2NRVA

Crystal structure of the c-terminal half of uvrc
Total Genus 75
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
75
sequence length
218
structure length
218
Chain Sequence
RGLRKEALEELMKLLNMKDFPYRIEGIDISHLQGKYTVASLVVFEDGFPKKGDYRRYKIEQDHPDDYESIRTVVKRRYSKHPLPNLLFVDGGIGQVNAAIEALKEIGKDCPVVGLAKKEETVVFENREIHLPHDHPVLRLLVQIRDETHRFAVSYHRKRREKESLRSVLDNVPGIGPIRKKKLIEHFGSLENIRSASLEEIARVIGSTEIARRVLDIL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords UvrABC system protein C
publication title Structure of the C-terminal half of UvrC reveals an RNase H endonuclease domain with an Argonaute-like catalytic triad.
pubmed doi rcsb
source organism Thermotoga maritima
molecule tags Hydrolase
total genus 75
structure length 218
sequence length 218
chains with identical sequence B
ec nomenclature
pdb deposition date 2006-11-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF08459 UvrC_HhH_N UvrC Helix-hairpin-helix N-terminal
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.20 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 5' to 3' exonuclease, C-terminal subdomain 2nrvA02
3.30.420.340 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Nucleotidyltransferase; domain 5 2nrvA01
4Z6EA 4O0IA 4O3QA 4O5EA 1X2IA 5KFXA 5KFOA 1NJZA 3PR5B 3GILA 4QW8A 1ZJMA 4BWJA 2J6TA 9ICHA 1KLNA 4CCHA 4B9TA 9ICBA 4I2JA 3SYZA 4KTQA 1MC8A 8ICAA 9ICUA 2LYHA 4EZ9A 2I9GA 5L1KA 4I28A 4F5OA 4Z6CA 3UQ0A 4DQSA 8ICCA 4NM2A 4RQ3A 3B0YA 5J0WA 1ZQKA 5BOLA 5DQIA 1WCNA 4KLGA 3GFKB 8ICQA 5J2CA 5KFHA 4YMNA 4Z6DA 4TURA 3RR8A 2IMWP 5F9NA 3RJHA 4I2CA 5KFAA 2AQ0A 4GC6A 1EXNA 2R8GA 4DF8A 1KSPA 4DOAA 7ICNA 3KHHA 1MQ2A 1D9FA 4JWNA 2NRZA 1ZQJA 3JPOA 8ICEA 2ATLA 5HMMA 4C8MA 2W9CA 3V7LA 1BGXT 4DFPA 7ICKA 5J2DA 2FMPA 4F4ZA 4ED2A 1ZQQA 2VA8A 5DGBA 3MFHA 1SL0A 1U45A 2M9NA 5DQHA 4O5KA 3TQ1A 2ZJAA 4C8LA 2R8JA 4YXJA 1UT8A 2FLPA 5KFEA 4DQPA 3BDPA 2ASDA 1NJWA 4DL4A 3QE9Y 5TZVA 1NOMA 5J2AA 1CUKA 9ICRA 2FLLA 3M8RA 5CJ7A 4QWEA 4K4HA 5KTQA 3THVA 4O3PA 3KHGA 2XCAA 4B9LA 1NJYA 5EOZA 2AQ4A 5KFLA 9ICSA 1K1QA 4RQ6A 4TUQA 4RZRA 4RUAA 1L3UA 2NRTA 3MR6A 4RT2A 3RB6A 5KT4A 1JN3A 2KZ3A 4UBCA 4J9LA 5J29A 4DO9A 5HP4A 3PNCA 3HP6A 4O5CA 1BPXA 1ZQHA 4IRKA 2FPMA 4R63A 2AGQA 3EYZA 4O3NA 4QZIA 1XSLA 7ICRA 4IR1A 5DB8A 3H7IA 4YCXA 4EYHB 4QZEA 1DGSA 1JMSA 5J2FA 1XSPA 2MUTA 3PR4A 3PW4A 4I2FA 1X9WA 9ICKA 3FDSA 4B9SA 3C1ZA 7ICSA 4F91B 1ZQWA 5J0PA 4GXKA 2IBKA 2W9BB 4DL5A 3JPSA 1BPDA 7ICUA 3TAPA 3QZ7A 5J0OA 1BPEA 4QZHA 3Q8SB 3T5LA 1B22A 4ED7A 4ED1A 1LB2B 2ALZA 5J0YA 1Z00B 3ZDBA 3RJEA 3B0XA 2AU0A 1T8EA 1ZQBA 4NXZA 2HVIA 5DB7A 4KLTA 3C65A 1LV5A 2BPFA 2Q0ZX 2JEGA 1S10A 4RNNA 5EWFA 3PMLA 3GIJA 4YG2A 2AGOA 4DS4A 3PY8A 4PH5A 5EWEA 5HNKA 8ICXA 4QZBA 4YP3A 1V9PA 2KTQA 9ICLA 2I1QA 4RPZA 4R66A 2JZBB 1QSLA 4I2DA 4QZCA 5DBBA 2DPIA 5HHHA 5KFUA 1TK8A 1QSSA 4KLIA 2KZMA 1BVSA 2W8LA 4DS5A 3PO4A 2F1HA 4MEXA 3UXNA 2XY6A 2ZTDA 3QZ8A 3TANA 4QZ8A 4F2RA 2AJQA 3HWTA 3BQ2A 3ZDAA 1SKWA 1S97A 2OWOA 4B9UA 1NK8A 4LZDA 4RPYA 1KRPA 4JWMA 3OJUA 4YD2A 1TAUA 4KN7A 3M9MB 1RYRA 3M9OB 9ICTA 5KFNA 4M6WA 3EPGA 4BWMA 4ECUA 8ICGA 4PGYA 2VA2A 3SV4A 4PHEA 4QZAA 4Q8EA 4J9QA 3PW5A 3PVXA 3ZD9A 2P6UA 3MGIA 1ZETA 3MBYA 4EZ6A 5L1JA 3KHRA 4G3IA 3HX0A 3PX6A 3KTQA 3AUOA 3ORYA 4RPXA 2NRRA 4DSLA 4R8UB 1TK5A 5DBCA 3V7KA 4MF2A 2XY7A 1SL2A 2UVRA 5D4BA 4MFAA 1ZQZA 2R8HA 3BQTA 5DBAA 7ICEA 4M9NA 9ICXA 4KLHA 5KG5A 2DFLA 3C5GA 5KFIA 3ZD8A 3G6XA 3RH4A 2UVVA 2BHNA 4B9NA 4F3OA 1QLNA 5CP2A 1XO1A 4IQUA 4YXMA 4DLEA 3UPQA 4NLNA 4QZDA 3Q8MA 1SZPA 1JIHA 2RDJA 2BQUA 4UAYA 4DSEA 4DSFA 3LWMA 2BR0A 4DWIA 1ZQDA 2KFZA 8ICPA 3SZ2A 8ICJA 1ZQTA 4HYKA 4MF8A 4KLSA 5KFGA 5HMLA 4XUSA 1ZQLA 4DSJA 1RXVA 5DKWA 4F50A 4NLZA 4C8OA 4TUPA 3KHLA 4EBEA 1L3TA 3JPRA 7ICPA 8ICZA 1U48A 3OSPA 5CR0A 1ZQYA 2ZJ8A 3OHBA 4BXOB 2W9MA 5KT7A 3RJIA 1NK7A 3C2LA 2JEJA 4BDPA 5DLGA 4KLUA 1NK6A 1COOA 4PGQA 3ISBA 5KFQA 4X5VA 1ZQEA 4I2EA 4PGXA 3IM1A 4YR0A 5KFFA 3V6KA 3EPIA 5KT3A 4TQSA 9ICWA 4YR3A 4NM1A 3RRHA 1UA0A 4FBUA 3C2MA 4F4YA 4P4OA 4BGDA 3H8JA 2W9AA 1JXEA 2ZTCA 1UA1A 3TARA 4IRCA 4KLOA 1NK0A 4M2YA 4NY8A 4YMMA 5J0SA 3PW2A 4DL7A 1ZYQA 3BJYA 5J2HA 3TFSA 1U47A 1JXLA 4ECRA 2J6SA 2HHWA 1QSYA 2KN7A 4F5RA 4FO6A 4LVSA 2BKEA 4QZ9A 7ICLA 3ZDEA 2A1JB 4J9SA 4ELTA 2JEIA 1NK5A 5KFBA 4KN4A 4IQVA 4JUZA 4RQ5A 2BPGA 5J2IA 3H40A 1RZTA 1IM4A 2IHMA 4DL2A 3MR2A 3PW0A 4M9LA 1Z3EB 2BPCA 2XGPA 1RYSA 4DQIA 5KFRA 4F92B 3RJGA 3IHQB 5KFSA 4XA5A 4R64A 4F2SA 3NGDA 1ZQIA 5CWRA 1A77A 4FS1A 1S77D 8ICKA 4M9GA 3LWLA 9ICGA 1HUZA 1DOQA 2W9BA 1NJXA 1PZNA 2PFOA 4F5PA 4ECYA 3MFIA 7ICIA 5KFKA 4I2HA 2XY5A 1ZQXA 4ZH4A 4GC7A 3ZDDA 1MQ3A 1S76D 9ICMA 3HW8A 2F1JA 4F4WA 3C21A 4R65A 3EZ5A 5DLFA 8ICSA 2NRXA 1B43A 3GIIA 1Z00A 3RB3A 9ICAA 5DB9A 9ICJA 4DFMA 3C1YA 3C23A 3RB4A 4O9MA 2NRWA 3OSNA 4ECZA 2HW3A 4M04A 3OJSA 1MSWD 5KG7A 4RQ0A 1X9MA 2PFPA 3RJKA 3PX4A 1T4GA 3UQ2A 4EBDA 4EBCA 4DQRA 1HUOA 3GQCA 4I27A 4UBBA 4KLDA 4RNMA 3EWAA 3ISDA 3C2KA 1KEJA 3Q8PB 3AU6A 3SI8A 2JZBA 1BPYA 4UB1A 4MFCA 5J0XA 1ZQRA 5KFPA 4DEZA 4UB2A 3T3FA 2C2DA 5L9XA 2HVHA 5KG0A 5KFYA 4IQTA 2C2EA 2FMSA 1BPBA 1XU4A 1ZQVA 4KITB 2PXIA 3Q8RB 7ICTA 4O3RA 2IA6A 2ASLA 4F93B 3ZDCA 2HHTA 3MR3A 4UB4A 2VANA 4ECVA 2NRVA 1L3SA 2ZUBA 3LDAA 4MFFA 4UQGA 4XRHA 5J0RA 3PV8A 1NK9A 4K4GA 2HHVA 4UB5A 3AU2A 4XQ8A 9ICIA 4Q44A 2MAXA 5HHIA 1U9LA 3G6VA 1TV9A 5KFVA 1CEZA 5J0TA 4RT3A 3N4MB 7ICOA 2W8KA 1S0VA 5EWGA 4PHDA 7ICVA 1ZQPA 3UXOA 4C8KA 8ICMA 4R8UA 4QWCA 5IIMA 2J6UA 4JV0A 3V6JA 1SKRA 3MDCA 5KFCA 3PW7A 3BQ0A 2ZTEA 5DB6A 3RTVA 3OHAA 2FPLA 4PHAA 2BQ3A 2C28A 4NLGA 4K4IA 2BCRA 4DF4A 5IIJA 4I2BA 3FYHA 2JEFA 4O3SA 4QWDA 8ICTA 4YD1A 8ICVA 4DL6A 4QZFA 4RQ1A 9ICNA 1L5UA 3E2EA 3G6YA 4DOBA 4FBTA 1KFDA 4M9JA 4QZGA 9ICVA 5IILA 7ICHA 5CB1A 4Q43A 1A76A 3M9NB 3V72A 5KG1A 4ECSA 5J2EA 5J2KA 4RNOA 1AROP 3SV3A 4I29A 8ICRA 9ICEA 5KG2A 5D49A 2AGPA 1S0NA 1QTMA 4J9NA 1XWLA 5F9LA 4UB3A 3HPOA 4UAWA 1H38A 1NK4A 4BXOA 7ICFA 5IIOA 3Q8KA 4YQWA 2XC9A 4KLJA 3UXPA 5BPCA 2FLNA 3T5HA 2DPJA 2WTFA 5IINA 1ZQCA 4M9HA 4Z6FA 4RQ4A 2V4RA 5L1LA 1SL1A 4B9VA 5KFTA 2HHUA 1KFSA 3JPNA 8ICFA 1N56A 4KLQA 3M8SA 4RQ8A 2Y1IA 1ZJNA 4QW9A 2UVUA 4J9MA 4ELUA 4IR9A 3H8WA 1S0MA 7ICJA 2BCVA 5DDMA 5J2BA 8ICBA 4F8RA 1N48A 2V9WA 4RU9A 5J0UA 1XSNA 2A1JA 2HHQA 5KG3A 4O3OA 2W9CB 2IHNA 7ICQA 9ICOA 4IRDA 5KG4A 3MDAA 1T3NA 3RJJA 3GIMA 4I2GA 4UAZA 4ECTA 1HJPA 5KT6A 3V6HA 2FMQA 5CA7A 2BCSA 8ICUA 2PI5A 3RBDA 1XC9A 1T7PA 1D8LA 3Q8LA 3MR5A 1ZQMA 1ZQSA 4ED3A 4B9MA 2C22A 8ICNA 4KLLA 2RDIA 3HT3A 4MEYA 4M47A 4JV1A 4KMUA 8ICIA 3BQ1A 2H5XA 5D46A 4ECWA 4YN4A 1S0OA 4P4PA 1RXWA 8ICLA 2BQRA 2ISOA 3PX0A 1NKCA 2PFNA 5KFWA 4DQQA 2ZUDA 1XS9D 3H4BA 2VA3A 2B21A 3JPPA 5CHGA 3RRGA 1K1SA 5KT5A 4ECXA 3RBEA 1BPZA 2KFNA 5L1IA 4F5QA 1NKEA 1KTQA 2P66A 5KFJA 3RH5A 2PI4A 4FS2A 1Y88A 2BCUA 3RB0A 2BGWA 2HHXA 2PFQA 4EYIB 3K75D 3RR7A 4IQWA 4KLMA 3GIKA 4KLEA 4RUCA 4J9OA 9ICFA 2MUTB 2F1IA 2ZUCA 3GV7B 3GV8B 1TAQA 1RPLA 4JK1A 5KFMA 5KFDA 5DG8A 1ZQNA 5DQGA 5KT2A 8ICYA 1KFTA 3PMNA 1ZQFA 4YR2A 3MABA 9ICQA 5IIKA 4Q45A 1L3VA 4M0AA 3H8SA 3K4GA 2Y1JA 4JV2A 2XGQA 1ZQUA 5DG9A 4RQ2A 5IIIA 2XCPA 2V4QA 2FPKA 3C5FA 4DFKA 3TI0A 3JPTA 1TK0A 3EW9A 4GXIA 3T5KA 9ICCA 2R8IA 2BDPA 4LZGA 4P4MA 4Q8FA 4GXJA 3JPQA 3Q8QB 1WCLA 3LK9A 3N97B 2R8KA 1TKDA 4P2HA 3TAQA 4PHPA 4QWBA 3OGUA 3RAXA 3RH6A 4I2AA 4YFKA 4TQRA 2XO7A 4DFJA 4YMOA 4KLFA 5KFZA 4DL3A 5C5JA 4E0DA 5DG7A 3V7JA 4DSIA 8ICWA 3ETLA 1KDHA 3GDXA 1C7YA 4ED8A 3ISCA 4GLXA 1ZQGA 2KZZA 3NTUA 4NLKA 4PPXA 4YVZA 2C2RA 5BOMA 1UT5A 7ICGA 4RQ7A 4F4XA 5DGAA 4J9RA 4DOCA 1TVAA 4J9KA 5J2JA 1NKBA 1SKSA 1U49A 4DLGA 1TFRA 1ZQAA 3RJFA 3MGHA 3PO5A 8ICHA 9ICPA 1X9SA 5J0QA 5JUMA 2BCQA 4J9PA 2HHSA 7ICMA 3GV5B 4EEYA 1S9FA 2GWSA 4DSKA 5J2GA 3QEBZ 4C8NA 2ASJA 5KG6A 1JX4A 3T5JA 4M6WB 2ZJ5A 4I2IA 3RAQA 2ISPA 2P6RA 4ED6A 3H4DA 4ECQA 5DDYA 4QWAA 1D9DA 4ELVA 4TUSA 1D8YA 4F4KA 4ED0A 3TFRA 1ZQOA 8ICOA 2UVWA 4F5NA 1U4BA 3QEAZ 1IXRA
chains in the Genus database with same CATH superfamily
4Z6EA 4CJKA 4O5EA 1X2IA 5DMRA 3A0IX 5KFOA 2RP5A 4LFAK 1JROA 2LYBA 4JEPA 3CCRN 3V9ZA 4QJFB 2J6TA 5AIAA 4B9TA 2OTLN 4J8FA 4FO0A 2I9GA 4JI2K 1GLDG 8ICCA 3D6JA 1ZQKA 2KG5A 3E66A 2GUPA 3ATUA 3GFKB 2JGAA 8ICQA 3C6AA 4JI5K 4FZYA 5KFHA 1NI3A 4PJ0U 1VSKA 5AKJA 5F9NA 3FFIA 4WQ5A 2HBMA 3FFKB 4CEQA 5J8YC 2PMZF 1EXNA 4HHTA 4DF8A 1RTIA 4FVUA 7ICNA 4JWNA 3I8DA 1W2BM 4Y2JA 5JLFA 2DFEA 1OW5A 3ZYYX 5AQFA 4F3TA 3VEZA 1SZHA 8ICEA 3KHYA 5HMMA 4U67L 1AQ6A 4O44A 7ICKA 2YHWA 2FMPA 4F4ZA 4ED2A 3QDKA 3MC1A 4ISEA 4JK9A 4H0TB 4BRAA 1DLOA 3NVYA 2BGGA 4CF0A 4RTFD 3AY9A 3BQ7A 3ASMA 3BDPA 2QWPA 3HVTA 3M6GA 2ASDA 3U9DA 4GVEA 1NOMA 2LM4A 2K8CB 2W3RA 5FP0A 5CJ7A 2OANA 4LD0A 3CFPA 1RT5A 2K8BB 2NZTA 4Y2SA 1IKXA 1VSFA 5I42A 4KHQA 2XCAA 5EOZA 4C4SA 3J7ZO 4JRQA 3HI0A 4O5BA 4K42A 3ZLJA 3MX2A 4FJMA 1L3UA 3CJ9A 4KHYA 3BGRA 1RBVA 2RHFA 2AP1A 4JI7K 3SQIA 2KZ3A 4UBCA 4DO9A 4FJGA 4C80A 3HP6A 4WFNL 5E26A 4IRKA 4KI6A 2FPMA 4R63A 4CE9A 3TPQA 4DTJA 3ULDA 2P9UB 4BDZA 1UOCA 5AK5A 4YCXA 4CBUA 3DLLL 4QZEA 1QQ5A 4FJKA 1QQ6A 5J2FA 2MUTA 4I2FA 3R6MA 1S1WA 5HRPA 1DGKN 1ZQWA 4H0VB 2QKKA 3HPHA 1NU0A 1UAXA 1BPEA 4QZHA 4PL1A 3AVNA 4ED1A 4BQZA 1JLCA 4NL9C 4UATA 4MDBA 2ZIXB 1LVHA 5FLXO 4FK0A 5AI8A 5C10A 1ZQBA 4NXZA 2EHGA 4FWSA 1X9XA 1U2VA 3C65A 1L8LA 3LAKA 2JEGA 1RNHA 4B3RK 3MCAB 5EWFA 2GBZA 5F3XB 3L3UA 3EKSA 2EAPA 1WUAA 3CM6A 3MEEA 5B8HA 3C29A 3JSMA 5JS1A 5KFUA 1TK8A 1QSSA 1BIUA 4BC4A 4BRHA 3PO4A 3H3NO 3TANA 1S1VA 1VSEA 4QZ8A 4F2RA 3AO2A 3H46O 1YJNN 3DLEA 3HO1A 3BQ2A 3ZDAA 2D4WA 2G06A 3VC8A 3VN5A 4BGAA 1YT3A 1NK8A 4LZDA 4RPYA 1KRPA 1HRHA 3H1VX 5ALHA 1RYRA 1COKA 4M6WA 5AK3A 4BWMA 3EPGA 4ECUA 4AILC 4Q8EA 3OYMA 4J9QA 4MFBA 5HRRA 3PW5A 5BPNA 1FFUA 1N63A 2JLEA 3MBYA 2OA8A 4M42A 2FF6A 4CK1A 3HX0A 3C7NB 5AJ3K 3OYDA 3KLHA 4RPXA 2F44A 2WF9A 4KHWA 4FM1A 2XVTA 1NGHA 2WAQF 5HBMA 3B8AX 3I33A 4GV3A 3V7KA 1JUDA 2PAVA 4EHTA 1L8OA 4KHPK 1WBDA 1G99A 2IAJA 3K5LA 2R8HA 4NWIA 4GFJA 1V38A 5KFIA 3G6XA 3U3YA 3DAWA 4B9NA 1QLNA 3FR0A 1XO1A 4YXMA 1TVRA 3D2EA 2G8IA 1HYVA 3UPQA 3Q8MA 4CZLA 2ZIVB 1JIHA 2A3ZA 4DFDA 3EZWA 4CFBA 2BQUA 3A5MC 2FSKA 2BR0A 2KFZA 3ZSZA 4BRIA 1LAVA 4XH1A 1ZQTA 4KLSA 4J2BA 4KX5A 1RXVA 3HZ6A 3L2UA 4TUPA 3KHLA 8ICZA 2E2OA 4LC9B 3UKUA 3OSPA 5CR0A 1HJOA 1VRTA 1NGGA 2YN4A 5KGWA 2W9MA 3RJIA 1J5EK 3MN9A 4DR1K 2G8HA 5DLGA 2OPRA 4FOIA 3VEVA 1NK6A 3KD5E 1KD1O 4X5VA 5TKYA 1RT1A 4M3UA 1D4XA 1M90O 4TQSA 3V1RA 5I9EB 3NH2A 3AVJA 4P4OA 1Z4OA 4CW7B 2W9AA 1JXEA 3ITHA 4QIWC 3WNGA 4LH5A 3K58A 2VWBA 4M2YA 5J0SA 3F5TA 3VEOA 2HHHK 3BJYA 1JXLA 2NYVA 5F1XA 4FO6A 4Z4HA 4DTRA 4I9LA 2GV9A 3BY5A 1FFVA 1PVPA 3C6UA 2P9NA 3DLHA 2AHOB 1N62A 2P1JA 2ZIUB 2CGJA 3OYIA 1K9MO 4IQVA 1IM4A 4NYNA 2IHMA 4OJLA 5AI5A 3R9PA 1KAYA 3LANA 3RJGA 3IHQB 4XA5A 4F2SA 2PYJA 1A77A 4LFBK 5JTIA 2UXDK 1VSDA 4CBWA 2RF2A 2HNDA 1NMNA 4OPKA 3V1QA 3AMZA 4PY5A 2IIRA 2W9BA 2PFOA 3MFIA 4QS7A 5KGXA 2XY5A 1GLLO 1IG6A 4CF9A 3OBYA 5CEHA 4ZH4A 4GC7A 2AA4A 4DTNA 4EELA 5DLFA 2Z1IA 1O13A 2NRXA 4KO0A 1Z00A 3PSFA 1KQSM 1PK1A 1FJGK 1S1UA 5KI6A 3NAEA 2UUCK 4O9MA 2YNIA 2IS3A 4DU1A 2NRWA 3CI5A 4LF6K 3R3LA 4OJOA 1WUDA 4M04A 2HW3A 4FK2A 4N41A 3FZLA 3PLAA 1X9MA 1MN8A 4MLEA 4MO5A 3UQ2A 4EBDA 4B3SK 4I27A 3GQCA 3KD3A 3HKZC 4UBBA 3TSUA 3EWAA 3Q8PB 3AU6A 3QEWA 5J0XA 1N36K 1GLAG 5KFPA 1NNLA 3T3FA 3PUFA 3QUBA 2PY5A 1LW0A 2HVHA 5KG0A 5KFYA 5MLCQ 1BPBA 3CG7A 3SCXA 4BJQA 2RPIA 2QWNA 3ZDCA 2HHTA 3MR3A 1B92A 4Y1CA 5AQKA 3AEVA 3D2QA 2VANA 2RQ5A 4MFFA 4XRHA 4BX9C 1NK9A 1WWVA 4HAIA 4XQ8A 3NUQA 5EE9A 1N5XA 4Z94A 1VQLN 3J8AA 3O4NA 1U9LA 4KB0A 1DTQA 5ALNA 5J0TA 1C1AA 4Z4EA 3RFAA 2W8KA 3LDQA 7ICVA 4EIAA 3FZHA 4CJRA 1ASUA 2UXCK 4C8KA 8ICMA 4IJNA 1EP4A 4Y2RA 1T94A 2DPNA 3GE1A 4JV0A 1JCEA 1RBUA 4KTZA 1A0PA 3VGLA 4KHNA 1KVCA 1T6CA 3BQ0A 2ZTEA 5DB6A 3ULEA 3OHAA 3T1YK 4JKCA 1S1TA 4U7BA 4CJFA 4FJHA 2BUPA 1HR0K 2Q1NA 1FW6A 3L5KA 2Q0RA 2UUBK 4PL2A 4YD1A 5ELZA 4YOWA 4QZFA 1FXXA 1L5UA 3A5OC 3E01A 5BPLA 5IWAK 3OPXA 4H5VA 4M9JA 4FWMA 2O8EA 3RSEB 3ICXA 4C4RA 2FBXA 4E19A 4DTSA 5KL8B 3V72A 3HOSA 1P90A 4PHTX 1AROP 1RDWX 5KG2A 5D49A 4O3MA 2P9IB 4JKGA 1S0NA 5M1NA 2BANA 3ZSYA 1OH5A 3HPOA 1H38A 3V9UA 3VEYA 3KK1A 3QU9A 4M45A 4P0QA 3MX5A 3OYFA 1XNQK 3MGVA 2YQEA 2FLNA 3CP8A 1FO4A 1JRPA 2DPJA 4RQ4A 2V4RA 4B9VA 1SL1A 2HHUA 1SQKA 4CD3A 2E1YA 2EZYA 3TADA 1KFSA 5KAIU 3SUNA 1ZJNA 1KAZA 5GTHU 2EQYA 1Y97A 4ELUA 1G15A 3E9LA 5DDMA 3QESA 4F8RA 1CZBA 2V51B 4FOEA 2YMMA 2A1JA 2W9CB 7ICQA 5AQMA 3AVLA 3CD6N 1V97A 2E3TA 5AM5A 3UMCA 3QERA 4UAZA 1FKOA 1N5WA 3OHRA 4AH9A 1CXQA 4JB3A 2F8KA 2BCSA 1XC9A 2HOIA 4FVMA 4KB1A 1ZQSA 2C22A 4JD2B 3GBTA 2IVNA 4PKIA 4CZGA 1N60A 2D3DA 1X40A 2FDRA 4MEYA 8ICIA 2H3FA 4IG3A 3WU2U 1RXWA 5FPNA 2BQRA 2KW4A 4BE0A 5AR0A 3OS0A 3PX0A 1NKCA 2X74A 5C2DA 4G9BA 5AM3A 5KFWA 1NZPA 3H4BA 2VA3A 4CHYA 3IN5A 1BPZA 4H4MA 5L1IA 1C1BA 2A41A 1EWRA 4DMNA 4DUYK 3RH5A 1Z19A 2PI4A 1Y88A 2YNGA 2K4EA 4CJ7A 2HHXA 3AN1A 3K75D 3AV9A 3B6PA 3E9PA 2KHOA 1RCHA 3SQ2A 1XHXA 3K2PA 1TAQA 1ZQNA 2CH6A 2K4PA 1YF5L 3D45A 3NFAA 3VMFB 1WWUA 4BRQA 5IIKA 1PVRA 3H8SA 3THYA 1YVNA 2XGQA 3L2VA 4RQ2A 2XCPA 4FLWA 1S72N 2GELA 3JPTA 1JLAA 9ICCA 4DR4K 4LZGA 1U04A 4P4MA 4GKJK 4GXJA 3VERA 3WNEA 5J2NA 4AHSA 1I94K 1K8KA 4P2HA 4PHPA 4QWBA 3RH6A 1BNPA 1TYQA 1NGBA 5BR9A 4E0DA 2YNFA 5DG7A 4YDUC 2G8KA 1KVAA 1NJIO 3KLIA 2RLTA 4CJPA 3H0RB 1BUPA 3AVMA 4O8UA 5AQHA 1ZQGA 2ZF5O 3ID6A 3SENA 3Q7BA 3UKRB 4CEDA 4CZIA 3K57A 4NLKA 4KI4A 5AM2A 1ILYA 5EY4A 4RQ7A 5GIPA 4EX7A 4F4XA 5DGAA 4MQ3A 3CMAN 3FZMA 4EP5A 4M41A 5HR7A 5BRDA 1ZQAA 2A42A 3CQYA 1RM6C 1X9SA 2BCQA 3M1YA 2JXJA 7ICMA 1BNOA 5G5HA 4EEYA 2GWSA 4DSKA 2HB5A 1NZBA 1J6ZA 3T5JA 3TWHA 3RAQA 1BDGA 4ED6A 1PK3A 3H4DA 3CJBA 4ELVA 4TUSA 1J5OA 4CF3A 3CCLN 3G0ZA 3G4SN 3MN5A 3ISNC 4CIGA 4JKAA 4O0IA 5BR8K 1HNZK 3LDPA 2FBTA 4KMOB 4B1ZA 5C2FA 4QW8A 1ZJMA 1WYGA 5JLHA 2DF4B 4I2JA 4KTQA 8ICAA 1MC8A 4EZ9A 3KD1E 3A5LC 1RYUA 4W5OA 3TABA 4FWKA 3AVBA 3QB0A 2KHQA 3LPUA 4RQ3A 2GWKA 3B0YA 2VWKA 4IG0A 4KH6A 3WKCA 5BOLA 1WCNA 3AA3A 1WB9A 2HOQA 5GADP 1WG8A 4US9A 3DM2A 3OVNA 4JLHA 4Z6DA 2A1AA 2IMWP 3S9HA 4I2CA 1I3AA 3C0BA 5KFAA 5AKYA 2VQEK 3AVCA 3QEIA 2WHEA 3OTOK 3KHHA 1MQ2A 4X66K 2K4IA 2NRZA 4DHYA 3NGIA 4Y2PA 4QIWF 3JPOA 1BQNA 2F96A 4CK3A 3KZXA 1MDUB 2GH1A 1NOYA 2YB1A 1BGXT 1QHAA 2P9PB 4BE1A 5DGBA 3UMBA 2M9NA 5DQHA 4O5KA 2D0AA 2ASOA 2X6NA 2A5XA 4M7XA 4N56A 1HNIA 1UT8A 2FLPA 3SQ4A 4DQPA 4OKJA 2JH1A 3CERA 1NJWA 2JH7A 3P4IA 4AHTA 4BRCA 5J2AA 3DLBA 3T1AA 4FLXA 1N5YA 1KL9A 2CGKA 3E9OA 1Q9XA 4LF8K 4FWLA 4K4HA 2EX3A 3WK6A 4O3PA 3QIPA 3CMEN 2Q97A 4B1UB 2P9KB 4EHUA 1PUZA 2AQ4A 5AZJA 4OGEA 2ZGZA 9ICSA 5LMNK 4KHSA 4I2QA 1ZC6A 4TUQA 4RZRA 5ALDA 2DFFA 4RUAA 4WQ5C 1IIPA 2NRTA 3ZT1A 4RT2A 3RB6A 1QQNA 3PIPL 5ALKA 1O03A 4M3YA 4NJ8A 4NXNK 1HYZA 4GNIA 4CHOA 2UYTA 1OVYA 1KKXA 3IFRA 4GMJB 4XH4A 4QAGA 2QWRA 3EYZA 4QZIA 4IR1A 2VCPA 4JHDA 3H7IA 4EYHB 3QU7A 1DGSA 2HI0A 1XSPA 3OYAA 3SNNA 3EUB2 4B9SA 4CGZA 4F91B 5J0PA 3HKZF 3I28A 4YOXA 3JPSA 7ICUA 4CGFA 2G08A 4BACA 1ITGA 2G8VA 4DV4K 3VEXA 3VF2A 3U4LA 3T5LA 2KKPA 3EL2A 5J0YA 3H1QA 5GAHP 5C42A 4PA1A 4RW6A 4FJ9A 4WFBL 5DB7A 3I0RA 3O0FA 5AQLA 2QXLA 3QNOA 1JLEA 4FL9A 2DL0A 1S10A 1CXUA 3PMLA 3GIJA 1O08A 5ALXA 2GOLA 5KQ8A 2KSOB 2ESEA 1HNXK 2JV3A 4B9QA 3D2SA 3ENOA 2LSNA 4B1YB 9ICLA 3AO1A 1YJWN 4BVOA 2I1QA 4RPZA 4R66A 1TAUA 3KZBA 2KZMA 2KK0A 1B9FA 3LDSA 5HHHA 1BWFO 2ASMA 3MCPA 4I2PA 4RW9A 4BRKA 4ZTFA 2W8LA 2F1HA 3CYMA 3QFUA 3VA0A 4JI6K 3VEWA 3L2RA 1XMOK 3ZX0A 1LCUA 1J2NA 4WJ3B 2AXTU 1SKWA 1S97A 1SAZA 4BRLA 4LFCK 4C4TA 4B9UA 2JWLA 3HL8A 4IWVA 1J2MA 3HXMA 3M7DA 3OJUA 2Z1HA 4KN7A 3HM8A 1SIJA 1QVGM 4PHEA 1YXQA 3R8EA 1ZETA 4EAHD 3WEEA 4EZ6A 4G3IA 5L1JA 3KHRA 4DV2K 2BDUA 1NM1A 4FE3A 1YVUA 4BVPA 2DKZA 4R8UB 4DSLA 5J2MA 1VQ5N 4MF2A 2XY7A 4RW4A 5ALRA 1SL2A 2G0AA 3SUPA 2H3VA 3H45C 1Q3UA 1ZQZA 1MWKA 9ICXA 4PZNA 1L7OA 4DTXA 1XMQK 3C5GA 2QI2A 3AA4A 3KIOA 3OYEA 4IQUA 5ALEA 4CJLA 2E8PA 4JKHA 4JI8K 1Q9YA 5ALQA 1SZPA 2RDJA 3KK3A 4DG1A 3DLKA 4B1WB 3LWMA 1GLJO 1ZQDA 1NGFA 4FLTA 2CPRA 1BI4B 3F2BA 4Q5VA 1X9JA 3KOOA 3F5EA 4MF8A 4CERA 5KFGA 4U6PA 1ZQLA 1NGIA 3HPGA 5GAGP 4FCYA 3F2CA 1D8BA 1ZQYA 4BXOB 5EOYA 2KVSA 5CHIA 3ATVA 5BREA 1S6QA 4B3OA 5KT7A 4AHVA 4KLUA 4BDPA 3C2LA 4BC5A 4RCHA 4P0PB 1GOBA 1SZ2A 3A8YA 4FZMA 1BQMA 5ALJA 4PGXA 2F2AB 5KT3A 2MU2A 1ECWA 3VQ8A 5M1KA 1K5OA 2B4JA 2W03A 4NM1A 3RRHA 2BTFA 5AQUA 4GV9A 5HOOA 5K4LA 2WONA 2ZTCA 4IRCA 3TARA 2IGIA 5ALZA 1ATSA 3SI6A 2QWOA 1MU2A 5AKKA 4NY8A 4ID5A 3WUHA 4IFYA 5SZTA 2J6SA 4ECRA 4WE1A 4CF1A 1RQNA 4F5RA 5CYQA 4J9SA 4R5PA 1BL3A 3U26A 2JEIA 2E1FA 3L4IA 5A2QO 3AAPA 2X78A 4KH5A 2JR5A 2P9UA 4H5WA 5AQYA 4FJ7A 3PW0A 4M9LA 2XGPA 3H08A 3LL3A 4AHCA 4DQIA 5KFRA 3VTIA 4F72A 1UCVA 3CCSN 2P9LB 1ZD4A 5SWMA 1HEKA 4Y1DA 8ICKA 1C0UA 2E88A 5AM1A 4KFBA 4M9GA 3I76A 1Q82O 1DOQA 1UHUA 4A2AA 7ICIA 2BH1A 4I2HA 3ZSOA 3TAMA 1W97L 2E2PA 3ZDDA 9ICMA 1S76D 1HQEA 3H3OB 4CK2A 4R65A 1B9DA 1MA9B 3HRDD 2EZXA 8ICSA 1B43A 4FWNA 2ZIXA 4FYDA 4JK7A 5DB9A 9ICJA 2P9SB 4CGJA 3C23A 4ISGA 1L7MA 3RB4A 3TU5A 5CYMA 4OLAA 3OSNA 2ZE2A 3K5OA 2WB1C 3CC7N 1OXJA 4RQ0A 3DOLA 1IH7A 2QK9A 3RJKA 3PX4A 4FFDA 1Q7YO 3SBGA 3NVVA 1TL3A 4E7HA 1YJ9N 4RNMA 4YNQA 1NGCA 4DV1K 4UB1A 4FLZA 2PZSA 3RMCA 4UB2A 1NGAA 2C2DA 2FSJA 2OPPA 3U3GA 2YKMA 4CF2A 2FMSA 2IOFK 4O3RA 2IA6A 3SK3A 2YTUA 3L3VA 3AQFA 3K59A 2YMLA 1QH9A 3HYFA 1F5SA 3N7PD 1FK9A 1TKXA 5EX5A 3NASA 3CF5L 3THWB 2E2NA 2HHVA 3O3GA 3IUCA 3LP3A 4CGDA 3AU2A 4Q44A 4EP4A 4UAVA 1VQ6N 5B5EU 2YB4A 3QEXA 5KFVA 1VRUA 4TSXA 7ICOA 2ZJQL 4ICLA 1WAJA 2KHVA 5AI0A 2OEHA 2HDOA 4PHDA 1S0VA 3C7NA 4KRFA 4JKDA 1L7NA 1O1WA 1C0MA 5H2FU 5AQNA 4H0OA 3F2DA 4C1NI 3G71N 1NNEA 2FC0A 1IV0A 4IBNA 3VENA 4BRFA 2FPLA 3OTQA 2BQ3A 3M6KA 3IDHA 4K4IA 2BCRA 1ASWA 5HROA 4H5RA 5KRSA 3AA5X 1Z25A 4KPYA 4O3SA 4AF1A 3T7ZA 4HVJA 5FPEA 4QWDA 8ICVA 4JI1K 1X6JA 9ICNA 3EKUA 1TAMA 1Q8KA 3E2EA 2ZIVA 1RTDA 4FBTA 4CEBA 2GWJA 4QZGA 9ICVA 7ICHA 4FZZA 2XRIA 4Q43A 4FJ5A 5AI9A 2RN2A 4OO1J 9ICEA 4BY9C 2AGPA 4K0KK 1NMDA 3SMVA 1KBUA 2HSTA 3O1WA 1JXBA 5KRTA 1N6QA 5IIOA 3Q8KA 1P7DA 1RTHA 5HP1A 1E4FT 5KQDA 3WQTA 3CXCM 4KREA 3IKMA 4FLVA 4UARA 2FBYA 3HK2A 3WNFA 1F0MA 1SXEA 4DCCA 3PSIA 2QWMA 3F9MA 5DM6L 3L2WA 1TUUA 2DKXA 3BF3A 1N56A 4US8A 4RQ8A 5AQSA 3B6OA 3QMLA 4PKHA 1M6YA 3CCEN 3ZT0A 2YHBA 1VQON 2OYQA 4J9MA 3VQ6A 7ICJA 4FJNA 1YZ6A 5J2BA 1N48A 2K60A 4RU9A 2V9WA 3O9QA 3QBWA 5J0UA 3J81j 5DM7L 3L8BA 1XSNA 1Z6RA 5KG3A 2PKEA 3THXB 3LDOA 2ZIUA 4JKFA 2W7OA 1HNVA 4G9ZA 3GIMA 4I2GA 2LBOA 3CETA 4ECTA 2DFHA 3V6HA 3P5JA 2NLXA 2VIXA 3QXGA 1T7PA 3Q8LA 8ICNA 1ZOLA 4AYBC 5CR4A 4Z0UA 2RDIA 3VESA 4AP9A 1K73O 3BQ1A 4CFCA 5D46A 3DXKB 1V4TA 5FPDA 5ALYA 3W3DA 5AZIB 4FJIA 5D3GA 2BZFA 4CIEA 2OPQA 2Q2RA 4M3WA 3TADC 4DQQA 2ZUDA 4IFEA 4JI4K 3N28A 4W5RA 1ZBUA 4NCGA 4DTUA 3CHWA 3RRGA 3MWTA 2KFNA 2QB0B 2UXBK 2JMGA 4I7FA 1L7PA 1KTQA 1NKEA 2K8AA 2E6LA 2BCUA 2BGWA 4H8KA 1VJ5A 2WBNA 1SV4A 2D0BA 3EN9A 2WFBA 3LZIA 3GIKA 4KLEA 3GV7B 2F1IA 3GV8B 5AIBA 1RPLA 5KFMA 3QNNA 4UB8U 4B1XB 4W5TA 1Q3VA 3DEEA 3AM9A 2FLOA 3HVRA 3BUZB 3DRRA 4KH4A 4CHQA 2YV0X 1L3VA 4JNEA 2WOMA 2NO5A 2KE7A 2YY6A 3K4GA 4JV2A 4BR4A 1ZQUA 2V4QA 3C95A 2FPKA 2Q0UA 2D0PA 1TK0A 5ALGA 4FWPA 4GXIA 3ALRA 4RQMA 5M1PA 2R8IA 2BDPA 4Q8FA 3D7EO 3JPQA 1WN7A 3MXJA 4J2EA 3Q8QB 3LK9A 5ALUA 1EQYA 3OYJA 2I7NA 2R8KA 4H0XB 3TAQA 3ED5A 3NVWA 3OGUA 1DT9A 4BQLA 2KIWA 3WXJA 1QCKA 4TQRA 4YMOA 3VQAA 5KFZA 4IDKA 5C5JA 1KCFA 8ICWA 2HBLA 3ETLA 5H1SQ 1KDHA 2YX8A 2KVCA 4IOXA 4OVLA 4YOYA 2ZXIA 3IRXA 3NS1A 4Z4GA 3OS1A 5T7BA 5EE0A 1CZAN 4DOCA 4J9KA 1MA7A 5CRXA 5AQTA 1NKBA 3NRZA 1SKSA 2YJFA 4NCBA 4XH5A 1TFRA 4Y2TA 3RJFA 8ICHA 4HUEA 3VQ9A 5J0QA 3CC2N 5JS2A 1NGDA 4DR5K 2MA1A 3GV5B 3FZFA 2W55A 2Y9TA 5J2GA 3QEBZ 4QS8A 3VF4A 1ESVA 2ASJA 1XNRK 1DK3A 1JX4A 2ZJ5A 2ISPA 2KTQA 3ALYA 4NO7A 3RSEA 3VCBA 2E1ZA 3SJJA 2W04A 3VGKA 1ZQOA 2HMIA 1U4BA 1IXRA 4PWDA 2P9IA 4O3QA 2O8BB 5KFXA 2D8CA 4R79A 2W42A 2G5IB 4M3TA 4FZLA 3SR6A 9ICBA 1S9EA 4HCBA 3SYZA 3SAGA 3BF1A 9ICUA 3HP9A 5L1KA 4F5OA 4Z6CA 1J53A 3FLCO 5LMUK 4NM2A 2VG5A 3LAMA 3ZEUB 5J0WA 1ZRMA 4NXMK 2NRHA 2JRZA 4YMNA 4O4GA 5F0XA 4A2BA 5ALMA 4TURA 3RR8A 1E4GT 4BROA 3RJHA 5JU5A 3KWIA 3QU4A 2O4GA 4CECA 4FJJA 3QLHA 5HRNA 2R8GA 2AQ0A 4KV8A 4JRPA 4F71A 3TAGA 1D9FA 3FC4A 3D2FB 3ZSQA 2O8FB 2E8MA 1VQNN 5A0LA 2PYLA 1YUWA 2WC9A 5JMVA 1T03A 2ATLA 1DRGA 4PL8A 3WXLA 1UPHA 2W9CA 4IZ9A 3KKRA 4RQNA 3WQUA 5EVZA 5J2DA 4H0YB 1ZQQA 2VA8A 3KZIU 2M0NA 1A5WA 1SL0A 5KPRA 2ZJAA 4C8LA 5F2RA 4FM2A 3FAHA 1VDVA 3IG5A 2W43A 1REVA 4JD2A 3QE9Y 2O8DB 1CUKA 9ICRA 3NF6A 2FLLA 3M8RA 1VQ9N 4NCAA 2FI1A 5KTQA 3THVA 4KX3A 4CJTA 3KHGA 1NJYA 5M1QA 5KFLA 3CJ1A 4LSLA 4OPHA 1K1QA 4RQ6A 3O9SA 3K9KA 4DV5K 3AO5A 3MR6A 3IAYA 2KJ5A 1V85A 3VQEA 4W5NA 4J9LA 2LMRA 1Q81O 1ZQHA 2UU9K 3S6JA 2VGNA 1X3NA 3KLFA 3WNHA 1XSLA 4O3NA 3RF9A 3GDQA 3NRWA 5DB8A 3VQ7A 2WB1F 3DRSA 2KQ2A 3OYBA 1JMSA 1URJA 1W0HA 4FZNA 2OH2A 3LPTA 3W0LA 1X9WA 3BS5B 2K4HA 4JKBA 4H5TA 7ICSA 4GXKA 3DYAA 2IBKA 4DL5A 1EWQA 1BPDA 3F53A 3ZT2A 3QZ7A 4CZFA 5J0OA 1Q8IA 3AA2A 2YJEA 5BPMA 3L6QA 3Q8SB 1JCGA 3ETRA 3D2NA 4ED7A 5JRTA 2Q31A 1LB2B 5J2PA 4BR7A 1VQKN 1X66A 2GO7A 1RBRA 2V7YA 3JAMO 1T8EA 2AU0A 4MO4A 1DK2A 1ZXIA 2KOBA 1ATNA 3TAFA 1ZD2P 2Q0ZX 3NBPA 3WKDA 4BE2A 1KC8O 3OYLA 1N33K 4YY3K 2AGOA 4USAA 3A0HU 3PY8A 1KVBA 2VQFK 3PSPA 3V1OA 3V6DA 1OH7A 1JCFA 2EDUA 4QZBA 4YP3A 1BO5O 2GX9A 3CC4N 1QZ5A 2JZBB 5EE1A 3ENBA 3HSTB 3UKRA 4KLIA 1QS4A 3UM9A 2Z7JA 2ES6A 3PZPA 4K8ZA 3SEIA 3UXNA 1GLBG 2W11A 4E1JA 3QZ8A 2A1SA 2CN1A 3IV6A 2HBKA 1RBTA 4BR2A 4LF5K 2AJQA 3SPZA 1S8OA 3HWTA 3P1GA 2OWOA 4K43A 1XO0A 3QUCA 1UWBA 4O55A 2LI6A 4FPAA 1P8ZA 9ICTA 2I5JA 1YI2N 1I39A 5KFNA 4ACOA 2A40A 4PGYA 3O9TA 1HUXA 3H0LB 3SV4A 3E58A 4JS5A 3BZKA 3ZD9A 1Z4NA 2P6UA 3PVXA 4IOAL 3PX6A 1NWKA 3KTQA 2ZJPL 3AUOA 2OM6A 5ALIA 2ZJRL 1SXDA 2NRRA 3CFRA 1TK5A 4CNQA 3QEPA 2XI9A 4CEAA 2MRLA 1ASVA 3WXMB 4I6MB 2I6XA 2UVRA 1VQMN 5D4BA 2QM1A 4PZOA 1JLQA 5GINA 4MFAA 7ICEA 3BQTA 5DBAA 3NHGA 4KLHA 5KG5A 2DFLA 3VPZA 3QU2A 4L3QA 2UVVA 3ZD8A 2ATQA 2BHNA 2W3SA 3GZFA 4FJXA 5CP2A 4DLEA 3AVGA 3OY9A 2YI1A 3S3NA 4QZDA 4E1NA 5AI4A 4CIFA 2YHYA 3RVCA 5AM0A 5AKLA 1XI1A 4UAYA 4BREA 1A5XA 3L2QA 4DWIA 3QX7A 3SZ2A 5I3UA 2ZXHA 1FKPA 4HYKA 5HMLA 4XUSA 4B3TK 4F50A 3HRGA 4C8OA 4EBEA 2WF8A 4BRMA 3JPRA 2P9PA 1DGJA 1BOTO 3C94A 1BIZA 4O0JA 3SMPA 4OD0A 2WTUA 5JVHL 2OZMA 4CD1A 3G6EN 3FM9A 2JEJA 4WQ4C 2N1RA 1COOA 4PGQA 3A5NC 4V19S 3NGZA 4Z4IA 3ISBA 4Y2UA 5KFQA 1ZQEA 3IM1A 3V6KA 1Q46A 4C0ZA 5KFFA 3EPIA 5E84A 3VQDA 1ZBFA 2E4LA 3OYHA 4UAUA 3LP1A 2F4VK 4AYBF 3I55N 4F4YA 3H8JA 3SAFA 2P9KA 2VWJA 1ATRA 1UA1A 2A19A 4FSVA 5GAEP 1NK0A 2P5GA 3OBWA 5B66U 1ZYQA 1U47A 3TFSA 2YHAA 3O9RA 2HHWA 3MWPA 5J1EA 4DTPA 1QSYA 4LVSA 1HLUA 1GLEG 5M1OA 3KKAC 3N7SC 4B6JA 7ICLA 3ZDEA 4ELTA 1S22A 1VSIA 2XICA 1LOTB 4KN4A 2GTDA 4K41A 2BPGA 3M3ZA 2HNYA 1RQLA 4FWQA 4DV0K 3H40A 1RZTA 2NV3A 4Y2YA 2HOEA 3O6WA 4WF9L 1Z3EB 4CZHA 3CW2C 1S9GA 4WYBA 5FROA 4BGBA 2B5JA 3ONNA 3VGMA 4K8XA 4A59A 1SV0A 1Z1BA 4CJEA 4E89A 1C0TA 9ICGA 2YNHA 1HUZA 5CE3A 1RGIA 1PZNA 2ZQBA 4ECYA 4PUOA 4RW7A 5KFKA 1ZQXA 3F2KA 4JYAK 2DY4A 3NVZA 2IOFA 3TTFA 3HW8A 2F1JA 4F4WA 3TKAA 4XEIA 4IC9A 3MECA 5ALOA 3GIIA 3RB3A 2GLEA 3KKSA 3O3FA 4CRXA 9ICAA 3ID8A 1WSJA 3O3HA 2QARB 4B3MK 4IL6U 4GVMA 2WF5A 3RMBA 1RG6A 3HBTA 4ECZA 1SWVA 3SUOA 1ZD3A 4ISFA 1WSHA 2HMPA 3CCUN 4Y0WA 5KG7A 1A6SA 5FRMA 1VK0A 1F44A 2IOHA 2KSOA 3LP0A 1T4GA 4M63C 4X64K 3CIPA 3AGRA 1CI4A 4EBCA 1HUOA 1N34K 5AQIA 1OUQA 2EANA 3ISDA 1KEJA 4OKKA 2E20A 3CPWM 4OPJA 4MFCA 5AKGA 1VSJA 4DEZA 1S5JA 4A62A 3U9ZA 2KMDA 3ZETB 5L9XA 3TTCA 2FXUA 3AVHA 1X1PA 1RFQA 2W54A 3H8MA 2HCFA 1KAXA 4A57A 3DXMB 1XU4A 1LKYB 3K9JA 1ZQVA 4KITB 2PXIA 3HM9A 4ILGB 7ICTA 2ASLA 5AQGA 3DLGA 5KPTA 4UB4A 2F77X 4ECVA 2NRVA 3MAQA 2B0CA 5AQQA 4K4GA 5J0RA 3AGKA 3DLRA 2F3NA 3LM2A 2F7TA 5AQPA 2E6MA 5HHIA 2ZIWB 4WCEL 1W7AA 1GOAA 3G6VA 2HF3A 1TV9A 4FLUA 1F21A 1GO3F 5EWGA 3IRUA 1ZQPA 3UXOA 4H4OA 4CZJA 4R8UA 2HSZA 5BRHA 1X42A 5IIMA 4LSNA 1SV5A 4WQ4A 2P5OA 4DR7K 3LDLA 1CZ9A 2F9TA 5KFCA 4NB4A 4X65K 4Y2VA 4IO9L 4FM0A 2VKQA 4PHAA 4BDYA 1A5VA 2G8UA 1ZBIA 3NH1A 4NLGA 4DF4A 5DK5A 2PFUA 4LF4K 3FYHA 3BS7A 2JEFA 1NG9A 1T6DA 8ICTA 2O8CB 4GY2B 4E7JA 4Q0BA 4DL6A 1FEZA 4RQ1A 3RMAA 4JS4A 3WK4A 2ZGYA 3G6YA 4KAZA 1KFDA 2KP7A 5IILA 4WFAL 1LWCA 4H5NA 3KKAA 3M9NB 5KG1A 4RNOA 5J2KA 8ICRA 1BI4A 1L6NA 5KPZA 2KJ9A 2ITMA 5F9LA 4UB3A 3NGYA 1RBSA 4BXOA 4DR2K 3NCIA 2YMQA 1J9AA 2I7PA 2ODGA 4GW6A 4M7YA 2XC9A 1JLGA 2E5SA 4QOZB 3UXPA 4XIUA 5BPCA 4P0PA 5TISU 1EETA 5HLFA 4M9HA 5ALFA 1SB3C 2WTFA 5IINA 1JJ2M 4Z6FA 1KLMA 1S5LU 5KFTA 3R9KA 2KNJA 3JPNA 8ICFA 2FE9A 4YHHK 3M8SA 2Y1IA 3SBTA 2JGUA 4OJ6A 3TSPA 4IR9A 1S0MA 2BCVA 3WK7A 2E2QA 2YX6A 1QVFM 4IDHA 4CZEA 2QXFA 3KK7A 2IHNA 3UMGA 5BN9A 3ZSXA 3P31A 4HUFA 4IRDA 4BG8A 1YTAA 5KG4A 1T3NA 3KK2A 2IVPA 3NMUA 2J4RA 2FMQA 3CNHA 1HJPA 5KT6A 1BA0A 4CJQA 1JL2A 2DBYA 3DI6A 2QB1A 3SAHA 1GLCG 8ICUA 1T44A 1ZQMA 3MR5A 4ED3A 2OPSA 1DXSA 1J54A 2P9LA 4KLLA 1IKYA 2DTUA 2W6KA 2NNWA 3F5AA 3K0SA 4ICAA 1DTTA 1Y64A 1M1KO 4UB6U 8ICLA 1YHQN 4OJ5A 1C1CA 4DKWA 2PFNA 2W41A 2B6AA 4DR6K 2D1KA 4AHUA 5BN8A 1YTUA 3ZSWA 3J7AP 4A5AA 5AK4A 4KBOA 1K6YA 2Y0SC 3JPPA 5CHGA 4DU3A 2QKBA 4BR9A 4ECXA 2P9SA 5FRNA 1EX4A 1S3XA 4Z4CA 1YIJN 4O5FA 3CM5A 2P66A 5CZ1A 1IG9A 1RT4A 1QHTA 5G5GA 4OPAA 1IG8A 4DQ8A 3BEXA 4CF4A 4NV0A 5AM4A 4J2DA 1B0XA 4KLMA 9ICFA 1WSFA 4E7KA 3SQ0A 2HF4A 3GU3A 2ETJA 2MUTB 4M47A 4FBUA 4FW2A 5DG8A 8ICYA 1KFTA 3AO4A 1LW2A 2VG7A 3G10A 4YR2A 5EU7A 4M0AA 4H03B 4HTLA 4DR3K 3IDWA 4CI6A 3T1HK 5DG9A 3TI0A 5IIIA 3C5FA 3KLEA 1JL1A 1R59O 1TKTA 4OCZA 3THWA 2G5HB 4FZXC 3WKEA 2DGZA 1U2VB 3N97B 2O6KA 1TKDA 1BG3A 3HTVA 2A1RA 4I2AA 4YFKA 1KQQA 4KLFA 3KJVA 2GUIA 3DWLA 4BR0A 2A3VA 2O4IA 3V7JA 3V9XA 3NVMA 3OYCA 3IS9A 1IKVA 1UQVA 4ED8A 1VSLA 3ISCA 4A61A 2F8SA 2KZZA 3NTUA 3K5MA 3JS6A 2YCHA 3EEQA 3DOKA 4J9RA 1TVAA 4EFHA 5J2JA 2KICA 3J81O 5C0YA 2CXYA 9ICPA 3BP8A 3PO5A 5J8YA 1OKJA 4B08A 4DB3A 5JUMA 2HHSA 3FZKA 4FLYA 4OJRA 1D5AA 3GG4A 1S9FA 5ALWA 1DEJA 3M8PA 2KIVA 3TR8A 4C8NA 2KKVA 4M6WB 2NO4A 5AQJA 4I2IA 3I1YA 5KL1B 4F4KA 4JV5K 1D8YA 1IBLK 4LF9K 3VTHA 4E1MA 8ICOA 4J03A 4MLHA 3KVGA 1DKGD 3K1ZA 1EXQA 4CEOA 3V81A 4CVNE 2CRXA 5ALTA 1NJZA 3PR5B 3GILA 9ICHA 3RMDA 4BWJA 1KLNA 4CCHA 4ID1A 1VAZA 4N5SA 2LKYA 3HJEA 5FDLA 1XUPO 2LYHA 3F73A 1BHLA 4I28A 3I8BA 3UQ0A 4DQSA 1NOZA 3DRPA 4PQUA 2BE2A 4GIBA 5DQIA 4AM6A 2OCEA 4KLGA 1VQ7N 3O5BA 2VG6A 5J2CA 4H0PA 1HIWA 2IVOA 3D2EB 1OH6A 1K8AO 5BRFA 3CQXA 2E8OA 1HPZA 5GIOA 4MHVA 3VOVA 4GC6A 1KSPA 4DOAA 1ZQJA 4FWRA 3M6ZA 1VLBA 2P51A 5AQZA 3SMSA 3QINA 3QFPA 4C8MA 3V7LA 3THXA 4DFPA 1ZXOA 4CGHA 1HJRA 3UKUB 4B8AB 4AHRA 2ZWHA 2W7PA 3AL0B 2MSNA 1SUQA 3QICA 2G8FA 3MFHA 3QBXA 1U45A 3NF7A 1VQ8N 3TQ1A 2A6AA 2R7YA 3KWGA 1KW4A 4YXJA 2R8JA 4IFVA 5KFEA 5C15A 5AICA 4DL4A 2Q3SA 3FGUA 5TZVA 4BRNA 1WBBA 1LWFA 4QWEA 5AKZA 2H3GX 3DXKA 2HBJA 1QZ6A 5AZIA 3ZI4A 4NL9A 4B9LA 3WT0A 5AFUA 4K25A 5T14A 4CGIA 3MXMA 3NF8A 4PKGA 5IT9O 4A8EA 4NYFA 3MK6A 2F8TA 5AKXA 5KT4A 4BG9A 1JN3A 4CJSA 5HP4A 2QB0A 5J29A 3TACB 2P9NB 3PNCA 4O5CA 4U7CA 5KAFU 1BPXA 3JYTA 4OLBA 4CJ3A 2AGQA 3QETA 1VHXA 7ICRA 4FJLA 2KLAA 3C6HA 2D6FC 4CEFA 3JXUA 1ZBHA 1WSIA 3H0MB 1ZBLA 3PR4A 3PW4A 3CCQN 9ICKA 3FDSA 3C1ZA 1CRXA 4QCLA 2H3ZA 2W9BB 1EO1A 1J97A 3TAPA 2D5RA 5C24A 3DDHA 2LM1A 1E3MA 1RDBA 3EE9A 3DMJA 1T05A 4JAXA 1B22A 2ALZA 3UB5A 2E5LK 1RDDA 1Z00B 3ZDBA 3VQ5A 1PK1B 2OHFA 3RJEA 3B0XA 3WK9A 2HVIA 5AFUH 3SUQA 4FXDA 2WUSA 3T69A 4KLTA 3VQPA 4B1VA 1JALA 1LV5A 2BPFA 4IS7A 3IG8A 3CJAA 3UIQA 3CJ7A 2VJ5A 3QYPA 4RNNA 2P35A 3S3MA 2XY8A 4DTMA 4HCCA 4YG2A 3C28A 4DS4A 4PH5A 1QQCA 5EWEA 3TAEA 2KKZA 5HNKA 4CJ4A 1B4FA 4MDAA 8ICXA 2G07A 1W9HA 1WNSA 3U8XA 1V9PA 1OH8A 2VJ4A 3LVWA 1QSLA 4I2DA 4QZCA 5DBBA 2DPIA 1C6VA 1WSGA 2DQNB 3GOIA 1C20A 1BVSA 5HR6A 4DS5A 1XNSA 2EWSA 4MEXA 2ZG6A 1BU6O 2XY6A 5ADXA 2ZTDA 1LAWA 1CLQA 2W6LA 4DCHA 2OYYA 1SS6A 3AARA 4JWMA 1YAGA 4CJWA 1HYSA 5JVGL 4ILJA 5AQRA 4YD2A 3M9MB 3EO3A 2V52B 3M9OB 1TL1A 4X62K 3SPYA 2G8WA 4RWTA 8ICGA 2VA2A 2PBDA 4QZAA 3LM9A 4DTOA 4FJ8A 4CZMA 3MGIA 3A2FA 3G25A 3V9SA 2O8BA 3L4QA 3ORYA 4CZKA 3ZX3A 5LY3A 1WSEA 5DBCA 3AO3A 3R1XA 1TGOA 1NGEA 4LY7A 1HNWK 4E7IA 3N7RC 5AHXA 1XC3A 3ULEB 3LZJA 5GTIU 1NGJA 3K1RB 1HKBA 3QU5A 2I5HA 4M9NA 3ZEUA 4RW8A 4OX9K 3WKBA 2E8AA 3HJFA 3RH4A 4F3OA 2QW9A 5ADXH 4NLNA 1Z26A 1T3VA 3N4QA 1XHZA 3T79A 3PSTA 1VSHA 2YHXA 4QS9A 4DSEA 4DSFA 3NF9A 2O8EB 3QNMA 8ICPA 3D2FA 4UY8O 2O8FA 2LYAA 8ICJA 3AAQA 2RE2A 4NLZA 4DSJA 5DKWA 2YMPA 4JKGB 3KBBA 3EE8A 1L3TA 4JN4A 7ICPA 3P38A 1U48A 1C0FA 5LJWA 2EAOA 2ZJ8A 3OHBA 3SJHA 1EKEA 4NLCA 3LP2A 4LF7K 2JHDA 3O1BA 5E41A 5AKHA 4CF5A 1NK7A 4CEEA 1RTJA 3ZSVA 4P0QB 4N47A 3KFUF 3VQCA 1HKGA 1JI7A 3AVAA 3NE6A 1HX1A 3O80A 4I2EA 4YR0A 2O8DA 2WF6A 4E3SA 9ICWA 1GOCA 4YR3A 2PMZC 3N4PA 1HKCA 3RWUA 1UA0A 3C2MA 4BGDA 3M8QA 3QUQA 4KLOA 4CBXA 3K5NA 2WF7A 1IO2A 4YMMA 3P39A 3PW2A 4DL7A 2K89A 3MMVA 5C12A 5J2HA 4DU4A 5C25A 2KN7A 4FWOA 1N2XA 4YOUA 2BKEA 1QQOA 4IOCL 4QNLA 4QZ9A 3MEGA 2LHTA 2A1JB 2QWLA 3DJCA 3TTDA 2CGLA 5AQWA 2Q36A 1NK5A 2Y0SF 5KFBA 2R18A 4RQ5A 4JUZA 4CF8A 2OTJN 5J2IA 1TKZA 4CE6A 3MR2A 4DL2A 2D0CA 2BPCA 1RYSA 3H6EA 4F92B 3CRXA 4F9OA 5KFSA 4R64A 3NGDA 1ZQIA 1C0GA 5CWRA 1RT7A 4FS1A 1SWWA 1S77D 1U6ZA 3CPEA 5CY4A 4YOVA 3BS5A 5EXWA 3V9WA 5J2QA 2ITGA 3T19A 3LWLA 1NJXA 4F5PA 2RHKA 4UASA 3AVKA 4Y2QA 4KHUA 2DWQA 1MQ3A 1TUYA 3MDQA 5FPMA 5AK6A 3WXKA 1WAFA 2NUBA 3VA3A 3C21A 3EZ5A 4CHZA 1FIQA 3IG1A 3J80O 1SGGA 3WKAA 1QQMA 4J2AA 4GKKK 4DFMA 3C1YA 4O8KA 5CZ2A 3FE1A 1ZQ1C 3UE5A 3AQEA 2OXOA 3OJSA 1MSWD 1RT2A 5KNIA 2PFPA 4IO8A 3CQ8A 1IBMK 1X6IA 4DQRA 3CCJN 3E0FA 4KLDA 3SLCA 3QIOA 3KLGA 3C2KA 3SI8A 1BPYA 4EX6A 1VQPN 2JZBA 4G1QA 4A5BA 1ZQRA 1R0AA 3VF6A 5ALPA 1SV0C 2RRDA 4IQTA 5EE3A 2C2EA 4CHNA 3THYB 3Q8RB 4IEIA 1RDAA 2DUYA 4F93B 4OKEA 4YOTA 3ZX2A 1Q86O 4LH4A 1NBWA 2LPEA 4JI0K 1L3SA 2ZUBA 3LDAA 4YFUA 4UQGA 3PV8A 1X3MA 2F9WA 4CJ5A 3OW2M 3V4IA 2E8NA 4UB5A 3LYSA 1S6PA 9ICIA 3IMXA 1K8KB 3ZSRA 2MAXA 3NDKA 3WK5A 3DV9A 1TYQB 4OJPA 3A0BU 1CEZA 2GEMA 4CFAA 4RT3A 3N4MB 1ZRNA 5AKIA 3J7YP 1N61A 3O4QA 1BA1A 3VQBA 1WLJA 1H1VA 3QUTA 4QWCA 2J6UA 1GLFO 4HUGA 3V6JA 1SKRA 2QWQA 3MDCA 3PW7A 4I6MA 4CJUA 4M3ZA 3I56N 3RTVA 2VGMA 4DV3K 2C28A 4DUZK 2XIDA 5IIJA 4I2BA 3MN6A 5HL7L 1Q18A 3AVFA 4C7YA 4CGGA 4HTUA 4BRPA 4BRDA 4HWIA 4AM7A 4DOBA 4JMUA 1IJJA 4CFDA 4KKOA 3OYGA 4IXCA 5CB1A 5HRSA 1A76A 1IV8A 4BUGA 4ECSA 4CDGA 5L1MA 5J2EA 4I29A 3SV3A 3MXIA 2WAQC 2YKNA 2AH5A 2ZD1A 3HOTA 3CCMN 2QEXN 1QTMA 4J9NA 1XWLA 1S1XA 4UAWA 1YZ7A 1NK4A 7ICFA 2Z1JA 1TV6A 2Q4TA 4YQWA 3TSQA 4KLJA 3Q7CA 2W40A 3OS2A 4CESA 1RT6A 4CEZA 3T5HA 5ALSA 1ZQCA 1KXPA 2HMXA 5L1LA 3MN7A 1JLBA 2UUAK 1RILA 3M1FA 3O4WA 4JKEA 2KD1A 3O9UA 4KLQA 1T3QA 3B9JA 2VYPA 3EY1A 4GV6A 4QW9A 2IOCA 2UVUA 1JKHA 4Y2XA 3LDNA 4E7LA 5E79U 1PVQA 2WFAA 3H8WA 4L8RB 4C7ZA 8ICBA 3OYNA 3ZCMA 1Z05A 2HHQA 3L3FX 9ICOA 4O3OA 5AQVA 3MDAA 3RJJA 3O08A 3L4PA 3BZCA 5CA7A 3SQ1A 2PI5A 3RBDA 3QO9A 1N8RO 1D8LA 4B9MA 3OA9A 4B8CA 3U6FA 1NLVA 4PL7A 4DV7K 2JWKA 3HT3A 3SD7A 4JV1A 3CCVN 2D0OA 4KMUA 2H5XA 4FPBA 4YORA 4W5QA 1ZD5A 4IEEA 4ECWA 4ZTJA 4YN4A 1S0OA 1JLFA 1VQ4N 4P4PA 4C1NK 3M5RA 3WK8A 2H3QA 2ISOA 2XHBA 1LWEA 5AZJB 4BR5A 2QA4N 2OZSA 1XS9D 1IKWA 2B21A 1K1SA 1TE2A 5KT5A 3RBEA 2QARA 4F5QA 4KTWA 3PIOL 2HOFA 2CH5A 2X6SA 5AQOA 4YDUA 3VETA 4JK8A 5KFJA 3MEDA 3VQQA 4FS2A 3RB0A 2PFQA 1QE1A 4C23A 1HMVA 4EYIB 3RR7A 4IQWA 1XQSC 4JHDB 2KV2A 5M1FA 3VQ4A 4RUCA 4J9OA 2L5YA 4OGCA 3ZT4A 4M3RA 2ZUCA 4JK1A 5KFDA 5AQXA 5JICA 1RT3A 5LJVA 5DQGA 2IC3A 2EH9A 3CFOA 5KT2A 3ZETA 1YITN 3PMNA 3AVIA 1ZQFA 9ICQA 3MABA 2IDOA 3ENHA 4UW9A 4Q45A 3DXMA 1LKYA 3L0QA 4Z4FA 1VSMA 5ALLA 2Y1JA 2KJ8A 4M3XA 3NVKA 3OYKA 4DFKA 1V4SA 3QEVA 2FJ6A 5LL6Z 4N76A 3EW9A 2EAMA 4ZOHC 1QQ7A 3T5KA 1BISA 1RDUA 3O8MA 4JI3K 3NH0A 2FF3B 2V7ZA 4FW1A 1WCLA 2Y9UA 2QTDA 2KEYA 1OVQA 1Z1VA 4LJXA 1IBKK 3RAXA 2G09A 3ZT3A 2ZIWA 2ZM6K 5AKEA 2XO7A 4DFJA 4BC2A 3HSCA 2HNZA 4DL3A 3S3OA 1BCOA 4ILHA 3S41A 4NLBA 3D0PA 4DSIA 3GDXA 1HQUA 1C7YA 5TKWA 4CJVA 1BCMA 4GLXA 2ASPA 4BRGA 2RKIA 1HPMA 4I9QA 4PPXA 1RDCA 4YVZA 4EENA 2C2RA 2QLTA 2EZZA 1UT5A 5BOMA 7ICGA 3C6TA 3LALA 4BC3A 1N32K 5AI6A 4FK4A 3CJCA 2QKQA 2F8LA 3F9KA 5ALVA 1MWMA 1U49A 4CHPA 4DLGA 1RDFA 4IKFA 3HILA 3E1YA 3MGHA 4IJAA 2FSNA 4J9PA 3LVVA 4RG8A 2E1EA 2O8CA 5K14A 2Z1GA 4DV6K 1KN5A 3GL1A 4EEKA 1ZBSA 3P83D 5KG6A 2F76X 2P6RA 4ECQA 5DDYA 2H3IA 4QWAA 1D9DA 2FBVA 4ZHRA 3I0SA 4ED0A 1ED1A 3TFRA 3IP4B 2B6GA 4F5NA 2UVWA 3D6RA 3WEEB 3WXIA 4AQYK 3QEAZ 1WOQA
chains in the Genus database with same CATH topology
4Z6EA 4O5EA 1X2IA 3A0IX 5KFOA 4JEPA 3CCRN 2J6TA 4B9TA 2OTLN 4J8FA 4FO0A 2I9GA 1GLDG 8ICCA 1ZQKA 3E66A 2GUPA 3ATUA 3GFKB 3C6AA 8ICQA 5KFHA 5F9NA 4WQ5A 2HBMA 3FFKB 1EXNA 4DF8A 4FVUA 7ICNA 4JWNA 1W2BM 5JLFA 3ZYYX 5AQFA 3VEZA 8ICEA 3KHYA 5HMMA 4U67L 7ICKA 2YHWA 2FMPA 4F4ZA 4ED2A 3QDKA 4ISEA 4JK9A 4H0TB 4BRAA 4RTFD 3AY9A 3BDPA 2QWPA 3M6GA 2ASDA 3U9DA 4GVEA 1NOMA 2OANA 5CJ7A 2NZTA 2XCAA 5EOZA 3J7ZO 3HI0A 4K42A 3MX2A 1L3UA 3CJ9A 2AP1A 2KZ3A 4UBCA 4DO9A 3HP6A 4WFNL 5E26A 4IRKA 2FPMA 4R63A 3TPQA 2P9UB 4YCXA 4CBUA 3DLLL 4QZEA 5J2FA 2MUTA 4I2FA 3R6MA 1DGKN 1ZQWA 4H0VB 1BPEA 4QZHA 4ED1A 4BQZA 4MDBA 5C10A 1ZQBA 4NXZA 4FWSA 1U2VA 3C65A 2JEGA 3MCAB 5EWFA 3EKSA 1WUAA 5B8HA 5KFUA 1TK8A 1QSSA 4BC4A 4BRHA 3PO4A 3H3NO 3TANA 4QZ8A 4F2RA 3H46O 1YJNN 3BQ2A 3ZDAA 2D4WA 4BGAA 1NK8A 4LZDA 4RPYA 1KRPA 3H1VX 1RYRA 4M6WA 3EPGA 4BWMA 4ECUA 4Q8EA 4J9QA 3PW5A 5BPNA 3MBYA 2FF6A 3HX0A 3C7NB 4RPXA 1NGHA 4GV3A 3B8AX 3I33A 3V7KA 2PAVA 4EHTA 1G99A 2R8HA 5KFIA 3G6XA 3DAWA 4B9NA 1QLNA 3FR0A 1XO1A 4YXMA 3D2EA 3UPQA 3Q8MA 4CZLA 1JIHA 2A3ZA 3EZWA 2BQUA 3A5MC 2FSKA 2BR0A 2KFZA 4BRIA 4XH1A 1ZQTA 4KLSA 1RXVA 3HZ6A 4TUPA 3KHLA 8ICZA 2E2OA 4LC9B 3UKUA 3OSPA 5CR0A 1HJOA 1NGGA 2W9MA 3RJIA 3MN9A 5DLGA 4FOIA 3VEVA 1NK6A 1KD1O 4X5VA 5TKYA 1D4XA 1M90O 4TQSA 5I9EB 4P4OA 2W9AA 1JXEA 2VWBA 4M2YA 5J0SA 3F5TA 3VEOA 3BJYA 1JXLA 5F1XA 4FO6A 2P9NA 2CGJA 1K9MO 4IQVA 1IM4A 2IHMA 3R9PA 1KAYA 3RJGA 3IHQB 4XA5A 4F2SA 1A77A 4CBWA 2IIRA 2W9BA 2PFOA 3MFIA 4QS7A 2XY5A 1GLLO 3OBYA 4ZH4A 4GC7A 2AA4A 5DLFA 1O13A 2NRXA 1Z00A 1KQSM 4O9MA 2NRWA 3CI5A 3R3LA 2HW3A 4M04A 3FZLA 3PLAA 1X9MA 4MLEA 4MO5A 3UQ2A 4EBDA 4I27A 3GQCA 4UBBA 3TSUA 3EWAA 3Q8PB 3AU6A 5J0XA 1GLAG 5KFPA 3T3FA 2HVHA 5KG0A 5KFYA 5MLCQ 1BPBA 2QWNA 3ZDCA 2HHTA 3MR3A 5AQKA 2VANA 4MFFA 4XRHA 1NK9A 4XQ8A 4Z94A 1VQLN 3J8AA 1U9LA 5J0TA 2W8KA 3LDQA 7ICVA 4EIAA 3FZHA 4C8KA 8ICMA 4IJNA 2DPNA 3GE1A 4JV0A 1JCEA 3VGLA 1T6CA 3BQ0A 2ZTEA 5DB6A 3ULEA 3OHAA 4JKCA 4U7BA 2BUPA 2Q1NA 2Q0RA 4YD1A 5ELZA 4YOWA 4QZFA 1L5UA 3A5OC 5BPLA 4H5VA 4M9JA 4FWMA 3RSEB 3V72A 3HOSA 1P90A 4PHTX 1AROP 1RDWX 5KG2A 5D49A 2P9IB 4JKGA 1S0NA 5M1NA 3HPOA 1H38A 3VEYA 3MX5A 2FLNA 2DPJA 4RQ4A 2V4RA 4B9VA 1SL1A 2HHUA 1SQKA 4CD3A 2E1YA 1KFSA 1ZJNA 1KAZA 4ELUA 3E9LA 5DDMA 4F8RA 2V51B 4FOEA 2A1JA 2W9CB 7ICQA 5AQMA 3CD6N 4UAZA 3OHRA 2BCSA 1XC9A 1ZQSA 2C22A 4JD2B 3GBTA 2IVNA 4PKIA 4CZGA 4MEYA 8ICIA 1RXWA 5FPNA 2BQRA 5AR0A 3PX0A 1NKCA 5C2DA 5KFWA 3H4BA 2VA3A 1BPZA 5L1IA 2A41A 3RH5A 2PI4A 1Y88A 4CJ7A 2HHXA 3K75D 3E9PA 2KHOA 1TAQA 1ZQNA 2CH6A 1YF5L 3VMFB 4BRQA 5IIKA 3H8SA 1YVNA 2XGQA 4RQ2A 2XCPA 1S72N 2GELA 3JPTA 9ICCA 4LZGA 4P4MA 4GXJA 3VERA 1K8KA 4P2HA 4PHPA 4QWBA 3RH6A 1TYQA 1NGBA 5BR9A 4E0DA 5DG7A 4YDUC 1NJIO 1BUPA 4O8UA 5AQHA 1ZQGA 2ZF5O 3ID6A 3Q7BA 3UKRB 4CZIA 4NLKA 1ILYA 5EY4A 4RQ7A 5GIPA 4F4XA 5DGAA 3CMAN 3FZMA 5BRDA 1ZQAA 2A42A 3CQYA 1X9SA 2BCQA 7ICMA 4EEYA 2GWSA 4DSKA 1J6ZA 3T5JA 1BDGA 3RAQA 4ED6A 3H4DA 3CJBA 4ELVA 4TUSA 3CCLN 3G4SN 3MN5A 4JKAA 4O0IA 3LDPA 4B1ZA 5C2FA 4QW8A 1ZJMA 5JLHA 4I2JA 4KTQA 8ICAA 1MC8A 4EZ9A 3A5LC 4FWKA 3QB0A 4RQ3A 2GWKA 3B0YA 4KH6A 5BOLA 1WCNA 5GADP 4Z6DA 2IMWP 4I2CA 3C0BA 5KFAA 3KHHA 1MQ2A 2NRZA 4DHYA 3JPOA 1MDUB 1BGXT 1QHAA 2P9PB 5DGBA 2M9NA 5DQHA 4O5KA 2ASOA 2A5XA 4M7XA 1UT8A 2FLPA 4DQPA 3CERA 1NJWA 3P4IA 4BRCA 5J2AA 2CGKA 3E9OA 4FWLA 4K4HA 4O3PA 3CMEN 2Q97A 4B1UB 2P9KB 4EHUA 2AQ4A 5AZJA 2ZGZA 9ICSA 1ZC6A 4TUQA 4RZRA 4WQ5C 4RUAA 3PIPL 2NRTA 4RT2A 3RB6A 1QQNA 4GNIA 2UYTA 1OVYA 3IFRA 4XH4A 2QWRA 3EYZA 4QZIA 4IR1A 2VCPA 4JHDA 3H7IA 4EYHB 1DGSA 1XSPA 4B9SA 4F91B 5J0PA 4YOXA 3JPSA 7ICUA 3VEXA 3VF2A 3U4LA 3T5LA 3EL2A 5J0YA 3H1QA 5GAHP 4WFBL 5DB7A 5AQLA 2QXLA 4FL9A 1S10A 3PMLA 3GIJA 5KQ8A 4B9QA 3ENOA 4B1YB 9ICLA 1YJWN 4BVOA 2I1QA 4RPZA 4R66A 1TAUA 3KZBA 2KZMA 5HHHA 1BWFO 2ASMA 3MCPA 4BRKA 2W8LA 2F1HA 3QFUA 3VEWA 3ZX0A 1LCUA 1SKWA 1S97A 1SAZA 4BRLA 4B9UA 2JWLA 4IWVA 3OJUA 4KN7A 3HM8A 1QVGM 4PHEA 1YXQA 3R8EA 1ZETA 4EAHD 3WEEA 4EZ6A 4G3IA 5L1JA 3KHRA 1NM1A 4BVPA 4DSLA 4R8UB 1VQ5N 4MF2A 2XY7A 1SL2A 3H45C 1MWKA 1ZQZA 9ICXA 3C5GA 2QI2A 4IQUA 4JKHA 1SZPA 2RDJA 4B1WB 3LWMA 1GLJO 1ZQDA 1NGFA 1X9JA 4MF8A 5KFGA 1NGIA 1ZQLA 5GAGP 1ZQYA 4BXOB 5EOYA 5CHIA 3ATVA 5BREA 5KT7A 4KLUA 4BDPA 3C2LA 4BC5A 4RCHA 1SZ2A 3A8YA 4PGXA 5KT3A 5M1KA 4NM1A 3RRHA 2BTFA 5AQUA 4GV9A 5HOOA 2ZTCA 4IRCA 3TARA 1ATSA 2QWOA 3WUHA 4NY8A 2J6SA 4ECRA 4F5RA 4J9SA 2JEIA 3L4IA 3AAPA 4KH5A 2P9UA 4H5WA 5AQYA 3PW0A 4M9LA 2XGPA 3LL3A 4DQIA 5KFRA 3VTIA 3CCSN 2P9LB 8ICKA 2E88A 4M9GA 1Q82O 1DOQA 4A2AA 7ICIA 2BH1A 4I2HA 1W97L 2E2PA 3ZDDA 9ICMA 1S76D 3H3OB 4R65A 1MA9B 8ICSA 1B43A 4FWNA 4JK7A 5DB9A 9ICJA 2P9SB 3C23A 4ISGA 3RB4A 3TU5A 3OSNA 3CC7N 4RQ0A 3RJKA 3PX4A 1Q7YO 3SBGA 1YJ9N 4RNMA 1NGCA 4UB1A 4UB2A 1NGAA 2C2DA 2FSJA 2FMSA 4O3RA 2IA6A 3SK3A 3CF5L 5EX5A 2E2NA 2HHVA 3IUCA 3AU2A 4Q44A 1VQ6N 5KFVA 7ICOA 2ZJQL 3C7NA 1S0VA 4PHDA 4JKDA 5AQNA 4H0OA 4C1NI 3G71N 4BRFA 3VENA 2FPLA 2BQ3A 3IDHA 4K4IA 2BCRA 4H5RA 4O3SA 4AF1A 3T7ZA 5FPEA 4QWDA 8ICVA 9ICNA 3EKUA 3E2EA 4FBTA 2GWJA 4QZGA 9ICVA 7ICHA 4Q43A 9ICEA 4OO1J 4BY9C 2AGPA 1NMDA 2HSTA 3O1WA 5IIOA 3Q8KA 1E4FT 5KQDA 3WQTA 3CXCM 3IKMA 2QWMA 3F9MA 5DM6L 1TUUA 3BF3A 1N56A 4RQ8A 5AQSA 3CCEN 3QMLA 4PKHA 1VQON 4J9MA 7ICJA 5J2BA 1N48A 2V9WA 4RU9A 3O9QA 3QBWA 5J0UA 5DM7L 1XSNA 1Z6RA 5KG3A 3LDOA 4JKFA 4G9ZA 3GIMA 4I2GA 3CETA 4ECTA 3V6HA 2NLXA 1T7PA 3Q8LA 8ICNA 5CR4A 2RDIA 3VESA 1K73O 3BQ1A 5D46A 3DXKB 1V4TA 5FPDA 3W3DA 5AZIB 2Q2RA 4DQQA 2ZUDA 4IFEA 3CHWA 3RRGA 3MWTA 2KFNA 1NKEA 1KTQA 2BCUA 2BGWA 2WBNA 3EN9A 2WFBA 3GIKA 4KLEA 3GV7B 2F1IA 3GV8B 1RPLA 5KFMA 4B1XB 2FLOA 3BUZB 4KH4A 1L3VA 4JNEA 3K4GA 4JV2A 4BR4A 1ZQUA 2V4QA 2FPKA 2Q0UA 2D0PA 1TK0A 4FWPA 4GXIA 5M1PA 2R8IA 2BDPA 4Q8FA 3D7EO 3JPQA 3Q8QB 3LK9A 1EQYA 2I7NA 2R8KA 4H0XB 3TAQA 1DT9A 3OGUA 4BQLA 3WXJA 4TQRA 4YMOA 5KFZA 5C5JA 8ICWA 2HBLA 3ETLA 5H1SQ 1KDHA 4YOYA 4IOXA 1CZAN 4DOCA 4J9KA 5AQTA 1NKBA 2YJFA 1SKSA 4XH5A 1TFRA 3RJFA 8ICHA 5J0QA 3CC2N 1NGDA 3FZFA 3GV5B 5J2GA 3QEBZ 4QS8A 3VF4A 1ESVA 2ASJA 1JX4A 2ZJ5A 2ISPA 2KTQA 4NO7A 3RSEA 2E1ZA 3VGKA 1ZQOA 1U4BA 1IXRA 2P9IA 4O3QA 5KFXA 4R79A 9ICBA 3SYZA 3SAGA 3BF1A 9ICUA 5L1KA 4F5OA 4Z6CA 3FLCO 4NM2A 3ZEUB 5J0WA 2NRHA 4YMNA 5F0XA 4A2BA 4TURA 3RR8A 1E4GT 4BROA 3RJHA 3KWIA 2R8GA 2AQ0A 1D9FA 3D2FB 1VQNN 1YUWA 2WC9A 5JMVA 2ATLA 4PL8A 3WXLA 2W9CA 4IZ9A 3WQUA 5EVZA 5J2DA 4H0YB 1ZQQA 2VA8A 1SL0A 5KPRA 2ZJAA 4C8LA 5F2RA 4JD2A 3QE9Y 1CUKA 9ICRA 2FLLA 3M8RA 1VQ9N 5KTQA 3THVA 3KHGA 1NJYA 5M1QA 5KFLA 3CJ1A 4OPHA 1K1QA 4RQ6A 3O9SA 3K9KA 3MR6A 4J9LA 1Q81O 1ZQHA 2VGNA 1X3NA 1XSLA 4O3NA 3GDQA 5DB8A 1JMSA 3W0LA 1X9WA 4JKBA 4H5TA 7ICSA 4GXKA 2IBKA 4DL5A 1BPDA 3QZ7A 4CZFA 5J0OA 2YJEA 5BPMA 3L6QA 3Q8SB 1JCGA 4ED7A 2Q31A 1VQKN 1LB2B 4BR7A 2V7YA 1T8EA 2AU0A 4MO4A 1ATNA 2Q0ZX 1KC8O 2AGOA 3PY8A 1JCFA 4QZBA 4YP3A 1BO5O 2GX9A 3CC4N 1QZ5A 2JZBB 3ENBA 3UKRA 4KLIA 3UXNA 1GLBG 4E1JA 3QZ8A 2HBKA 4BR2A 2AJQA 3HWTA 4K43A 2OWOA 4FPAA 1P8ZA 9ICTA 1YI2N 5KFNA 2A40A 4PGYA 3O9TA 1HUXA 3SV4A 3PVXA 3ZD9A 2P6UA 4IOAL 3PX6A 1NWKA 3KTQA 2ZJPL 3AUOA 2ZJRL 2NRRA 1TK5A 3WXMB 4I6MB 2UVRA 1VQMN 5D4BA 2QM1A 5GINA 4MFAA 7ICEA 3BQTA 5DBAA 4KLHA 5KG5A 2DFLA 3VPZA 4L3QA 2UVVA 3ZD8A 2BHNA 5CP2A 4DLEA 2YI1A 4QZDA 2YHYA 3RVCA 4UAYA 4BREA 4DWIA 3SZ2A 4HYKA 5HMLA 4XUSA 4F50A 3HRGA 4C8OA 4EBEA 4BRMA 3JPRA 2P9PA 1BOTO 3SMPA 5JVHL 4CD1A 3G6EN 2JEJA 4WQ4C 1COOA 4PGQA 3A5NC 3ISBA 5KFQA 1ZQEA 3IM1A 3V6KA 5KFFA 3EPIA 5E84A 3I55N 4F4YA 3H8JA 3SAFA 2P9KA 1ATRA 1UA1A 4FSVA 5GAEP 1NK0A 3OBWA 1ZYQA 1U47A 3O9RA 3TFSA 2HHWA 3MWPA 1QSYA 4LVSA 1HLUA 1GLEG 5M1OA 1S22A 7ICLA 3ZDEA 4ELTA 1LOTB 4KN4A 2GTDA 4K41A 2BPGA 3M3ZA 4FWQA 3H40A 1RZTA 2HOEA 3O6WA 4WF9L 1Z3EB 4CZHA 4WYBA 4BGBA 3VGMA 4A59A 9ICGA 1HUZA 5CE3A 1RGIA 1PZNA 4ECYA 5KFKA 1ZQXA 3F2KA 3TTFA 3HW8A 2F1JA 4F4WA 4XEIA 3GIIA 3RB3A 9ICAA 3ID8A 3HBTA 4ECZA 4ISFA 2HMPA 3CCUN 4Y0WA 5KG7A 1T4GA 4M63C 3CIPA 3AGRA 4EBCA 1HUOA 5AQIA 3ISDA 1KEJA 3CPWM 2E20A 4MFCA 4DEZA 4A62A 3U9ZA 3ZETB 5L9XA 3TTCA 2FXUA 1RFQA 1KAXA 4A57A 3DXMB 1XU4A 3K9JA 1ZQVA 4KITB 2PXIA 4ILGB 7ICTA 2ASLA 5AQGA 5KPTA 4UB4A 4ECVA 2NRVA 5AQQA 4K4GA 5J0RA 3AGKA 3LM2A 2F7TA 5AQPA 5HHIA 4WCEL 3G6VA 2HF3A 1TV9A 5EWGA 1ZQPA 3UXOA 4CZJA 4R8UA 5BRHA 5IIMA 4WQ4A 3LDLA 2F9TA 5KFCA 4NB4A 4IO9L 4PHAA 4NLGA 4DF4A 2PFUA 3FYHA 2JEFA 1T6DA 8ICTA 4GY2B 4DL6A 4RQ1A 2ZGYA 3G6YA 1KFDA 5IILA 4WFAL 4H5NA 3M9NB 5KG1A 4RNOA 5J2KA 8ICRA 5KPZA 2ITMA 5F9LA 4UB3A 4BXOA 2I7PA 4M7YA 2XC9A 3UXPA 5BPCA 4M9HA 1JJ2M 2WTFA 5IINA 4Z6FA 5KFTA 3JPNA 8ICFA 3M8SA 2Y1IA 3SBTA 3TSPA 4IR9A 1S0MA 2BCVA 2E2QA 2YX6A 1QVFM 4IDHA 4CZEA 3KK7A 2IHNA 5BN9A 3P31A 4IRDA 4BG8A 5KG4A 1T3NA 2IVPA 3NMUA 2J4RA 2FMQA 1HJPA 5KT6A 1BA0A 3SAHA 1GLCG 8ICUA 1T44A 1ZQMA 3MR5A 4ED3A 2P9LA 4KLLA 2NNWA 1Y64A 1M1KO 8ICLA 1YHQN 4DKWA 2PFNA 2W41A 2D1KA 5BN8A 4A5AA 4KBOA 3JPPA 5CHGA 4BR9A 4ECXA 2P9SA 1S3XA 1YIJN 4O5FA 2P66A 4OPAA 1IG8A 4DQ8A 3BEXA 4KLMA 9ICFA 2HF4A 2MUTB 4M47A 4FBUA 5DG8A 8ICYA 1KFTA 4YR2A 4M0AA 4H03B 4HTLA 4CI6A 5DG9A 3TI0A 5IIIA 3C5FA 1R59O 1U2VB 3N97B 1TKDA 1BG3A 3HTVA 4I2AA 4YFKA 4KLFA 3DWLA 4BR0A 3V7JA 3NVMA 4ED8A 3ISCA 4A61A 2KZZA 3NTUA 3JS6A 2YCHA 4J9RA 1TVAA 4EFHA 5J2JA 5C0YA 9ICPA 3BP8A 3PO5A 1OKJA 4DB3A 5JUMA 2HHSA 3FZKA 3GG4A 1S9FA 1DEJA 4C8NA 4M6WB 5AQJA 4I2IA 4F4KA 1D8YA 3VTHA 8ICOA 4MLHA 3KVGA 1DKGD