2NRVA

Crystal structure of the c-terminal half of uvrc
Total Genus 75
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
75
sequence length
218
structure length
218
Chain Sequence
RGLRKEALEELMKLLNMKDFPYRIEGIDISHLQGKYTVASLVVFEDGFPKKGDYRRYKIEQDHPDDYESIRTVVKRRYSKHPLPNLLFVDGGIGQVNAAIEALKEIGKDCPVVGLAKKEETVVFENREIHLPHDHPVLRLLVQIRDETHRFAVSYHRKRREKESLRSVLDNVPGIGPIRKKKLIEHFGSLENIRSASLEEIARVIGSTEIARRVLDIL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Structure of the C-terminal half of UvrC reveals an RNase H endonuclease domain with an Argonaute-like catalytic triad.
pubmed doi rcsb
source organism Thermotoga maritima
molecule tags Hydrolase
molecule keywords UvrABC system protein C
total genus 75
structure length 218
sequence length 218
chains with identical sequence B
ec nomenclature
pdb deposition date 2006-11-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF08459 UvrC_HhH_N UvrC Helix-hairpin-helix N-terminal
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.20 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 5' to 3' exonuclease, C-terminal subdomain 2nrvA02
3.30.420.340 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Nucleotidyltransferase; domain 5 2nrvA01
4B9LA 4QZAA 1L3TA 3Q8RB 3JPOA 3G6YA 1XWLA 4YMOA 4O3RA 1U49A 9ICRA 5KT3A 4P4MA 5DBBA 4NLKA 2BHNA 8ICGA 5KFNA 4KLFA 4Q44A 5EWFA 1NKCA 2R8JA 3PNCA 9ICJA 4RNMA 4MF2A 5J0TA 2BQ3A 9ICWA 8ICRA 2FLLA 3RJIA 5KT6A 4F5PA 3Q8KA 1U45A 2ZJ8A 3JPTA 3LWMA 2J6TA 1NOMA 3UXPA 1QSLA 4PPXA 3KHRA 3SYZA 1SL1A 1A76A 4DLGA 2BPFA 1QLNA 5KT4A 2BCSA 2Y1JA 5IIJA 1D8YA 1ZQGA 4EBCA 4TQRA 3MFHA 3RR7A 4YR3A 4YD2A 3ISDA 4YXJA 4ECRA 4ELTA 2R8HA 3C2KA 1ZYQA 1Z00A 5J0XA 1L3VA 2XCPA 2FPLA 2MUTA 1HUOA 4Z6EA 2H5XA 3RJJA 9ICBA 2LYHA 3LWLA 2BGWA 4KLEA 4BXOA 4PH5A 4QZGA 2V4QA 2W9BA 1SKWA 9ICFA 9ICVA 4J9NA 9ICXA 4MEXA 2MUTB 4Q8EA 3H7IA 2ASLA 3B0YA 1TAUA 1ZQXA 2M9NA 2FMSA 7ICEA 1D9FA 4YQWA 2XC9A 4DQPA 5IIKA 2VA8A 5KG3A 4TUQA 1QSSA 4RQ1A 4DO9A 4ZH4A 8ICVA 5L1KA 3RBEA 4PHAA 1WCNA 4PGYA 4M6WB 3GV8B 4ECXA 4ED8A 1Y88A 1XSPA 1S0OA 1ZQAA 8ICSA 3ETLA 1NK4A 3JPPA 2ZUDA 1S0MA 3JPRA 3FDSA 5JUMA 4QZFA 4GXIA 2BR0A 3RJGA 1ZQRA 4I2CA 3TFRA 3C23A 1SL0A 2UVVA 4FS2A 1TV9A 1NK9A 4G3IA 4R63A 2JEFA 2F1HA 4KLOA 4KLTA 1V9PA 9ICHA 4ED0A 8ICQA 1RYRA 4ECZA 2J6UA 2ZJ5A 1TFRA 4Z6FA 1ZQNA 1ZQFA 7ICHA 3C2LA 4O3OA 5J0SA 5DB7A 2VA3A 4M9HA 2KFZA 2ZTDA 2MAXA 3LK9A 1NK8A 3ZDDA 4I2HA 5D49A 5KG0A 4DFMA 1NJZA 5HNKA 4XQ8A 5DQIA 1EXNA 1NJXA 9ICPA 3BQ1A 1S77D 1JMSA 1UA0A 9ICOA 1X9SA 4UB5A 1BPXA 4KN4A 2W8LA 2PI5A 4Q45A 2NRTA 2F1JA 3H8JA 1TK5A 3V7LA 3PMNA 4ECQA 2W9CA 4KLQA 5KT7A 5CJ7A 4F4WA 5D4BA 1NKBA 3HX0A 4LVSA 5KFWA 2AJQA 3JPQA 1RYSA 5DGBA 4NM2A 2P6UA 5TZVA 4R64A 3T5JA 2ZTEA 4DQSA 3RJKA 4I2EA 1JXLA 5HHHA 3RRGA 8ICHA 5DBAA 5EWGA 4BWJA 4ELUA 4MFCA 4PHDA 2C22A 4DSIA 4UBBA 8ICMA 5J0PA 4F50A 4F5RA 2R8IA 9ICEA 4BWMA 4RQ4A 2A1JA 1U4BA 4DFJA 1BPYA 4RU9A 1PZNA 5IIIA 1B43A 3RB4A 2BCVA 4QZCA 3BJYA 4GXKA 4F2RA 2NRZA 3MABA 3C5GA 4M9GA 1ZQTA 4P4PA 5J2AA 3MR5A 3PX0A 5J2JA 5HMLA 4M47A 4X5VA 5KG4A 3AUOA 4BGDA 5DLFA 8ICCA 5IIMA 3GFKB 2AGQA 2W9AA 1XO1A 3PV8A 4DSJA 5BOMA 8ICTA 3OSPA 5J29A 5J2GA 3M9MB 3QZ7A 5J2IA 3PW7A 1ZQLA 2NRRA 4XRHA 4M9JA 5CR0A 5KFDA 4PGXA 4YN4A 4RUCA 4RQ5A 3Q8PB 3HW8A 4PHEA 4DOCA 2XY7A 2HHTA 4I28A 8ICNA 4J9MA 4UB2A 1KRPA 1BPBA 1ZQKA 4DL7A 5DQGA 4RNNA 1ZQMA 4NY8A 8ICYA 5IILA 2BPGA 4KTQA 8ICKA 3OSNA 5J0RA 1QTMA 8ICPA 1T3NA 4GXJA 3NGDA 1MQ2A 4QW8A 3RB0A 4UAZA 3RTVA 4Z6CA 4B9MA 4IRCA 4O5EA 3UXNA 5KT5A 1AROP 3C21A 1ZQSA 3Q8SB 8ICWA 3PW5A 5KFXA 2Y1IA 4FBTA 7ICFA 5CA7A 4TQSA 3Q8MA 1MC8A 4UB3A 1TAQA 1T8EA 4TUPA 3TQ1A 7ICIA 5DDMA 4DSFA 4KN7A 4RT3A 7ICJA 3GV5B 4O3QA 1D9DA 1KLNA 5DKWA 4JWMA 2AQ4A 3GIKA 1SL2A 1BPEA 3GDXA 3PO5A 1ZQOA 4TURA 7ICQA 4F93B 5KG2A 3PW4A 3ISCA 4RQ2A 4J9LA 4RNOA 5J0OA 1JN3A 2OWOA 4QWBA 4YG2A 4R8UB 4GC7A 1LV5A 3V7KA 1NK6A 3FYHA 4M0AA 1MQ3A 4DFPA 2J6SA 4DEZA 1S9FA 5D46A 3MR2A 4GC6A 2BCUA 3RJFA 1MSWD 4DWIA 4O3NA 3GIJA 3BQTA 4B9VA 1TK0A 7ICRA 4MEYA 3RRHA 4YMMA 4KLHA 5KFSA 1K1QA 3H8SA 4XUSA 1ZQUA 4I2GA 1T4GA 3OHBA 5KFKA 4NLZA 7ICSA 3EWAA 4B9NA 1JIHA 3M9NB 2JZBB 4QWAA 4I27A 4NXZA 5KFYA 2FPKA 3C2MA 4UQGA 3RB3A 1N48A 2BCRA 3QZ8A 4K4IA 5F9LA 5DB9A 4EZ9A 9ICQA 3BQ0A 7ICNA 2R8KA 1TKDA 2KZMA 1KFTA 3HP6A 3M8SA 2NRXA 3EPIA 1LB2B 4M04A 2KFNA 3MR3A 1X9MA 3MGHA 3K75D 5J2KA 4ED6A 2HHUA 2ZUBA 2AQ0A 4DL5A 5KFGA 4RUAA 5DG8A 3H4DA 4M6WA 4E0DA 3SZ2A 4ECSA 8ICBA 4I2FA 4NM1A 1RPLA 3EPGA 2BDPA 5KG1A 1RXWA 5KFVA 3QE9Y 4RQ7A 5J0UA 1U47A 3PW2A 5EOZA 4DQIA 4I2AA 2KTQA 4IQUA 1Z3EB 3UQ2A 4QZBA 2ALZA 2IMWP 3KTQA 4QZHA 5KFPA 4F4YA 3N4MB 4TUSA 2VA2A 4ED2A 4FBUA 2JZBA 3N97B 2PFNA 2BCQA 5BOLA 4F4XA 5KFTA 4YXMA 2JEGA 3ISBA 4DOAA 3T5HA 2ATLA 4F5NA 1UT5A 4ECYA 4LZDA 1NJWA 5J2CA 1S76D 2HHSA 4IRKA 4QZIA 1XSLA 5EWEA 4DL4A 2WTFA 1H38A 5CWRA 4UBCA 8ICEA 4EYIB 3ZDAA 7ICMA 2C28A 3HPOA 4RQ3A 4BDPA 9ICIA 5KFLA 1NJYA 3T5LA 4F2SA 3EW9A 4QZ8A 1SZPA 4EBDA 5KT2A 3OHAA 5HP4A 3EYZA 4EBEA 4KLJA 7ICTA 4RPXA 9ICUA 4C8KA 2PFOA 4QZEA 3IHQB 4J9RA 2FMQA 4NLGA 4DQQA 4M9NA 7ICGA 1KEJA 1COOA 4IQTA 1XC9A 4GLXA 1ZQBA 1U9LA 4UAWA 4RQ0A 2W8KA 3PX6A 3SV4A 4JWNA 1TVAA 2BPCA 3ORYA 3ZDEA 1XS9D 4DF4A 2RDIA 5KFQA 4J9KA 2FMPA 4IR9A 2Q0ZX 4FO6A 3KHGA 4ECUA 5HHIA 5J2DA 4IQVA 1WCLA 1ZJMA 1ZQYA 1D8LA 4YFKA 5KTQA 3MDAA 3ZDCA 4M9LA 4P2HA 5J0YA 4Z6DA 2PXIA 3SV3A 3GIIA 4ECVA 3B0XA 3SI8A 4ED7A 4R66A 4CCHA 1HUZA 2C2RA 2PFQA 3H4BA 4P4OA 3HWTA 1RZTA 1L5UA 3JPSA 4IR1A 8ICAA 4DS4A 3C65A 2FLPA 1UT8A 4JV1A 4KLDA 9ICTA 4ED3A 2W9CB 4B9TA 1ZQHA 3RBDA 4M2YA 1ZETA 1DGSA 3GILA 4I29A 3RB6A 5DG7A 8ICLA 3BQ2A 7ICOA 2ISOA 2HHXA 5J0QA 3TAQA 4I2DA 2DFLA 5KFAA 9ICGA 4F91B 5CHGA 2UVUA 2P6RA 3TFSA 1KFDA 4F92B 3EZ5A 9ICLA 7ICPA 3UQ0A 7ICKA 1UA1A 5KFIA 3AU2A 5DBCA 5J2HA 3MFIA 4KITB 4QZ9A 2XCAA 3HT3A 4RZRA 3MR6A 3H40A 5KG5A 2R8GA 5J2FA 3OGUA 3T3FA 1CEZA 5L1JA 4KLGA 4JV0A 1A77A 4IRDA 2DPIA 4O3SA 2FPMA 3RH6A 3TAPA 2AGPA 4F8RA 3QEBZ 3RJEA 3TANA 7ICLA 1X9WA 8ICXA 5F9NA 2C2EA 4YR2A 5KFMA 4J9QA 4RPYA 4ED1A 2ZTCA 9ICMA 5CB1A 5J0WA 2V4RA 3TARA 1ZQZA 5L9XA 2KZ3A 5KFCA 5KFJA 3GIMA 3V72A 5J2BA 3M9OB 5KFFA 3PMLA 5KFRA 4C8MA 1BGXT 2HHWA 4I2BA 1JXEA 1ZQQA 4O0IA 1KSPA 3PO4A 2IBKA 4EEYA 4DSLA 2ASJA 4K4HA 2W9MA 4ELVA 4NLNA 4ECTA 4YP3A 4LZGA 1X2IA 9ICSA 2JEJA 3TI0A 2IHNA 5CP2A 4DL6A 2AU0A 8ICFA 4F5QA 4ECWA 3THVA 1NKEA 4MFFA 2W9BB 4F4ZA 3PVXA 8ICOA 3K4GA 2KZZA 3UXOA 3ZD9A 1K1SA 5C5JA 3OJSA 5IIOA 4UB4A 4F5OA 4JK1A 4DFKA 4DLEA 5L1LA 4DL3A 2XY5A 1ZQJA 1DOQA 4UAYA 4J9SA 1ZQWA 4DSEA 4MFAA 4QWEA 4KLMA 3V6HA 4DQRA 3BDPA 4BXOB 4HYKA 1ZQCA 2XGPA 1QSYA 4DOBA 4JV2A 4K4GA 3KHHA 1B22A 3ZD8A 4QWDA 1ZQIA 4C8OA 4YD1A 4DF8A 4UB1A 1XU4A 2BKEA 1NK7A 2C2DA 5KFHA 1ZJNA 3RH4A 2ISPA 4YR0A 2VANA 2XO7A 4DL2A 4KLSA 1S0VA 4RQ6A 4EZ6A 3MBYA 5DB6A 3MDCA 4J9OA 2XY6A 3GQCA 1L3SA 2I9GA 4I2JA 1KTQA 2IHMA 4R8UA 2UVRA 4DS5A 8ICJA 2P66A 9ICCA 5KG7A 3OJUA 4PGQA 1IM4A 5KFOA 4O9MA 4YCXA 4RPZA 3C1ZA 5DG9A 4QW9A 1S0NA 4I2IA 3G6VA 5DLGA 3PX4A 1SKRA 5KFEA 1N56A 3PR5B 2HVIA 4C8NA 3M8RA 1TK8A 1ZQEA 3T5KA 3V6JA 3MGIA 4KLIA 1HJPA 1NK5A 1BPDA 1ZQDA 2HW3A 2ZJAA 2NRWA 4YMNA 3GV7B 1ZQPA 3E2EA 2JEIA 2HVHA 2I1QA 1CUKA 3NTUA 3KHLA 2ZUCA 2ASDA 7ICVA 3RR8A 4O5CA 2XGQA 1KFSA 4Q43A 9ICNA 3ZDBA 1S97A 4R65A 4KLUA 4MF8A 3LDAA 1IXRA 2HHQA 2A1JB 3V6KA 1JX4A 4B9SA 2PI4A 5BPCA 2NRVA 4XA5A 1XSNA 1L3UA 1S10A 3C1YA 1ZQVA 5KG6A 1BVSA 4KMUA 5DB8A 8ICUA 5KFUA 4JUZA 3PR4A 4DSKA 1C7YA 4O3PA 4B9UA 4Q8FA 2DPJA 4C8LA 5KFBA 1SKSA 4F3OA 2PFPA 4F4KA 3RAXA 4KLLA 9ICKA 3IM1A 2B21A 5J2EA 5KFZA 3UPQA 3PW0A 2IA6A 7ICUA 8ICIA 5L1IA 4O5KA 4YVZA 3RAQA 3JPNA 3H8WA 1T7PA 4J9PA 2RDJA 5DDYA 2BQUA 1BPZA 1RXVA 3AU6A 4RQ8A 2KN7A 3C5FA 1NK0A 8ICZA 5HMMA 1KDHA 3G6XA 2BQRA 5IINA 9ICAA 3PY8A 2F1IA 3RJHA 3Q8QB 2HHVA 3RH5A 2AGOA 1U48A 2V9WA 4QZDA 2UVWA 3Q8LA 4FS1A 5DQHA 2GWSA 3V7JA 4QWCA 4EYHB 4RT2A 1Z00B 5DGAA 3QEAZ 4PHPA 2FLNA 4IQWA
chains in the Genus database with same CATH superfamily
4JD2A 5TKWA 3EY1A 1DK3A 1K8KA 3H3NO 3HL8A 1N6QA 1NOYA 3JPOA 3NFAA 3O8MA 1L8LA 1TUUA 3E0FA 3M5RA 4IS7A 4NLKA 3ENOA 4ZOHC 1Q8KA 4KLFA 4O0JA 3V81A 2P9KB 4OPKA 3BQ7A 2F2AB 2OANA 9ICWA 3AA3A 4LSNA 5ALWA 4BE1A 5K14A 4F5PA 2UXDK 4E7IA 4FWMA 3LWMA 3LP0A 4B3MK 1IIPA 3UXPA 1NGCA 1N36K 3WKAA 4JHDB 2W11A 2QEXN 4DLGA 2BPFA 1ZBSA 4WQ4C 3ZT1A 4LF8K 2BCSA 2Y1JA 5HRRA 3DOLA 4EBCA 4K43A 4TQRA 2YNFA 3WQTA 3MFHA 3GU3A 1N61A 2XIDA 4YD2A 4YXJA 3ISDA 1QCKA 1TE2A 1BA1A 1HYVA 1UQVA 2G08A 2AA4A 2YI1A 1Z00A 5J0XA 3V1OA 2XCPA 1JCEA 4UB6U 4BC4A 3NCIA 4Z6EA 1K5OA 1E4FT 4E1MA 4LFAK 2BGWA 9ICOA 2W9BA 3BZCA 4QZGA 2V4QA 2FDRA 1SKWA 9ICVA 1COKA 1YXQA 2E6LA 1LW0A 3C6UA 4Y2TA 4DV2K 3C6HA 1TAUA 4DKWA 1RM6C 4FWQA 4JN4A 1T3QA 2XC9A 2Q3SA 4O5FA 2W03A 2FXUA 3LYSA 1S0OA 4ED8A 2EDUA 2O8BA 4HCCA 3TWHA 3L3FX 4NV0A 1DT9A 2ZUDA 1S0MA 2F9TA 2BR0A 4I2CA 4LF9K 3MCAB 1CXQA 2P9SA 4Z4CA 2G07A 3C23A 3CPEA 3R1XA 2UVVA 4FS2A 4ISFA 4K0KK 2CGJA 5I9EB 4YOUA 2F1HA 5K4LA 3WK6A 4B8AB 4LY7A 4YNQA 1VQ5N 4Y2XA 1LKYB 4MHVA 5SZTA 2JGUA 4ECZA 3OYGA 3AQFA 1WBBA 4L8RB 1R59O 1S5JA 2VA3A 5FPMA 2Q4TA 2VG6A 3E9LA 2F9WA 5ADXH 2LBOA 4I2HA 1CRXA 2QI2A 4KHPK 2OH2A 4DFMA 3ZSQA 1RTHA 4XQ8A 5AQIA 2GLEA 9ICPA 3BQ1A 4O8KA 2LHTA 3Q7BA 4H0TB 2YY6A 4EELA 4BRQA 3SQ4A 1SQKA 2F1JA 3H8JA 3KK1A 4ECQA 4BQLA 1V4TA 3HJFA 5KT7A 5CJ7A 5J2PA 1SV0A 1NKBA 3L6QA 3KBBA 3KFUF 5AQLA 5KFWA 4DTOA 2QB0A 3R8EA 4R64A 3RJKA 4BRGA 5AZJB 3EKSA 5HHHA 1K6YA 2DFEA 5DBAA 5EWGA 2A40A 4PHDA 2C22A 3QUBA 5AKHA 3HZ6A 3ZX3A 4CGZA 1N8RO 1WSEA 1ECWA 1A5VA 3VEXA 1F5SA 1KVAA 2G8UA 4JKEA 1YT3A 4M9GA 2ZIVB 4PKHA 4P4PA 3L5KA 5J2AA 4FWRA 5J2JA 5HMLA 1JLBA 4X5VA 4JB3A 3AUOA 4BGDA 2LYAA 2YX6A 4FWKA 1KL9A 4IEEA 1HJRA 1MDUB 2KNJA 3UMCA 2NRRA 4JI1K 1OXJA 5BR9A 3K57A 4RQ5A 3NVKA 3BF3A 8ICNA 3PUFA 2UUBK 3QU4A 3VEVA 4J9MA 4UB2A 1KRPA 3NF8A 1BPBA 3M6GA 4C1NI 3KKRA 4NY8A 8ICYA 3H6EA 3AVIA 8ICKA 5J0RA 1QTMA 3ZT0A 4F9OA 1T3NA 2YMMA 3NGDA 1PUZA 4KMOB 3RB0A 3F9MA 4M3WA 3UXNA 4CJFA 3C21A 2O8FB 1VSJA 3LDPA 1GLJO 1TUYA 2QXFA 2IC3A 2NUBA 7ICFA 5AM5A 4BRFA 5KQ8A 4E19A 3SJJA 3ALRA 5CA7A 4BG8A 1HEKA 1MC8A 3EZWA 1TAQA 3O4NA 1WSJA 3TQ1A 4KN7A 2KP7A 7ICJA 3GV5B 4O3QA 2JRZA 3N4QA 1WUAA 4Z4GA 4F71A 2AQ4A 3LM2A 2Q97A 1EP4A 3QIPA 3VTHA 1YITN 4F93B 3PW4A 2OTLN 3ZT4A 3ISCA 3TSPA 4J9LA 2RHKA 4RNOA 2KMDA 1QE1A 2WOMA 3V1QA 4R8UB 3EEQA 5EVZA 3K1ZA 1MQ3A 1WSGA 2J6SA 3CJ7A 3CCSN 5D46A 3MR2A 3HPHA 4CW7B 1OW5A 1ASUA 4PL7A 3OYHA 2PZSA 3C0BA 3GIJA 3LDLA 3LDOA 2P5GA 7ICRA 3UIQA 1K8AO 4Y2YA 5HR7A 4B9NA 4GV6A 2JZBB 3OYAA 2EHGA 3N7RC 2E1YA 4I7FA 4QWAA 2RKIA 3AVLA 1VDVA 2OM6A 1TKXA 1TV6A 2KVCA 2UYTA 3QNNA 5AQSA 2NO4A 2YHYA 1Z4NA 3UB5A 1GLDG 3EPIA 4L3QA 1LB2B 4M04A 5MLCQ 2ZUBA 2AQ0A 5JLFA 1YZ6A 4K25A 2YMLA 4J2BA 4E0DA 3HI0A 4DCHA 4ECSA 1BOTO 3QLHA 4I2FA 4NO7A 2KJ5A 1PVQA 4GY2B 1RXWA 3KWGA 3ZSYA 1GLFO 3MECA 3HOSA 5ALTA 3A0BU 5EOZA 2V7YA 2IMWP 3KTQA 2E8OA 3EO3A 3CC7N 2HF3A 4N56A 4M63C 4DFDA 2VA2A 1B92A 1JCFA 4FBUA 2JZBA 2QWQA 1ZD3A 5DM7L 4CJPA 3GG4A 5AI6A 3EKUA 5AZJA 3T5HA 5ALKA 5AQRA 4JHDA 3CCJN 1NJWA 1OVQA 1S76D 2VWKA 4JK8A 2G8KA 4QZIA 1NM1A 1NGHA 1XSLA 4FM0A 2MU2A 3KHYA 3QFPA 1H38A 1PK1A 4CZEA 3B6PA 4B1XB 5JS1A 2C28A 1VJ5A 3IDHA 3VQ8A 3ZSWA 4CERA 9ICIA 3S3OA 1DRGA 5ALJA 5HP4A 4KLJA 4YHHK 3EYZA 1DLOA 4IO9L 2O4IA 5HRPA 3ZLJA 4US9A 2QKKA 2PFOA 1NJIO 3DDHA 4BRLA 2FMQA 3E1YA 3QINA 4BR2A 7ICGA 1T6DA 1COOA 1IKVA 5AQVA 1IKWA 1S1VA 1ATRA 4UAWA 3BGRA 1JLFA 4JWNA 4EX7A 4FCYA 5ALYA 2BPCA 3ORYA 3E01A 2HF4A 2FMPA 2Q0ZX 4FO6A 4IEIA 3HRDD 1NGDA 4WFBL 3FC4A 3ZDCA 1UCVA 4M9LA 1VSFA 4CRXA 1RDWX 3GIIA 4ECVA 1U6ZA 4ED7A 1RDAA 4CCHA 2ZIUB 2PFQA 1N62A 2V7ZA 2OA8A 3H4BA 1RZTA 1RTIA 3E9PA 3QUQA 3DLEA 1RG6A 1ILYA 2P9IA 3T1HK 3MX5A 4KB1A 1ZETA 4F72A 1DGSA 5DG7A 1RT5A 4OPHA 2GUPA 1Q3UA 3TAQA 3ZEUA 5KFAA 3LP1A 5LY3A 3CJAA 1FO4A 4F92B 2IDOA 3EZ5A 1BL3A 1SZ2A 3OHRA 3UQ0A 4FJLA 1T94A 5J2HA 5FP0A 4QZ9A 2XCAA 3MR6A 5AHXA 3OS2A 2R8GA 3OGUA 3T3FA 1CEZA 1CZ9A 3VENA 1VSEA 4JV0A 2QB0B 1WYGA 5ELZA 1A77A 4CIEA 4PY5A 4O3SA 4IG0A 3L0QA 2AGPA 1X9WA 5EE3A 1RBRA 1IKXA 3TKAA 3GDQA 4NYFA 5G5GA 4RPYA 1REVA 1JKHA 3KK3A 3SENA 5HRNA 5AM0A 2EX3A 3QUCA 2W3SA 2HHHK 5FROA 3HILA 4CF5A 2OHFA 3D2SA 1BIUA 3KLIA 4RG8A 5I3UA 2OYYA 2P9PB 4Z4HA 1M6YA 4CFDA 3A0IX 5KFJA 3WNEA 3M9OB 3D2NA 1YTAA 5KFRA 1IG9A 1C1BA 1ZQQA 1KSPA 3MEDA 5ALHA 4IDKA 2ASJA 2LPEA 1S6PA 4IFEA 1K73O 2BGGA 4YP3A 2ES6A 4FW1A 4CEZA 4CI6A 4KO0A 2AU0A 5ALXA 4Y1CA 4F5QA 3THVA 4CZGA 4H5WA 3AVMA 2CGKA 4F4ZA 8ICOA 2E2OA 2KZZA 2P35A 4C4RA 1XI1A 2F77X 3KZXA 4OJPA 4DU1A 1QS4A 3U6FA 3FZKA 2GO7A 4CJTA 1G99A 4CEDA 3A8YA 4CZKA 3U3GA 4UY8O 4OJ5A 3L8BA 4HHTA 2WF8A 1ZQWA 4MFAA 4NJ8A 3F2DA 5F1XA 3WNHA 3BDPA 2XGPA 4JV2A 4DOBA 3KHHA 5CZ1A 4QWDA 3EL2A 4LFCK 2BKEA 1NK7A 5KFHA 4KLSA 4R5PA 4DL2A 3DRPA 4H0VB 4DV1K 1VQ8N 4KI4A 4P0PA 4A5BA 4J9OA 2EZXA 4HAIA 5DB6A 2I9GA 5AI9A 4MDAA 3IKMA 2P9NB 5KGWA 3O9UA 2EZYA 4R8UA 1TGOA 5AQTA 1OH7A 3CFPA 2P66A 3I76A 3TAMA 4CNQA 4PL1A 3RMDA 3I0RA 3BF1A 4PGQA 5AJ3K 1IM4A 4O9MA 1RBTA 4RPZA 1E3MA 2A1RA 2QA4N 1S0NA 4RQNA 4CHZA 5KFEA 2HVIA 5E84A 2Z1HA 2XVTA 3V6JA 1HLUA 3LAKA 4FOIA 1NK5A 1WSFA 4K8ZA 2HW3A 3HTVA 1VK0A 1ZQPA 4B6JA 3GV7B 1ATNA 2KSOA 4CK3A 4C4TA 2ZXHA 2JEIA 2N1RA 4H4OA 4KFBA 4CHQA 1D5AA 3U9ZA 3KHLA 2KJ8A 1NGAA 4HVJA 2D0CA 2XGQA 4IKFA 4Q43A 2VJ5A 9ICNA 1S5LU 2IVNA 1LOTB 2YHWA 3ZEUB 3TTDA 3LZJA 4KLUA 4UASA 1L6NA 4RW7A 4B9SA 2PI4A 2NRVA 3FE1A 4KMUA 2E2NA 1C1CA 3EUB2 4K42A 5KFUA 2KQ2A 4H5TA 4BC3A 1JALA 5E79U 2ZD1A 5AKXA 4C8LA 4F4KA 4KLLA 4F3OA 2PFPA 3TTFA 3RAXA 2B21A 1X9XA 3GZFA 5KFZA 3ID6A 3MCPA 5AI4A 3UPQA 2IA6A 3R6MA 4FZYA 5M1PA 4BACA 4FPAA 2ZIWA 3OTOK 4RTFD 4WJ3B 4NYNA 4PA1A 1T7PA 2ITMA 2DGZA 4BRMA 2KSOB 4CHOA 3SD7A 2BQUA 1RQNA 3ETRA 2HNZA 3AU6A 3AARA 3LDQA 2KN7A 3NASA 4O4GA 4BREA 2DTUA 1KDHA 2QW9A 4NXMK 1U2VA 1BG3A 3DRSA 1GOCA 1TYQB 3PY8A 1SV0C 4FWPA 1XUPO 2K60A 3KKAA 3ZSRA 5HOOA 3OW2M 4GV3A 2H3FA 2AGOA 3VQ9A 4YOTA 2V9WA 3CC2N 3RWUA 4DR4K 2IS3A 3C7NA 4JEPA 4IJNA 4K8XA 2O8CA 3NGYA 5DQHA 2GWSA 3SPYA 1KAYA 3EE9A 5GADP 3L2RA 4CJ3A 1Z00B 4QNLA 2RLTA 4NWIA 4BRCA 1YVUA 4QS9A 4OJ6A 3U4LA 4B9LA 1L3TA 5A2QO 4CE9A 3D2QA 3VPZA 3SNNA 4PKGA 1N5XA 5BREA 4YMOA 4BR7A 3A5MC 3SAGA 3LM9A 2RP5A 4P4MA 3CJBA 5DBBA 3IN5A 4JKHA 5J1EA 1CZAN 3SUPA 8ICGA 5KFNA 1GLCG 1RDFA 4IL6U 1NKCA 1N32K 2KJ9A 4HCBA 4Q0BA 4H4MA 4RNMA 3AO5A 2BQ3A 1UOCA 1EQYA 3RJIA 3OA9A 1YZ7A 3DEEA 1JROA 1EXQA 3DLLL 1NOMA 1QSLA 4JS4A 4JKCA 2DY4A 4OPJA 4LSLA 1ZD5A 4PPXA 2W40A 5AKLA 2F3NA 1A76A 1W2BM 2HNDA 4Y2SA 1IV0A 5IIJA 3NAEA 1ZQGA 3V1RA 4JI2K 1RQLA 3HM8A 4YY3K 3CCEN 1ZD4A 4ECRA 3HO1A 3QBXA 1ZYQA 2YN4A 4BC5A 3OYDA 4BRAA 3RJJA 4DG1A 1A5XA 2H5XA 3QU2A 2BE2A 3LWLA 4BXOA 4PH5A 3ZSZA 1IJJA 4CEBA 3I8BA 1WUDA 2G09A 4Q8EA 3LALA 5F0XA 1TAMA 2NV3A 5BN9A 5CR4A 2FC0A 2M9NA 2DUYA 7ICEA 2WUSA 1D9FA 1BO5O 4DQPA 5KG3A 1B9FA 1QSSA 1BWFO 4WFNL 3SQ0A 4RQ1A 3PSTA 3ZETB 4ZH4A 4CFCA 1QZ6A 3NVVA 1BU6O 3UKRB 3RBEA 3GV8B 1WCNA 4U6PA 3KVGA 1XSPA 3KKAC 1Y88A 4WCEL 4CHNA 3ETLA 1NGJA 1NK4A 3AVFA 3OY9A 3RJGA 4PJ0U 5KPTA 3SUOA 1X42A 4E7LA 2RPIA 4LD0A 4KLOA 5D3GA 3S3MA 4OX9K 4ED0A 4JI5K 1EX4A 1VHXA 1ZQFA 7ICHA 5EU7A 4O3OA 3MAQA 2KFZA 4M9HA 3TAGA 1VSKA 5JS2A 4MO5A 4LC9B 5KG0A 3DLHA 3VESA 4ILGB 2ZIXA 4OJRA 1EXNA 3LANA 5AQGA 2DFFA 2IVOA 2VYPA 4N76A 1UA0A 3O4WA 3VF4A 4M3XA 1X9SA 4DU4A 2PI5A 1DGKN 2D0AA 2NRTA 2O8EA 4KBOA 5AI5A 1TK5A 4KTZA 3V7LA 3WK7A 5AKJA 4E1JA 1WOQA 1ATSA 5ALUA 3HVTA 2AJQA 4ZTJA 5DGBA 1J9AA 3E66A 4NM2A 2HBKA 2P6UA 1HPMA 3RRGA 3VEYA 2D0BA 3F5TA 4N41A 3TABA 3O3FA 8ICMA 4Q5VA 3BZKA 2R8IA 9ICEA 4BWMA 4MO4A 2A1JA 2A5XA 5C2DA 3QU9A 4Z4IA 2KV2A 1PZNA 3NGZA 5EE1A 2BCVA 1FKPA 1RNHA 3D45A 3VCBA 3BJYA 4GXKA 4F2RA 4Z94A 3MABA 3FZMA 5BRFA 4E7HA 2OPPA 3WU2U 5FDLA 1KCFA 5KG4A 2UUAK 8ICCA 4EP5A 1HNXK 2PKEA 1U04A 2AGQA 3PV8A 1KN5A 1G15A 2OTJN 5BOMA 3HBTA 8ICTA 5J29A 5J2GA 2GWJA 3M9MB 3QZ7A 4M3UA 5AKYA 1ZQLA 2HSTA 4FZXC 1J2MA 5GTHU 5CR0A 4PGXA 3Q8PB 2HHTA 1BIZA 2FBTA 2LSNA 2P9NA 1A0PA 2ZE2A 5AR0A 1VQMN 4FJHA 1ZBFA 1JLQA 1ZQKA 5CYQA 1ZQMA 3LAMA 3OYBA 5AKEA 4FLZA 3OSNA 8ICPA 2YKNA 3NUQA 5KNIA 4JAXA 4IFYA 2IVPA 4B9MA 1MQ2A 3RTVA 4B1YB 4C7YA 5KT5A 1A6SA 1AROP 2PY5A 2HBJA 2A3ZA 5AQHA 1ZXOA 5ALRA 4Y2JA 5KFXA 4FW2A 3IP4B 4KX5A 2YNHA 3WQUA 3Q8MA 5E26A 5E41A 1C0MA 4DSFA 2B5JA 4RT3A 3SAHA 2W55A 2HOIA 3C94A 4FPBA 3M6ZA 2OPSA 3LP3A 3QETA 1Q9YA 4KHWA 4CJSA 3K59A 4M3TA 5FPEA 1SL2A 3PO5A 2HNYA 5ALDA 7ICQA 4CFBA 4FZNA 1QVFM 3LP2A 1L8OA 2B4JA 1Z6RA 3CNHA 1T3VA 3FGUA 4LJXA 1J5EK 4YG2A 4GC7A 4ILHA 1LV5A 4CBXA 2E1FA 3FYHA 1C0GA 3VQDA 4J2DA 4DEZA 1S9FA 2FF3B 4R79A 4GC6A 3RJFA 2LM4A 3THXA 3H45C 4EIAA 3KIOA 4OO1J 4FJJA 4DWIA 2O8DA 1TKTA 3VMFB 2O8BB 4O3NA 4JRQA 2KK0A 3BQTA 3WKCA 3RRHA 2HI0A 4KLHA 5KFSA 1Y64A 4AM6A 2BTFA 4F3TA 4I2GA 4XUSA 1WSHA 4C1NK 1QQ5A 3OHBA 4EFHA 5KFKA 1BA0A 4IJAA 4O8UA 4JI0K 3EN9A 1MN8A 4C23A 2NYVA 3G0ZA 4FM1A 2HMXA 2VKQA 5GIOA 5CRXA 5KFYA 2CPRA 3A5NC 2D1KA 4EHUA 3QYPA 1FFUA 4CJ5A 2EWSA 4UAUA 4K4IA 2GTDA 3RFAA 5DB9A 3TR8A 3ZT2A 1BUPA 1TKDA 1JLCA 2NRXA 4PWDA 2BANA 1P8ZA 3OBWA 1HKCA 3NMUA 4BE0A 2FSKA 3HPGA 4IOAL 3H4DA 4M6WA 5TKYA 3CF5L 1HKGA 2WAQC 1CZBA 4NM1A 1DGJA 1RT1A 2NNWA 4MLHA 4KRFA 5AI0A 1TL1A 1N5YA 1NI3A 5B8HA 4FJ7A 2ZQBA 1QQOA 1U47A 4I2AA 2E2PA 5T14A 5C24A 1Z3EB 3UQ2A 2ALZA 3FZFA 4OJOA 4F4YA 3RSEB 3OYJA 4KX3A 1S6QA 1NGEA 1WNSA 4DUZK 4ED2A 3THXB 2BCQA 2G8FA 2OYQA 3DM2A 5BOLA 4NB4A 4AHCA 5ALSA 3J80O 4BDYA 5F2RA 2JEGA 2FI1A 2EANA 4DOAA 1SAZA 4FJ8A 2ZIUA 3K0SA 4ECYA 4LZDA 2NZTA 3AA2A 3ENBA 4W5TA 4FJMA 1XNRK 3DJCA 1D4XA 1NZBA 4DB3A 5EWEA 3VQ6A 3SLCA 3WXLA 1ZOLA 3ZDAA 5CHIA 4FWLA 3WXMB 4F2SA 4IBNA 3EW9A 2V51B 4HUFA 1IH7A 4DTRA 2IIRA 1JLAA 2JR5A 3AN1A 4BJQA 4QZEA 3IHQB 4J9RA 1BISA 3OS0A 3OYCA 4NLGA 4DQQA 4M9NA 1D8BA 2A1SA 3O9TA 5C10A 2HSZA 1ZQBA 4KHNA 5KL1B 2XRIA 3AVAA 1YJ9N 1TVAA 1LWCA 3THWA 3WKBA 3H0RB 3AO4A 4H0YB 2RDIA 3J7ZO 5ALVA 1Q86O 3KHGA 4E7JA 3IG1A 5J2DA 1ZJMA 1ZQYA 5KTQA 1D8LA 3H8MA 1IKYA 3SV3A 3GBTA 5BPNA 3SI8A 3HP9A 3NHGA 1QQ6A 4R66A 4KKOA 1HUZA 2BUPA 4P4OA 3HWTA 4IR1A 2F8TA 1JL2A 8ICAA 3ULEA 3C65A 2E1EA 5AK5A 5J8YA 3O9SA 4JV1A 4B9TA 3V6DA 4M2YA 2QLTA 3KWIA 1O13A 4CECA 2KVSA 4OD0A 1HNZK 2W43A 4NLBA 3BQ2A 3WUHA 2ISOA 2HHXA 3ZI4A 1VSIA 1HNWK 4F91B 5CHGA 2P6RA 1SGGA 4UATA 2KD1A 3AO3A 1NMDA 2HOEA 4CF4A 1HQUA 4LH5A 7ICPA 2OEHA 7ICKA 2O8EB 4O44A 1WAJA 3NRWA 3MXJA 4RQMA 4BVOA 2JMGA 3DLBA 1XQSC 4X65K 3O1BA 4LH4A 1SWVA 3C6TA 2R7YA 3GOIA 4KLGA 4X62K 5AKKA 5KPRA 2KKPA 4EX6A 2IGIA 3RJEA 3J81j 1N33K 5F9NA 2C2EA 4BE2A 1FJGK 1J54A 3LPUA 4J9QA 4NXNK 2F7TA 5AQMA 1HUXA 2X78A 1Q81O 2IOFA 2KZ3A 5KFCA 1ZBUA 4FZLA 4X66K 3QX7A 5J2BA 4DR5K 2GWKA 4J2EA 1MWKA 3CCVN 4PL2A 1KAZA 1C0UA 2K8AA 4I2BA 1ESVA 2H3VA 4CGHA 3SEIA 1L7MA 5GAEP 3CFRA 4BDZA 5AZIA 4DSLA 5GAGP 5BPMA 4K4HA 2VGMA 5AQKA 2KHOA 5AIBA 4CJRA 4ELVA 4KHYA 1JLGA 4ECTA 2P9LA 4Y2UA 2K8BB 3U9DA 4ILJA 1J5OA 3PSPA 3KKSA 1ZBIA 5JRTA 4I2PA 2YNIA 4MFFA 2W9BB 4KAZA 4H8KA 3K4GA 3MWTA 2CXYA 3ZD9A 1K1SA 3IDWA 5C5JA 4J2AA 1UHUA 4A5AA 1L7OA 3SQIA 1DTTA 1TKZA 1EETA 1NU0A 1W9HA 4DSEA 3PSFA 4QWEA 3NVMA 3BP8A 2QB1A 4WQ5C 4EENA 3DLRA 4CEAA 1BHLA 4JKGB 4RW4A 3ZSVA 3ONNA 3KD5E 3J7AP 4FE3A 4O5BA 3A5OC 3CI5A 4C8OA 4YD1A 2PAVA 4UB1A 1T03A 1FFVA 3AM9A 2ISPA 1ZJNA 3W3DA 3RH4A 5LJWA 2VANA 1GLAG 2E2QA 2WFBA 3PIPL 3C29A 3MBYA 3MDCA 1LKYA 2JHDA 3D2EB 3BS5B 2QARB 2KW4A 3R9KA 3QEIA 8ICJA 3J7YP 9ICCA 4DCCA 5KFOA 2QWMA 4W5QA 1V38A 4QW9A 3O4QA 5DG9A 3HM9A 3SJHA 3G6VA 5BRHA 2JH7A 3ZSOA 3PX4A 3OYEA 2VWJA 1S22A 4P0QA 3M8RA 1TK8A 1ZQEA 3MC1A 1RDUA 3F9KA 1ZQDA 5DMRA 4B1VA 2ZJAA 2G8IA 3E2EA 2QTDA 3MN7A 4FXDA 3WXJA 1Z1VA 2D0PA 4B3TK 2NRHA 3SPZA 3NTUA 7ICVA 2ZUCA 5EY4A 4JK9A 1IV8A 3MXMA 3ZDBA 2Q31A 2WF5A 1S97A 3T19A 1R0AA 4R65A 1GOAA 5AKZA 5KAIU 4MF8A 3SBTA 5JTIA 2A3VA 5AICA 4XA5A 3FAHA 1XSNA 3C1YA 1JCGA 5KG6A 4JKDA 2P9PA 5J2QA 4DSKA 2K4EA 3PR4A 1ITGA 1C7YA 1C1AA 4CZJA 5LMUK 4KTWA 4Z4FA 2PMZC 1Z1BA 2JWLA 1SKSA 9ICKA 1QQ7A 2HCFA 5J2EA 1M1KO 2OZMA 4FOEA 5BRDA 3CFOA 2ODGA 5L1IA 4CF8A 2KHQA 4OLAA 3FLCO 4BG9A 2ZGZA 3N7PD 3CRXA 2RDJA 4CHPA 1BPZA 1RXVA 8ICZA 1NK0A 5HMMA 3IG5A 1UWBA 1VSMA 4BUGA 9ICAA 3M8PA 2F1IA 4DTJA 3DXMA 3L2QA 1ZD2P 2OPRA 3RH5A 1M90O 2EH9A 3QB0A 2UVWA 2JXJA 5B66U 1S3XA 1S9EA 3VEZA 3WEEB 1S8OA 4BRHA 1CXUA 4RT2A 2FLNA 2NO5A 3MGVA 3B9JA 4QZAA 1ZRNA 1KD1O 3Q8RB 4PZOA 4OKEA 3CC4N 3G6YA 4FJXA 1HNVA 4O3RA 2HDOA 2E8MA 1BDGA 1WN7A 2MSNA 3HKZC 1ASVA 1W97L 2BHNA 5ALFA 2YHBA 3MN5A 4ICLA 2EZZA 4FJGA 2Z7JA 2QKQA 3PNCA 4CDGA 9ICJA 3M8QA 4MF2A 4HUEA 5CE3A 2R18A 3OS1A 3Q8KA 1U45A 2ZJ8A 3M6KA 1VRTA 2J6TA 5HR6A 3AO1A 3KHRA 1X66A 5EE0A 3SYZA 3A2FA 4A2AA 1QLNA 1YVNA 2UXBK 2YKMA 2AHOB 3T69A 2ATQA 5ALIA 4OGEA 3CERA 3AEVA 4AHRA 4FJNA 1Q7YO 4CGDA 1UAXA 4YR3A 4ELTA 2R8HA 3H0LB 1RGIA 3C2KA 2QK9A 3VERA 4DTPA 2MUTA 9ICBA 2YHAA 1WSIA 4KLEA 2GUIA 4CHYA 9ICFA 3V9ZA 9ICXA 3FFIA 3C6AA 2YHXA 4PKIA 2XICA 2ZM6K 3B0YA 4I9LA 3VQCA 2FMSA 1PK3A 3MWPA 2VA8A 1Q3VA 3DI6A 2GEMA 4M3ZA 1V85A 4RW8A 5LL6Z 2F96A 2O8FA 4LFBK 1F44A 3K5OA 4CZLA 2KIVA 2EQYA 1X6JA 4DO9A 8ICVA 2QWPA 3CJ9A 4M7YA 3S41A 4BGBA 5L1KA 4FO0A 3K9JA 1DK2A 4ECXA 8ICSA 4CF9A 5AK4A 1ZQAA 5GINA 3O3GA 4DR1K 3IG8A 1JXBA 3JPPA 3NBPA 3JPRA 1L7NA 3FDSA 5JUMA 3O6WA 1XHZA 1ZQRA 4BR4A 1URJA 4O55A 1TV9A 1NK9A 2JWKA 4G3IA 4GNIA 4JKBA 4R63A 2JEFA 4CGJA 3CMEN 1SXDA 3V9WA 1V9PA 2P9SB 1RYRA 1JL1A 2ZJ5A 5AKIA 2WAQF 2Z1IA 1ZQNA 3N4PA 4JS5A 3C2LA 3RMCA 5J0SA 4M3RA 1FKOA 5IT9O 2LMRA 5DB7A 4FVMA 5HRSA 4H5RA 3SMPA 4JI7K 2ZTDA 3QDKA 3LK9A 1Z26A 4NL9A 3L4IA 3OPXA 3VQ4A 4BRKA 4FM2A 1NJZA 2KE7A 5HNKA 2F8KA 1LAWA 3NS1A 3AVCA 3LDNA 4XH5A 4H5VA 1BPXA 1QZ5A 3OYFA 2W8LA 4Q45A 2K89A 4CBWA 3CCMN 1RBSA 3PMNA 2W7OA 2Z1JA 2W9CA 5D4BA 3WT0A 1SZHA 4QJFB 3JPQA 1VSLA 2KHVA 4QOZB 2ZTEA 4DQSA 3H0MB 3VETA 5JU5A 4LF5K 8ICHA 2E4LA 4ELUA 1Q82O 4DSIA 4GMJB 5HL7L 1ZXIA 2KIWA 4F5RA 4O3MA 3LL3A 3JSMA 4GKJK 5AM3A 1U4BA 4DFJA 4OKJA 1BPYA 3KZBA 4M3YA 3RB4A 4MQ3A 4XEIA 1OH8A 4CZMA 4QZCA 2E1ZA 4JRPA 3C5GA 2EAOA 4DUYK 1KVCA 4JLHA 3HK2A 1Q18A 3CM5A 1NGFA 4M47A 4LF4K 3ULDA 4MDBA 4B8CA 4CZIA 1XHXA 5IIMA 3GFKB 4DSJA 2WF9A 2W9AA 2OPQA 3OYIA 3E9OA 3PW7A 5HLFA 4BRDA 1HRHA 3P39A 2AXTU 2P51A 2XY7A 4YN4A 3BS5A 1KLMA 3HW8A 3ASMA 2ZG6A 1T6CA 4DL7A 4RNNA 3BEXA 4YDUC 4KTQA 2BPGA 4OPAA 4OGCA 4CBUA 2G0AA 1C20A 4GXJA 4UAVA 2FLOA 4IRCA 4QW8A 3MDQA 4UAZA 4WYBA 3HOTA 1O03A 1ZQSA 3DAWA 3Q8SB 2KICA 1F21A 1FXXA 3D2FA 1RILA 2Y1IA 3RMBA 1QVGM 4U7BA 4M7XA 1IBKK 4UB3A 2RHFA 1VLBA 4TUPA 1T8EA 7ICIA 2YCHA 5DDMA 2D0OA 4FLXA 3CM6A 1D9DA 1KLNA 1VQKN 2DF4B 4CD3A 3GIKA 2B0CA 4B1ZA 1BPEA 3GDXA 4DMNA 4Y1DA 3TSUA 4FZZA 1ZBHA 5ADXA 5EE9A 5J0OA 4AM7A 1JN3A 2OWOA 4QWBA 1KQQA 5AM2A 4ISGA 4CEQA 3V7KA 3VEOA 3HVRA 2ASPA 4GVMA 4MFBA 1MSWD 2P9UA 3SAFA 4WF9L 3P1GA 2ZF5O 3AGKA 4JMUA 1TK0A 4WQ4A 3VQPA 4MEYA 4YMMA 2IOHA 3OVNA 3H8SA 1ZQUA 1T4GA 1VQ6N 3I0SA 7ICSA 3EWAA 2NLXA 4QCLA 1JIHA 3M9NB 3QMLA 5AI8A 1LWFA 4I27A 4C80A 1J6ZA 4NXZA 3MEEA 3SBGA 3C2MA 2FPKA 3H46O 3L4QA 3RB3A 1JRPA 3KLFA 3QNMA 1N48A 2HBLA 1IG6A 2GV9A 3QZ8A 9ICQA 5F9LA 3D2FB 2WTUA 3BQ0A 7ICNA 2R8KA 1OKJA 3I55N 1KFTA 3HP6A 3M8SA 5I42A 1YTUA 5JVGL 4AH9A 5T7BA 4DV3K 1X9MA 1X40A 2Y0SC 3MGHA 1N5WA 3K75D 2FBXA 2EAMA 5DG8A 5DK5A 8ICBA 2VIXA 1RPLA 3AY9A 3F73A 3UM9A 3WEEA 5J0UA 3J8AA 3MX2A 2KTQA 4XIUA 4OVLA 2BZFA 4QZBA 4BC2A 4QZHA 1BI4A 3DXMB 1HNIA 1RFQA 3N4MB 4DU3A 4TUSA 3F2BA 3KK2A 1RDBA 2W41A 3U8XA 5BPLA 3V9SA 3A0HU 2HMIA 5AQQA 2MRLA 4PHTX 3O1WA 3PZPA 4F4XA 4USAA 3H1VX 4DR7K 5B5EU 5GAHP 1Z05A 3LZIA 1WG8A 5J2CA 3O5BA 2HHSA 4IRKA 2YV0X 3HKZF 2D4WA 1IBMK 3NDKA 2WTFA 3CCUN 4EYIB 1FEZA 4FWOA 3HPOA 1LVHA 4BDPA 5ALQA 2G8WA 5KFLA 4XH1A 1PK1B 1SZPA 3OHAA 3QUTA 4RPXA 4C8KA 1X3NA 5CYMA 4CEFA 4E89A 4JI3K 4B9QA 4HTUA 2LI6A 2RQ5A 3QU7A 4YORA 1XNQK 5AQNA 1OH6A 1KEJA 1Q9XA 1B4FA 4IQTA 4GLXA 2B6AA 2LYBA 1U9LA 5C15A 4FJKA 3T1AA 3ZDEA 1XS9D 2CRXA 4DTUA 4DF4A 4IR9A 4GW6A 2FSNA 3NVWA 2ITGA 3H08A 3MDAA 4H0XB 4US8A 5ALMA 4W5NA 3S9HA 3QERA 4DV0K 2PXIA 4DV4K 2WHEA 2C2RA 4CJQA 1KVBA 4ZTFA 3T79A 4OKKA 4BR9A 3WK8A 4BQZA 2I7NA 3CCRN 2CN1A 4DTSA 2FLPA 1L7PA 4KLDA 1K8KB 3MN9A 4ED3A 2YMPA 4FJ5A 3RBDA 1RCHA 4GVEA 3AVBA 3K2PA 4I29A 1HYZA 2VQEK 7ICOA 2QXLA 3VC8A 2OZSA 3AVJA 4I2DA 2DFLA 3FR0A 9ICGA 1YAGA 4FLWA 2UVUA 4CFAA 2ZIXB 3VN5A 1RBVA 2B6GA 2WC9A 4QAGA 3V9XA 3TFSA 1KFDA 1VQPN 2F44A 3LVWA 9ICLA 4CF0A 4GV9A 5ALPA 4H5NA 5KFIA 3AU2A 5DBCA 3J81O 3MFIA 4KITB 2CGLA 1DXSA 3NH0A 3GE1A 5KG5A 5J2FA 5KGXA 4M45A 1SV4A 4CJVA 4GFJA 4IRDA 2DPIA 4WE1A 2FPMA 3RH6A 3TAPA 4F8RA 1LWEA 3QEBZ 7ICLA 2P1JA 3OYLA 2L5YA 2P9UB 4E1NA 3M1YA 4YR2A 5KFMA 1GLBG 2YQEA 1IO2A 3D6JA 1NGIA 5BR8K 3F2KA 1WBDA 3MXIA 5CB1A 1CI4A 2I5JA 2KG5A 1O1WA 3ZETA 5G5HA 1SIJA 3TARA 3K5LA 1ZQZA 2W04A 4FVUA 3GIMA 1EKEA 2JGAA 3SK3A 2OCEA 3QEVA 5JMVA 3JS6A 3JXUA 3PMLA 3WNFA 4CESA 3L3VA 3T1YK 3W0LA 4FJ9A 1WWVA 4C8MA 1X3MA 4A59A 4O0IA 5IWAK 2YB4A 2FBYA 2IBKA 4ICAA 4EEYA 2JLEA 3ITHA 5C0YA 5KRTA 1RT2A 3OTQA 3CXCM 4NLNA 3DOKA 2DL0A 4LZGA 1X2IA 9ICSA 1SXEA 2W3RA 2IHNA 4DL6A 8ICFA 4ECWA 2DWQA 1Z25A 2IAJA 2Q0UA 2DKZA 1NKEA 1QQCA 3P31A 3ZX0A 3NRZA 1W7AA 5M1NA 3PVXA 1H1VA 3AMZA 3QU5A 4JNEA 4Y2PA 3L2VA 3B6OA 4DFKA 3OJSA 3SUQA 4UB4A 2QKBA 4B3RK 4DLEA 2FF6A 3VGMA 1EWQA 4BGAA 2XY5A 4IWVA 1DOQA 4UAYA 2YMQA 2W54A 2OXOA 2VG5A 2YJEA 1YI2N 1WAFA 2ETJA 4YFUA 4FLTA 2LKYA 3F5EA 1QSYA 2Y0SF 4B3OA 3DXKA 1B22A 1ZRMA 3HJEA 1WB9A 2DPNA 3O80A 2QWRA 5M1OA 4KV8A 3AA5X 3UMGA 5M1QA 4U67L 2WF6A 4C0ZA 1L3SA 2XY6A 1QH9A 3GQCA 1X1PA 3DLKA 4I2JA 3DYAA 3WXIA 4CJEA 4KHUA 2UVRA 1OH5A 4DS5A 2YJFA 3R3LA 1OUQA 3WK9A 4CJKA 1Z4OA 2FE9A 3BUZB 3OJUA 1BCMA 3KLEA 3LDSA 4FK2A 1DTQA 3C1ZA 1SKRA 1JUDA 1N56A 4HUGA 3PR5B 2VWBA 4C8NA 4CEOA 4CZHA 5ALZA 3FFKB 3T5KA 3MGIA 4ISEA 4H03B 2D3DA 1QQNA 2X6SA 3V4IA 2NRWA 4DV6K 4FK0A 3ENHA 3IFRA 1XNSA 1YF5L 5KRSA 5CEHA 2HVHA 2I1QA 1CUKA 1V97A 2VCPA 1SV5A 2ASDA 3T7ZA 3RF9A 4O5CA 5AQXA 5HP1A 1NNLA 4BRIA 1GOBA 2UUCK 3TPQA 4B08A 4MLEA 4CE6A 2K4PA 3K5NA 4P0QB 3UE5A 1IXRA 1RDDA 2Q1NA 2A1JB 3V6KA 1JX4A 4HTLA 3NVYA 5BPCA 2QWLA 1ED1A 5KAFU 4X64K 3PLAA 1L3UA 1ZQVA 8ICUA 1BVSA 1T44A 3QBWA 3I56N 4FSVA 4JYAK 2FJ6A 4JUZA 2G8HA 4E3SA 4DTNA 3KK7A 4O3PA 4B9UA 2DPJA 4CF2A 4GIBA 3IM1A 5ALNA 5AQZA 1EO1A 3CJCA 3PW0A 7ICUA 2A41A 4O5KA 3H8WA 4CJWA 4E7KA 5TISU 4J9PA 4JV5K 4BR5A 4B1UB 3KOOA 4RQ8A 3C5FA 3AVNA 4FWNA 3IV6A 3HRGA 1Y97A 3G4SN 3KD3A 3G6XA 2BQRA 5IINA 2Z1GA 4PL8A 3RJHA 2I5HA 1VQ4N 3Q8QB 1U48A 3G10A 3VTIA 3S3NA 2IOCA 4V19S 2VQFK 3QEPA 4QWCA 4EYHB 3THWB 3BS7A 1I39A 5DGAA 2KKZA 4KH4A 3WNGA 4PHPA 4LVSA 2FSJA 4CF1A 4AYBC 4IQWA 1NZPA 2X6NA 3TAFA 1NNEA 3O9RA 1YIJN 1PVPA 1FIQA 1C0TA 2EAPA 4QS8A 1TYQA 1XWLA 9ICRA 1U49A 2FBVA 3M3ZA 5KT3A 2PMZF 5FPDA 3CW2C 3C7NB 2O8CB 5KL8B 4P0PB 1SWWA 4Q44A 5EWFA 5HROA 2R8JA 2ZJRL 2HOQA 5J0TA 2QM1A 1VRUA 8ICRA 1NGGA 2F4VK 2FLLA 3K5MA 5KT6A 3N28A 3N7SC 3JPTA 1I3AA 2YB1A 4KH6A 2GELA 3WKDA 3WK4A 1SL1A 4QIWF 4AHSA 5KT4A 3D2EA 4FFDA 1D8YA 3NF9A 4PUOA 3RR7A 4CGFA 4EP4A 1N63A 4UW9A 1TVRA 1L3VA 2FPLA 1HUOA 4ACOA 2LYHA 2KOBA 3FZLA 3K9KA 4JKGA 1NOZA 4TSXA 4J9NA 2PBDA 1HKBA 5BN8A 4MEXA 2MUTB 3H7IA 4KI6A 1FK9A 4YDUA 2ASLA 2E8PA 2HMPA 1ZQXA 1Z19A 1GO3F 4A61A 3NGIA 3H1QA 4YQWA 5IIKA 1BQMA 3ZYYX 5F3XB 4TUQA 5EOYA 4OLBA 2PYJA 3ID8A 1NBWA 1FW6A 3VA0A 4CJ7A 4DR2K 1KQSM 4PHAA 1ZQOA 4PGYA 4M6WB 2E5SA 4BROA 3TTCA 2M0NA 3VQQA 1B9DA 4FJIA 4GXIA 4QZFA 1VSHA 3ATVA 4ZHRA 2F8SA 3TFRA 1SL0A 3QO9A 2D5RA 4CD1A 4KLTA 2H3GX 2X74A 9ICHA 1N2XA 8ICQA 1GLLO 3SUNA 2J6UA 2RN2A 2PYLA 1TFRA 3L4PA 4Z6FA 3V9UA 4EHTA 1QQMA 4H0OA 4FWSA 3ZDDA 2MAXA 1NK8A 1WLJA 3CQXA 5D49A 1I94K 4OCZA 4YOXA 2ESEA 1ZQ1C 5EXWA 4A2BA 4WFAL 1N60A 5DQIA 4Y2QA 1NJXA 1S77D 3PIOL 1JMSA 3VA3A 4UB5A 3VQBA 4KN4A 5C25A 1HR0K 3TADA 5FPNA 2E3TA 1OVYA 1RYUA 1W0HA 4KLQA 1VQON 1BNOA 4F4WA 3QICA 2W42A 3QESA 3HX0A 5JLHA 3H3OB 1RYSA 1AQ6A 1SB3C 5TZVA 3T5JA 5JVHL 4I2EA 1VQNN 1JXLA 4BWJA 4MFCA 2O8DB 4UBBA 3NH1A 5J0PA 4F50A 3DMJA 4RQ4A 1YHQN 2LM1A 4RU9A 4I9QA 2I6XA 2ZIVA 5IIIA 1B43A 2CH5A 2QARA 3BY5A 2HBMA 1VSDA 5AM1A 3F2CA 1EWRA 2KKVA 2NRZA 1RT7A 1ZQTA 3ZT3A 3MR5A 3PX0A 4AHUA 5DLFA 4LF6K 3VQ5A 4YOWA 1XO1A 3VQEA 3OSPA 4Z4EA 2MA1A 4KB0A 3ULEB 5FLXO 3F5AA 5J2IA 4ID5A 4XRHA 4M9JA 3CQYA 5KFDA 3G71N 4RUCA 1NMNA 4AILC 4PHEA 4DOCA 4I28A 3SQ1A 3L2UA 1X6IA 5L1MA 5DQGA 2O4GA 5IILA 1LCUA 4BR0A 3QIOA 2ZWHA 4O5EA 2WB1C 3CHWA 4DR3K 5LMNK 1S1UA 4Z6CA 5AZIB 3SMVA 3F53A 4CGGA 3IRXA 4ID1A 1T05A 5FRNA 5M1FA 1HJOA 2P5OA 8ICWA 1CLQA 4BVPA 3PW5A 1HQEA 2YX8A 4FBTA 2I7PA 5AQYA 3GL1A 4TQSA 3UKRA 3PSIA 4QIWC 4IG3A 3IRUA 4Z0UA 3CCQN 3Q7CA 5DKWA 5AQJA 2XI9A 1HMVA 1QHTA 3O3HA 3VGLA 4AF1A 4TURA 4RWTA 4JI4K 5KG2A 2W7PA 3C95A 4JD2B 4RQ2A 2DKXA 2ZXIA 3QXGA 1K9MO 3CQ8A 2K4IA 4CGIA 2J4RA 3L2WA 1VQLN 4BX9C 1NK6A 4M0AA 2ZGYA 4DFPA 3M1FA 3KZIU 4KREA 2BCUA 2P9IB 3QNOA 1IBLK 2H3QA 3E58A 4BRPA 1V4SA 4B9VA 1MWMA 3CG7A 4H0PA 4FLUA 1NWKA 1C6VA 1KAXA 3MK6A 1XMOK 1K1QA 2WONA 2E5LK 2G5IB 2E88A 3NVZA 4UB8U 3O0FA 2H3IA 2GH1A 1RT6A 3NE6A 4UQGA 4PQUA 4CZFA 2BCRA 5SWMA 3MEGA 3OYNA 4EZ9A 4W5OA 5J2NA 3NH2A 4NCGA 1KXPA 1Q46A 2KZMA 3SI6A 4CJUA 4UARA 5AQPA 3WXKA 4DHYA 1J2NA 5ALLA 2KFNA 5KQDA 3MR3A 4DV5K 4OJLA 5J2KA 4ED6A 2HHUA 4DL5A 3ISNC 5KFGA 3UKUA 3TAEA 4RUAA 3AV9A 4YOVA 3ZX2A 2E8NA 3SZ2A 3ZSXA 2ZJPL 3KD1E 4A57A 3EPGA 2BDPA 4IOCL 5KG1A 1JI7A 3O08A 4J8FA 5KFVA 1XMQK 1QHAA 3QE9Y 4RQ7A 4WQ5A 3DV9A 2W6LA 3PW2A 3DWLA 4DQIA 3ICXA 4JKAA 5C2FA 4IQUA 1RTJA 5KFPA 1VQ9N 4DTMA 1ASWA 3CIPA 3N97B 4G9BA 2PFNA 1J97A 3HSCA 4CEEA 4YOYA 1B0XA 3KLGA 3QEXA 4CK1A 3AL0B 3EE8A 5KFTA 4YXMA 3B8AX 3ISBA 4I2QA 1YJWN 2ATLA 4FLVA 4F5NA 2CH6A 4M42A 1UT5A 4I6MA 3WK5A 5CY4A 1YJNN 2IOFK 5AQUA 4DL4A 2V52B 5CWRA 3CP8A 4UBCA 8ICEA 7ICMA 5ALEA 4RQ3A 3NF7A 1WWUA 4U7CA 5A0LA 4G1QA 3JAMO 3O9QA 1NJYA 3T5LA 2WFAA 4QZ8A 1BQNA 3OBYA 4EBDA 5KT2A 7ICTA 3CYMA 9ICUA 4EBEA 4DV7K 3THYA 1NGBA 4FLYA 2WB1F 3WKEA 1KW4A 1RTDA 5ALOA 1XC9A 3CJ1A 5ALGA 1KKXA 2W8KA 4RQ0A 2Y9UA 3PX6A 3SV4A 5AFUH 4CK2A 3VQ7A 5KFQA 4J9KA 2AP1A 2DQNB 2RRDA 2JV3A 3UMBA 5HHIA 4ECUA 4IQVA 1WCLA 2WBNA 4IOXA 2Q36A 4YFKA 1ZC6A 2XHBA 2A19A 5GTIU 2F8LA 5J0YA 4P2HA 4Z6DA 5EX5A 4LF7K 2BDUA 4Y0WA 4GKKK 3B0XA 4N5SA 2GX9A 1GLEG 5AQOA 3CD6N 1S1WA 3S6JA 4RW6A 2YTUA 1L5UA 3JPSA 4CJLA 4CIFA 1NLVA 4Y2VA 3D7EO 4DS4A 1X9JA 3R9PA 3A5LC 3DLGA 3CMAN 3CPWM 5J8YC 9ICTA 1UT8A 3I8DA 2E20A 3ZCMA 2W9CB 1ZQHA 2BH1A 4JK7A 5AQFA 3AQEA 3L3UA 3GILA 8ICLA 3RB6A 2VJ4A 5J0QA 3HSTB 4K41A 2ZJQL 1RT3A 2DBYA 2H3ZA 1SS6A 1HYSA 2E8AA 1F0MA 3AAPA 4CJ4A 3SCXA 3VF2A 1UA1A 1XC3A 2GBZA 3AA4A 3VF6A 3THYB 4I6MB 3HT3A 3TACB 4RZRA 3H40A 4B3SK 1HX1A 2Q2RA 3VEWA 5L1JA 4J03A 3ATUA 2AH5A 4KPYA 4BRNA 5JICA 2ZIWB 1MA9B 8ICXA 3TANA 4JI6K 1BNPA 1JLEA 1O08A 4KHSA 2QWNA 4ED1A 3ALYA 2ZTCA 3TADC 2XY8A 9ICMA 3K58A 2QWOA 2UU9K 5J0WA 3LPTA 2V4RA 3CCLN 1UPHA 3I1YA 5AQWA 3ED5A 5L9XA 3KLHA 4BY9C 5GIPA 3V72A 2DFHA 5H1SQ 2JH1A 5C42A 5KFFA 4FL9A 5AK6A 2W6KA 5FRMA 3UKUB 1BGXT 2G5HB 2HHWA 1JXEA 3PO4A 3I28A 5AK3A 1TL3A 4KH5A 4A8EA 1KBUA 4DQ8A 3RMAA 1VQ7N 3DRRA 3IUCA 3TSQA 3VGKA 5J2MA 3SR6A 2W9MA 4W5RA 4FK4A 2HB5A 1S1TA 2JEJA 5KI6A 3TI0A 5CP2A 5C12A 4C4SA 3CETA 1J53A 4IFVA 5H2FU 4RW9A 3SMSA 1LAVA 2P9LB 2D8CA 1RT4A 4M41A 1RDCA 4DTXA 3KJVA 5AFUA 4EEKA 3AVGA 3UXOA 3K1RB 4DR6K 4PZNA 5IIOA 4F5OA 4JK1A 4HWIA 5L1LA 1S72N 4DL3A 1ZQJA 3JYTA 1SUQA 4J9SA 3VOVA 2ASMA 4KLMA 4A62A 5DM6L 3I33A 3V6HA 4DQRA 4BXOB 1RBUA 4HYKA 1ZQCA 2RF2A 4K4GA 4N47A 2O6KA 2VGNA 4NCAA 2KEYA 3ZD8A 4IZ9A 1KC8O 1ZQIA 3C28A 4DF8A 1XO0A 4NLZA 1XU4A 2C2DA 1S0VA 4YR0A 4AHVA 2XO7A 4RQ6A 3DXKB 4EZ6A 3FZHA 4XH4A 4FYDA 4IC9A 3OYMA 4JWMA 1ZBLA 2IHMA 2ASOA 2PFUA 1KTQA 4NCBA 3HXMA 3VQAA 5M1KA 5KG7A 4G9ZA 3P83D 3QFUA 4YCXA 1P7DA 1A5WA 4I2IA 5AM4A 5DLGA 2VG7A 4AYBF 4CVNE 3D6RA 3U26A 4Y2RA 4KLIA 3G25A 4AQYK 2D6FC 2Y9TA 1HJPA 3AVKA 1BPDA 2RE2A 3AO2A 4YMNA 3AVHA 3P5JA 3U3YA 4IXCA 3D0PA 2K4HA 2YNGA 1IG8A 3RVCA 2F76X 3RSEA 2G06A 1E4GT 1Q8IA 3IS9A 3P4IA 1N34K 5KPZA 2K8CB 3RR8A 1YUWA 1KFSA 3LVVA 4KHQA 3FM9A 2G8VA 1DKGD 4CIGA 3LDAA 2HHQA 2E6MA 3OYKA 1S10A 3AAQA 5DB8A 2WF7A 2A42A 4NLCA 2KLAA 1VAZA 1BCOA 1C0FA 2P9KA 2Q0RA 4Q8FA 5KFBA 1S1XA 2A6AA 1MA7A 3SQ2A 1DEJA 4FZMA 8ICIA 4RCHA 4QS7A 3IMXA 4YVZA 3AGRA 1HIWA 3RAQA 3JPNA 1BI4B 3M7DA 4B1WB 5LJVA 4CF3A 4AHTA 3QEWA 3MMVA 1U2VB 1JJ2M 2UXCK 5AIAA 5DDYA 1PVRA 4IO8A 4EAHD 3NF6A 3HYFA 3MN6A 3TU5A 4JI8K 2GOLA 1P90A 2HOFA 3G6EN 4C7ZA 2A1AA 1LW2A 4NL9C 1MU2A 2HHVA 1HPZA 3P38A 4IDHA 5AKGA 4QZDA 4JKFA 3Q8LA 4FS1A 3IAYA 1NG9A 3V7JA 5HBMA 3QEAZ 5CZ2A 4AP9A 1S9GA
chains in the Genus database with same CATH topology
4JD2A 5TKWA 1K8KA 3H3NO 3JPOA 3O8MA 1TUUA 3M5RA 4NLKA 3ENOA 4KLFA 2P9KB 2OANA 9ICWA 4F5PA 4FWMA 3LWMA 3UXPA 1NGCA 4JHDB 2QEXN 4DLGA 2BPFA 1ZBSA 4WQ4C 2BCSA 2Y1JA 4EBCA 4K43A 4TQRA 3WQTA 3MFHA 4YD2A 3ISDA 4YXJA 1BA1A 2AA4A 2YI1A 4BC4A 1Z00A 5J0XA 2XCPA 1JCEA 4Z6EA 1E4FT 2BGWA 9ICOA 1YXQA 4QZGA 2V4QA 2W9BA 1SKWA 9ICVA 3C6HA 1TAUA 4DKWA 4FWQA 4JN4A 2XC9A 4O5FA 2FXUA 1S0OA 4ED8A 1DT9A 2ZUDA 1S0MA 2F9TA 2BR0A 4I2CA 3MCAB 2P9SA 3CPEA 3C23A 3R1XA 4ISFA 2UVVA 4FS2A 2CGJA 5I9EB 4YOUA 2F1HA 1VQ5N 4ECZA 1R59O 2VA3A 5FPMA 3E9LA 2F9WA 5ADXH 4I2HA 2QI2A 4DFMA 4XQ8A 5AQIA 9ICPA 3BQ1A 4O8KA 3Q7BA 4H0TB 4BRQA 1SQKA 2F1JA 3H8JA 4ECQA 4BQLA 1V4TA 5KT7A 5CJ7A 1NKBA 3L6QA 5AQLA 5KFWA 3R8EA 4R64A 3RJKA 4BRGA 5AZJB 3EKSA 5HHHA 5DBAA 5EWGA 2A40A 4PHDA 2C22A 3HZ6A 3ZX3A 1N8RO 3VEXA 4JKEA 4M9GA 4PKHA 4P4PA 5J2AA 4FWRA 5J2JA 5HMLA 4X5VA 3AUOA 4BGDA 2YX6A 4FWKA 4IEEA 1MDUB 2NRRA 5BR9A 4RQ5A 3NVKA 3BF3A 8ICNA 3VEVA 4J9MA 4UB2A 1KRPA 1BPBA 3M6GA 4C1NI 4NY8A 8ICYA 3H6EA 8ICKA 5J0RA 1QTMA 4F9OA 1T3NA 3NGDA 3RB0A 3F9MA 3UXNA 3C21A 3LDPA 1GLJO 1TUYA 7ICFA 5KQ8A 4BRFA 5CA7A 4BG8A 1MC8A 3EZWA 1TAQA 3TQ1A 4KN7A 7ICJA 3GV5B 4O3QA 3N4QA 1WUAA 2AQ4A 3LM2A 2Q97A 3VTHA 1YITN 4F93B 3PW4A 2OTLN 3ISCA 3TSPA 4J9LA 2RHKA 4RNOA 4R8UB 5EVZA 1MQ3A 2J6SA 3CJ7A 3CCSN 5D46A 3MR2A 4PL7A 3C0BA 3GIJA 3LDLA 3LDOA 7ICRA 1K8AO 4B9NA 4GV6A 2JZBB 2E1YA 4QWAA 2UYTA 5AQSA 2YHYA 3UB5A 1GLDG 3EPIA 4L3QA 1LB2B 4M04A 5MLCQ 2ZUBA 2AQ0A 5JLFA 4K25A 4E0DA 3HI0A 4DCHA 4ECSA 1BOTO 4I2FA 4NO7A 4GY2B 1RXWA 3KWGA 3HOSA 1GLFO 5EOZA 2V7YA 2IMWP 3KTQA 3EO3A 3CC7N 2HF3A 4M63C 2VA2A 1JCFA 4FBUA 2JZBA 2QWQA 5DM7L 3GG4A 3EKUA 5AZJA 3T5HA 5AQRA 3CCJN 4JHDA 1NJWA 1S76D 4JK8A 4QZIA 1NM1A 1NGHA 1XSLA 3KHYA 3QFPA 1H38A 4CZEA 4B1XB 2C28A 3IDHA 9ICIA 5HP4A 4KLJA 3EYZA 4IO9L 2PFOA 1NJIO 4BRLA 2FMQA 3E1YA 4BR2A 7ICGA 1T6DA 1COOA 5AQVA 1ATRA 4UAWA 4JWNA 2BPCA 3ORYA 2HF4A 2FMPA 2Q0ZX 4FO6A 4IEIA 4WFBL 1NGDA 3ZDCA 4M9LA 1RDWX 3GIIA 4ECVA 1U6ZA 4ED7A 4CCHA 2PFQA 2V7ZA 3H4BA 1RZTA 3E9PA 1ILYA 2P9IA 3MX5A 1ZETA 1DGSA 5DG7A 4OPHA 2GUPA 3ZEUA 3TAQA 5KFAA 5LY3A 3CJAA 4F92B 3EZ5A 1SZ2A 3OHRA 3UQ0A 5J2HA 4QZ9A 2XCAA 3MR6A 2R8GA 3OGUA 3T3FA 1CEZA 3VENA 4JV0A 5ELZA 1A77A 4O3SA 3L0QA 2AGPA 1X9WA 3GDQA 4RPYA 2P9PB 3A0IX 5KFJA 3M9OB 5KFRA 1ZQQA 1KSPA 2ASJA 4IFEA 1K73O 4YP3A 4CI6A 2AU0A 4F5QA 3THVA 4CZGA 4H5WA 2CGKA 4F4ZA 8ICOA 2E2OA 2KZZA 3FZKA 1G99A 3A8YA 4CZKA 4UY8O 1ZQWA 4MFAA 5F1XA 3BDPA 2XGPA 4JV2A 4DOBA 3KHHA 4QWDA 3EL2A 2BKEA 1NK7A 5KFHA 4KLSA 4DL2A 4H0VB 1VQ8N 4A5BA 5DB6A 4J9OA 2I9GA 4MDAA 3IKMA 2P9NB 3O9UA 4R8UA 5AQTA 2P66A 3BF1A 4PGQA 1IM4A 4O9MA 4RPZA 2QA4N 1S0NA 5KFEA 2HVIA 5E84A 3V6JA 1HLUA 4FOIA 1NK5A 2HW3A 3HTVA 1ZQPA 3GV7B 1ATNA 2JEIA 3U9ZA 3KHLA 1NGAA 2XGQA 4Q43A 9ICNA 2IVNA 1LOTB 2YHWA 3ZEUB 3TTDA 4KLUA 4B9SA 2PI4A 2NRVA 3FE1A 4KMUA 2E2NA 4K42A 5KFUA 4H5TA 4BC3A 4C8LA 4F4KA 4KLLA 4F3OA 2PFPA 3TTFA 3RAXA 2B21A 5KFZA 3ID6A 3MCPA 3UPQA 3R6MA 2IA6A 5M1PA 4FPAA 4RTFD 1T7PA 2ITMA 4BRMA 2BQUA 3LDQA 3AU6A 3AARA 2KN7A 4BREA 1KDHA 2QW9A 1U2VA 1BG3A 1TYQB 3PY8A 4FWPA 1XUPO 5HOOA 3OW2M 4GV3A 2AGOA 3CC2N 4YOTA 2V9WA 3C7NA 4JEPA 4IJNA 5DQHA 2GWSA 1KAYA 3EE9A 5GADP 1Z00B 4BRCA 4QS9A 3U4LA 4B9LA 1L3TA 3VPZA 4PKGA 5BREA 4YMOA 4BR7A 3A5MC 3LM9A 3SAGA 4P4MA 3CJBA 5DBBA 4JKHA 1CZAN 8ICGA 5KFNA 1GLCG 1NKCA 4RNMA 2BQ3A 1EQYA 3RJIA 3OA9A 3DLLL 1NOMA 1QSLA 4JKCA 4PPXA 2W40A 1A76A 1W2BM 5IIJA 1ZQGA 3CCEN 3HM8A 4ECRA 3QBXA 1ZYQA 4BC5A 4BRAA 3RJJA 2H5XA 3LWLA 4BXOA 4PH5A 1IJJA 3I8BA 4Q8EA 5F0XA 5BN9A 5CR4A 2WUSA 2M9NA 7ICEA 1D9FA 1BO5O 4DQPA 5KG3A 1QSSA 1BWFO 4WFNL 4RQ1A 3ZETB 4ZH4A 1QZ6A 3UKRB 1BU6O 3RBEA 3GV8B 1WCNA 3KVGA 4WCEL 1XSPA 1Y88A 3ETLA 1NGJA 1NK4A 3RJGA 5KPTA 4KLOA 4ED0A 1ZQFA 7ICHA 4O3OA 2KFZA 4M9HA 4MO5A 4LC9B 5KG0A 3VESA 4ILGB 1EXNA 5AQGA 2IVOA 2VYPA 1UA0A 3O4WA 3VF4A 1X9SA 2PI5A 1DGKN 2NRTA 4KBOA 1TK5A 3V7LA 4E1JA 1WOQA 1ATSA 2AJQA 5DGBA 3E66A 4NM2A 2P6UA 2HBKA 1HPMA 3RRGA 3VEYA 3F5TA 8ICMA 2R8IA 9ICEA 4BWMA 4MO4A 2A1JA 2A5XA 5C2DA 1PZNA 2BCVA 3BJYA 4GXKA 4F2RA 4Z94A 5BRFA 3MABA 3FZMA 5KG4A 8ICCA 2AGQA 3PV8A 2OTJN 5BOMA 3HBTA 8ICTA 5J29A 5J2GA 2GWJA 3M9MB 3QZ7A 1ZQLA 2HSTA 5CR0A 4PGXA 3Q8PB 2HHTA 2P9NA 5AR0A 1VQMN 1ZQKA 1ZQMA 3OSNA 8ICPA 4JAXA 2IVPA 4B9MA 1MQ2A 3RTVA 4B1YB 5KT5A 1AROP 2HBJA 2A3ZA 5AQHA 1ZXOA 5KFXA 3WQUA 3Q8MA 5E26A 4DSFA 4RT3A 3SAHA 4FPBA 5FPEA 1SL2A 3PO5A 7ICQA 1QVFM 1Z6RA 1T3VA 3FGUA 4YG2A 4GC7A 4ILHA 1LV5A 4CBXA 3FYHA 1C0GA 4DEZA 1S9FA 2FF3B 4R79A 4GC6A 3RJFA 3H45C 4EIAA 4OO1J 4DWIA 3VMFB 4O3NA 3BQTA 3RRHA 4KLHA 1Y64A 5KFSA 4AM6A 2BTFA 4I2GA 4XUSA 4C1NK 3OHBA 4EFHA 5KFKA 1BA0A 4IJAA 4O8UA 3EN9A 4C23A 5GIOA 5KFYA 3A5NC 2D1KA 4EHUA 2EWSA 4K4IA 2GTDA 5DB9A 1BUPA 1TKDA 2NRXA 1P8ZA 3OBWA 1HKCA 3NMUA 2FSKA 4IOAL 3H4DA 4M6WA 5TKYA 3CF5L 1HKGA 4NM1A 2NNWA 4MLHA 5B8HA 1QQOA 1U47A 4I2AA 2E2PA 1Z3EB 3UQ2A 2ALZA 3FZFA 4F4YA 3RSEB 1NGEA 4ED2A 2BCQA 5BOLA 4NB4A 5F2RA 2JEGA 4DOAA 1SAZA 4ECYA 4LZDA 2NZTA 3ENBA 3DJCA 1D4XA 4DB3A 5EWEA 3SLCA 3WXLA 3ZDAA 5CHIA 4FWLA 3WXMB 4F2SA 3EW9A 2V51B 2IIRA 4QZEA 3IHQB 4J9RA 4NLGA 4DQQA 4M9NA 3O9TA 5C10A 1ZQBA 1YJ9N 1TVAA 4H0YB 2RDIA 3J7ZO 1Q86O 3KHGA 5J2DA 1ZJMA 1ZQYA 1D8LA 5KTQA 3SV3A 3GBTA 5BPNA 3SI8A 4R66A 1HUZA 2BUPA 4P4OA 3HWTA 4IR1A 8ICAA 3ULEA 3C65A 3O9SA 4JV1A 4B9TA 4M2YA 3KWIA 1O13A 4NLBA 3BQ2A 3WUHA 2ISOA 2HHXA 4F91B 5CHGA 2P6RA 1NMDA 2HOEA 7ICPA 7ICKA 4BVOA 1XQSC 3O1BA 3GOIA 4KLGA 5KPRA 3RJEA 5F9NA 2C2EA 4J9QA 2F7TA 5AQMA 1HUXA 1Q81O 2KZ3A 5KFCA 5J2BA 2GWKA 1MWKA 3CCVN 1KAZA 4I2BA 1ESVA 5GAEP 5AZIA 4DSLA 5GAGP 5BPMA 4K4HA 2VGMA 5AQKA 2KHOA 4ELVA 4ECTA 2P9LA 3U9DA 4ILJA 4MFFA 2W9BB 3K4GA 3MWTA 3ZD9A 1K1SA 5C5JA 4A5AA 4DSEA 4QWEA 3NVMA 3BP8A 4WQ5C 4JKGB 3A5OC 3CI5A 4C8OA 4YD1A 2PAVA 4UB1A 2ISPA 3W3DA 1ZJNA 3RH4A 5LJWA 2VANA 1GLAG 2E2QA 2WFBA 3PIPL 3MBYA 3MDCA 3D2EB 8ICJA 9ICCA 5KFOA 2QWMA 4QW9A 5DG9A 3SJHA 3G6VA 5BRHA 3PX4A 1S22A 3M8RA 1TK8A 1ZQEA 1RDUA 1ZQDA 4B1VA 2ZJAA 3E2EA 2QTDA 3MN7A 3WXJA 2D0PA 2NRHA 3NTUA 7ICVA 2ZUCA 5EY4A 4JK9A 3ZDBA 2Q31A 1S97A 4R65A 4MF8A 3SBTA 4XA5A 1XSNA 3C1YA 1JCGA 5KG6A 4JKDA 2P9PA 4DSKA 3PR4A 1C7YA 4CZJA 2JWLA 1SKSA 9ICKA 5J2EA 1M1KO 4FOEA 5BRDA 5L1IA 3FLCO 4BG9A 2ZGZA 2RDJA 1BPZA 1RXVA 8ICZA 1NK0A 5HMMA 9ICAA 2F1IA 3DXMA 3RH5A 1M90O 3QB0A 2UVWA 1S3XA 3WEEB 3VEZA 4BRHA 4RT2A 2FLNA 4QZAA 1KD1O 3Q8RB 3CC4N 3G6YA 4O3RA 1BDGA 1W97L 2BHNA 3MN5A 3PNCA 9ICJA 4MF2A 5CE3A 3Q8KA 1U45A 2ZJ8A 2J6TA 3KHRA 3SYZA 4A2AA 1QLNA 1YVNA 3T69A 3CERA 1Q7YO 4YR3A 4ELTA 2R8HA 1RGIA 3C2KA 3VERA 2MUTA 9ICBA 4KLEA 9ICFA 9ICXA 3C6AA 2YHXA 4PKIA 3B0YA 2FMSA 3MWPA 2VA8A 2GEMA 4CZLA 4DO9A 8ICVA 2QWPA 3CJ9A 4M7YA 3S41A 4BGBA 5L1KA 4FO0A 3K9JA 4ECXA 8ICSA 1ZQAA 5GINA 3JPPA 3JPRA 3FDSA 5JUMA 3O6WA 1ZQRA 4BR4A 1TV9A 1NK9A 2JWKA 4G3IA 4GNIA 4JKBA 4R63A 2JEFA 3CMEN 1V9PA 2P9SB 1RYRA 2ZJ5A 1ZQNA 3N4PA 3C2LA 5J0SA 5DB7A 4H5RA 3SMPA 2ZTDA 3QDKA 3LK9A 3L4IA 4BRKA 1NJZA 3LDNA 5HNKA 4XH5A 4H5VA 1BPXA 1QZ5A 2W8LA 4Q45A 4CBWA 3CCMN 3PMNA 2W9CA 5D4BA 3WT0A 3JPQA 2ZTEA 4DQSA 3VETA 8ICHA 4ELUA 1Q82O 4DSIA 5HL7L 4F5RA 3LL3A 1U4BA 4DFJA 1BPYA 3KZBA 3RB4A 4XEIA 4CZMA 4QZCA 2E1ZA 3C5GA 1Q18A 1NGFA 4M47A 4MDBA 4CZIA 5IIMA 3GFKB 4DSJA 2W9AA 3E9OA 3PW7A 4BRDA 3P39A 2XY7A 4YN4A 3HW8A 1T6CA 4DL7A 4RNNA 3BEXA 4YDUC 4KTQA 2BPGA 4OPAA 4CBUA 4GXJA 2FLOA 4IRCA 4QW8A 3MDQA 4UAZA 4WYBA 3HOTA 1ZQSA 3DAWA 3Q8SB 3D2FA 2Y1IA 1QVGM 4U7BA 4M7XA 4UB3A 1T8EA 4TUPA 7ICIA 2YCHA 5DDMA 2D0OA 1D9DA 1KLNA 1VQKN 4CD3A 3GIKA 4B1ZA 1BPEA 3GDXA 3TSUA 5ADXA 5J0OA 4AM7A 1JN3A 2OWOA 4QWBA 4ISGA 3V7KA 3VEOA 2ASPA 1MSWD 2P9UA 3SAFA 4WF9L 2ZF5O 3AGKA 1TK0A 4WQ4A 4MEYA 4YMMA 3H8SA 1ZQUA 1T4GA 1VQ6N 7ICSA 3EWAA 2NLXA 1JIHA 3M9NB 3QMLA 4I27A 1J6ZA 4NXZA 3SBGA 3C2MA 2FPKA 3H46O 3L4QA 3RB3A 1N48A 2HBLA 3D2FB 3QZ8A 9ICQA 5F9LA 3BQ0A 7ICNA 2R8KA 1OKJA 3I55N 1KFTA 3HP6A 3M8SA 5JVGL 1X9MA 3MGHA 3K75D 5DG8A 8ICBA 1RPLA 3AY9A 3WEEA 5J0UA 3J8AA 3MX2A 2KTQA 4QZBA 4BC2A 4QZHA 3DXMB 1RFQA 3N4MB 4TUSA 2W41A 3U8XA 5BPLA 5AQQA 4PHTX 3O1WA 4F4XA 3H1VX 5GAHP 1Z05A 5J2CA 3O5BA 2HHSA 4IRKA 2D4WA 2WTFA 3CCUN 4EYIB 4FWOA 3HPOA 4BDPA 5KFLA 4XH1A 1SZPA 3OHAA 4RPXA 4C8KA 1X3NA 4B9QA 4YORA 5AQNA 1KEJA 4IQTA 4GLXA 1U9LA 5C15A 3ZDEA 1XS9D 4DF4A 4IR9A 2FSNA 3MDAA 4H0XB 2PXIA 2C2RA 4BR9A 4BQZA 2I7NA 3CCRN 2FLPA 4KLDA 1K8KB 3MN9A 4ED3A 3RBDA 4GVEA 4I29A 7ICOA 2QXLA 4I2DA 2DFLA 3FR0A 9ICGA 1YAGA 2UVUA 2WC9A 1VQPN 3TFSA 1KFDA 9ICLA 4GV9A 4H5NA 5KFIA 3AU2A 5DBCA 3MFIA 4KITB 2CGLA 3GE1A 5KG5A 5J2FA 4IRDA 2DPIA 2FPMA 3RH6A 3TAPA 4F8RA 3QEBZ 7ICLA 2P9UB 4YR2A 5KFMA 1GLBG 1NGIA 3F2KA 5CB1A 3ZETA 3TARA 1ZQZA 4FVUA 3GIMA 3SK3A 5JMVA 3JS6A 3JXUA 3PMLA 3W0LA 4C8MA 1X3MA 4A59A 4O0IA 2IBKA 4EEYA 5C0YA 3CXCM 4NLNA 4LZGA 1X2IA 9ICSA 2IHNA 4DL6A 8ICFA 4ECWA 2Q0UA 1NKEA 3P31A 3ZX0A 5M1NA 3PVXA 1H1VA 4JNEA 4DFKA 3OJSA 4UB4A 4DLEA 2FF6A 3VGMA 4BGAA 2XY5A 4IWVA 1DOQA 4UAYA 2YJEA 1YI2N 1QSYA 3DXKA 1B22A 2DPNA 3O80A 2QWRA 5M1OA 5M1QA 4U67L 1L3SA 2XY6A 3GQCA 3WXIA 4I2JA 2UVRA 4DS5A 2YJFA 3R3LA 3BUZB 3OJUA 3C1ZA 1SKRA 1N56A 2VWBA 3PR5B 4C8NA 4CZHA 3FFKB 3T5KA 3MGIA 4ISEA 4H03B 1QQNA 2NRWA 3ENHA 3IFRA 1YF5L 2HVHA 2I1QA 1CUKA 2VCPA 2ASDA 3T7ZA 4O5CA 5AQXA 4BRIA 3TPQA 4MLEA 3UE5A 1IXRA 4HTLA 2Q1NA 2A1JB 3V6KA 1JX4A 3PLAA 5BPCA 2QWLA 1L3UA 1ZQVA 8ICUA 1BVSA 1T44A 3QBWA 3I56N 4FSVA 4JUZA 3KK7A 4O3PA 4B9UA<