1SV0C

Crystal structure of yan-sam/mae-sam complex
Total Genus 27
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
27
sequence length
82
structure length
82
Chain Sequence
PLGSDGLPLDPRDWTRADVWKWLINMAVSEGLEVTAELPQKFPMNGKALCLMSLDMYLCRVPVGGKMLYRDFRVRLARAMSR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Transcription
molecule keywords Ets DNA-binding protein pokkuri
publication title Derepression by depolymerization; structural insights into the regulation of yan by mae.
pubmed doi rcsb
source organism Drosophila melanogaster
total genus 27
structure length 82
sequence length 82
chains with identical sequence D
ec nomenclature
pdb deposition date 2004-03-26
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.50 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 Transcription Factor, Ets-1 1sv0C00
2ESEA 5JTIA 1WWVA 2EANA 2KE7A 5J8YC 2D8CA 5J8YA 2JV3A 2QB0B 2E8MA 2KSOB 2Y9TA 1COKA 4PZOA 2LPEA 3KKAA 2E8NA 4RQMA 3TADC 1V85A 2DL0A 2F3NA 2QKQA 2E8PA 3HILA 1PK1A 2Y9UA 2EAPA 2DKZA 1F0MA 2KIVA 5JU5A 1Z1VA 3BS5B 4IS7A 1SXEA 2D3DA 2E8OA 1OXJA 4NL9A 3K1RB 4RQNA 1RG6A 1SV0A 5JRTA 2FE9A 3H8MA 3BS7A 1V38A 2EAMA 1LKYB 1B0XA 4NL9C 2EAOA 1X66A 3IDWA 1OW5A 2DKXA 1JI7A 2F8KA 3KKAC 1X9XA 1DXSA 2QB0A 2ES6A 2KSOA 2L5YA 1PK1B 2KMDA 1SXDA 3BQ7A 4MHVA 4NJ8A 2K60A 3SENA 1UQVA 2QB1A 2QARA 1B4FA 3TACB 1WWUA 2B6GA 5KNIA 1SV0C 1KW4A 2K4PA 1SGGA 4PZNA 3TADA 1X40A 1LKYA 1UCVA 2GLEA 5F3XB 2F44A 1PK3A 2YTUA 2QARB 1SV4A 2KG5A 5L1MA 3SEIA 2LMRA 3BS5A
chains in the Genus database with same CATH superfamily
3ALRA 3H7IA 3ISCA 3SZ2A 1KSPA 5AK6A 2Z7JA 1BPYA 1ZRMA 1KN5A 2KZZA 2G06A 1IXRA 4F93B 3HW8A 1ZQZA 1Z00A 3KFUF 8ICYA 2H3FA 2R8IA 3RH5A 3D2NA 3QYPA 2DPJA 2YMLA 1ZD5A 2PFQA 2EAPA 3WK8A 3HKZC 4EEYA 4UB1A 1ZQYA 1ZQWA 8ICLA 4AYBC 3WK4A 4JV1A 1NOMA 3BS5B 2BCRA 7ICPA 1UT5A 4BGDA 3KTQA 3IG5A 1ZD2P 1YZ6A 1CI4A 2K4IA 2XI9A 4DS4A 3QU2A 2C2DA 2EAOA 2DQNB 1S8OA 8ICSA 1COOA 2K4EA 1VDVA 2DKXA 5T14A 2KKVA 3KKAC 1NK4A 2XY5A 3D2QA 4NM2A 4ED6A 5AKGA 1JROA 3TFSA 1ZQRA 2E3TA 3ZD8A 2Y1IA 2VA3A 2Q0ZX 2WF5A 2W9CA 5L1LA 5G5GA 4TUPA 2FMSA 3H8WA 2RLTA 1YT3A 1WWUA 1P7DA 2W03A 2KV2A 4FS1A 7ICVA 1SV0C 1U49A 2KVSA 1H38A 4NXZA 1BNPA 4KN4A 3TARA 5DLGA 4UAWA 2JEFA 5D46A 9ICIA 3EW9A 1Z1BA 1KQQA 5L1MA 1KKXA 3NTUA 3G6VA 5HR7A 4JWMA 1U9LA 3JPRA 4BWJA 4E0DA 4C4SA 4BXOB 3J81j 3KHRA 3B0YA 4I2AA 2NRXA 9ICMA 5J8YC 2D8CA 2XIDA 8ICIA 1XNSA 2J6TA 4XQ8A 1BPZA 1NNLA 2KJ8A 4OCZA 4ECSA 1ZD3A 5ALIA 2FMQA 1J97A 2UVUA 5ALXA 1N63A 4F91B 4RUCA 9ICUA 4UW9A 5TISU 5KFYA 4O5KA 3PX6A 5DKWA 4Y2PA 1Q8KA 1L7OA 1RG6A 4M9NA 2PMZF 1ZRNA 4J9RA 4BX9C 2HMXA 4IC9A 4U6PA 9ICGA 1RXWA 7ICNA 3F5EA 3MR5A 3T5LA 2UVWA 4TQSA 3ZDAA 7ICKA 4U7CA 5ALKA 3WK7A 5CHGA 1TV9A 1PVPA 5J29A 2W04A 4ZH4A 1S76D 4JB3A 8ICEA 3RTVA 4DQPA 4YN4A 3WKAA 5KG3A 4Y2UA 5J2HA 2JEJA 3TI0A 2BPFA 1ECWA 1ZQDA 4OJ6A 9ICNA 3TQ1A 4O3NA 2YTUA 3I28A 2HBJA 1HIWA 3NVYA 5AM2A 3MDAA 4YCXA 3GILA 4ELTA 2KJ5A 4RQ8A 1ZQLA 4F4WA 3BS5A 4R8UB 2BKEA 4Q43A 1SKRA 4QZ8A 4O5EA 4J9OA 4OD0A 3SD7A 8ICKA 5JUMA 2JV3A 1VLBA 3GIMA 2ZJ5A 4QIWF 3H4DA 4F71A 4Z6FA 2F1IA 4RQMA 4TQRA 2F3NA 1M6YA 4M9JA 1LB2B 5JU5A 4NWIA 2RP5A 2HOIA 4J9LA 2P66A 2HOFA 4RNMA 1L8LA 4O9MA 3PW4A 2BCQA 3AL0B 4KITB 5KG0A 3BS7A 2BHNA 5E79U 7ICIA 2WAQC 3G6YA 2HSZA 3WKDA 3CYMA 4ECXA 5J0WA 4ED2A 2WF8A 1V9PA 3RH6A 4QZGA 4DSIA 1Q3VA 3RAXA 2QB1A 3GIJA 5J0TA 1ZQOA 1NZBA 3AM9A 5ALDA 5H2FU 1L7PA 5KTQA 3C2KA 4I2DA 4P4OA 2XGPA 4K4HA 5KL1B 1S0NA 2M9NA 2IHMA 4M9GA 2GH1A 5J0OA 2ZIUB 3ONNA 5DB8A 4F4ZA 4PHPA 3SAHA 2EZYA 4YXMA 8ICJA 3SR6A 4F5RA 1UCVA 4UAVA 4CDGA 1ZQQA 4FBUA 3M9MB 4ELVA 5ALVA 1K1SA 4KLOA 4FZLA 1OUQA 5KFXA 2ZTEA 4B9SA 4QZBA 4ED8A 5KAFU 3BDPA 3MFIA 2KN7A 3F5AA 1IM4A 1XS9D 7ICUA 2NRTA 5BOMA 5AHXA 3C1YA 8ICVA 4KLDA 4PZOA 3OGUA 1V85A 5HP4A 3HILA 2KHQA 4Q8EA 1L7NA 5KG4A 2OXOA 2WF9A 4OO1J 1S97A 5FP0A 4CF5A 3N4MB 1KRPA 2AH5A 3F53A 2D3DA 3UXNA 2BQRA 5KFUA 1ZQUA 5AM3A 3H40A 4C7ZA 2ZJ8A 3PSTA 2WF7A 1HJPA 5KFKA 2NRWA 3PSIA 4NL9C 3SQIA 4AP9A 1B43A 4Z6CA 4YP3A 3ICXA 2JEGA 2F1HA 2BQUA 4MF8A 1X9XA 4UAZA 1ZD4A 4X5VA 1U48A 1KFTA 3JPOA 3C28A 4CGZA 1C7YA 4I2GA 3ORYA 1BPBA 5J0PA 1N5XA 3N7SC 4YD2A 2VJ5A 4YR3A 3RJHA 4R8UA 3M9NB 3UXPA 7ICTA 1MC8A 4DL5A 5DG9A 2YY6A 1SGGA 3MR3A 5AI9A 1FO4A 3QX7A 4Y2YA 5ALFA 2WHEA 1MSWD 4DF4A 2BGWA 2W8LA 5F3XB 2WF6A 3C5GA 4PGQA 2KG5A 3HRDD 2V4QA 4KLLA 4UB3A 5J8YA 3GV5B 3JPQA 2EANA 5HNKA 2KJ9A 4RQ2A 4LZGA 1COKA 2DGZA 4DL3A 2KZ3A 2IHNA 3GIIA 4DF8A 4NLNA 5DQIA 7ICFA 1ZQNA 3UM9A 3QU4A 1FFUA 4PHEA 2XICA 4RNNA 4YFKA 3N7RC 4IS7A 1SXEA 1JUDA 2HVHA 4BWMA 1HEKA 2I5HA 4R65A 4DFPA 2RDJA 1WYGA 3MFHA 3RB3A 4UAYA 1XC9A 1X42A 2KKPA 2ZIUA 3HT3A 2UVRA 2FPKA 2ES6A 2L5YA 2KMDA 4NLBA 2PFOA 3RJKA 3L3FX 2ZXIA 3NGDA 1NJWA 1ZOLA 1XSNA 4C8NA 4B9VA 5AKZA 5HHIA 4P4MA 3UMGA 2KNJA 2FMPA 1NZPA 4EX6A 5DQHA 1NJYA 2EH9A 9ICOA 5DDMA 4IRCA 1Z4OA 3LVVA 1BPXA 2PFNA 1ZJNA 4KLQA 3K1ZA 2C28A 1QH9A 3QZ8A 3QU7A 3PW0A 1NK8A 1KTQA 5AIAA 5AK3A 5DLFA 4OJLA 3NVVA 7ICJA 1PK3A 3RB0A 4KLEA 2KICA 1ZXIA 3PMLA 3WK9A 4BUGA 4EBDA 2LMRA 3RBEA 2ESEA 5KG5A 4PJ0U 1NKEA 5J2AA 3HP6A 2CPRA 4KLTA 5J0QA 8ICPA 2PFPA 4DSFA 3Q8KA 2NYVA 4QZDA 5KFLA 4NY8A 3GIKA 2PI4A 3BQ2A 3G6XA 4B6JA 2HBKA 3UQ2A 3F2CA 5AKKA 2W7OA 2UVVA 1L3VA 5KT6A 3KHHA 4DCCA 2AQ0A 3ETLA 2FLNA 3CNHA 3K1RB 3WU2U 1NKBA 2C22A 1ZJMA 2YB1A 4OJ5A 3PY8A 1O08A 2VIXA 1QCKA 3AN1A 5AKEA 1T7PA 3HKZF 2K89A 3IDWA 2Q4TA 4AYBF 3N97B 2QB0A 3THVA 5CJ7A 9ICFA 4QW8A 3MGIA 2W9MA 3QUQA 2RRDA 1A6SA 4DLEA 4F8RA 3T5KA 2FI1A 4I27A 3PW2A 4EEKA 4NLZA 1QLNA 2ZIVA 4I2EA 1BPDA 4DQQA 1IG6A 4NM1A 1J2MA 3O0FA 1TK0A 2A3VA 4DL7A 3K4GA 4O3QA 4B9UA 4QW9A 1NK5A 4M9LA 4C4RA 4EX7A 4P0PA 3M7DA 2EDUA 5DB9A 1T3QA 7ICLA 1KFDA 2MA1A 1ZYQA 1QSYA 3NVZA 5ALUA 2OH2A 5JTIA 2D6FC 2KE7A 2KHVA 3KD3A 8ICRA 1LV5A 3AU6A 3KZIU 2PXIA 5KAIU 1ZQEA 5KFZA 4UBBA 1KEJA 3RF9A 5HR6A 2C2RA 3ZI4A 5CB1A 2N1RA 3OJUA 3BJYA 3KOOA 2KD1A 2KK0A 5KFPA 4DFJA 2CXYA 1JXEA 1NI3A 2E8OA 4RNOA 4UB2A 3V6KA 4NL9A 2K8BB 4F5NA 3SAFA 4RQ3A 2HI0A 3RJEA 4DQRA 5IIKA 1MQ2A 4KLFA 5KFOA 1JRPA 5KG2A 2BPCA 2R8JA 4NLKA 4QWEA 3RR7A 2BCUA 4MFCA 3M6ZA 3T5HA 1JXLA 1N56A 1KFSA 2YMMA 1SL2A 4KMUA 4P4PA 1FIQA 5AM1A 1MQ3A 3ISDA 4QZEA 4TURA 5DG8A 2FPMA 4R64A 3MR6A 3TAQA 5ALHA 4CF3A 4ECQA 2GO7A 1T94A 7ICGA 3H0LB 3MR2A 8ICUA 3C5FA 4LVSA 3WKEA 4DSKA 4J9MA 1PVRA 3RJIA 3SV4A 4PZNA 4B9NA 1X6JA 3NS1A 1DOQA 9ICSA 4I28A 3HJEA 1A77A 1L8OA 4YVZA 2E1EA 2BDPA 4RQ4A 3R9KA 2MU2A 1CEZA 2LM1A 4ACOA 2B0CA 1ZETA 1WWVA 2ZIWB 4DFDA 2E8MA 2AXTU 1PZNA 4FBTA 4EZ6A 4I2IA 5BOLA 3TFRA 5J2EA 2BZFA 2Y9UA 2JH1A 4ECYA 1N62A 3PW7A 2G08A 1Z1VA 1RDFA 4HYKA 1RYRA 2WB1C 2DPIA 3NASA 3VCBA 8ICTA 2ZUCA 4RT2A 5KT5A 4RU9A 2GOLA 1KBUA 7ICMA 3N7PD 4I2FA 3UPQA 1NJZA 3QU5A 1ZQIA 1ED1A 1X9SA 1HUOA 1ZQHA 4KN7A 5KG6A 4QWAA 2YX8A 4QWBA 5J2DA 3EPGA 3QEAZ 3IN5A 1JI7A 3UXOA 2ASDA 4Q8FA 2F8KA 7ICEA 2K8AA 1NKCA 4M9HA 1ZQTA 1NK7A 2F77X 9ICVA 9ICBA 1UQVA 3LDAA 2MUTA 2J6SA 1TAQA 4QIWC 5IIOA 4JK1A 5AICA 5ALPA 4J9SA 2HHTA 2WAQF 3BQ1A 4RZRA 2F2AB 2NV3A 2H3QA 4G9BA 5AI4A 3C2LA 4MFFA 4LZDA 5DDYA 8ICBA 2F1JA 2HDOA 5J0UA 1LKYA 4YG2A 4WJ3B 2XCAA 4YD1A 3FDSA 4NLCA 2BR0A 3LWLA 5G5HA 3JPNA 5EWFA 1RYUA 4USAA 1RM6C 1L5UA 8ICFA 4YXJA 5BPCA 5CRXA 1SIJA 3DEEA 4DOAA 1JN3A 4DFKA 4DL2A 1IIPA 2FLLA 2G07A 4PGYA 3IHQB 1K5OA 3U26A 4O3RA 4RQ7A 1A0PA 4KLIA 5AK4A 5B5EU 2ZIXB 2E8PA 1DGSA 3Q8MA 1F0MA 2HHSA 5KG1A 4Y2VA 9ICEA 7ICRA 4F4XA 3Q8RB 4M47A 5AK5A 2W11A 4KLJA 1BNOA 2IOFA 3Q8QB 2FE9A 5EE9A 9ICAA 4IQUA 1V38A 5KFVA 4PGXA 1XSLA 2IA6A 4DQSA 2JH7A 2M0NA 5AKLA 2HBMA 9ICTA 4UB4A 2XY6A 5ALMA 5KFSA 2OYYA 5C0YA 1UA1A 2KTQA 5ALNA 4RQ6A 2R8HA 1L3TA 2VA8A 2BCVA 1KLNA 2H3ZA 5KFCA 3GV8B 3QE9Y 1B4FA 2LYHA 3TACB 4OJPA 4QZHA 4CE6A 3JPSA 4US9A 3RH4A 3GZFA 5J2KA 4UQGA 3V7JA 4I2JA 1NJXA 2ZIWA 2EZZA 2VANA 5ALZA 4FFDA 3Q8PB 1WCLA 2DFLA 5AI8A 5CP2A 3KZXA 2HW3A 5ALWA 4I29A 3MGHA 5A0LA 5AIBA 2I6XA 3ZD9A 4GLXA 4PL2A 5J2FA 2I1QA 5KT4A 1SV4A 1L3SA 3NUQA 1QSLA 4HAIA 3OHAA 4B9TA 4Z6DA 4I2HA 3M6KA 5CA7A 2W7PA 4Y2SA 1HUZA 4TUQA 5GTIU 2A19A 2QB0B 3ZDEA 4DSLA 2AGQA 1XWLA 3N28A 3RRGA 5KFQA 3WK5A 3RB6A 3ISBA 8ICNA 3RRHA 3TANA 4F3OA 2KIVA 4Y2QA 4JMUA 2GWSA 3AQEA 3FYHA 1UPHA 2ZIVB 4DEZA 4KX5A 4DLGA 1Y88A 1OXJA 4LJXA 5HMLA 1S0VA 3H0RB 3C23A 1XSPA 5EE0A 2DF4B 2R8KA 2W9BA 1TK5A 3HWTA 4P0PB 4ECUA 1QSSA 3MABA 5J2CA 4R66A 4O5CA 4Y2XA 1DXSA 2IOFK 2KSOA 2MRLA 1B22A 1SKSA 5ALYA 3C2MA 1RPLA 5D4BA 1SB3C 4UARA 9ICPA 2HCFA 2PKEA 5EOZA 3SAGA 9ICCA 3VC8A 1Q3UA 2BPGA 4DL4A 3M8RA 1WG8A 4C8KA 3A0HU 4GXIA 2XGQA 5AI0A 3HX0A 1X6IA 2A1AA 4M6WA 3MBYA 5KT3A 3ED5A 2JHDA 1ZQKA 3IG8A 2HOQA 5KFNA 1BPEA 4BJQA 3UQ0A 3RJGA 4DOBA 3PZPA 4C0ZA 3E0FA 4C7YA 1VJ5A 4GC6A 5GTHU 5KFTA 2ZIXA 2P6RA 5AKJA 2OWOA 2AU0A 4O3SA 2RQ5A 4M2YA 2P6UA 2VKQA 2Y0SC 1X9MA 8ICZA 9ICHA 3UMCA 3EUB2 5IIMA 2ZUBA 2LHTA 3EWAA 4GXJA 1AROP 1S77D 1SWWA 2LPEA 1CUKA 2XVTA 3GQCA 2OEHA 1SZPA 3ZDDA 4OJOA 8ICMA 4RQ1A 2LKYA 4BDPA 4DSJA 1EXNA 2DKZA 3WK6A 1U4BA 5DBAA 3H4BA 5ALSA 3NRZA 1UHUA 2OCEA 3GDXA 4F5OA 4ECZA 4CCHA 1ZQBA 1XU4A 7ICOA 4RQ0A 3KBBA 5L1JA 9ICQA 5ALEA 4O3PA 4ED7A 1PUZA 4EZ9A 1X66A 4DSEA 2AGOA 5KFIA 2XCPA 4RPYA 3AMZA 3PW5A 1WUDA 5KFRA 3JPTA 2ISPA 2YN4A 1SZHA 3T3FA 4O0IA 2W43A 5ALGA 5C5JA 1FEZA 1QQ5A 5KG7A 2W3SA 4I2BA 3M8SA 2YB4A 2ISOA 4UASA 3TADA 1X40A 2GLEA 4P2HA 4EYIB 5EWEA 2F44A 4IR9A 5KFEA 4C8MA 4DOCA 3OHBA 1ZQXA 3L4PA 3PSPA 2QARB 1RQNA 1ZQVA 3GFKB 2ZTDA 1WCNA 1S0OA 2LM4A 3SEIA 2VJ4A 1DRGA 4Z6EA 5KFBA 4Y2TA 4F50A 8ICWA 4XUSA 3AEVA 3AQFA 8ICGA 2G5HB 4RPXA 4YR0A 1C20A 5ALRA 3PV8A 3IM1A 3AU2A 3IP4B 3ETRA 2DL0A 2MUTB 3FAHA 4JV2A 2W55A 2IBKA 9ICKA 4EBEA 3PR4A 4US8A 3RFAA 3MDCA 3PVXA 2HHWA 4ZOHC 2KVCA 1JMSA 5KFFA 9ICRA 2BDUA 1Z4NA 1JALA 3TKAA 2XC9A 1J2NA 2CRXA 1LKYB 1B0XA 2YMQA 2HHUA 5L1IA 4ECVA 1V97A 5F9LA 5AI6A 5L9XA 3M9OB 8ICHA 5ALJA 1N2XA 5D49A 2JR5A 2DBYA 1SWVA 5IILA 4NJ8A 2H5XA 3EPIA 2K60A 4EELA 3F2DA 1UA0A 5CR0A 5HMMA 3C29A 2FJ6A 4Q45A 3DV9A 5ALLA 1ZQCA 4P0QA 4K4GA 2ASLA 3H8JA 2ODGA 4NLGA 4UB6U 4KLMA 1O03A 5TZVA 1TK8A 4J9QA 5DQGA 1N5WA 1A76A 1DGJA 5IIIA 4FZMA 4C8OA 1XO1A 2V4RA 2JEIA 1TFRA 2E1FA 1CRXA 2KIWA 2A1JA 2WTFA 5KL8B 3RJJA 1QQ7A 8ICQA 2ZJAA 1F5SA 3HPOA 3IRUA 1U47A 4MEXA 1BVSA 2KEYA 3PO5A 2NRZA 1BGXT 4PPXA 5F9NA 2VA2A 2Y9TA 4MF2A 3ZDCA 2E8NA 2PMZC 2AGPA 4Q44A 4YQWA 3V72A 1T4GA 4ECTA 1D9DA 3WKBA 2YQEA 2IOHA 5J2JA 2RHFA 4ICAA 4QZ9A 1D8BA 5KFDA 2KFNA 3C21A 4PL1A 5EWGA 1SKWA 1SL0A 4B9MA 4KLUA 4G3IA 5DB6A 9ICLA 3OSNA 1QTMA 2AHOB 3OTQA 2J6UA 3RBDA 2NO5A 2P35A 4YMNA 1ZQSA 2KZMA 1L7MA 2G5IB 3BQ0A 1OW5A 1K1QA 3B0XA 3QUTA 4CF4A 4JV0A 5KFWA 2WB1F 4C4TA 3RB4A 3BQ7A 4QZAA 4MHVA 4IQVA 3AUOA 3MGVA 2W3RA 2QARA 4IRDA 4F5PA 5AI5A 1MA7A 3TAPA 3PO4A 1L6NA 2DWQA 2I9GA 4F4KA 1S0MA 1S5LU 3E2EA 4QNLA 3H0MB 2HHQA 2B21A 3NRWA 2MAXA 2LYAA 2XY7A 3PMNA 2PI5A 4KTQA 5DG7A 3NVWA 3L5KA 4ECRA 4UAUA 1Z19A 1N61A 1YZ7A 1D8LA 3BZCA 2W9AA 3KHLA 3OJSA 5ALOA 1KDHA 4UB8U 3EZ5A 3QUCA 3DDHA 2KP7A 2HVIA 5L1KA 4F72A 4DO9A 1T3NA 3PNCA 4ED3A 2W9BB 2RDIA 3V6JA 1GO3F 2K4HA 3IV6A 5HHHA 2KSOB 3E58A 3A0BU 5AKHA 3QUBA 2LBOA 1NK0A 4FZNA 1Z3EB 2AQ4A 3TADC 2QKQA 4IL6U 1LVHA 2BQ3A 4RPZA 4C8LA 4UB5A 5AM4A 4EBCA 4I2CA 4IQTA 3MC1A 4YMMA 4M6WB 1ZQJA 5AM0A 4QZFA 8ICAA 1N48A 3SI8A 4RQNA 1RYSA 3B9JA 3SYZA 4O3OA 4KMOB 1JX4A 1QQ6A 3GU3A 1T8EA 4BXOA 2KFZA 1RQLA 1U45A 1S9FA 2ZXHA 1PK1B 3QZ7A 3JPPA 3SV3A 3V6HA 2JZBB 2YMPA 2ASJA 4GFJA 1TAUA 1ZQ1C 3LVWA 3RJFA 2HBLA 4F4YA 3WKCA 5AKYA 1TE2A 5KFAA 4ELUA 5DGBA 4MFAA 4EENA 2NRVA 1RXVA 3BZKA 4Y2RA 5IIJA 5EE3A 4J9KA 1IV8A 4F2SA 4UATA 4B9LA 4QZIA 2FLPA 2BCSA 4M04A 2IMWP 4K4IA 3RR8A 4ED0A 5KFJA 4F5QA 2HHVA 3OSPA 2MSNA 5DB7A 4ECWA 2DUYA 2HHXA 4J9PA 2ZUDA 5AKXA 5J0SA 4RT3A 1FFVA 3KKAA 4MEYA 3LK9A 4GC7A 3UMBA 2R18A 5CWRA 2FPLA 2K8CB 3RAQA 7ICSA 1URJA 4PHDA 2ZTCA 4C80A 9ICXA 4IRKA 1UT8A 1D9FA 3SMVA 4FS2A 1SV0A 5JRTA 3Q8LA 1Z00B 1AQ6A 2EAMA 3OPXA 4KX3A 4RQ5A 1SL1A 5IINA 4DWIA 4QWCA 4Y2JA 3QXGA 2JGAA 2ZG6A 2NO4A 2ALZA 2W8KA 1SXDA 1JIHA 4A8EA 3PX0A 3SENA 2EQYA 2CN1A 4FE3A 4J03A 4XA5A 4CRXA 1X9WA 5CEHA 1S10A 3I76A 3V7LA 5J2BA 2JXJA 5KFGA 4PH5A 5K4LA 4CNQA 4QWDA 5DBBA 3KHGA 5KNIA 5B66U 1KW4A 2OM6A 9ICWA 2K4PA 2H3IA 4R63A 4RUAA 5J2IA 5KT2A 2AJQA 1TVAA 1X2IA 1ZQAA 2KOBA 5KFMA 3T79A 3EYZA 4TUSA 4M0AA 2WFAA 2W54A 5J0RA 3S6JA 2JRZA 3GV7B 2ATLA 2C2EA 1D8YA 4IR1A 2W9CB 4GXKA 1ZQGA 3PR5B 3CW2C 2JMGA 4NV0A 4IQWA 2XO7A 7ICQA 4XRHA 5KT7A 3Q8SB 3D2SA 3CRXA 2QLTA 1ZQMA 4QZCA 1ZQFA 1KL9A 1TKDA 3V7KA 4J9NA 5AM5A 4KLSA 4DL6A 2O6KA 3C1ZA 3D6JA 3BQTA 4DQIA 5ALTA 1PK1A 2Y0SF 3I1YA 1MN8A 2JZBA 3QU9A 3K75D 3QNMA 4P0QB 2EZXA 5EE1A 4EYHB 3FM9A 2R8GA 1TAMA 1XO0A 2LI6A 3H8SA 2G09A 1F44A 1DK2A 8ICOA 5DGAA 3F2BA 3LYSA 4F92B 3LWMA 3H8MA 8ICXA 4JUZA 1Q46A 1PVQA 2V9WA 2A1JB 3CP8A 3PSFA 3QEBZ 1RZTA 4O3MA 3PX4A 2LYBA 4DS5A 5DBCA 7ICHA 3FC4A 9ICJA 1N60A 4KLHA 2Y1JA 5J2GA 5ALQA 4PHAA 5KFHA 4YMOA 4QJFB 2B6GA 5AKIA 1DK3A 3T5JA 1ZQPA 5J0YA 4JWNA 8ICCA 2E5SA 1L3UA 4GIBA 3M1YA 4F2RA 2G0AA 5J0XA 2H3VA 2F76X 1NK9A 4ED1A 4UBCA 2FDRA 2F8LA 2OHFA 4FO6A 1NK6A 4KLGA 3ZDBA 4YR2A 4DFMA
chains in the Genus database with same CATH topology
2ESEA 5JTIA 1WWVA 2EANA 2KE7A 5J8YC 2D8CA 5J8YA 2JV3A 2QB0B 2E8MA 2KSOB 2Y9TA 1COKA 4PZOA 2LPEA 3KKAA 2E8NA 4RQMA 3TADC 1V85A 2DL0A 2F3NA 2QKQA 2E8PA 3HILA 1PK1A 2Y9UA 2EAPA 2DKZA 1F0MA 2KIVA 5JU5A 1Z1VA 3BS5B 4IS7A 1SXEA 2D3DA 2E8OA 1OXJA 4NL9A 3K1RB 4RQNA 1RG6A 1SV0A 5JRTA 2FE9A 3H8MA 3BS7A 1V38A 2EAMA 1LKYB 1B0XA 4NL9C 2EAOA 1X66A 3IDWA 1OW5A 2DKXA 1JI7A 2F8KA 3KKAC 1X9XA 1DXSA 2QB0A 2ES6A 2KSOA 2L5YA 1PK1B 2KMDA 1SXDA 3BQ7A 4MHVA 4NJ8A 2K60A 3SENA 1UQVA 2QB1A 2QARA 1B4FA 3TACB 1WWUA 2B6GA 5KNIA 1SV0C 1KW4A 2K4PA 1SGGA 4PZNA 3TADA 1X40A 1LKYA 1UCVA 2GLEA 5F3XB 2F44A 1PK3A 2YTUA 2QARB 1SV4A 2KG5A 5L1MA 3SEIA 2LMRA 3BS5A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2ESE A;  5JTI A;  1WWV A;  2EAN A;  2KE7 A;  5J8Y C;  2D8C A;  5J8Y A;  2JV3 A;  2QB0 B;  2E8M A;  2KSO B;  2Y9T A;  1COK A;  4PZO A;  2LPE A;  3KKA A;  2E8N A;  4RQM A;  3TAD C;  1V85 A;  2DL0 A;  2F3N A;  2QKQ A;  2E8P A;  3HIL A;  1PK1 A;  2Y9U A;  2EAP A;  2DKZ A;  1F0M A;  2KIV A;  5JU5 A;  1Z1V A;  3BS5 B;  4IS7 A;  1SXE A;  2D3D A;  2E8O A;  1OXJ A;  4NL9 A;  3K1R B;  4RQN A;  1RG6 A;  1SV0 A;  5JRT A;  2FE9 A;  3H8M A;  3BS7 A;  1V38 A;  2EAM A;  1LKY B;  1B0X A;  4NL9 C;  2EAO A;  1X66 A;  3IDW A;  1OW5 A;  2DKX A;  1JI7 A;  2F8K A;  3KKA C;  1X9X A;  1DXS A;  2QB0 A;  2ES6 A;  2KSO A;  2L5Y A;  1PK1 B;  2KMD A;  1SXD A;  3BQ7 A;  4MHV A;  4NJ8 A;  2K60 A;  3SEN A;  1UQV A;  2QB1 A;  2QAR A;  1B4F A;  3TAC B;  1WWU A;  2B6G A;  5KNI A;  1SV0 C;  1KW4 A;  2K4P A;  1SGG A;  4PZN A;  3TAD A;  1X40 A;  1LKY A;  1UCV A;  2GLE A;  5F3X B;  2F44 A;  1PK3 A;  2YTU A;  2QAR B;  1SV4 A;  2KG5 A;  5L1M A;  3SEI A;  2LMR A;  3BS5 A; 
#chains in the Genus database with same CATH topology
 3ALR A;  3H7I A;  3ISC A;  3SZ2 A;  1KSP A;  5AK6 A;  2Z7J A;  1BPY A;  1ZRM A;  1KN5 A;  2KZZ A;  2G06 A;  1IXR A;  4F93 B;  3HW8 A;  1ZQZ A;  1Z00 A;  3KFU F;  8ICY A;  2H3F A;  2R8I A;  3RH5 A;  3D2N A;  3QYP A;  2DPJ A;  2YML A;  1ZD5 A;  2PFQ A;  2EAP A;  3WK8 A;  3HKZ C;  4EEY A;  4UB1 A;  1ZQY A;  1ZQW A;  8ICL A;  4AYB C;  3WK4 A;  4JV1 A;  1NOM A;  3BS5 B;  2BCR A;  7ICP A;  1UT5 A;  4BGD A;  3KTQ A;  3IG5 A;  1ZD2 P;  1YZ6 A;  1CI4 A;  2K4I A;  2XI9 A;  4DS4 A;  3QU2 A;  2C2D A;  2EAO A;  2DQN B;  1S8O A;  8ICS A;  1COO A;  2K4E A;  1VDV A;  2DKX A;  5T14 A;  2KKV A;  3KKA C;  1NK4 A;  2XY5 A;  3D2Q A;  4NM2 A;  4ED6 A;  5AKG A;  1JRO A;  3TFS A;  1ZQR A;  2E3T A;  3ZD8 A;  2Y1I A;  2VA3 A;  2Q0Z X;  2WF5 A;  2W9C A;  5L1L A;  5G5G A;  4TUP A;  2FMS A;  3H8W A;  2RLT A;  1YT3 A;  1WWU A;  1P7D A;  2W03 A;  2KV2 A;  4FS1 A;  7ICV A;  1SV0 C;  1U49 A;  2KVS A;  1H38 A;  4NXZ A;  1BNP A;  4KN4 A;  3TAR A;  5DLG A;  4UAW A;  2JEF A;  5D46 A;  9ICI A;  3EW9 A;  1Z1B A;  1KQQ A;  5L1M A;  1KKX A;  3NTU A;  3G6V A;  5HR7 A;  4JWM A;  1U9L A;  3JPR A;  4BWJ A;  4E0D A;  4C4S A;  4BXO B;  3J81 j;  3KHR A;  3B0Y A;  4I2A A;  2NRX A;  9ICM A;  5J8Y C;  2D8C A;  2XID A;  8ICI A;  1XNS A;  2J6T A;  4XQ8 A;  1BPZ A;  1NNL A;  2KJ8 A;  4OCZ A;  4ECS A;  1ZD3 A;  5ALI A;  2FMQ A;  1J97 A;  2UVU A;  5ALX A;  1N63 A;  4F91 B;  4RUC A;  9ICU A;  4UW9 A;  5TIS U;  5KFY A;  4O5K A;  3PX6 A;  5DKW A;  4Y2P A;  1Q8K A;  1L7O A;  1RG6 A;  4M9N A;  2PMZ F;  1ZRN A;  4J9R A;  4BX9 C;  2HMX A;  4IC9 A;  4U6P A;  9ICG A;  1RXW A;  7ICN A;  3F5E A;  3MR5 A;  3T5L A;  2UVW A;  4TQS A;  3ZDA A;  7ICK A;  4U7C A;  5ALK A;  3WK7 A;  5CHG A;  1TV9 A;  1PVP A;  5J29 A;  2W04 A;  4ZH4 A;  1S76 D;  4JB3 A;  8ICE A;  3RTV A;  4DQP A;  4YN4 A;  3WKA A;  5KG3 A;  4Y2U A;  5J2H A;  2JEJ A;  3TI0 A;  2BPF A;  1ECW A;  1ZQD A;  4OJ6 A;  9ICN A;  3TQ1 A;  4O3N A;  2YTU A;  3I28 A;  2HBJ A;  1HIW A;  3NVY A;  5AM2 A;  3MDA A;  4YCX A;  3GIL A;  4ELT A;  2KJ5 A;  4RQ8 A;  1ZQL A;  4F4W A;  3BS5 A;  4R8U B;  2BKE A;  4Q43 A;  1SKR A;  4QZ8 A;  4O5E A;  4J9O A;  4OD0 A;  3SD7 A;  8ICK A;  5JUM A;  2JV3 A;  1VLB A;  3GIM A;  2ZJ5 A;  4QIW F;  3H4D A;  4F71 A;  4Z6F A;  2F1I A;  4RQM A;  4TQR A;  2F3N A;  1M6Y A;  4M9J A;  1LB2 B;  5JU5 A;  4NWI A;  2RP5 A;  2HOI A;  4J9L A;  2P66 A;  2HOF A;  4RNM A;  1L8L A;  4O9M A;  3PW4 A;  2BCQ A;  3AL0 B;  4KIT B;  5KG0 A;  3BS7 A;  2BHN A;  5E79 U;  7ICI A;  2WAQ C;  3G6Y A;  2HSZ A;  3WKD A;  3CYM A;  4ECX A;  5J0W A;  4ED2 A;  2WF8 A;  1V9P A;  3RH6 A;  4QZG A;  4DSI A;  1Q3V A;  3RAX A;  2QB1 A;  3GIJ A;  5J0T A;  1ZQO A;  1NZB A;  3AM9 A;  5ALD A;  5H2F U;  1L7P A;  5KTQ A;  3C2K A;  4I2D A;  4P4O A;  2XGP A;  4K4H A;  5KL1 B;  1S0N A;  2M9N A;  2IHM A;  4M9G A;  2GH1 A;  5J0O A;  2ZIU B;  3ONN A;  5DB8 A;  4F4Z A;  4PHP A;  3SAH A;  2EZY A;  4YXM A;  8ICJ A;  3SR6 A;  4F5R A;  1UCV A;  4UAV A;  4CDG A;  1ZQQ A;  4FBU A;  3M9M B;  4ELV A;  5ALV A;  1K1S A;  4KLO A;  4FZL A;  1OUQ A;  5KFX A;  2ZTE A;  4B9S A;  4QZB A;  4ED8 A;  5KAF U;  3BDP A;  3MFI A;  2KN7 A;  3F5A A;  1IM4 A;  1XS9 D;  7ICU A;  2NRT A;  5BOM A;  5AHX A;  3C1Y A;  8ICV A;  4KLD A;  4PZO A;  3OGU A;  1V85 A;  5HP4 A;  3HIL A;  2KHQ A;  4Q8E A;  1L7N A;  5KG4 A;  2OXO A;  2WF9 A;  4OO1 J;  1S97 A;  5FP0 A;  4CF5 A;  3N4M B;  1KRP A;  2AH5 A;  3F53 A;  2D3D A;  3UXN A;  2BQR A;  5KFU A;  1ZQU A;  5AM3 A;  3H40 A;  4C7Z A;  2ZJ8 A;  3PST A;  2WF7 A;  1HJP A;  5KFK A;  2NRW A;  3PSI A;  4NL9 C;  3SQI A;  4AP9 A;  1B43 A;  4Z6C A;  4YP3 A;  3ICX A;  2JEG A;  2F1H A;  2BQU A;  4MF8 A;  1X9X A;  4UAZ A;  1ZD4 A;  4X5V A;  1U48 A;  1KFT A;  3JPO A;  3C28 A;  4CGZ A;  1C7Y A;  4I2G A;  3ORY A;  1BPB A;  5J0P A;  1N5X A;  3N7S C;  4YD2 A;  2VJ5 A;  4YR3 A;  3RJH A;  4R8U A;  3M9N B;  3UXP A;  7ICT A;  1MC8 A;  4DL5 A;  5DG9 A;  2YY6 A;  1SGG A;  3MR3 A;  5AI9 A;  1FO4 A;  3QX7 A;  4Y2Y A;  5ALF A;  2WHE A;  1MSW D;  4DF4 A;  2BGW A;  2W8L A;  5F3X B;  2WF6 A;  3C5G A;  4PGQ A;  2KG5 A;  3HRD D;  2V4Q A;  4KLL A;  4UB3 A;  5J8Y A;  3GV5 B;  3JPQ A;  2EAN A;  5HNK A;  2KJ9 A;  4RQ2 A;  4LZG A;  1COK A;  2DGZ A;  4DL3 A;  2KZ3 A;  2IHN A;  3GII A;  4DF8 A;  4NLN A;  5DQI A;  7ICF A;  1ZQN A;  3UM9 A;  3QU4 A;  1FFU A;  4PHE A;  2XIC A;  4RNN A;  4YFK A;  3N7R C;  4IS7 A;  1SXE A;  1JUD A;  2HVH A;  4BWM A;  1HEK A;  2I5H A;  4R65 A;  4DFP A;  2RDJ A;  1WYG A;  3MFH A;  3RB3 A;  4UAY A;  1XC9 A;  1X42 A;  2KKP A;  2ZIU A;  3HT3 A;  2UVR A;  2FPK A;  2ES6 A;  2L5Y A;  2KMD A;  4NLB A;  2PFO A;  3RJK A;  3L3F X;  2ZXI A;  3NGD A;  1NJW A;  1ZOL A;  1XSN A;  4C8N A;  4B9V A;  5AKZ A;  5HHI A;  4P4M A;  3UMG A;  2KNJ A;  2FMP A;  1NZP A;  4EX6 A;  5DQH A;  1NJY A;  2EH9 A;  9ICO A;  5DDM A;  4IRC A;  1Z4O A;  3LVV A;  1BPX A;  2PFN A;  1ZJN A;  4KLQ A;  3K1Z A;  2C28 A;  1QH9 A;  3QZ8 A;  3QU7 A;  3PW0 A;  1NK8 A;  1KTQ A;  5AIA A;  5AK3 A;  5DLF A;  4OJL A;  3NVV A;  7ICJ A;  1PK3 A;  3RB0 A;  4KLE A;  2KIC A;  1ZXI A;  3PML A;  3WK9 A;  4BUG A;  4EBD A;  2LMR A;  3RBE A;  2ESE A;  5KG5 A;  4PJ0 U;  1NKE A;  5J2A A;  3HP6 A;  2CPR A;  4KLT A;  5J0Q A;  8ICP A;  2PFP A;  4DSF A;  3Q8K A;  2NYV A;  4QZD A;  5KFL A;  4NY8 A;  3GIK A;  2PI4 A;  3BQ2 A;  3G6X A;  4B6J A;  2HBK A;  3UQ2 A;  3F2C A;  5AKK A;  2W7O A;  2UVV A;  1L3V A;  5KT6 A;  3KHH A;  4DCC A;  2AQ0 A;  3ETL A;  2FLN A;  3CNH A;  3K1R B;  3WU2 U;  1NKB A;  2C22 A;  1ZJM A;  2YB1 A;  4OJ5 A;  3PY8 A;  1O08 A;  2VIX A;  1QCK A;  3AN1 A;  5AKE A;  1T7P A;  3HKZ F;  2K89 A;  3IDW A;  2Q4T A;  4AYB F;  3N97 B;  2QB0 A;  3THV A;  5CJ7 A;  9ICF A;  4QW8 A;  3MGI A;  2W9M A;  3QUQ A;  2RRD A;  1A6S A;  4DLE A;  4F8R A;  3T5K A;  2FI1 A;  4I27 A;  3PW2 A;  4EEK A;  4NLZ A;  1QLN A;  2ZIV A;  4I2E A;  1BPD A;  4DQQ A;  1IG6 A;  4NM1 A;  1J2M A;  3O0F A;  1TK0 A;  2A3V A;  4DL7 A;  3K4G A;  4O3Q A;  4B9U A;  4QW9 A;  1NK5 A;  4M9L A;  4C4R A;  4EX7 A;  4P0P A;  3M7D A;  2EDU A;  5DB9 A;  1T3Q A;  7ICL A;  1KFD A;  2MA1 A;  1ZYQ A;  1QSY A;  3NVZ A;  5ALU A;  2OH2 A;  5JTI A;  2D6F C;  2KE7 A;  2KHV A;  3KD3 A;  8ICR A;  1LV5 A;  3AU6 A;  3KZI U;  2PXI A;  5KAI U;  1ZQE A;  5KFZ A;  4UBB A;  1KEJ A;  3RF9 A;  5HR6 A;  2C2R A;  3ZI4 A;  5CB1 A;  2N1R A;  3OJU A;  3BJY A;  3KOO A;  2KD1 A;  2KK0 A;  5KFP A;  4DFJ A;  2CXY A;  1JXE A;  1NI3 A;  2E8O A;  4RNO A;  4UB2 A;  3V6K A;  4NL9 A;  2K8B B;  4F5N A;  3SAF A;  4RQ3 A;  2HI0 A;  3RJE A;  4DQR A;  5IIK A;  1MQ2 A;  4KLF A;  5KFO A;  1JRP A;  5KG2 A;  2BPC A;  2R8J A;  4NLK A;  4QWE A;  3RR7 A;  2BCU A;  4MFC A;  3M6Z A;  3T5H A;  1JXL A;  1N56 A;  1KFS A;  2YMM A;  1SL2 A;  4KMU A;  4P4P A;  1FIQ A;  5AM1 A;  1MQ3 A;  3ISD A;  4QZE A;  4TUR A;  5DG8 A;  2FPM A;  4R64 A;  3MR6 A;  3TAQ A;  5ALH A;  4CF3 A;  4ECQ A;  2GO7 A;  1T94 A;  7ICG A;  3H0L B;  3MR2 A;  8ICU A;  3C5F A;  4LVS A;  3WKE A;  4DSK A;  4J9M A;  1PVR A;  3RJI A;  3SV4 A;  4PZN A;  4B9N A;  1X6J A;  3NS1 A;  1DOQ A;  9ICS A;  4I28 A;  3HJE A;  1A77 A;  1L8O A;  4YVZ A;  2E1E A;  2BDP A;  4RQ4 A;  3R9K A;  2MU2 A;  1CEZ A;  2LM1 A;  4ACO A;  2B0C A;  1ZET A;  1WWV A;  2ZIW B;  4DFD A;  2E8M A;  2AXT U;  1PZN A;  4FBT A;  4EZ6 A;  4I2I A;  5BOL A;  3TFR A;  5J2E A;  2BZF A;  2Y9U A;  2JH1 A;  4ECY A;  1N62 A;  3PW7 A;  2G08 A;  1Z1V A;  1RDF A;  4HYK A;  1RYR A;  2WB1 C;  2DPI A;  3NAS A;  3VCB A;  8ICT A;  2ZUC A;  4RT2 A;  5KT5 A;  4RU9 A;  2GOL A;  1KBU A;  7ICM A;  3N7P D;  4I2F A;  3UPQ A;  1NJZ A;  3QU5 A;  1ZQI A;  1ED1 A;  1X9S A;  1HUO A;  1ZQH A;  4KN7 A;  5KG6 A;  4QWA A;  2YX8 A;  4QWB A;  5J2D A;  3EPG A;  3QEA Z;  3IN5 A;  1JI7 A;  3UXO A;  2ASD A;  4Q8F A;  2F8K A;  7ICE A;  2K8A A;  1NKC A;  4M9H A;  1ZQT A;  1NK7 A;  2F77 X;  9ICV A;  9ICB A;  1UQV A;  3LDA A;  2MUT A;  2J6S A;  1TAQ A;  4QIW C;  5IIO A;  4JK1 A;  5AIC A;  5ALP A;  4J9S A;  2HHT A;  2WAQ F;  3BQ1 A;  4RZR A;  2F2A B;  2NV3 A;  2H3Q A;  4G9B A;  5AI4 A;  3C2L A;  4MFF A;  4LZD A;  5DDY A;  8ICB A;  2F1J A;  2HDO A;  5J0U A;  1LKY A;  4YG2 A;  4WJ3 B;  2XCA A;  4YD1 A;  3FDS A;  4NLC A;  2BR0 A;  3LWL A;  5G5H A;  3JPN A;  5EWF A;  1RYU A;  4USA A;  1RM6 C;  1L5U A;  8ICF A;  4YXJ A;  5BPC A;  5CRX A;  1SIJ A;  3DEE A;  4DOA A;  1JN3 A;  4DFK A;  4DL2 A;  1IIP A;  2FLL A;  2G07 A;  4PGY A;  3IHQ B;  1K5O A;  3U26 A;  4O3R A;  4RQ7 A;  1A0P A;  4KLI A;  5AK4 A;  5B5E U;  2ZIX B;  2E8P A;  1DGS A;  3Q8M A;  1F0M A;  2HHS A;  5KG1 A;  4Y2V A;  9ICE A;  7ICR A;  4F4X A;  3Q8R B;  4M47 A;  5AK5 A;  2W11 A;  4KLJ A;  1BNO A;  2IOF A;  3Q8Q B;  2FE9 A;  5EE9 A;  9ICA A;  4IQU A;  1V38 A;  5KFV A;  4PGX A;  1XSL A;  2IA6 A;  4DQS A;  2JH7 A;  2M0N A;  5AKL A;  2HBM A;  9ICT A;  4UB4 A;  2XY6 A;  5ALM A;  5KFS A;  2OYY A;  5C0Y A;  1UA1 A;  2KTQ A;  5ALN A;  4RQ6 A;  2R8H A;  1L3T A;  2VA8 A;  2BCV A;  1KLN A;  2H3Z A;  5KFC A;  3GV8 B;  3QE9 Y;  1B4F A;  2LYH A;  3TAC B;  4OJP A;  4QZH A;  4CE6 A;  3JPS A;  4US9 A;  3RH4 A;  3GZF A;  5J2K A;  4UQG A;  3V7J A;  4I2J A;  1NJX A;  2ZIW A;  2EZZ A;  2VAN A;  5ALZ A;  4FFD A;  3Q8P B;  1WCL A;  2DFL A;  5AI8 A;  5CP2 A;  3KZX A;  2HW3 A;  5ALW A;  4I29 A;  3MGH A;  5A0L A;  5AIB A;  2I6X A;  3ZD9 A;  4GLX A;  4PL2 A;  5J2F A;  2I1Q A;  5KT4 A;  1SV4 A;  1L3S A;  3NUQ A;  1QSL A;  4HAI A;  3OHA A;  4B9T A;  4Z6D A;  4I2H A;  3M6K A;  5CA7 A;  2W7P A;  4Y2S A;  1HUZ A;  4TUQ A;  5GTI U;  2A19 A;  2QB0 B;  3ZDE A;  4DSL A;  2AGQ A;  1XWL A;  3N28 A;  3RRG A;  5KFQ A;  3WK5 A;  3RB6 A;  3ISB A;  8ICN A;  3RRH A;  3TAN A;  4F3O A;  2KIV A;  4Y2Q A;  4JMU A;  2GWS A;  3AQE A;  3FYH A;  1UPH A;  2ZIV B;  4DEZ A;  4KX5 A;  4DLG A;  1Y88 A;  1OXJ A;  4LJX A;  5HML A;  1S0V A;  3H0R B;  3C23 A;  1XSP A;  5EE0 A;  2DF4 B;  2R8K A;  2W9B A;  1TK5 A;  3HWT A;  4P0P B;  4ECU A;  1QSS A;  3MAB A;  5J2C A;  4R66 A;  4O5C A;  4Y2X A;  1DXS A;  2IOF K;  2KSO A;  2MRL A;  1B22 A;  1SKS A;  5ALY A;  3C2M A;  1RPL A;  5D4B A;  1SB3 C;  4UAR A;  9ICP A;  2HCF A;  2PKE A;  5EOZ A;  3SAG A;  9ICC A;  3VC8 A;  1Q3U A;  2BPG A;  4DL4 A;  3M8R A;  1WG8 A;  4C8K A;  3A0H U;  4GXI A;  2XGQ A;  5AI0 A;  3HX0 A;  1X6I A;  2A1A A;  4M6W A;  3MBY A;  5KT3 A;  3ED5 A;  2JHD A;  1ZQK A;  3IG8 A;  2HOQ A;  5KFN A;  1BPE A;  4BJQ A;  3UQ0 A;  3RJG A;  4DOB A;  3PZP A;  4C0Z A;  3E0F A;  4C7Y A;  1VJ5 A;  4GC6 A;  5GTH U;  5KFT A;  2ZIX A;  2P6R A;  5AKJ A;  2OWO A;  2AU0 A;  4O3S A;  2RQ5 A;  4M2Y A;  2P6U A;  2VKQ A;  2Y0S C;  1X9M A;  8ICZ A;  9ICH A;  3UMC A;  3EUB 2;  5IIM A;  2ZUB A;  2LHT A;  3EWA A;  4GXJ A;  1ARO P;  1S77 D;  1SWW A;  2LPE A;  1CUK A;  2XVT A;  3GQC A;  2OEH A;  1SZP A;  3ZDD A;  4OJO A;  8ICM A;  4RQ1 A;  2LKY A;  4BDP A;  4DSJ A;  1EXN A;  2DKZ A;  3WK6 A;  1U4B A;  5DBA A;  3H4B A;  5ALS A;  3NRZ A;  1UHU A;  2OCE A;  3GDX A;  4F5O A;  4ECZ A;  4CCH A;  1ZQB A;  1XU4 A;  7ICO A;  4RQ0 A;  3KBB A;  5L1J A;  9ICQ A;  5ALE A;  4O3P A;  4ED7 A;  1PUZ A;  4EZ9 A;  1X66 A;  4DSE A;  2AGO A;  5KFI A;  2XCP A;  4RPY A;  3AMZ A;  3PW5 A;  1WUD A;  5KFR A;  3JPT A;  2ISP A;  2YN4 A;  1SZH A;  3T3F A;  4O0I A;  2W43 A;  5ALG A;  5C5J A;  1FEZ A;  1QQ5 A;  5KG7 A;  2W3S A;  4I2B A;  3M8S A;  2YB4 A;  2ISO A;  4UAS A;  3TAD A;  1X40 A;  2GLE A;  4P2H A;  4EYI B;  5EWE A;  2F44 A;  4IR9 A;  5KFE A;  4C8M A;  4DOC A;  3OHB A;  1ZQX A;  3L4P A;  3PSP A;  2QAR B;  1RQN A;  1ZQV A;  3GFK B;  2ZTD A;  1WCN A;  1S0O A;  2LM4 A;  3SEI A;  2VJ4 A;  1DRG A;  4Z6E A;  5KFB A;  4Y2T A;  4F50 A;  8ICW A;  4XUS A;  3AEV A;  3AQF A;  8ICG A;  2G5H B;  4RPX A;  4YR0 A;  1C20 A;  5ALR A;  3PV8 A;  3IM1 A;  3AU2 A;  3IP4 B;  3ETR A;  2DL0 A;  2MUT B;  3FAH A;  4JV2 A;  2W55 A;  2IBK A;  9ICK A;  4EBE A;  3PR4 A;  4US8 A;  3RFA A;  3MDC A;  3PVX A;  2HHW A;  4ZOH C;  2KVC A;  1JMS A;  5KFF A;  9ICR A;  2BDU A;  1Z4N A;  1JAL A;  3TKA A;  2XC9 A;  1J2N A;  2CRX A;  1LKY B;  1B0X A;  2YMQ A;  2HHU A;  5L1I A;  4ECV A;  1V97 A;  5F9L A;  5AI6 A;  5L9X A;  3M9O B;  8ICH A;  5ALJ A;  1N2X A;  5D49 A;  2JR5 A;  2DBY A;  1SWV A;  5IIL A;  4NJ8 A;  2H5X A;  3EPI A;  2K60 A;  4EEL A;  3F2D A;  1UA0 A;  5CR0 A;  5HMM A;  3C29 A;  2FJ6 A;  4Q45 A;  3DV9 A;  5ALL A;  1ZQC A;  4P0Q A;  4K4G A;  2ASL A;  3H8J A;  2ODG A;  4NLG A;  4UB6 U;  4KLM A;  1O03 A;  5TZV A;  1TK8 A;  4J9Q A;  5DQG A;  1N5W A;  1A76 A;  1DGJ A;  5III A;  4FZM A;  4C8O A;  1XO1 A;  2V4R A;  2JEI A;  1TFR A;  2E1F A;  1CRX A;  2KIW A;  2A1J A;  2WTF A;  5KL8 B;  3RJJ A;  1QQ7 A;  8ICQ A;  2ZJA A;  1F5S A;  3HPO A;  3IRU A;  1U47 A;  4MEX A;  1BVS A;  2KEY A;  3PO5 A;  2NRZ A;  1BGX T;  4PPX A;  5F9N A;  2VA2 A;  2Y9T A;  4MF2 A;  3ZDC A;  2E8N A;  2PMZ C;  2AGP A;  4Q44 A;  4YQW A;  3V72 A;  1T4G A;  4ECT A;  1D9D A;  3WKB A;  2YQE A;  2IOH A;  5J2J A;  2RHF A;  4ICA A;  4QZ9 A;  1D8B A;  5KFD A;  2KFN A;  3C21 A;  4PL1 A;  5EWG A;  1SKW A;  1SL0 A;  4B9M A;  4KLU A;  4G3I A;  5DB6 A;  9ICL A;  3OSN A;  1QTM A;  2AHO B;  3OTQ A;  2J6U A;  3RBD A;  2NO5 A;  2P35 A;  4YMN A;  1ZQS A;  2KZM A;  1L7M A;  2G5I B;  3BQ0 A;  1OW5 A;  1K1Q A;  3B0X A;  3QUT A;  4CF4 A;  4JV0 A;  5KFW A;  2WB1 F;  4C4T A;  3RB4 A;  3BQ7 A;  4QZA A;  4MHV A;  4IQV A;  3AUO A;  3MGV A;  2W3R A;  2QAR A;  4IRD A;  4F5P A;  5AI5 A;  1MA7 A;  3TAP A;  3PO4 A;  1L6N A;  2DWQ A;  2I9G A;  4F4K A;  1S0M A;  1S5L U;  3E2E A;  4QNL A;  3H0M B;  2HHQ A;  2B21 A;  3NRW A;  2MAX A;  2LYA A;  2XY7 A;  3PMN A;  2PI5 A;  4KTQ A;  5DG7 A;  3NVW A;  3L5K A;  4ECR A;  4UAU A;  1Z19 A;  1N61 A;  1YZ7 A;  1D8L A;  3BZC A;  2W9A A;  3KHL A;  3OJS A;  5ALO A;  1KDH A;  4UB8 U;  3EZ5 A;  3QUC A;  3DDH A;  2KP7 A;  2HVI A;  5L1K A;  4F72 A;  4DO9 A;  1T3N A;  3PNC A;  4ED3 A;  2W9B B;  2RDI A;  3V6J A;  1GO3 F;  2K4H A;  3IV6 A;  5HHH A;  2KSO B;  3E58 A;  3A0B U;  5AKH A;  3QUB A;  2LBO A;  1NK0 A;  4FZN A;  1Z3E B;  2AQ4 A;  3TAD C;  2QKQ A;  4IL6 U;  1LVH A;  2BQ3 A;  4RPZ A;  4C8L A;  4UB5 A;  5AM4 A;  4EBC A;  4I2C A;  4IQT A;  3MC1 A;  4YMM A;  4M6W B;  1ZQJ A;  5AM0 A;  4QZF A;  8ICA A;  1N48 A;  3SI8 A;  4RQN A;  1RYS A;  3B9J A;  3SYZ A;  4O3O A;  4KMO B;  1JX4 A;  1QQ6 A;  3GU3 A;  1T8E A;  4BXO A;  2KFZ A;  1RQL A;  1U45 A;  1S9F A;  2ZXH A;  1PK1 B;  3QZ7 A;  3JPP A;  3SV3 A;  3V6H A;  2JZB B;  2YMP A;  2ASJ A;  4GFJ A;  1TAU A;  1ZQ1 C;  3LVW A;  3RJF A;  2HBL A;  4F4Y A;  3WKC A;  5AKY A;  1TE2 A;  5KFA A;  4ELU A;  5DGB A;  4MFA A;  4EEN A;  2NRV A;  1RXV A;  3BZK A;  4Y2R A;  5IIJ A;  5EE3 A;  4J9K A;  1IV8 A;  4F2S A;  4UAT A;  4B9L A;  4QZI A;  2FLP A;  2BCS A;  4M04 A;  2IMW P;  4K4I A;  3RR8 A;  4ED0 A;  5KFJ A;  4F5Q A;  2HHV A;  3OSP A;  2MSN A;  5DB7 A;  4ECW A;  2DUY A;  2HHX A;  4J9P A;  2ZUD A;  5AKX A;  5J0S A;  4RT3 A;  1FFV A;  3KKA A;  4MEY A;  3LK9 A;  4GC7 A;  3UMB A;  2R18 A;  5CWR A;  2FPL A;  2K8C B;  3RAQ A;  7ICS A;  1URJ A;  4PHD A;  2ZTC A;  4C80 A;  9ICX A;  4IRK A;  1UT8 A;  1D9F A;  3SMV A;  4FS2 A;  1SV0 A;  5JRT A;  3Q8L A;  1Z00 B;  1AQ6 A;  2EAM A;  3OPX A;  4KX3 A;  4RQ5 A;  1SL1 A;  5IIN A;  4DWI A;  4QWC A;  4Y2J A;  3QXG A;  2JGA A;  2ZG6 A;  2NO4 A;  2ALZ A;  2W8K A;  1SXD A;  1JIH A;  4A8E A;  3PX0 A;  3SEN A;  2EQY A;  2CN1 A;  4FE3 A;  4J03 A;  4XA5 A;  4CRX A;  1X9W A;  5CEH A;  1S10 A;  3I76 A;  3V7L A;  5J2B A;  2JXJ A;  5KFG A;  4PH5 A;  5K4L A;  4CNQ A;  4QWD A;  5DBB A;  3KHG A;  5KNI A;  5B66 U;  1KW4 A;  2OM6 A;  9ICW A;  2K4P A;  2H3I A;  4R63 A;  4RUA A;  5J2I A;  5KT2 A;  2AJQ A;  1TVA A;  1X2I A;  1ZQA A;  2KOB A;  5KFM A;  3T79 A;  3EYZ A;  4TUS A;  4M0A A;  2WFA A;  2W54 A;  5J0R A;  3S6J A;  2JRZ A;  3GV7 B;  2ATL A;  2C2E A;  1D8Y A;  4IR1 A;  2W9C B;  4GXK A;  1ZQG A;  3PR5 B;  3CW2 C;  2JMG A;  4NV0 A;  4IQW A;  2XO7 A;  7ICQ A;  4XRH A;  5KT7 A;  3Q8S B;  3D2S A;  3CRX A;  2QLT A;  1ZQM A;  4QZC A;  1ZQF A;  1KL9 A;  1TKD A;  3V7K A;  4J9N A;  5AM5 A;  4KLS A;  4DL6 A;  2O6K A;  3C1Z A;  3D6J A;  3BQT A;  4DQI A;  5ALT A;  1PK1 A;  2Y0S F;  3I1Y A;  1MN8 A;  2JZB A;  3QU9 A;  3K75 D;  3QNM A;  4P0Q B;  2EZX A;  5EE1 A;  4EYH B;  3FM9 A;  2R8G A;  1TAM A;  1XO0 A;  2LI6 A;  3H8S A;  2G09 A;  1F44 A;  1DK2 A;  8ICO A;  5DGA A;  3F2B A;  3LYS A;  4F92 B;  3LWM A;  3H8M A;  8ICX A;  4JUZ A;  1Q46 A;  1PVQ A;  2V9W A;  2A1J B;  3CP8 A;  3PSF A;  3QEB Z;  1RZT A;  4O3M A;  3PX4 A;  2LYB A;  4DS5 A;  5DBC A;  7ICH A;  3FC4 A;  9ICJ A;  1N60 A;  4KLH A;  2Y1J A;  5J2G A;  5ALQ A;  4PHA A;  5KFH A;  4YMO A;  4QJF B;  2B6G A;  5AKI A;  1DK3 A;  3T5J A;  1ZQP A;  5J0Y A;  4JWN A;  8ICC A;  2E5S A;  1L3U A;  4GIB A;  3M1Y A;  4F2R A;  2G0A A;  5J0X A;  2H3V A;  2F76 X;  1NK9 A;  4ED1 A;  4UBC A;  2FDR A;  2F8L A;  2OHF A;  4FO6 A;  1NK6 A;  4KLG A;  3ZDB A;  4YR2 A;  4DFM A; 
#chains in the Genus database with same CATH homology
 2ESE A;  5JTI A;  1WWV A;  2EAN A;  2KE7 A;  5J8Y C;  2D8C A;  5J8Y A;  2JV3 A;  2QB0 B;  2E8M A;  2KSO B;  2Y9T A;  1COK A;  4PZO A;  2LPE A;  3KKA A;  2E8N A;  4RQM A;  3TAD C;  1V85 A;  2DL0 A;  2F3N A;  2QKQ A;  2E8P A;  3HIL A;  1PK1 A;  2Y9U A;  2EAP A;  2DKZ A;  1F0M A;  2KIV A;  5JU5 A;  1Z1V A;  3BS5 B;  4IS7 A;  1SXE A;  2D3D A;  2E8O A;  1OXJ A;  4NL9 A;  3K1R B;  4RQN A;  1RG6 A;  1SV0 A;  5JRT A;  2FE9 A;  3H8M A;  3BS7 A;  1V38 A;  2EAM A;  1LKY B;  1B0X A;  4NL9 C;  2EAO A;  1X66 A;  3IDW A;  1OW5 A;  2DKX A;  1JI7 A;  2F8K A;  3KKA C;  1X9X A;  1DXS A;  2QB0 A;  2ES6 A;  2KSO A;  2L5Y A;  1PK1 B;  2KMD A;  1SXD A;  3BQ7 A;  4MHV A;  4NJ8 A;  2K60 A;  3SEN A;  1UQV A;  2QB1 A;  2QAR A;  1B4F A;  3TAC B;  1WWU A;  2B6G A;  5KNI A;  1SV0 C;  1KW4 A;  2K4P A;  1SGG A;  4PZN A;  3TAD A;  1X40 A;  1LKY A;  1UCV A;  2GLE A;  5F3X B;  2F44 A;  1PK3 A;  2YTU A;  2QAR B;  1SV4 A;  2KG5 A;  5L1M A;  3SEI A;  2LMR A;  3BS5 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...