2NRVA

Crystal structure of the c-terminal half of uvrc
Total Genus 75
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
75
sequence length
218
structure length
218
Chain Sequence
RGLRKEALEELMKLLNMKDFPYRIEGIDISHLQGKYTVASLVVFEDGFPKKGDYRRYKIEQDHPDDYESIRTVVKRRYSKHPLPNLLFVDGGIGQVNAAIEALKEIGKDCPVVGLAKKEETVVFENREIHLPHDHPVLRLLVQIRDETHRFAVSYHRKRREKESLRSVLDNVPGIGPIRKKKLIEHFGSLENIRSASLEEIARVIGSTEIARRVLDIL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords UvrABC system protein C
publication title Structure of the C-terminal half of UvrC reveals an RNase H endonuclease domain with an Argonaute-like catalytic triad.
pubmed doi rcsb
source organism Thermotoga maritima
molecule tags Hydrolase
total genus 75
structure length 218
sequence length 218
chains with identical sequence B
ec nomenclature
pdb deposition date 2006-11-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF08459 UvrC_HhH_N UvrC Helix-hairpin-helix N-terminal
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.20 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 5' to 3' exonuclease, C-terminal subdomain 2nrvA02
3.30.420.340 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Nucleotidyltransferase; domain 5 2nrvA01
2OWOA 4UBCA 3RJIA 1UT8A 3FYHA 4UAWA 3C2KA 4DF4A 2PFPA 1H38A 2PFOA 2W9AA 5KFUA 4IRKA 3RJJA 2HVHA 4QZFA 2J6TA 1AROP 5J0PA 4KLUA 4QZGA 2KN7A 4R65A 3JPPA 3SZ2A 1S0VA 1UT5A 4F5NA 1NJXA 4EBCA 1XSNA 3PR5B 3RBEA 1A77A 3H8WA 3PW4A 2DFLA 1S77D 4DLEA 4B9NA 5IIJA 4DO9A 1ZYQA 2PFNA 4PPXA 4RUAA 4JWNA 2KTQA 3PNCA 3V7KA 3RJEA 3C1ZA 2HHQA 4EBDA 3MR6A 5BOLA 2AU0A 1UA0A 5J2DA 2ZTEA 1ZQFA 4KLLA 3RB3A 2A1JB 3BQ2A 5KG4A 5KFFA 3MGIA 4DL6A 5KFDA 5KFNA 3G6XA 4J9QA 5KT5A 3RJFA 4DFKA 3M9OB 2Q0ZX 4MEXA 4R66A 9ICIA 2R8HA 3ZDDA 1NK5A 4FBUA 4YMMA 8ICAA 4YG2A 5KG5A 4KITB 4ECSA 5J2CA 2XGQA 2VA2A 5KT2A 4J9OA 5KG7A 3PMNA 3HT3A 4Z6EA 5EWFA 5J2FA 2C2RA 3LDAA 4BGDA 1ZQGA 2P66A 3QE9Y 1XS9D 1RXVA 2R8GA 8ICEA 8ICJA 3RB6A 5KFXA 4M9GA 1V9PA 2W9BA 2MUTB 4QZDA 1RPLA 5DKWA 2WTFA 3ZDBA 2HHWA 1L3UA 3UXPA 5J2GA 1SL1A 1U48A 1NK0A 1JMSA 3KHLA 3TI0A 3OSPA 2W9CA 4DOBA 4MF2A 3RJGA 4QZBA 3RTVA 4F50A 3EPIA 4DFMA 4C8MA 5KTQA 8ICYA 2ASDA 1HJPA 2XC9A 1BVSA 1ZQKA 3JPRA 3THVA 8ICHA 2HHUA 1LB2B 1S0NA 5KFRA 5DDYA 1D8LA 4Z6FA 7ICNA 2FPMA 5HMMA 4RQ6A 4BWMA 4F4XA 5HHHA 4JK1A 4ZH4A 4ECZA 4F91B 4TQRA 3SV3A 7ICTA 3TANA 4FS2A 4UB1A 8ICCA 3HPOA 3OHAA 3JPTA 2V4QA 2Y1JA 1RYRA 1L3VA 5DB7A 5DBBA 3GIKA 3H4BA 1TV9A 1MQ2A 9ICQA 2P6RA 4G3IA 9ICPA 4PHEA 4NM2A 1ZQTA 4EZ9A 3GILA 1CEZA 4QWAA 2NRVA 3LK9A 1SKRA 1PZNA 4YD1A 4KLQA 1SKSA 2ZJ5A 4EYHB 3SV4A 5KFWA 3KHHA 5J0TA 4NLKA 1XU4A 4DL3A 1ZETA 1T8EA 3PO4A 3MR5A 2HVIA 4QZAA 4DWIA 2KZ3A 3H7IA 4JWMA 7ICPA 9ICVA 4I2CA 7ICJA 3HWTA 2HW3A 1DGSA 4R8UA 5KG1A 5KFJA 4MFAA 4TUSA 3UQ2A 2BPFA 4YR0A 4M6WA 4ECUA 2V4RA 4MFFA 3EYZA 3C23A 2UVVA 2F1HA 4KN4A 3MGHA 3T3FA 4ELTA 4XRHA 5DDMA 1RZTA 4PGXA 5IIMA 1TVAA 3OSNA 4YN4A 4DQIA 1S0MA 1JX4A 1D9DA 4TUQA 5KFPA 2R8JA 4K4HA 5KFHA 4C8LA 4M9NA 3OJSA 5IIOA 4DL2A 4B9LA 7ICEA 4KLGA 2V9WA 4DOCA 5IIIA 4DEZA 2IMWP 4LZDA 5KFGA 1XWLA 2ZUCA 3B0XA 3NTUA 8ICFA 1UA1A 1NKCA 4I2AA 5D49A 4ECVA 4XA5A 4YFKA 3ISDA 2IHMA 1ZQRA 4YVZA 2XCAA 3ISBA 4Q8FA 2H5XA 4XQ8A 3V6JA 4LZGA 4J9RA 4GLXA 3GV8B 3OGUA 5D4BA 4DFPA 4JV2A 4QZEA 5KG6A 3UXOA 4UAZA 3AUOA 4F8RA 4O3SA 3JPOA 3ZDAA 4F5QA 4DSKA 4XUSA 2BKEA 3ISCA 3PW0A 7ICHA 1WCLA 4YR2A 2LYHA 4F4WA 4ED7A 3Q8MA 4QW8A 3IHQB 3JPSA 3EZ5A 3TFRA 1SKWA 4DSLA 4M04A 1JIHA 3E2EA 4KN7A 4PHAA 1SL2A 4Q43A 1Z00A 1BPYA 2AQ0A 3SYZA 2FPKA 2NRTA 5L1JA 4DL5A 1ZQCA 5J2IA 9ICCA 4BXOA 4F4YA 3V6HA 4FBTA 2UVRA 5KFMA 2ATLA 4I29A 3QZ8A 4EEYA 1ZJNA 1RYSA 2BQ3A 5J0RA 3TQ1A 3BQ0A 3QEBZ 5KFZA 2HHVA 5KFEA 5KFYA 1BPBA 4KLMA 4PHPA 4DSFA 4RQ0A 4DL4A 4FS1A 5J2BA 4IRDA 4RQ1A 9ICMA 1S10A 2W9CB 5KFQA 4QWCA 5DGBA 3RR8A 1KSPA 4DQPA 1NK8A 3Q8SB 4PGYA 5CHGA 5JUMA 3PX0A 4ED2A 4YXJA 2FLLA 2NRZA 2BCSA 3GIJA 1BPDA 3GV7B 4J9NA 8ICVA 4KLJA 2I9GA 1NJYA 3IM1A 3KHGA 2BCVA 5BOMA 1BPXA 4DFJA 4B9TA 1ZQSA 4Z6DA 3MDCA 1ZJMA 1U45A 1D9FA 7ICFA 2ASLA 5DB9A 2BR0A 3V72A 2M9NA 4QWDA 5EWGA 3Q8RB 2KFZA 2BPGA 4RZRA 4ED0A 1NJZA 5IILA 1T4GA 3BJYA 2KZMA 9ICTA 4YXMA 4M9HA 7ICUA 5CJ7A 3RH4A 3MDAA 4NLGA 4DSJA 4BWJA 3TAQA 7ICSA 3RRHA 4K4IA 1ZQWA 1B43A 2R8IA 1ZQLA 2A1JA 4EBEA 5KG3A 4ECXA 3HX0A 4UB3A 1BPZA 2DPJA 1HUZA 7ICOA 2AGOA 3Q8LA 1U4BA 1TK0A 4DQQA 4O3NA 4O5CA 5DBAA 1MC8A 4UAYA 4ED6A 1HUOA 1S76D 1KDHA 1NK4A 4X5VA 5DG8A 5L1IA 4HYKA 4ED3A 4P4OA 4QW9A 3C5GA 3RAXA 1NJWA 1NK6A 1ZQMA 3BDPA 1NOMA 4RPYA 4RPZA 5KFVA 5KFSA 5J29A 3M8SA 4I2EA 2XO7A 1C7YA 2FMPA 4P2HA 3GIMA 3HW8A 4ECWA 3JPQA 1NKEA 2BCRA 4ECYA 3RBDA 1X9WA 2FMQA 1IXRA 4R8UB 3TAPA 4E0DA 1ZQZA 9ICAA 4TQSA 5CB1A 1WCNA 1S97A 2MUTA 2BCQA 2IHNA 2XY7A 3PR4A 1L5UA 4ELVA 2BQUA 2AQ4A 3PO5A 4I2DA 9ICLA 5KT7A 2W8KA 2GWSA 5J2JA 1S0OA 1NKBA 4IQVA 3RH5A 5J2KA 4RQ8A 4QWEA 3RR7A 3LWLA 3AU2A 4JV1A 3HP6A 5BPCA 4ECQA 8ICRA 4DF8A 1X2IA 8ICTA 3ZD8A 4J9MA 2XCPA 1ZQQA 3OHBA 4DQSA 2F1IA 5DGAA 9ICSA 3KHRA 3EW9A 3Q8PB 1ZQHA 5DB8A 4CCHA 4F5RA 2C2DA 5EOZA 2ISPA 4B9VA 9ICOA 2KFNA 8ICSA 1CUKA 1ZQEA 2JZBB 2FMSA 4IRCA 5DBCA 5CP2A 1U49A 3MBYA 5KFTA 2RDIA 5L1LA 4UB2A 8ICOA 2VA3A 2VA8A 5CWRA 3M9NB 4F5OA 5DG9A 4TURA 1KEJA 1L3TA 4B9MA 3B0YA 3ZDEA 4I28A 3OJUA 4K4GA 3UQ0A 5HP4A 2BGWA 3V7JA 7ICLA 3ZD9A 9ICWA 4KLFA 3EPGA 2AJQA 4RNMA 1XO1A 1TAUA 5KFOA 4F2RA 3QZ7A 2P6UA 1T7PA 3M8RA 4R64A 5DB6A 3PW5A 8ICKA 8ICWA 1B22A 1JN3A 4DSEA 4NM1A 4QZ8A 4QZCA 4O9MA 4JV0A 1Z3EB 4GXKA 4GC6A 5J2AA 2BDPA 3RJHA 4DS5A 4IR1A 4QZHA 5HHIA 3Q8QB 1ZQUA 4M9JA 4ED1A 4KLSA 7ICRA 1RXWA 2VANA 4KTQA 4P4MA 3LWMA 4GC7A 2BPCA 3RH6A 8ICGA 4YCXA 3RRGA 7ICIA 4YR3A 1ZQAA 4KLTA 4QZ9A 3C65A 3T5HA 3C2MA 4UB5A 1QSSA 2ZTCA 1N56A 1BPEA 5J0WA 4KLDA 2JEIA 4F4ZA 3TARA 4DOAA 7ICGA 4PHDA 2BHNA 4M9LA 9ICHA 2C22A 9ICUA 4B9UA 2NRRA 4JUZA 2W9BB 3M9MB 3GFKB 2JEFA 2XGPA 4KLIA 2UVUA 2HHSA 3EWAA 9ICXA 4M47A 2W9MA 3MABA 2JEJA 3C21A 4O3OA 5KT3A 1TFRA 4RPXA 5IIKA 3T5KA 3N4MB 1L3SA 3SI8A 3N97B 7ICKA 2PFQA 4EZ6A 5CR0A 4DS4A 4R63A 3MFHA 4IQUA 5KT4A 3RB4A 4ED8A 4QWBA 2PI4A 4C8OA 4Z6CA 8ICLA 5KFAA 2FLPA 4P4PA 4KLHA 3PMLA 4NLZA 4RNOA 3GQCA 4QZIA 1KFTA 4I2HA 4RT2A 5J2EA 3TFSA 1NK9A 1ZQDA 4RQ7A 4F5PA 5HMLA 3KTQA 5CA7A 8ICQA 3GIIA 1XC9A 7ICQA 2I1QA 3C5FA 1JXLA 4MFCA 9ICEA 8ICXA 2PI5A 4KMUA 3K75D 2XY5A 5J0YA 7ICVA 5J0SA 5KG0A 4F2SA 3C1YA 3G6YA 2B21A 9ICFA 5DQGA 3G6VA 3H4DA 1ZQPA 4RU9A 4I2IA 5KT6A 4YMNA 4YMOA 3H8SA 5KFIA 2BCUA 3AU6A 1KLNA 3ZDCA 4F93B 3Q8KA 4MF8A 4UQGA 1ZQBA 2J6UA 4KLOA 2MAXA 4MEYA 3FDSA 4J9PA 4M2YA 2ZTDA 2UVWA 2IBKA 1ZQOA 5F9LA 3PX6A 3JPNA 1S9FA 4TUPA 2R8KA 1X9MA 1KRPA 4YQWA 4PGQA 1K1SA 5J0OA 2PXIA 1SL0A 4M0AA 5KG2A 1ZQJA 4DLGA 2DPIA 4RQ2A 1IM4A 3C2LA 4O5EA 4IQTA 5J0UA 1ZQXA 1TK5A 2C2EA 2JEGA 2ASJA 8ICMA 4M6WB 5EWEA 9ICKA 1K1QA 5C5JA 5DG7A 5HNKA 1ZQYA 4O3QA 4J9SA 2FLNA 4BDPA 1EXNA 3BQTA 2AGPA 4RNNA 4IR9A 5KFKA 4PH5A 4C8NA 4J9LA 4F3OA 4RQ5A 3MFIA 1MSWD 3BQ1A 4EYIB 1TK8A 2ISOA 4B9SA 4O5KA 2HHXA 5J2HA 4ECTA 4Q8EA 2NRWA 5TZVA 5DLFA 3PW7A 3UPQA 5IINA 3ETLA 4Q44A 4O0IA 8ICZA 1SZPA 1BGXT 3RJKA 2IA6A 1KFSA 5KFCA 4YP3A 3MR3A 4DQRA 3RB0A 5L1KA 3PW2A 4IQWA 3V7LA 5KFBA 4I2FA 1TAQA 2C28A 2ZJ8A 2F1JA 1JXEA 3NGDA 4I2BA 9ICGA 1N48A 1COOA 1MQ3A 2W8LA 4RQ4A 3T5JA 3PX4A 1QTMA 1D8YA 3GV5B 8ICUA 3QEAZ 1ZQNA 1QSYA 5DLGA 3V6KA 1ZQIA 1LV5A 5DQIA 1X9SA 1KFDA 5J0XA 2KZZA 4NXZA 5F9NA 1KTQA 3UXNA 1Z00B 2BQRA 8ICBA 1Y88A 2XY6A 3H40A 3GDXA 4ECRA 3PVXA 2AGQA 4F4KA 4O3RA 4BXOB 2J6SA 3H8JA 1QLNA 4LVSA 4RQ3A 2FPLA 5L9XA 4C8KA 5J0QA 1A76A 2ALZA 4ELUA 4O3PA 9ICRA 2RDJA 1U47A 4KLEA 4GXIA 2ZUDA 4F92B 4UBBA 4J9KA 2Y1IA 1T3NA 4I2JA 1QSLA 9ICJA 1NK7A 3ORYA 8ICIA 5KFLA 4NLNA 3RAQA 4RUCA 4YD2A 4RT3A 4I27A 1U9LA 2JZBA 3T5LA 7ICMA 1XSPA 1ZQVA 8ICNA 2HHTA 5D46A 4Q45A 4DL7A 2NRXA 2ZJAA 3PV8A 1TKDA 4I2GA 5DQHA 9ICBA 4DSIA 4GXJA 4NY8A 1DOQA 4FO6A 4UB4A 3PY8A 9ICNA 1XSLA 3MR2A 8ICPA 2ZUBA 3K4GA
chains in the Genus database with same CATH superfamily
4K8XA 1JLCA 3RJIA 4DF4A 4UAWA 4FVUA 2PFOA 4KLUA 3AVLA 3MK6A 3SMVA 4R65A 4N76A 4EBCA 2PAVA 3PR5B 4BR5A 2FF6A 3QNNA 1UOCA 4PPXA 4J2AA 2PFNA 1WNSA 1N8RO 2P9KB 3PNCA 1A6SA 1IBLK 3CHWA 2R7YA 2MU2A 3THXA 4GV9A 5BOLA 3MC1A 4P0PA 3RB3A 2I5JA 2A1JB 3QBXA 3MGIA 3WNHA 1RT3A 4FM0A 4BROA 1NI3A 5AM1A 3RJFA 4LF9K 4MO4A 4Y2TA 4JK7A 5B8HA 3NASA 2G8VA 2R8HA 3A2FA 5HROA 3NDKA 4Y2YA 4CF2A 4YMMA 5JLFA 1SUQA 3GZFA 2AA4A 5KG5A 3KZXA 5J2CA 2XGQA 2DBYA 5KT2A 2VA2A 4H0XB 5HBMA 5J2MA 1SWWA 4OJ6A 3HRDD 2NV3A 3LDAA 1ATNA 3QE9Y 1RXVA 8ICEA 1KAYA 3RB6A 3NVZA 4QZDA 2WTFA 1NGJA 2W7OA 1SL1A 4W5OA 4DQ8A 3KLFA 2K8BB 1GLJO 1HJOA 2ZWHA 2CGJA 2OA8A 3AA4A 1REVA 2WF8A 3HILA 3DRRA 3J81O 2LBOA 5AK6A 5KFRA 3R9PA 1D8LA 2IVOA 4J2BA 2E1YA 4RQ6A 3LANA 2KKVA 2NYVA 2YMQA 3OYLA 3BS7A 3N4PA 3DRPA 2R18A 3HPOA 3OHAA 4U67L 2Y1JA 4I2PA 2OYYA 3QEXA 5AKHA 4PKIA 3O9RA 2HHHK 2O8CB 9ICQA 2VYPA 4E3SA 3RWUA 4PHEA 1QQMA 1J9AA 3Q7BA 1B4FA 1C0GA 3GILA 3C7NB 3H6EA 3L0QA 4ISFA 3SJJA 2ZD1A 3LK9A 4DR1K 1PZNA 3O80A 4CEEA 2HB5A 3S3NA 3AQFA 5HRRA 3IUCA 3SV4A 3AVCA 5KFWA 3FFIA 4BE1A 1QQCA 4M3TA 1T8EA 4FW1A 1YHQN 3PO4A 1QQ6A 4QZAA 1EX4A 3H7IA 3QLHA 1LWFA 4QS9A 4GIBA 5AQFA 3DM2A 4M3XA 7ICJA 3HWTA 2VKQA 4FWLA 1J5EK 5KG1A 4R8UA 4TUSA 3ZYYX 2Q31A 2IOFK 1GLDG 1N36K 3C23A 4ZTFA 4M42A 3VEOA 3SENA 3KLHA 3MGHA 3TSQA 1RT2A 5DDMA 2O8DB 1J97A 5IIMA 2FI1A 1TVAA 1KVAA 2WTUA 2UXBK 4M7XA 4DB3A 1N33K 1YAGA 2ZIVA 1JX4A 4WQ5A 5EE3A 4CIGA 1D9DA 4FWSA 2KVSA 2BGGA 4K4HA 3IAYA 4ZTJA 3IV6A 4C8LA 4M9NA 5AKLA 2NZTA 7ICEA 3V9UA 4FFDA 5IIIA 1HNZK 5TKWA 2RHKA 3ZCMA 2PMZF 3KK1A 3NTUA 5AFUH 2QKQA 4CZGA 3VQQA 1NKCA 3LDSA 3NGZA 3SNNA 4XA5A 2PFUA 1K8AO 1ZQRA 4Q8FA 3ISBA 1MWMA 1NOZA 2BE2A 3EKUA 4C4RA 1Y97A 3GV8B 3MN5A 3ICXA 4JV2A 4PKGA 5CYMA 1IV0A 3AUOA 4F8RA 3JPOA 5JVGL 4F5QA 5AQWA 4CJSA 4AQYK 2KSOA 3PW0A 3OS2A 2I6XA 5GIOA 1U48A 1CXUA 2WAQF 4QW8A 3EZ5A 3THYB 1SKWA 4N56A 2G8HA 1KLMA 1WG8A 1SL2A 3R6MA 1FKPA 4FLUA 3SYZA 5J2QA 4N41A 2NRTA 3QFPA 3N7PD 5FRNA 4KI4A 3V6HA 3SCXA 1XHZA 4IWVA 1RBSA 4BRDA 2V51B 2WFBA 3TR8A 2P9PB 5BR8K 4J8FA 3MXMA 4QCLA 4FJMA 3BQ0A 4NCBA 1RT7A 1QQNA 5KFEA 5EOYA 5KFYA 3L8BA 3RSEA 1BA0A 4YOYA 4PHPA 4DSFA 1DK2A 4YOWA 1OH7A 3VQ4A 3VF4A 5JTIA 4RQ1A 3MGVA 9ICMA 3DEEA 2W9CB 4QWCA 1BWFO 3MEDA 3V9ZA 1G99A 2HMIA 4IOAL 4CGHA 2JRZA 2RE2A 2P9LB 1B0XA 3S6JA 4DMNA 1YJWN 2Y0SC 4ED2A 2FLLA 1KD1O 3HZ6A 1SV5A 3NHGA 3GV7B 3QEVA 2I9GA 3S9HA 1DRGA 2EZYA 3HPHA 5ALFA 3J81j 3V81A 2OANA 2H3ZA 1ZQSA 3IKMA 1D9FA 7ICFA 1HKCA 3V72A 3ZSQA 5AQOA 1NJZA 4CGIA 3KLGA 2CXYA 3BJYA 2BUPA 3H46O 4Y1DA 3CI5A 1IJJA 3CPWM 3MDAA 2FBYA 2JMGA 1NGFA 5KAIU 4DCCA 3TAQA 1JKHA 5GINA 3OYGA 1MDUB 2X74A 4IBNA 2A1JA 1BPZA 2E2QA 3HX0A 3N4QA 2AGOA 1VSKA 4FLXA 1ZD4A 1HYZA 4DQQA 3ATUA 4Z4GA 2HMXA 4BRFA 1O1WA 4PL8A 4X5VA 1NG9A 1KN5A 4ED3A 1NGCA 3F9KA 4QW9A 3C5GA 3W0LA 5KPRA 2LHTA 3ZEUB 4CJ5A 3M8SA 4P2HA 5AJ3K 1C7YA 3HW8A 2A5XA 3EL2A 1KVBA 4FLYA 4E0DA 1ZQZA 2ZG6A 4TQSA 5CB1A 3D7EO 3HPGA 3LP0A 3ZX0A 4B08A 4FZXC 1WN7A 2IHNA 4QNLA 2E8MA 2XY7A 4WFBL 2O6KA 3PR4A 2X6SA 3K2PA 4FWQA 4LFAK 2F7TA 4I2DA 4FK2A 1V4TA 5AI4A 4CZLA 2W8KA 4YOTA 4FJIA 4A62A 4O5BA 2JXJA 3TKAA 1NKBA 4E89A 4IQVA 3RH5A 5J2KA 4RQ8A 3FE1A 3HP6A 5BPCA 3QU2A 3P5JA 1KQQA 4CF5A 4UASA 4K41A 2IVPA 2QA4N 1K6YA 1WSGA 3EW9A 2Q3SA 1ZQHA 5DB8A 1V4SA 3NF6A 1NGAA 4CEQA 1SIJA 2D0BA 1QHAA 3H3NO 1J6ZA 4NB4A 2IAJA 3TTDA 5DBCA 1M1KO 3AVAA 3DJCA 4PHTX 2FSKA 1C0FA 1ZOLA 1RTJA 3CQYA 5L1LA 4UB2A 4FLZA 5CWRA 3M9NB 3TU5A 2O8CA 5ELZA 4TURA 4GV6A 1HKBA 5J1EA 2RLTA 3QFUA 4UB6U 4Y2UA 5BRDA 5HP4A 3N28A 3V7JA 2O8BB 4CHNA 7ICLA 3CCMN 1T44A 2A1RA 4KLFA 3DWLA 5KFOA 4F2RA 3QZ7A 3D2EA 8ICWA 2G8FA 3PW5A 1X9JA 1TE2A 2RN2A 1L7PA 2F3NA 4QZ8A 4IOCL 1SXDA 3CCSN 1GLLO 4FOEA 3RJHA 4DS5A 2ITGA 1J5OA 2OTLN 3VTHA 3OYCA 3MMVA 1O03A 1ZQUA 4IFEA 4EFHA 4PL2A 7ICRA 2I5HA 4IEIA 3KD5E 4BRLA 3VERA 2O8DA 2YHWA 2CH5A 4FLWA 1ZXOA 3I55N 3NMUA 4C4SA 3O4NA 4QZ9A 4A2AA 4MLHA 4BRKA 1HNWK 2AXTU 3UM9A 4CZJA 1S6PA 5J0WA 4OPJA 4DU3A 2PYJA 4LF5K 4DOAA 4M9LA 3M6GA 1SV4A 4Z4IA 2KNJA 4JYAK 1W9HA 2W9BB 4ID1A 3M9MB 3GFKB 3EKSA 3E1YA 2W9MA 5KNIA 3MABA 3ZT1A 5KT3A 2YX6A 4K8ZA 5E84A 1TFRA 4RPXA 3T5KA 1YI2N 4PJ0U 7ICKA 2FBVA 5BR9A 2PFQA 1ZRMA 2GH1A 4DS4A 4R63A 1GLAG 3RB4A 1BA1A 1X6IA 3QUBA 2HI0A 3NVVA 4QWBA 4X62K 3MEEA 4KHPK 4F71A 2ESEA 1P90A 1WOQA 2JHDA 2VGNA 3VA3A 3RMBA 3DLBA 3VQ5A 1C1BA 3TFSA 4DU4A 4FJNA 4JB3A 3HM8A 3KFUF 2W11A 3THYA 3GIIA 3EO3A 3L2UA 3T79A 2E20A 1Z6RA 1JXLA 4MFCA 3OYKA 3D6RA 4BC5A 1S8OA 1NM1A 1YT3A 3K75D 3OYIA 3QIOA 4DV7K 3HJFA 2HNYA 3G6YA 9ICFA 2IC3A 1S5LU 4Y1CA 3G6VA 5C2FA 1Z05A 2P9PA 4YORA 5M1QA 2UXCK 3QU4A 2HOFA 4CEAA 3AAPA 3H8SA 2OEHA 1SB3C 3NRWA 3ZDCA 2QB0A 4KB0A 5L1MA 3WXIA 3PSPA 4KLOA 2MAXA 5EU7A 1RILA 2ODGA 3W3DA 2JWKA 2P9IB 4I6MB 1CZAN 4FWKA 2IBKA 3AVNA 4KHNA 3PX6A 3JPNA 2P9LA 4CBUA 2OH2A 3QU9A 1IKXA 4M0AA 3QEWA 5KG2A 3GE1A 2VWBA 4OCZA 1Z1BA 2AP1A 5J0UA 4YDUC 1ZQXA 3LYSA 4CZIA 3H1VX 2DUYA 2W7PA 2ASJA 1I39A 5GAGP 3DV9A 4IO9L 3T1HK 1K1QA 1NNLA 3BS5A 3LPUA 1LKYB 1DEJA 4RW4A 5H1SQ 4BDPA 3FFKB 4BUGA 2BZFA 1RTDA 4DG1A 4RNNA 4YDUA 2E8NA 5KFKA 4MQ3A 4PH5A 4C8NA 4J9LA 2OPPA 1N5WA 4RQ5A 4F3OA 3UKRB 3MFIA 1QE1A 1XHXA 3R8EA 3BQ1A 1TK8A 1K5OA 4O5KA 1BG3A 4FWNA 3KLEA 4JK8A 3WKCA 4Q8EA 4C1NK 2CH6A 5TZVA 3UPQA 5IINA 1PVPA 3BZCA 4CZHA 4O0IA 8ICZA 3SPZA 3RJKA 4YP3A 3SI6A 3MR3A 2E2NA 1XMQK 3LDOA 3HSCA 1S1UA 2F77X 3UMBA 3CD6N 3V7LA 1GOAA 1JXEA 5AI0A 3QESA 4O44A 9ICGA 4JKEA 2VJ5A 4JI7K 5AQZA 5FPDA 5M1PA 4CBWA 2GUPA 3QUTA 1X3NA 4V19S 2KV2A 5B5EU 1LV5A 5DQIA 2E8PA 3WKEA 4CJRA 3ULEB 1EWQA 5J0XA 1HNIA 1ZBIA 5HR7A 1GLBG 2F2AB 3UXNA 2BQRA 2XY6A 3AVHA 3H40A 3WEEB 1QLNA 3SR6A 4ECRA 1S9EA 4KTWA 3V9XA 4BXOB 4LY7A 5CZ1A 3TTFA 4RQ3A 3L3UA 5J0QA 2ALZA 2XRIA 4O3PA 9ICRA 3CMAN 2Y9UA 2F76X 4KLEA 1WYGA 4J9KA 2Y1IA 4XEIA 1CZBA 3D0PA 4WFNL 8ICIA 2DFFA 3OVNA 4YD2A 4RT3A 4OJRA 4CK2A 3OY9A 1X3MA 3MEGA 1GLCG 4KHWA 2Z7JA 1E3MA 3T5LA 1KAZA 1NMNA 3FGUA 2LKYA 1OH6A 1XSPA 2Q1NA 5EE1A 8ICNA 2HHTA 2XVTA 1M6YA 1TKDA 3J7ZO 3AO2A 4DSIA 4GNIA 3VEWA 5C24A 4NY8A 1RYUA 1EETA 2A1SA 9ICNA 2LPEA 1XSLA 2JR5A 2ZUBA 4KAZA 3IRXA 3JPTA 5BN9A 4OX9K 4CECA 2DTUA 4X66K 4BC2A 2O8BA 2DKZA 4NLBA 3AVBA 3C2KA 2W9AA 5KFUA 1K8KB 1VSLA 4M3RA 4CJ4A 1AROP 3IDWA 5J0PA 1NWKA 3CMEN 2G0AA 1S0VA 4F5NA 2JLEA 4AHRA 2Y9TA 1XSNA 4CEDA 3H8WA 2HOQA 2DFLA 3PW4A 3BP8A 4JI2K 5IIJA 4DO9A 1HQUA 4CGDA 4JI6K 4RUAA 1HLUA 1LOTB 2M0NA 2HHQA 3S3OA 3MR6A 5KPTA 2AU0A 1UA0A 2ZF5O 2E2OA 1T6CA 1ZQFA 4KLLA 4MFBA 5KG4A 5KFFA 4R79A 3QEPA 3L4PA 3L4QA 5FLXO 2G06A 1HMVA 4IG3A 4J9QA 2OCEA 1OVYA 3AO5A 4MEXA 2A1AA 3ZDDA 3FC4A 4AYBF 4O5FA 2OZSA 4I2QA 3KKSA 1U04A 3PMNA 5C42A 4Z6EA 5EWFA 2OHFA 1NMDA 3OYHA 2YMPA 1BNOA 5AQJA 2P66A 4JI0K 8ICJA 1XS9D 4JD2B 4FZZA 2W9BA 5DKWA 3ZDBA 4B3SK 4M3YA 1L3UA 4W5NA 3UXPA 3CJBA 1ZXIA 3SQ1A 4B8AB 2W04A 1ASUA 4BR0A 3NH2A 4MF2A 3M1YA 3RJGA 4Q5VA 4QZBA 1V38A 4OD0A 2G8KA 3AA5X 2KHVA 4DFMA 5CR4A 8ICYA 3C94A 4CD3A 2B5JA 1RT5A 2YHAA 4E7JA 2YJEA 3GBTA 4E7LA 5AKJA 1TL1A 1C0MA 1ZQKA 3JPRA 8ICHA 2YHXA 1LB2B 1S0NA 2NNWA 4CZFA 4NCAA 4DHYA 4RTFD 1VQ4N 3TPQA 2HBLA 3DOKA 2WHEA 5HMMA 4F4XA 5HHHA 4A5AA 1I94K 1DTTA 4ZH4A 3ZX2A 4TQRA 2JGAA 4LF8K 7ICTA 3TANA 3HO1A 3CP8A 4FS2A 1O08A 3VQ9A 4E1JA 2XY8A 4WQ4A 4W5QA 2WB1F 1RTIA 1VQ6N 3VQAA 1L3VA 3RVCA 2YJFA 4JRQA 5DB7A 2ZJPL 3GIKA 3VOVA 5AKIA 1TV9A 4HTLA 1VLBA 2P6RA 4Z4HA 2QKBA 3KVGA 1ZQTA 4EZ9A 3U3YA 4JV5K 4DUZK 4QWAA 4BGBA 1SKRA 3T7ZA 3VF2A 3KBBA 3NVMA 1M90O 2D8CA 4CI6A 4FW2A 3SK3A 2ZJ5A 3U26A 3VEVA 2ASPA 5E79U 3KHHA 2YNGA 5AQGA 4A59A 2F9TA 2DFEA 4BRPA 5ALEA 4I6MA 1T05A 3MR5A 2HDOA 4DWIA 1HX1A 5AKKA 3SUPA 4Q0BA 1LAWA 1TUUA 1JLEA 5MLCQ 2ASMA 1N5YA 1RG6A 5D3GA 1KVCA 2BPFA 4FXDA 4JKGB 3E0FA 4NL9A 4ECUA 1BDGA 4K0KK 3G6EN 2F1HA 4Y2PA 1WAJA 4C23A 1LKYA 1ZRNA 1SS6A 2E5SA 3M3ZA 4C0ZA 3OBYA 1LWCA 4EP5A 3ID8A 1WWVA 3OSNA 4DQIA 2A3ZA 1HJRA 1S0MA 2HF4A 2RKIA 4EIAA 2F8TA 3UKRA 4TUQA 3ZSRA 4OKJA 4FPAA 5DM6L 3ENOA 5IIOA 5AQRA 4DL2A 4KLGA 2ZIUB 1OXJA 4DOCA 4DEZA 2IMWP 1EXQA 2CGKA 4H5TA 2W55A 1UA1A 3K5LA 2O8EA 1KXPA 3E9LA 3M7DA 4ECVA 4OJLA 4YFKA 3ISDA 2IHMA 2KIWA 3HM9A 4YVZA 2H5XA 3H3OB 1GOBA 4JNEA 4NYFA 3OGUA 4DTRA 2Q0RA 4BRGA 2YMMA 3SEIA 3LVVA 4H0PA 2KKPA 1ECWA 5HR6A 4ISEA 3N7RC 2LYHA 3DDHA 5JRTA 4YR2A 4M04A 3IHQB 5JU5A 4DSLA 1RFQA 3ULEA 1VSMA 3PSFA 3DXMB 3AVGA 4PHAA 3O9SA 5J2PA 4DTOA 2AQ0A 3WEEA 1VRTA 3WNFA 4UY8O 1ZQCA 5J2IA 2F96A 4BXOA 4OJOA 3HL8A 3O5BA 5LMNK 4IXCA 5KFMA 4CHQA 4EEYA 3CM5A 5BRHA 3SUQA 2QKKA 4MLEA 3V9SA 1ZJNA 2BQ3A 5J0RA 1PVRA 3CFPA 1Q86O 2HHVA 4CD1A 2YY6A 4FL9A 4CBXA 4KLMA 4QAGA 4ISGA 1W0HA 3P83D 4IFVA 1BQMA 3LAMA 4FS1A 1KW4A 5AIAA 5J2BA 1NGIA 1NGBA 4B8CA 5DGBA 3IG5A 1YF5L 1W97L 2KE7A 1NJIO 1Q3VA 1TKXA 3NFAA 4KMOB 2BCSA 3GIJA 1N34K 4G9ZA 2D0AA 5KRSA 4PA1A 4JS5A 1NOYA 1EP4A 8ICVA 1XNQK 4M3WA 1TL3A 3CM6A 3VEZA 5BOMA 1BPXA 3VF6A 4B9TA 4RQNA 4Z6DA 2KHQA 1ZJMA 4O0JA 4OKKA 2ASLA 2BR0A 4CK3A 3I0RA 2BPGA 2P9SA 4PKHA 5IILA 3ZSZA 3NCIA 5GTIU 2LSNA 4DTNA 2Q4TA 1ZBLA 5ALPA 5EE0A 2KZMA 1HKGA 7ICUA 4M9HA 4WF9L 2KJ5A 5CJ7A 3RH4A 1VSHA 3B9JA 3AVJA 1RDFA 4GV3A 1N2XA 1IIPA 4FJ5A 4GVEA 2WOMA 5ALKA 3WKAA 3RRHA 3SQIA 2ZIXB 2R8IA 4AHCA 5AM5A 4Z4CA 4EBEA 3DLKA 3CCQN 1JALA 1TK0A 4AM6A 3WK6A 4O3NA 3T1AA 4HCCA 1MC8A 3BGRA 1RBVA 3CJCA 4EAHD 5L1IA 4HYKA 4US8A 1NJWA 1ZQMA 3VGLA 1NOMA 2L5YA 5J29A 5KFSA 4LF7K 1VSFA 3LL3A 5GAHP 4ECWA 4CJTA 3A0BU 4BDZA 1NKEA 1TGOA 4ECYA 1X9WA 2OM6A 2FMQA 4JD2A 4CERA 9ICAA 4BY9C 3O1BA 3THWB 5FPMA 4CF3A 1NGDA 1EKEA 1XC3A 1SZHA 4JI1K 4BC4A 1FFVA 4YOVA 1E4GT 5BREA 3QETA 1SXEA 4K43A 4C4TA 4E1MA 3NBPA 3OBWA 3L6QA 1Q9YA 1EQYA 3ZI4A 4J9MA 1ZQQA 2I7NA 4WQ5C 1IV8A 1X42A 3FAHA 4CE6A 5DGAA 1HNVA 3BF1A 1RDBA 2KVCA 1SWVA 1X6JA 5EOZA 2ISPA 2F9WA 3P31A 3OYJA 4Y0WA 2RF2A 1ZQEA 2FMSA 4IRCA 2JWLA 3B6PA 1D5AA 2DFHA 2XHBA 2RDIA 1P7DA 1RDDA 2OPRA 2VA3A 1FW6A 5ALQA 2VA8A 3D6JA 5ALVA 3B0YA 3Q7CA 4DTPA 3OJUA 3D2FB 1FFUA 4YY3K 1VSEA 2QWQA 3ZD9A 5ALOA 5EXWA 1EO1A 1TAUA 2ZGZA 3HOTA 5AKGA 3E58A 4H8KA 1YJ9N 3EY1A 3TAEA 1YTUA 1B22A 5AQUA 1JN3A 1ZBUA 2EZXA 2QW9A 3O1WA 3SLCA 4B3RK 3OW2M 1OUQA 3ENHA 4JV0A 1Z3EB 4BACA 3JXUA 5ALYA 4IR1A 2ASOA 4JKGA 4EP4A 3LP2A 3CRXA 4M9JA 3OTOK 1F0MA 2F44A 5AKXA 4KLSA 3SAFA 1RXWA 4W5RA 3OYBA 2UU9K 4JAXA 3V1OA 3WT0A 1HYVA 3IDHA 3U4LA 3M5RA 4DV0K 5A2QO 4YCXA 4EX7A 2ETJA 4XIUA 4IJNA 3RRGA 7ICIA 1ZQAA 3T5HA 3DLLL 1XNSA 4UB5A 3F2KA 2ZTCA 2JV3A 1BPEA 1RQNA 4KLDA 4A61A 4F4ZA 4FSVA 4A8EA 4F72A 4PHDA 4OKEA 1VQON 4HCBA 3AQEA 1YTAA 1VQ9N 2NRRA 4OLAA 1WUAA 2RQ5A 2JEFA 9ICXA 4H5NA 2HHSA 1NBWA 1WBDA 3EWAA 4LD0A 3K59A 1U6ZA 1WWUA 1L3SA 3SI8A 2LYAA 5CR0A 2XIDA 3MFHA 5AZJB 4IQUA 5KT4A 4DV5K 1DT9A 5AQIA 3VC8A 3H1QA 4C8OA 1ZC6A 4E1NA 4PUOA 8ICLA 2YB4A 3CW2C 1ZBHA 4IOXA 4BG8A 3PMLA 4CF8A 2F4VK 4NLCA 4QZIA 4CFAA 1CXQA 3CJ9A 1NK9A 3BQ7A 2E6MA 4F5PA 1DXSA 1H1VA 5AR0A 3VN5A 1WBBA 7ICQA 2I1QA 2IOCA 5C12A 4L8RB 1F21A 3BF3A 4U7BA 1YUWA 2PI5A 4CJEA 2X6NA 2D1KA 5J0SA 5KG0A 3C1YA 2P9KA 3OHRA 5DK5A 3HKZF 5DQGA 3H4DA 4HTUA 1YXQA 2Q0UA 3S41A 3NVWA 4RU9A 1UPHA 2IOFA 4I2IA 3QO9A 4ILGB 3BEXA 3PLAA 1NGEA 5BRFA 2BCUA 2EX3A 3CQXA 2Z1GA 2RRDA 4F93B 3Q8KA 3WK4A 2J6UA 3D45A 3KKAA 2Q97A 3FDSA 4J9PA 3MDQA 3O9UA 3K5MA 5JS2A 3CJAA 3QU7A 1IG6A 5CYQA 4TUPA 1N6QA 2VIXA 4EELA 2LM1A 4YQWA 2W43A 1X9MA 1SL0A 5AI5A 2DPIA 4RQ2A 4N47A 3TWHA 2NO4A 1RM6C 3IG1A 4OGCA 4CFBA 4M6WB 2QLTA 1RGIA 5ADXH 5ALZA 2DF4B 3KK7A 2FLNA 2YNFA 4DTMA 4B3OA 4C7ZA 4ZHRA 2A42A 1QZ5A 4IR9A 1NZBA 4CJUA 4R5PA 4B3MK 4M41A 4B1YB 3HI0A 4KH6A 4NV0A 4CJ7A 4CK1A 2NRWA 4DR2K 1UQVA 2OXOA 2ZIXA 1SZPA 1BGXT 2QEXN 3L3FX 1KFSA 2NLXA 5KFCA 1VQNN 4IQWA 4CHYA 4I2FA 3DLGA 2K4EA 1XUPO 2PBDA 3WNGA 3WUHA 4B1WB 1N48A 2FJ6A 1A0PA 5AK3A 1COOA 1MQ3A 3ZLJA 2ES6A 3L3VA 2GX9A 3C7NA 3PX4A 1RT1A 1D8YA 3GV5B 4WFAL 8ICUA 3PSIA 1QSYA 4CGJA 3K9KA 5FRMA 2DL0A 3NS1A 4FLTA 3THWA 1KFDA 3DLHA 3UMCA 5SWMA 4C1NI 2KZZA 4CZKA 1T6DA 5F9NA 3DOLA 1Z00B 8ICBA 1JLAA 5LJVA 3GDXA 1VDVA 4F4KA 5IT9O 2J6SA 5AM4A 2HBKA 3VMFB 5F3XB 5L9XA 3WK5A 3NAEA 2Q36A 3QXGA 4NYNA 1U47A 3ISNC 4GXIA 1GLFO 4XH4A 1QVGM 4IKFA 2KG5A 3NF9A 1C0UA 3ZSXA 1NK7A 5LY3A 3RAQA 1N63A 4RUCA 4I27A 3CIPA 1U9LA 2WBNA 4KV8A 5BPLA 3ED5A 4O8KA 1B9DA 1L8OA 1HIWA 2HBMA 7ICMA 2QWPA 3I33A 5KRTA 4RWTA 4Q45A 3KJVA 1N32K 2NRXA 2YN4A 2ZJAA 5ALDA 1JL1A 5KQ8A 1DOQA 4H5WA 3K57A 3MR2A 2PMZC 1SV0A 4EENA 3K4GA 4DV4K 3KD1E 1UT8A 3FYHA 4FJ7A 4IRKA 2PZSA 3RJJA 4QZFA 3NF8A 2Z1HA 2K8AA 5KI6A 4CJKA 5J2NA 2XI9A 3O6WA 1NJXA 3F5TA 3RBEA 1A77A 3WXMB 5CEHA 1TKTA 1S77D 4B9NA 2KTQA 3AL0B 1UCVA 4FK0A 4JWNA 3AMZA 3J80O 3C95A 4B1ZA 4FZMA 5J2DA 2WAQC 4G1QA 2E8AA 2XICA 3BQ2A 4K25A 5GADP 2VQEK 3LPTA 5KFDA 5KFNA 3O3GA 3O08A 3M9OB 9ICIA 4R66A 3PSTA 4CF1A 8ICAA 4KITB 4ECSA 4JK9A 5BPNA 3U6FA 1F5SA 4KX3A 5KG7A 4HWIA 4EEKA 2C2RA 1Q8IA 3FLCO 1ZQGA 1NU0A 1RCHA 2R8GA 4Z94A 4BX9C 3QUCA 5KFXA 2EDUA 1KL9A 1V9PA 4M9GA 1BISA 4I9LA 2HHWA 2E88A 3FR0A 3RMCA 4FJXA 2ZE2A 3ID6A 1N60A 1JMSA 3KHLA 2W3RA 3T1YK 3OSPA 2W9CA 3E01A 5AQKA 2GUIA 5BPMA 3OS1A 1CZ9A 5AZJA 1W7AA 3RTVA 1Q18A 2VCPA 3I56N 1ZQ1C 2ZGYA 1HJPA 2QTDA 2XC9A 3THVA 1RTHA 3DLRA 4QIWF 1J2NA 4Z6FA 4LH4A 4CHPA 4F3TA 2RPIA 4Y2JA 5AQSA 5AI6A 4JK1A 4HUFA 4F91B 2EAMA 4RW6A 2KW4A 4J03A 3SQ4A 2KJ9A 2V4QA 1RYRA 1L6NA 1IH7A 4U7CA 3VQ8A 5DBBA 1MN8A 2EZZA 3CJ7A 3EE8A 3MCAB 1MQ2A 4B1VA 3VA0A 1BO5O 1JLFA 2H3GX 2YB1A 2BTFA 5A0LA 1SAZA 2B6AA 5AI9A 4TSXA 3O9QA 4OO1J 2NRVA 2ZQBA 4BC3A 4YD1A 2I7PA 4UB8U 3RMDA 1S3XA 4EYHB 4CHZA 4IG0A 3MN6A 5M1FA 3SUOA 1QQ7A 5J0TA 4NLKA 2MSNA 3PIOL 4DL3A 1ZETA 4CF9A 2WF7A 3ZEUA 1ATRA 2W41A 3PZPA 4JWMA 7ICPA 9ICVA 3A8YA 4IS7A 4I2CA 3MCPA 3R1XA 2YV0X 4FJKA 1JL2A 5KFJA 5F2RA 4MFAA 3VEYA 4BR2A 4YR0A 4M6WA 4JI8K 2V4RA 2AHOB 2EQYA 3EYZA 4ICLA 5LMUK 1URJA 1LWEA 4AH9A 4GFJA 4ELTA 4KHQA 2CPRA 4XRHA 1NZPA 4O3MA 2G09A 4YN4A 1O13A 5KFPA 3O3HA 3C6UA 2R8JA 3SD7A 5CHIA 3J7YP 4DR4K 5KQDA 2O4IA 3L5KA 3OJSA 4B9LA 1FIQA 2HF3A 1L7NA 4US9A 3HRGA 4LZDA 4H0YB 1VQKN 4FJHA 1HYSA 1T3VA 4DTUA 8ICFA 1Z19A 2HNDA 4CJVA 3SQ2A 4UAUA 4JKCA 4O55A 4I2AA 3G10A 1VQ8N 1J2MA 2EHGA 1Z1VA 1QZ6A 3DLEA 4XQ8A 4Z0UA 1WSJA 1ASVA 2B4JA 3P4IA 4NWIA 5ALJA 3MX2A 4QZEA 1S6QA 3UXOA 4UAZA 3HYFA 4X65K 3LZJA 2E8OA 3HP9A 3QEIA 3VGMA 4DSKA 4OJ5A 2BKEA 3HTVA 3WK9A 4NCGA 2HOIA 4ED7A 4K42A 2YNHA 3ZSVA 3JPSA 4PL7A 5AICA 1JIHA 1RBUA 4DTJA 1BPYA 1Z4NA 1Z00A 3C0BA 5GAEP 2FPKA 9ICCA 1E4FT 4F4YA 2OPSA 3KIOA 1Z26A 1L7OA 3A0HU 2UVRA 1L8LA 4I29A 2RP5A 1TVRA 2W40A 3KLIA 2DQNB 5AQNA 3B8AX 1RYSA 3WQTA 5FP0A 5KFZA 1WLJA 4KFBA 1BPBA 2P51A 4DTSA 3OPXA 3A5LC 1D8BA 1VQ7N 5GTHU 3AV9A 3VQDA 4FM2A 4BREA 4IRDA 3MECA 1I3AA 2WFAA 4CFDA 3RR8A 5AQVA 3QX7A 1KSPA 3M8PA 4DR7K 1NK8A 3F2BA 1HUXA 2DY4A 4PGYA 5CHGA 2VWJA 3TAFA 2NRZA 1BPDA 5JLHA 3ZETB 2DKXA 1WSFA 3GDQA 4BVPA 2BCVA 3ENBA 4DFJA 4AHSA 2ZXIA 4BR7A 1U45A 4UAVA 2M9NA 2KFZA 1IBMK 4RZRA 5BN8A 1T4GA 2W6LA 2W3SA 5KGWA 9ICTA 1CRXA 3ZSOA 1FEZA 4NLGA 4JI3K 4WQ4C 5ALSA 7ICSA 5FROA 4NXMK 4I9QA 4KRFA 2O8FB 1B43A 4C7YA 3F2CA 1ZQLA 1U2VB 4ECXA 5KG3A 1P8ZA 5AM3A 4UB3A 7ICOA 1HUZA 2G08A 4LF6K 1XO0A 3Q8LA 1Q7YO 5AKEA 4FZYA 4O5CA 3IP4B 4UAYA 1HUOA 3RAXA 1PUZA 4YOXA 3K5NA 3BDPA 2FF3B 4RPZA 5ALNA 1VQMN 5KFVA 4I2EA 2QM1A 1ZD3A 2XO7A 2FMPA 3WXKA 3P39A 3JPQA 2BCRA 2LMRA 5E26A 3RBDA 5TKYA 3NE6A 3AM9A 1IXRA 1MA7A 4R8UB 3TAPA 3KWGA 4IDKA 2V7ZA 3D2QA 4FJLA 4IJAA 3S3MA 2VJ4A 1N62A 2QWNA 1L5UA 4JLHA 1YJNN 1XQSC 2BQUA 1ZD5A 2AQ4A 3PO5A 5TISU 3V4IA 4NL9C 3IN5A 9ICLA 2P9IA 1Q9XA 3LDNA 4GY2B 2AH5A 4IFYA 4H5VA 5AK5A 4JI4K 1Q81O 2ZIVB 3G25A 3WK8A 3RR7A 3LWLA 3AU2A 3LP3A 4KTZA 1X2IA 4CEBA 4DTXA 4DR6K 2XCPA 3SMSA 3OHBA 4DQSA 4CRXA 1WUDA 2GO7A 3KHRA 4FJ9A 2BDUA 3Q8PB 3DI6A 4BE0A 5T7BA 4B9VA 3TADA 3AO4A 1BL3A 3C29A 2G07A 1S1WA 2FLOA 2H3IA 3NF7A 4FOIA 2JZBB 5CP2A 4BR9A 3MBYA 5KFTA 3U3GA 1GOCA 4UATA 4KBOA 4F5OA 5DG9A 1KEJA 3OS0A 2D5RA 1ASWA 1S1TA 1UAXA 3ZDEA 2FXUA 1MU2A 3OYFA 4JHDB 3GL1A 1JI7A 2KSOB 3VETA 5CE3A 2H3VA 2CN1A 3E66A 4ILJA 3U9DA 2AJQA 3LP1A 2P6UA 1HRHA 4FPBA 3ZSWA 3MAQA 1T7PA 4QOZB 4R64A 8ICKA 5E41A 5K14A 4DSEA 3A5NC 3CG7A 2VG7A 4AHTA 3K58A 4QZCA 3R9KA 4GXKA 1PK1B 5C25A 5J2AA 2BDPA 3EZWA 4CE9A 2HMPA 4QZHA 5HHIA 1Q8KA 4AP9A 3Q8QB 1YVUA 2LYBA 3RSEB 4ED1A 2OZMA 4NO7A 3BUZB 4JKAA 4EX6A 2VANA 2FDRA 4FLVA 4KTQA 4P4MA 3LWMA 3CPEA 3TTCA 3JYTA 2BPCA 3RH6A 3VQCA 8ICGA 3WQUA 2QI2A 4YR3A 4KLTA 5EVZA 2F8LA 3C2MA 5J8YA 3I28A 2Y0SF 1QSSA 2GOLA 1N56A 4JEPA 3ZSYA 1HEKA 2QB1A 4B1XB 3TARA 4PY5A 7ICGA 2BHNA 3CNHA 3L2RA 9ICUA 4B9UA 1VAZA 4JUZA 4DUYK 4PL1A 4KLIA 4YOUA 2XGPA 2GEMA 4M47A 1JRPA 3GU3A 1A5WA 4O3OA 4A2BA 3LAKA 5IIKA 3N4MB 2IOHA 1BNPA 4EZ6A 1IG9A 1VJ5A 4FJ8A 4AHVA 4CIFA 1A5XA 2KOBA 3O9TA 4L3QA 4P4PA 1LCUA 1QS4A 3GQCA 1KFTA 3KOOA 1LAVA 4RT2A 1ZQDA 4CGFA 4LH5A 4CJLA 4RQ7A 5HMLA 5CA7A 1XC9A 1YITN 2OTJN 3QU5A 1DTQA 1K8KA 4KI6A 1RQLA 2ZIWB 2F8KA 4YHHK 1R59O 3I8BA 8ICXA 7ICVA 4CF4A 3HBTA 4BGAA 1QH9A 4CZMA 3ZX3A 2WF6A 2OPQA 2B21A 1RDWX 5HP1A 3T19A 4YNQA 3CCLN 2F8SA 2YNIA 4CJPA 4YMNA 2QXLA 4YMOA 3FZHA 5KFIA 3AU6A 2D6FC 4Z4EA 4UQGA 3F9MA 4H0VB 1JROA 4WCEL 4AYBC 1C20A 2HBJA 3ZT2A 1FK9A 2QWMA 4RG8A 2UVWA 2FSJA 3F73A 4Y2RA 3F53A 3SAHA 3ITHA 1C1CA 3ZT0A 2R8KA 1KRPA 2PXIA 1K1SA 4CEZA 1Q3UA 1YZ7A 2FSNA 4M63C 4DLGA 3CC2N 3ZETA 2G5IB 1IM4A 3CCVN 4IQTA 3VQBA 2RHFA 2C2EA 8ICMA 3L2WA 3T69A 1FJGK 1FXXA 3H08A 1ILYA 2EAOA 3IFRA 5C5JA 5DG7A 4DV6K 3WK7A 1PVQA 1VSJA 1ZQYA 4O3QA 4J9SA 2D0PA 3AO1A 3BQTA 3FZFA 3MN9A 5M1NA 1IO2A 4JKHA 2KJ8A 4CJWA 2P9UB 2K4IA 1MSWD 1T03A 3M6ZA 2ISOA 4B9SA 5SZTA 2HHXA 1X40A 3O4WA 5J2HA 2E1EA 5KAFU 1XNRK 4FE3A 2O8FA 1N61A 5I3UA 4I7FA 2EH9A 3ETLA 1U2VA 3CCUN 1NNEA 3F2DA 1HPMA 4HUEA 1DGKN 2PYLA 2QWLA 2E3TA 4DQRA 3RB0A 1NGGA 5AFUA 1SZ2A 4WYBA 4PZOA 3PW2A 3DXKB 1BU6O 2WB1C 3K9JA 1TAQA 5KL8B 3D2EB 2ZJ8A 3C6HA 5CY4A 1HQEA 4OJPA 2V52B 3FZMA 3I0SA 2LM4A 5FPEA 1PK3A 3SBGA 2W8LA 4RQ4A 5AM2A 1QTMA 3QEAZ 1ZQNA 4E7KA 4LFBK 5DLGA 3V6KA 3LDPA 4RW9A 4Z4FA 4BVOA 2GWKA 5ALGA 1X9SA 3OYAA 4KKOA 3I1YA 1BIZA 4GMJB 4CF0A 2W03A 1VQPN 1TKZA 3JS6A 1SGGA 3MWPA 2AGQA 1V97A 4O3RA 4HAIA 4CJFA 2KHOA 4MDAA 3WXLA 4LC9B 4C8KA 3K1RB 1A76A 2LI6A 4H5RA 4MDBA 4RW7A 3L2VA 2P5OA 4FK4A 2DWQA 2RDJA 1JCEA 2ZUDA 5JVHL 2WONA 1Y64A 1T3NA 5ALTA 5K4LA 3M6KA 3MX5A 2VGMA 5AQYA 4A57A 2IS3A 1S1XA 2K4HA 3J8AA 3ATVA 4NLNA 3AGRA 4IL6U 2D0CA 5AQPA 2G8IA 2K8CB 3O4QA 4M7YA 2JZBA 3QBWA 3U9ZA 3VENA 4H4OA 1Q46A 5AI8A 1ZQVA 3CCJN 5H2FU 4QS7A 3CF5L 4LF4K 2P35A 2IIRA 5DM7L 2KEYA 4JN4A 4OLBA 3BY5A 1FO4A 4I2GA 9ICBA 3IMXA 2GWJA 1TYQB 4IO8A 4UB4A 2ZIUA 2P1JA 4JHDA 1KQSM 3VQPA 4X64K 2OWOA 4UBCA 3QMLA 3CCEN 2UYTA 2PFPA 3AN1A 2BANA 1H38A 5ALRA 3ULDA 2HVHA 4GW6A 3HVTA 2J6TA 3L2QA 2FC0A 3TABA 4PZNA 4QZGA 2KN7A 3JPPA 3SZ2A 4J2DA 1UT5A 4Y2VA 3WKBA 3AVMA 5F0XA 2KP7A 3F5EA 2ITMA 1ITGA 4DLEA 3MWTA 1ZYQA 3UMGA 3EN9A 3A5MC 1TAMA 3V7KA 3C28A 2GLEA 3C1ZA 3RJEA 1PK1A 4EBDA 1S1VA 4RCHA 2D0OA 3ALYA 4JKFA 1W2BM 2ZTEA 2D4WA 4DL6A 5CZ2A 3QDKA 4GKJK 2QB0B 1IG8A 3I8DA 2K60A 3G6XA 3SAGA 5KT5A 3DXMA 4DFKA 2Q0ZX 1NK5A 4FBUA 1BI4B 4YG2A 2JH7A 4Y2XA 1COKA 3IG8A 3N7SC 3KD3A 3KKAC 4RQMA 3A5OC 4J9OA 3ASMA 3VESA 3HT3A 4G9BA 4KX5A 3K5OA 1NLVA 4CDGA 1B92A 5J2FA 4ACOA 4BGDA 3UIQA 3NUQA 4LSLA 3TSPA 3C6AA 2MUTB 5AKYA 1RPLA 4NJ8A 5ADXA 1RBTA 3BS5B 4HHTA 3KK3A 5J2GA 3AVIA 4ILHA 3K0SA 4M3ZA 5ALWA 1NK0A 4CGGA 3TI0A 4CHOA 4KH4A 5LL6Z 4DOBA 1QVFM 2Z1IA 3QICA 3CCRN 4O8UA 3MXIA 3QNMA 5HLFA 4F50A 3EPIA 1JXBA 4C8MA 5KTQA 2ASDA 1ED1A 3P38A 1BVSA 2HHUA 3AA3A 4AHUA 5JMVA 5DDYA 2NUBA 7ICNA 4QS8A 2FPMA 4H0OA 1VSDA 1WB9A 4BWMA 3ALRA 4AF1A 2P5GA 4ECZA 3SV3A 4BRCA 2E1FA 3CYMA 4FWPA 5ALIA 2ZIWA 3UKUB 4UB1A 8ICCA 4CJQA 3HOSA 1KAXA 2NRHA 3QUQA 2B0CA 4JKDA 3D2SA 3H4BA 5LJWA 4EHUA 4G3IA 9ICPA 2N1RA 4NM2A 4BR4A 1CEZA 4UARA 2A6AA 2W6KA 4KLQA 2A3VA 1MA9B 2QXFA 1SKSA 3DRSA 3NH0A 3AEVA 2K4PA 2A41A 3UB5A 3OYDA 1XU4A 1S5JA 4BQZA 2YMLA 2YQEA 5G5GA 2HVIA 1S72N 1LVHA 2KZ3A 3NVYA 2E2PA 1QHTA 2YKNA 3CQ8A 3V1RA 2WC9A 4BG9A 3EE9A 2HW3A 2E5LK 1F44A 1DGSA 3UQ2A 1T94A 1TUYA 1G15A 2UUCK 4CVNE 4MFFA 4USAA 4LSNA 3HVRA 2E1ZA 2UVVA 2KIVA 4KN4A 4FWMA 4IZ9A 4EHTA 3T3FA 2BH1A 1VK0A 3HXMA 5AIBA 3R3LA 1RZTA 4PGXA 5KGXA 2GTDA 4CW7B 3V9WA 1KC8O 1J53A 3LVWA 2P9UA 5ALHA 4B3TK 3VQ7A 3O8MA 5GIPA 3VTIA 5KFHA 2DGZA 4DV1K 4BRHA 4CEFA 5F1XA 5EY4A 2V9WA 3HSTB 3I76A 5KFGA 1XWLA 3PIPL 2OYQA 3K1ZA 2ZUCA 3B0XA 1JLQA 2G8WA 1OH8A 2YKMA 4P0QB 5D49A 3DXKA 1KCFA 5FDLA 3G71N 1SV0C 3L4IA 2HSTA 2XCAA 2GELA 2MRLA 3V6JA 5B66U 4LZGA 2GBZA 4ICAA 4J9RA 4GLXA 3GOIA 1GLEG 4XH5A 5D4BA 2MA1A 4DFPA 1LW2A 2GV9A 2P9NB 3NGIA 1SQKA 5KG6A 4O3SA 4B9QA 3QB0A 5ALXA 3ZDAA 1RDUA 3D2FA 4E7HA 4XUSA 7ICHA 3ISCA 4IDHA 5EE9A 1WCLA 1FKOA 5AQMA 2ZM6K 3Q8MA 4ELUA 4F4WA 2UUBK 4KHSA 3E2EA 3TFRA 5AM0A 4BDYA 4KN7A 2CRXA 4Q43A 1RT4A 5ALMA 5L1JA 4DL5A 4JS4A 4FBTA 2W42A 4FM1A 2ATLA 3LM9A 4JRPA 3QZ8A 1WSIA 1KKXA 1VQ5N 3NGYA 5DMRA 3TQ1A 3JAMO 4DCHA 3QEBZ 3SPYA 2J4RA 3VPZA 3ZT4A 4CESA 2HOEA 1ESVA 3OYMA 4RQ0A 4DL4A 1S10A 3AVFA 5KFQA 2WF9A 4M45A 4DQPA 2ATQA 5HL7L 3Q8SB 3SMPA 4DV2K 3TACB 5JUMA 3PX0A 4YXJA 2KQ2A 1KBUA 1X66A 1A5VA 3B6OA 1X9XA 1VQLN 2K89A 4J9NA 1TYQA 4KLJA 1NJYA 1C1AA 3IM1A 2PY5A 3KHGA 4OPHA 4CFCA 3MDCA 2ZJRL 5DB9A 2QARB 1BCOA 1Z25A 4QWDA 5EWGA 3Q8RB 3FZLA 3JSMA 4FCYA 4ED0A 3HK2A 2FBTA 2D3DA 4KO0A 1L7MA 4YXMA 4LJXA 3CERA 3H0LB 5AKZA 2HCFA 2EANA 4BWJA 4DSJA 3FZKA 4K4IA 1ZQWA 1QQ5A 1BOTO 1VHXA 3VQEA 5I42A 2DPJA 5C0YA 2KLAA 2ZJQL 5M1KA 1S9GA 1U4BA 3TAMA 2UUAK 4WE1A 1K9MO 5DBAA 3KZIU 4ED6A 2E6LA 1S76D 3QIPA 3NH1A 1KDHA 1NK4A 3H45C 5DG8A 1BI4A 4JMUA 4P4OA 1NK6A 4RPYA 3HKZC 2HSZA 1VRUA 3RF9A 1Z4OA 2G5HB 2YTUA 3D2NA 3GIMA 3EEQA 4FVMA 1LW0A 3VGKA 3O0FA 1OW5A 1YIJN 1T3QA 3RFAA 1WCNA 2QK9A 2YX8A 1S97A 2MUTA 2BCQA 4OPAA 1WSHA 2H3FA 4ELVA 3P1GA 3RMAA 1JJ2M 5KT7A 2GWSA 5J2JA 1S0OA 1WAFA 4XH1A 2VWKA 4BRNA 4IEEA 2PKEA 4QWEA 3IRUA 4JV1A 4C80A 4ECQA 4DF8A 8ICRA 4N5SA 2IGIA 8ICTA 3QERA 3ZD8A 4OPKA 3H0MB 2F1IA 9ICSA 3LZIA 3HJEA 4CCHA 4F5RA 2C2DA 9ICOA 4JKBA 1YZ6A 2KFNA 8ICSA 2O8EB 4B6JA 1IKVA 1CUKA 1BCMA 1RDCA 2X78A 3UKUA 2JGUA 1U49A 1X1PA 1N5XA 3AVKA 4BRMA 3BZKA 1ZD2P 8ICOA 4CEOA 4U6PA 4PQUA 5AZIB 1L3TA 4B9MA 4PWDA 4I28A 4K4GA 3SUNA 3UQ0A 2BGWA 3CFOA 5EX5A 2YHBA 5AQHA 9ICWA 2H3QA 3EPGA 5JS1A 4RNMA 1XO1A 3MN7A 3LALA 4RW8A 3M8RA 5DB6A 4BRAA 4CIEA 3LM2A 2KKZA 1C0TA 1JCFA 5AQXA 2FE9A 4NM1A 4BRQA 3DAWA 3QINA 4O9MA 3THXB 4GC6A 1BQNA 2CGLA 3TSUA 3NVKA 4P0PB 2QWRA 5KL1B 4H4MA 5C10A 1VSIA 4ID5A 4FO0A 2WF5A 3PUFA 3OA9A 4GC7A 2FBXA 5HRNA 3V6DA 2ZXHA 3MXJA 1MWKA 3QNOA 3SJHA 3C65A 2JH1A 2JEIA 5CRXA 9ICHA 3AAQA 2C22A 1IBKK 5ALLA 2UVUA 5HOOA 3KKRA 4MHVA 1QCKA 1OVQA 1WSEA 2JEJA 3C21A 1ZBSA 5AQLA 4KB1A 3KWIA 3LDQA 4P0QA 3N97B 1IKWA 1JCGA 2P9SB 5KPZA 4ED8A 3AA2A 4O4GA 4CNQA 2VG6A 2PI4A 2A19A 5AHXA 3WKDA 4MO5A 2P9NA 4Z6CA 5I9EB 5KFAA 2FLPA 4KLHA 5JICA 4NLZA 1DK3A 3ETRA 4RNOA 3AGKA 4I2HA 2NO5A 5J2EA 1JLBA 1TV6A 1V85A 3G4SN 1R0AA 4KPYA 3G0ZA 3KTQA 8ICQA 2QWOA 1HNXK 4Y2QA 3C5FA 1AQ6A 4A5BA 1DLOA 9ICEA 1EWRA 4FYDA 4KMUA 2XY5A 5J0YA 3E9PA 1GO3F 4F2SA 5C2DA 3E9OA 4DU1A 5FPNA 3WU2U 1ZQPA 4BRIA 1RBRA 4KREA 5KT6A 3SQ0A 3OYNA 1JLGA 3VCBA 3VQ6A 3H0RB 1KLNA 4UW9A 1ZQBA 4MF8A 4AM7A 2G8UA 4MEYA 4M2YA 4CGZA 1B9FA 2ZTDA 1BIUA 5T14A 2IVNA 4Y2SA 1UWBA 3GG4A 4JI5K 3KHYA 1ZQOA 4H03B 5F9LA 1S9FA 4IC9A 4H0TB 5AK4A 4E7IA 2V7YA 4PGQA 5J0OA 1JUDA 1ZQJA 3M1FA 5HRPA 3AY9A 3KZBA 4AILC 3C2LA 4O5EA 4CZEA 1Q82O 3J7AP 3UE5A 1TK5A 2JEGA 2IDOA 5G5HA 5EWEA 9ICKA 5C15A 1BUPA 3IS9A 4KHYA 5HNKA 3EUB2 4E19A 1XI1A 1K73O 1EXNA 4FWOA 3DYAA 2QARA 2AGPA 1HPZA 5IWAK 2VG5A 2YHYA 3TADC 2HNZA 3M8QA 4J2EA 2EAPA 4BJQA 4EYIB 3QYPA 4OVLA 5AQQA 3OYEA 4QIWC 4ECTA 3AARA 3DMJA 4BQLA 5DLFA 3PW7A 1RDAA 3WNEA 4QJFB 2YI1A 3F5AA 4Q44A 4GVMA 2WUSA 1BHLA 2VQFK 2IA6A 1NGHA 5ALUA 3ONNA 4DFDA 5L1KA 3OTQA 5KFBA 3CFRA 2C28A 3V1QA 4LFCK 4F9OA 2F1JA 4HUGA 4M3UA 3SBTA 4B1UB 3NGDA 4I2BA 1XMOK 4DKWA 2Q2RA 3T5JA 3LDLA 1C6VA 3TAGA 2KICA 1ZQIA 1D4XA 5AQTA 1J54A 4NXZA 2EWSA 4W5TA 4FJJA 1KTQA 1IKYA 1Y88A 4ZOHC 2KD1A 3PVXA 3A0IX 1ZBFA 2O4GA 4HVJA 4FZLA 3CETA 4GKKK 3H8JA 4LVSA 3O3FA 1RT6A 2YCHA 2FPLA 3VEXA 1OH5A 5HRSA 2B6GA 1QQOA 1UHUA 1DGJA 3U8XA 3ZT3A 2KK0A 4DR3K 4F92B 2Z1JA 4FJGA 1CI4A 4UBBA 4I2JA 3FM9A 5J8YC 1QSLA 4WJ3B 9ICJA 4BE2A 4KHUA 3ORYA 4FWRA 4KH5A 2UXDK 1CLQA 3CJ1A 5KFLA 2W54A 4OGEA 4FZNA 1HR0K 1OKJA 1DKGD 3AO3A 1YVNA 2E4LA 3NRZA 1RNHA 3WXJA 4DV3K 3CC7N 2KMDA 5D46A 4DL7A 3PV8A 4CJ3A 3KK2A 4DR5K 5M1OA 1ATSA 1S22A 5DQHA 2A40A 5AZIA 3CXCM 4GXJA 4NXNK 2DPNA 4FO6A 3PY8A 4YFUA 3CC4N 3H8MA 8ICPA 3C6TA
chains in the Genus database with same CATH topology
3RJIA 4DF4A 4UAWA 4FVUA 2PFOA 4KLUA 3MK6A 4R65A 4EBCA 2PAVA 3PR5B 4BR5A 2FF6A 4PPXA 2PFNA 1N8RO 2P9KB 3PNCA 3CHWA 4GV9A 5BOLA 3RB3A 2A1JB 3QBXA 3MGIA 4BROA 3RJFA 4MO4A 5B8HA 4JK7A 2R8HA 4YMMA 5JLFA 2AA4A 5KG5A 5J2CA 2XGQA 2VA2A 5KT2A 4H0XB 3LDAA 1ATNA 3QE9Y 1RXVA 8ICEA 1KAYA 3RB6A 4QZDA 2WTFA 1NGJA 1SL1A 4DQ8A 1GLJO 1HJOA 2ZWHA 2CGJA 5KFRA 3R9PA 1D8LA 2IVOA 2E1YA 4RQ6A 3N4PA 4U67L 3HPOA 3OHAA 2Y1JA 4PKIA 3O9RA 9ICQA 2VYPA 4PHEA 1QQMA 3Q7BA 1C0GA 3GILA 3C7NB 3H6EA 3L0QA 4ISFA 3LK9A 1PZNA 3O80A 3IUCA 3SV4A 5KFWA 1T8EA 1YHQN 3PO4A 4QZAA 3H7IA 5AQFA 4QS9A 7ICJA 3HWTA 4FWLA 5KG1A 4R8UA 4TUSA 3ZYYX 2Q31A 1GLDG 3C23A 3VEOA 3MGHA 3TSQA 5DDMA 5IIMA 1TVAA 4M7XA 4DB3A 1YAGA 1JX4A 4WQ5A 1D9DA 4FWSA 4K4HA 4C8LA 4M9NA 2NZTA 7ICEA 5IIIA 5TKWA 2RHKA 3NTUA 5AFUH 4CZGA 1NKCA 4XA5A 2PFUA 1K8AO 1ZQRA 4Q8FA 3ISBA 1MWMA 3EKUA 3GV8B 3MN5A 4PKGA 4JV2A 3AUOA 4F8RA 3JPOA 5JVGL 4F5QA 5AQWA 3PW0A 5GIOA 1U48A 4QW8A 3EZ5A 1SKWA 1SL2A 3R6MA 3SYZA 2NRTA 3QFPA 3V6HA 4IWVA 4BRDA 2V51B 2WFBA 2P9PB 4J8FA 3BQ0A 1QQNA 5KFEA 5EOYA 5KFYA 3RSEA 1BA0A 4YOYA 4PHPA 4DSFA 4YOWA 3VF4A 9ICMA 4RQ1A 2W9CB 4QWCA 1BWFO 1G99A 4IOAL 2RE2A 2P9LB 1YJWN 4ED2A 2FLLA 1KD1O 3HZ6A 3GV7B 2I9GA 2OANA 1ZQSA 3IKMA 1D9FA 7ICFA 1HKCA 3V72A 5AQOA 1NJZA 3BJYA 2BUPA 3H46O 3CI5A 1IJJA 3CPWM 3MDAA 1NGFA 3TAQA 5GINA 1MDUB 2A1JA 1BPZA 2E2QA 3HX0A 3N4QA 2AGOA 3ATUA 4DQQA 4BRFA 4PL8A 4X5VA 1NGCA 4ED3A 3W0LA 4QW9A 3C5GA 5KPRA 3ZEUB 3M8SA 4P2HA 1C7YA 3HW8A 2A5XA 3EL2A 4E0DA 1ZQZA 4TQSA 5CB1A 3D7EO 3ZX0A 2IHNA 2XY7A 4WFBL 3PR4A 4FWQA 2F7TA 4I2DA 1V4TA 4CZLA 2W8KA 4YOTA 4A62A 1NKBA 4IQVA 3RH5A 5J2KA 4RQ8A 3FE1A 3HP6A 5BPCA 4K41A 2IVPA 2QA4N 3EW9A 1ZQHA 5DB8A 1V4SA 1NGAA 3H3NO 4NB4A 1QHAA 1J6ZA 3TTDA 5DBCA 1M1KO 3DJCA 4PHTX 2FSKA 1C0FA 3CQYA 5L1LA 4UB2A 5CWRA 3M9NB 3TU5A 5ELZA 4TURA 4GV6A 1HKBA 3QFUA 5BRDA 5HP4A 3V7JA 7ICLA 3CCMN 1T44A 4KLFA 3DWLA 5KFOA 4F2RA 3QZ7A 3D2EA 8ICWA 3PW5A 1X9JA 4QZ8A 4IOCL 3CCSN 1GLLO 4FOEA 3RJHA 4DS5A 2OTLN 3VTHA 3MMVA 1ZQUA 4IFEA 4EFHA 7ICRA 4IEIA 4BRLA 3VERA 2YHWA 2CH5A 1ZXOA 3I55N 3NMUA 4A2AA 4QZ9A 4BRKA 4MLHA 4CZJA 5J0WA 4DOAA 4M9LA 3M6GA 2W9BB 3M9MB 3GFKB 3EKSA 3E1YA 2W9MA 3MABA 5KT3A 2YX6A 5E84A 1TFRA 4RPXA 3T5KA 1YI2N 7ICKA 5BR9A 2PFQA 4DS4A 4R63A 1GLAG 3RB4A 1BA1A 4QWBA 1P90A 1WOQA 2VGNA 3TFSA 3HM8A 3GIIA 3EO3A 2E20A 1Z6RA 1JXLA 4MFCA 3D6RA 4BC5A 1NM1A 3K75D 3G6YA 9ICFA 3G6VA 5C2FA 1Z05A 2P9PA 4YORA 5M1QA 3AAPA 3H8SA 3ZDCA 3WXIA 4KLOA 2MAXA 3W3DA 2JWKA 2P9IB 4I6MB 1CZAN 4FWKA 2IBKA 3PX6A 3JPNA 2P9LA 4CBUA 4M0AA 5KG2A 3GE1A 2VWBA 2AP1A 5J0UA 4YDUC 1ZQXA 4CZIA 3H1VX 2ASJA 5GAGP 4IO9L 1K1QA 5H1SQ 1DEJA 4BDPA 3FFKB 4RNNA 4YDUA 5KFKA 4PH5A 4C8NA 4J9LA 4F3OA 4RQ5A 3UKRB 3MFIA 3R8EA 3BQ1A 1TK8A 1BG3A 4O5KA 4FWNA 4JK8A 4Q8EA 4C1NK 2CH6A 5TZVA 3UPQA 5IINA 4CZHA 4O0IA 8ICZA 3RJKA 4YP3A 3MR3A 2E2NA 3LDOA 3HSCA 3CD6N 3V7LA 1JXEA 9ICGA 4JKEA 5AQZA 5FPDA 5M1PA 4CBWA 2GUPA 1X3NA 1LV5A 5DQIA 3ULEB 5J0XA 1GLBG 3UXNA 2BQRA 2XY6A 3H40A 3WEEB 1QLNA 4ECRA 4BXOB 3TTFA 4RQ3A 5J0QA 2ALZA 4O3PA 9ICRA 3CMAN 4KLEA 4J9KA 2Y1IA 4XEIA 4WFNL 8ICIA 4YD2A 4RT3A 1X3MA 1GLCG 3T5LA 1KAZA 3FGUA 1XSPA 2Q1NA 8ICNA 2HHTA 1TKDA 3J7ZO 4DSIA 4GNIA 3VEWA 4NY8A 9ICNA 1XSLA 2ZUBA 3JPTA 5BN9A 4BC2A 4NLBA 3C2KA 2W9AA 5KFUA 1K8KB 1AROP 5J0PA 1NWKA 3CMEN 1S0VA 4F5NA 1XSNA 3H8WA 3PW4A 2DFLA 3BP8A 5IIJA 4DO9A 4RUAA 1HLUA 1LOTB 2HHQA 3MR6A 5KPTA 2AU0A 1UA0A 2ZF5O 2E2OA 1T6CA 1ZQFA 4KLLA 5KG4A 5KFFA 4R79A 3L4QA 4J9QA 1OVYA 4MEXA 3ZDDA 4O5FA 3PMNA 4Z6EA 5EWFA 1NMDA 5AQJA 2P66A 8ICJA 1XS9D 4JD2B 2W9BA 5DKWA 3ZDBA 1L3UA 3UXPA 3CJBA 4BR0A 4MF2A 3RJGA 4QZBA 5CR4A 4DFMA 8ICYA 4CD3A 2YJEA 3GBTA 1ZQKA 3JPRA 8ICHA 2YHXA 1LB2B 1S0NA 2NNWA 4CZFA 4DHYA 4RTFD 1VQ4N 2HBLA 5HMMA 4F4XA 5HHHA 4A5AA 4ZH4A 3ZX2A 4TQRA 7ICTA 3TANA 4FS2A 1VQ6N 4E1JA 4WQ4A 1L3VA 3RVCA 2YJFA 5DB7A 2ZJPL 3GIKA 3VOVA 1TV9A 4HTLA 2P6RA 3KVGA 1ZQTA 4EZ9A 4QWAA 4BGBA 1SKRA 3T7ZA 3VF2A 3NVMA 1M90O 4CI6A 3SK3A 2ZJ5A 3VEVA 2ASPA 3KHHA 4A59A 5AQGA 2F9TA 4BRPA 4I6MA 3MR5A 4DWIA 1HX1A 1TUUA 5MLCQ 2ASMA 2BPFA 4JKGB 4ECUA 1BDGA 3G6EN 2F1HA 4C23A 1SS6A 3OBYA 3M3ZA 3ID8A 3OSNA 4DQIA 2A3ZA 2HF4A 1S0MA 4EIAA 3UKRA 4TUQA 4FPAA 5DM6L 3ENOA 5IIOA 5AQRA 4DL2A 4KLGA 4DOCA 4DEZA 2IMWP 2CGKA 4H5TA 1UA1A 1KXPA 3E9LA 4ECVA 4YFKA 2IHMA 3ISDA 4YVZA 2H5XA 3H3OB 4JNEA 3OGUA 2Q0RA 4BRGA 4H0PA 4ISEA 4YR2A 2LYHA 4M04A 1RFQA 3IHQB 4DSLA 3ULEA 3DXMB 3O9SA 4PHAA 2AQ0A 3WEEA 4UY8O 1ZQCA 5J2IA 4BXOA 3O5BA 4IXCA 5KFMA 4EEYA 5BRHA 4MLEA 1ZJNA 2BQ3A 5J0RA 1Q86O 2HHVA 4CD1A 4FL9A 4CBXA 4KLMA 4ISGA 4FS1A 1NGIA 5J2BA 1NGBA 5DGBA 1YF5L 1W97L 1NJIO 2BCSA 4G9ZA 3GIJA 8ICVA 3VEZA 5BOMA 1BPXA 3VF6A 4B9TA 4Z6DA 1ZJMA 2ASLA 2BR0A 2BPGA 2P9SA 4PKHA 5IILA 2KZMA 1HKGA 7ICUA 4M9HA 4WF9L 5CJ7A 3RH4A 4GV3A 4GVEA 3RRHA 2R8IA 4EBEA 3CCQN 1TK0A 4AM6A 4O3NA 1MC8A 3CJCA 4EAHD 5L1IA 4HYKA 1NJWA 1ZQMA 3VGLA 1NOMA 5J29A 5KFSA 3LL3A 5GAHP 4ECWA 1NKEA 4ECYA 1X9WA 2FMQA 4JD2A 9ICAA 3O1BA 5FPMA 1NGDA 1XC3A 4BC4A 4YOVA 1E4GT 5BREA 4K43A 3OBWA 3L6QA 1EQYA 4J9MA 1ZQQA 2I7NA 4WQ5C 5DGAA 3BF1A 5EOZA 2ISPA 2F9WA 3P31A 4Y0WA 1ZQEA 2FMSA 4IRCA 2JWLA 2RDIA 2VA3A 2VA8A 3B0YA 3Q7CA 3OJUA 3D2FB 2QWQA 3ZD9A 5EXWA 1EO1A 1TAUA 2ZGZA 3HOTA 1YJ9N 1B22A 5AQUA 1JN3A 2QW9A 3O1WA 3SLCA 3OW2M 3ENHA 4JV0A 1Z3EB 3JXUA 4IR1A 2ASOA 4JKGA 4M9JA 4KLSA 3SAFA 1RXWA 4JAXA 3WT0A 3U4LA 3IDHA 3M5RA 4YCXA 4IJNA 3RRGA 7ICIA 1ZQAA 3T5HA 3DLLL 4UB5A 3F2KA 2ZTCA 1BPEA 4KLDA 4A61A 4F4ZA 4FSVA 4PHDA 1VQON 1VQ9N 2NRRA 1WUAA 2JEFA 9ICXA 4H5NA 2HHSA 1NBWA 3EWAA 1U6ZA 1L3SA 3SI8A 5CR0A 3MFHA 5AZJB 4IQUA 5KT4A 1DT9A 5AQIA 3H1QA 4C8OA 1ZC6A 8ICLA 4IOXA 4BG8A 3PMLA 4NLCA 4QZIA 3CJ9A 1NK9A 4F5PA 1H1VA 5AR0A 7ICQA 2I1QA 5C12A 3BF3A 4U7BA 1YUWA 2PI5A 2D1KA 5J0SA 5KG0A 3C1YA 2P9KA 3OHRA 5DQGA 3H4DA 1YXQA 2Q0UA 3S41A 4RU9A 4I2IA 4ILGB 3BEXA 3PLAA 1NGEA 5BRFA 2BCUA 3CQXA 4F93B 3Q8KA 2J6UA 2Q97A 3FDSA 4J9PA 3MDQA 3O9UA 3CJAA 4TUPA 1X9MA 4YQWA 1SL0A 2DPIA 4RQ2A 4M6WB 1RGIA 5ADXH 3KK7A 2FLNA 2A42A 1QZ5A 4IR9A 4B1YB 3HI0A 4KH6A 4CJ7A 2NRWA 1SZPA 1BGXT 2QEXN 1KFSA 2NLXA 5KFCA 1VQNN 4IQWA 4I2FA 1XUPO 2PBDA 3WUHA 4B1WB 1N48A 1COOA 1MQ3A 2GX9A 3C7NA 3PX4A 1D8YA 3GV5B 4WFAL 8ICUA 1QSYA 3K9KA 1KFDA 4C1NI 2KZZA 4CZKA 1T6DA 5F9NA 1Z00B 8ICBA 5LJVA 3GDXA 4F4KA 2J6SA 2HBKA 3VMFB 5L9XA 2Q36A 1U47A 4XH4A 4GXIA 1GLFO 1QVGM 1NK7A 5LY3A 3RAQA 4RUCA 4I27A 3CIPA 1U9LA 2WBNA 5BPLA 4O8KA 2HBMA 7ICMA 2QWPA 3I33A 4RWTA 4Q45A 2NRXA 2ZJAA 5KQ8A 1DOQA 4H5WA 3MR2A 3K4GA 1UT8A 3FYHA 4IRKA 3RJJA 4QZFA 3O6WA 1NJXA 3F5TA 3RBEA 1A77A 3WXMB 1S77D 4B9NA 2KTQA 4JWNA 4B1ZA 5J2DA 2E8AA 3BQ2A 4K25A 5GADP 5KFDA 5KFNA 3O08A 3M9OB 9ICIA 4R66A 8ICAA 4KITB 4ECSA 4JK9A 5BPNA 5KG7A 4HWIA 2C2RA 3FLCO 1ZQGA 2R8GA 4Z94A 5KFXA 4M9GA 1V9PA 2HHWA 2E88A 3FR0A 3ID6A 1JMSA 3KHLA 3OSPA 2W9CA 5AQKA 5BPMA 5AZJA 3RTVA 1Q18A 2VCPA 3I56N 2ZGYA 1HJPA 2QTDA 2XC9A 3THVA 4Z6FA 5AQSA 4JK1A 4F91B 2V4QA 1RYRA 5DBBA 3CJ7A 3EE8A 3MCAB 4B1VA 1MQ2A 1BO5O 2H3GX 2BTFA 1SAZA 3O9QA 4BC3A 2NRVA 4OO1J 4YD1A 2I7PA 1S3XA 4EYHB 3MN6A 5M1FA 5J0TA 3PIOL 4NLKA 4DL3A 1ZETA 3ZEUA 1ATRA 2W41A 4JWMA 7ICPA 9ICVA 3A8YA 4I2CA 3MCPA 3R1XA 5KFJA 5F2RA 4MFAA 3VEYA 4BR2A 4YR0A 4M6WA 2V4RA 3EYZA 4ELTA 4XRHA 4YN4A 1O13A 5KFPA 2R8JA 5CHIA 5KQDA 3OJSA 4B9LA 2HF3A 3HRGA 4LZDA 4H0YB 1VQKN 1T3VA 8ICFA 4JKCA 4I2AA 1VQ8N 1QZ6A 4XQ8A 3P4IA 3MX2A 4QZEA 3UXOA 4UAZA 3VGMA 4DSKA 2BKEA 3HTVA 4ED7A 4K42A 3JPSA 4PL7A 1JIHA 1BPYA 3C0BA 1Z00A 5GAEP 2FPKA 9ICCA 1E4FT 4F4YA 2UVRA 4I29A 2W40A 5AQNA 3B8AX 1RYSA 3WQTA 5KFZA 1BPBA 3A5LC 1VQ7N 4BREA 4IRDA 3RR8A 5AQVA 1KSPA 1NK8A 1HUXA 4PGYA 5CHGA 2NRZA 1BPDA 5JLHA 3ZETB 3GDQA 4BVPA 2BCVA 3ENBA 4DFJA 4BR7A 1U45A 2M9NA 2KFZA 4RZRA 5BN8A 1T4GA 9ICTA 4NLGA 4WQ4C 7ICSA 1B43A 1ZQLA 1U2VB 4ECXA 5KG3A 1P8ZA 4UB3A 7ICOA 1HUZA 1Q7YO 3Q8LA 4O5CA 4UAYA 1HUOA 3RAXA 4YOXA 3BDPA 2FF3B 4RPZA 1VQMN 5KFVA 4I2EA 2QM1A 2XO7A 2FMPA 3WXKA 3P39A 3JPQA 2BCRA 5E26A 3RBDA 5TKYA 1IXRA 4R8UB 3TAPA 3KWGA 2V7ZA 4IJAA 2QWNA 1L5UA 1YJNN 1XQSC 2BQUA 2AQ4A 3PO5A 9ICLA 2P9IA 3LDNA 4GY2B 4H5VA 1Q81O 3G25A 3RR7A 3LWLA 3AU2A 1X2IA 2XCPA 3SMSA 3OHBA 4DQSA 3KHRA 3Q8PB 4B9VA 2FLOA 4FOIA 2JZBB 5CP2A 4BR9A 3MBYA 5KFTA 4KBOA 4F5OA 5DG9A 1KEJA 3ZDEA 2FXUA 4JHDB 3GL1A 5CE3A 3VETA 3E66A 4ILJA 3U9DA 2AJQA 2P6UA 4FPBA 1T7PA 4R64A 8ICKA 4DSEA 3A5NC 4QZCA 4GXKA 5J2AA 2BDPA 3EZWA 2HMPA 4QZHA 5HHIA 3Q8QB 3RSEB 4ED1A 4NO7A 3BUZB 4JKAA 2VANA 4KTQA 4P4MA 3LWMA 3CPEA 3TTCA 2BPCA 3RH6A 8ICGA 3WQUA 2QI2A 4YR3A 4KLTA 5EVZA 3C2MA 1QSSA 1N56A 4B1XB 4JEPA 3TARA 7ICGA 2BHNA 9ICUA 4B9UA 1VAZA 4JUZA 4KLIA 4YOUA 2XGPA 2GEMA 4M47A 4O3OA 4A2BA 5IIKA 3N4MB 4EZ6A 3O9TA 4L3QA 4P4PA 1LCUA 3GQCA 1KFTA 4RT2A 1ZQDA 4RQ7A 5HMLA 5CA7A 1XC9A 1YITN 2OTJN 1K8KA 1R59O 3I8BA 8ICXA 7ICVA 3HBTA 4BGAA 4CZMA 3ZX3A 2B21A 1RDWX 3CCLN 4YMNA 2QXLA 4YMOA 3FZHA 5KFIA 3AU6A 4UQGA 3F9MA 4H0VB 4WCEL 2HBJA 2QWMA 2UVWA 2FSJA 3SAHA 2R8KA 1KRPA 2PXIA 1K1SA 4M63C 2FSNA 3CC2N 4DLGA 3ZETA 1IM4A 3CCVN 4IQTA 2C2EA 8ICMA 3T69A 1ILYA 3IFRA 5C5JA 5DG7A 1ZQYA 4O3QA 4J9SA 2D0PA 3FZFA 3BQTA 3MN9A 5M1NA 4JKHA 2P9UB 1MSWD 2ISOA 4B9SA 2HHXA 3O4WA 5J2HA 3ETLA 1U2VA 3CCUN 1HPMA 1DGKN 2QWLA 4DQRA 3RB0A 1NGGA 5AFUA 1SZ2A 4WYBA 3PW2A 3DXKB 1BU6O 3K9JA 1TAQA 3D2EB 2ZJ8A 3C6HA 2V52B 3FZMA 5FPEA 3SBGA 2W8LA 4RQ4A 1QTMA 3QEAZ 1ZQNA 5DLGA 3V6KA 3LDPA 4BVOA 2GWKA 1X9SA 1VQPN 3JS6A