPNA 3SYZA 4BR5A 3WXLA 1C0FA 4MO4A 2IVOA 2C2EA 4I27A 4RT3A 2HOEA 4H0TB 5KFNA 3OW2M 1ZQZA 4H5TA 2NLXA 8ICRA 4RCHA 5DQHA 1RZTA 2R8HA 4KLSA 2YCHA 8ICAA 1X9JA 4QZHA 1GLBG 4O5EA 1UT5A 1MDUB 4UY8O 2JZBA 4M47A 9ICWA 5AZJA 4FO0A 5M1FA 2F1IA 4ECRA 2HBMA 1YJWN 3P4IA 4FWNA 3ULEA 2AGQA 5TKWA 3M5RA 3EE8A 5CE3A 4NLGA 1NGAA 4QS9A 4UAWA 1T7PA 4B9VA 2HW3A 4BC2A 5AR0A 3R1XA 3PIOL 3F5TA 2XGQA 3ZX2A 5C15A 3BP8A 3VF2A 4DCHA 3N4MB 5KT3A 3H8WA 5CP2A 2CH5A 2E1ZA 2AU0A 3CCJN 5KG2A 4I2JA 4PGQA 4NXZA 2YJFA 2IIRA 5E26A 5J0PA 1RPLA 2A6AA 3VERA 3TSUA 4XRHA 2HHTA 2ZUCA 2NRRA 3TPQA 3H1VX 5LJVA 3JPTA 4DFPA 2ZGZA 4DSFA 7ICTA 8ICHA 4CCHA 4YG2A 2E88A 4YORA 3DXKB 3CETA 2H3GX 4I2CA 4H5WA 4F3OA 3GL1A 4JD2B 4I2IA 3Q7BA 3HOSA 2P6RA 3MCAB 4JKBA 4DSKA 1IJJA 2I7NA 4UBBA 3C1ZA 3WQTA 4K25A 4R66A 3F9MA 4DQSA 4YMMA 2BQ3A 4QZDA 4RU9A 4FBUA 3BQ2A 2P9LA 2BCUA 9ICJA 1TYQA 1ZQHA 1N8RO 4DSEA 3GIIA 4Q8EA 1ATRA 3WXJA 5KFJA 1YITN 4F9OA 4CBUA 2JZBB 4IQTA 4IJAA 4EEYA 4GVEA 4DL7A 1ZQNA 5AQPA 1VQMN 3DXMB 5CR0A 5IIKA 1SL0A 3O1WA 3KK7A 3C2LA 1K9MO 2R8IA 2PI5A 3SV3A 4O8KA 4O3OA 2MUTA 4I29A 5C10A 5IIJA 2HHUA 4DL2A 9ICLA 4KLUA 1BO5O 5D49A 1BU6O 4ILHA 1QQNA 1ZQXA 4GV6A 5L1JA 4FVUA 4UB5A 3CHWA 4BRQA 2NRXA 4IQUA 1ATNA 4X5VA 8ICEA 2W9BA 5BOMA 9ICQA 5KT7A 5J2CA 4Z6EA 3THVA 4DS5A 3CPEA 4BRLA 2HBLA 5AQNA 4BWJA 2ZJRL 3D2FA 1HJPA 3M8RA 3KWGA 3RRGA 3MGIA 2PFNA 3T5JA 8ICFA 3PMNA 3A0IX 3AY9A 7ICMA 3T7ZA 3OSNA 4ISGA 3M3ZA 5LJWA 3QZ8A 2W9AA 3NMUA 5C0YA 3CCEN 4IEIA 3BQ1A 5J0OA 2FXUA 9ICTA 2GWKA 2CH6A 3TI0A 3Q8LA 4MEXA 2AP1A 2A3ZA 2MAXA 4BRMA 1XSLA 4J9OA 3CIPA 1K1QA 4DO9A 4J9PA 5AQJA 2WTFA 3C23A 3GV7B 2BR0A 1QHAA 1XC9A 4JNEA 5AQVA 4RQ3A 4ECVA 1U9LA 4B1WB 5GAEP 3JPPA 2Q36A 4GLXA 2QTDA 3LM2A 5KFRA 5KFSA 1U2VB 4U67L 3MWTA 1LB2B 4O9MA 1DKGD 4JKAA 4O3SA 2P9UA 3D7EO 4YD2A 3O9TA 4UB3A 8ICPA 3U4LA 5TKYA 3UQ2A 8ICJA 4NLBA 3RR8A 3K9JA 1VQ7N 2LYHA 1KFSA 1ZQFA 3PR5B 4MLEA 1HUZA 3GIKA 1MC8A 4M63C 5BREA 3VEWA 2F9TA 3EE9A 2A42A 4IEEA 3WT0A 4B1XB 4U7BA 1A76A 2W9MA 1U48A 2FMPA 5J0XA 4A2AA 4UAYA 4CZIA 4RQ8A 4B9UA 2NNWA 1B22A 3UXNA 8ICOA 1Y88A 4JAXA 8ICVA 1WCNA 4YR2A 4FOEA 4KN7A 1BGXT 3RJFA 1S76D 4ZH4A 4R63A 5KG3A 4O3PA 4KLHA 2A41A 5AQYA 4P4MA 4I2GA 1QSYA 4QZ9A 1KSPA 4PPXA 1HKGA 1Z05A 4I2EA 4BRFA 2HMPA 3C5FA 4KH5A 1ZQYA 2ISOA 4M04A 3EPGA 5IIMA 4R64A 2VA2A 3ULEB 3GFKB 3CI5A 5KFXA 4OPHA 1VQ5N 1XS9D 3SMPA 3ZDBA 4K43A 4EYHB 1NGBA 3LDPA 1JX4A 2Q1NA 1ZQQA 1DGKN 1VAZA 5IINA 4CI6A 5AQZA 5AQGA 1BA1A 4I6MB 4CJ7A 4JKDA 1CEZA 1ZQDA 5I9EB 4H0OA 2KFZA 3AAPA 4GXKA 4K42A 1ZQTA 1GLAG 4JV0A 3QICA 2KFNA 1SKWA 4IRDA 3ISBA 2RDJA 3CCLN 2ITMA 4Z6CA 3IFRA 4BG8A 3PMLA 4UB2A 1CZAN 3BQTA 1NBWA 1SKRA 4C8NA 3A8YA 4JK8A 1VQKN 2UYTA 2IVPA 3MFIA 4F4YA 5DBBA 3M1FA 2ZJQL 1D4XA 2J6TA 1EQYA 1ZJNA 5DGBA 3DXKA 1Z3EB 1QVGM 3N97B 4EIAA 2RHKA 3MDAA 9ICNA 2CGLA 8ICNA 2WUSA 4QWCA 4KMUA 4M7XA 3GBTA 3PVXA 4KLLA 5AQKA 3BQ0A 1NKBA 5AQRA 4DQ8A 3OHBA 1QTMA 4XH1A 3WXMB 4I2AA 4KH4A 5E84A 1NK8A 4PL8A 2H5XA 3OBWA 5F0XA 2KZMA 4YFKA 1Y64A 3WXKA 1X9MA 2XC9A 4LZDA 8ICCA 3UKRB 1ZC6A 4RQ1A 4UQGA 8ICBA 3DLLL 4XA5A 1NWKA 2PXIA 2C28A 2P9IA 3RBDA 2R8KA 2BGWA 2QM1A 2I7PA 5JVGL 3CMEN 2XGPA 2AGPA 4K41A 4FBTA 4A61A 1ZJMA 4EZ9A 2UVUA 3P38A 5KPTA 1YUWA 3KVGA 3KZBA 4BR7A 3OJSA 2GEMA 3UXPA 1ZQWA 2FSKA 4RTFD 3G25A 3PV8A 3V72A 1NLVA 3HX0A 8ICSA 9ICVA 2A1JB 3MX5A 1MWMA 4PHTX 5HHIA 4WF9L 1QVFM 4YN4A 3L4QA 1U47A 5HMMA 1X9WA 1SS6A 2FSJA 2V52B 5AQLA 4Z6DA 5DB7A 2P9NB 4KLEA 2BH1A 4EFHA 4IRCA 3CQXA 2VGMA 4C1NK 3RBEA 2I1QA 3PY8A 1GLEG 5L1IA 2BDPA 3KHYA 4R8UA 3FYHA 4GY2B 4IQWA 3G6EN 4YR0A 1C0GA 4BWMA 4J9RA 1S10A 1NGHA 4GC6A 2D0PA 1XSNA 3DAWA 1C7YA 2CGKA 1ZQIA 3ZDCA 4EAHD 4RQ5A 2P9PA 5L1LA 5HP4A 4CZKA 2VCPA 1JN3A 4BVOA 9ICXA 4P4PA 3T5HA 3PW5A 3MN6A 4JUZA 3MR2A 8ICQA 5BRDA 2OTLN 3FZLA 4C8KA 2YHXA 5GIOA 3CXCM 4MO5A 2RE2A 5GADP 2QWQA 1TK5A 1R59O 3VGKA 3QZ7A 3FDSA 3L0QA 7ICUA 3JPOA 3C65A 1MSWD 7ICPA 4ECTA 5KFYA 4Q43A 2FSNA 5M1NA 1S3XA 1NK7A 4GV9A 3PR4A 4BRPA 2YHWA 3PX4A 3TU5A 1RGIA 1ZQCA 3OHAA 4ECSA 3TAQA 2E2OA 5J0TA 3VEOA 4JKGB 4PKIA 3MMVA 1L3TA 5ADXH 4DFMA 5KFBA 3E9PA 5KFQA 3CJ7A 4IJNA 3MGHA 1YVNA 3S41A 4BR9A 7ICJA 5EWFA 2ASPA 4B9SA 3WEEA 2FPMA 2KZ3A 3HM8A 4CBWA 1IXRA 4PH5A 1XC3A 4F4KA 5EXWA 5CB1A 5CJ7A 3VF4A 4YOYA 4ECZA 4KLTA 3WUHA 2ZJPL 2F1JA 4AM7A 2ASLA 4YOXA 1VQLN 5AZIA 1IG8A 4PL7A 5CHIA 4WCEL 3SAGA 3KHRA 2ASMA 2IBKA 5L9XA 4B9TA 4BC4A 1ZBSA 3V6KA 2A40A 3N4QA 3RVCA 3UKUB 2BPGA 9ICEA 4I2BA 2P9PB 3AGRA 7ICEA 1ZQBA 1MA9B 4YCXA 3Q8PB 3M8SA 4BRHA 1BPDA 5KG4A 1GLFO 2EWSA 5BPMA 2DPIA 4TQSA 4IOXA 3GV5B 4KLOA 4H5RA 3N4PA 4JK9A 1NGJA 4E1JA 1HJOA 1X3NA 2E20A 1AROP 2V9WA 4J8FA 1BPYA 2P66A 1ILYA 1S0NA 4ISEA 1QSSA 3KHGA 3T5KA 1XQSC 4QS8A 2HHSA 2WFBA 3IDHA 1S72N 4IXCA 3CF5L 3U9ZA 7ICIA 2C2DA 2V51B 4DSLA 4Q45A 2P9KB 2AQ0A 5F9NA 1TFRA 3C5GA 3FFKB 3VEXA 3NVMA 4RUCA 4F4ZA 3G6YA 5KFHA 4BQLA 4KN4A 3G71N 1EXNA 5GAGP 4PGXA 5AZIB 2P6UA 4DL6A 2HF3A 5FPNA 1YJ9N 5J2KA 7ICNA 1TVAA 4DQRA 4QZIA 3AU2A 4NM2A 5KFWA 2D0OA 8ICUA 2E2NA 3D6RA 4RNMA 1DEJA 3V7LA 4PHPA 4RPXA 3GIJA 1WOQA 4JKGA 3C0BA 4UAZA 4O8UA 4BGDA 2A5XA 4BY9C 1OVYA 3LDNA 3J8AA 3MABA 3P31A 4C8LA 3ATVA 1JIHA 2BQRA 5DB6A 4O5KA 5EY4A 4BXOA 2VYPA 3PO5A 3I56N 1S22A 3CJ1A 3HRGA 2ZTEA 3FZFA 5C2FA 4M9JA 2PFPA 2BCVA 4BQZA 3AUOA 3D2EA 3ATUA 9ICIA 4MDBA<