1SV0C

Crystal structure of yan-sam/mae-sam complex
Total Genus 27
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
27
sequence length
82
structure length
82
Chain Sequence
PLGSDGLPLDPRDWTRADVWKWLINMAVSEGLEVTAELPQKFPMNGKALCLMSLDMYLCRVPVGGKMLYRDFRVRLARAMSR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Derepression by depolymerization; structural insights into the regulation of yan by mae.
pubmed doi rcsb
source organism Drosophila melanogaster
molecule tags Transcription
molecule keywords Ets DNA-binding protein pokkuri
total genus 27
structure length 82
sequence length 82
chains with identical sequence D
ec nomenclature
pdb deposition date 2004-03-26
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.50 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 Transcription Factor, Ets-1 1sv0C00
2QARA 1WWUA 2B6GA 1SV0A 3BS5A 1SXDA 2E8NA 4PZOA 2Y9UA 2E8MA 2KSOA 1SGGA 3BQ7A 2KMDA 2D3DA 1B4FA 2Y9TA 1DXSA 2K4PA 2KG5A 2LPEA 1PK1B 3K1RB 1RG6A 1COKA 1KW4A 2E8PA 4NL9A 1X9XA 2D8CA 1LKYA 5JRTA 3KKAA 2QARB 1UQVA 2DL0A 4IS7A 2DKZA 3H8MA 1JI7A 2KIVA 2QB1A 4RQNA 2GLEA 2EAOA 2ESEA 1Z1VA 1X66A 2EANA 4MHVA 1B0XA 2LMRA 2FE9A 2QB0A 1OW5A 2L5YA 2YTUA 1PK3A 1SV4A 1SXEA 3IDWA 2F8KA 4RQMA 5F3XB 2EAPA 5KNIA 2F44A 3SENA 2EAMA 1PK1A 1F0MA 1X40A 4NL9C 5J8YC 5JTIA 4NJ8A 2E8OA 1LKYB 2K60A 2F3NA 1WWVA 1V38A 2QB0B 3BS7A 3KKAC 1UCVA 1V85A 3TADA 2QKQA 5JU5A 1OXJA 5J8YA 3SEIA 2JV3A 2KE7A 5L1MA 1SV0C 3TADC 2ES6A 4PZNA 2KSOB 2DKXA 3TACB 3BS5B 3HILA
chains in the Genus database with same CATH superfamily
2QARA 4RQ6A 1TFRA 1KFSA 2KJ9A 1KFTA 2JEGA 3C1YA 5DB9A 9ICQA 4DL6A 3C2LA 5KFGA 4A8EA 4DQIA 2KZ3A 3FDSA 3GFKB 4KX3A 2DUYA 3OSPA 8ICNA 1JALA 3QE9Y 3KZXA 5DB8A 1PK1B 4B9NA 1ZQDA 4OJ6A 1ZQEA 3GIJA 7ICEA 1S0VA 4QIWF 4NLKA 1PVRA 9ICPA 2XVTA 1UQVA 1B43A 5KFWA 5CA7A 2F1HA 4HYKA 5AKYA 4J9SA 1QQ5A 4I2EA 7ICSA 3ZDEA 3GIMA 3AM9A 4RQ1A 2WAQC 2YMQA 4BUGA 1ZQKA 1A76A 2EZZA 1TVAA 4I28A 4ECZA 3WK6A 1ZXIA 8ICJA 3IDWA 1F5SA 4UAUA 4RPYA 2AU0A 2HHVA 3LDAA 4ACOA 3WKEA 4O3PA 3PMNA 3SYZA 2R8JA 1S5LU 3NUQA 1S10A 3UXOA 4M6WB 1WCLA 4OJPA 5AI5A 4GC6A 1XC9A 3TI0A 1N56A 3T3FA 2NYVA 2XCAA 2ASJA 5ALTA 1RPLA 3SZ2A 2DBYA 1Z1BA 3TADC 2WHEA 5J2CA 8ICHA 7ICHA 9ICIA 5EE3A 4QW9A 4DSFA 2XY7A 1XSLA 3HILA 4KLDA 4PHEA 2ZUBA 3ONNA 1ZQMA 4GC7A 1TV9A 5J0RA 2E8NA 3Q8MA 5DLFA 2PI5A 2NRWA 4KLEA 2YMPA 1XO1A 1K1SA 1JRPA 2W04A 3T5LA 3Q8RB 4ICAA 3OPXA 4J9MA 1D8YA 5KFJA 4RUCA 9ICLA 4QWDA 1HUOA 2I9GA 5DB6A 5J0YA 3M8SA 3HRDD 4PGYA 2FLLA 4RQNA 4IL6U 2WF5A 1V97A 4TURA 2AHOB 4ECVA 8ICLA 1ZQZA 1N61A 3F5AA 4K4IA 4I2GA 5IIOA 4DL2A 2HOIA 3ZDDA 4YQWA 5BPCA 4F72A 2WF7A 2KZMA 4KLQA 2N1RA 4KLOA 5ALOA 5HMLA 2EAPA 4GIBA 3NVZA 2IHMA 4UAZA 2RDJA 1Z3EB 4F5PA 3L3FX 4AYBC 3GILA 2P66A 4P0QB 4I27A 3S6JA 3GDXA 3KHGA 3SD7A 4UASA 3FM9A 4EENA 2ZJ8A 4RNOA 5AKJA 5KFRA 2J6UA 2ZIWB 4B6JA 4BJQA 1ZQHA 1XO0A 3KKAC 4M6WA 3LVVA 4C8KA 2Z7JA 3LK9A 3H40A 4I2BA 3GV8B 4I2AA 5AKIA 4CCHA 2XY6A 5EE0A 1N48A 4R65A 3H8WA 4UAWA 5EE9A 5CHGA 3RRHA 2W8LA 3RH4A 5ALRA 1UA0A 2C28A 1ZYQA 2ZTCA 1L7MA 3Q8SB 3BS5A 4FO6A 7ICLA 1VDVA 5KT2A 5KFIA 3O0FA 2KHVA 4KLMA 2G09A 4ED1A 3RTVA 2KEYA 5KFSA 4QZBA 2JEFA 2M0NA 4TUPA 4DF8A 1ZQIA 2YB4A 4IR9A 4M47A 4DOBA 1D9FA 5J0WA 2A3VA 5KT4A 3AU2A 2C2RA 1Z1VA 2AQ0A 1X66A 3BDPA 1L7NA 5KFEA 3TFSA 1H38A 2K89A 4MHVA 1ZQXA 3UMBA 3N7PD 5ALEA 3RJJA 5AI8A 2HBKA 1MQ3A 2XIDA 3DV9A 3KD3A 3UMGA 1XSPA 5TZVA 3MR5A 8ICOA 4PHPA 3QYPA 1QSSA 2A1AA 4RU9A 5HR6A 3T5KA 1A77A 2W9CB 3I76A 1T94A 3SR6A 5ALNA 3C29A 1WWVA 3PSTA 2DWQA 1NKCA 1YZ6A 3QZ7A 4KLHA 4YD2A 5C5JA 1KFDA 1PVPA 4Q43A 3H8JA 2HMXA 3MC1A 4EBDA 1CRXA 5L1MA 2JZBB 2XCPA 3AUOA 3ZDBA 3C5FA 2PFPA 4YMOA 1FFVA 2DKXA 4F5NA 4F8RA 2F77X 1URJA 2W8KA 3JPSA 2BPCA 1D9DA 1JROA 4ECSA 2J6SA 2Y1JA 4BDPA 3NASA 4KLJA 2KSOA 1ZETA 4B9TA 3SV4A 4IR1A 4RQ3A 2GH1A 1ZQFA 4F5RA 4ED8A 4RZRA 3ZD9A 1HUZA 3ICXA 4OJLA 2KFZA 4MEYA 1MSWD 2EH9A 2BHNA 2D8CA 2ZJAA 3K75D 1O03A 2RHFA 2E3TA 2HHSA 3NGDA 4JK1A 2DL0A 3I28A 3WK7A 3ISBA 3H8MA 4XA5A 3RJFA 5EOZA 4DCCA 2A1JB 2OYYA 3ETLA 1L7OA 4MFFA 1ZJNA 3PV8A 2R8KA 4QWBA 2VKQA 3A0BU 4F5QA 3C23A 1SXEA 3QU2A 4KTQA 3E0FA 3F2BA 4P4MA 3C21A 5H2FU 1S77D 3F5EA 1U48A 4I2FA 1N5XA 3KHRA 5ALIA 5AIAA 4RQ7A 4Q45A 4IRKA 4IQVA 2KOBA 2DFLA 1QSLA 2C22A 1X40A 4DQRA 2HBLA 5J8YC 3JPPA 4EX6A 2F3NA 1UPHA 1WUDA 1V85A 5IIKA 9ICKA 4UB3A 5B66U 5KFUA 2IA6A 2VA8A 1Z4OA 4LZGA 3QZ8A 4Y2TA 3RB3A 2HOFA 8ICPA 1ZQJA 2ZIXB 2RP5A 1TKDA 2MRLA 5KFAA 2HHWA 2W55A 4DS4A 2ISOA 4GLXA 2XGQA 5BOMA 4F5OA 2Y0SC 5KFMA 4DS5A 4BX9C 2ZG6A 3TKAA 5DBCA 2W9BB 3NS1A 3QNMA 7ICJA 3NRWA 4YMMA 4F2RA 4F3OA 5AKZA 5K4LA 4MFAA 2PFQA 3QEBZ 3UM9A 7ICMA 3MABA 3UPQA 4KITB 4ECXA 2P6UA 2PI4A 3U26A 1T3NA 5KFXA 3SAFA 4NLBA 1PZNA 2DPJA 3HX0A 4O3NA 4ECTA 3RJEA 4NM1A 2LYHA 2BQUA 2EAOA 2LMRA 3M7DA 4O3RA 2FE9A 5HHHA 2UVRA 3MBYA 3PX4A 3T79A 2YTUA 4UB5A 1VJ5A 1F44A 1SL1A 4B9LA 1Q8KA 2ASLA 2ATLA 3GZFA 5KNIA 5CRXA 1Q3UA 1BPEA 2BPGA 3OHBA 1PK1A 2JXJA 3GU3A 3H7IA 5DG9A 4B9SA 2G5IB 3NVVA 2FDRA 2LHTA 4CDGA 1DRGA 3PW5A 5AKGA 5J0PA 2C2DA 1BGXT 3B9JA 2IMWP 3PSPA 2QKQA 5HNKA 4DFKA 5J0TA 4PH5A 3IV6A 5HMMA 1ZD2P 4DO9A 8ICSA 2MSNA 4DSKA 4KLIA 3OJSA 4DFPA 1ZQSA 3PW0A 4IQTA 5KG7A 4B9MA 1XU4A 4O9MA 1WWUA 2B6GA 5J2BA 3HPOA 2FPMA 4EELA 5ALSA 5KFQA 4J9NA 7ICQA 3BJYA 1J2NA 2OWOA 2IHNA 3HW8A 4O5CA 1ZD4A 2KK0A 1B4FA 3RJIA 8ICMA 9ICUA 2H5XA 4G3IA 8ICTA 2AGOA 2K4IA 1LB2B 2UVVA 3TAPA 5KFDA 3M8RA 3F2DA 2IOFK 5CJ7A 3UQ0A 3PSIA 3RH5A 8ICRA 3EW9A 3ALRA 3G6YA 3BQ0A 2CN1A 2B0CA 4JUZA 3J81j 5GTHU 4J9KA 2V9WA 1ZQLA 2F1IA 3CYMA 4US8A 4TQRA 1X6IA 2NO5A 1V9PA 1SZHA 4U7CA 5AM0A 4CF5A 5CR0A 4YFKA 3NVWA 4J9OA 2BCQA 5EWEA 4JWNA 1NK0A 4EEKA 4FFDA 2F2AB 2K4EA 3D2QA 2W9CA 2CXYA 3SENA 1L3TA 1RZTA 3ETRA 5HR7A 3WK8A 1JMSA 2DF4B 2H3VA 1NKEA 3GQCA 9ICVA 4YMNA 1A6SA 5L1JA 2QB0B 1FIQA 2OH2A 2G0AA 5AKHA 1MC8A 3CP8A 4ECUA 3B0YA 3OHAA 4K4GA 4I29A 4YG2A 5AKXA 1N62A 1L3VA 1T8EA 2V4QA 2FI1A 4CE6A 5E79U 8ICQA 1Z19A 3H0LB 4QJFB 3LWMA 4KLTA 4IQWA 3M1YA 4F4ZA 4AP9A 5KFCA 1J2MA 2A1JA 3MR3A 5DQIA 2PFNA 2KJ5A 1DOQA 2F8LA 2LI6A 2KG5A 2WFAA 4OJ5A 2QLTA 4YR2A 3PW2A 1AQ6A 4C8LA 1S0MA 2YB1A 5J2GA 3UQ2A 2ZIWA 4Z6CA 4BXOB 4DQPA 1BPYA 4JV1A 1U49A 1K1QA 5J2JA 3CNHA 4Y2SA 2XY5A 1L3UA 1ZQ1C 4RQ8A 9ICAA 3JPOA 4R66A 5CB1A 3PR4A 2UVUA 4E0DA 2G06A 4EYIB 5KT6A 2XO7A 3LVWA 4EBEA 4PPXA 2L5YA 5L1LA 4QIWC 3VC8A 4U6PA 3ZI4A 4Y2UA 4UARA 4Y2QA 4RQMA 5F3XB 3PVXA 2IBKA 4UB4A 4P0PB 2LM4A 2JHDA 3C28A 4R63A 1HEKA 2OM6A 2O6KA 3MFIA 9ICJA 4DSEA 3F2CA 2OXOA 1JXEA 4C4SA 2GWSA 3FAHA 1XSNA 4ELTA 5KAIU 2J6TA 1ZQAA 1U45A 1OXJA 4LZDA 1QTMA 1SKWA 2BCVA 3QU5A 1XS9D 3EPGA 3D2SA 4UATA 2RLTA 4F4YA 1NJYA 3Q8LA 1NI3A 5BOLA 5ALKA 4QWEA 4BGDA 3AEVA 4QZHA 3N97B 1SWVA 3PR5B 5L9XA 5DQGA 3PY8A 3QUBA 1TAQA 2PKEA 4ELVA 3V7KA 3IRUA 5G5GA 2ZXHA 1NOMA 4YP3A 9ICNA 2MUTA 2W11A 1X42A 5A0LA 4CNQA 2BQ3A 2R8HA 5KT7A 4QNLA 3PNCA 4FE3A 9ICXA 2FPLA 4F91B 3KHHA 5DGAA 2K8BB 4O3OA 4I2DA 1UHUA 2HSZA 1IM4A 1QSYA 3PO5A 2LYAA 1S9FA 4OO1J 5D46A 2YQEA 5HP4A 2G5HB 2FMQA 1N63A 3SAGA 1SKSA 4QWCA 2ZIVA 3H8SA 1CEZA 4Z6EA 3AQFA 1BPBA 3QU4A 2HHXA 2AXTU 4EEYA 5D4BA 3RBEA 5T14A 1X9MA 2F76X 4GXJA 1FO4A 1S0NA 3PW4A 4Y2JA 3Q8PB 4QZEA 4RUAA 1NZBA 1SZPA 4DFJA 5B5EU 1FEZA 4FZNA 3HP6A 1ZQUA 4DSLA 5ALGA 5J2IA 1SL0A 1MN8A 5KT3A 1JIHA 2NV3A 2AQ4A 2ODGA 1SIJA 2AGQA 1RYUA 5ALQA 1XWLA 1O08A 3FC4A 1KQQA 2VJ4A 3V6KA 9ICOA 3M6KA 3N7SC 1SGGA 3BQ7A 4M04A 2KMDA 2KKVA 4RT3A 3HKZC 3H4BA 4TUQA 5DB7A 2VA2A 2KTQA 3HWTA 1KW4A 3QU9A 2KFNA 3IHQB 3EPIA 4USAA 4KLGA 5AK4A 3QU7A 4BWJA 5F9LA 1ZQPA 4ED0A 1ZQBA 2I6XA 4NWIA 4KLLA 5HHIA 4C8OA 3GIIA 1NK6A 3KHLA 1AROP 3PSFA 4YN4A 4RT2A 1YT3A 4YR0A 4IRCA 1RXVA 5KFNA 3M9OB 1ZQTA 3PX0A 4R8UA 2GO7A 2RQ5A 4O5EA 2XI9A 4ED7A 3RB4A 1PUZA 1NJXA 3SAHA 1ZJMA 4B9VA 1NK9A 1IXRA 1EXNA 3OTQA 5DQHA 2MUTB 1F0MA 9ICBA 2WF9A 2E5SA 3BQTA 4JB3A 5KG1A 2Y1IA 3RJGA 3THVA 3KTQA 5JU5A 2F1JA 2C2EA 4B9UA 4PGXA 3EYZA 5KFZA 4UB6U 1HJPA 5JUMA 2W7PA 3CRXA 3QXGA 5CP2A 1ZD5A 1COOA 4M9NA 3EZ5A 1ZQCA 3PW7A 5DKWA 3TACB 4P0QA 3C1ZA 9ICCA 1S97A 4MF2A 3HJEA 4ELUA 4OCZA 2ZIXA 1Q46A 2DGZA 2G07A 5IIMA 4UBBA 2XGPA 2D3DA 4RQ5A 1DXSA 4PL2A 3DEEA 3SI8A 2JEJA 2JR5A 2KP7A 1SWWA 3C5GA 1L6NA 5JRTA 4KLSA 9ICTA 1X9WA 1N5WA 2NRXA 2KD1A 3C2KA 1MA7A 8ICBA 2BPFA 2YMLA 1KN5A 2ZTDA 3N7RC 1KBUA 3MGIA 4Y2XA 1WYGA 1RDFA 5EWGA 4UAYA 4ECQA 4FS2A 1XNSA 1SV4A 2WF6A 3SV3A 3LYSA 4ECYA 2W9BA 3V6HA 2HBJA 1NJWA 3RFAA 4DLGA 2KVSA 5ALZA 1NJZA 2JEIA 4J9PA 4O3SA 3IN5A 1ZQGA 4Z6FA 1M6YA 2EAMA 4R8UB 4IC9A 2EZYA 4O0IA 2YN4A 3H4DA 2FLPA 4J9QA 3AQEA 2R8GA 3NRZA 1TAMA 4CGZA 1SKRA 4C8MA 3UXPA 4XRHA 2P6RA 2Q0ZX 3BQ2A 4DLEA 8ICKA 4HAIA 1ZQWA 1SV0C 4GXIA 4NV0A 5CEHA 2KSOB 2NRTA 1BPXA 1RM6C 4JWMA 2KIWA 2JH1A 2GOLA 1SL2A 4DQSA 5G5HA 1ZD3A 5KG4A 1NK7A 1ED1A 3T5HA 1Z00A 4JV2A 1JUDA 4PZOA 1NNLA 4NXZA 4OJOA 4O3QA 5KFFA 5AIBA 9ICHA 2MA1A 3B0XA 7ICRA 2VJ5A 3RB0A 4C4TA 3ED5A 3RRGA 5AK3A 1S76D 4NLGA 1KKXA 4C80A 3MR6A 2HCFA 2FPKA 2LYBA 2M9NA 3V6JA 1X9XA 7ICKA 1B22A 5TISU 5KL1B 4I2IA 3E2EA 1JN3A 2CPRA 2FJ6A 1L8LA 3WK4A 4NLZA 3N28A 4IS7A 5IILA 1JX4A 5AKKA 2W7OA 1Z4NA 1QQ6A 3QUTA 2KVCA 2OEHA 1NK4A 3I1YA 7ICUA 3QUQA 4WJ3B 2HW3A 1KRPA 1U47A 3SMVA 2ZUDA 5KG2A 3D2NA 3GV5B 1Z00B 2AJQA 2W54A 1QQ7A 4KMUA 1NKBA 2BCUA 1RQLA 4ZOHC 2F8KA 1BNPA 3BQ1A 4X5VA 2VIXA 4Y2RA 3WK9A 5L1KA 3MGVA 2JH7A 4Y2YA 3ZDCA 4RQ2A 2HDOA 4NY8A 2PMZC 1ZRMA 1ECWA 2ZIUA 3A0HU 4NL9C 9ICWA 2EQYA 2E8OA 5KFBA 5KFOA 2HHQA 3HT3A 1UCVA 2KNJA 3DDHA 2ZUCA 5DBBA 5J0QA 3V7LA 4DEZA 2W03A 2WF8A 3G6VA 3RAXA 4O5KA 4TQSA 3M9NB 1VLBA 3BS5B 4ECWA 4DL4A 8ICUA 1SV0A 3K1ZA 5ALDA 1ZQRA 1N60A 1SB3C 5L1IA 1U4BA 1BNOA 2JGAA 3VCBA 2H3IA 5J2AA 2Y9TA 5AM3A 4FZMA 3MDAA 4FZLA 2Y0SF 1L3SA 4ECRA 2VANA 5J0OA 2CRXA 4QZ9A 3L5KA 5AM2A 3E58A 2UVWA 4P0PA 1D8LA 4QZGA 3JPQA 2QARB 5ALUA 5DLGA 2DKZA 2ZJ5A 4F93B 1DK3A 2QB1A 4NLNA 5AI0A 2PFOA 2BR0A 4UW9A 3UMCA 4DFMA 4TUSA 3JPTA 4PHDA 4F50A 3WKBA 3SQIA 1X9SA 4M9LA 2EDUA 4O3MA 2RRDA 5ALPA 4F71A 3RR7A 4ED2A 3IG8A 3L4PA 3JPNA 8ICWA 3OSNA 3WK5A 4GFJA 1GO3F 2P35A 2WTFA 4BXOA 4M9HA 1OUQA 8ICCA 3WKAA 2F44A 5KFHA 3PX6A 2R8IA 5ALHA 4IQUA 1ZQQA 5JTIA 4C7ZA 2HI0A 2H3FA 4R64A 1QH9A 2JMGA 4UAVA 1L8OA 1Y88A 3K4GA 2I5HA 4DL3A 2JV3A 5AK5A 9ICSA 1WCNA 2ES6A 1C7YA 3LWLA 4RNMA 2Q4TA 2KN7A 5ALYA 4RNNA 4ZH4A 1BPZA 4G9BA 4C8NA 5J0XA 2BQRA 5J2DA 2LKYA 2W3RA 3WKDA 4I2HA 4UQGA 3ZDAA 4YVZA 2JRZA 1JXLA 2LPEA 4AYBF 1FFUA 1RG6A 3RJKA 5C0YA 2YY6A 7ICPA 5KFKA 4M0AA 1KLNA 1ZOLA 4C4RA 3MR2A 5AI9A 4F4XA 1QLNA 2W3SA 4MEXA 1JI7A 4M9JA 2MU2A 3M6ZA 3WU2U 1RQNA 5DDYA 3OGUA 2EANA 4LVSA 2KJ8A 8ICYA 5KFLA 2QB0A 4DWIA 1TAUA 2IOHA 5AHXA 4RPZA 2ISPA 3GV7B 1NK5A 4DSIA 9ICMA 4PL1A 5KG0A 3QX7A 2AH5A 4UB8U 7ICNA 3FYHA 4YXJA 2H3QA 3MFHA 3CW2C 5J0UA 4CRXA 5KFTA 5F9NA 1WG8A 4EBCA 2MAXA 5GTIU 3TARA 4QZCA 2YMMA 3RJHA 1T7PA 2FMPA 1L5UA 5CWRA 2HOQA 2ASDA 2I1QA 4UBCA 5KG6A 4P2HA 2ALZA 1N2XA 5FP0A 8ICIA 4Q44A 1LV5A 2XC9A 4PZNA 3JPRA 4Q8FA 1T4GA 2WB1C 5AICA 4EZ6A 2HVHA 4NM2A 5KTQA 3V7JA 5KFVA 2WB1F 4Z6DA 1IV8A 4FBUA 3RB6A 3PZPA 3EWAA 2E8MA 4DOCA 8ICZA 4QW8A 2B21A 8ICFA 4FS1A 5KFYA 3RBDA 2BDUA 2KKPA 4QZFA 2ZIUB 2BGWA 4NL9A 3IG5A 4DL7A 1LKYA 2H3ZA 5AI4A 4C7YA 1ZQYA 2KV2A 2BCRA 2W9AA 3ISCA 3AL0B 5KFPA 5J29A 2KIVA 1X6JA 1QCKA 4CF4A 2GLEA 2ESEA 9ICGA 4YD1A 4UB2A 2K4HA 1BPDA 4XUSA 4M9GA 2DQNB 1PK3A 3N4MB 1TK5A 2VA3A 2W9MA 1TE2A 5AM1A 5ALVA 7ICVA 2NRZA 5KT5A 4DQQA 5AK6A 3ZD8A 1P7DA 4KLFA 3GIKA 1A0PA 2HHUA 3C2MA 1T3QA 1RYRA 4QZDA 2HVIA 1LKYB 1LVHA 5AM4A 4J9RA 4P4OA 1V38A 4ED6A 2V4RA 1IG6A 2EZXA 4QZAA 1U9LA 2JZBA 2ZTEA 4DFDA 4MF8A 4F92B 2BKEA 4K4HA 4KN4A 4PHAA 4QWAA 5EE1A 2E1EA 4KX5A 4J03A 4YCXA 5DGBA 4RQ4A 3G6XA 1SXDA 3QUCA 2BZFA 5J0SA 3KFUF 2ZIVB 4RPXA 3KBBA 2K4PA 1ZRNA 4F4WA 9ICFA 1S8OA 5D49A 3K1RB 3TANA 1COKA 7ICIA 3PMLA 1BVSA 2OHFA 1TK0A 4I2JA 4F2SA 1X2IA 2W43A 2NO4A 5EWFA 5IINA 4C0ZA 2XICA 1YZ7A 2YX8A 3RH6A 3OJUA 3Q8KA 2OCEA 3TFRA 2HHTA 4BWMA 3AN1A 4JV0A 2KZZA 4Q8EA 8ICEA 4JMUA 3F53A 5AI6A 1IIPA 4P4PA 2K8CB 5KG5A 4PJ0U 2PMZF 4F4KA 2LBOA 3ISDA 5KL8B 5DDMA 2DPIA 3AU6A 8ICVA 5ALWA 4YR3A 5ALFA 3RAQA 3UXNA 2AGPA 5ALXA 1K5OA 1DK2A 3H0RB 3HKZF 4UB1A 4DOAA 4DSJA 4EX7A 1UT5A 2RDIA 1DGSA 3KOOA 1KDHA 1C20A 2KHQA 1RYSA 7ICOA 5IIIA 3BS7A 3RF9A 4IRDA 2KICA 4ED3A 2WAQF 3IP4B 5J8YA 5AM5A 3SEIA 1L7PA 3QEAZ 1DGJA 4I2CA 4US9A 4KMOB 2K8AA 1S0OA 5DBAA 3H0MB 5IIJA 5J2EA 1NK8A 3D6JA 5ALMA 2PXIA 2D6FC 5ALJA 3MGHA 1CUKA 3M9MB 2Y9UA 4Y2VA 3WKCA 3BZCA 4DF4A 8ICXA 4RQ0A 3MDCA 2R18A 3Q8QB 3R9KA 5AKEA 5KG3A 5J2KA 4J9LA 1RXWA 2IOFA 4KN7A 4EYHB 9ICEA 1KTQA 5DG7A 3TQ1A 2E8PA 1KSPA 1TK8A 4YXMA 3KKAA 2FMSA 1J97A 4GXKA 1KEJA 3V72A 3KZIU 4Y2PA 4NLCA 1ZQOA 1CI4A 2ZXIA 2BDPA 1UA1A 1MQ2A 1B0XA 3NTUA 1OW5A 4XQ8A 4LJXA 2FLNA 5ALLA 4EZ9A 3T5JA 9ICRA 5J2FA 2NRVA 7ICTA 1ZQVA 4PGQA 3TAQA 4DL5A 2G08A 3EUB2 4KLUA 7ICGA 4CF3A 4QZ8A 2E1FA 2LM1A 3NVYA 1Q3VA 7ICFA 1D8BA 4NJ8A 2HBMA 1KL9A 2K60A 3RR8A 5KAFU 4OD0A 1UT8A 3TADA 4QZIA 8ICAA 4M2YA 1ZQNA 3AMZA 2BCSA 2KE7A 2A19A 3IM1A 3PO4A 3ORYA 5DG8A 1PVQA 4MFCA 4FBTA 1HIWA 5AKLA 8ICGA 5J2HA 3BZKA 1NZPA
chains in the Genus database with same CATH topology
2QARA 1WWUA 2B6GA 1SV0A 3BS5A 1SXDA 2E8NA 4PZOA 2Y9UA 2E8MA 2KSOA 1SGGA 3BQ7A 2KMDA 2D3DA 1B4FA 2Y9TA 1DXSA 2K4PA 2KG5A 2LPEA 1PK1B 3K1RB 1RG6A 1COKA 1KW4A 2E8PA 4NL9A 1X9XA 2D8CA 1LKYA 5JRTA 3KKAA 2QARB 1UQVA 2DL0A 4IS7A 2DKZA 3H8MA 1JI7A 2KIVA 2QB1A 4RQNA 2GLEA 2EAOA 2ESEA 1Z1VA 1X66A 2EANA 4MHVA 1B0XA 2LMRA 2FE9A 2QB0A 1OW5A 2L5YA 2YTUA 1PK3A 1SV4A 1SXEA 3IDWA 2F8KA 4RQMA 5F3XB 2EAPA 5KNIA 2F44A 3SENA 2EAMA 1PK1A 1F0MA 1X40A 4NL9C 5J8YC 5JTIA 4NJ8A 2E8OA 1LKYB 2K60A 2F3NA 1WWVA 1V38A 2QB0B 3BS7A 3KKAC 1UCVA 1V85A 3TADA 2QKQA 5JU5A 1OXJA 5J8YA 3SEIA 2JV3A 2KE7A 5L1MA 1SV0C 3TADC 2ES6A 4PZNA 2KSOB 2DKXA 3TACB 3BS5B 3HILA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2QAR A;  1WWU A;  2B6G A;  1SV0 A;  3BS5 A;  1SXD A;  2E8N A;  4PZO A;  2Y9U A;  2E8M A;  2KSO A;  1SGG A;  3BQ7 A;  2KMD A;  2D3D A;  1B4F A;  2Y9T A;  1DXS A;  2K4P A;  2KG5 A;  2LPE A;  1PK1 B;  3K1R B;  1RG6 A;  1COK A;  1KW4 A;  2E8P A;  4NL9 A;  1X9X A;  2D8C A;  1LKY A;  5JRT A;  3KKA A;  2QAR B;  1UQV A;  2DL0 A;  4IS7 A;  2DKZ A;  3H8M A;  1JI7 A;  2KIV A;  2QB1 A;  4RQN A;  2GLE A;  2EAO A;  2ESE A;  1Z1V A;  1X66 A;  2EAN A;  4MHV A;  1B0X A;  2LMR A;  2FE9 A;  2QB0 A;  1OW5 A;  2L5Y A;  2YTU A;  1PK3 A;  1SV4 A;  1SXE A;  3IDW A;  2F8K A;  4RQM A;  5F3X B;  2EAP A;  5KNI A;  2F44 A;  3SEN A;  2EAM A;  1PK1 A;  1F0M A;  1X40 A;  4NL9 C;  5J8Y C;  5JTI A;  4NJ8 A;  2E8O A;  1LKY B;  2K60 A;  2F3N A;  1WWV A;  1V38 A;  2QB0 B;  3BS7 A;  3KKA C;  1UCV A;  1V85 A;  3TAD A;  2QKQ A;  5JU5 A;  1OXJ A;  5J8Y A;  3SEI A;  2JV3 A;  2KE7 A;  5L1M A;  1SV0 C;  3TAD C;  2ES6 A;  4PZN A;  2KSO B;  2DKX A;  3TAC B;  3BS5 B;  3HIL A; 
#chains in the Genus database with same CATH topology
 2QAR A;  4RQ6 A;  1TFR A;  1KFS A;  2KJ9 A;  1KFT A;  2JEG A;  3C1Y A;  5DB9 A;  9ICQ A;  4DL6 A;  3C2L A;  5KFG A;  4A8E A;  4DQI A;  2KZ3 A;  3FDS A;  3GFK B;  4KX3 A;  2DUY A;  3OSP A;  8ICN A;  1JAL A;  3QE9 Y;  3KZX A;  5DB8 A;  1PK1 B;  4B9N A;  1ZQD A;  4OJ6 A;  1ZQE A;  3GIJ A;  7ICE A;  1S0V A;  4QIW F;  4NLK A;  1PVR A;  9ICP A;  2XVT A;  1UQV A;  1B43 A;  5KFW A;  5CA7 A;  2F1H A;  4HYK A;  5AKY A;  4J9S A;  1QQ5 A;  4I2E A;  7ICS A;  3ZDE A;  3GIM A;  3AM9 A;  4RQ1 A;  2WAQ C;  2YMQ A;  4BUG A;  1ZQK A;  1A76 A;  2EZZ A;  1TVA A;  4I28 A;  4ECZ A;  3WK6 A;  1ZXI A;  8ICJ A;  3IDW A;  1F5S A;  4UAU A;  4RPY A;  2AU0 A;  2HHV A;  3LDA A;  4ACO A;  3WKE A;  4O3P A;  3PMN A;  3SYZ A;  2R8J A;  1S5L U;  3NUQ A;  1S10 A;  3UXO A;  4M6W B;  1WCL A;  4OJP A;  5AI5 A;  4GC6 A;  1XC9 A;  3TI0 A;  1N56 A;  3T3F A;  2NYV A;  2XCA A;  2ASJ A;  5ALT A;  1RPL A;  3SZ2 A;  2DBY A;  1Z1B A;  3TAD C;  2WHE A;  5J2C A;  8ICH A;  7ICH A;  9ICI A;  5EE3 A;  4QW9 A;  4DSF A;  2XY7 A;  1XSL A;  3HIL A;  4KLD A;  4PHE A;  2ZUB A;  3ONN A;  1ZQM A;  4GC7 A;  1TV9 A;  5J0R A;  2E8N A;  3Q8M A;  5DLF A;  2PI5 A;  2NRW A;  4KLE A;  2YMP A;  1XO1 A;  1K1S A;  1JRP A;  2W04 A;  3T5L A;  3Q8R B;  4ICA A;  3OPX A;  4J9M A;  1D8Y A;  5KFJ A;  4RUC A;  9ICL A;  4QWD A;  1HUO A;  2I9G A;  5DB6 A;  5J0Y A;  3M8S A;  3HRD D;  4PGY A;  2FLL A;  4RQN A;  4IL6 U;  2WF5 A;  1V97 A;  4TUR A;  2AHO B;  4ECV A;  8ICL A;  1ZQZ A;  1N61 A;  3F5A A;  4K4I A;  4I2G A;  5IIO A;  4DL2 A;  2HOI A;  3ZDD A;  4YQW A;  5BPC A;  4F72 A;  2WF7 A;  2KZM A;  4KLQ A;  2N1R A;  4KLO A;  5ALO A;  5HML A;  2EAP A;  4GIB A;  3NVZ A;  2IHM A;  4UAZ A;  2RDJ A;  1Z3E B;  4F5P A;  3L3F X;  4AYB C;  3GIL A;  2P66 A;  4P0Q B;  4I27 A;  3S6J A;  3GDX A;  3KHG A;  3SD7 A;  4UAS A;  3FM9 A;  4EEN A;  2ZJ8 A;  4RNO A;  5AKJ A;  5KFR A;  2J6U A;  2ZIW B;  4B6J A;  4BJQ A;  1ZQH A;  1XO0 A;  3KKA C;  4M6W A;  3LVV A;  4C8K A;  2Z7J A;  3LK9 A;  3H40 A;  4I2B A;  3GV8 B;  4I2A A;  5AKI A;  4CCH A;  2XY6 A;  5EE0 A;  1N48 A;  4R65 A;  3H8W A;  4UAW A;  5EE9 A;  5CHG A;  3RRH A;  2W8L A;  3RH4 A;  5ALR A;  1UA0 A;  2C28 A;  1ZYQ A;  2ZTC A;  1L7M A;  3Q8S B;  3BS5 A;  4FO6 A;  7ICL A;  1VDV A;  5KT2 A;  5KFI A;  3O0F A;  2KHV A;  4KLM A;  2G09 A;  4ED1 A;  3RTV A;  2KEY A;  5KFS A;  4QZB A;  2JEF A;  2M0N A;  4TUP A;  4DF8 A;  1ZQI A;  2YB4 A;  4IR9 A;  4M47 A;  4DOB A;  1D9F A;  5J0W A;  2A3V A;  5KT4 A;  3AU2 A;  2C2R A;  1Z1V A;  2AQ0 A;  1X66 A;  3BDP A;  1L7N A;  5KFE A;  3TFS A;  1H38 A;  2K89 A;  4MHV A;  1ZQX A;  3UMB A;  3N7P D;  5ALE A;  3RJJ A;  5AI8 A;  2HBK A;  1MQ3 A;  2XID A;  3DV9 A;  3KD3 A;  3UMG A;  1XSP A;  5TZV A;  3MR5 A;  8ICO A;  4PHP A;  3QYP A;  1QSS A;  2A1A A;  4RU9 A;  5HR6 A;  3T5K A;  1A77 A;  2W9C B;  3I76 A;  1T94 A;  3SR6 A;  5ALN A;  3C29 A;  1WWV A;  3PST A;  2DWQ A;  1NKC A;  1YZ6 A;  3QZ7 A;  4KLH A;  4YD2 A;  5C5J A;  1KFD A;  1PVP A;  4Q43 A;  3H8J A;  2HMX A;  3MC1 A;  4EBD A;  1CRX A;  5L1M A;  2JZB B;  2XCP A;  3AUO A;  3ZDB A;  3C5F A;  2PFP A;  4YMO A;  1FFV A;  2DKX A;  4F5N A;  4F8R A;  2F77 X;  1URJ A;  2W8K A;  3JPS A;  2BPC A;  1D9D A;  1JRO A;  4ECS A;  2J6S A;  2Y1J A;  4BDP A;  3NAS A;  4KLJ A;  2KSO A;  1ZET A;  4B9T A;  3SV4 A;  4IR1 A;  4RQ3 A;  2GH1 A;  1ZQF A;  4F5R A;  4ED8 A;  4RZR A;  3ZD9 A;  1HUZ A;  3ICX A;  4OJL A;  2KFZ A;  4MEY A;  1MSW D;  2EH9 A;  2BHN A;  2D8C A;  2ZJA A;  3K75 D;  1O03 A;  2RHF A;  2E3T A;  2HHS A;  3NGD A;  4JK1 A;  2DL0 A;  3I28 A;  3WK7 A;  3ISB A;  3H8M A;  4XA5 A;  3RJF A;  5EOZ A;  4DCC A;  2A1J B;  2OYY A;  3ETL A;  1L7O A;  4MFF A;  1ZJN A;  3PV8 A;  2R8K A;  4QWB A;  2VKQ A;  3A0B U;  4F5Q A;  3C23 A;  1SXE A;  3QU2 A;  4KTQ A;  3E0F A;  3F2B A;  4P4M A;  3C21 A;  5H2F U;  1S77 D;  3F5E A;  1U48 A;  4I2F A;  1N5X A;  3KHR A;  5ALI A;  5AIA A;  4RQ7 A;  4Q45 A;  4IRK A;  4IQV A;  2KOB A;  2DFL A;  1QSL A;  2C22 A;  1X40 A;  4DQR A;  2HBL A;  5J8Y C;  3JPP A;  4EX6 A;  2F3N A;  1UPH A;  1WUD A;  1V85 A;  5IIK A;  9ICK A;  4UB3 A;  5B66 U;  5KFU A;  2IA6 A;  2VA8 A;  1Z4O A;  4LZG A;  3QZ8 A;  4Y2T A;  3RB3 A;  2HOF A;  8ICP A;  1ZQJ A;  2ZIX B;  2RP5 A;  1TKD A;  2MRL A;  5KFA A;  2HHW A;  2W55 A;  4DS4 A;  2ISO A;  4GLX A;  2XGQ A;  5BOM A;  4F5O A;  2Y0S C;  5KFM A;  4DS5 A;  4BX9 C;  2ZG6 A;  3TKA A;  5DBC A;  2W9B B;  3NS1 A;  3QNM A;  7ICJ A;  3NRW A;  4YMM A;  4F2R A;  4F3O A;  5AKZ A;  5K4L A;  4MFA A;  2PFQ A;  3QEB Z;  3UM9 A;  7ICM A;  3MAB A;  3UPQ A;  4KIT B;  4ECX A;  2P6U A;  2PI4 A;  3U26 A;  1T3N A;  5KFX A;  3SAF A;  4NLB A;  1PZN A;  2DPJ A;  3HX0 A;  4O3N A;  4ECT A;  3RJE A;  4NM1 A;  2LYH A;  2BQU A;  2EAO A;  2LMR A;  3M7D A;  4O3R A;  2FE9 A;  5HHH A;  2UVR A;  3MBY A;  3PX4 A;  3T79 A;  2YTU A;  4UB5 A;  1VJ5 A;  1F44 A;  1SL1 A;  4B9L A;  1Q8K A;  2ASL A;  2ATL A;  3GZF A;  5KNI A;  5CRX A;  1Q3U A;  1BPE A;  2BPG A;  3OHB A;  1PK1 A;  2JXJ A;  3GU3 A;  3H7I A;  5DG9 A;  4B9S A;  2G5I B;  3NVV A;  2FDR A;  2LHT A;  4CDG A;  1DRG A;  3PW5 A;  5AKG A;  5J0P A;  2C2D A;  1BGX T;  3B9J A;  2IMW P;  3PSP A;  2QKQ A;  5HNK A;  4DFK A;  5J0T A;  4PH5 A;  3IV6 A;  5HMM A;  1ZD2 P;  4DO9 A;  8ICS A;  2MSN A;  4DSK A;  4KLI A;  3OJS A;  4DFP A;  1ZQS A;  3PW0 A;  4IQT A;  5KG7 A;  4B9M A;  1XU4 A;  4O9M A;  1WWU A;  2B6G A;  5J2B A;  3HPO A;  2FPM A;  4EEL A;  5ALS A;  5KFQ A;  4J9N A;  7ICQ A;  3BJY A;  1J2N A;  2OWO A;  2IHN A;  3HW8 A;  4O5C A;  1ZD4 A;  2KK0 A;  1B4F A;  3RJI A;  8ICM A;  9ICU A;  2H5X A;  4G3I A;  8ICT A;  2AGO A;  2K4I A;  1LB2 B;  2UVV A;  3TAP A;  5KFD A;  3M8R A;  3F2D A;  2IOF K;  5CJ7 A;  3UQ0 A;  3PSI A;  3RH5 A;  8ICR A;  3EW9 A;  3ALR A;  3G6Y A;  3BQ0 A;  2CN1 A;  2B0C A;  4JUZ A;  3J81 j;  5GTH U;  4J9K A;  2V9W A;  1ZQL A;  2F1I A;  3CYM A;  4US8 A;  4TQR A;  1X6I A;  2NO5 A;  1V9P A;  1SZH A;  4U7C A;  5AM0 A;  4CF5 A;  5CR0 A;  4YFK A;  3NVW A;  4J9O A;  2BCQ A;  5EWE A;  4JWN A;  1NK0 A;  4EEK A;  4FFD A;  2F2A B;  2K4E A;  3D2Q A;  2W9C A;  2CXY A;  3SEN A;  1L3T A;  1RZT A;  3ETR A;  5HR7 A;  3WK8 A;  1JMS A;  2DF4 B;  2H3V A;  1NKE A;  3GQC A;  9ICV A;  4YMN A;  1A6S A;  5L1J A;  2QB0 B;  1FIQ A;  2OH2 A;  2G0A A;  5AKH A;  1MC8 A;  3CP8 A;  4ECU A;  3B0Y A;  3OHA A;  4K4G A;  4I29 A;  4YG2 A;  5AKX A;  1N62 A;  1L3V A;  1T8E A;  2V4Q A;  2FI1 A;  4CE6 A;  5E79 U;  8ICQ A;  1Z19 A;  3H0L B;  4QJF B;  3LWM A;  4KLT A;  4IQW A;  3M1Y A;  4F4Z A;  4AP9 A;  5KFC A;  1J2M A;  2A1J A;  3MR3 A;  5DQI A;  2PFN A;  2KJ5 A;  1DOQ A;  2F8L A;  2LI6 A;  2KG5 A;  2WFA A;  4OJ5 A;  2QLT A;  4YR2 A;  3PW2 A;  1AQ6 A;  4C8L A;  1S0M A;  2YB1 A;  5J2G A;  3UQ2 A;  2ZIW A;  4Z6C A;  4BXO B;  4DQP A;  1BPY A;  4JV1 A;  1U49 A;  1K1Q A;  5J2J A;  3CNH A;  4Y2S A;  2XY5 A;  1L3U A;  1ZQ1 C;  4RQ8 A;  9ICA A;  3JPO A;  4R66 A;  5CB1 A;  3PR4 A;  2UVU A;  4E0D A;  2G06 A;  4EYI B;  5KT6 A;  2XO7 A;  3LVW A;  4EBE A;  4PPX A;  2L5Y A;  5L1L A;  4QIW C;  3VC8 A;  4U6P A;  3ZI4 A;  4Y2U A;  4UAR A;  4Y2Q A;  4RQM A;  5F3X B;  3PVX A;  2IBK A;  4UB4 A;  4P0P B;  2LM4 A;  2JHD A;  3C28 A;  4R63 A;  1HEK A;  2OM6 A;  2O6K A;  3MFI A;  9ICJ A;  4DSE A;  3F2C A;  2OXO A;  1JXE A;  4C4S A;  2GWS A;  3FAH A;  1XSN A;  4ELT A;  5KAI U;  2J6T A;  1ZQA A;  1U45 A;  1OXJ A;  4LZD A;  1QTM A;  1SKW A;  2BCV A;  3QU5 A;  1XS9 D;  3EPG A;  3D2S A;  4UAT A;  2RLT A;  4F4Y A;  1NJY A;  3Q8L A;  1NI3 A;  5BOL A;  5ALK A;  4QWE A;  4BGD A;  3AEV A;  4QZH A;  3N97 B;  1SWV A;  3PR5 B;  5L9X A;  5DQG A;  3PY8 A;  3QUB A;  1TAQ A;  2PKE A;  4ELV A;  3V7K A;  3IRU A;  5G5G A;  2ZXH A;  1NOM A;  4YP3 A;  9ICN A;  2MUT A;  2W11 A;  1X42 A;  5A0L A;  4CNQ A;  2BQ3 A;  2R8H A;  5KT7 A;  4QNL A;  3PNC A;  4FE3 A;  9ICX A;  2FPL A;  4F91 B;  3KHH A;  5DGA A;  2K8B B;  4O3O A;  4I2D A;  1UHU A;  2HSZ A;  1IM4 A;  1QSY A;  3PO5 A;  2LYA A;  1S9F A;  4OO1 J;  5D46 A;  2YQE A;  5HP4 A;  2G5H B;  2FMQ A;  1N63 A;  3SAG A;  1SKS A;  4QWC A;  2ZIV A;  3H8S A;  1CEZ A;  4Z6E A;  3AQF A;  1BPB A;  3QU4 A;  2HHX A;  2AXT U;  4EEY A;  5D4B A;  3RBE A;  5T14 A;  1X9M A;  2F76 X;  4GXJ A;  1FO4 A;  1S0N A;  3PW4 A;  4Y2J A;  3Q8P B;  4QZE A;  4RUA A;  1NZB A;  1SZP A;  4DFJ A;  5B5E U;  1FEZ A;  4FZN A;  3HP6 A;  1ZQU A;  4DSL A;  5ALG A;  5J2I A;  1SL0 A;  1MN8 A;  5KT3 A;  1JIH A;  2NV3 A;  2AQ4 A;  2ODG A;  1SIJ A;  2AGQ A;  1RYU A;  5ALQ A;  1XWL A;  1O08 A;  3FC4 A;  1KQQ A;  2VJ4 A;  3V6K A;  9ICO A;  3M6K A;  3N7S C;  1SGG A;  3BQ7 A;  4M04 A;  2KMD A;  2KKV A;  4RT3 A;  3HKZ C;  3H4B A;  4TUQ A;  5DB7 A;  2VA2 A;  2KTQ A;  3HWT A;  1KW4 A;  3QU9 A;  2KFN A;  3IHQ B;  3EPI A;  4USA A;  4KLG A;  5AK4 A;  3QU7 A;  4BWJ A;  5F9L A;  1ZQP A;  4ED0 A;  1ZQB A;  2I6X A;  4NWI A;  4KLL A;  5HHI A;  4C8O A;  3GII A;  1NK6 A;  3KHL A;  1ARO P;  3PSF A;  4YN4 A;  4RT2 A;  1YT3 A;  4YR0 A;  4IRC A;  1RXV A;  5KFN A;  3M9O B;  1ZQT A;  3PX0 A;  4R8U A;  2GO7 A;  2RQ5 A;  4O5E A;  2XI9 A;  4ED7 A;  3RB4 A;  1PUZ A;  1NJX A;  3SAH A;  1ZJM A;  4B9V A;  1NK9 A;  1IXR A;  1EXN A;  3OTQ A;  5DQH A;  2MUT B;  1F0M A;  9ICB A;  2WF9 A;  2E5S A;  3BQT A;  4JB3 A;  5KG1 A;  2Y1I A;  3RJG A;  3THV A;  3KTQ A;  5JU5 A;  2F1J A;  2C2E A;  4B9U A;  4PGX A;  3EYZ A;  5KFZ A;  4UB6 U;  1HJP A;  5JUM A;  2W7P A;  3CRX A;  3QXG A;  5CP2 A;  1ZD5 A;  1COO A;  4M9N A;  3EZ5 A;  1ZQC A;  3PW7 A;  5DKW A;  3TAC B;  4P0Q A;  3C1Z A;  9ICC A;  1S97 A;  4MF2 A;  3HJE A;  4ELU A;  4OCZ A;  2ZIX A;  1Q46 A;  2DGZ A;  2G07 A;  5IIM A;  4UBB A;  2XGP A;  2D3D A;  4RQ5 A;  1DXS A;  4PL2 A;  3DEE A;  3SI8 A;  2JEJ A;  2JR5 A;  2KP7 A;  1SWW A;  3C5G A;  1L6N A;  5JRT A;  4KLS A;  9ICT A;  1X9W A;  1N5W A;  2NRX A;  2KD1 A;  3C2K A;  1MA7 A;  8ICB A;  2BPF A;  2YML A;  1KN5 A;  2ZTD A;  3N7R C;  1KBU A;  3MGI A;  4Y2X A;  1WYG A;  1RDF A;  5EWG A;  4UAY A;  4ECQ A;  4FS2 A;  1XNS A;  1SV4 A;  2WF6 A;  3SV3 A;  3LYS A;  4ECY A;  2W9B A;  3V6H A;  2HBJ A;  1NJW A;  3RFA A;  4DLG A;  2KVS A;  5ALZ A;  1NJZ A;  2JEI A;  4J9P A;  4O3S A;  3IN5 A;  1ZQG A;  4Z6F A;  1M6Y A;  2EAM A;  4R8U B;  4IC9 A;  2EZY A;  4O0I A;  2YN4 A;  3H4D A;  2FLP A;  4J9Q A;  3AQE A;  2R8G A;  3NRZ A;  1TAM A;  4CGZ A;  1SKR A;  4C8M A;  3UXP A;  4XRH A;  2P6R A;  2Q0Z X;  3BQ2 A;  4DLE A;  8ICK A;  4HAI A;  1ZQW A;  1SV0 C;  4GXI A;  4NV0 A;  5CEH A;  2KSO B;  2NRT A;  1BPX A;  1RM6 C;  4JWM A;  2KIW A;  2JH1 A;  2GOL A;  1SL2 A;  4DQS A;  5G5H A;  1ZD3 A;  5KG4 A;  1NK7 A;  1ED1 A;  3T5H A;  1Z00 A;  4JV2 A;  1JUD A;  4PZO A;  1NNL A;  4NXZ A;  4OJO A;  4O3Q A;  5KFF A;  5AIB A;  9ICH A;  2MA1 A;  3B0X A;  7ICR A;  2VJ5 A;  3RB0 A;  4C4T A;  3ED5 A;  3RRG A;  5AK3 A;  1S76 D;  4NLG A;  1KKX A;  4C80 A;  3MR6 A;  2HCF A;  2FPK A;  2LYB A;  2M9N A;  3V6J A;  1X9X A;  7ICK A;  1B22 A;  5TIS U;  5KL1 B;  4I2I A;  3E2E A;  1JN3 A;  2CPR A;  2FJ6 A;  1L8L A;  3WK4 A;  4NLZ A;  3N28 A;  4IS7 A;  5IIL A;  1JX4 A;  5AKK A;  2W7O A;  1Z4N A;  1QQ6 A;  3QUT A;  2KVC A;  2OEH A;  1NK4 A;  3I1Y A;  7ICU A;  3QUQ A;  4WJ3 B;  2HW3 A;  1KRP A;  1U47 A;  3SMV A;  2ZUD A;  5KG2 A;  3D2N A;  3GV5 B;  1Z00 B;  2AJQ A;  2W54 A;  1QQ7 A;  4KMU A;  1NKB A;  2BCU A;  1RQL A;  4ZOH C;  2F8K A;  1BNP A;  3BQ1 A;  4X5V A;  2VIX A;  4Y2R A;  3WK9 A;  5L1K A;  3MGV A;  2JH7 A;  4Y2Y A;  3ZDC A;  4RQ2 A;  2HDO A;  4NY8 A;  2PMZ C;  1ZRM A;  1ECW A;  2ZIU A;  3A0H U;  4NL9 C;  9ICW A;  2EQY A;  2E8O A;  5KFB A;  5KFO A;  2HHQ A;  3HT3 A;  1UCV A;  2KNJ A;  3DDH A;  2ZUC A;  5DBB A;  5J0Q A;  3V7L A;  4DEZ A;  2W03 A;  2WF8 A;  3G6V A;  3RAX A;  4O5K A;  4TQS A;  3M9N B;  1VLB A;  3BS5 B;  4ECW A;  4DL4 A;  8ICU A;  1SV0 A;  3K1Z A;  5ALD A;  1ZQR A;  1N60 A;  1SB3 C;  5L1I A;  1U4B A;  1BNO A;  2JGA A;  3VCB A;  2H3I A;  5J2A A;  2Y9T A;  5AM3 A;  4FZM A;  3MDA A;  4FZL A;  2Y0S F;  1L3S A;  4ECR A;  2VAN A;  5J0O A;  2CRX A;  4QZ9 A;  3L5K A;  5AM2 A;  3E58 A;  2UVW A;  4P0P A;  1D8L A;  4QZG A;  3JPQ A;  2QAR B;  5ALU A;  5DLG A;  2DKZ A;  2ZJ5 A;  4F93 B;  1DK3 A;  2QB1 A;  4NLN A;  5AI0 A;  2PFO A;  2BR0 A;  4UW9 A;  3UMC A;  4DFM A;  4TUS A;  3JPT A;  4PHD A;  4F50 A;  3WKB A;  3SQI A;  1X9S A;  4M9L A;  2EDU A;  4O3M A;  2RRD A;  5ALP A;  4F71 A;  3RR7 A;  4ED2 A;  3IG8 A;  3L4P A;  3JPN A;  8ICW A;  3OSN A;  3WK5 A;  4GFJ A;  1GO3 F;  2P35 A;  2WTF A;  4BXO A;  4M9H A;  1OUQ A;  8ICC A;  3WKA A;  2F44 A;  5KFH A;  3PX6 A;  2R8I A;  5ALH A;  4IQU A;  1ZQQ A;  5JTI A;  4C7Z A;  2HI0 A;  2H3F A;  4R64 A;  1QH9 A;  2JMG A;  4UAV A;  1L8O A;  1Y88 A;  3K4G A;  2I5H A;  4DL3 A;  2JV3 A;  5AK5 A;  9ICS A;  1WCN A;  2ES6 A;  1C7Y A;  3LWL A;  4RNM A;  2Q4T A;  2KN7 A;  5ALY A;  4RNN A;  4ZH4 A;  1BPZ A;  4G9B A;  4C8N A;  5J0X A;  2BQR A;  5J2D A;  2LKY A;  2W3R A;  3WKD A;  4I2H A;  4UQG A;  3ZDA A;  4YVZ A;  2JRZ A;  1JXL A;  2LPE A;  4AYB F;  1FFU A;  1RG6 A;  3RJK A;  5C0Y A;  2YY6 A;  7ICP A;  5KFK A;  4M0A A;  1KLN A;  1ZOL A;  4C4R A;  3MR2 A;  5AI9 A;  4F4X A;  1QLN A;  2W3S A;  4MEX A;  1JI7 A;  4M9J A;  2MU2 A;  3M6Z A;  3WU2 U;  1RQN A;  5DDY A;  3OGU A;  2EAN A;  4LVS A;  2KJ8 A;  8ICY A;  5KFL A;  2QB0 A;  4DWI A;  1TAU A;  2IOH A;  5AHX A;  4RPZ A;  2ISP A;  3GV7 B;  1NK5 A;  4DSI A;  9ICM A;  4PL1 A;  5KG0 A;  3QX7 A;  2AH5 A;  4UB8 U;  7ICN A;  3FYH A;  4YXJ A;  2H3Q A;  3MFH A;  3CW2 C;  5J0U A;  4CRX A;  5KFT A;  5F9N A;  1WG8 A;  4EBC A;  2MAX A;  5GTI U;  3TAR A;  4QZC A;  2YMM A;  3RJH A;  1T7P A;  2FMP A;  1L5U A;  5CWR A;  2HOQ A;  2ASD A;  2I1Q A;  4UBC A;  5KG6 A;  4P2H A;  2ALZ A;  1N2X A;  5FP0 A;  8ICI A;  4Q44 A;  1LV5 A;  2XC9 A;  4PZN A;  3JPR A;  4Q8F A;  1T4G A;  2WB1 C;  5AIC A;  4EZ6 A;  2HVH A;  4NM2 A;  5KTQ A;  3V7J A;  5KFV A;  2WB1 F;  4Z6D A;  1IV8 A;  4FBU A;  3RB6 A;  3PZP A;  3EWA A;  2E8M A;  4DOC A;  8ICZ A;  4QW8 A;  2B21 A;  8ICF A;  4FS1 A;  5KFY A;  3RBD A;  2BDU A;  2KKP A;  4QZF A;  2ZIU B;  2BGW A;  4NL9 A;  3IG5 A;  4DL7 A;  1LKY A;  2H3Z A;  5AI4 A;  4C7Y A;  1ZQY A;  2KV2 A;  2BCR A;  2W9A A;  3ISC A;  3AL0 B;  5KFP A;  5J29 A;  2KIV A;  1X6J A;  1QCK A;  4CF4 A;  2GLE A;  2ESE A;  9ICG A;  4YD1 A;  4UB2 A;  2K4H A;  1BPD A;  4XUS A;  4M9G A;  2DQN B;  1PK3 A;  3N4M B;  1TK5 A;  2VA3 A;  2W9M A;  1TE2 A;  5AM1 A;  5ALV A;  7ICV A;  2NRZ A;  5KT5 A;  4DQQ A;  5AK6 A;  3ZD8 A;  1P7D A;  4KLF A;  3GIK A;  1A0P A;  2HHU A;  3C2M A;  1T3Q A;  1RYR A;  4QZD A;  2HVI A;  1LKY B;  1LVH A;  5AM4 A;  4J9R A;  4P4O A;  1V38 A;  4ED6 A;  2V4R A;  1IG6 A;  2EZX A;  4QZA A;  1U9L A;  2JZB A;  2ZTE A;  4DFD A;  4MF8 A;  4F92 B;  2BKE A;  4K4H A;  4KN4 A;  4PHA A;  4QWA A;  5EE1 A;  2E1E A;  4KX5 A;  4J03 A;  4YCX A;  5DGB A;  4RQ4 A;  3G6X A;  1SXD A;  3QUC A;  2BZF A;  5J0S A;  3KFU F;  2ZIV B;  4RPX A;  3KBB A;  2K4P A;  1ZRN A;  4F4W A;  9ICF A;  1S8O A;  5D49 A;  3K1R B;  3TAN A;  1COK A;  7ICI A;  3PML A;  1BVS A;  2OHF A;  1TK0 A;  4I2J A;  4F2S A;  1X2I A;  2W43 A;  2NO4 A;  5EWF A;  5IIN A;  4C0Z A;  2XIC A;  1YZ7 A;  2YX8 A;  3RH6 A;  3OJU A;  3Q8K A;  2OCE A;  3TFR A;  2HHT A;  4BWM A;  3AN1 A;  4JV0 A;  2KZZ A;  4Q8E A;  8ICE A;  4JMU A;  3F53 A;  5AI6 A;  1IIP A;  4P4P A;  2K8C B;  5KG5 A;  4PJ0 U;  2PMZ F;  4F4K A;  2LBO A;  3ISD A;  5KL8 B;  5DDM A;  2DPI A;  3AU6 A;  8ICV A;  5ALW A;  4YR3 A;  5ALF A;  3RAQ A;  3UXN A;  2AGP A;  5ALX A;  1K5O A;  1DK2 A;  3H0R B;  3HKZ F;  4UB1 A;  4DOA A;  4DSJ A;  4EX7 A;  1UT5 A;  2RDI A;  1DGS A;  3KOO A;  1KDH A;  1C20 A;  2KHQ A;  1RYS A;  7ICO A;  5III A;  3BS7 A;  3RF9 A;  4IRD A;  2KIC A;  4ED3 A;  2WAQ F;  3IP4 B;  5J8Y A;  5AM5 A;  3SEI A;  1L7P A;  3QEA Z;  1DGJ A;  4I2C A;  4US9 A;  4KMO B;  2K8A A;  1S0O A;  5DBA A;  3H0M B;  5IIJ A;  5J2E A;  1NK8 A;  3D6J A;  5ALM A;  2PXI A;  2D6F C;  5ALJ A;  3MGH A;  1CUK A;  3M9M B;  2Y9U A;  4Y2V A;  3WKC A;  3BZC A;  4DF4 A;  8ICX A;  4RQ0 A;  3MDC A;  2R18 A;  3Q8Q B;  3R9K A;  5AKE A;  5KG3 A;  5J2K A;  4J9L A;  1RXW A;  2IOF A;  4KN7 A;  4EYH B;  9ICE A;  1KTQ A;  5DG7 A;  3TQ1 A;  2E8P A;  1KSP A;  1TK8 A;  4YXM A;  3KKA A;  2FMS A;  1J97 A;  4GXK A;  1KEJ A;  3V72 A;  3KZI U;  4Y2P A;  4NLC A;  1ZQO A;  1CI4 A;  2ZXI A;  2BDP A;  1UA1 A;  1MQ2 A;  1B0X A;  3NTU A;  1OW5 A;  4XQ8 A;  4LJX A;  2FLN A;  5ALL A;  4EZ9 A;  3T5J A;  9ICR A;  5J2F A;  2NRV A;  7ICT A;  1ZQV A;  4PGQ A;  3TAQ A;  4DL5 A;  2G08 A;  3EUB 2;  4KLU A;  7ICG A;  4CF3 A;  4QZ8 A;  2E1F A;  2LM1 A;  3NVY A;  1Q3V A;  7ICF A;  1D8B A;  4NJ8 A;  2HBM A;  1KL9 A;  2K60 A;  3RR8 A;  5KAF U;  4OD0 A;  1UT8 A;  3TAD A;  4QZI A;  8ICA A;  4M2Y A;  1ZQN A;  3AMZ A;  2BCS A;  2KE7 A;  2A19 A;  3IM1 A;  3PO4 A;  3ORY A;  5DG8 A;  1PVQ A;  4MFC A;  4FBT A;  1HIW A;  5AKL A;  8ICG A;  5J2H A;  3BZK A;  1NZP A; 
#chains in the Genus database with same CATH homology
 2QAR A;  1WWU A;  2B6G A;  1SV0 A;  3BS5 A;  1SXD A;  2E8N A;  4PZO A;  2Y9U A;  2E8M A;  2KSO A;  1SGG A;  3BQ7 A;  2KMD A;  2D3D A;  1B4F A;  2Y9T A;  1DXS A;  2K4P A;  2KG5 A;  2LPE A;  1PK1 B;  3K1R B;  1RG6 A;  1COK A;  1KW4 A;  2E8P A;  4NL9 A;  1X9X A;  2D8C A;  1LKY A;  5JRT A;  3KKA A;  2QAR B;  1UQV A;  2DL0 A;  4IS7 A;  2DKZ A;  3H8M A;  1JI7 A;  2KIV A;  2QB1 A;  4RQN A;  2GLE A;  2EAO A;  2ESE A;  1Z1V A;  1X66 A;  2EAN A;  4MHV A;  1B0X A;  2LMR A;  2FE9 A;  2QB0 A;  1OW5 A;  2L5Y A;  2YTU A;  1PK3 A;  1SV4 A;  1SXE A;  3IDW A;  2F8K A;  4RQM A;  5F3X B;  2EAP A;  5KNI A;  2F44 A;  3SEN A;  2EAM A;  1PK1 A;  1F0M A;  1X40 A;  4NL9 C;  5J8Y C;  5JTI A;  4NJ8 A;  2E8O A;  1LKY B;  2K60 A;  2F3N A;  1WWV A;  1V38 A;  2QB0 B;  3BS7 A;  3KKA C;  1UCV A;  1V85 A;  3TAD A;  2QKQ A;  5JU5 A;  1OXJ A;  5J8Y A;  3SEI A;  2JV3 A;  2KE7 A;  5L1M A;  1SV0 C;  3TAD C;  2ES6 A;  4PZN A;  2KSO B;  2DKX A;  3TAC B;  3BS5 B;  3HIL A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...