2NRVA

Crystal structure of the c-terminal half of uvrc
Total Genus 75
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
75
sequence length
218
structure length
218
Chain Sequence
RGLRKEALEELMKLLNMKDFPYRIEGIDISHLQGKYTVASLVVFEDGFPKKGDYRRYKIEQDHPDDYESIRTVVKRRYSKHPLPNLLFVDGGIGQVNAAIEALKEIGKDCPVVGLAKKEETVVFENREIHLPHDHPVLRLLVQIRDETHRFAVSYHRKRREKESLRSVLDNVPGIGPIRKKKLIEHFGSLENIRSASLEEIARVIGSTEIARRVLDIL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Hydrolase
molecule keywords UvrABC system protein C
publication title Structure of the C-terminal half of UvrC reveals an RNase H endonuclease domain with an Argonaute-like catalytic triad.
pubmed doi rcsb
source organism Thermotoga maritima
total genus 75
structure length 218
sequence length 218
chains with identical sequence B
ec nomenclature
pdb deposition date 2006-11-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF08459 UvrC_HhH_N UvrC Helix-hairpin-helix N-terminal
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.20 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 5' to 3' exonuclease, C-terminal subdomain 2nrvA02
3.30.420.340 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Nucleotidyltransferase; domain 5 2nrvA01
4Q44A 1U49A 4ED1A 2WTFA 2IA6A 1KSPA 2VA8A 4ED7A 4DSJA 1ZJNA 2XCPA 1ZQPA 9ICRA 1L3VA 4RT2A 4RQ3A 3QE9Y 4NM2A 5KT5A 3KHGA 2XY6A 5KG7A 3HX0A 5J2HA 5BPCA 7ICTA 5JUMA 5KFOA 3V7JA 5J0UA 1ZQEA 4IR1A 3GDXA 4F5NA 4RQ0A 4KLHA 4DFMA 2JEIA 2VA3A 4IRCA 3TANA 4J9SA 4B9UA 3HT3A 2ISPA 4GC6A 9ICGA 4F2SA 4F5PA 4JK1A 2MAXA 1QSLA 8ICEA 3M9OB 2C28A 5KFDA 4ECRA 2V9WA 3H4BA 4EYIB 3C5FA 3UXNA 5KG2A 2KFNA 3HP6A 1NKEA 2KFZA 2JEFA 2ZJAA 1SL2A 4PHDA 1ZQDA 8ICPA 1PZNA 2NRVA 4DEZA 2A1JB 4MFCA 3TFSA 1NJZA 2I9GA 3GV5B 2IHNA 3NGDA 3RAQA 2KZZA 1L5UA 2AGOA 1S0NA 3JPTA 5DG9A 1TAUA 3PMNA 5DQIA 2DPIA 3JPNA 2NRTA 3RH4A 4M9LA 5J0TA 4YR3A 7ICSA 1U47A 3ISBA 3MR3A 2W9CA 3G6XA 2C2EA 1UA1A 4G3IA 2HHXA 5IIKA 4NLNA 2ZUDA 5DG8A 3QEBZ 4CCHA 3C1ZA 3PW2A 8ICRA 1BPDA 5DLGA 4FBTA 2HHUA 4QZEA 4MEYA 3G6YA 9ICVA 3TAQA 1N48A 1TK0A 4EZ9A 4RU9A 5KG3A 4TUQA 4RQ7A 4M9GA 5J0SA 4KLQA 9ICJA 7ICRA 2W9BA 3RJJA 4DQIA 1KDHA 5KFFA 2BPFA 4IRKA 2AQ0A 3GIIA 1T4GA 4UB3A 1ZQFA 2VA2A 1TK8A 4O5KA 1B43A 4EBEA 5KT2A 2MUTA 4YFKA 9ICPA 2R8GA 9ICOA 5DQGA 2JZBB 5KFBA 4QWEA 3Q8QB 4J9RA 2AGQA 3PVXA 3T5HA 4J9OA 8ICZA 4M2YA 2Q0ZX 5J2KA 3PW7A 4QZHA 4KN4A 3GIKA 5DDMA 5D4BA 1KFTA 4KLTA 2NRZA 5C5JA 5KFUA 4BDPA 4KITB 5KFLA 5DB9A 4DOAA 4I2JA 3EPIA 3V6JA 4JWMA 2C2RA 3V7KA 7ICEA 3GFKB 1ZQUA 1XO1A 4IQTA 4YR0A 5J2CA 4DL3A 1BPZA 2BCSA 4EZ6A 4M9HA 5DLFA 5KT4A 1RXWA 2H5XA 1TAQA 1S0OA 2GWSA 4P4MA 2B21A 5CB1A 5DGBA 5IINA 5KFWA 2FPKA 1NJYA 1S76D 2HVHA 3GV8B 4DQQA 3T5KA 3V6HA 4K4IA 4O3PA 3MBYA 4PGXA 2ATLA 8ICJA 4F4YA 8ICGA 4DFPA 4BXOB 7ICVA 4DFKA 4R8UB 5HHHA 4ECUA 2P6RA 4KLFA 1BVSA 4JUZA 4B9TA 4C8KA 3M9MB 1QTMA 3KTQA 4B9MA 4JV0A 5DDYA 1D8YA 3SZ2A 4IQUA 3BDPA 4QZCA 3RR8A 4Z6EA 7ICLA 5HNKA 4DSIA 5KFKA 1IXRA 1MQ2A 4QWAA 8ICKA 4KTQA 1T7PA 4RUAA 2FLLA 3RJKA 1AROP 3H4DA 3QEAZ 2XY7A 4ELTA 2UVWA 2BHNA 2UVVA 4M9JA 4ZH4A 3RB3A 3RB4A 1L3SA 3T3FA 2C22A 4DWIA 3IHQB 3Q8RB 1U9LA 1Z3EB 3PX6A 3OSPA 1ZYQA 4NM1A 1X9WA 4B9NA 3FYHA 5TZVA 4J9LA 4P2HA 2LYHA 2P6UA 4MEXA 2PI5A 1X9SA 5KG1A 4M6WA 1TFRA 3ZDBA 4YMOA 5KFPA 5KG5A 3FDSA 2HHSA 3B0YA 2I1QA 5EWEA 2BCVA 3PR5B 4PPXA 4F2RA 8ICYA 3C5GA 1NK9A 1KLNA 2NRXA 4DL2A 4YD2A 3JPRA 2BDPA 5J2GA 3T5LA 5KFNA 3V72A 3ISCA 5DB7A 1CEZA 4C8LA 1Z00A 2FMPA 4F5OA 2BQRA 4RQ5A 3TQ1A 3TFRA 3AU2A 1KRPA 2ASJA 1ZQMA 4F8RA 3QZ8A 3OGUA 4GXKA 4I2AA 4LZGA 4KLMA 9ICSA 1U45A 2ZTCA 1BPEA 4RPYA 3RB0A 3GV7B 2KZ3A 1ZQNA 4Z6CA 4NLZA 2AJQA 5KFJA 5CJ7A 2BQUA 1S0MA 2KN7A 4O3QA 4YP3A 2P66A 4M47A 1NK8A 1RYSA 3LWMA 4C8NA 5J0RA 2C2DA 5J2BA 3H8WA 3PX4A 5J2AA 2BPGA 4EBCA 4Z6DA 2FMQA 8ICAA 5KT7A 4DQRA 2PFPA 9ICXA 3RJGA 1SZPA 4ECTA 4ECWA 5KFEA 4I2DA 4ED2A 8ICTA 1CUKA 4DOBA 3H40A 2VANA 1JN3A 5KFAA 5L1KA 4QZIA 2IHMA 4QZ9A 8ICFA 4IQWA 1B22A 3Q8MA 2F1IA 3PR4A 4JWNA 2KTQA 2BCQA 5KT3A 3C2MA 4YD1A 4MF2A 4RNMA 2IMWP 3EW9A 4QZDA 3RH6A 3KHLA 2FPMA 1T8EA 3HWTA 3PW4A 1XC9A 3MABA 3RBDA 1LB2B 1TVAA 3N4MB 2ASDA 3RBEA 2BR0A 2XY5A 4DO9A 4XQ8A 8ICQA 7ICPA 3C21A 4UBCA 1L3UA 8ICOA 2RDIA 3MR2A 4MFFA 4TUPA 9ICTA 2PFOA 5DB6A 2Y1IA 7ICQA 3SI8A 1COOA 2ZTEA 2PFNA 3BQ0A 3EYZA 4YR2A 3TAPA 1ZQAA 4QZBA 3ZDDA 4UBBA 3PW5A 5EOZA 5DGAA 5J2FA 5CP2A 1D8LA 1XSLA 1RXVA 3EWAA 3PO4A 2HHVA 4DLGA 1V9PA 2A1JA 4ECXA 5KFYA 3GIJA 1D9FA 2OWOA 4FS2A 1SKSA 3M8RA 3C23A 3RJIA 4NLKA 4Q8FA 4J9MA 5KFTA 3UXOA 3G6VA 9ICFA 1BGXT 4PH5A 1NKCA 1H38A 1ZQKA 3B0XA 2ZJ8A 4F91B 5D46A 4EBDA 4QWBA 5KFXA 1HJPA 1XWLA 5KFZA 4Q43A 2RDJA 1IM4A 4HYKA 4ECVA 4BGDA 3ZDAA 4NLGA 3E2EA 4ECSA 2R8HA 4UAWA 4P4PA 1ZQQA 3PNCA 3N97B 1QSYA 7ICFA 5EWFA 4UAZA 4TQSA 4ED8A 4I2BA 4KLJA 4Q45A 2FLPA 1Y88A 1ZQXA 4F4XA 8ICLA 3RJEA 4ED3A 4IRDA 3M8SA 4QZAA 1QSSA 4M04A 2BCRA 1ZQOA 4O3RA 5CA7A 1KFDA 4I29A 1S9FA 1KEJA 2PXIA 4DL5A 9ICLA 2W8LA 2HHQA 2HHWA 3RJHA 2ZUCA 1U48A 4DL4A 4DL6A 5DBBA 2PI4A 1ZQJA 5F9NA 9ICNA 2PFQA 1NK5A 4F4WA 2JZBA 3GILA 2AU0A 4QZGA 4R66A 1K1SA 4YXMA 3OJSA 2AQ4A 2W9MA 8ICBA 4C8MA 4M6WB 4YN4A 4LVSA 4KLDA 2R8IA 4DLEA 2F1HA 4P4OA 1NK4A 4RZRA 1BPBA 3RAXA 1NK7A 5KFIA 3JPSA 1JMSA 5KG4A 4KLOA 4I2HA 4RPXA 5D49A 1C7YA 5BOLA 3JPQA 4C8OA 4JV2A 4QZFA 2JEGA 4UB1A 4PHPA 3LDAA 1BPXA 1KFSA 2XGQA 2J6UA 2R8JA 3PMLA 3K4GA 5CWRA 5L9XA 4UB5A 9ICAA 3H8JA 4O3NA 3ZD8A 2FLNA 4DQSA 4BXOA 4QZ8A 3V7LA 3PO5A 4R8UA 3SYZA 5HHIA 2ASLA 4I2FA 5IIJA 4GXJA 4GXIA 4F4ZA 4UB4A 5J29A 4TUSA 5KFMA 4PHAA 1N56A 4M9NA 5KG6A 2V4RA 1UT5A 1UT8A 3H8SA 4DSFA 3PV8A 4X5VA 5DBAA 1EXNA 4MF8A 1XS9D 3EZ5A 3UQ0A 4R65A 5KFQA 1QLNA 4F5QA 1ZQHA 4DS4A 4YG2A 1TKDA 5DQHA 2XC9A 3SV3A 1ZQTA 1S77D 5KT6A 4NY8A 3K75D 4RNOA 3OSNA 4J9QA 2XCAA 4DL7A 4F50A 1K1QA 2FPLA 4QW8A 4IQVA 4O3SA 9ICHA 2V4QA 4IR9A 2J6SA 2NRWA 3BQ1A 3RTVA 1WCNA 5CR0A 4PGYA 5EWGA 4KN7A 4QW9A 2W9CB 2W8KA 4RNNA 1TV9A 4ELUA 4FBUA 4FS1A 5J0OA 3RR7A 1ZQIA 1NK6A 7ICIA 5IIOA 5L1LA 5KTQA 4KMUA 3LK9A 4I28A 4RPZA 9ICCA 4F3OA 1ZQCA 5J0PA 4XA5A 3AUOA 1ZJMA 3MDAA 1XSPA 4BWMA 2R8KA 4RQ4A 2BQ3A 4DSLA 4DF8A 1ZQZA 4ED0A 2W9BB 3GIMA 3RRHA 5KFRA 3UQ2A 4I2CA 4KLLA 8ICIA 1DOQA 3ETLA 8ICSA 4QWCA 3IM1A 1TK5A 1RZTA 4DOCA 3UXPA 1ZQBA 2BCUA 1XSNA 9ICBA 4O3OA 2MUTB 4B9LA 3UPQA 4YXJA 2JEJA 5J2DA 1D9DA 4I27A 4I2EA 9ICUA 4DFJA 3RJFA 5DBCA 3OHAA 4O5EA 4F92B 5J0YA 1ZQGA 3QZ7A 1JX4A 2DPJA 7ICGA 5J0XA 4FO6A 8ICXA 3PY8A 5J0WA 1A76A 5L1IA 1UA0A 1NJXA 8ICMA 5CHGA 5KFGA 5DB8A 4R64A 4KLUA 2M9NA 8ICVA 7ICNA 3LWLA 5DKWA 4RQ8A 1ZQSA 4ELVA 7ICMA 1ZQYA 2F1JA 4QWDA 4YVZA 1SKRA 3MFIA 4F93B 3C2LA 1ZQWA 1SL0A 1ZETA 3C65A 4J9NA 4ECYA 3Q8PB 3MR5A 5KFSA 3BQTA 1A77A 4I2IA 4NXZA 5J2EA 3GQCA 5IILA 4JV1A 3TI0A 4YCXA 8ICNA 5DG7A 1NJWA 4RUCA 1RPLA 4RQ6A 3T5JA 2ALZA 5IIMA 2XGPA 9ICIA 3ZDCA 4Q8EA 3Q8LA 4EEYA 2IBKA 1DGSA 4YMNA 4XUSA 3SV4A 7ICHA 3ZD9A 3KHRA 2DFLA 4DSKA 2KZMA 2AGPA 3NTUA 3RRGA 4TURA 4I2GA 1LV5A 3BQ2A 1SL1A 1ZQVA 2UVUA 1NOMA 4BWJA 2HHTA 5F9LA 4O0IA 4K4GA 4RQ1A 1X9MA 1L3TA 4GC7A 3PX0A 1HUOA 5J2JA 4RT3A 4ECQA 1JXLA 4B9VA 4UAYA 2UVRA 4M0AA 7ICKA 3Q8KA 5IIIA 3H7IA 3BJYA 9ICQA 4B9SA 4KLSA 1S0VA 3RH5A 9ICMA 2ZTDA 4EYHB 4DS5A 1WCLA 5KFHA 5J0QA 3THVA 5KFCA 3HW8A 1JXEA 1RYRA 5BOMA 1SKWA 1MQ3A 1ZQLA 3EPGA 3ZDEA 3MGHA 5HMMA 4GLXA 5HP4A 3MGIA 8ICCA 4ECZA 3KHHA 9ICWA 4E0DA 9ICEA 4Z6FA 4J9PA 1JIHA 3AU6A 4DQPA 3JPPA 5J2IA 2HW3A 1U4BA 7ICUA 4J9KA 4YQWA 3TARA 5KG0A 4O5CA 3HPOA 1S97A 1Z00B 4F5RA 4DF4A 1MSWD 2HVIA 1KTQA 3C2KA 2NRRA 4KLGA 4MFAA 3V6KA 2BKEA 1ZQRA 3ISDA 3ORYA 2J6TA 1T3NA 8ICWA 8ICHA 4ED6A 2BGWA 4KLIA 4XRHA 2Y1JA 3OJUA 2ZJ5A 1BPYA 7ICJA 5L1JA 3RB6A 4PHEA 3M9NB 1NKBA 4F4KA 4UB2A 5KFVA 2XO7A 3OHBA 4RQ2A 3MDCA 8ICUA 3Q8SB 2ZUBA 2W9AA 4K4HA 4LZDA 4KLEA 2BPCA 3C1YA 4UQGA 4R63A 3JPOA 1MC8A 1NK0A 4PGQA 4YMMA 3MR6A 4DSEA 2FMSA 7ICOA 4O9MA 1X2IA 3MFHA 4TQRA 2ISOA 1XU4A 1HUZA 1S10A 3PW0A 9ICKA 5HMLA
chains in the Genus database with same CATH superfamily
3V9XA 3HVRA 3BY5A 2WTFA 1JCEA 2OZSA 3VF4A 2N1RA 1IG6A 3T19A 2RKIA 3FZLA 5FPMA 1V4SA 1BI4A 1BO5O 4RT2A 3SCXA 4LF5K 3HX0A 4IOAL 4OCZA 7ICTA 5AK3A 5KFOA 5B8HA 5DMRA 2D0AA 1EXQA 5J0UA 1ZQEA 4IR1A 3VGLA 4KB0A 5GADP 3HT3A 2ISPA 2QXLA 2JXJA 2KVCA 4PL1A 2WAQC 3A5NC 4CESA 4FZNA 4F5PA 1QSLA 3M9OB 4NO7A 3K5NA 4ECRA 2W42A 2V9WA 2HOQA 2K8AA 4EYIB 1VRUA 3C5FA 4FSVA 2KFNA 4IS7A 2IAJA 1N36K 2GTDA 2BZFA 2KFZA 3I28A 2JEFA 1ATRA 2B0CA 4PHDA 2EZXA 1ZQDA 3ZYYX 4DU3A 3KHYA 2IHNA 2D5RA 5KL1B 3RAQA 3C6AA 2DBYA 4C80A 2YV0X 1IV8A 3O4QA 3C29A 2B6GA 1YVUA 5DG9A 2E4LA 3U8XA 4M3YA 4DTNA 2OPQA 4IBNA 5J0TA 4YR3A 4Z4GA 2W9CA 4B3RK 1BNPA 4FO0A 4KX3A 2XI9A 1GO3F 4N76A 4BRIA 3HJFA 1EETA 3L4IA 4ZHRA 4ACOA 3G6YA 3TAQA 3ZT3A 4BRPA 4IOCL 4EZ9A 4RU9A 4RQ7A 5J0SA 9ICJA 3JS6A 1RT6A 4DQIA 1PVPA 4Y0WA 2ZG6A 3GIIA 1WNSA 1NZBA 4EBEA 5AQYA 4BDZA 4CEOA 3QUCA 2R8GA 5T14A 1TKTA 3IKMA 4C1NI 4EAHD 3LDOA 4DV3K 1I94K 4J9RA 1BDGA 1KW4A 2Q36A 1N62A 3CC4N 2A40A 5HRNA 3QU5A 4AYBF 5D4BA 4FW2A 4KITB 4I2JA 3NBPA 3V7KA 2YB1A 1J5EK 4YR0A 1QQMA 5J2CA 1BPZA 4OPKA 1RXWA 1SQKA 1S0OA 5AI9A 4E7LA 1N8RO 3D2EA 4P4MA 1S76D 5GINA 3A5MC 5KFWA 1NJYA 2HVHA 2ZD1A 3LAKA 1PK1A 4DQQA 3T5KA 2J4RA 2P9IB 3TTCA 1ZBUA 3LM2A 3WKBA 3Q7BA 2P9KB 4CF3A 8ICJA 5BRHA 4Q5VA 4KI4A 4DFPA 4R8UB 4DV6K 2P6RA 4JUZA 1QCKA 4F71A 4HAIA 4C8KA 3H1QA 4BG9A 2NO5A 5GAGP 3THXB 4B9MA 4JV0A 2O8DB 1ASUA 4JNEA 2NYVA 3FZHA 1FIQA 2EQYA 4CJRA 5KRSA 3RR8A 1K9MO 3CYMA 5HNKA 4DSIA 3ITHA 3N4PA 5LMNK 8ICKA 5AKYA 3CCRN 3N7SC 4GNIA 4A5AA 1T7PA 2FLLA 2FC0A 3RJKA 4NB4A 4WYBA 4ELTA 5CYQA 4CGDA 3B9JA 3UKUA 4FJLA 1SWWA 3VEVA 3HILA 4I2QA 2HBJA 4P0PB 3V9WA 3S3MA 1L3SA 2C22A 1BL3A 3NS1A 3OTQA 3KKSA 1W9HA 2P6UA 1GLLO 3LALA 5I42A 3MX5A 3AEVA 3WK9A 4UAUA 5KG5A 1BU6O 1Z26A 1RNHA 2VG7A 5EXWA 3O5BA 3VQPA 3ZSWA 3UMGA 4PPXA 4F2RA 8ICYA 3C5GA 1KLNA 2Z1GA 2D4WA 4YD2A 2QB1A 4W5RA 4IG3A 4DV7K 5DB7A 1WOQA 2IGIA 4FL9A 5C12A 2QB0B 3V9SA 2P9SB 4CZGA 5E79U 1YXQA 2BQRA 4RQ5A 4C7ZA 3AVGA 4OGCA 5EU7A 4GKJK 4JN4A 4J2EA 3LP1A 1ZQMA 4E1MA 3QZ8A 2G8IA 4I2AA 3ZT0A 4KLMA 9ICSA 4NLCA 4ILHA 2ZTCA 1BPEA 2EX3A 3RB0A 2KZ3A 4NLZA 4NYFA 2MA1A 4R5PA 2KVSA 2BQUA 4K8XA 1EQYA 3IRXA 4CJ5A 1IG9A 2QLTA 4O3QA 4YP3A 2P66A 4AHTA 4CF0A 1RYSA 5ALKA 5FLXO 5ALZA 5LL6Z 4FJXA 2C2DA 5J2BA 1X6JA 1ECWA 5J2AA 3DEEA 4OJLA 4EBCA 2BPGA 1XC3A 1FJGK 2CH6A 2A5XA 2KMDA 3RJGA 1RT1A 1TL3A 4BR2A 4YOVA 5JVGL 2MSNA 4UW9A 3VPZA 2O8EA 1X6IA 4PUOA 3MCAB 5KFAA 8ICFA 5M1FA 2D3DA 4IQWA 1NNLA 1JLEA 4JI6K 4NLBA 3PR4A 1DRGA 2KTQA 5KT3A 3CM5A 1L7NA 4YD1A 1RTHA 1SGGA 4RNMA 2O8BA 3RH6A 1S9GA 4CF8A 3QUTA 4BRCA 4DTXA 3HWTA 1XC9A 4NV0A 1N61A 4JI1K 5HL7L 1TVAA 2ASDA 8ICQA 4FLYA 1YIJN 3E66A 3KKAC 3KK7A 4TUPA 3HXMA 3QETA 2WF6A 4OO1J 1YTAA 2P9UB 1BQNA 4CEDA 1PK3A 5AQVA 4GKKK 3SI8A 1T03A 4P0QA 3PIPL 3EYZA 1BG3A 3TAPA 3KWIA 4A2AA 4QZBA 5BPNA 4YFUA 4UBBA 2X78A 3AV9A 4Y2TA 1RXVA 1D8LA 3ETRA 4LFAK 3EWAA 2BUPA 3DV9A 5DM7L 2OWOA 2GBZA 3TTFA 5KFYA 3QEWA 1KAZA 3O9TA 3RJIA 4Y2SA 2W40A 4FOIA 4J9MA 4IZ9A 3UXOA 3VGMA 2WAQF 4C4SA 1H38A 1NNEA 4F91B 5D46A 4OKEA 4BGBA 4QWBA 5KFXA 1HJPA 1IM4A 3SAGA 2F96A 5BR9A 4U6PA 2O6KA 5AQZA 7ICFA 3LVVA 2YHBA 4B3SK 4KLJA 3FZMA 2RP5A 4Q45A 4GVMA 4NCAA 3E0FA 1ZQXA 5DM6L 4F4XA 5ALQA 4GV3A 4ED3A 4IRDA 3M8SA 4QZAA 2A6AA 4O3RA 3HI0A 4CZEA 4E1JA 3NF6A 3L6QA 2PXIA 1SXDA 2FBYA 2P5GA 2KHVA 1VSIA 1UPHA 1TYQA 4XIUA 2IDOA 1Z25A 4DL6A 3VEYA 3ZEUB 5AQHA 5C2DA 2KP7A 1CI4A 2PFQA 9ICNA 2FF3B 4CJQA 1JCFA 4QZGA 4YXMA 4L3QA 8ICBA 3TSUA 4M6WB 4YN4A 3UKRB 1ASWA 2X74A 4LVSA 4H5WA 3VA0A 4OJOA 1L7MA 3EZWA 3M8QA 3KK1A 4P4OA 3DXKB 3RAXA 4DG1A 1QQ5A 5CZ1A 4O4GA 2W6LA 4KHSA 2FDRA 3JPSA 1GLDG 4KLOA 2VCPA 5AKKA 4O3MA 3JPQA 3GG4A 3P83D 3RMDA 3U9DA 1SV0C 2JEGA 1GLCG 5KQ8A 3J81j 4UARA 2J6UA 3G25A 4YDUA 1TKZA 2E2NA 2VQEK 4UB5A 3CD6N 3TADA 1X1PA 9ICAA 3ZD8A 3DRRA 3CJCA 2FSKA 2YNFA 2QWRA 5AI8A 5HHIA 5IIJA 2OH2A 4Z94A 2Z7JA 5JMVA 4GXJA 4GXIA 4JKFA 4IO9L 2JWLA 3C6HA 3OYGA 4OJ5A 5J29A 4USAA 4DKWA 1HNWK 4PHAA 1N56A 3I8BA 5KG6A 1XI1A 1ZBFA 3L2RA 1SIJA 3HO1A 4EHTA 3PV8A 4IDKA 4EELA 5FRNA 4QIWC 4FWPA 4MF8A 2ASPA 1YUWA 4I7FA 4H8KA 3WUHA 2HHHK 1QLNA 1RILA 3NFAA 4OJPA 5DQHA 1HPMA 1HMVA 4CI6A 3LPUA 4A57A 1S77D 4ID5A 4NY8A 2KKPA 3S6JA 3BZKA 4O55A 5CE3A 5LJVA 4HUGA 5KRTA 2ZF5O 4YOTA 4FJ5A 2NRWA 3BQ1A 3RTVA 1WCNA 1GOAA 1RBSA 3M5RA 4AH9A 3OS1A 1YJ9N 4CBUA 4HVJA 4KMUA 2PY5A 3OS2A 3O4WA 2VJ5A 5B5EU 1TVRA 2ITMA 4XA5A 2CN1A 1G99A 2P51A 2BQ3A 4FJJA 3CFOA 2G07A 2ZIVB 1BWFO 3A5OC 5ALPA 3U3YA 2K60A 3DLHA 4JI2K 1BQMA 1BISA 8ICSA 2YHYA 4JKGB 4XH5A 3IM1A 5EVZA 1XMOK 2V7ZA 1XSNA 9ICBA 4O3OA 4B9LA 2W04A 2ZJRL 2P5OA 2HDOA 3K1ZA 4I2EA 2NZTA 2Y0SC 3ONNA 4DFJA 2VG6A 2O4IA 5DBCA 3HOSA 5J0YA 2DPJA 2HNZA 2F44A 5J0XA 4ICLA 2M0NA 3KJVA 3MEGA 3LWLA 2YY6A 4RQ8A 3THWB 2OYYA 4QWDA 3O1WA 4YVZA 2ATQA 1SKRA 1ZRNA 2E2PA 3O4NA 1EKEA 2WF7A 4CIEA 3KK2A 3AMZA 1ZETA 3C65A 1PVQA 2GWJA 1MU2A 4CJSA 5KFSA 2P9PA 3BQTA 1QZ6A 5J2EA 3GQCA 5LY3A 4B8CA 3KLIA 3TI0A 3L2VA 4CJEA 2GV9A 2CGKA 4N47A 4NL9C 3OVNA 1RPLA 2GUIA 4K41A 5SWMA 4RQ6A 3NCIA 1ZXOA 2ALZA 4FM1A 1GLJO 4Q8EA 1S1WA 2HMPA 4BROA 1DGSA 3WK4A 3SV4A 4M3TA 3O0FA 3KHRA 3VQ6A 4Y2VA 3NF7A 1COKA 2A1SA 5I3UA 2AGPA 3KLGA 1CXQA 2B6AA 5ALRA 4KKOA 4OJRA 1W97L 2YMLA 1Q9XA 1FKOA 3R1XA 3VEXA 4B9QA 5AQIA 1L7PA 1X9XA 1Q46A 2I5HA 1L3TA 1CRXA 1HUOA 2I7PA 2W54A 1JXLA 4M0AA 3NRWA 1RDDA 4UAYA 3SJHA 1RG6A 3H3OB 5IIIA 3VQ5A 4MQ3A 3ED5A 4B1UB 3O9RA 3TR8A 9ICMA 2ZGYA 4B08A 2Z1HA 5AFUA 2E8OA 4EYHB 1NGHA 3ZLJA 5KFHA 3PSPA 1JXEA 1IKWA 2D6FC 1J2NA 1Q18A 1MQ3A 2F8LA 4GLXA 3MGIA 3KLHA 4G9BA 3IG8A 4LFCK 2IS3A 4LC9B 2LYAA 9ICWA 4Z6FA 3QICA 1U4BA 3CCVN 4PY5A 4MO5A 2KICA 4KH6A 3HPOA 1Z00B 1S5LU 1RT3A 4M7XA 3V4IA 3SAFA 4BC3A 5LMUK 3HKZC 1SS6A 3V6KA 4Y2YA 4BJQA 2YN4A 3ISDA 3EKSA 1T3NA 4FWMA 4FZXC 2NUBA 1C0TA 4WQ5A 7ICJA 4ISGA 3SMVA 3U3GA 4FXDA 2WHEA 5KQDA 4JK8A 3G10A 2BGGA 5KFVA 2XO7A 3MDCA 8ICUA 5TISU 4EX7A 1R0AA 5F0XA 2VWJA 1DLOA 2W9AA 1CZ9A 3E58A 3IN5A 4LZDA 4KLEA 2JGUA 4CE9A 4BE0A 1KAXA 4M3UA 2QTDA 1NGJA 5KPZA 3OYJA 4DSEA 3I55N 2ZM6K 4G9ZA 3N7RC 5AQQA 3R9KA 2UUAK 4M3XA 3ZSQA 2KHOA 4FJIA 1JROA 3A8YA 2IA6A 5AKLA 4JKHA 4ED7A 1DK2A 3QNOA 1XNRK 2XCPA 1ZQPA 1V38A 9ICRA 5FRMA 5KT5A 4CGIA 1S72N 2PMZF 3SI6A 1OH6A 4W5TA 5AIBA 2E6LA 5C24A 3BS7A 3GDXA 4F5NA 4KLHA 4DFMA 1KXPA 1R59O 2Q2RA 3MX2A 4H03B 5ALTA 1Q3VA 2RN2A 1QQNA 4BRDA 3VQ4A 3H4BA 4NCBA 5ALOA 1HIWA 4NYNA 2IVPA 3KZIU 2B5JA 1E4FT 1N6QA 1NKEA 1HR0K 2KIVA 1FFUA 2NRVA 5ALXA 2A1JB 5AKJA 3TACB 1NJZA 3AVLA 3ZT4A 3O9QA 3CQ8A 1K5OA 1CLQA 3D6JA 2WONA 4GIBA 3NGDA 3PSIA 2RRDA 3HRGA 3NVZA 4NJ8A 3DLRA 3MWPA 2AGOA 4RW4A 5AQPA 2G5HB 1RQNA 1B0XA 3RH4A 1RBTA 7ICSA 4CHNA 1U47A 2OTLN 4BVPA 2C2EA 4KHYA 3DI6A 5MLCQ 4DR5K 5DG8A 2GH1A 4CCHA 3C1ZA 3E9PA 4FBTA 5EX5A 1LW0A 4MEYA 3C7NB 5EY4A 3CF5L 1N48A 4BC5A 3R9PA 3WT0A 1VSLA 1GLFO 5HR7A 1RTDA 4TUQA 4M9GA 4KLQA 4PZOA 2W9BA 3LP3A 1KL9A 3HBTA 2YNGA 3JYTA 5KPTA 4HWIA 4CGHA 2AQ0A 4IOXA 3IS9A 3QX7A 4O5KA 2YQEA 1OKJA 3BF1A 1Q82O 1NGEA 2KG5A 2ZE2A 4X65K 2ZJQL 1NWKA 4WQ4C 3AVKA 4NL9A 3EUB2 3TSQA 1QQ6A 1Q7YO 2DTUA 8ICZA 4J9OA 3QFPA 2XICA 3SQ4A 2ZIXB 4NCGA 3GIKA 4CF2A 3KLFA 1JLBA 3VA3A 7ICEA 3SAHA 3EPIA 3V6JA 3BGRA 4JKDA 2G06A 2Y0SF 5JICA 1TAQA 2QWLA 2HMIA 1VJ5A 5IINA 2JHDA 4IFEA 2FPKA 4QOZB 3MAQA 4CFAA 2A3ZA 4CFDA 4K0KK 4O3PA 4KHUA 1UCVA 4BVOA 4Y2PA 2ATLA 3WQUA 2BDUA 4F4YA 4CZLA 4CIFA 4AQYK 5KGWA 3AVNA 3LDNA 3H0MB 8ICGA 3ZSOA 7ICVA 4DFKA 3I56N 2Q31A 4KLFA 1QQ7A 4J03A 3HL8A 3M9MB 1QTMA 4LD0A 1ITGA 3C28A 1G15A 4CD3A 3SZ2A 4BRMA 3V9ZA 1HPZA 4QZCA 4Z6EA 2QEXN 2H3FA 1IXRA 1UWBA 2OA8A 5JLHA 1N34K 4KTQA 1EWRA 3T79A 3CJ9A 3NMUA 3QEVA 4M45A 3H4DA 3FLCO 2ZGZA 3WNEA 2UVWA 2BHNA 5ALDA 4M3RA 3RB3A 3RB4A 5H1SQ 2KJ5A 2F2AB 1BA0A 1NGGA 1RDBA 1WG8A 2V51B 4O44A 1RT7A 3Q8RB 1U9LA 3PX6A 2OPPA 3OS0A 1KN5A 2Q0RA 5AQRA 1X9WA 4B9NA 4C23A 5AQSA 3ZT1A 1WSJA 1X9SA 2BTFA 1C0MA 4KHNA 4YMOA 5KFPA 2E2OA 3FDSA 2I1QA 1J97A 2O8CB 3PR5B 3HTVA 3LVWA 5H2FU 3NH1A 5J2GA 3T5LA 5KFNA 1CEZA 3ISCA 3ATUA 1ZOLA 4HUFA 4M3WA 1SV4A 2FMPA 4UB6U 4JV5K 3DM2A 4DQ8A 3TQ1A 3AO2A 2QKKA 3OYBA 3AU2A 2CPRA 2ASJA 4YOUA 1TUYA 3HK2A 1WYGA 3HSTB 2UYTA 4GXKA 4CBWA 3SMPA 4JD2A 1L8LA 1U45A 3CFRA 1ZQNA 2NLXA 3GV7B 4JHDB 2YMQA 2HBMA 2F76X 5KFJA 5CJ7A 4CZFA 1S0MA 1Z4NA 2ZIUA 2DKZA 2KN7A 3OYLA 4PZNA 4WE1A 3LWMA 1C1BA 1Z6RA 5FPEA 5J0RA 3OPXA 3QU2A 2FF6A 1E3MA 3HKZF 8ICAA 4DMNA 4PJ0U 2HOEA 3SD7A 9ICXA 1HYVA 1I3AA 5AK5A 3HOTA 3HPGA 3DLEA 3OYNA 3NVYA 4CNQA 8ICTA 1CUKA 4PL2A 2D8CA 2VANA 2IHMA 4QZIA 4QZ9A 2QARB 3FC4A 3KZBA 4CFBA 1N5YA 1CZAN 4JWNA 1F0MA 5AK4A 3CERA 2IMWP 1IG8A 3EE8A 3OW2M 1S9EA 2FPMA 3L0QA 1Q86O 3O8MA 3OY9A 5AI5A 5ALUA 1VDVA 2KKVA 3MABA 3PW4A 2P1JA 1LB2B 1AQ6A 2RE2A 3CQXA 2LYBA 1HNIA 2DKXA 7ICPA 3C6UA 3C21A 4UBCA 4H5VA 3F73A 2OEHA 8ICOA 5JS2A 2A3VA 2MU2A 4ILJA 3M1YA 1BIZA 1WLJA 4KFBA 1TUUA 2PFOA 4CJPA 4FJGA 4Y2JA 4PKHA 1MWKA 3SUOA 1A5XA 2ZTEA 2PFNA 2DWQA 3BQ0A 4CHOA 5M1NA 4YR2A 3ZDDA 2WUSA 3AVBA 5F2RA 5EOZA 2DF4B 1XSLA 2E6MA 3LPTA 3W3DA 2HHVA 4I6MB 2HCFA 4ECXA 3FFKB 4W5OA 1XMQK 3GIJA 1D9FA 4FS2A 1SKSA 3M1FA 5T7BA 3AL0B 1C0UA 2DFEA 5BRDA 1BGXT 5AKZA 1NKCA 1QE1A 1V85A 3B0XA 3AVFA 3H08A 1RDWX 4H4MA 1K73O 3QESA 1XWLA 4Q43A 1JL1A 4H4OA 4ECVA 3QU9A 2KQ2A 3QEIA 5KAFU 1RT5A 2RHFA 3F2KA 5AM2A 4NLGA 3E2EA 4P4PA 1ZQQA 3K58A 3AO3A 2W6KA 4UAZA 4TQSA 4ED8A 1WWVA 4UY8O 1Y88A 3FM9A 3SENA 1KC8O 3RJEA 1S8OA 1QSSA 4M04A 3MECA 3IDWA 2Q0UA 4I29A 3DWLA 4JLHA 3OYEA 2K89A 3IMXA 9ICLA 2W8LA 2A1RA 2HHWA 2OPRA 3WEEA 5AQWA 4DL4A 3OYCA 5J1EA 2PI4A 2OYQA 4PWDA 3J7AP 5F9NA 5M1OA 3SMSA 3LYSA 5AIAA 3DXMB 3QERA 1U2VB 5E41A 4DR3K 3V1RA 3CI5A 4C8MA 3D45A 3ENHA 2IOCA 5J2MA 3H45C 4RTFD 3V81A 3HPHA 2ETJA 3NDKA 4M42A 2KK0A 4O8UA 1NK7A 4KI6A 4QS8A 3MC1A 5D49A 5BOLA 1J5OA 2EAOA 1TE2A 5E84A 2V7YA 5K14A 1KFSA 2XGQA 3QEXA 2P9IA 2JH1A 1XO0A 5L9XA 4FLWA 3L5KA 2P9KA 3U9ZA 1VQ9N 5J8YA 1OH7A 4O3NA 3CCJN 3CCUN 4QZ8A 3UMBA 2YMMA 4R8UA 4FW1A 2G08A 3LDLA 1O13A 1T44A 4CJVA 3VOVA 3THXA 2O8DA 4XH1A 3NVVA 4TUSA 5AQLA 2Q4TA 5KFMA 4CDGA 2HBLA 1KVCA 1S3XA 2P9LB 5CY4A 1XHZA 1VQ4N 2V4RA 1JXBA 2DPNA 4DFDA 1UT5A 3H8SA 1IKXA 2F9TA 2OANA 1UQVA 2PAVA 2QWQA 4X5VA 5DBAA 4FZYA 3DRSA 3IUCA 3MEEA 3S3NA 1XS9D 4R65A 1ZD5A 1F21A 4F5QA 2DQNB 4YG2A 3LM9A 1TKDA 2XC9A 4NXNK 4KMOB 1ZQTA 3HM9A 1DT9A 3HVTA 3QO9A 4FZZA 1F5SA 3U26A 2OTJN 3K75D 4WCEL 4Y2RA 4DL7A 4QW8A 4O3SA 3RMAA 1VSHA 4CHPA 2QKBA 3CRXA 1LWFA 3BS5B 3D7EO 4ZTJA 3F2CA 2W8KA 4FBUA 2QWNA 3BUZB 7ICIA 4KPYA 1NK6A 5IIOA 4MLEA 4I28A 4RPZA 4F3OA 1S1TA 5J0PA 5IT9O 3Q7CA 4JI0K 3AUOA 1ZJMA 1XSPA 4BWMA 2R8KA 5HRRA 4DSLA 3SUQA 4KHPK 5AQNA 3SLCA 3IDHA 3UQ2A 2RQ5A 4CZHA 8ICIA 4FJ7A 1REVA 2HI0A 1VK0A 2QB0A 3QYPA 2P9SA 2O8FB 4DOCA 3UXPA 1ZQBA 1HJRA 3PSFA 2IIRA 4CJ7A 2MUTB 3NVWA 4DUZK 4CK3A 2JEJA 5J2DA 4CERA 9ICUA 2YNIA 5KAIU 1L8OA 3OHAA 4F92B 1Z1VA 3U4LA 3QEPA 7ICGA 3P5JA 1GLEG 2DGZA 3PY8A 5L1IA 1UA0A 4R64A 5KFGA 5DB8A 3KLEA 8ICVA 5DKWA 1ZQSA 4ELVA 2OHFA 3RMCA 2UXDK 3AA4A 2YJEA 1LOTB 4JKEA 4K8ZA 3QNNA 3ULDA 4JK9A 3T1HK 4CGZA 2LSNA 3DMJA 2KKZA 3OYIA 3J81O 4I2IA 1LWCA 4DTJA 4FK0A 5DG7A 3SQ1A 4JI8K 4OD0A 2QKQA 4O0JA 4A5BA 2YI1A 3T5JA 4JYAK 2PKEA 2XIDA 5ALJA 3R6MA 3TTDA 4AM7A 1YTUA 4OX9K 1BIUA 4EEYA 3MN5A 4YMNA 1DK3A 7ICHA 2DFLA 4JAXA 2EANA 1QZ5A 1VLBA 3I76A 5ALHA 2R18A 4I2GA 1E4GT 3L3UA 4RW9A 4DR1K 2K4EA 1LV5A 5AJ3K 2YTUA 4J2BA 1ZRMA 4FZLA 5ALFA 1Z19A 1NOMA 3SUPA 1JL2A 4N5SA 3GBTA 1ZD3A 3F5AA 4RQMA 1NZPA 5M1KA 1X40A 3WKAA 4RT3A 4ECQA 7ICKA 2P35A 4FWQA 3H7IA 2XY8A 2GOLA 1VQKN 3E01A 1S0VA 4IEEA 4CZJA 2ZTDA 3HW8A 3TAMA 5BOMA 3HM8A 5JS1A 1NMDA 3MGHA 2JGAA 4US9A 5FROA 5HP4A 4YOYA 1VQLN 3LZJA 5AZIB 3ZI4A 4J9PA 1DKGD 3AU6A 4DQPA 3WKDA 1ATSA 2QXFA 2KSOB 4CZMA 5JLFA 4A61A 3QNMA 2HW3A 1XQSC 2Q1NA 2K8CB 7ICUA 4J9KA 3CETA 3EY1A 3CCLN 5C10A 2B4JA 4F5RA 4A2BA 2E1ZA 1TAMA 1FFVA 4QJFB 4Y2UA 3VERA 2W03A 1DXSA 4R79A 1YJWN 2CH5A 1ZD2P 2BKEA 3OYAA 1ZQRA 1ATNA 3ORYA 2HOFA 8ICHA 4MDAA 1Y64A 4XRHA 4DR2K 3RF9A 2ZJ5A 1BPYA 4AP9A 3ENBA 3MXIA 5BN8A 4JKCA 4UB2A 1HX1A 4RWTA 4RQ2A 1PVRA 4CEEA 5HRPA 3ZEUA 4K4HA 1T3QA 4U67L 3HZ6A 5AQUA 1NK0A 1RQLA 3JPOA 1MC8A 1D4XA 2IC3A 3D2FB 4PGQA 4YMMA 2FMSA 2ESEA 4FJ8A 2QWMA 3UKRA 2JH7A 9ICKA 2CGJA 5M1QA 1YZ7A 1YHQN 3DXKA 4ED1A 4GVEA 1KSPA 2VA8A 4V19S 4C4TA 3AO5A 1ZJNA 1IV0A 2FBXA 1VQ6N 3IV6A 1O08A 1MN8A 3M7DA 2XY6A 3A0HU 1KVAA 5J2HA 1RM6C 3WQTA 1ZBIA 1YF5L 5AQXA 1ZXIA 3UMCA 3V7JA 4IWVA 1J54A 4I2PA 1RCHA 2QI2A 1ASVA 4RQ0A 4CF1A 4FVUA 4E7IA 4J9SA 4JEPA 1KVBA 2V52B 4OJ6A 4O8KA 4GC6A 3L4PA 4F2SA 3WK7A 2GELA 4Y2XA 4JK1A 2MAXA 8ICEA 2C28A 3ZSXA 5KFDA 1U04A 4PQUA 3CC7N 1RTIA 5KG2A 5ADXH 3NUQA 2G8KA 3HP6A 3P39A 3J8AA 3QUQA 4FE3A 4GFJA 2VG5A 1GOBA 1WSGA 4CEQA 8ICPA 1SB3C 1PZNA 4DEZA 1S6PA 2P9PB 4B1XB 3TFSA 1NGCA 4LSLA 4AHRA 1HQEA 3ULEB 2A1AA 4CJWA 3THYB 3JPTA 1QQCA 3AVHA 1TAUA 5DQIA 3H0LB 5AKIA 3JPNA 2NRTA 2W41A 2FSNA 4M9LA 4FLUA 3N7PD 5A0LA 3QIPA 2HMXA 1T05A 2ES6A 3MR3A 3ISBA 3G6XA 4G3IA 2YKMA 1BOTO 4NLNA 2QWOA 3D2NA 1QQOA 2ZUDA 3KKAA 4EX6A 3QEBZ 8ICRA 3PW2A 2KEYA 1JKHA 1K8KB 1TKXA 4B1WB 3R8EA 4QZEA 4FWSA 4BRHA 3ID6A 2BE2A 1Q8IA 2WTUA 1P8ZA 5J2NA 1YITN 3J7YP 2ZXIA 4B6JA 3V1QA 3CCEN 4OGEA 3DDHA 3QDKA 4E7KA 3A5LC 5KFFA 4IRKA 4JKGA 2W7PA 4JKBA 4UASA 4UB3A 3QMLA 2IVOA 1B43A 2RPIA 2HBKA 4K25A 1GLAG 5FPDA 5AI6A 3KD5E 4YFKA 3CCMN 2F9WA 9ICOA 4CF9A 1P7DA 4QWEA 2JZBB 1U6ZA 5GIPA 1RBRA 3TWHA 1VQ7N 4Z4IA 4IFVA 3PVXA 4OPAA 2Q0ZX 3NVMA 5J2KA 2BANA 3THWA 2Z1IA 4FLZA 4KN4A 4KLTA 2NRZA 5C5JA 5KFUA 5KFLA 5DB9A 3ZX0A 4BRNA 1JLFA 3GFKB 1ZQUA 4IQTA 4DL3A 2BCSA 1M1KO 1SWVA 2DUYA 5DLFA 5KT4A 2B21A 5AHXA 5CB1A 5DGBA 2XRIA 3H6EA 1YZ6A 4JK7A 3V6HA 4ZOHC 4K4IA 1UHUA 4EFHA 4PGXA 3PSTA 3TAGA 3N28A 4JI3K 4RCHA 2F3NA 4BG8A 2A19A 4C7YA 4BXOB 2PBDA 3RSEB 1RFQA 3OBYA 5AQMA 1Z4OA 1HNVA 3O08A 1CZBA 5AQGA 3NH2A 3AVAA 4B9TA 5AM5A 4CEFA 2RLTA 3ID8A 3OA9A 4M63C 4BRLA 4IQUA 3RWUA 4OKJA 1M6YA 4QWAA 5D3GA 4E3SA 1VSKA 1J2MA 3NRZA 5EOYA 4RUAA 1RBUA 1WWUA 3QEAZ 2KIWA 2XY7A 1HRHA 4LSNA 2UVVA 4M9JA 4ZH4A 5F1XA 1SV0A 3QIOA 3AA2A 1HJOA 2NO4A 4XH4A 1YT3A 3IHQB 2EWSA 1RDUA 3AQEA 3SQIA 4NM1A 3EE9A 5AICA 4PKGA 1B92A 3FYHA 5TZVA 3MMVA 3V1OA 4UB8U 4J9LA 2LYHA 4P2HA 3WXIA 4MEXA 3WK5A 3N4QA 5KG1A 1LAVA 1WB9A 3CXCM 2PFUA 4BQLA 1ZBHA 5G5HA 3B0YA 2HHSA 3WXMB 5EWEA 3AVJA 2BCVA 3T1AA 3V6DA 4C4RA 4DL2A 1S22A 3O6WA 4PKIA 3JPRA 2JV3A 3V72A 3VQ9A 4DTPA 4C8LA 1Z00A 3PLAA 5I9EB 1N32K 3KD1E 1ED1A 3BF3A 1WSEA 3TFRA 4FWNA 5FPNA 1KRPA 1LKYB 4F8RA 1BCMA 3AVMA 5HROA 1NGIA 2ZIWA 4CJLA 3QINA 3SBGA 4FOEA 3O3HA 2JR5A 4HHTA 3AO4A 1VQ5N 5AKXA 4RPYA 2FBVA 2IOFK 3AGRA 5AI4A 1IKYA 2H3QA 3IG5A 3F2BA 1OVYA 1KCFA 4DV1K 2OXOA 1N60A 3O3FA 5C15A 4Z4CA 2EAMA 3H8WA 3PX4A 1HKGA 3OTOK 4Z6DA 5EE1A 5ALVA 3QXGA 5KT7A 4DQRA 2E8AA 5KFEA 5AZJB 1IBKK 2JLEA 4ED2A 1JJ2M 3VEZA 4DOBA 3H40A 5L1KA 5JU5A 2E5LK 4BDYA 1B22A 1Z05A 3ZETB 2F1IA 3SEIA 2FXUA 3LDQA 2BCQA 3C2MA 4AYBC 1QVGM 1OVQA 2Y9TA 4QIWF 4QZDA 3KHLA 3F5TA 1WSFA 4JRPA 2F7TA 4JMUA 2CRXA 1IO2A 1N33K 3N4MB 5M1PA 2BR0A 3K9KA 4XQ8A 3WKEA 1LCUA 2L5YA 1L3UA 3KWGA 2D1KA 3ZT2A 4CEAA 1L6NA 2KNJA 4MFFA 1NM1A 9ICTA 1VQMN 3KIOA 5DB6A 5CYMA 5AKEA 2Y1IA 4PL8A 4C0ZA 1COOA 1NMNA 3I0RA 4FJKA 3G6EN 1ZQAA 4LH4A 3CMAN 4EP5A 3CM6A 1RYUA 3PW5A 5DGAA 1WSHA 5FP0A 5J2FA 5CP2A 3D6RA 2VQFK 3K9JA 3NF9A 1C6VA 5ALEA 4IJAA 4OKKA 3CJ1A 4DLGA 1V9PA 2A1JA 2Q3SA 3QBWA 4NLKA 4Q8FA 3G6VA 2EHGA 3FZKA 4KH5A 4KO0A 3F9KA 2ZJ8A 4EBDA 4DR6K 5BN9A 5KFZA 4BRQA 2RDJA 1NU0A 4OPJA 4KAZA 5AM0A 3ZDAA 2G8FA 3CQYA 4ECSA 4UAWA 2FBTA 2VGMA 3N97B 3DJCA 4B3TK 4DTOA 4CHQA 5JTIA 4Q0BA 1BUPA 2UXBK 4I2BA 2FLPA 3C7NA 1ILYA 1O03A 3K0SA 3I8DA 2FJ6A 8ICLA 1GOCA 3PUFA 4KTWA 1N5WA 5ALNA 4AILC 4Z0UA 1S9FA 1WAJA 1J9AA 3WXKA 3P1GA 2HHQA 4XEIA 4AHVA 3RJHA 3E9OA 2G8UA 5DBBA 4H5NA 1ZQJA 1TGOA 3B6OA 1NK5A 3B8AX 1K1SA 2KHQA 1Q3UA 3CIPA 4K43A 4CFCA 4CK2A 3OYKA 4KH4A 2PYJA 2P9NB 2ZIXA 2F1HA 1NK4A 4RZRA 1DTTA 4B1VA 1KBUA 2F8SA 4FM2A 5KFIA 1JMSA 4H5RA 4I2HA 4RPXA 3LANA 1C7YA 5AQTA 3IFRA 3OYHA 1BI4B 4UB1A 4PHPA 2E1YA 3L2UA 3VMFB 3K4GA 3S3OA 1QH9A 2FSJA 4FWOA 5KL8B 2LM4A 2W11A 3A0BU 2OZMA 2FLNA 4AF1A 1NGFA 4DTSA 3PO5A 1W2BM 2ASLA 3D2SA 4QAGA 4JS5A 3NAEA 4UB4A 3U6FA 4G1QA 1KAYA 4CECA 1UT8A 4DSFA 4CJTA 1HNZK 1J53A 4WF9L 4MLHA 3EKUA 3UQ0A 1S1VA 4H5TA 3NHGA 1ZQHA 4DS4A 3ZSZA 3VTHA 4IXCA 5HP1A 2IVNA 4RNOA 2VGNA 4J9QA 3E9LA 3LP2A 4B1YB 2OM6A 4Z4EA 1K1QA 4IQVA 4JRQA 1JALA 4OLBA 9ICHA 2KJ9A 4HCCA 2J6SA 2PZSA 5CR0A 2W9CB 4PGYA 5EWGA 4KN7A 4EEKA 4CE6A 4QW9A 1TV9A 4BUGA 4ELUA 1HEKA 3M8PA 5J0OA 2K4IA 5L1LA 1C0GA 2UXCK 1Q8KA 2NNWA 4U7CA 1ZQCA 3RFAA 3MDAA 2O8CA 2EDUA 4RQ4A 4JI4K 4DF8A 2FE9A 3M6KA 1ZQZA 3G71N 1SUQA 5KFRA 4IC9A 1JUDA 4KLLA 5CEHA 1DOQA 3ETLA 4DR4K 4QWCA 2QW9A 4MHVA 2I6XA 2BH1A 2BCUA 3AM9A 5C42A 4F9OA 3UPQA 3NGIA 4I27A 4KX5A 2LBOA 2KV2A 1ZQGA 3QZ7A 4MFBA 4FO6A 2H3GX 1J6ZA 4FCYA 4W5QA 1A76A 8ICMA 5CHGA 3EN9A 3ATVA 3NF8A 2M9NA 4JHDA 7ICNA 3DOLA 2KE7A 3IAYA 1FEZA 1ZQYA 5G5GA 2F1JA 4RG8A 1K6YA 4FYDA 1M90O 2R7YA 4CEZA 4YOWA 2PYLA 3MFIA 4F93B 3C2LA 5HLFA 4DR7K 4JI5K 4ECYA 3VQQA 4C1NK 3Q8PB 2Y9UA 2E20A 3MR5A 5KI6A 2JRZA 1T94A 3D2EB 3SPYA 1A77A 4H0VB 2D0CA 3FFIA 5HBMA 1PK1B 4JV1A 3VQDA 2F4VK 2QK9A 4HUEA 4CJFA 4YY3K 1MWMA 1NJWA 2E8MA 4BR9A 1RTJA 3WK6A 3DLBA 1OUQA 2QARA 3PIOL 5JVHL 1Z1BA 3ZDCA 3MN6A 3Q8LA 5KPRA 3MN7A 2IBKA 4XUSA 2W43A 3WEEB 4WQ4A 3SQ2A 4RQNA 4DSKA 1TV6A 2X6SA 1C20A 4BACA 4TURA 3AO1A 5FDLA 3BQ2A 2NRHA 4HTLA 1ZQ1C 1EP4A 2E8PA 1NG9A 1RBVA 3WNGA 2UVUA 4BWJA 5C25A 5F9LA 4K4GA 4RQ1A 1X9MA 1O1WA 3NGYA 3TSPA 2EZZA 4B9VA 2WF5A 3PX0A 5J2JA 1FKPA 3UKUB 2UVRA 1SXEA 3Q8KA 3H0RB 5ALMA 2K4PA 9ICQA 3IP4B 4B9SA 5CRXA 2ODGA 1LAWA 4FWRA 3TAFA 3T69A 3HSCA 5J0QA 3THVA 4I6MA 3FR0A 1SKWA 1V4TA 3ZDEA 1ESVA 5HMMA 5JRTA 8ICCA 5BRFA 4E0DA 5K4LA 9ICEA 4M41A 1XUPO 4QS7A 3OYFA 3QFUA 3JPPA 5J2IA 2D0PA 3VEWA 3CJBA 1NGAA 4YQWA 3QBXA 3J7ZO 3TARA 3CCSN 1QHAA 4F3TA 2VJ4A 4CRXA 2LM1A 4DF4A 2AXTU 4J2DA 3AAPA 3NVKA 1X66A 4E1NA 2HVIA 4YORA 3MXJA 1T3VA 3C2KA 3SK3A 3FE1A 4BREA 4MFAA 1VSFA 2KD1A 2YHAA 2W3SA 3ZX2A 3MDQA 4UATA 2WF8A 4YDUC 2J6TA 2HF3A 2QA4N 3ENOA 3NE6A 3CJAA 3TADC 5L1JA 1BA1A 1SZ2A 2E88A 4CK1A 4Z4FA 4PHEA 1QVFM 4CF4A 2G0AA 3M9NB 1NKBA 3TKAA 3GZFA 1MA9B 3OHBA 2ZWHA 2YNHA 3K57A 2ZUBA 3ZSRA 3M6GA 3KK3A 3G0ZA 1KD1O 4BY9C 2BPCA 3C1YA 4UQGA 4R63A 2NV3A 1IKVA 2GEMA 2EH9A 3DXMA 1U2VA 3EO3A 4KTZA 3MR6A 2D0OA 3JSMA 7ICOA 4O9MA 1X2IA 3MFHA 2FLOA 1S6QA 2ISOA 1XU4A 1HUZA 4QCLA 1S10A 3PW0A 2O8EB 2ZXHA 1S1XA 4Q44A 1U49A 4P0PA 3VC8A 4FVMA 5AM1A 1IBLK 2E3TA 5CR4A 3S9HA 4DSJA 4LF8K 5J2PA 4M3ZA 3SR6A 3K5OA 2O8BB 3M3ZA 1L3VA 1NLVA 3TPQA 4B3MK 4RQ3A 3QE9Y 4NM2A 3KHGA 3LDPA 5KG7A 1NOZA 5BPCA 3K59A 5JUMA 1S5JA 5B66U 1MA7A 2X6NA 4YOXA 1Q81O 2IOHA 2JEIA 2G09A 2VA3A 2A41A 4IRCA 3TANA 4B9UA 3MCPA 1RT4A 1RDFA 4X66K 1ZC6A 1VSDA 9ICGA 2WFBA 3LDSA 4X62K 2G8VA 1X3NA 2GO7A 4P0QB 2P9LA 4IFYA 3UXNA 1V97A 3O80A 2AH5A 5AQJA 3VQEA 3SUNA 5HR6A 4JKAA 3HJEA 2ZJAA 1SL2A 1SV5A 5TKWA 4PHTX 4CJ4A 4MFCA 1RT2A 4E7HA 2I9GA 3GV5B 4DUYK 2KZZA 2F8KA 2G8HA 1L5UA 3WXJA 4BX9C 1S0NA 4FJMA 1JLQA 3JAMO 5ALGA 3PMNA 2WF9A 2DPIA 1OXJA 4H0PA 3BS5A 5BREA 1SZHA 2ITGA 1HNXK 3DYAA 1EWQA 1JCGA 1UA1A 3MK6A 2HHXA 3C95A 5IIKA 2IOFA 2EZYA 1C1AA 3H1VX 1BNOA 1BPDA 3KD3A 5DLGA 2HHUA 4H0TB 4BC2A 4N56A 2GUPA 1PUZA 9ICVA 1YAGA 2UUBK 2WOMA 3QUBA 2CXYA 1TK0A 4DCHA 3DOKA 5KG3A 4DB3A 7ICRA 3GL1A 3RJJA 1KDHA 3ZSYA 2BPFA 3AVIA 4J8FA 1T4GA 3F2DA 1ZQFA 3VQCA 5IWAK 2VA2A 1TK8A 3L2QA 2O8FA 1TYQB 5KT2A 3D2QA 3FAHA 4ZTFA 2MUTA 1VHXA 9ICPA 1GLBG 2VWBA 5AQOA 4BRFA 1FW6A 4B8AB 5DQGA 5KFBA 4GW6A 3Q8QB 2G5IB 4NWIA 2AGQA 3T5HA 3R3LA 3CFPA 1T6CA 2P9UA 4M2YA 5GIOA 4QNLA 4QZHA 3PW7A 1KFTA 2AHOB 5DDMA 4CVNE 4BDPA 4DOAA 2VWKA 4JWMA 2ZQBA 3T1YK 2C2RA 2WB1C 1LW2A 4MO4A 1XO1A 4EZ6A 4M9HA 3E1YA 4ISEA 3L4QA 4DTUA 5AQKA 2H5XA 4OVLA 3L3FX 2GWSA 3KFUF 4PL7A 3NH0A 1JRPA 3JXUA 3GV8B 4CJUA 3MBYA 3VQBA 4DV5K 4ILGB 4FLXA 3ZCMA 1NGBA 3GE1A 1XHXA 4CD1A 1LVHA 4Y2QA 5HHHA 4ECUA 1EX4A 2UUCK 1BVSA 4N41A 4LY7A 3HP9A 3KTQA 4CGJA 5DDYA 2OCEA 4CHYA 4IKFA 3TU5A 5BR8K 1D8YA 3BDPA 7ICLA 4CZKA 3QU4A 5KFKA 4EIAA 2ASMA 3OYDA 3M6ZA 1MQ2A 2PMZC 3IRUA 4IG0A 2VIXA 3AN1A 1HQUA 4FPBA 4BE2A 3RVCA 1AROP 1KLMA 3D0PA 1NOYA 4ISFA 1WBDA 2KJ8A 1A6SA 1NI3A 3T3FA 4DWIA 1RGIA 4WQ5C 3VQAA 3H46O 3HRDD 1A5VA 1Z3EB 3OSPA 1ZYQA 1BHLA 3VESA 1Q9YA 4BR0A 4EHUA 1X42A 2LI6A 3V9UA 3KZXA 4BE1A 2PI5A 3K2PA 4DCCA 2YHWA 4M6WA 1TFRA 3ZDBA 3F9MA 3WKCA 5AZIA 5GTHU 4OPHA 1JLAA 1ZBLA 2KSOA 3CNHA 5ALWA 1NK9A 1RDCA 4X64K 2NRXA 2YB4A 3CHWA 4EP4A 4I9QA 2BDPA 5AM4A 1WUAA 2W3RA 4GMJB 4FPAA 4F5OA 3KVGA 3OYMA 3K5MA 4BGAA 1XNQK 5EE0A 2RHKA 3OGUA 4CF5A 4O5FA 5F3XB 3ZSVA 4LZGA 3UB5A 4J2AA 2HSZA 4RW8A 4LF4K 3MWTA 2AJQA 4Z6CA 4Y1CA 2K4HA 4A62A 5E26A 5AI0A 1VSMA 3QLHA 4GY2B 4KBOA 5DK5A 4KHWA 4M47A 1HYZA 1NK8A 3CMEN 4GV6A 4C8NA 1HYSA 2WC9A 4LF7K 3CPEA 2CGLA 3CPWM 4ICAA 2FMQA 3KOOA 3D2FA 2RF2A 2Q97A 5C0YA 2PFPA 4AHSA 3SJJA 1SZPA 3AQFA 4US8A 4ECTA 4ECWA 2DFFA 4I2DA 3LL3A 1JN3A 5TKYA 4FWLA 4BRKA 4NXMK 3Q8MA 2XHBA 4O5BA 4LFBK 5ELZA 4HCBA 4MF2A 3GOIA 3T7ZA 3EW9A 4A8EA 2HF4A 3EL2A 1T8EA 4WJ3B 1CXUA 3DRPA 3RBDA 4RW7A 3DAWA 3RBEA 5ALYA 4DO9A 2XY5A 5AFUH 2DL0A 5AR0A 2HSTA 3S41A 1C1CA 1B9DA 2RDIA 3C0BA 2H3ZA 1SAZA 3MR2A 2KW4A 2ZIVA 5AKHA 4FWKA 3H3NO 7ICQA 4Z4HA 1BCOA 2W7OA 2F77X 3F5EA 3HYFA 2YJFA 4K42A 2LMRA 4FJ9A 1B9FA 5GTIU 3PO4A 2AP1A 3P38A 3UIQA 4KRFA 3ASMA 3M8RA 3C23A 3I1YA 3BZCA 5KFTA 4QS9A 3ULEA 5BPLA 9ICFA 2YMPA 1VSJA 1IIPA 4PH5A 1ZQKA 3VTIA 3THYA 1YI2N 3OBWA 3VGKA 4HYKA 4YHHK 4TSXA 5ADXA 1URJA 4FZMA 4BGDA 1VRTA 1HKBA 4BRAA 5J2QA 1P90A 2YHXA 2R8HA 1WN7A 3PNCA 1OH8A 3WNFA 3O3GA 1F44A 1K8KA 4AHCA 4GV9A 5KNIA 1QSYA 5EWFA 4CJKA 2OPSA 4IDHA 3SPZA 1DGKN 2HOIA 1OW5A 5EE9A 2KLAA 3DLGA 4U7BA 2E8NA 2E2QA 3I33A 3P4IA 3NGZA 2A42A 5ALIA 2BCRA 1ZQOA 5CA7A 5AKGA 3O9SA 1KFDA 4DU4A 1KEJA 3F53A 4DL5A 3VEOA 4DV4K 4BR7A 5EE3A 2ZUCA 1JI7A 1U48A 1VQON 5KGXA 1X3MA 1VSEA 1VAZA 4F4WA 2JZBA 3GILA 2AU0A 1MDUB 1A5WA 3SNNA 4R66A 5AK6A 4DV2K 3OJSA 2AQ4A 2W9MA 4KV8A 1L7OA 4KLDA 2R8IA 4DLEA 1W0HA 3A2FA 2DY4A 1ZBSA 1UAXA 1BPBA 1YJNN 3BEXA 4CHZA 5KG4A 1N2XA 3C94A 4YNQA 4JV2A 4C8OA 4QZFA 1KQQA 3MGVA 3LDAA 1QS4A 4MDBA 1BPXA 1NGDA 2R8JA 1KQSM 3PMLA 5CWRA 1OH5A 3H8JA 4DQSA 2ZIWB 4BXOA 2H3IA 3V7LA 3RSEA 2ZJPL 2H3VA 1WAFA 3SYZA 4I2FA 1XNSA 2WB1F 2HB5A 3H8MA 4F4ZA 1ZD4A 3J80O 1FXXA 4M9NA 1B4FA 3VQ7A 3PZPA 2Z1JA 2F8TA 1EXNA 1Y97A 3VCBA 2AA4A 3BQ7A 2E5SA 3EZ5A 4FJNA 5KFQA 3WNHA 4HTUA 4DHYA 5CHIA 3AA5X 3EEQA 5AM3A 2LHTA 3SV3A 2ASOA 5HOOA 5KT6A 4BR4A 1D8BA 1IH7A 2LPEA 3OSNA 1T6DA 2XCAA 4CZIA 4F50A 2FPLA 4Y1DA 4CGFA 2E1FA 2V4QA 4IR9A 3ALRA 3RRGA 3FZFA 4DV0K 4FLTA 2QM1A 4RNNA 3UM9A 3RMBA 1N63A 4FS1A 1DTQA 2D0BA 1EO1A 3VF2A 3RR7A 1ZQIA 4CIGA 3TABA 3WK8A 5KTQA 3LK9A 9ICCA 3SBTA 4LF6K 4CGGA 1FO4A 3CJ7A 1I39A 4E19A 3QU7A 2WFAA 3CC2N 4FK4A 3CP8A 2O4GA 3MXMA 2E1EA 3AARA 4ED0A 2W9BB 3GIMA 3RRHA 3CCQN 4I2CA 4LJXA 3GDQA 3LZIA 4JB3A 1TK5A 1RZTA 1D5AA 4BC4A 5GAEP 4YXJA 1D9DA 1LKYA 1TL1A 3RJFA 1C0FA 2I7NA 4O5EA 8ICXA 1JX4A 3GU3A 4E7JA 1N5XA 5J0WA 1NJXA 2DFHA 1H1VA 2HNDA 3ALYA 4DTMA 4KLUA 4JS4A 7ICMA 2YCHA 1S1UA 2W55A 5A2QO 2G8WA 4B3OA 3LP0A 5CZ2A 3K1RB 4I9LA 3DLKA 1ZQWA 1SL0A 3WXLA 2KOBA 5C2FA 4J9NA 4FFDA 2JWKA 2GLEA 4NXZA 3AGKA 5IILA 1UOCA 5AZJA 3MN9A 5LJWA 4YCXA 2XVTA 2YX8A 8ICNA 5SZTA 4W5NA 4RUCA 4LH5A 4EENA 4E89A 4WFBL 4CBXA 5IIMA 2XGPA 3AY9A 3CG7A 3ZETA 5GAHP 9ICIA 3W0LA 2VYPA 3G4SN 3MEDA 3ZX3A 1HLUA 4KREA 4DU1A 2EAPA 4FLVA 4UAVA 4FM0A 3LAMA 3ZD9A 3L2WA 3ISNC 1WUDA 2KZMA 1FK9A 3KKRA 4RW6A 3NTUA 1HKCA 1YVNA 1X9JA 1NJIO 4L8RB 4IL6U 1SL1A 2MRLA 1KKXA 1ZQVA 3VETA 4IO8A 3VQ8A 2HHTA 5ALSA 3CW2C 3AA3A 4O0IA 5BPMA 5HRSA 3VN5A 2HNYA 4GC7A 1DGJA 4FK2A 4CJ3A 3B6PA 1JLGA 3DLLL 1W7AA 3BJYA 3C6TA 3VF6A 4KLSA 3L8BA 3RH5A 3IG1A 4AHUA 3K5LA 4DS5A 4ID1A 2FI1A 1WCLA 3WU2U 3NASA 5KFCA 1RYRA 1WSIA 4DTRA 1RDAA 5L1MA 1HUXA 1ZQLA 1NBWA 3EPGA 3A0IX 4JI7K 3KBBA 2VKQA 4H0YB 2I5JA 5ALLA 4ECZA 4LF9K 3TAEA 1IBMK 3KHHA 1A0PA 4BRGA 1JIHA 4BR5A 3I0SA 4KHQA 2JMGA 2K8BB 1DEJA 2LKYA 3P31A 3AVCA 5KG0A 4O5CA 3QB0A 4A59A 1S97A 4AM6A 1VQNN 4F72A 2GX9A 2GWKA 3ICXA 4BQZA 1IJJA 1MSWD 4WFNL 1KTQA 2NRRA 4KLGA 4KB1A 4CEBA 4WFAL 8ICWA 4ED6A 4JD2B 1VQ8N 3O1BA 2BGWA 4KLIA 1JLCA 3AAQA 2Y1JA 3OJUA 4CW7B 2QWPA 4M7YA 2UU9K 5J8YC 3RB6A 3UE5A 3SQ0A 4F4KA 2ZIUB 3VENA 3BP8A 4IEIA 3Q8SB 3O9UA 4FJHA 4H0OA 4PA1A 5AQFA 2YX6A 4H0XB 2YKNA 1LWEA 3FGUA 3OHRA 1K8AO 4OLAA 4TQRA 2WBNA 4IJNA 1WBBA 1VQPN 1QHTA 4B1ZA 5HMLA 2P9NA 3L3VA
chains in the Genus database with same CATH topology
2WTFA 1JCEA 3VF4A 3FZLA 5FPMA 1V4SA 1BO5O 4RT2A 3HX0A 4IOAL 7ICTA 5B8HA 5KFOA 5J0UA 1ZQEA 4IR1A 3VGLA 5GADP 3HT3A 2ISPA 2QXLA 3A5NC 4F5PA 1QSLA 3M9OB 4NO7A 4ECRA 2V9WA 4FSVA 4EYIB 3C5FA 2KFNA 2GTDA 2KFZA 2JEFA 1ATRA 4PHDA 1ZQDA 3ZYYX 3KHYA 2IHNA 3RAQA 3C6AA 5DG9A 3U8XA 5J0TA 4YR3A 2W9CA 4FO0A 4BRIA 3L4IA 3G6YA 3TAQA 4BRPA 4EZ9A 4RU9A 4RQ7A 5J0SA 9ICJA 3JS6A 4DQIA 4Y0WA 3GIIA 4EBEA 5AQYA 2R8GA 3IKMA 4C1NI 4EAHD 3LDOA 4J9RA 1BDGA 2Q36A 3CC4N 2A40A 5D4BA 4KITB 4I2JA 3V7KA 4YR0A 1QQMA 5J2CA 1BPZA 1RXWA 1SQKA 1S0OA 1N8RO 3D2EA 4P4MA 1S76D 5GINA 3A5MC 5KFWA 1NJYA 2HVHA 4DQQA 3T5KA 2J4RA 2P9IB 3TTCA 3LM2A 3Q7BA 2P9KB 5BRHA 8ICJA 4DFPA 4R8UB 2P6RA 4JUZA 3H1QA 5GAGP 4C8KA 4BG9A 4B9MA 4JV0A 4JNEA 3FZHA 3RR8A 1K9MO 5HNKA 4DSIA 3N4PA 8ICKA 3CCRN 4GNIA 4A5AA 1T7PA 2FLLA 3RJKA 4NB4A 4WYBA 4ELTA 3UKUA 3VEVA 2HBJA 1L3SA 2C22A 2P6UA 1GLLO 3MX5A 5KG5A 1BU6O 5EXWA 3O5BA 4PPXA 4F2RA 8ICYA 3C5GA 1KLNA 2D4WA 4YD2A 5DB7A 1WOQA 4FL9A 5C12A 2P9SB 4CZGA 1YXQA 2BQRA 4RQ5A 4JN4A 1ZQMA 3QZ8A 4I2AA 4KLMA 9ICSA 4ILHA 4NLCA 2ZTCA 1BPEA 3RB0A 2KZ3A 4NLZA 2BQUA 1EQYA 4O3QA 4YP3A 2P66A 1RYSA 2C2DA 5J2BA 2BPGA 5J2AA 1XC3A 4EBCA 2CH6A 2A5XA 3RJGA 4BR2A 4YOVA 5JVGL 3VPZA 3MCAB 5KFAA 8ICFA 5M1FA 4IQWA 4NLBA 3PR4A 2KTQA 5KT3A 4YD1A 4RNMA 3RH6A 4BRCA 3HWTA 1XC9A 5HL7L 1TVAA 2ASDA 8ICQA 1YIJN 3E66A 3KK7A 4TUPA 4OO1J 2P9UB 5AQVA 3SI8A 3PIPL 3EYZA 1BG3A 3TAPA 3KWIA 4A2AA 4QZBA 5BPNA 4UBBA 1RXVA 1D8LA 3EWAA 2BUPA 5DM7L 2OWOA 3TTFA 5KFYA 1KAZA 3O9TA 3RJIA 4FOIA 2W40A 4IZ9A 4J9MA 3VGMA 3UXOA 1H38A 4F91B 5D46A 4BGBA 4QWBA 5KFXA 1HJPA 1IM4A 3SAGA 5BR9A 5AQZA 7ICFA 4KLJA 3FZMA 4Q45A 1ZQXA 5DM6L 4F4XA 4GV3A 4ED3A 4IRDA 3M8SA 4QZAA 2A6AA 4O3RA 3HI0A 4CZEA 4E1JA 3L6QA 2PXIA 1TYQA 4DL6A 3VEYA 3ZEUB 5AQHA 5C2DA 9ICNA 2PFQA 2FF3B 1JCFA 4QZGA 4YXMA 4L3QA 8ICBA 3TSUA 4M6WB 4YN4A 3UKRB 4LVSA 4H5WA 3EZWA 4P4OA 3DXKB 3RAXA 3JPSA 1GLDG 4KLOA 2VCPA 3GG4A 3JPQA 3U9DA 1GLCG 2JEGA 5KQ8A 4YDUA 2J6UA 3G25A 2E2NA 4UB5A 3CD6N 9ICAA 3ZD8A 3CJCA 2FSKA 2QWRA 5HHIA 5IIJA 4Z94A 5JMVA 4GXJA 4GXIA 4JKFA 4IO9L 2JWLA 3C6HA 5J29A 4DKWA 4PHAA 1N56A 3I8BA 5KG6A 4EHTA 3PV8A 4FWPA 4MF8A 2ASPA 1YUWA 1QLNA 5DQHA 1HPMA 4CI6A 4A57A 1S77D 4NY8A 5CE3A 5LJVA 2ZF5O 4YOTA 2NRWA 3BQ1A 3RTVA 1WCNA 3M5RA 1YJ9N 4CBUA 4KMUA 3O4WA 2ITMA 4XA5A 1G99A 2BQ3A 1BWFO 3A5OC 4JKGB 8ICSA 2YHYA 4XH5A 3IM1A 5EVZA 2V7ZA 1XSNA 9ICBA 4O3OA 4B9LA 2ZJRL 4I2EA 2NZTA 4DFJA 5DBCA 3HOSA 5J0YA 2DPJA 5J0XA 3LWLA 4RQ8A 4QWDA 3O1WA 4YVZA 1SKRA 2E2PA 1ZETA 3C65A 2GWJA 5KFSA 2P9PA 3BQTA 1QZ6A 5J2EA 3GQCA 5LY3A 3TI0A 2CGKA 1RPLA 4K41A 4RQ6A 1ZXOA 2ALZA 1GLJO 4Q8EA 2HMPA 4BROA 1DGSA 3SV4A 3KHRA 2AGPA 1W97L 3R1XA 3VEXA 4B9QA 5AQIA 1L3TA 2I7PA 1HUOA 1JXLA 4M0AA 3SJHA 4UAYA 3H3OB 5IIIA 4B1UB 3O9RA 9ICMA 2ZGYA 5AFUA 4EYHB 1NGHA 5KFHA 1JXEA 1Q18A 1MQ3A 4GLXA 3MGIA 4LC9B 9ICWA 4Z6FA 3QICA 1U4BA 3CCVN 4MO5A 4KH6A 3HPOA 1Z00B 4M7XA 3SAFA 4BC3A 1SS6A 3V6KA 3ISDA 3EKSA 1T3NA 4FWMA 4WQ5A 7ICJA 4ISGA 5KQDA 4JK8A 5KFVA 2XO7A 3MDCA 8ICUA 5F0XA 2W9AA 4LZDA 4KLEA 1KAXA 2QTDA 1NGJA 5KPZA 3I55N 4DSEA 4G9ZA 5AQQA 2KHOA 3A8YA 2IA6A 4JKHA 4ED7A 2XCPA 1ZQPA 9ICRA 5KT5A 1S72N 3GDXA 4F5NA 4KLHA 4DFMA 1KXPA 1R59O 2Q2RA 3MX2A 4H03B 1QQNA 4BRDA 3H4BA 2IVPA 1E4FT 1NKEA 2NRVA 2A1JB 1NJZA 3O9QA 3NGDA 3HRGA 3MWPA 2AGOA 5AQPA 3RH4A 7ICSA 2OTLN 1U47A 4BVPA 2C2EA 5MLCQ 5DG8A 4CCHA 3C1ZA 3E9PA 4FBTA 5EX5A 3C7NB 4MEYA 5EY4A 3CF5L 1N48A 4BC5A 3R9PA 3WT0A 1GLFO 4TUQA 4M9GA 4KLQA 2W9BA 3HBTA 5KPTA 4HWIA 2AQ0A 4IOXA 4O5KA 1OKJA 3BF1A 1Q82O 1NGEA 2ZJQL 1NWKA 4WQ4C 3TSQA 1Q7YO 8ICZA 4J9OA 3QFPA 3GIKA 7ICEA 3SAHA 3EPIA 3V6JA 4JKDA 5JICA 1TAQA 2QWLA 5IINA 4IFEA 2FPKA 2A3ZA 4O3PA 4BVOA 2ATLA 3WQUA 4F4YA 4CZLA 3LDNA 8ICGA 7ICVA 4DFKA 3I56N 2Q31A 4KLFA 3M9MB 1QTMA 4CD3A 3SZ2A 4BRMA 4QZCA 4Z6EA 2QEXN 1IXRA 5JLHA 4KTQA 3CJ9A 3NMUA 3H4DA 3FLCO 2ZGZA 2UVWA 2BHNA 3RB3A 3RB4A 5H1SQ 1BA0A 1NGGA 2V51B 3Q8RB 1U9LA 3PX6A 2Q0RA 5AQRA 1X9WA 4B9NA 4C23A 5AQSA 1X9SA 2BTFA 4YMOA 5KFPA 2E2OA 3FDSA 2I1QA 3PR5B 3HTVA 5J2GA 3T5LA 5KFNA 1CEZA 3ISCA 3ATUA 2FMPA 4DQ8A 3TQ1A 3AU2A 2ASJA 4YOUA 1TUYA 2UYTA 4GXKA 4CBWA 3SMPA 4JD2A 1U45A 1ZQNA 2NLXA 3GV7B 4JHDB 5KFJA 5CJ7A 2HBMA 4CZFA 1S0MA 2KN7A 3LWMA 1Z6RA 5FPEA 5J0RA 2FF6A 8ICAA 2HOEA 9ICXA 3HOTA 8ICTA 1CUKA 2VANA 2IHMA 4QZIA 4QZ9A 3KZBA 1CZAN 4JWNA 3CERA 2IMWP 1IG8A 3EE8A 3OW2M 2FPMA 3L0QA 1Q86O 3O8MA 3PW4A 3CQXA 2RE2A 3MABA 1LB2B 7ICPA 4H5VA 3C21A 4UBCA 8ICOA 4ILJA 1TUUA 2PFOA 4PKHA 1MWKA 2ZTEA 2PFNA 3BQ0A 5M1NA 4YR2A 3ZDDA 2WUSA 5F2RA 5EOZA 1XSLA 3W3DA 2HHVA 4I6MB 4ECXA 3FFKB 3GIJA 1D9FA 4FS2A 1SKSA 3M1FA 5BRDA 1BGXT 1NKCA 3B0XA 1K73O 1RDWX 1XWLA 4Q43A 4ECVA 3F2KA 4NLGA 3E2EA 4P4PA 1ZQQA 4UAZA 4TQSA 4ED8A 4UY8O 1Y88A 1KC8O 3RJEA 1QSSA 4M04A 2Q0UA 4I29A 3DWLA 3IMXA 9ICLA 2W8LA 2HHWA 3WEEA 5AQWA 4DL4A 2PI4A 5F9NA 5M1OA 3SMSA 3DXMB 1U2VB 3CI5A 4C8MA 3ENHA 3H45C 4RTFD 4O8UA 1NK7A 4QS8A 5D49A 5BOLA 5E84A 2V7YA 1KFSA 2XGQA 2P9IA 5L9XA 2P9KA 3U9ZA 1VQ9N 4O3NA 3CCJN 3CCUN 4QZ8A 4R8UA 3LDLA 1O13A 1T44A 3VOVA 4XH1A 4TUSA 5AQLA 1S3XA 5KFMA 2P9LB 2HBLA 1VQ4N 2V4RA 2DPNA 2OANA 1UT5A 3H8SA 2F9TA 2PAVA 2QWQA 4X5VA 5DBAA 3IUCA 1XS9D 4R65A 4F5QA 3LM9A 4YG2A 1TKDA 2XC9A 1ZQTA 1DT9A 2OTJN 3K75D 4WCEL 4DL7A 4QW8A 4O3SA 3D7EO 2W8KA 4FBUA 2QWNA 3BUZB 7ICIA 1NK6A 5IIOA 4MLEA 4I28A 4RPZA 4F3OA 5J0PA 3Q7CA 3AUOA 1ZJMA 1XSPA 4BWMA 2R8KA 4DSLA 5AQNA 3SLCA 3IDHA 3UQ2A 4CZHA 8ICIA 2P9SA 4DOCA 3UXPA 1ZQBA 2IIRA 4CJ7A 2MUTB 2JEJA 5J2DA 9ICUA 3OHAA 4F92B 3U4LA 7ICGA 1GLEG 3PY8A 5L1IA 1UA0A 4R64A 5KFGA 5DB8A 8ICVA 5DKWA 1ZQSA 4ELVA 2YJEA 1LOTB 4JKEA 4JK9A 2KKZA 4I2IA 5DG7A 4A5BA 2YI1A 3T5JA 3R6MA 3TTDA 4AM7A 4EEYA 3MN5A 4YMNA 7ICHA 2DFLA 4JAXA 1QZ5A 4I2GA 1E4GT 1LV5A 1NOMA 3GBTA 5M1KA 4RT3A 4ECQA 7ICKA 4FWQA 3H7IA 1VQKN 1S0VA 4IEEA 4CZJA 2ZTDA 3HW8A 5BOMA 3HM8A 1NMDA 3MGHA 5HP4A 4YOYA 1VQLN 5AZIB 4J9PA 1DKGD 3AU6A 4DQPA 4CZMA 1ATSA 5JLFA 4BY9C 4A61A 2HW3A 3CETA 1XQSC 2Q1NA 7ICUA 3CCLN 4J9KA 5C10A 4F5RA 4A2BA 2E1ZA 3VERA 4R79A 1YJWN 2CH5A 2BKEA 1ZQRA 1ATNA 3ORYA 8ICHA 4MDAA 1Y64A 4XRHA 2ZJ5A 1BPYA 3ENBA 5BN8A 4JKCA 4UB2A 1HX1A 4RWTA 4RQ2A 3ZEUA 4K4HA 4U67L 3HZ6A 5AQUA 1NK0A 1D4XA 3JPOA 1MC8A 3D2FB 4PGQA 4YMMA 2FMSA 2QWMA 3UKRA 9ICKA 2CGJA 5M1QA 1YHQN 3DXKA 4ED1A 4GVEA 1KSPA 2VA8A 1ZJNA 1VQ6N 2XY6A 3WQTA 5J2HA 1YF5L 5AQXA 3V7JA 4IWVA 2QI2A 4RQ0A 4FVUA 4J9SA 4JEPA 2V52B 4O8KA 4GC6A 4F2SA 2GELA 4JK1A 2MAXA 8ICEA 2C28A 5KFDA 3CC7N 5KG2A 5ADXH 3HP6A 3P39A 3J8AA 8ICPA 1PZNA 4DEZA 2P9PB 4B1XB 3TFSA 1NGCA 3ULEB 3JPTA 1TAUA 5DQIA 2W41A 3JPNA 2NRTA 2FSNA 4M9LA 3ISBA 3MR3A 3G6XA 4G3IA 1BOTO 4NLNA 2QWOA 1QQOA 2ZUDA 3QEBZ 4AF1A 8ICRA 1K8KB 3PW2A 4B1WB 3R8EA 4QZEA 4FWSA 4BRHA 3ID6A 1P8ZA 1YITN 3CCEN 3QDKA 3A5LC 5KFFA 4IRKA 4JKGA 4JKBA 4UB3A 3QMLA 2IVOA 1B43A 2HBKA 4K25A 1GLAG 5FPDA 4YFKA 3CCMN 2F9WA 9ICOA 4QWEA 2JZBB 1U6ZA 5GIPA 1VQ7N 3PVXA 4OPAA 2Q0ZX 3NVMA 5J2KA 4KN4A 4KLTA 2NRZA 5C5JA 5KFUA 5KFLA 5DB9A 3ZX0A 4BRNA 3GFKB 1ZQUA 4IQTA 4DL3A 2BCSA 1M1KO 5DLFA 5KT4A 2B21A 5CB1A 5DGBA 3H6EA 4JK7A 3V6HA 4K4IA 4EFHA 4PGXA 4RCHA 4BG8A 4BXOB 2PBDA 3RSEB 1RFQA 3OBYA 5AQMA 3O08A 5AQGA 4B9TA 3ID8A 3OA9A 4M63C 4BRLA 4IQUA 4QWAA 5EOYA 4RUAA 3QEAZ 2XY7A 2UVVA 4M9JA 4ZH4A 5F1XA 1HJOA 4XH4A 3IHQB 2EWSA 1RDUA 4NM1A 3EE9A 4PKGA 3FYHA 5TZVA 3MMVA 4J9LA 4P2HA 2LYHA 3WXIA 4MEXA 3N4QA 5KG1A 3CXCM 2PFUA 4BQLA 2HHSA 3B0YA 3WXMB 5EWEA 2BCVA 4DL2A 1S22A 3O6WA 4PKIA 3JPRA 3V72A 4C8LA 1Z00A 3PLAA 5I9EB 3BF3A 3TFRA 4FWNA 5FPNA 1KRPA 4F8RA 1NGIA 3SBGA 4FOEA 1VQ5N 4RPYA 3AGRA 1OVYA 5C15A 3H8WA 3PX4A 1HKGA 4Z6DA 5KT7A 4DQRA 2E8AA 5KFEA 5AZJB 1JJ2M 4ED2A 3VEZA 4DOBA 3H40A 5L1KA 1B22A 1Z05A 3ZETB 2F1IA 2FXUA 3LDQA 2BCQA 3C2MA 1QVGM 4QZDA 3F5TA 3KHLA 2F7TA 3N4MB 5M1PA 2BR0A 3K9KA 4XQ8A 1LCUA 3KWGA 1L3UA 2D1KA 4MFFA 1NM1A 9ICTA 1VQMN 5DB6A 4PL8A 2Y1IA 1COOA 3G6EN 1ZQAA 3CMAN 3PW5A 5DGAA 3D6RA 5J2FA 5CP2A 3K9JA 4IJAA 3CJ1A 4DLGA 1V9PA 2A1JA 3QBWA 4NLKA 4Q8FA 3G6VA 3FZKA 4KH5A 2ZJ8A 4EBDA 5BN9A 5KFZA 4BRQA 2RDJA 3ZDAA 3CQYA 4ECSA 4UAWA 2VGMA 3DJCA 3N97B 1BUPA 4I2BA 2FLPA 3C7NA 1ILYA 8ICLA 1S9FA 3WXKA 2HHQA 4XEIA 3RJHA 3E9OA 5DBBA 4H5NA 1ZQJA 1NK5A 3B8AX 1K1SA 3CIPA 4K43A 4KH4A 2P9NB 2F1HA 1NK4A 4RZRA 4B1VA 5KFIA 1JMSA 4H5RA 4I2HA 4RPXA 5AQTA 1C7YA 3IFRA 4UB1A 4PHPA 2E1YA 3VMFB 3K4GA 2FSJA 4FWOA 2FLNA 1NGFA 3PO5A 1W2BM 2ASLA 4UB4A 1KAYA 1UT8A 4DSFA 4WF9L 4MLHA 3EKUA 3UQ0A 4H5TA 1ZQHA 4DS4A 3VTHA 4IXCA 2IVNA 4RNOA 2VGNA 4J9QA 3E9LA 4B1YB 1K1QA 4IQVA 9ICHA 2J6SA 5CR0A 4PGYA 5EWGA 4QW9A 4KN7A 2W9CB 1TV9A 4ELUA 9ICIA 5J0OA 1C0GA 5L1LA 2NNWA 1ZQCA 3MDAA 4RQ4A 4DF8A 1ZQZA 3G71N 5KFRA 4KLLA 1DOQA 3ETLA 4QWCA 2QW9A 2BH1A 2BCUA 4F9OA 3UPQA 4I27A 1ZQGA 3QZ7A 4FO6A 2H3GX 1J6ZA 1A76A 8ICMA 5CHGA 3EN9A 3ATVA 4JHDA 2M9NA 7ICNA 1ZQYA 2F1JA 1M90O 4YOWA 3MFIA 4F93B 3C2LA 4ECYA 4C1NK 3Q8PB 2E20A 3MR5A 3D2EB 1A77A 4H0VB 4JV1A 1MWMA 1NJWA 4BR9A 3PIOL 5JVHL 3ZDCA 3MN6A 3Q8LA 5KPRA 3MN7A 2IBKA 4XUSA 3WEEB 4WQ4A 4DSKA 4TURA 3BQ2A 2NRHA 4HTLA 2UVUA 4BWJA 5F9LA 4K4GA 4RQ1A 1X9MA 3WUHA 3TSPA 4B9VA 3PX0A 5J2JA 3UKUB 2UVRA 3Q8KA 9ICQA 4B9SA 4FWRA 3T69A 3HSCA 5J0QA 3THVA 4I6MA 3FR0A 1SKWA 1V4TA 3ZDEA 1ESVA 5HMMA 8ICCA 5BRFA 4E0DA 9ICEA 1XUPO 4QS7A 3QFUA 3JPPA 5J2IA 2D0PA 3VEWA 3CJBA 1NGAA 4YQWA 3QBXA 3J7ZO 3TARA 3CCSN 1QHAA 4DF4A 3AAPA 3NVKA 2HVIA 4YORA 1T3VA 3C2KA 3SK3A 3FE1A 4BREA 4MFAA