2NRVA

Crystal structure of the c-terminal half of uvrc
Total Genus 75
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
75
sequence length
218
structure length
218
Chain Sequence
b'RGLRKEALEELMKLLNMKDFPYRIEGIDISHLQGKYTVASLVVFEDGFPKKGDYRRYKIEQDHPDDYESIRTVVKRRYSKHPLPNLLFVDGGIGQVNAAIEALKEIGKDCPVVGLAKKEETVVFENREIHLPHDHPVLRLLVQIRDETHRFAVSYHRKRREKESLRSVLDNVPGIGPIRKKKLIEHFGSLENIRSASLEEIARVIGSTEIARRVLDIL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords UvrABC system protein C
publication title Structure of the C-terminal half of UvrC reveals an RNase H endonuclease domain with an Argonaute-like catalytic triad.
pubmed doi rcsb
source organism Thermotoga maritima
molecule tags Hydrolase
total genus 75
structure length 218
sequence length 218
chains with identical sequence B
ec nomenclature
pdb deposition date 2006-11-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF08459 UvrC_HhH_N UvrC Helix-hairpin-helix N-terminal
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.20 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 5' to 3' exonuclease, C-terminal subdomain 2nrvA02
3.30.420.340 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Nucleotidyltransferase; domain 5 2nrvA01
4DL6A 2ASJA 2UVWA 3C2KA 2PI4A 3ZDEA 3TI0A 3GIMA 4KLDA 3H8JA 4KITB 2XGPA 4KLEA 2HHTA 9ICKA 3SZ2A 9ICTA 4F92B 2PXIA 2IHNA 4ELTA 1ZQAA 3K4GA 2XGQA 1AROP 2IHMA 4DF8A 1SKSA 8ICBA 3PW2A 4O3SA 1ZQLA 4IRDA 8ICAA 5DQGA 3ETLA 4B9NA 2PFNA 8ICFA 9ICVA 3AU2A 5F9NA 4F5OA 3HT3A 3ZDDA 8ICHA 8ICSA 1ZQIA 2BR0A 2AJQA 2NRVA 3RH4A 4PPXA 7ICMA 3N4MB 4I2AA 3KHHA 1NKBA 3JPPA 7ICQA 4EBEA 2AU0A 5KFGA 4DS4A 2MUTB 2BCSA 4QW9A 3RB3A 2DPIA 3E2EA 4MFCA 4MF8A 4M9GA 1TKDA 1N56A 3EWAA 5J2AA 5TZVA 5J2EA 4UB1A 1L3SA 3BDPA 2AQ0A 3PX4A 3HP6A 4YXJA 4F4WA 4GC6A 3V72A 2UVVA 2R8GA 1HUOA 1IM4A 7ICKA 9ICNA 5KFDA 2I9GA 2W9AA 2BCRA 3V7KA 1ZQRA 2XCPA 2KZZA 4KLSA 2P6UA 4RQ4A 1NK4A 2PI5A 2BQUA 4O0IA 5KFIA 5KFLA 4ED0A 4O5EA 4GXIA 4FBUA 4K4HA 3V7LA 2HVHA 4R66A 2AGPA 4IQTA 4KLFA 5IIJA 1L3TA 2C2EA 1MC8A 4XQ8A 5F9LA 3G6YA 2FLNA 4DSIA 4KLQA 9ICMA 3UQ0A 5CHGA 7ICUA 2BCUA 4UB4A 4DSFA 4DF4A 1WCLA 3PR5B 1S0NA 4I2CA 2KFZA 4TUPA 5D4BA 4Q8FA 4IR9A 3RJGA 2KFNA 4JV2A 3GQCA 5L9XA 1BPYA 4I2FA 2JZBB 2VA8A 5C5JA 3RJEA 2PFPA 3RR8A 4F2RA 5KFXA 3GILA 3MR2A 3M9OB 9ICBA 1BPEA 4RNNA 1NK6A 5J2JA 3KHRA 7ICNA 3MR5A 1Z00A 4KLOA 4YMMA 5J0TA 4TURA 1S0OA 4QWCA 4TUSA 5DKWA 3C5FA 4X5VA 4R63A 5KFCA 3QZ8A 1UT8A 3OJSA 3PO4A 4KLTA 5DB6A 3OGUA 1ZQVA 3T5HA 4RQ0A 4DL7A 2MAXA 4LZDA 3PR4A 1XS9D 3NTUA 2J6TA 3JPTA 4C8MA 5J2BA 5BPCA 1RXWA 1L3VA 3PV8A 4F5NA 4NLNA 4PHAA 4KN4A 4FS2A 3PX6A 3Q8LA 4B9LA 4R8UA 5J2HA 4JV1A 2W8LA 4ED6A 4ED7A 7ICLA 3M8SA 1KTQA 3ZDBA 4P4PA 4DLEA 5DG9A 5KFZA 2FMPA 3ORYA 4XRHA 4I2BA 4PHDA 4C8KA 8ICYA 4DQSA 3ZD8A 3PW4A 2KN7A 1NK5A 5IIKA 1K1SA 4UBCA 1SKRA 2XO7A 4P2HA 4CCHA 5D46A 3MGIA 3N97B 9ICAA 2ALZA 2HHQA 2A1JB 2NRZA 8ICTA 5DQHA 8ICLA 4ECRA 5IINA 5J0XA 4F4YA 1Y88A 7ICIA 5J0YA 2BCQA 8ICWA 4YG2A 4RNMA 8ICJA 1X9SA 1KDHA 8ICCA 1NJZA 1NK9A 1U9LA 4EBCA 1QLNA 4GXJA 7ICTA 5J2GA 4YR2A 4QWDA 4HYKA 9ICWA 4M6WB 4QWBA 3Q8SB 3BQ0A 8ICEA 4M47A 4Z6CA 8ICMA 1KLNA 3JPOA 4QW8A 4FBTA 4IRKA 4PGXA 1HUZA 4M9HA 2NRRA 3TFRA 3LWMA 4ED1A 3T5LA 4RQ3A 2C2DA 2AGQA 4QZ9A 4YD2A 2R8HA 2XY6A 3GFKB 2XY5A 4DQIA 2W9CA 1SL2A 4QZCA 4F5QA 4RQ6A 1MQ3A 1ZQMA 1QSYA 4M9JA 4QWEA 1ZQUA 4JWMA 4O5CA 1KFDA 7ICOA 4MEXA 2R8JA 4B9TA 4Z6DA 5KTQA 4DOCA 5KFBA 5DLFA 3PW5A 4KLIA 9ICEA 5KT2A 4O3RA 1ZQPA 3C2MA 9ICJA 4KLHA 2ISPA 5KFFA 8ICXA 5KG2A 4O3OA 4RT2A 2F1HA 5KFJA 5DGBA 4QWAA 3MDAA 2V9WA 3PW7A 4DSLA 2ZTEA 3GV5B 1X2IA 4O3QA 2H5XA 5KT7A 2P6RA 4QZIA 5J0OA 1D9FA 3RJJA 5DDMA 3TAPA 1SL1A 4RQ7A 9ICHA 5D49A 4KLMA 4O3PA 4I29A 1BPDA 1S9FA 1U49A 3MR6A 4DQQA 4DS5A 2FPMA 4QZGA 1ZQFA 4C8OA 4F93B 3ZDAA 4KLJA 9ICLA 4J9OA 1BGXT 4RZRA 4UAYA 4FO6A 1LV5A 1XSNA 1NJYA 2ZTDA 2ZJ5A 3UXPA 3V6HA 1C7YA 3UXNA 1SZPA 3BJYA 2ZUCA 1S97A 4DOBA 2FMQA 5KT5A 2W9MA 3JPNA 4TQSA 3PX0A 3RB4A 5EOZA 1ZETA 4QZ8A 3HWTA 5J2DA 1L5UA 2JEIA 4ECWA 4PHEA 5KFTA 5L1KA 4DEZA 3EPIA 1RYRA 4ECVA 4RUCA 2HHUA 1S0VA 8ICNA 4PGYA 5HHIA 4FS1A 2UVUA 2IBKA 4UAWA 3HPOA 3ISCA 3Q8KA 4K4IA 4ZH4A 4NLGA 3SV3A 2C22A 8ICUA 1JIHA 5KFEA 1MQ2A 9ICPA 3SI8A 4YXMA 3C65A 2NRTA 4DL5A 5KG0A 3RB0A 8ICIA 5J2IA 1U4BA 1Z3EB 3T5JA 8ICVA 3H7IA 3JPRA 2W8KA 4PHPA 1ZQQA 4JUZA 2F1IA 4MEYA 1ZJMA 8ICQA 3MABA 1SKWA 1IXRA 3EW9A 5KG5A 5J2CA 5DG8A 3SV4A 4JV0A 5KFUA 1D8YA 4IRCA 4I2EA 3PY8A 1UA0A 3RBDA 4NY8A 4PGQA 1JN3A 3M9MB 1T8EA 1NK0A 3C5GA 3RBEA 4ECSA 4YMOA 5JUMA 4RQ2A 4LZGA 5CB1A 4Z6EA 4G3IA 3RAQA 4F5PA 2Q0ZX 1WCNA 2IA6A 4P4OA 2M9NA 4R8UB 1DGSA 4KN7A 5KT4A 4JWNA 5KFRA 1T4GA 4BWJA 4DOAA 2FPKA 4I28A 5DBBA 3Q8RB 4O9MA 5IIMA 4F5RA 4ELUA 2KTQA 3C1YA 2OWOA 4DSEA 5CP2A 4QZDA 1ZQJA 3H8SA 4RPXA 4NM2A 2ASDA 5L1LA 3V7JA 2BHNA 5KT3A 4F4KA 2VANA 3EZ5A 7ICGA 8ICPA 4DLGA 1RZTA 3QEAZ 4ECYA 4I2HA 5J0QA 8ICOA 3LWLA 3RJIA 2WTFA 1CUKA 1COOA 1A76A 3OHBA 3GIJA 3THVA 5HP4A 3OSPA 2BQ3A 4YVZA 1QSLA 3C1ZA 3MFHA 5CJ7A 4R64A 5J2KA 4BXOA 3UQ2A 2UVRA 4DQRA 4M0AA 3Q8QB 2XC9A 1XO1A 1ZQKA 4E0DA 9ICXA 5J2FA 2DFLA 1ZQXA 1BPZA 3BQ1A 7ICVA 1BPBA 4RU9A 3M9NB 2IMWP 2BGWA 9ICFA 1ZYQA 1JX4A 4RPYA 5DB7A 1U48A 4I2DA 4R65A 5DB9A 4Q44A 4F4ZA 2BQRA 3MBYA 3IM1A 1B43A 4DWIA 5DQIA 4XUSA 2P66A 3EPGA 3PVXA 4ECQA 4J9NA 7ICHA 5KFYA 1KSPA 5KFSA 1NK7A 1S76D 4Q45A 4YFKA 1ZQGA 5HMMA 3RRHA 3BQTA 4RQ5A 4QZAA 4O3NA 3C23A 4DFPA 3T5KA 2FMSA 2W9BA 4DL3A 1XSLA 4M9LA 5DB8A 4DSKA 2JEGA 2VA2A 1QTMA 2AQ4A 2BKEA 1MSWD 5J0WA 5IIIA 3UPQA 3RJFA 2J6SA 1TK0A 4M9NA 4TUQA 4F4XA 5KFAA 2PFOA 1H38A 5J0UA 3TANA 4ED8A 9ICGA 1ZQYA 3RRGA 4BWMA 4ECZA 2DPJA 4IR1A 3H4DA 3RH5A 4EZ6A 3C2LA 2A1JA 1RPLA 3HW8A 2ASLA 3H40A 1NKEA 5KT6A 8ICZA 7ICFA 7ICEA 3TAQA 3FDSA 1TVAA 4XA5A 1X9WA 1QSSA 4EZ9A 4YR0A 3C21A 5CA7A 3K75D 4J9KA 4O5KA 1L3UA 3RJKA 1ZQBA 2HHSA 1D8LA 5KFPA 2ZTCA 4RNOA 9ICIA 4ECTA 3HX0A 4F8RA 4LVSA 4M6WA 3TFSA 3RJHA 4B9SA 2NRXA 2HHXA 3GIIA 5DBCA 2XCAA 2RDJA 3B0YA 2FPLA 3T3FA 4QZFA 1TV9A 5HHHA 4B9MA 3H8WA 4C8LA 1B22A 5DG7A 5BOLA 3ISDA 2BPCA 3MGHA 5L1IA 4YP3A 2BDPA 1RYSA 1T7PA 7ICJA 4IQUA 4DFMA 1T3NA 1KFTA 1EXNA 3LDAA 2KZMA 4IQWA 4NM1A 1ZQDA 4Q43A 4DL4A 4DFKA 4UB3A 5IILA 5DDYA 4RQ8A 4B9UA 3PNCA 4M2YA 4J9RA 1JMSA 4NLZA 2I1QA 2LYHA 4J9PA 4ED3A 2Y1JA 1XSPA 1X9MA 1CEZA 5HNKA 3MFIA 4ECXA 3PMNA 4UBBA 1NKCA 8ICRA 4KTQA 5KG4A 4DO9A 5KFKA 2ATLA 1A77A 3G6VA 4KLLA 4YR3A 9ICSA 4RQ1A 3JPSA 4GXKA 1UT5A 2HHVA 1TAUA 2AGOA 5DBAA 3OSNA 3UXOA 4UQGA 4B9VA 9ICUA 5KG7A 4J9MA 1KFSA 1Z00B 5BOMA 3V6JA 1HJPA 5KFVA 3Q8MA 2R8KA 2JEJA 1NK8A 3QE9Y 2FLLA 1U45A 4Z6FA 4P4MA 1XWLA 3PO5A 2MUTA 2ZUDA 3OJUA 2C28A 4I2JA 3QEBZ 3ISBA 1BVSA 4EYHB 1ZQCA 2RDIA 2HVIA 4QZBA 4J9SA 7ICSA 5KG1A 1SL0A 4K4GA 4YCXA 1KEJA 3RTVA 5KFWA 4DL2A 7ICPA 2V4RA 5KFOA 2Y1IA 4YN4A 5EWEA 3IHQB 1K1QA 4F3OA 1DOQA 4ELVA 5KFMA 3TQ1A 1TK8A 3TARA 3MDCA 4I27A 4I2IA 4EEYA 2HHWA 4Q8EA 1JXEA 4BXOB 3B0XA 1ZQZA 4IQVA 1NJWA 4MFFA 4RT3A 1S77D 2BCVA 7ICRA 3FYHA 5HMLA 4QZEA 5KFHA 3SYZA 5J0PA 4GC7A 2HW3A 1PZNA 3NGDA 5CR0A 5L1JA 4C8NA 5KG3A 2BPGA 4KLUA 5KG6A 4DSJA 3GV7B 4F2SA 4YQWA 1ZQTA 3GDXA 1U47A 1JXLA 1D9DA 1ZJNA 4JK1A 4YD1A 3KHLA 4J9QA 2R8IA 3RR7A 5J29A 2JZBA 4EBDA 4MFAA 4DQPA 4KMUA 2B21A 3ZDCA 1S10A 5KFNA 4UAZA 5DGAA 4RPZA 3PW0A 3M8RA 1NOMA 4MF2A 3RAXA 3JPQA 3ZD9A 4YMNA 4KLGA 9ICCA 5EWGA 4TQRA 2ZJ8A 3KHGA 4GLXA 2ISOA 2J6UA 4BDPA 4EYIB 5DLGA 2ZUBA 2W9BB 4NLKA 3V6KA 3RB6A 5KFQA 4NXZA 3EYZA 2W9CB 3MR3A 4F50A 2ZJAA 9ICRA 3RH6A 2GWSA 4UB5A 4ED2A 3AUOA 2C2RA 3OHAA 8ICGA 2KZ3A 1ZQOA 4RUAA 2PFQA 4BGDA 5CWRA 3H4BA 3GIKA 2V4QA 2XY7A 1TFRA 2F1JA 1ZQHA 1ZQWA 3Q8PB 3AU6A 3G6XA 3QZ7A 1TK5A 2VA3A 1XU4A 9ICOA 1XC9A 4M04A 1ZQSA 4DFJA 4J9LA 1NJXA 3BQ2A 1N48A 1RXVA 1ZQEA 1LB2B 5J0RA 8ICKA 1BPXA 5EWFA 1KRPA 4F91B 1S0MA 9ICQA 2FLPA 4ECUA 2JEFA 4UB2A 3LK9A 2BPFA 4QZHA 5IIOA 3KTQA 4I2GA 3GV8B 1TAQA 3PMLA 2NRWA 4PH5A 5J0SA 1ZQNA 1UA1A 1V9PA
chains in the Genus database with same CATH superfamily
4H0PA 3C2KA 1QQCA 2H3GX 4JKHA 5DMRA 4CE6A 1HKGA 4CFDA 4YY3K 4KITB 2E4LA 2YNIA 3D45A 2XGPA 4BE1A 2HHTA 9ICKA 4KB0A 5AI8A 3SQIA 2PXIA 2ZD1A 1Q7YO 3SQ0A 4NXMK 4CJLA 3K4GA 2XGQA 4DR4K 3OBYA 4DUYK 5AI4A 2IHMA 8ICBA 1ITGA 4CJFA 3S9HA 1ZQLA 4IRDA 1ATSA 1ZBFA 1VK0A 4JKFA 1T3QA 5DQGA 2PFNA 1GOBA 3AU2A 3AV9A 3HT3A 1X40A 4DU4A 5AKJA 1ZQIA 4RW4A 3ZSWA 2HBMA 4PPXA 4OCZA 1VRUA 4C4SA 1Z4OA 2WF9A 1RT1A 3H1QA 3VGKA 3V9UA 5B5EU 1HNVA 3QICA 3VQ4A 4Z4GA 2KKVA 1TL3A 2YNFA 1NKBA 2AU0A 3A0IX 1C1BA 2E8AA 4LSLA 3ZLJA 4BE0A 4U67L 5TZVA 5J2EA 1BHLA 2ES6A 2IVPA 4IEIA 5KI6A 5SZTA 1IBMK 3WQUA 4PKIA 3V72A 4GC6A 1J9AA 4H5TA 5LL6Z 2W6LA 4CZFA 2I9GA 4M3RA 2OPRA 1ZBLA 3QEWA 3V7KA 1ZQRA 2XCPA 4JS5A 2PI5A 2QLTA 4DV4K 3VF2A 3MWTA 4LFBK 4K4HA 2W6KA 2EX3A 1N62A 4IQTA 4CGJA 2QXLA 4XQ8A 4W5TA 4DV5K 3DOKA 1VSIA 3UQ0A 4M7YA 3NS1A 5CHGA 3LDQA 2E3TA 3LZIA 4B3TK 4W5OA 2YNGA 1WCLA 5C0YA 1SS6A 2AA4A 1S0NA 5AQIA 2HOEA 3F2BA 4CI6A 3CCSN 2LM1A 1S5LU 4TUPA 4E7HA 1RILA 4H0YB 3F2KA 1TAMA 3RJGA 5L9XA 1BPYA 4WQ4C 4YNQA 3J7ZO 5C5JA 2YHXA 3RR8A 2PFPA 4F2RA 1VSJA 5C15A 3VA3A 3M9OB 1PVRA 1NGHA 4FLUA 2N1RA 5J2JA 3KHRA 5IWAK 4FJ9A 4KLOA 4YMMA 4TURA 4YDUC 2GH1A 3NGZA 2E5LK 4PL1A 3KD1E 4TUSA 1KVCA 3C5FA 2OZMA 1JLQA 3M6ZA 4CJQA 4LF6K 1FK9A 3MX2A 5AQRA 1KAZA 5DB6A 1BIZA 4OD0A 4CJ5A 4CGGA 5AQVA 4JMUA 1XS9D 3IDWA 3PR4A 5C24A 3NDKA 4H0OA 1NOYA 2KIWA 3CRXA 4C8MA 1L3VA 2IS3A 3DXKA 4FS2A 5ALNA 2EAMA 3VOVA 4BVPA 4Z4IA 2HOFA 2Z1HA 2EHGA 4B1UB 2KE7A 5KFZA 1YITN 1VSKA 5AQKA 1DXSA 1WSJA 8ICYA 2VQEK 4DQSA 3ZD8A 4P2HA 2Z7JA 1S1XA 4QS7A 3QB0A 1QVGM 1T6CA 4FLZA 5ALYA 1T03A 3OYBA 1N60A 5KL1B 3MN5A 4BRFA 5KAFU 2NRZA 1HPZA 2NO4A 8ICLA 2XIDA 4FO0A 2YMQA 3SEIA 5IINA 5EX5A 2FBVA 1P90A 5BRHA 3WEEB 4USAA 8ICJA 3OS1A 2XICA 1KDHA 1SZHA 2Q3SA 1KVBA 4EBCA 3HPHA 1QLNA 4GXJA 4CJEA 4QWDA 9ICWA 4HYKA 3A0BU 4AHUA 2UUCK 1X1PA 1NGDA 4Z6CA 2FI1A 2JMGA 4K41A 3JPOA 4QW8A 4IRKA 2LSNA 1HUZA 3D7EO 4M9HA 2O4IA 2OTJN 3F73A 2DY4A 2NLXA 5BPNA 3QU9A 1VSLA 2X78A 1MN8A 4OJRA 4KBOA 3PIOL 2W9CA 4OGCA 4QZCA 4RQ6A 1ZQMA 1DTQA 3NGYA 4BR5A 7ICOA 1VSHA 3HTVA 1C20A 4KREA 4BROA 2D0CA 3CW2C 5DLFA 3PW5A 2E5SA 9ICEA 2ITMA 4O3RA 2QWRA 2ISPA 3ZEUB 4RW6A 4O3OA 2F1HA 3HSCA 5DGBA 3MDAA 2V9WA 1W97L 3GV5B 2CN1A 5KT7A 2FSJA 1N5WA 4QZIA 4AH9A 5C10A 1D9FA 3CPWM 1HYSA 4DCCA 1K6YA 1ZBHA 4L3QA 3VEWA 4KLMA 2ITGA 4Z4EA 1BPDA 4UATA 1U49A 2FPMA 4BR0A 5BRDA 4KLJA 1RDBA 3CPEA 2VWJA 3H3NO 2OPQA 3FM9A 4FO6A 2KV2A 4CJ7A 1Z6RA 1XSNA 4X64K 4GV6A 1NM1A 3P83D 2ZJ5A 2GEMA 3F53A 4IBNA 4FFDA 1C7YA 2IDOA 4BUGA 2LHTA 1BQMA 2LKYA 5BN8A 4DR1K 2W3RA 2W9MA 3JPNA 2WONA 3RB4A 3LAKA 4CBUA 4QZ8A 3BZKA 4CIEA 2AHOB 3P5JA 2DWQA 4DEZA 4CJKA 2NO5A 1SWWA 4ECVA 2BANA 8ICNA 5GAGP 5JVGL 4PGYA 4FS1A 3FR0A 2P5GA 3MAQA 3ISCA 1ZXOA 2HHHK 4ZH4A 4NLGA 1BCOA 2C22A 2RRDA 1JIHA 5KFEA 2QARB 3AARA 5HP1A 3SI8A 1TKXA 3OYHA 3C65A 4CGDA 1LCUA 4IFVA 4DL5A 3NF6A 4KHUA 2QXFA 2RN2A 2DFFA 2A42A 1M6YA 4EFHA 2GUIA 2HF3A 2WFAA 3G25A 1VQ8N 2G5HB 4PHPA 4LF7K 4JUZA 3QO9A 1WSEA 5FPEA 2F1IA 4MEYA 4FVMA 8ICQA 4TSXA 1IXRA 3QXGA 3ZT2A 4IRCA 4IXCA 4J2EA 4I2QA 4NY8A 5AFUA 1JN3A 3VF4A 2GELA 4RQ2A 5HRNA 4B1VA 2CPRA 1EWQA 4PL8A 3AL0B 5GINA 1NGCA 2IA6A 2EWSA 4FWPA 1Q9YA 3S3NA 4R8UB 2G08A 4KN7A 4Y2SA 5IIMA 3HKZF 4F5RA 3OYLA 4CZJA 3C1YA 1RBSA 3S3OA 2OWOA 3E9LA 3LVWA 4QZDA 4OPHA 2RE2A 1S6PA 2ASDA 1MA7A 2BHNA 2GO7A 1VQ4N 4J2DA 8ICPA 1ILYA 1RZTA 1DT9A 3OS0A 3BY5A 4ECYA 2DFHA 3MEGA 5J0QA 2O8CA 4IJAA 4UB8U 1S1VA 3ASMA 3CQYA 2BQ3A 3V81A 3OSPA 5HP4A 4CEBA 1QSLA 4YVZA 2IVNA 3NH2A 3SAFA 3MFHA 4BXOA 1BUPA 1WWVA 3UQ2A 1U2VA 2QWPA 2UVRA 2P9IA 4CF5A 1IKWA 2V52B 4HUEA 2HMIA 4JYAK 2XC9A 3VQ7A 9ICXA 2K60A 4BACA 3SJJA 3QU7A 3WQTA 3V1RA 3BQ1A 4FK0A 1FO4A 4RU9A 3M9NB 3KD3A 3QU5A 2CH5A 2L5YA 5T7BA 1ZYQA 3ZSXA 1XO0A 2A3VA 3CG7A 2JWLA 3IM1A 4FZYA 5AICA 1N32K 3NASA 5DQIA 4XUSA 4J9NA 1N33K 3SQ2A 3K5MA 4ICAA 4IEEA 4A61A 4B1XB 2KICA 3ULEA 4DCHA 4YFKA 3ENBA 5GADP 5AZIA 3THYA 4Y1DA 3BQTA 4RQ5A 4QZAA 5EE3A 3T5KA 3WK4A 2FMSA 1XSLA 1M90O 1QQMA 2WB1C 4LSNA 2BKEA 1S1TA 1TK0A 4TUQA 3AGRA 4E1JA 2HB5A 4ILJA 3U3YA 1FJGK 1TE2A 3CJBA 3MWPA 3RRGA 2F4VK 5AQJA 4ECZA 3H4DA 4Z94A 2CH6A 4PY5A 4WF9L 3HW8A 1Z05A 1NKEA 4N41A 3WKAA 7ICFA 1K8KA 5BR8K 2G5IB 4XA5A 2E88A 2DFEA 1SV0A 3WKDA 2P9SA 3KLGA 3EO3A 2EZZA 4KHSA 4BG8A 3RJKA 3N4PA 1NMDA 4FJ5A 4FZMA 4CZIA 1D8LA 4RNOA 5B8HA 3PIPL 5J2NA 3TFSA 3RJHA 4B9SA 3VESA 4M3UA 5ALXA 3TAFA 1O1WA 3EN9A 2JGAA 3E0FA 3B0YA 2YI1A 3TWHA 4H8KA 4FWMA 1UPHA 5ALVA 2BDPA 5HR7A 7ICJA 1DGKN 4DQ8A 4DV0K 1RDWX 1IKXA 4IQWA 2E6MA 1ZQDA 4Q43A 1F21A 1A5WA 3HO1A 4DFKA 3ZSYA 2OTLN 4B9UA 2FDRA 3PNCA 4M2YA 4B9QA 5GIOA 2EQYA 2VCPA 4E89A 2LYHA 4J9PA 2Y1JA 1NKCA 1XNSA 3VQ9A 1HX1A 4UBBA 1UCVA 1XI1A 4KHNA 1WWUA 5KG4A 4DO9A 9ICSA 1XMQK 4NWIA 4Q5VA 3ETRA 3MN6A 5DBAA 4A57A 3U26A 3UXOA 9ICUA 2QK9A 3G10A 4JV5K 2M0NA 3CFRA 1C0GA 3GZFA 1JCFA 1JCEA 2YHWA 3R9PA 1U04A 4H5VA 3C94A 4GVMA 2VWBA 2G07A 1UAXA 4LF5K 1XWLA 3HPGA 1UHUA 2Q4TA 3KKSA 2C28A 3CETA 4CEFA 3DLLL 1BVSA 2HVIA 4ILHA 4J9SA 3K59A 3LVVA 2OANA 3E66A 3A5OC 4IOXA 5BREA 2YN4A 3DLRA 4DV6K 4OVLA 1J53A 4YN4A 1R59O 1PVQA 2F44A 3IHQB 3TADA 1DOQA 3TKAA 4F3OA 1C0UA 4ELVA 1TK8A 1DTTA 2YNHA 3H0LB 3K2PA 4IO8A 4KHQA 2HBJA 4RTFD 1B4FA 3GOIA 3D0PA 4EX7A 1KC8O 2O8DB 3WXIA 4IQVA 4Y2UA 4MFFA 5AKEA 4XH5A 5AIBA 4ISFA 4H4MA 1IG9A 1JROA 5HMLA 4K8XA 4Q0BA 3SYZA 1MU2A 5J0PA 4E7LA 1YJ9N 2BPGA 2A41A 4IFEA 3GV7B 1Q3VA 4R79A 1ZQTA 2VGNA 3O8MA 1VDVA 1U47A 2P35A 1ZJNA 1GLEG 4JK1A 4YD1A 4MO5A 3RF9A 3CCJN 1N8RO 2WF7A 4CNQA 5E26A 1S10A 5KFNA 5DGAA 2QI2A 4RPZA 3EEQA 5AQQA 1KL9A 1NOMA 4BC4A 4FOEA 2RKIA 3RAXA 4BG9A 2VGMA 9ICCA 4TQRA 3O9UA 3KWGA 3DLBA 3KK2A 3I1YA 4GLXA 4H5RA 4KHWA 1HNXK 1ZXIA 1JLFA 4FJ8A 1S5JA 5C2FA 1X9XA 3C7NB 4NXZA 3OVNA 2W9CB 1O13A 4AHRA 1SGGA 4PKGA 2QW9A 4ID5A 5KGWA 2C2RA 4ED2A 1COKA 1TV6A 3MN9A 4B1WB 5ALJA 2PFQA 3H3OB 5CWRA 3H4BA 3GIKA 2PFUA 1JLAA 3VQDA 5I3UA 4N76A 1TFRA 1R0AA 1ZQHA 2PYLA 3G6XA 2JLEA 1VQNN 1DEJA 1XC9A 1KD1O 2KJ8A 3V9ZA 1HKBA 5EVZA 2HNDA 3RVCA 4DTMA 4KI4A 2K8CB 1N48A 4GV3A 5AFUH 4KPYA 3VQEA 2H3VA 8ICKA 1SUQA 5EWFA 3AVBA 1NLVA 2FLPA 3FGUA 4KRFA 1OH5A 5AQNA 4ECUA 5DK5A 1WNSA 5ALUA 4UB2A 2JEFA 2BPFA 3KTQA 1BL3A 2FLOA 3IFRA 4I2GA 1Z4NA 3GV8B 1URJA 4CZLA 3WEEA 3KLEA 2QEXN 2NRWA 4HCCA 2YQEA 2YKNA 3ULDA 2PKEA 5JLHA 2PI4A 2O6KA 2AH5A 5F3XB 3TI0A 3GIMA 2ATQA 3IG1A 5K4LA 2GV9A 5AZJB 3UMCA 3SZ2A 1I94K 3H8MA 3UKUA 3WK8A 4FJ7A 1AROP 1QZ6A 4DF8A 1SKSA 1XUPO 3LDSA 3PW2A 8ICAA 3B9JA 3ETLA 4B9NA 3MGVA 1BDGA 3L2QA 9ICVA 1Q46A 2FXUA 2K4IA 5J2PA 4UASA 3E1YA 2R18A 1ATNA 1KKXA 3RH4A 4BQLA 4FYDA 3NVKA 4PA1A 3ZEUA 2G8KA 4QNLA 2WBNA 2HSZA 1WG8A 3H0MB 3O08A 5FLXO 4JI0K 2DKZA 2WFBA 5CEHA 2A6AA 3NMUA 1SV4A 4DS4A 1LW0A 2DPIA 3E2EA 3DYAA 3VENA 3DI6A 1TKDA 2D6FC 4EX6A 4UB1A 2QWQA 4CVNE 1NG9A 5AQFA 3AA3A 3AM9A 3EUB2 3A8YA 3DXMB 4YXJA 4CIFA 4M3YA 1ZOLA 1KW4A 3NUQA 5FDLA 1IM4A 1V4SA 5JU5A 4KV8A 2OZSA 5ALZA 2I7NA 2BCRA 4O55A 3QNOA 3O3GA 5BRFA 1LOTB 1N5YA 4GW6A 1HQEA 5JMVA 2BQUA 1NGAA 3DEEA 4FBUA 3DLEA 4M3TA 3M1YA 2HVHA 5JLFA 5KPZA 5AI0A 4KLQA 2FLNA 5F9LA 3G6YA 3OYEA 1JUDA 5CR4A 4FM0A 7ICUA 4DSFA 1HYZA 2IOFA 3DLHA 4IG3A 4BGAA 4JLHA 2B0CA 3NRZA 4UY8O 1HEKA 2KFZA 4RWTA 1J5EK 3V9SA 2QARA 4M7XA 3WKCA 3RFAA 4Q8FA 2IC3A 3B6PA 3CERA 1L7MA 3BF1A 3RJEA 4FJHA 2LYBA 2D0BA 3GILA 4I6MA 1DK3A 3SD7A 9ICBA 1BPEA 4RNNA 1NK6A 3CFOA 3KZIU 1WBBA 1KN5A 3P31A 4FWLA 5J0TA 3ZT1A 2ZJPL 5DKWA 4FJGA 5KFCA 3QZ8A 5JS2A 1UT8A 3HRGA 3CNHA 4C4TA 5JTIA 4JI1K 3PO4A 2DQNB 3OGUA 4CEAA 4RW9A 3IAYA 1QVFM 3KK3A 1BWFO 1ZQVA 3CIPA 4RQ0A 3ID8A 3KHYA 1LAWA 4F72A 1YHQN 3H0RB 2J6TA 5BPCA 4OPAA 2A1AA 3AVIA 3QERA 3PV8A 1K73O 4KN4A 5AI5A 2ASMA 3LDPA 4R8UA 5AM5A 2OHFA 4ED6A 4B3OA 1IIPA 1REVA 4JK7A 3ZDBA 2B4JA 3M5RA 5CHIA 4P4PA 4DLEA 2FMPA 2EDUA 3ORYA 4DTPA 4XRHA 4I2BA 2VG6A 4A59A 3QEIA 3WK5A 1SKRA 5IIKA 1K1SA 4FWSA 4ZTJA 4QAGA 1BCMA 1TYQA 1MDUB 4DR3K 4KX5A 3V6DA 3H46O 4LH4A 2DKXA 1MWKA 5AI6A 5LMUK 3G0ZA 8ICTA 1BA1A 4ECRA 3LM9A 3VQ6A 4IDHA 1GLDG 7ICIA 1LWEA 3GE1A 1XNRK 3AVHA 4YG2A 2P9UB 2QB1A 1A5XA 3KZXA 1X9SA 2E2PA 8ICCA 4CFBA 3CD6N 5C42A 4YR2A 1LAVA 2W11A 4QWBA 3BQ0A 5FPDA 1NGBA 2VWKA 4Y0WA 4FBTA 2ODGA 4R5PA 2KP7A 3BGRA 4BR7A 3T5LA 4ED1A 3NAEA 3ZI4A 4RQ3A 2C2DA 3SPZA 3HZ6A 1VQ5N 4QZ9A 4CERA 4DQIA 2KMDA 2GWJA 3V4IA 3DAWA 2IOHA 4YOUA 4FW1A 4OJOA 2KQ2A 4B3MK 4K8ZA 4CJ3A 1KFDA 4H4OA 3HXMA 3CC7N 3SNNA 5KTQA 5KFBA 5EOYA 3OYDA 3H08A 1J97A 1NNEA 2ZIXB 1ZQPA 1J2NA 2Q31A 4A5AA 4KLHA 1F0MA 5AIAA 5KG2A 5KFFA 4RT2A 2RF2A 3IMXA 4CJPA 3MN7A 5K14A 2P6RA 2IVOA 5DDMA 4E1MA 3TAPA 2AP1A 5D49A 4O3PA 2UXBK 2W7OA 2ZM6K 3MR6A 4DQQA 5A2QO 2P5OA 1ZQFA 4OJPA 4F93B 3ZDAA 3P38A 1B0XA 4J9OA 5TKYA 4G9ZA 1BGXT 5AJ3K 4UAYA 3CI5A 5M1PA 2JRZA 3VETA 4O3MA 1NJYA 1RT3A 2ZTDA 2D8CA 4CECA 1UWBA 4DV1K 3VEVA 3BJYA 2D4WA 3QIOA 5AQUA 2FMQA 4BRNA 3SQ1A 5KT5A 4BR4A 1RTJA 1ZETA 3MXMA 5EOZA 1JL2A 3CJ9A 3KWIA 5J2DA 1XQSC 2JEIA 4YOXA 3I76A 5L1KA 3OYIA 4OPJA 5AKYA 1YUWA 1YJNN 3NE6A 3SMVA 3IN5A 2HHUA 3LYSA 3RWUA 5HHIA 3L4IA 3QLHA 4B1ZA 2IBKA 3HPOA 1KXPA 3Q8KA 4CW7B 2H3IA 2BE2A 1YXQA 2NRTA 2D0PA 5KG0A 5J2IA 4Z4HA 1RFQA 4LC9B 2FF3B 4Z4CA 3NFAA 1NWKA 1Q8KA 3ATUA 5AQZA 5J2CA 5KG5A 5C12A 4JV0A 4I2EA 3D2QA 5I42A 4LFCK 3AVCA 4IC9A 3PY8A 4JKEA 3CCVN 3QIPA 3RBEA 1CZAN 4LZGA 1FIQA 4C23A 2A1SA 4Z6EA 5F0XA 3M8QA 3HKZC 1LWFA 3RAQA 1GLAG 2E1ZA 3CJCA 2Q0ZX 1KLMA 3NH1A 3B6OA 4Y2JA 3VCBA 1DGSA 3CJ1A 2VJ5A 4JWNA 4NLCA 1W2BM 4BWJA 1JJ2M 5DBBA 4CJ4A 3OYKA 3J81j 3AVFA 2AXTU 4CF8A 2KTQA 1ZD5A 1EO1A 4DSEA 5CP2A 3FZKA 2FJ6A 5AK6A 3H8SA 1BG3A 1HIWA 3IRXA 4NM2A 2Y0SC 3V7JA 2RP5A 5ALGA 5KT3A 4DLGA 3PUFA 1YI2N 3VTHA 8ICOA 4UAVA 1BISA 3LWLA 2WTFA 1CUKA 4BRCA 4BRDA 2NRHA 3F9KA 4BR2A 3RMBA 2HMXA 3C1ZA 1IG6A 3QEXA 2DGZA 2O8DA 2YJEA 1SV0C 1FEZA 1L8LA 4B8AB 3Q8QB 1VQ7N 1KVAA 1N5XA 2BGGA 2PMZF 5AK4A 3SPYA 4FWKA 4C1NI 3T1YK 4ID1A 3WU2U 2BGWA 1VJ5A 3SUPA 3CCRN 1U48A 1FKOA 3IS9A 3LALA 2XY8A 3O4WA 2NYVA 2BQRA 3CM6A 3KVGA 4FJXA 3MBYA 1B43A 4OKEA 3EPGA 3PVXA 5AQOA 2LBOA 3I0SA 5KFYA 1EETA 2P1JA 1VQLN 3TAEA 1HMVA 1NK7A 4P0PB 1IG8A 4Q45A 2HCFA 1ZQGA 3I33A 3IDHA 3NF9A 4GMJB 3SBGA 3ZX2A 5MLCQ 4DR5K 2NUBA 3C6UA 2DF4B 1SXDA 1OVQA 1J6ZA 2RLTA 4BRPA 4CF2A 4CHOA 4DSKA 3C7NA 2YX6A 2VA2A 5ALTA 3UKUB 4CEDA 2AQ4A 1MSWD 3UPQA 5IIIA 2J6SA 3J8AA 1C0FA 3RSEB 1Q8IA 1JCGA 4CK2A 5J0UA 3TANA 3HL8A 5AKGA 5HR6A 3RH5A 1QQ5A 5BR9A 2A1JA 3SUQA 2ZE2A 1RPLA 2ASLA 1OUQA 3H40A 2ZWHA 4JKAA 5KT6A 3R3LA 4BR9A 3DJCA 1C1CA 3P4IA 1TVAA 4AM6A 1L7NA 4I9QA 4DTJA 3HI0A 1DRGA 4EZ9A 4YR0A 1A6SA 3C21A 1GLCG 5JRTA 3C28A 5EY4A 3T7ZA 2LM4A 5AKKA 4O5KA 3AVLA 4KX3A 3CM5A 3AVKA 5AQMA 4ECTA 4F8RA 2Q36A 1OH7A 1A5VA 3DV9A 4M6WA 3SI6A 2NRXA 2HHXA 5DBCA 2XCAA 2BH1A 4HVJA 4C80A 3TAMA 4QZFA 1TV9A 1B22A 4C8LA 3TADC 2MU2A 1KAYA 3OPXA 1JALA 1X42A 5L1IA 3DOLA 3QDKA 4CZEA 1T7PA 5T14A 4WJ3B 4DFMA 3CCQN 3LDAA 2JWKA 4FE3A 3AO3A 3MC1A 5IILA 3A5NC 1SIJA 5KGXA 4CHPA 5AZJA 3OTQA 2OM6A 2I1QA 5AK5A 3KD5E 1CEZA 1JLGA 8ICRA 2K4HA 3MFIA 1S3XA 5CZ2A 4JI6K 1N6QA 4DV3K 3WK7A 3K57A 1A77A 3O1WA 1S6QA 4RQ1A 3JPSA 2HHVA 1UT5A 1TAUA 5EE1A 3OYNA 4P0QB 2W3SA 3TPQA 4I6MB 4UQGA 2OA8A 3J81O 1KFSA 2UU9K 4YOTA 3V6JA 1SXEA 1HJPA 3FC4A 5KFVA 5AQPA 3QE9Y 3NH0A 5BPLA 1QE1A 3OJUA 4EYHB 3BUZB 3KKAA 4QZBA 1E3MA 5TKWA 4PL2A 5AKXA 3DXMA 3SK3A 3O9TA 2VIXA 3ATVA 4CF9A 7ICPA 2UXCK 3M1FA 2P9KA 5EWEA 2K8AA 1K9MO 1B92A 3TQ1A 2YX8A 3TARA 1JI7A 2QKQA 4I27A 5J8YA 2I7PA 3V1OA 4IOAL 4Q8EA 1JXEA 3HP9A 4AHVA 4A8EA 3B0XA 3EKUA 3S41A 1ZQZA 4Z0UA 2PBDA 4PZNA 4EELA 4RT3A 1TYQB 4CJRA 2BCVA 7ICRA 1SZ2A 3WK9A 4QZEA 5KFHA 1OKJA 4I2PA 2UUBK 2FBYA 4GC7A 2HW3A 1OVYA 1PZNA 3R1XA 5EU7A 2Y0SF 5CR0A 5L1JA 5KG3A 4IZ9A 2EAOA 1VSMA 5KG6A 3SJHA 4E19A 4QOZB 4IL6U 3GDXA 1JXLA 3M8PA 2DL0A 3KHLA 2ZIUA 4EBDA 4MFAA 4U6PA 3ZSOA 1QQOA 1TUYA 1SB3C 4MF2A 3JPQA 4WFBL 3ZD9A 1JLCA 2HNZA 3O9RA 2I5JA 5EWGA 1VQKN 2IOFK 4EYIB 3F2DA 5DLGA 2V51B 2W9BB 3EKSA 1RG6A 3AAPA 1PUZA 3PSTA 2A3ZA 4JNEA 4YOYA 1Q86O 1I39A 4LY7A 4RQNA 2O8EA 4GFJA 3AUOA 1PVPA 5KNIA 8ICGA 3L4QA 3CQ8A 5GIPA 2KVCA 3MCAB 4AM7A 4RUAA 2OYQA 4BGDA 3JS6A 3D2SA 2XY7A 4JI2K 2PYJA 3L5KA 1ASVA 2JH7A 1ZQWA 5KQDA 4FZLA 9ICOA 4K25A 1ZBIA 3O9QA 2F8SA 4M04A 3QUBA 3BEXA 1Q18A 2G8VA 4J9LA 3HM8A 3OW2M 1YVUA 2VG5A 1LB2B 1X3MA 1Z1BA 1Q3UA 3UB5A 2YB4A 3A2FA 3H6EA 1KRPA 4F91B 1NZPA 5HRSA 1G99A 5HL7L 3KLHA 3CCUN 4QZHA 4ISEA 2P9UA 3NBPA 1CZBA 3PSIA 5J0SA 3D2FA 4NCAA 4FLXA 2ZIWB 4DL6A 3THXA 3W3DA 2UVWA 5F1XA 4O0JA 3AN1A 2BZFA 4DHYA 4DTUA 2ZGYA 4ICLA 4KLDA 3H8JA 1KBUA 3GDQA 4KLEA 9ICTA 5M1QA 4BRIA 1HQUA 4H0VB 2IHNA 2YJFA 4ELTA 3AA5X 3KK1A 1V38A 3CCMN 2F76X 1RBTA 1SV5A 4AYBF 4DTXA 1QH9A 4O3SA 5AKLA 3O1BA 1H1VA 3QUCA 1BO5O 3DMJA 1RQLA 1WSFA 4JKCA 4A2AA 8ICFA 3I55N 4NV0A 4F5OA 2QB0A 4JEPA 3ZDDA 8ICHA 8ICSA 3AAQA 3T1AA 3LAMA 4CGIA 2BR0A 2ZIXA 1T3VA 1X9JA 3FZHA 3I8DA 3N4MB 5E84A 1ESVA 4XH4A 3K1ZA 2E8OA 3BP8A 2DTUA 3O80A 4I2AA 4CHZA 3Q7BA 5KFGA 3TSUA 2MUTB 2P9LB 5M1NA 4BRLA 3WXJA 4KO0A 1NZBA 4MFCA 4M9GA 4W5QA 1L3SA 1N56A 3EWAA 5EE9A 5J2AA 3BDPA 1ZC6A 3CMEN 5FRMA 2AQ0A 2JH1A 3PX4A 1EQYA 4DV7K 4JI7K 3HP6A 4FJLA 4F4WA 2UVVA 3TSPA 5FRNA 1HUOA 2ESEA 5KFDA 3K5LA 2BUPA 2W9AA 1HKCA 2KZZA 2VG7A 4B08A 4OLBA 4RQ4A 3AGKA 2VQFK 2G06A 5CRXA 4J2AA 4PWDA 3UE5A 3SUOA 5KFIA 3QX7A 4ED0A 4O5EA 5ALMA 1CXQA 4GY2B 3DWLA 4R66A 2AGPA 1TKZA 3ENHA 4FK4A 3ZSVA 3I8BA 3I0RA 3ED5A 1MWMA 2C2EA 1MC8A 4DSIA 2Z1GA 5B66U 3ALYA 4DR6K 1ZRMA 1T6DA 4CD3A 4FLVA 3O3FA 4JRQA 2QKKA 4FK2A 4C7YA 3IRUA 4FCYA 3VGMA 1VRTA 2G8WA 3HK2A 4I2CA 4ZOHC 1TVRA 2KNJA 2I6XA 4IWVA 5D4BA 2KSOB 4GKJK 1RT6A 3VEZA 2KFNA 3GL1A 4JV2A 5HRRA 4I2FA 2VA8A 3BZCA 4CHYA 5KFXA 4MDBA 4PKHA 3MR2A 3FFIA 2KK0A 1PK3A 2IGIA 5LJWA 3LDNA 1Z00A 1L7OA 1S0OA 3CF5L 4C4RA 3VQCA 1LWCA 3ZT0A 2ASPA 5CY4A 3OJSA 3M7DA 1X6IA 4BX9C 3WNEA 5AKIA 3QBWA 5GAHP 1T44A 3ZSZA 1DLOA 2MAXA 1VQ6N 3ZT3A 3I56N 3JPTA 3N7PD 5J2BA 3AQEA 5AM2A 4NLNA 5ALPA 4PHAA 3PX6A 3Q8LA 4B9LA 4JV1A 1E4FT 5J2HA 2W8LA 4ED7A 7ICLA 1RBRA 2E20A 3ALRA 3SQ4A 1C0TA 5DG9A 4FZNA 4DU1A 2K89A 4MO4A 2P9PB 4DTNA 4PHDA 4C8KA 5FROA 1BU6O 3PW4A 2KN7A 3OBWA 5J1EA 3PSPA 3U9ZA 4CESA 2XO7A 2KG5A 1A0PA 4BDYA 4LF8K 1YZ6A 2XI9A 3MGIA 3N97B 1TGOA 4JAXA 4NB4A 4WQ5A 2A1JB 3KIOA 1O03A 1WLJA 3QUTA 3F5TA 2HNYA 2WF6A 5DQHA 3O4NA 4CBWA 3WUHA 2BTFA 4Y2TA 1X66A 3LP3A 5J0YA 8ICWA 3FZMA 4C1NK 4CF0A 1RDUA 4RNMA 1IJJA 4F3TA 4I9LA 4DG1A 1NK9A 4KFBA 1U9LA 1CZ9A 3CJAA 7ICTA 5J2GA 5A0LA 4LF9K 4M6WB 3TTDA 3Q8SB 8ICEA 4M47A 1KLNA 4PGXA 2NRRA 3TFRA 2QA4N 4A62A 2QWOA 4EIAA 1AQ6A 2FC0A 4YD2A 5ELZA 3TSQA 5C25A 2XY5A 1SL2A 5DM6L 4F5QA 4MDAA 1QCKA 1MQ3A 3L6QA 1GOCA 1ZD3A 1Q82O 1ZQUA 4P0PA 4DR7K 2A5XA 3WKBA 2KD1A 4KH5A 3VA0A 3CFPA 2OEHA 5KT2A 1IO2A 1RGIA 3C2MA 4BRQA 8ICXA 4QWAA 5KFJA 2UYTA 3J80O 2ZTEA 4DU3A 4O3QA 3THWB 3RSEA 2ZIVB 3A0HU 3MXIA 3RJJA 3VC8A 1NU0A 3KZBA 3OYFA 2YKMA 2KVSA 1SL1A 4RQ7A 1C6VA 1EP4A 9ICHA 3D2EB 5H1SQ 1K5OA 1HJOA 2YTUA 5G5HA 1S9FA 1FKPA 4DS5A 3L4PA 1ZRNA 3E9OA 2GOLA 3QU4A 1GO3F 4RZRA 1FFVA 4FPBA 2KW4A 5GTHU 3UXPA 5ALOA 2LMRA 4BY9C 1NMNA 1S97A 2ZUCA 1YTAA 2QM1A 4DFDA 2O8BB 3W0LA 4TQSA 3PX0A 3KLFA 3HWTA 4JKBA 1L5UA 4ECWA 3QEVA 3OYJA 3CQXA 3AO5A 1RYRA 1RT7A 4XH1A 4RUCA 2P9KB 4DV2K 2UVUA 4B1YB 3OA9A 4UAWA 5JICA 1QHTA 3EY1A 8ICUA 3NVVA 3D2NA 1MQ2A 2W40A 3G6EN 1VQPN 5AQXA 4YXMA 4QJFB 4E7JA 4IJNA 1HNIA 2XVTA 4YOVA 4NYFA 5AQGA 1XHXA 3M6GA 1Z3EB 1W9HA 1ZQQA 2HMPA 3HOSA 1IV8A 3HOTA 5KAIU 1EKEA 1RDDA 1ZJMA 3NVMA 3MABA 1SKWA 5KRTA 1GLJO 3SV4A 5DG8A 2Q0RA 2D0AA 4FM2A 2F8LA 5E41A 1BNPA 4CF4A 3LP0A 4YHHK 2ZIUB 4PGQA 5JVHL 3SAGA 4P0QA 2YHAA 1NK0A 3ZCMA 1CXUA 1K8AO 1Y97A 5CB1A 3QMLA 4LD0A 4IOCL 4G3IA 3SCXA 1WCNA 3AO2A 5LY3A 1N61A 2M9NA 5EXWA 1YJWN 2KIVA 1QQ7A 3P1GA 3ZYYX 1YAGA 4I28A 1BNOA 1T4GA 1JLEA 2FPKA 1LW2A 3Q8RB 2F2AB 4FWOA 4GVEA 4JK8A 4BC2A 4ELUA 1WBDA 3S6JA 4E1NA 3BQ7A 3AVGA 1B9DA 1ZQJA 4E7KA 2O8EB 4F4KA 5L1LA 7ICGA 2WOMA 3EZ5A 5KPTA 5CZ1A 3QEAZ 1Z25A 4BREA 5CE3A 3OYGA 2ZXHA 4I2HA 4XEIA 4KMOB 3RJIA 1A76A 3OHBA 3FAHA 3GIJA 4PL7A 5ALWA 2PMZC 2YCHA 3L2RA 3L8BA 5KRSA 2FSNA 4DR2K 5CJ7A 5J2KA 3J7AP 3JXUA 4QCLA 1YZ7A 4M0AA 1ZQKA 1XO1A 4E0DA 1ZBSA 4AHSA 5J2FA 4CZHA 2B6GA 3QNMA 2DFLA 1Q81O 1ZQXA 3VN5A 3GU3A 1BPZA 2E8NA 7ICVA 1N34K 1BPBA 4FZZA 3SMSA 4LFAK 3D6JA 2FE9A 5J2MA 4W5NA 4HWIA 4I7FA 3CC2N 3U4LA 2YMMA 5DB7A 2Z1JA 4R65A 3CYMA 2NZTA 4Q44A 1NBWA 4UB6U 4FWQA 2UUAK 3B8AX 3D2FB 4DWIA 1VSEA 2PZSA 2KJ5A 3VQQA 3THXB 1HRHA 2LI6A 2WC9A 1KSPA 4NL9A 5KL8B 1S76D 2GUPA 3F5EA 3WKEA 1YT3A 5HMMA 1T05A 3RRHA 3NRWA 5GAEP 1J54A 4DFPA 4O3NA 4DKWA 4FWRA 3JAMO 4CF1A 4CZMA 2VJ4A 2W9BA 5IT9O 4MQ3A 5DB8A 2H3ZA 1QTMA 3FE1A 3SBTA 2E8MA 5J0WA 2W41A 1L7PA 4M9NA 3ID6A 2PFOA 3DDHA 4ED8A 2DUYA 1ZQYA 2QB0B 3MK6A 3CCLN 4BWMA 2DPJA 1EWRA 1JXBA 4IR1A 5AQTA 4OO1J 3V1QA 2A1RA 4M3XA 3C2LA 3C95A 3K9JA 2RQ5A 2Q1NA 3OS2A 4FXDA 4K42A 2GLEA 7ICEA 3TAQA 3HJEA 2X74A 3AVMA 1X9WA 1QSSA 3VPZA 2H3QA 3K75D 5AK3A 4J9KA 3KKAC 1YIJN 2V7ZA 1L3UA 4X62K 4DB3A 2GX9A 2HHSA 3O9SA 2F7TA 5KFPA 4OX9K 2ZTCA 9ICIA 1Z19A 2YHYA 4LVSA 3HX0A 3ONNA 2GTDA 4ZTFA 2F3NA 3GIIA 1VAZA 2W43A 3J7YP 1N36K 2FPLA 3T3FA 1NGIA 5HHHA 3MX5A 3H8WA 3R8EA 3ISDA 1Z26A 4BQZA 5KQ8A 3SMPA 3MGHA 4JI5K 3KK7A 5J8YC 1RYSA 2ZIWA 3DM2A 4IQUA 1T3NA 1KFTA 5ALIA 1EXNA 2JV3A 4OKJA 2E2QA 4W5RA 1VQMN 4GKKK 4NM1A 4DL4A 4M3WA 4UB3A 2XRIA 3MDQA 5DDYA 4RQ8A 5DM7L 2FBTA 1ASUA 5HRPA 1JMSA 1F44A 4NLZA 4RQMA 4ED3A 1X9MA 5KPRA 5HNKA 2V7YA 3CC4N 1S22A 3MEEA 1X3NA 2YY6A 2MSNA 2ATLA 4KTQA 5KFKA 3RMAA 4DTOA 4FVUA 1RT2A 2KHOA 1DGJA 2AGOA 2E1EA 5AHXA 1E4GT 2WF5A 4KKOA 4BC3A 1XMOK 1Z00B 5BOMA 2J4RA 3IKMA 4EP5A 4AQYK 3K58A 2Q2RA 5AKHA 2JEJA 2VKQA 2R8KA 3L3VA 4LF4K 2FLLA 2CGLA 4P4MA 4WFNL 5AQLA 2MUTA 5L1MA 2P9LA 3N28A 3ISBA 2B5JA 2RDIA 2K4EA 2RPIA 1ZD2P 2QTDA 4FLWA 5KG1A 1SL0A 4YCXA 3IUCA 2FF6A 1KEJA 3EZWA 4PQUA 1ZD4A 5KFWA 3KLIA 3R9KA 4DL2A 4HCBA 2V4RA 5KFOA 4US8A 2Y1IA 4Y2RA 1BI4A 3EL2A 1K1QA 4BRGA 1VSFA 1WUDA 4OGEA 1N2XA 3MDCA 2P9NA 2HHWA 4EEYA 3RMDA 3ZX3A 2Y9TA 1D4XA 1Y64A 4H03B 1NJWA 4O5BA 1YF5L 4GIBA 3AY9A 3VEXA 4CJTA 4N47A 5HOOA 3LDLA 5CYQA 3QESA 4QS8A 5LJVA 5ALQA 4F2SA 5M1KA 2KSOA 1D9DA 4JN4A 4J9QA 3RR7A 1F5SA 1VQON 2W04A 3AVJA 2HOQA 4HTUA 3HRDD 4KMUA 1QS4A 4CGHA 3TAGA 2B21A 1V85A 5ADXH 2FBXA 3AO4A 1BQNA 4DMNA 2G8IA 4YMNA 1YTUA 4NXNK 3UMGA 2ZJ8A 2OCEA 1HPMA 4Y2YA 5G5GA 2J6UA 1SAZA 2OYYA 2ZUBA 1RM6C 3MXJA 3RB6A 2RHFA 3QUQA 4CZGA 4H5WA 2ZJAA 1DK2A 5JS1A 4IDKA 1D8BA 3OHAA 3O3HA 3VGLA 2KZ3A 1FFUA 3OY9A 4X66K 4YORA 2V4QA 1OXJA 1ED1A 3Q8PB 1KAXA 3AU6A 3QZ7A 2YV0X 5D3GA 5M1FA 1XU4A 3L3FX 1J2MA 3U6FA 3VQPA 1GLBG 1KCFA 2P9PA 1JLBA 2X6NA 3QYPA 4DFJA 1FW6A 1XC3A 2CGKA 1ZQEA 4C0ZA 2HBLA 4FW2A 3AQFA 1BPXA 2HI0A 1S0MA 2D0OA 4FOIA 3HVTA 3VQAA 3DLGA 5BN9A 3E9PA 3NGIA 5IIOA 1J5OA 2ZGZA 2OPPA 1OH6A 3O6WA 1TAQA 1Q9XA 4EENA 2E2NA 1ZBUA 2VYPA 3R6MA 2WHEA 1HR0K 2ASJA 3ZDEA 1NOZA 3E01A 3OYAA 4AYBC 1VSDA 4BVOA 2G8FA 1V4TA 2E6LA 5AQYA 4F92B 1ATRA 2QWLA 2G09A 4XIUA 1ZQAA 3LM2A 4J2BA 3IP4B 2DPNA 2EZXA 3OYMA 2KEYA 3M3ZA 3HSTB 4BDZA 3VMFB 4JB3A 2HOIA 5F9NA 2EZYA 3IG5A 3E58A 3VQBA 2AJQA 2NRVA 7ICMA 3ZSQA 3SR6A 1P8ZA 2HF4A 3KHHA 3NCIA 3THWA 3JPPA 5AM3A 1PK1B 4EBEA 7ICQA 2ZIVA 2BCSA 1WOQA 4QW9A 5AM4A 3RB3A 4CEEA 2EAPA 5FPNA 5HBMA 2JR5A 4MF8A 3AVNA 3D2EA 1FXXA 1WAFA 4CEOA 1N63A 4JKGB 3BS5A 4FLTA 3KOOA 2B6AA 3VTIA 2R8GA 7ICKA 9ICNA 4IKFA 1IKVA 4Y2QA 1XNQK 3HVRA 4CJVA 4BRHA 4IO9L 4KLSA 2P6UA 1NGJA 1NK4A 2MRLA 4O0IA 2O8BA 2I5HA 5KFLA 3L2VA 4GXIA 3V7LA 4U7CA 2E1FA 2E8PA 1S8OA 4KLFA 5IIJA 1L3TA 2FSKA 3L3UA 4KHPK 1LKYB 2W54A 9ICMA 4F9OA 1BOTO 4WQ5C 4KI6A 2BCUA 4UB4A 4DF4A 3HM9A 3PR5B 2D3DA 5GTIU 4KH4A 3AMZA 2QKBA 3VQ8A 4Y2PA 4IR9A 4GV9A 1S9GA 3GQCA 3WXKA 2JZBB 4FM1A 1OW5A 4QIWC 4CK3A 4CFCA 4DUZK 4JD2A 7ICNA 3JYTA 3MR5A 1W0HA 4QWCA 4X5VA 2Q0UA 1CI4A 4R63A 1HYVA 3T69A 3UKRB 3LZJA 4L8RB 4MFBA 3EE8A 4KLTA 2K8BB 3LPUA 4M63C 1KQSM 4DL7A 3F2CA 4US9A 3T5HA 4KAZA 4DTSA 4LZDA 3DRPA 1TUUA 3NTUA 4FJIA 1ECWA 1RXWA 3K1RB 4F5NA 1RYUA 4ILGB 4MLHA 2YMLA 4CRXA 3ICXA 4FJMA 2CXYA 3M8SA 1X6JA 4U7BA 1KTQA 3PLAA 4CGZA 2EANA 2ASOA 1O08A 1I3AA 2KJ9A 3ENOA 1NK5A 4UBCA 4IG0A 4CIGA 4JKDA 1BA0A 2QWMA 1EX4A 4CCHA 3MEDA 3FZLA 2D5RA 5D46A 9ICAA 1WSGA 2ALZA 2HHQA 3NVWA 3VF6A 4JHDA 3WT0A 4FJNA 1NI3A 5J0XA 4F4YA 1Y88A 4WQ4A 2BCQA 5AQSA 4DTRA 2KLAA 4BRKA 1NJZA 4FLYA 1RTDA 1JKHA 4EAHD 4YDUA 8ICMA 3NF7A 5ALFA 4CJUA 3LWMA 2AGQA 1LVHA 4EEKA 3PZPA 5CYMA 2R8HA 2XY6A 3GFKB 4V19S 5FPMA 4IFYA 2F77X 1QSYA 4M9JA 4GNIA 4QWEA 4JWMA 4O5CA 4H0TB 3QFPA 3HJFA 4MEXA 2ZF5O 3O0FA 4MHVA 2R8JA 4B9TA 4Z6DA 4DOCA 4KLIA 1ASWA 3WNGA 1QHAA 4KB1A 1CRXA 3PSFA 9ICJA 3KKRA 1NGGA 3QETA 3I28A 1P7DA 4WFAL 4FZXC 3WXLA 5J2QA 2UXDK 4M45A 3WNFA 4DSLA 2IOCA 3PW7A 3LL3A 1X2IA 3TR8A 2H5XA 5J0OA 4E7IA 2F8TA 1VHXA 2A40A 3ZETA 4CGFA 4OPKA 3MCPA 1L6NA 4JI3K 4CHNA 3ZSRA 3LP2A 3CCEN 4I29A 3NF8A 4CJWA 3OHRA 1C0MA 4O8UA 4AP9A 4QZGA 4C8OA 1RQNA 9ICLA 4UARA 4AF1A 1L8OA 1OH8A 1LV5A 2XHBA 2ETJA 2ZG6A 4M41A 4BRAA 3V6HA 4HTLA 1ZQ1C 3UXNA 1SZPA 4Y2VA 2CGJA 2ZQBA 4DOBA 3AA2A 4QS9A 4CDGA 4FPAA 4RG8A 5FP0A 5AQHA 5SWMA 2KKZA 4CHQA 2NV3A 4PHEA 5KFTA 4NYNA 4B3SK 2D1KA 2R7YA 3EPIA 1BI4B 1S0VA 4FL9A 4K0KK 4A5BA 3ITHA 3T1HK 1RCHA 3WXMB 2KHVA 2P9NB 4K4IA 4KHYA 3SENA 3SV3A 9ICPA 4MLEA 2DBYA 1IH7A 4WCEL 2F9TA 1QQNA 3GG4A 1IBKK 3RB0A 8ICIA 1WYGA 1U4BA 3U9DA 3K0SA 3T5JA 3LDOA 1RT5A 8ICVA 3H7IA 3JPRA 2K4PA 2Y9UA 2W8KA 1HLUA 4EP4A 2ZJQL 2LYAA 3NVYA 3C6HA 3EW9A 1D8YA 5KFUA 4CBXA 5C2DA 2LPEA 4O4GA 3TACB 3RBDA 1UA0A 4JRPA 1WSIA 2WAQC 2H3FA 3M9MB 3SAHA 3LPTA 5ALSA 1RDAA 1T8EA 3C5GA 4ECSA 1QQ6A 4YMOA 5JUMA 4CZKA 4CEQA 3F5AA 2E1YA 4HHTA 4NL9C 4F5PA 3DXKB 4QIWF 4P4OA 4F71A 4EHUA 2WTUA 5KT4A 1WSHA 4LJXA 5KFRA 4O9MA 4DOAA 2JHDA 4CFAA 4AILC 3JSMA 1G15A 3VEYA 3S3MA 4ISGA 3K9KA 4RPXA 3TTFA 3QEPA 5ALEA 2VANA 2GBZA 1RBUA 2JGUA 1NJIO 3H45C 1S9EA 4B8CA 3P39A 1VLBA 1COOA 3THVA 3IV6A 4RW8A 4R64A 4DQRA 1V97A 4HUGA 3VQ5A 3QNNA 2G8UA 2A19A 3Q7CA 4RCHA 2WF8A 3WK6A 2CRXA 2IMWP 9ICFA 1UOCA 4M42A 3QU2A 1JX4A 4NJ8A 4RPYA 4I2DA 3UIQA 5DB9A 4FJKA 3ZT4A 4LH5A 4F4ZA 3CP8A 4ACOA 4RW7A 4UW9A 2P66A 4PHTX 4ECQA 1SWVA 7ICHA 4K43A 1NGFA 2O4GA 1IBLK 1GLLO 2RHKA 5KFSA 4NO7A 2X6SA 3LANA 3U8XA 3C23A 2BDUA 2EH9A 1UQVA 3IG8A 4DL3A 4M9LA 3OYCA 4JI4K 1XHZA 4X65K 2JEGA 3D6RA 3ISNC 3QFUA 2YMPA 3K5OA 3RJFA 3L2WA 1VQ9N 4F4XA 4BRMA 5KFAA 4OJ6A 1H38A 1NGEA 3DRSA 1W7AA 2WB1F 4B6JA 9ICGA 2WUSA 3A5MC 3FZFA 4BE2A 4A2BA 4PJ0U 3KJVA 3TTCA 4EZ6A 1RDFA 3TU5A 3LP1A 3C0BA 2KOBA 4JK9A 8ICZA 1RT4A 3FDSA 1B9FA 4CJSA 5AKZA 5CA7A 3AVAA 3V9WA 1ZQBA 5AQWA 1HJRA 3BS5B 2ZJRL 3CXCM 3SUNA 4O5FA 4PZOA 2RDJA 2JXJA 4B9MA 1WUAA 5DG7A 5ADXA 1D5AA 5BOLA 3DRRA 2O8FB 2HDOA 2BPCA 4C7ZA 3TABA 5H2FU 3UMBA 4EHTA 4YP3A 3FFKB 4O8KA 2KZMA 3A5LC 1JRPA 5HROA 1BIUA 4G1QA 4BGBA 3K5NA 3N7RC 4J9RA 3C29A 5AM1A 3ZX0A 1XSPA 4ECXA 3PMNA 4CD1A 3OTOK 5ALHA 3BS7A 3G6VA 2P51A 4KLLA 4YR3A 1CLQA 2KHQA 4OJLA 4GXKA 3KFUF 3L2UA 4CEZA 3OSNA 3AO1A 4WYBA 4B9VA 2QWNA 5KG7A 4HUFA 4J9MA 4JD2B 2IIRA 2W42A 1RBVA 3H1VX 5I9EB 1NNLA 3AEVA 2G0AA 3Q8MA 4KTZA 3O5BA 2GWKA 1NK8A 3U3GA 1C1AA 1U45A 4Z6FA 1SQKA 2ZXIA 2IAJA 3PO5A 4H5NA 1PK1A 1WB9A 2O8FA 4N56A 2KKPA 2ZUDA 1S1UA 4I2JA 3QEBZ 1ZQCA 4BC5A 4OLAA 4H0XB 7ICSA 4ZHRA 2W55A 4J8FA 4JKGA 4K4GA 4CE9A 3G71N 1Z1VA 2WAQF 3RTVA 3QINA 2W7PA 5F2RA 4AHTA 3EE9A 5BPMA 4B3RK 3T79A 4UAUA 4AHCA 3UM9A 2O8CB 4PUOA 2F9WA 3N7SC 1IV0A 5KFMA 1KQQA 3RMCA 1JL1A 2NNWA 2Q97A 2OH2A 4I2IA 5AM0A 1DKGD 3M6KA 1RTHA 4BXOB 1U2VB 2OXOA 4Y2XA 4IS7A 2P9IB 3NVZA 2E2OA 3WNHA 4M3ZA 4YOWA 1S77D 2HBKA 1WN7A 3F9MA 1LKYA 3FYHA 3VEOA 4E3SA 4NLBA 4FSVA 2YHBA 4Y1CA 5TISU 3NGDA 4C8NA 3FLCO 4KLUA 4JHDB 5AI9A 4DSJA 2F96A 3KBBA 4YQWA 2OPSA 1TL1A 3N4QA 3V9XA 3C6AA 2R8IA 5J29A 2JZBA 4DQPA 4CF3A 3MECA 3NHGA 3ZDCA 3SLCA 3CMAN 4UAZA 3PW0A 3M8RA 4JI8K 1GLFO 2HSTA 1U6ZA 3ULEB 4KLGA 4KTWA 5HLFA 4BJQA 5AZIB 3THYB 3KHGA 2ISOA 4BDPA 1TKTA 3UKRA 1S72N 1HNWK 4NLKA 3HILA 4HAIA 3V6KA 2G8HA 5KFQA 3EYZA 3L0QA 1S1WA 3MR3A 4F50A 1QZ5A 1M1KO 9ICRA 3RH6A 2GWSA 2Z1IA 4UB5A 4Z4FA 3CJ7A 4JS4A 1HNZK 1RNHA 4NCGA 1ZQOA 4J03A 3HYFA 1EXQA 1RDCA 4FWNA 4G9BA 1WAJA 2YB1A 2F1JA 3HBTA 1TK5A 2VA3A 3QBXA 5ALDA 4O44A 4OKKA 4OJ5A 5AR0A 1K8KB 3CHWA 5M1OA 4CK1A 1YVNA 4YFUA 3G4SN 2P9SB 5E79U 1HUXA 1ZQSA 5ALKA 3ZETB 1NJXA 3BQ2A 5ALLA 1RXVA 2MA1A 3GBTA 4WE1A 5J0RA 2W03A 1RTIA 3BF3A 4N5SA 9ICQA 1GOAA 3DLKA 2PAVA 1IKYA 1MA9B 3LK9A 4KH6A 3T19A 2PY5A 2F8KA 3AA4A 3VERA 3PMLA 1T94A 5EE0A 4PH5A 1ZQNA 3C6TA 3O4QA 4NCBA 1UA1A 3MMVA 5ALRA 5LMNK 4FJJA 1V9PA
chains in the Genus database with same CATH topology
4H0PA 3C2KA 2H3GX 4JKHA 1HKGA 4KITB 2XGPA 2HHTA 9ICKA 2PXIA 1Q7YO 3K4GA 2XGQA 3OBYA 2IHMA 8ICBA 1ZQLA 4IRDA 1ATSA 4JKFA 5DQGA 2PFNA 3AU2A 3HT3A 1ZQIA 4PPXA 2HBMA 3VGKA 3H1QA 3QICA 1NKBA 2AU0A 3A0IX 2E8AA 4U67L 5TZVA 5J2EA 4IEIA 2IVPA 3WQUA 4PKIA 3V72A 4GC6A 4H5TA 4CZFA 2I9GA 3V7KA 1ZQRA 2XCPA 2PI5A 3VF2A 3MWTA 4K4HA 4IQTA 2QXLA 4XQ8A 4M7YA 3UQ0A 5CHGA 3LDQA 1WCLA 1SS6A 5C0YA 2AA4A 1S0NA 5AQIA 2HOEA 4CI6A 3CCSN 4TUPA 4H0YB 3F2KA 3RJGA 5L9XA 1BPYA 4WQ4C 3J7ZO 5C5JA 2YHXA 3RR8A 2PFPA 4F2RA 5C15A 3M9OB 1NGHA 5J2JA 3KHRA 4KLOA 4YMMA 4TURA 4YDUC 4TUSA 3C5FA 3MX2A 5AQRA 1KAZA 5DB6A 5AQVA 1XS9D 3PR4A 4H0OA 4C8MA 1L3VA 3DXKA 4FS2A 3VOVA 4BVPA 4B1UB 5KFZA 1YITN 5AQKA 8ICYA 4DQSA 3ZD8A 4P2HA 4QS7A 3QB0A 1QVGM 1T6CA 3MN5A 4BRFA 2NRZA 8ICLA 4FO0A 5IINA 5EX5A 1P90A 5BRHA 3WEEB 8ICJA 1KDHA 4EBCA 1QLNA 4GXJA 4QWDA 9ICWA 4HYKA 1NGDA 4Z6CA 4K41A 3JPOA 4QW8A 4IRKA 3D7EO 1HUZA 2OTJN 4M9HA 2NLXA 5BPNA 4KBOA 3PIOL 2W9CA 4QZCA 4RQ6A 1ZQMA 4BR5A 7ICOA 3HTVA 4BROA 5DLFA 3PW5A 9ICEA 2ITMA 4O3RA 2QWRA 2ISPA 3ZEUB 4O3OA 2F1HA 3HSCA 5DGBA 3MDAA 2V9WA 1W97L 3GV5B 5KT7A 2FSJA 4QZIA 5C10A 1D9FA 3CPWM 4L3QA 3VEWA 4KLMA 1BPDA 1U49A 2FPMA 4BR0A 5BRDA 4KLJA 3CPEA 3H3NO 4FO6A 4CJ7A 1Z6RA 1XSNA 4GV6A 1NM1A 2ZJ5A 2GEMA 1C7YA 5BN8A 2W9MA 3JPNA 3RB4A 4CBUA 4QZ8A 4DEZA 4ECVA 8ICNA 5GAGP 5JVGL 4PGYA 4FS1A 3FR0A 3ISCA 1ZXOA 4ZH4A 4NLGA 2C22A 1JIHA 5KFEA 3AARA 3SI8A 3C65A 1LCUA 4DL5A 2A42A 4EFHA 2HF3A 3G25A 1VQ8N 4PHPA 4JUZA 5FPEA 2F1IA 4MEYA 8ICQA 1IXRA 4IRCA 4IXCA 4NY8A 5AFUA 1JN3A 3VF4A 2GELA 4RQ2A 4B1VA 4PL8A 5GINA 1NGCA 2IA6A 2EWSA 4FWPA 4R8UB 4KN7A 5IIMA 4F5RA 4CZJA 3C1YA 2OWOA 3E9LA 4QZDA 4OPHA 2RE2A 2ASDA 2BHNA 1VQ4N 8ICPA 1ILYA 1RZTA 1DT9A 4ECYA 5J0QA 4IJAA 3CQYA 2BQ3A 3OSPA 5HP4A 1QSLA 4YVZA 2IVNA 3MFHA 3SAFA 4BXOA 1BUPA 3UQ2A 1U2VA 2QWPA 2V52B 2UVRA 2P9IA 1S72N 2XC9A 9ICXA 3WQTA 3BQ1A 4RU9A 3M9NB 2CH5A 1ZYQA 2JWLA 3IM1A 5DQIA 4XUSA 4J9NA 4IEEA 4A61A 4B1XB 3ULEA 4DCHA 4YFKA 3ENBA 5GADP 5AZIA 3BQTA 4RQ5A 4QZAA 3T5KA 2FMSA 1XSLA 1M90O 1QQMA 2BKEA 1TK0A 4TUQA 3AGRA 4E1JA 4ILJA 3CJBA 3MWPA 3RRGA 5AQJA 4ECZA 3H4DA 4Z94A 2CH6A 4WF9L 3HW8A 1Z05A 1NKEA 7ICFA 1K8KA 4XA5A 2E88A 2P9SA 3EO3A 4BG8A 3RJKA 3N4PA 1NMDA 4CZIA 1D8LA 4RNOA 5B8HA 3PIPL 3TFSA 3RJHA 4B9SA 3VESA 3EN9A 3B0YA 2YI1A 4FWMA 2BDPA 7ICJA 1DGKN 4DQ8A 1RDWX 4IQWA 1ZQDA 4Q43A 4DFKA 2OTLN 4B9UA 3PNCA 4M2YA 4B9QA 5GIOA 2VCPA 2LYHA 4J9PA 2Y1JA 1NKCA 1HX1A 4UBBA 5KG4A 4DO9A 9ICSA 3MN6A 5DBAA 4A57A 3UXOA 9ICUA 1C0GA 1JCFA 1JCEA 2YHWA 3R9PA 4H5VA 2VWBA 1XWLA 3DLLL 2C28A 3CETA 1BVSA 2HVIA 4ILHA 4J9SA 2OANA 3E66A 3A5OC 4IOXA 5BREA 4YN4A 1R59O 3IHQB 4F3OA 1DOQA 4ELVA 1TK8A 4IO8A 2HBJA 4RTFD 3GOIA 1KC8O 3WXIA 4IQVA 4MFFA 4XH5A 4ISFA 5HMLA 3SYZA 5J0PA 1YJ9N 2BPGA 2A41A 4IFEA 3GV7B 4R79A 1ZQTA 2VGNA 3O8MA 1U47A 4MO5A 1ZJNA 1GLEG 4JK1A 4YD1A 3CCJN 1N8RO 5E26A 1S10A 5KFNA 5DGAA 2QI2A 4RPZA 5AQQA 1NOMA 4BC4A 4BG9A 4FOEA 3RAXA 2VGMA 9ICCA 4TQRA 3O9UA 3KWGA 4GLXA 4H5RA 5C2FA 3C7NB 4NXZA 2W9CB 1O13A 4PKGA 2QW9A 2C2RA 4ED2A 4B1WB 3MN9A 2PFQA 3H3OB 5CWRA 3H4BA 3GIKA 2PFUA 1TFRA 1ZQHA 3G6XA 1VQNN 1DEJA 1XC9A 1KD1O 1HKBA 5EVZA 3RVCA 1N48A 4GV3A 5AFUH 8ICKA 5EWFA 1NLVA 2FLPA 3FGUA 5AQNA 4ECUA 2JEFA 4UB2A 3KTQA 2BPFA 2FLOA 3IFRA 4I2GA 4CZLA 3GV8B 2QEXN 3WEEA 2NRWA 5JLHA 2PI4A 3TI0A 3GIMA 5AZJB 3SZ2A 3UKUA 1AROP 1QZ6A 4DF8A 1SKSA 1XUPO 3PW2A 8ICAA 3ETLA 1BDGA 4B9NA 9ICVA 2FXUA 3E1YA 1ATNA 4BQLA 3RH4A 3NVKA 3ZEUA 2WBNA 3O08A 2WFBA 2A6AA 3NMUA 4DS4A 2DPIA 3E2EA 3VENA 1TKDA 4UB1A 2QWQA 5AQFA 3A8YA 3DXMB 4YXJA 1IM4A 1V4SA 2I7NA 2BCRA 5BRFA 1LOTB 5JMVA 2BQUA 1NGAA 4FBUA 2HVHA 5JLFA 5KPZA 4KLQA 2FLNA 5F9LA 3G6YA 5CR4A 7ICUA 4DSFA 4UY8O 4BGAA 2KFZA 4RWTA 4M7XA 3CERA 4Q8FA 3BF1A 3RJEA 3GILA 4I6MA 9ICBA 1BPEA 4RNNA 1NK6A 3P31A 4FWLA 5J0TA 2ZJPL 5DKWA 5KFCA 3QZ8A 1UT8A 3HRGA 3PO4A 3OGUA 1QVFM 1BWFO 1ZQVA 3CIPA 4RQ0A 3ID8A 3KHYA 1YHQN 2J6TA 5BPCA 4OPAA 3PV8A 1K73O 4KN4A 2ASMA 3LDPA 4R8UA 4ED6A 4JK7A 3ZDBA 5CHIA 3M5RA 4P4PA 4DLEA 2FMPA 3ORYA 4XRHA 4I2BA 4A59A 1SKRA 5IIKA 1K1SA 4FWSA 1TYQA 1MDUB 3H46O 1MWKA 8ICTA 1BA1A 4ECRA 3LM9A 4IDHA 1GLDG 7ICIA 3GE1A 4YG2A 2P9UB 1X9SA 2E2PA 8ICCA 3CD6N 4YR2A 4QWBA 3BQ0A 5FPDA 1NGBA 4Y0WA 4FBTA 4BR7A 3T5LA 4ED1A 4RQ3A 2C2DA 3HZ6A 1VQ5N 4QZ9A 4DQIA 2GWJA 3DAWA 4YOUA 1KFDA 5KTQA 5KFBA 5EOYA 1ZQPA 2Q31A 4A5AA 4KLHA 5KFFA 3IMXA 5KG2A 4RT2A 3MN7A 2P6RA 2IVOA 5DDMA 3TAPA 2AP1A 5D49A 4O3PA 3MR6A 4DQQA 1ZQFA 4F93B 3ZDAA 3P38A 4J9OA 5TKYA 4G9ZA 1BGXT 4UAYA 3CI5A 5M1PA 3VETA 1NJYA 2ZTDA 3VEVA 3BJYA 2D4WA 5AQUA 2FMQA 4BRNA 5KT5A 4BR4A 1ZETA 5EOZA 3CJ9A 3KWIA 5J2DA 1XQSC 2JEIA 4YOXA 5L1KA 1YUWA 1YJNN 2HHUA 5HHIA 3L4IA 4B1ZA 2IBKA 3HPOA 1KXPA 3Q8KA 1YXQA 2NRTA 2D0PA 5KG0A 5J2IA 1RFQA 4LC9B 2FF3B 1NWKA 3ATUA 5AQZA 5J2CA 5KG5A 5C12A 4JV0A 4I2EA 3PY8A 4JKEA 3CCVN 3RBEA 1CZAN 4LZGA 4C23A 4Z6EA 5F0XA 3RAQA 1GLAG 2E1ZA 3CJCA 2Q0ZX 1DGSA 3CJ1A 4JWNA 4NLCA 1W2BM 4BWJA 1JJ2M 5DBBA 2KTQA 1EO1A 4DSEA 5CP2A 3FZKA 3H8SA 1BG3A 4NM2A 3V7JA 5KT3A 4DLGA 1YI2N 3VTHA 8ICOA 3LWLA 2WTFA 1CUKA 4BRCA 4BRDA 2NRHA 4BR2A 3C1ZA 2YJEA 3Q8QB 1VQ7N 4FWKA 4C1NI 2BGWA 3CCRN 1U48A 3O4WA 2BQRA 3KVGA 3MBYA 1B43A 3EPGA 3PVXA 5AQOA 1VQLN 5KFYA 1NK7A 1IG8A 4Q45A 3IDHA 1ZQGA 3I33A 3SBGA 3ZX2A 5MLCQ 1J6ZA 4BRPA 4DSKA 3C7NA 2YX6A 2VA2A 3UKUB 2AQ4A 1MSWD 3UPQA 5IIIA 2J6SA 3J8AA 1C0FA 3RSEB 1JCGA 5J0UA 3TANA 3RH5A 5BR9A 2A1JA 1RPLA 2ASLA 3H40A 2ZWHA 4JKAA 5KT6A 3R3LA 4BR9A 3DJCA 3P4IA 1TVAA 4AM6A 3HI0A 4EZ9A 4YR0A 3C21A 1GLCG 5EY4A 3T7ZA 4O5KA 5AQMA 4ECTA 4F8RA 2Q36A 4M6WA 2NRXA 2HHXA 5DBCA 2XCAA 2BH1A 4QZFA 1TV9A 1B22A 4C8LA 1KAYA 5L1IA 4CZEA 3QDKA 1T7PA 4DFMA 3CCQN 3LDAA 2JWKA 5IILA 3A5NC 5AZJA 2I1QA 1CEZA 8ICRA 1S3XA 3MFIA 1A77A 3O1WA 4RQ1A 3JPSA 2HHVA 1UT5A 1TAUA 3TPQA 4I6MB 4UQGA 1KFSA 4YOTA 3V6JA 1HJPA 5KFVA 5AQPA 3QE9Y 5BPLA 3OJUA 4EYHB 3BUZB 4QZBA 5TKWA 3DXMA 3SK3A 3O9TA 3ATVA 7ICPA 3M1FA 2P9KA 5EWEA 1K9MO 3TQ1A 3TARA 4I27A 2I7PA 4Q8EA 1JXEA 3B0XA 3EKUA 3S41A 1ZQZA 2PBDA 4RT3A 1TYQB 2BCVA 7ICRA 1SZ2A 5KFHA 4QZEA 1OKJA 4IOAL 4GC7A 2HW3A 1OVYA 1PZNA 3R1XA 5L1JA 5CR0A 5KG3A 5KG6A 3SJHA 3GDXA 1JXLA 3KHLA 4EBDA 4MFAA 1QQOA 1TUYA 4MF2A 3JPQA 4WFBL 3ZD9A 3O9RA 5EWGA 1VQKN 4EYIB 5DLGA 2V51B 2W9BB 3EKSA 3AAPA 2A3ZA 4JNEA 4YOYA 1Q86O 3AUOA 8ICGA 3L4QA 5GIPA 3MCAB 4AM7A 4RUAA 4BGDA 3JS6A 2XY7A 1ZQWA 5KQDA 9ICOA 4K25A 3O9QA 4M04A 3BEXA 1Q18A 4J9LA 3HM8A 3OW2M 1LB2B 1X3MA 3UB5A 3H6EA 1KRPA 4F91B 1G99A 5HL7L 3CCUN 4QZHA 4ISEA 2P9UA 5J0SA 3D2FA 4DL6A 3W3DA 2UVWA 5F1XA 4DHYA 2ZGYA 4KLDA 3H8JA 3GDQA 4KLEA 9ICTA 5M1QA 4BRIA 4H0VB 2IHNA 2YJFA 4ELTA 3CCMN 4O3SA 3O1BA 1H1VA 1BO5O 4A2AA 4JKCA 8ICFA 3I55N 4JEPA 4F5OA 3ZDDA 8ICHA 8ICSA 3AAQA 2BR0A 1T3VA 1X9JA 3FZHA 3N4MB 5E84A 1ESVA 4XH4A 3BP8A 3O80A 4I2AA 3Q7BA 5KFGA 3TSUA 2MUTB 2P9LB 5M1NA 4BRLA 3WXJA 4MFCA 4M9GA 3CMEN 1L3SA 1N56A 3EWAA 5J2AA 3BDPA 1ZC6A 2AQ0A 3PX4A 1EQYA 3HP6A 4F4WA 2UVVA 3TSPA 1HUOA 5KFDA 2BUPA 2W9AA 1HKCA 2KZZA 4RQ4A 3AGKA 3UE5A 5KFIA 4ED0A 4O5EA 4GY2B 3DWLA 4R66A 2AGPA 3ENHA 3I8BA 1MWMA 2C2EA 1MC8A 4DSIA 4CD3A 1T6DA 3VGMA 4I2CA 4IWVA 5D4BA 3VEZA 2KFNA 3GL1A 4JV2A 4I2FA 2VA8A 5KFXA 4MDBA 4PKHA 3MR2A 5LJWA 3LDNA 1Z00A 3CF5L 1S0OA 2ASPA 3OJSA 3QBWA 5GAHP 1T44A 2MAXA 1VQ6N 3I56N 3JPTA 5J2BA 4NLNA 4PHAA 3PX6A 3Q8LA 4B9LA 4JV1A 1E4FT 5J2HA 2W8LA 4ED7A 7ICLA 2E20A 5DG9A 4MO4A 2P9PB 4PHDA 4C8KA 1BU6O 3PW4A 2KN7A 3OBWA 3U9ZA 2XO7A 3MGIA 3N97B 4JAXA 4NB4A 4WQ5A 2A1JB 3F5TA 4CBWA 5DQHA 3WUHA 2BTFA 5J0YA 8ICWA 3FZMA 4C1NK 1RDUA 4RNMA 1IJJA 1NK9A 1U9LA 3CJAA 7ICTA 5J2GA 4M6WB 3TTDA 3Q8SB 8ICEA 4M47A 1KLNA 4PGXA 2NRRA 3TFRA 2QA4N 4A62A 2QWOA 4EIAA 4YD2A 5ELZA 3TSQA 2XY5A 1SL2A 5DM6L 4F5QA 4MDAA 1MQ3A 3L6QA 1Q82O 1ZQUA 2A5XA 4KH5A 5KT2A 1RGIA 3C2MA 4BRQA 8ICXA 4QWAA 5KFJA 2UYTA 2ZTEA 4O3QA 3RSEA 3RJJA 3KZBA 1SL1A 4RQ7A 3D2EB 9ICHA 5H1SQ 1HJOA 1S9FA 4DS5A 3E9OA 4FPBA 4RZRA 3UXPA 4BY9C 1S97A 2ZUCA 2QM1A 3W0LA 4TQSA 3PX0A 3HWTA 4JKBA 1L5UA 4ECWA 3CQXA 1RYRA 4XH1A 4RUCA 2P9KB 2UVUA 4B1YB 3OA9A 4UAWA 5JICA 8ICUA 1MQ2A 2W40A 3G6EN 1VQPN 5AQXA 4YXMA 4IJNA 4YOVA 5AQGA 3M6GA 1Z3EB 1ZQQA 2HMPA 3HOSA 3HOTA 1ZJMA 3NVMA 3MABA 1SKWA 1GLJO 3SV4A 5DG8A 2Q0RA 4PGQA 5JVHL 3SAGA 1NK0A 1K8AO 5CB1A 3QMLA 4IOCL 4G3IA 1WCNA 5LY3A 2M9NA 5EXWA 1YJWN 3ZYYX 1YAGA 4I28A 1T4GA 4GVEA 4FWOA 2FPKA 4JK8A 3Q8RB 4BC2A 4ELUA 1ZQJA 4F4KA 5L1LA 7ICGA 3EZ5A 5KPTA 3QEAZ 4BREA 5CE3A 4I2HA 4XEIA 3RJIA 1A76A 3OHBA 3GIJA 4PL7A 2YCHA 2FSNA 5CJ7A 5J2KA 3JXUA 4M0AA 1ZQKA 1XO1A 4E0DA 1ZBSA 1Q81O 5J2FA 4CZHA 2DFLA 1ZQXA 1BPZA 7ICVA 1BPBA 3SMSA 4HWIA 3CC2N 3U4LA 5DB7A 4R65A 2NZTA 4Q44A 1NBWA 4FWQA 3B8AX 3D2FB 4DWIA 2WC9A 1KSPA 1S76D 2GUPA 5HMMA 3RRHA 5GAEP 4DFPA 4O3NA 4DKWA 4FWRA 4CZMA 2W9BA 5DB8A 3FE1A 1QTMA 3SBTA 5J0WA 2W41A 4M9NA 3ID6A 2PFOA 4ED8A 1ZQYA 3MK6A 3CCLN 4BWMA 2DPJA 4IR1A 5AQTA 4OO1J 3C2LA 3K9JA 2Q1NA 4K42A 7ICEA 3TAQA 1X9WA 1QSSA 3VPZA 3K75D 4J9KA 1YIJN 2V7ZA 1L3UA 4DB3A 2GX9A 2HHSA 3O9SA 2F7TA 5KFPA 2ZTCA 9ICIA 2YHYA 4LVSA 3HX0A 2GTDA 3GIIA 1VAZA 2FPLA 3T3FA 1NGIA 5HHHA 3MX5A 3H8WA 3R8EA 3ISDA 4BQZA 5KQ8A 3SMPA 3MGHA 3KK7A 1RYSA 4IQUA 1T3NA 1KFTA 1VQMN 1EXNA 2E2QA 4NM1A 4DL4A 4UB3A 3MDQA 5DDYA 4RQ8A 5DM7L 1JMSA 4NLZA 4ED3A 1X9MA 5KPRA 5HNKA 2V7YA 3CC4N 1S22A 1X3NA 4KTQA 2ATLA 5KFKA 4FVUA 2KHOA 2AGOA 1E4GT 4BC3A 1Z00B 5BOMA 2J4RA 3IKMA 2Q2RA 2R8KA 2JEJA 2FLLA 2CGLA