1SV0C

Crystal structure of yan-sam/mae-sam complex
Total Genus 27
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
27
sequence length
82
structure length
82
Chain Sequence
b'PLGSDGLPLDPRDWTRADVWKWLINMAVSEGLEVTAELPQKFPMNGKALCLMSLDMYLCRVPVGGKMLYRDFRVRLARAMSR'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Ets DNA-binding protein pokkuri
publication title Derepression by depolymerization; structural insights into the regulation of yan by mae.
pubmed doi rcsb
source organism Drosophila melanogaster
molecule tags Transcription
total genus 27
structure length 82
sequence length 82
chains with identical sequence D
ec nomenclature
pdb deposition date 2004-03-26
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.50 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 Transcription Factor, Ets-1 1sv0C00
2QB0B 3IDWA 2D8CA 3BS5A 2E8PA 5J8YA 3BQ7A 3HILA 5JU5A 4IS7A 2L5YA 2LPEA 1X9XA 1X66A 3H8MA 3KKAA 5JRTA 2FE9A 1OW5A 2Y9TA 2QARB 1V38A 2F8KA 1DXSA 2QKQA 2KE7A 4RQNA 3TADA 4NJ8A 2QARA 3K1RB 2Y9UA 1PK3A 2K60A 2QB1A 5F3XB 1JI7A 1RG6A 1SXDA 1X40A 4NL9C 1SV4A 1LKYA 3SENA 3SEIA 2GLEA 2KIVA 3BS7A 5J8YC 2DKXA 2LMRA 2YTUA 4MHVA 1PK1A 3KKAC 3TACB 2F44A 2ES6A 2K4PA 1B4FA 1LKYB 3TADC 1UQVA 1OXJA 1Z1VA 5L1MA 2DKZA 1PK1B 1UCVA 2D3DA 1SV0A 1WWVA 1SXEA 2JV3A 4PZNA 2E8MA 1WWUA 1B0XA 2F3NA 1SGGA 2E8OA 2EANA 5KNIA 2EAPA 2B6GA 2EAMA 4PZOA 1V85A 2DL0A 2QB0A 1F0MA 2KG5A 1KW4A 2KSOB 5JTIA 2ESEA 2KMDA 3BS5B 1COKA 2E8NA 4NL9A 2EAOA 1SV0C 2KSOA 4RQMA
chains in the Genus database with same CATH superfamily
1UA0A 4LZGA 2QB0B 5DLGA 4I28A 3ZDAA 2Y1JA 2R8KA 4ECTA 2E8PA 4A8EA 3KZIU 5DDMA 3RJGA 3QEBZ 3C2MA 3DV9A 1Z4OA 2G07A 2JR5A 3GV7B 3UXOA 5J0UA 4QWAA 4RNMA 1KFSA 5HMLA 3C5FA 1ZD5A 3N7SC 4UAYA 4YR3A 1SV4A 5AK5A 5KFUA 1JXLA 2LYHA 4KLQA 4IQUA 5J2DA 1XWLA 2FPLA 4UAVA 4BWMA 2Z7JA 3C21A 3PSFA 2G0AA 5HHHA 4C4RA 1S76D 1BGXT 4Y2XA 2XICA 2R18A 2CN1A 4AP9A 1B4FA 1A6SA 3UMGA 4KMUA 5AHXA 2CXYA 2BCSA 2XVTA 3QX7A 5L1MA 1Z19A 4DLEA 3C23A 2F77X 3IHQB 2JH7A 1QQ7A 1WUDA 2AQ0A 3H0MB 5C0YA 3Q8RB 5L1JA 3H4BA 4RQ1A 5AI6A 5DQHA 3T3FA 2KFNA 2F1HA 4TUQA 4RUAA 2DL0A 2ZJAA 5AKKA 1TK8A 3M1YA 4Z6CA 4BXOB 9ICNA 4QZEA 4F4YA 3V72A 1SKSA 1TK5A 1SL2A 4PGQA 2KMDA 2KTQA 4BGDA 4DQQA 5J0WA 2ZIUA 4RQ6A 4B9LA 2Y0SF 1U48A 4FZLA 4M9LA 4MFAA 5KT5A 2LI6A 4ED3A 5EWGA 5AICA 2J6UA 2AQ4A 5ALRA 2BCRA 3R9KA 2W9AA 4NY8A 1ZQMA 3TADA 2VA2A 2Y9UA 2K60A 2QB1A 1QQ6A 2FPMA 1SIJA 2CPRA 4DSIA 2JZBB 4U7CA 5DKWA 3TKAA 5EE1A 2KIVA 4O0IA 2KN7A 1X2IA 2OM6A 5KFMA 4ECQA 3AU2A 4DFJA 2AXTU 3BJYA 5ALVA 3B0YA 5KFDA 3RJHA 8ICVA 4QW8A 1N62A 4DL5A 1KN5A 4F71A 1N56A 8ICFA 2XI9A 3SYZA 2GOLA 1L7OA 5TZVA 3ZDEA 2W9CA 3HKZF 2DBYA 4R66A 3RAXA 2HI0A 1ZD2P 2W03A 4XRHA 5EWEA 2E8MA 2YQEA 4GC6A 2ASDA 3ZDDA 5J2KA 5ALNA 5DB6A 4UASA 4DOBA 4FE3A 2EAMA 2LBOA 1S10A 3SAGA 5E79U 5F9LA 1MQ2A 3PR4A 2XY7A 5G5GA 3VC8A 1KFDA 2RP5A 2RRDA 5KFOA 4KN4A 1CUKA 1XU4A 4CNQA 4YCXA 1SKWA 1SV0C 2BCQA 5D46A 1TAMA 4Y2PA 1FFUA 4O5KA 4ECZA 1WG8A 5KG3A 2KZ3A 1ZRNA 1RM6C 4Y2VA 2W9MA 1J97A 1L8OA 2JRZA 1N60A 1Q3UA 2WFAA 4US8A 2QARB 1NK7A 3LVWA 4PHDA 1D8YA 3LVVA 2HVIA 3G6VA 3K1RB 4Q8EA 1C7YA 1NZBA 5EE3A 5KG2A 2NRZA 3PSPA 3RJEA 4PHEA 1IG6A 7ICEA 2GLEA 3LWLA 4ECXA 2HBMA 5IINA 5ALOA 2P6UA 2IBKA 5BOMA 3UQ2A 4KLSA 1ZXIA 3GIMA 2K4PA 2UVUA 2DUYA 2PMZC 2VJ4A 5ALDA 1X6JA 4J9RA 3ZD8A 4B9VA 3V6JA 4F4ZA 5AM1A 4KLIA 3JPSA 3MFIA 1JX4A 4NM1A 3H0LB 4CF4A 2K89A 4I2GA 1JN3A 4F50A 1SKRA 1UPHA 3WK9A 5J0QA 2K8CB 3H8JA 5DLFA 1Z3EB 2KNJA 1NK9A 1MC8A 3BZCA 3AEVA 3KHLA 2ZJ5A 1F5SA 3NS1A 1Q8KA 4MEYA 4TUSA 1KFTA 9ICPA 1TK0A 3KHRA 2HHUA 2KOBA 3TQ1A 1SWVA 4ELUA 2E5SA 4YP3A 5KL8B 5AKZA 3LWMA 4I27A 2PFNA 4X5VA 2FI1A 3M6ZA 4WJ3B 5CRXA 3NTUA 3QE9Y 1X66A 3H0RB 2WTFA 9ICFA 4DFMA 4KLUA 3U26A 2ZIUB 4UAWA 2W7OA 8ICOA 1J2NA 4ECSA 4C8LA 4RQNA 4FBTA 4KLDA 3HX0A 5ALSA 1SXDA 2BQ3A 3UXNA 2KJ5A 4Z6DA 4HYKA 4J9OA 3H8SA 5ALIA 3OHAA 4YD2A 2GO7A 4ACOA 3JPPA 3QYPA 4ECVA 5KT6A 3SD7A 4I29A 4LVSA 1WCLA 1DRGA 2XGQA 3RF9A 4C8OA 5DGAA 3E2EA 4YR0A 3RAQA 3TADC 4ECWA 1KEJA 5KL1B 3CNHA 5AI8A 3L5KA 3QU4A 3KHHA 3KFUF 1ZRMA 3ZI4A 1VDVA 5DG8A 3O0FA 3RBDA 3F53A 3QU9A 1SZHA 2F3NA 1SGGA 4C4TA 2WB1F 4QZGA 3IP4B 4F2RA 4C80A 4F5OA 4IC9A 1D8LA 3RR8A 8ICUA 5KG0A 4DWIA 5DBCA 2BGWA 1HUOA 4IRDA 4RQ3A 3TAQA 1UT8A 2XC9A 1TKDA 5BPCA 3IG5A 3GDXA 3BS5B 2YX8A 5DBBA 3C1YA 4NXZA 5J0PA 1JUDA 4XQ8A 5AI0A 2VA8A 3T5LA 8ICCA 3N4MB 2HHWA 1ECWA 2F1JA 1IXRA 4DSEA 4DL4A 3MABA 3WU2U 3BQ7A 9ICMA 1Q3VA 2KKVA 5ALGA 2FE9A 3M8SA 1FIQA 2R8IA 3RFAA 2BPCA 2FLNA 1PK3A 2UVVA 4DL2A 3ISDA 3KZXA 4QIWF 1TVAA 5CHGA 2KVCA 3ZD9A 3SQIA 4QZCA 4QZAA 4UAUA 5AM2A 2JZBA 1NKBA 9ICSA 2DKXA 5AK4A 8ICAA 3SR6A 2WF7A 2K8AA 1QQ5A 3ETRA 2NRVA 4BUGA 3KOOA 2ES6A 1TAQA 3FYHA 2WAQC 3LK9A 4EBCA 1D9FA 2YB4A 4M9JA 1TAUA 2W3SA 2XO7A 4F5RA 3MC1A 4KX5A 4UB6U 2DKZA 5EE9A 3TFSA 3MR2A 4OJ5A 3UXPA 2JV3A 5KFLA 1S97A 2G08A 5A0LA 5AI5A 3V7LA 3EZ5A 4M0AA 2KP7A 3RBEA 2MSNA 5KTQA 1T3NA 5J2HA 3J81j 3RB4A 7ICLA 8ICIA 4PZOA 1CEZA 5AKEA 5ALXA 2KEYA 4B9TA 2BCVA 2KD1A 2M0NA 4ZOHC 5J29A 7ICOA 3PW0A 4EYHB 2KSOB 4FFDA 4JK1A 3PSIA 4DSKA 2ESEA 5DBAA 4RQ7A 3I76A 4UARA 3H8WA 4I2IA 3PW5A 4QZ8A 3I1YA 4ED0A 4YMOA 2F76X 3NRWA 4YMNA 1YZ7A 1KRPA 4AYBC 1S77D 1DGSA 2DGZA 3G6YA 1BNOA 2Q4TA 3HILA 1NJYA 2UVRA 2K4EA 5CR0A 2GH1A 3CW2C 3GIJA 1BPBA 3Q8MA 5J0SA 8ICMA 2ZIVB 4DQRA 7ICKA 2QARA 3I28A 5EWFA 5KFRA 1RG6A 3S6JA 2VKQA 4UB8U 2UVWA 4C7ZA 5T14A 3H7IA 1HEKA 1KLNA 4ED6A 1A76A 5J0TA 3JPRA 4YG2A 2WF5A 2OCEA 2OXOA 3C2KA 3V6KA 2A1JB 5AKLA 1X9MA 1Z1VA 8ICSA 3QNMA 4GFJA 1T8EA 2EZXA 4DLGA 3QXGA 1WWVA 5DG7A 5HR7A 3D2NA 4M2YA 1J2MA 5DQIA 4G3IA 2E8OA 2JH1A 4DS4A 1ZQIA 1AROP 2M9NA 1ZYQA 4EBDA 7ICHA 1ZQAA 4FBUA 5ALLA 1U47A 3LDAA 1T4GA 5IIJA 3QUBA 3CP8A 4GXKA 2EZYA 7ICJA 5KG5A 5JTIA 9ICHA 1ZQDA 3WK7A 2ISOA 2LYAA 2CRXA 3BZKA 2C28A 4F4WA 1NI3A 5JU5A 5AIBA 3PX4A 2NRTA 3H8MA 3PV8A 1ZQKA 1ZJMA 1IV8A 1N2XA 3HPOA 5J2GA 4QWCA 2IOFA 5AKHA 4UB4A 2AHOB 9ICTA 5J2CA 3HT3A 2BDUA 1KDHA 5FP0A 2B0CA 1TFRA 1QLNA 5KFJA 9ICOA 2PI4A 2FMSA 2LYBA 1A77A 3BS7A 5KFWA 5AKJA 4IQTA 2LMRA 1ZQSA 4K4HA 4O3MA 4EX7A 5EOZA 3HP6A 1BPZA 3C2LA 1KQQA 3C28A 3SMVA 2H3FA 5KFGA 4TUPA 2ASJA 1ZETA 3Q8QB 2HHSA 1FEZA 4RQ2A 1ZQUA 2FPKA 5F9NA 1S0NA 4YFKA 2NO4A 4QZDA 1B0XA 1HIWA 1BPXA 7ICPA 5J2FA 2Y1IA 4DF8A 3ICXA 1XC9A 1O08A 4Z6FA 4JV2A 9ICKA 3D2QA 2WF6A 5D49A 4ELTA 3AQEA 1L7NA 4F4XA 3E0FA 1NKEA 2H3QA 1KSPA 3A0HU 2ZIXB 3WK5A 2WF8A 2BQRA 2E8NA 4DOAA 4PL1A 2EAOA 4FZMA 4GIBA 3UM9A 3HJEA 4DSFA 5J0RA 3BS5A 4Y2QA 4OJOA 5KFYA 4IRCA 5IIKA 3LYSA 5JRTA 3EUB2 5ALJA 1NNLA 5CA7A 4NLGA 2XCPA 4DF4A 3C1ZA 2G5HB 5HNKA 1T94A 2YN4A 2PKEA 1DOQA 1U45A 4I2DA 4R8UA 1YT3A 1ZQBA 2I5HA 4E0DA 2A3VA 1L6NA 4XA5A 4Q45A 2KFZA 4MHVA 2IOHA 2BCUA 2BDPA 8ICTA 5ALQA 2I9GA 4CF5A 3F2DA 2KHQA 2IHNA 3AQFA 5ALEA 4PPXA 2MU2A 4F92B 3PO4A 4FZNA 2YMLA 4EZ9A 5BOLA 2AGQA 2C2DA 1S5LU 4M9GA 9ICEA 2PMZF 3D2SA 1D9DA 1DGJA 3OGUA 4PZNA 5J0YA 1WYGA 4RNNA 3TARA 4OD0A 3QEAZ 8ICXA 4O3QA 1ZQGA 2FLLA 1BVSA 3JPOA 1ZQYA 1URJA 3RRGA 3ZDBA 1B22A 2W04A 3UMBA 2BPFA 2MAXA 4RPXA 4QWEA 1ZQXA 4YVZA 1N63A 3V6HA 3KD3A 3Q8LA 4NWIA 5AKIA 4F3OA 4PJ0U 1KTQA 2D6FC 3NVYA 2RQ5A 9ICLA 2JEJA 4U6PA 1N48A 1P7DA 2JGAA 3NGDA 3SI8A 8ICNA 3AL0B 5AKGA 2W8KA 2P66A 2KV2A 2KSOA 4I2EA 4RQMA 2HHTA 3IDWA 2IMWP 2W54A 5DDYA 9ICAA 2ZUBA 2EQYA 4C8KA 3AN1A 1PVPA 4UAZA 3BQ1A 1OW5A 4UB2A 4P4PA 3DEEA 2W55A 3ED5A 5H2FU 1X9SA 4LZDA 2JEIA 1N5XA 3ISCA 4DOCA 1XS9D 4P0QB 1ZJNA 1LB2B 4R63A 3A0BU 1L3UA 4O3PA 1RZTA 3ETLA 2ZIVA 5J2BA 3V7KA 4KLOA 1WCNA 1PVRA 2H5XA 2KJ9A 4EEYA 5KFZA 2W7PA 5IILA 4CGZA 5DB7A 3SV4A 1QSSA 4Q44A 2YTUA 3TACB 3MR6A 3BQ2A 5J2JA 2HHXA 1K1SA 1U9LA 2J6SA 4O3RA 1NK4A 5KG4A 3MR3A 2FMQA 2A1JA 3WKDA 2GWSA 3TANA 4C8NA 3EW9A 2R8JA 1PUZA 1RQLA 5ALTA 4JWMA 3OJUA 4DO9A 1ZQZA 4TQSA 5ALYA 5DB9A 5KNIA 4ELVA 4KX3A 3H4DA 2W8LA 3MFHA 5IIIA 4KLHA 4Y2YA 4JUZA 5GTHU 3QUTA 2EZZA 3WKEA 3N28A 4Y2JA 2D8CA 3FDSA 5KFTA 4UB1A 7ICQA 2MRLA 5J8YA 4IS7A 4UATA 2Y9TA 5J0XA 4FS1A 2F8KA 1TE2A 2QKQA 1VJ5A 8ICLA 5KFKA 8ICPA 5KT3A 5B66U 5ALKA 1JMSA 3JPQA 1L3SA 1JI7A 3PX0A 1JRPA 4KITB 4BDPA 5AK3A 1JROA 2W11A 2W43A 3NUQA 3UPQA 1MQ3A 2IA6A 5AM3A 3B9JA 2WB1C 3RH5A 3IV6A 3AU6A 3RR7A 1ZQJA 4NLBA 4R8UB 2C22A 4YD1A 1DK3A 5KG6A 3K4GA 4PGYA 4RQ5A 2WHEA 1ZQHA 2ZXHA 4JB3A 1XSNA 4P2HA 3OPXA 5ALMA 5AM5A 2XY5A 4ED1A 5ALFA 5ALZA 5KAIU 1ZQVA 1N61A 3KTQA 4P0PA 3M9OB 1S0VA 4QZHA 2G5IB 1COOA 2RHFA 3PNCA 4NLKA 2PI5A 4NLNA 4MFFA 5J2IA 4OCZA 3F2BA 3SAHA 1IM4A 2K4IA 1MN8A 3HRDD 2KKPA 3NVWA 3WKBA 9ICCA 4RQ8A 1H38A 4O5EA 2F8LA 1N5WA 1V97A 4I2JA 1C20A 1SL0A 4ZH4A 1ZOLA 4IRKA 5AIAA 3RRHA 4KLMA 2O6KA 4QIWC 3PMLA 2E3TA 3C5GA 5KFBA 4J9KA 5JUMA 1COKA 4NL9A 1T3QA 8ICWA 5HMMA 2ODGA 3AUOA 2ZIXA 1KBUA 2VANA 2HOQA 5KT4A 4QZFA 4RQ4A 1Z4NA 1L3TA 3UQ0A 1L7MA 2PFPA 3NRZA 1Z00B 3GFKB 4O5CA 2KHVA 4DEZA 2LPEA 1X9XA 2JEGA 3NASA 1XSPA 2ZJ8A 1U4BA 4AYBF 4Q43A 3F5AA 5B5EU 1DXSA 4I2FA 1FFVA 4J9NA 3GIKA 4B9UA 4JV1A 1ZQWA 1L3VA 5AI4A 2ALZA 4EBEA 3N7RC 1BNPA 5HP4A 4DSLA 1X42A 8ICEA 1XSLA 1MA7A 1S0OA 5J2EA 5DGBA 3F2CA 3QUQA 1RXVA 3K1ZA 4I2CA 3IG8A 4O3NA 5ALPA 3Q8KA 4JWNA 3ALRA 4C0ZA 1RYUA 4F2SA 2NRXA 1ZQFA 1V9PA 2HDOA 3T5JA 2BQUA 8ICGA 3KBBA 1OXJA 5DB8A 4M9HA 1ZQTA 4KLLA 4Y2TA 3OJSA 2AU0A 2XGPA 4KLJA 7ICFA 2OHFA 1SXEA 5J0OA 3TFRA 7ICGA 4GXJA 1YZ6A 2B21A 3ORYA 7ICNA 2J6TA 3PW7A 5KFCA 3FAHA 2YMMA 5DQGA 4CCHA 1AQ6A 4M6WA 3KHGA 5L1IA 2R8HA 4K4IA 2AGPA 1CI4A 3TI0A 2RDJA 4DQSA 4FO6A 3QZ8A 3FM9A 1HJPA 5KFQA 2HSZA 2VIXA 4MF8A 1LV5A 2OYYA 2ZTCA 1QCKA 9ICGA 2QLTA 9ICWA 3BDPA 4O9MA 4F8RA 4US9A 7ICRA 4B9SA 3NVVA 4O3SA 3MGIA 4RT3A 3PW4A 5KFNA 5HR6A 1V38A 3OSNA 3QU5A 2JHDA 3RB6A 2DPIA 3RJKA 2HOIA 4NJ8A 3QU7A 4M04A 1O03A 4QWBA 5KAFU 1NOMA 1UT5A 4YMMA 4P0QA 4BJQA 2ASLA 3B0XA 1BPDA 2HVHA 1JXEA 4CE6A 3QZ7A 5J8YC 2W9BA 1NJXA 5CP2A 2AGOA 1PK1A 3OTQA 2R8GA 2IOFK 1X6IA 4Y2SA 1S9FA 1KKXA 3MBYA 2NRWA 5J2AA 3RJIA 2EH9A 4J9PA 2LKYA 3GU3A 1FO4A 1UQVA 2FJ6A 2F2AB 2LM1A 2OH2A 4G9BA 3RJFA 4ICAA 1UCVA 2ZG6A 1NZPA 2ISPA 5EE0A 1SB3C 3MR5A 3GZFA 4IQVA 4DL6A 4RZRA 2NV3A 4PH5A 3MGHA 3M7DA 4P0PB 4DSJA 8ICKA 2PFQA 3CRXA 5KG1A 2WF9A 9ICRA 2G06A 2ZTDA 4B9MA 2Q0ZX 4Q8FA 4UB3A 3FC4A 4J9QA 2KG5A 5KFEA 3M9NB 1PVQA 1D8BA 2Y0SC 4GC7A 2MUTA 5G5HA 4KTQA 4YXJA 3WKAA 3PO5A 4J9MA 4DL7A 3EYZA 1L8LA 3C29A 3KKAA 4C4SA 4UB5A 2BHNA 2JMGA 4R65A 1GO3F 4RPZA 3SAFA 4HAIA 4KN7A 2YMQA 1KL9A 2HBLA 5F3XB 2VJ5A 2FDRA 3BQTA 3OSPA 4EZ6A 4NL9C 4XUSA 4PHPA 1Q46A 1QSLA 3IM1A 1LKYA 1XNSA 4J9LA 4DFKA 3PX6A 1RPLA 4RT2A 9ICVA 1A0PA 4OJPA 4ECYA 2YMPA 8ICZA 3THVA 4P4MA 4JV0A 4P4OA 3HKZC 3T5KA 4C8MA 4GLXA 3RB0A 3RH4A 3JPNA 4GXIA 2V4RA 1JALA 1X9WA 3RH6A 3F5EA 2AJQA 2JXJA 3HWTA 2MA1A 2BPGA 2KVSA 2I6XA 1NK8A 8ICYA 2DF4B 5AI9A 4R64A 3N97B 5CEHA 1F0MA 2ZIWA 4UBBA 4I2BA 5DG9A 2H3VA 5KFXA 2ZUCA 2V9WA 2HW3A 4FS2A 8ICQA 1L5UA 2IHMA 2ZTEA 4NM2A 3PW2A 2NO5A 4QW9A 4RNOA 3M9MB 4M6WB 9ICQA 2AH5A 4CDGA 4QZIA 2HOFA 2P35A 4EX6A 1XO1A 1S0MA 2L5YA 2OEHA 2LM4A 1CRXA 2RLTA 5KFIA 4KLEA 4YQWA 1Z00A 4EELA 4DFDA 2KK0A 1Z1BA 1XO0A 4RQ0A 4DS5A 3MDCA 3Q8SB 5KFAA 4UW9A 4ECUA 4Y2RA 3IRUA 2A19A 3L3FX 4DQIA 4ED2A 4MF2A 4Z6EA 4EYIB 9ICXA 2F1IA 4EEKA 4CF3A 4F91B 3GV8B 2F44A 4IR1A 1LVHA 5ALWA 5CJ7A 2NYVA 1BPYA 3H40A 1ZQQA 1MSWD 2C2RA 4BX9C 1RYRA 3ZDCA 4OO1J 2W9BB 9ICUA 2W3RA 4OJLA 2VA3A 3K75D 2DFLA 1PK1B 5AKXA 1SWWA 2D3DA 3PY8A 4NLCA 1NK6A 1WWUA 4DQPA 2EDUA 5KFHA 4F93B 4QZBA 2EANA 2N1RA 3RJJA 5ALHA 2HBJA 4ECRA 3PR5B 5IIMA 5AM0A 1BPEA 1V85A 2XY6A 2QB0A 4J9SA 5HHIA 3GILA 4QZ9A 5D4BA 3ONNA 4B9NA 2KIWA 4QJFB 2HHVA 1VLBA 4EENA 1KW4A 3OHBA 3MDAA 4F5NA 3IN5A 1T7PA 1PZNA 4F72A 1NJWA 5CB1A 4TQRA 3ISBA 1ZQRA 4F4KA 1DK2A 2XCAA 2A1AA 3RTVA 3PMNA 2HHQA 1S8OA 3PSTA 3M8RA 2MUTB 4KLGA 5L9XA 3JPTA 1RQNA 4UBCA 3NVZA 3VCBA 2KZZA 1ZQEA 4DL3A 1ZD3A 3SV3A 4YXMA 4DCCA 3PZPA 4M47A 3EWAA 8ICBA 5AKYA 4K4GA 1NK5A 8ICJA 1X40A 4I2HA 4J03A 4DFPA 4MFCA 1ED1A 5ALUA 7ICUA 4OJ6A 2G09A 4USAA 3UMCA 2BKEA 2FLPA 2H3IA 7ICTA 2I1QA 5KFFA 4UQGA 2YB1A 3WK6A 4ED7A 2K4HA 5IIOA 2BZFA 3KKAC 2C2EA 3AMZA 5CWRA 3T5HA 3Q8PB 1LKYB 2W9CB 2DQNB 4RUCA 5AK6A 4RU9A 1F44A 2H3ZA 7ICMA 1QTMA 4PGXA 3D6JA 1B43A 4M9NA 3QUCA 4BXOA 1NKCA 4MEXA 2RDIA 3DDHA 2HCFA 1K5OA 1QH9A 2HMXA 3G6XA 4NLZA 3MGVA 1TV9A 1RDFA 4IQWA 2ATLA 2WAQF 9ICJA 3RB3A 3N7PD 5KFVA 1RYSA 9ICIA 3EPGA 4QNLA 4KLFA 2HBKA 3PVXA 2XIDA 5TISU 4B6JA 5GTIU 3GIIA 2ZIWB 2V4QA 5AM4A 8ICRA 2ZXIA 3WK8A 5L1LA 1Y88A 2E1FA 2JEFA 3WK4A 1OUQA 4JMUA 5KT2A 5K4LA 1ZD4A 1NK0A 4F5QA 1ZQCA 1HUZA 4NV0A 2KE7A 4RPYA 8ICHA 1SZPA 3BQ0A 7ICSA 4TURA 1ZQNA 2PXIA 1L7PA 3SENA 2ZUDA 2PFOA 3SEIA 3L4PA 3QU2A 3M6KA 3AM9A 4F5PA 2KZMA 1IIPA 4IR9A 1EXNA 1JIHA 2FMPA 4YR2A 2DPJA 5KG7A 4I2AA 1U49A 5KFSA 4YN4A 4LJXA 2LHTA 1ZQPA 4Y2UA 2OWOA 2E1EA 2DWQA 2K8BB 4IL6U 3V7JA 7ICIA 3TAPA 1ZQ1C 1UHUA 2BR0A 4BWJA 2KJ8A 1SV0A 3EPIA 7ICVA 4KMOB 4ED8A 5L1KA 2KICA 3SZ2A 4CRXA 1QSYA 5KT7A 4C7YA 1RXWA 3T79A 1UA1A 5C5JA 4QWDA 1ZQLA 2EAPA 2B6GA 1ZQOA 3GQCA 1NJZA 3WKCA 2P6RA 5KFPA 4PHAA 9ICBA 4PL2A 3GV5B 1SL1A 1K1QA 3CYMA 1M6YA 2YY6A 3E58A 4KLTA 4O3OA 3HW8A
chains in the Genus database with same CATH topology
2QB0B 3IDWA 2D8CA 3BS5A 2E8PA 5J8YA 3BQ7A 3HILA 5JU5A 4IS7A 2L5YA 2LPEA 1X9XA 1X66A 3H8MA 3KKAA 5JRTA 2FE9A 1OW5A 2Y9TA 2QARB 1V38A 2F8KA 1DXSA 2QKQA 2KE7A 4RQNA 3TADA 4NJ8A 2QARA 3K1RB 2Y9UA 1PK3A 2K60A 2QB1A 5F3XB 1JI7A 1RG6A 1SXDA 1X40A 4NL9C 1SV4A 1LKYA 3SENA 3SEIA 2GLEA 2KIVA 3BS7A 5J8YC 2DKXA 2LMRA 2YTUA 4MHVA 1PK1A 3KKAC 3TACB 2F44A 2ES6A 2K4PA 1B4FA 1LKYB 3TADC 1UQVA 1OXJA 1Z1VA 5L1MA 2DKZA 1PK1B 1UCVA 2D3DA 1SV0A 1WWVA 1SXEA 2JV3A 4PZNA 2E8MA 1WWUA 1B0XA 2F3NA 1SGGA 2E8OA 2EANA 5KNIA 2EAPA 2B6GA 2EAMA 4PZOA 1V85A 2DL0A 2QB0A 1F0MA 2KG5A 1KW4A 2KSOB 5JTIA 2ESEA 2KMDA 3BS5B 1COKA 2E8NA 4NL9A 2EAOA 1SV0C 2KSOA 4RQMA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2QB0 B;  3IDW A;  2D8C A;  3BS5 A;  2E8P A;  5J8Y A;  3BQ7 A;  3HIL A;  5JU5 A;  4IS7 A;  2L5Y A;  2LPE A;  1X9X A;  1X66 A;  3H8M A;  3KKA A;  5JRT A;  2FE9 A;  1OW5 A;  2Y9T A;  2QAR B;  1V38 A;  2F8K A;  1DXS A;  2QKQ A;  2KE7 A;  4RQN A;  3TAD A;  4NJ8 A;  2QAR A;  3K1R B;  2Y9U A;  1PK3 A;  2K60 A;  2QB1 A;  5F3X B;  1JI7 A;  1RG6 A;  1SXD A;  1X40 A;  4NL9 C;  1SV4 A;  1LKY A;  3SEN A;  3SEI A;  2GLE A;  2KIV A;  3BS7 A;  5J8Y C;  2DKX A;  2LMR A;  2YTU A;  4MHV A;  1PK1 A;  3KKA C;  3TAC B;  2F44 A;  2ES6 A;  2K4P A;  1B4F A;  1LKY B;  3TAD C;  1UQV A;  1OXJ A;  1Z1V A;  5L1M A;  2DKZ A;  1PK1 B;  1UCV A;  2D3D A;  1SV0 A;  1WWV A;  1SXE A;  2JV3 A;  4PZN A;  2E8M A;  1WWU A;  1B0X A;  2F3N A;  1SGG A;  2E8O A;  2EAN A;  5KNI A;  2EAP A;  2B6G A;  2EAM A;  4PZO A;  1V85 A;  2DL0 A;  2QB0 A;  1F0M A;  2KG5 A;  1KW4 A;  2KSO B;  5JTI A;  2ESE A;  2KMD A;  3BS5 B;  1COK A;  2E8N A;  4NL9 A;  2EAO A;  1SV0 C;  2KSO A;  4RQM A; 
#chains in the Genus database with same CATH topology
 1UA0 A;  4LZG A;  2QB0 B;  5DLG A;  4I28 A;  3ZDA A;  2Y1J A;  2R8K A;  4ECT A;  2E8P A;  4A8E A;  3KZI U;  5DDM A;  3RJG A;  3QEB Z;  3C2M A;  3DV9 A;  1Z4O A;  2G07 A;  2JR5 A;  3GV7 B;  3UXO A;  5J0U A;  4QWA A;  4RNM A;  1KFS A;  5HML A;  3C5F A;  1ZD5 A;  3N7S C;  4UAY A;  4YR3 A;  1SV4 A;  5AK5 A;  5KFU A;  1JXL A;  2LYH A;  4KLQ A;  4IQU A;  5J2D A;  1XWL A;  2FPL A;  4UAV A;  4BWM A;  2Z7J A;  3C21 A;  3PSF A;  2G0A A;  5HHH A;  4C4R A;  1S76 D;  1BGX T;  4Y2X A;  2XIC A;  2R18 A;  2CN1 A;  4AP9 A;  1B4F A;  1A6S A;  3UMG A;  4KMU A;  5AHX A;  2CXY A;  2BCS A;  2XVT A;  3QX7 A;  5L1M A;  1Z19 A;  4DLE A;  3C23 A;  2F77 X;  3IHQ B;  2JH7 A;  1QQ7 A;  1WUD A;  2AQ0 A;  3H0M B;  5C0Y A;  3Q8R B;  5L1J A;  3H4B A;  4RQ1 A;  5AI6 A;  5DQH A;  3T3F A;  2KFN A;  2F1H A;  4TUQ A;  4RUA A;  2DL0 A;  2ZJA A;  5AKK A;  1TK8 A;  3M1Y A;  4Z6C A;  4BXO B;  9ICN A;  4QZE A;  4F4Y A;  3V72 A;  1SKS A;  1TK5 A;  1SL2 A;  4PGQ A;  2KMD A;  2KTQ A;  4BGD A;  4DQQ A;  5J0W A;  2ZIU A;  4RQ6 A;  4B9L A;  2Y0S F;  1U48 A;  4FZL A;  4M9L A;  4MFA A;  5KT5 A;  2LI6 A;  4ED3 A;  5EWG A;  5AIC A;  2J6U A;  2AQ4 A;  5ALR A;  2BCR A;  3R9K A;  2W9A A;  4NY8 A;  1ZQM A;  3TAD A;  2VA2 A;  2Y9U A;  2K60 A;  2QB1 A;  1QQ6 A;  2FPM A;  1SIJ A;  2CPR A;  4DSI A;  2JZB B;  4U7C A;  5DKW A;  3TKA A;  5EE1 A;  2KIV A;  4O0I A;  2KN7 A;  1X2I A;  2OM6 A;  5KFM A;  4ECQ A;  3AU2 A;  4DFJ A;  2AXT U;  3BJY A;  5ALV A;  3B0Y A;  5KFD A;  3RJH A;  8ICV A;  4QW8 A;  1N62 A;  4DL5 A;  1KN5 A;  4F71 A;  1N56 A;  8ICF A;  2XI9 A;  3SYZ A;  2GOL A;  1L7O A;  5TZV A;  3ZDE A;  2W9C A;  3HKZ F;  2DBY A;  4R66 A;  3RAX A;  2HI0 A;  1ZD2 P;  2W03 A;  4XRH A;  5EWE A;  2E8M A;  2YQE A;  4GC6 A;  2ASD A;  3ZDD A;  5J2K A;  5ALN A;  5DB6 A;  4UAS A;  4DOB A;  4FE3 A;  2EAM A;  2LBO A;  1S10 A;  3SAG A;  5E79 U;  5F9L A;  1MQ2 A;  3PR4 A;  2XY7 A;  5G5G A;  3VC8 A;  1KFD A;  2RP5 A;  2RRD A;  5KFO A;  4KN4 A;  1CUK A;  1XU4 A;  4CNQ A;  4YCX A;  1SKW A;  1SV0 C;  2BCQ A;  5D46 A;  1TAM A;  4Y2P A;  1FFU A;  4O5K A;  4ECZ A;  1WG8 A;  5KG3 A;  2KZ3 A;  1ZRN A;  1RM6 C;  4Y2V A;  2W9M A;  1J97 A;  1L8O A;  2JRZ A;  1N60 A;  1Q3U A;  2WFA A;  4US8 A;  2QAR B;  1NK7 A;  3LVW A;  4PHD A;  1D8Y A;  3LVV A;  2HVI A;  3G6V A;  3K1R B;  4Q8E A;  1C7Y A;  1NZB A;  5EE3 A;  5KG2 A;  2NRZ A;  3PSP A;  3RJE A;  4PHE A;  1IG6 A;  7ICE A;  2GLE A;  3LWL A;  4ECX A;  2HBM A;  5IIN A;  5ALO A;  2P6U A;  2IBK A;  5BOM A;  3UQ2 A;  4KLS A;  1ZXI A;  3GIM A;  2K4P A;  2UVU A;  2DUY A;  2PMZ C;  2VJ4 A;  5ALD A;  1X6J A;  4J9R A;  3ZD8 A;  4B9V A;  3V6J A;  4F4Z A;  5AM1 A;  4KLI A;  3JPS A;  3MFI A;  1JX4 A;  4NM1 A;  3H0L B;  4CF4 A;  2K89 A;  4I2G A;  1JN3 A;  4F50 A;  1SKR A;  1UPH A;  3WK9 A;  5J0Q A;  2K8C B;  3H8J A;  5DLF A;  1Z3E B;  2KNJ A;  1NK9 A;  1MC8 A;  3BZC A;  3AEV A;  3KHL A;  2ZJ5 A;  1F5S A;  3NS1 A;  1Q8K A;  4MEY A;  4TUS A;  1KFT A;  9ICP A;  1TK0 A;  3KHR A;  2HHU A;  2KOB A;  3TQ1 A;  1SWV A;  4ELU A;  2E5S A;  4YP3 A;  5KL8 B;  5AKZ A;  3LWM A;  4I27 A;  2PFN A;  4X5V A;  2FI1 A;  3M6Z A;  4WJ3 B;  5CRX A;  3NTU A;  3QE9 Y;  1X66 A;  3H0R B;  2WTF A;  9ICF A;  4DFM A;  4KLU A;  3U26 A;  2ZIU B;  4UAW A;  2W7O A;  8ICO A;  1J2N A;  4ECS A;  4C8L A;  4RQN A;  4FBT A;  4KLD A;  3HX0 A;  5ALS A;  1SXD A;  2BQ3 A;  3UXN A;  2KJ5 A;  4Z6D A;  4HYK A;  4J9O A;  3H8S A;  5ALI A;  3OHA A;  4YD2 A;  2GO7 A;  4ACO A;  3JPP A;  3QYP A;  4ECV A;  5KT6 A;  3SD7 A;  4I29 A;  4LVS A;  1WCL A;  1DRG A;  2XGQ A;  3RF9 A;  4C8O A;  5DGA A;  3E2E A;  4YR0 A;  3RAQ A;  3TAD C;  4ECW A;  1KEJ A;  5KL1 B;  3CNH A;  5AI8 A;  3L5K A;  3QU4 A;  3KHH A;  3KFU F;  1ZRM A;  3ZI4 A;  1VDV A;  5DG8 A;  3O0F A;  3RBD A;  3F53 A;  3QU9 A;  1SZH A;  2F3N A;  1SGG A;  4C4T A;  2WB1 F;  4QZG A;  3IP4 B;  4F2R A;  4C80 A;  4F5O A;  4IC9 A;  1D8L A;  3RR8 A;  8ICU A;  5KG0 A;  4DWI A;  5DBC A;  2BGW A;  1HUO A;  4IRD A;  4RQ3 A;  3TAQ A;  1UT8 A;  2XC9 A;  1TKD A;  5BPC A;  3IG5 A;  3GDX A;  3BS5 B;  2YX8 A;  5DBB A;  3C1Y A;  4NXZ A;  5J0P A;  1JUD A;  4XQ8 A;  5AI0 A;  2VA8 A;  3T5L A;  8ICC A;  3N4M B;  2HHW A;  1ECW A;  2F1J A;  1IXR A;  4DSE A;  4DL4 A;  3MAB A;  3WU2 U;  3BQ7 A;  9ICM A;  1Q3V A;  2KKV A;  5ALG A;  2FE9 A;  3M8S A;  1FIQ A;  2R8I A;  3RFA A;  2BPC A;  2FLN A;  1PK3 A;  2UVV A;  4DL2 A;  3ISD A;  3KZX A;  4QIW F;  1TVA A;  5CHG A;  2KVC A;  3ZD9 A;  3SQI A;  4QZC A;  4QZA A;  4UAU A;  5AM2 A;  2JZB A;  1NKB A;  9ICS A;  2DKX A;  5AK4 A;  8ICA A;  3SR6 A;  2WF7 A;  2K8A A;  1QQ5 A;  3ETR A;  2NRV A;  4BUG A;  3KOO A;  2ES6 A;  1TAQ A;  3FYH A;  2WAQ C;  3LK9 A;  4EBC A;  1D9F A;  2YB4 A;  4M9J A;  1TAU A;  2W3S A;  2XO7 A;  4F5R A;  3MC1 A;  4KX5 A;  4UB6 U;  2DKZ A;  5EE9 A;  3TFS A;  3MR2 A;  4OJ5 A;  3UXP A;  2JV3 A;  5KFL A;  1S97 A;  2G08 A;  5A0L A;  5AI5 A;  3V7L A;  3EZ5 A;  4M0A A;  2KP7 A;  3RBE A;  2MSN A;  5KTQ A;  1T3N A;  5J2H A;  3J81 j;  3RB4 A;  7ICL A;  8ICI A;  4PZO A;  1CEZ A;  5AKE A;  5ALX A;  2KEY A;  4B9T A;  2BCV A;  2KD1 A;  2M0N A;  4ZOH C;  5J29 A;  7ICO A;  3PW0 A;  4EYH B;  2KSO B;  4FFD A;  4JK1 A;  3PSI A;  4DSK A;  2ESE A;  5DBA A;  4RQ7 A;  3I76 A;  4UAR A;  3H8W A;  4I2I A;  3PW5 A;  4QZ8 A;  3I1Y A;  4ED0 A;  4YMO A;  2F76 X;  3NRW A;  4YMN A;  1YZ7 A;  1KRP A;  4AYB C;  1S77 D;  1DGS A;  2DGZ A;  3G6Y A;  1BNO A;  2Q4T A;  3HIL A;  1NJY A;  2UVR A;  2K4E A;  5CR0 A;  2GH1 A;  3CW2 C;  3GIJ A;  1BPB A;  3Q8M A;  5J0S A;  8ICM A;  2ZIV B;  4DQR A;  7ICK A;  2QAR A;  3I28 A;  5EWF A;  5KFR A;  1RG6 A;  3S6J A;  2VKQ A;  4UB8 U;  2UVW A;  4C7Z A;  5T14 A;  3H7I A;  1HEK A;  1KLN A;  4ED6 A;  1A76 A;  5J0T A;  3JPR A;  4YG2 A;  2WF5 A;  2OCE A;  2OXO A;  3C2K A;  3V6K A;  2A1J B;  5AKL A;  1X9M A;  1Z1V A;  8ICS A;  3QNM A;  4GFJ A;  1T8E A;  2EZX A;  4DLG A;  3QXG A;  1WWV A;  5DG7 A;  5HR7 A;  3D2N A;  4M2Y A;  1J2M A;  5DQI A;  4G3I A;  2E8O A;  2JH1 A;  4DS4 A;  1ZQI A;  1ARO P;  2M9N A;  1ZYQ A;  4EBD A;  7ICH A;  1ZQA A;  4FBU A;  5ALL A;  1U47 A;  3LDA A;  1T4G A;  5IIJ A;  3QUB A;  3CP8 A;  4GXK A;  2EZY A;  7ICJ A;  5KG5 A;  5JTI A;  9ICH A;  1ZQD A;  3WK7 A;  2ISO A;  2LYA A;  2CRX A;  3BZK A;  2C28 A;  4F4W A;  1NI3 A;  5JU5 A;  5AIB A;  3PX4 A;  2NRT A;  3H8M A;  3PV8 A;  1ZQK A;  1ZJM A;  1IV8 A;  1N2X A;  3HPO A;  5J2G A;  4QWC A;  2IOF A;  5AKH A;  4UB4 A;  2AHO B;  9ICT A;  5J2C A;  3HT3 A;  2BDU A;  1KDH A;  5FP0 A;  2B0C A;  1TFR A;  1QLN A;  5KFJ A;  9ICO A;  2PI4 A;  2FMS A;  2LYB A;  1A77 A;  3BS7 A;  5KFW A;  5AKJ A;  4IQT A;  2LMR A;  1ZQS A;  4K4H A;  4O3M A;  4EX7 A;  5EOZ A;  3HP6 A;  1BPZ A;  3C2L A;  1KQQ A;  3C28 A;  3SMV A;  2H3F A;  5KFG A;  4TUP A;  2ASJ A;  1ZET A;  3Q8Q B;  2HHS A;  1FEZ A;  4RQ2 A;  1ZQU A;  2FPK A;  5F9N A;  1S0N A;  4YFK A;  2NO4 A;  4QZD A;  1B0X A;  1HIW A;  1BPX A;  7ICP A;  5J2F A;  2Y1I A;  4DF8 A;  3ICX A;  1XC9 A;  1O08 A;  4Z6F A;  4JV2 A;  9ICK A;  3D2Q A;  2WF6 A;  5D49 A;  4ELT A;  3AQE A;  1L7N A;  4F4X A;  3E0F A;  1NKE A;  2H3Q A;  1KSP A;  3A0H U;  2ZIX B;  3WK5 A;  2WF8 A;  2BQR A;  2E8N A;  4DOA A;  4PL1 A;  2EAO A;  4FZM A;  4GIB A;  3UM9 A;  3HJE A;  4DSF A;  5J0R A;  3BS5 A;  4Y2Q A;  4OJO A;  5KFY A;  4IRC A;  5IIK A;  3LYS A;  5JRT A;  3EUB 2;  5ALJ A;  1NNL A;  5CA7 A;  4NLG A;  2XCP A;  4DF4 A;  3C1Z A;  2G5H B;  5HNK A;  1T94 A;  2YN4 A;  2PKE A;  1DOQ A;  1U45 A;  4I2D A;  4R8U A;  1YT3 A;  1ZQB A;  2I5H A;  4E0D A;  2A3V A;  1L6N A;  4XA5 A;  4Q45 A;  2KFZ A;  4MHV A;  2IOH A;  2BCU A;  2BDP A;  8ICT A;  5ALQ A;  2I9G A;  4CF5 A;  3F2D A;  2KHQ A;  2IHN A;  3AQF A;  5ALE A;  4PPX A;  2MU2 A;  4F92 B;  3PO4 A;  4FZN A;  2YML A;  4EZ9 A;  5BOL A;  2AGQ A;  2C2D A;  1S5L U;  4M9G A;  9ICE A;  2PMZ F;  3D2S A;  1D9D A;  1DGJ A;  3OGU A;  4PZN A;  5J0Y A;  1WYG A;  4RNN A;  3TAR A;  4OD0 A;  3QEA Z;  8ICX A;  4O3Q A;  1ZQG A;  2FLL A;  1BVS A;  3JPO A;  1ZQY A;  1URJ A;  3RRG A;  3ZDB A;  1B22 A;  2W04 A;  3UMB A;  2BPF A;  2MAX A;  4RPX A;  4QWE A;  1ZQX A;  4YVZ A;  1N63 A;  3V6H A;  3KD3 A;  3Q8L A;  4NWI A;  5AKI A;  4F3O A;  4PJ0 U;  1KTQ A;  2D6F C;  3NVY A;  2RQ5 A;  9ICL A;  2JEJ A;  4U6P A;  1N48 A;  1P7D A;  2JGA A;  3NGD A;  3SI8 A;  8ICN A;  3AL0 B;  5AKG A;  2W8K A;  2P66 A;  2KV2 A;  2KSO A;  4I2E A;  4RQM A;  2HHT A;  3IDW A;  2IMW P;  2W54 A;  5DDY A;  9ICA A;  2ZUB A;  2EQY A;  4C8K A;  3AN1 A;  1PVP A;  4UAZ A;  3BQ1 A;  1OW5 A;  4UB2 A;  4P4P A;  3DEE A;  2W55 A;  3ED5 A;  5H2F U;  1X9S A;  4LZD A;  2JEI A;  1N5X A;  3ISC A;  4DOC A;  1XS9 D;  4P0Q B;  1ZJN A;  1LB2 B;  4R63 A;  3A0B U;  1L3U A;  4O3P A;  1RZT A;  3ETL A;  2ZIV A;  5J2B A;  3V7K A;  4KLO A;  1WCN A;  1PVR A;  2H5X A;  2KJ9 A;  4EEY A;  5KFZ A;  2W7P A;  5IIL A;  4CGZ A;  5DB7 A;  3SV4 A;  1QSS A;  4Q44 A;  2YTU A;  3TAC B;  3MR6 A;  3BQ2 A;  5J2J A;  2HHX A;  1K1S A;  1U9L A;  2J6S A;  4O3R A;  1NK4 A;  5KG4 A;  3MR3 A;  2FMQ A;  2A1J A;  3WKD A;  2GWS A;  3TAN A;  4C8N A;  3EW9 A;  2R8J A;  1PUZ A;  1RQL A;  5ALT A;  4JWM A;  3OJU A;  4DO9 A;  1ZQZ A;  4TQS A;  5ALY A;  5DB9 A;  5KNI A;  4ELV A;  4KX3 A;  3H4D A;  2W8L A;  3MFH A;  5III A;  4KLH A;  4Y2Y A;  4JUZ A;  5GTH U;  3QUT A;  2EZZ A;  3WKE A;  3N28 A;  4Y2J A;  2D8C A;  3FDS A;  5KFT A;  4UB1 A;  7ICQ A;  2MRL A;  5J8Y A;  4IS7 A;  4UAT A;  2Y9T A;  5J0X A;  4FS1 A;  2F8K A;  1TE2 A;  2QKQ A;  1VJ5 A;  8ICL A;  5KFK A;  8ICP A;  5KT3 A;  5B66 U;  5ALK A;  1JMS A;  3JPQ A;  1L3S A;  1JI7 A;  3PX0 A;  1JRP A;  4KIT B;  4BDP A;  5AK3 A;  1JRO A;  2W11 A;  2W43 A;  3NUQ A;  3UPQ A;  1MQ3 A;  2IA6 A;  5AM3 A;  3B9J A;  2WB1 C;  3RH5 A;  3IV6 A;  3AU6 A;  3RR7 A;  1ZQJ A;  4NLB A;  4R8U B;  2C22 A;  4YD1 A;  1DK3 A;  5KG6 A;  3K4G A;  4PGY A;  4RQ5 A;  2WHE A;  1ZQH A;  2ZXH A;  4JB3 A;  1XSN A;  4P2H A;  3OPX A;  5ALM A;  5AM5 A;  2XY5 A;  4ED1 A;  5ALF A;  5ALZ A;  5KAI U;  1ZQV A;  1N61 A;  3KTQ A;  4P0P A;  3M9O B;  1S0V A;  4QZH A;  2G5I B;  1COO A;  2RHF A;  3PNC A;  4NLK A;  2PI5 A;  4NLN A;  4MFF A;  5J2I A;  4OCZ A;  3F2B A;  3SAH A;  1IM4 A;  2K4I A;  1MN8 A;  3HRD D;  2KKP A;  3NVW A;  3WKB A;  9ICC A;  4RQ8 A;  1H38 A;  4O5E A;  2F8L A;  1N5W A;  1V97 A;  4I2J A;  1C20 A;  1SL0 A;  4ZH4 A;  1ZOL A;  4IRK A;  5AIA A;  3RRH A;  4KLM A;  2O6K A;  4QIW C;  3PML A;  2E3T A;  3C5G A;  5KFB A;  4J9K A;  5JUM A;  1COK A;  4NL9 A;  1T3Q A;  8ICW A;  5HMM A;  2ODG A;  3AUO A;  2ZIX A;  1KBU A;  2VAN A;  2HOQ A;  5KT4 A;  4QZF A;  4RQ4 A;  1Z4N A;  1L3T A;  3UQ0 A;  1L7M A;  2PFP A;  3NRZ A;  1Z00 B;  3GFK B;  4O5C A;  2KHV A;  4DEZ A;  2LPE A;  1X9X A;  2JEG A;  3NAS A;  1XSP A;  2ZJ8 A;  1U4B A;  4AYB F;  4Q43 A;  3F5A A;  5B5E U;  1DXS A;  4I2F A;  1FFV A;  4J9N A;  3GIK A;  4B9U A;  4JV1 A;  1ZQW A;  1L3V A;  5AI4 A;  2ALZ A;  4EBE A;  3N7R C;  1BNP A;  5HP4 A;  4DSL A;  1X42 A;  8ICE A;  1XSL A;  1MA7 A;  1S0O A;  5J2E A;  5DGB A;  3F2C A;  3QUQ A;  1RXV A;  3K1Z A;  4I2C A;  3IG8 A;  4O3N A;  5ALP A;  3Q8K A;  4JWN A;  3ALR A;  4C0Z A;  1RYU A;  4F2S A;  2NRX A;  1ZQF A;  1V9P A;  2HDO A;  3T5J A;  2BQU A;  8ICG A;  3KBB A;  1OXJ A;  5DB8 A;  4M9H A;  1ZQT A;  4KLL A;  4Y2T A;  3OJS A;  2AU0 A;  2XGP A;  4KLJ A;  7ICF A;  2OHF A;  1SXE A;  5J0O A;  3TFR A;  7ICG A;  4GXJ A;  1YZ6 A;  2B21 A;  3ORY A;  7ICN A;  2J6T A;  3PW7 A;  5KFC A;  3FAH A;  2YMM A;  5DQG A;  4CCH A;  1AQ6 A;  4M6W A;  3KHG A;  5L1I A;  2R8H A;  4K4I A;  2AGP A;  1CI4 A;  3TI0 A;  2RDJ A;  4DQS A;  4FO6 A;  3QZ8 A;  3FM9 A;  1HJP A;  5KFQ A;  2HSZ A;  2VIX A;  4MF8 A;  1LV5 A;  2OYY A;  2ZTC A;  1QCK A;  9ICG A;  2QLT A;  9ICW A;  3BDP A;  4O9M A;  4F8R A;  4US9 A;  7ICR A;  4B9S A;  3NVV A;  4O3S A;  3MGI A;  4RT3 A;  3PW4 A;  5KFN A;  5HR6 A;  1V38 A;  3OSN A;  3QU5 A;  2JHD A;  3RB6 A;  2DPI A;  3RJK A;  2HOI A;  4NJ8 A;  3QU7 A;  4M04 A;  1O03 A;  4QWB A;  5KAF U;  1NOM A;  1UT5 A;  4YMM A;  4P0Q A;  4BJQ A;  2ASL A;  3B0X A;  1BPD A;  2HVH A;  1JXE A;  4CE6 A;  3QZ7 A;  5J8Y C;  2W9B A;  1NJX A;  5CP2 A;  2AGO A;  1PK1 A;  3OTQ A;  2R8G A;  2IOF K;  1X6I A;  4Y2S A;  1S9F A;  1KKX A;  3MBY A;  2NRW A;  5J2A A;  3RJI A;  2EH9 A;  4J9P A;  2LKY A;  3GU3 A;  1FO4 A;  1UQV A;  2FJ6 A;  2F2A B;  2LM1 A;  2OH2 A;  4G9B A;  3RJF A;  4ICA A;  1UCV A;  2ZG6 A;  1NZP A;  2ISP A;  5EE0 A;  1SB3 C;  3MR5 A;  3GZF A;  4IQV A;  4DL6 A;  4RZR A;  2NV3 A;  4PH5 A;  3MGH A;  3M7D A;  4P0P B;  4DSJ A;  8ICK A;  2PFQ A;  3CRX A;  5KG1 A;  2WF9 A;  9ICR A;  2G06 A;  2ZTD A;  4B9M A;  2Q0Z X;  4Q8F A;  4UB3 A;  3FC4 A;  4J9Q A;  2KG5 A;  5KFE A;  3M9N B;  1PVQ A;  1D8B A;  2Y0S C;  4GC7 A;  2MUT A;  5G5H A;  4KTQ A;  4YXJ A;  3WKA A;  3PO5 A;  4J9M A;  4DL7 A;  3EYZ A;  1L8L A;  3C29 A;  3KKA A;  4C4S A;  4UB5 A;  2BHN A;  2JMG A;  4R65 A;  1GO3 F;  4RPZ A;  3SAF A;  4HAI A;  4KN7 A;  2YMQ A;  1KL9 A;  2HBL A;  5F3X B;  2VJ5 A;  2FDR A;  3BQT A;  3OSP A;  4EZ6 A;  4NL9 C;  4XUS A;  4PHP A;  1Q46 A;  1QSL A;  3IM1 A;  1LKY A;  1XNS A;  4J9L A;  4DFK A;  3PX6 A;  1RPL A;  4RT2 A;  9ICV A;  1A0P A;  4OJP A;  4ECY A;  2YMP A;  8ICZ A;  3THV A;  4P4M A;  4JV0 A;  4P4O A;  3HKZ C;  3T5K A;  4C8M A;  4GLX A;  3RB0 A;  3RH4 A;  3JPN A;  4GXI A;  2V4R A;  1JAL A;  1X9W A;  3RH6 A;  3F5E A;  2AJQ A;  2JXJ A;  3HWT A;  2MA1 A;  2BPG A;  2KVS A;  2I6X A;  1NK8 A;  8ICY A;  2DF4 B;  5AI9 A;  4R64 A;  3N97 B;  5CEH A;  1F0M A;  2ZIW A;  4UBB A;  4I2B A;  5DG9 A;  2H3V A;  5KFX A;  2ZUC A;  2V9W A;  2HW3 A;  4FS2 A;  8ICQ A;  1L5U A;  2IHM A;  2ZTE A;  4NM2 A;  3PW2 A;  2NO5 A;  4QW9 A;  4RNO A;  3M9M B;  4M6W B;  9ICQ A;  2AH5 A;  4CDG A;  4QZI A;  2HOF A;  2P35 A;  4EX6 A;  1XO1 A;  1S0M A;  2L5Y A;  2OEH A;  2LM4 A;  1CRX A;  2RLT A;  5KFI A;  4KLE A;  4YQW A;  1Z00 A;  4EEL A;  4DFD A;  2KK0 A;  1Z1B A;  1XO0 A;  4RQ0 A;  4DS5 A;  3MDC A;  3Q8S B;  5KFA A;  4UW9 A;  4ECU A;  4Y2R A;  3IRU A;  2A19 A;  3L3F X;  4DQI A;  4ED2 A;  4MF2 A;  4Z6E A;  4EYI B;  9ICX A;  2F1I A;  4EEK A;  4CF3 A;  4F91 B;  3GV8 B;  2F44 A;  4IR1 A;  1LVH A;  5ALW A;  5CJ7 A;  2NYV A;  1BPY A;  3H40 A;  1ZQQ A;  1MSW D;  2C2R A;  4BX9 C;  1RYR A;  3ZDC A;  4OO1 J;  2W9B B;  9ICU A;  2W3R A;  4OJL A;  2VA3 A;  3K75 D;  2DFL A;  1PK1 B;  5AKX A;  1SWW A;  2D3D A;  3PY8 A;  4NLC A;  1NK6 A;  1WWU A;  4DQP A;  2EDU A;  5KFH A;  4F93 B;  4QZB A;  2EAN A;  2N1R A;  3RJJ A;  5ALH A;  2HBJ A;  4ECR A;  3PR5 B;  5IIM A;  5AM0 A;  1BPE A;  1V85 A;  2XY6 A;  2QB0 A;  4J9S A;  5HHI A;  3GIL A;  4QZ9 A;  5D4B A;  3ONN A;  4B9N A;  2KIW A;  4QJF B;  2HHV A;  1VLB A;  4EEN A;  1KW4 A;  3OHB A;  3MDA A;  4F5N A;  3IN5 A;  1T7P A;  1PZN A;  4F72 A;  1NJW A;  5CB1 A;  4TQR A;  3ISB A;  1ZQR A;  4F4K A;  1DK2 A;  2XCA A;  2A1A A;  3RTV A;  3PMN A;  2HHQ A;  1S8O A;  3PST A;  3M8R A;  2MUT B;  4KLG A;  5L9X A;  3JPT A;  1RQN A;  4UBC A;  3NVZ A;  3VCB A;  2KZZ A;  1ZQE A;  4DL3 A;  1ZD3 A;  3SV3 A;  4YXM A;  4DCC A;  3PZP A;  4M47 A;  3EWA A;  8ICB A;  5AKY A;  4K4G A;  1NK5 A;  8ICJ A;  1X40 A;  4I2H A;  4J03 A;  4DFP A;  4MFC A;  1ED1 A;  5ALU A;  7ICU A;  4OJ6 A;  2G09 A;  4USA A;  3UMC A;  2BKE A;  2FLP A;  2H3I A;  7ICT A;  2I1Q A;  5KFF A;  4UQG A;  2YB1 A;  3WK6 A;  4ED7 A;  2K4H A;  5IIO A;  2BZF A;  3KKA C;  2C2E A;  3AMZ A;  5CWR A;  3T5H A;  3Q8P B;  1LKY B;  2W9C B;  2DQN B;  4RUC A;  5AK6 A;  4RU9 A;  1F44 A;  2H3Z A;  7ICM A;  1QTM A;  4PGX A;  3D6J A;  1B43 A;  4M9N A;  3QUC A;  4BXO A;  1NKC A;  4MEX A;  2RDI A;  3DDH A;  2HCF A;  1K5O A;  1QH9 A;  2HMX A;  3G6X A;  4NLZ A;  3MGV A;  1TV9 A;  1RDF A;  4IQW A;  2ATL A;  2WAQ F;  9ICJ A;  3RB3 A;  3N7P D;  5KFV A;  1RYS A;  9ICI A;  3EPG A;  4QNL A;  4KLF A;  2HBK A;  3PVX A;  2XID A;  5TIS U;  4B6J A;  5GTI U;  3GII A;  2ZIW B;  2V4Q A;  5AM4 A;  8ICR A;  2ZXI A;  3WK8 A;  5L1L A;  1Y88 A;  2E1F A;  2JEF A;  3WK4 A;  1OUQ A;  4JMU A;  5KT2 A;  5K4L A;  1ZD4 A;  1NK0 A;  4F5Q A;  1ZQC A;  1HUZ A;  4NV0 A;  2KE7 A;  4RPY A;  8ICH A;  1SZP A;  3BQ0 A;  7ICS A;  4TUR A;  1ZQN A;  2PXI A;  1L7P A;  3SEN A;  2ZUD A;  2PFO A;  3SEI A;  3L4P A;  3QU2 A;  3M6K A;  3AM9 A;  4F5P A;  2KZM A;  1IIP A;  4IR9 A;  1EXN A;  1JIH A;  2FMP A;  4YR2 A;  2DPJ A;  5KG7 A;  4I2A A;  1U49 A;  5KFS A;  4YN4 A;  4LJX A;  2LHT A;  1ZQP A;  4Y2U A;  2OWO A;  2E1E A;  2DWQ A;  2K8B B;  4IL6 U;  3V7J A;  7ICI A;  3TAP A;  1ZQ1 C;  1UHU A;  2BR0 A;  4BWJ A;  2KJ8 A;  1SV0 A;  3EPI A;  7ICV A;  4KMO B;  4ED8 A;  5L1K A;  2KIC A;  3SZ2 A;  4CRX A;  1QSY A;  5KT7 A;  4C7Y A;  1RXW A;  3T79 A;  1UA1 A;  5C5J A;  4QWD A;  1ZQL A;  2EAP A;  2B6G A;  1ZQO A;  3GQC A;  1NJZ A;  3WKC A;  2P6R A;  5KFP A;  4PHA A;  9ICB A;  4PL2 A;  3GV5 B;  1SL1 A;  1K1Q A;  3CYM A;  1M6Y A;  2YY6 A;  3E58 A;  4KLT A;  4O3O A;  3HW8 A; 
#chains in the Genus database with same CATH homology
 2QB0 B;  3IDW A;  2D8C A;  3BS5 A;  2E8P A;  5J8Y A;  3BQ7 A;  3HIL A;  5JU5 A;  4IS7 A;  2L5Y A;  2LPE A;  1X9X A;  1X66 A;  3H8M A;  3KKA A;  5JRT A;  2FE9 A;  1OW5 A;  2Y9T A;  2QAR B;  1V38 A;  2F8K A;  1DXS A;  2QKQ A;  2KE7 A;  4RQN A;  3TAD A;  4NJ8 A;  2QAR A;  3K1R B;  2Y9U A;  1PK3 A;  2K60 A;  2QB1 A;  5F3X B;  1JI7 A;  1RG6 A;  1SXD A;  1X40 A;  4NL9 C;  1SV4 A;  1LKY A;  3SEN A;  3SEI A;  2GLE A;  2KIV A;  3BS7 A;  5J8Y C;  2DKX A;  2LMR A;  2YTU A;  4MHV A;  1PK1 A;  3KKA C;  3TAC B;  2F44 A;  2ES6 A;  2K4P A;  1B4F A;  1LKY B;  3TAD C;  1UQV A;  1OXJ A;  1Z1V A;  5L1M A;  2DKZ A;  1PK1 B;  1UCV A;  2D3D A;  1SV0 A;  1WWV A;  1SXE A;  2JV3 A;  4PZN A;  2E8M A;  1WWU A;  1B0X A;  2F3N A;  1SGG A;  2E8O A;  2EAN A;  5KNI A;  2EAP A;  2B6G A;  2EAM A;  4PZO A;  1V85 A;  2DL0 A;  2QB0 A;  1F0M A;  2KG5 A;  1KW4 A;  2KSO B;  5JTI A;  2ESE A;  2KMD A;  3BS5 B;  1COK A;  2E8N A;  4NL9 A;  2EAO A;  1SV0 C;  2KSO A;  4RQM A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...