1SV0C

Crystal structure of yan-sam/mae-sam complex
Total Genus 27
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
27
sequence length
82
structure length
82
Chain Sequence
PLGSDGLPLDPRDWTRADVWKWLINMAVSEGLEVTAELPQKFPMNGKALCLMSLDMYLCRVPVGGKMLYRDFRVRLARAMSR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Derepression by depolymerization; structural insights into the regulation of yan by mae.
pubmed doi rcsb
source organism Drosophila melanogaster
molecule tags Transcription
molecule keywords Ets DNA-binding protein pokkuri
total genus 27
structure length 82
sequence length 82
chains with identical sequence D
ec nomenclature
pdb deposition date 2004-03-26
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.50 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 Transcription Factor, Ets-1 1sv0C00
1SV4A 2GLEA 4PZNA 5JU5A 2QARB 1SV0A 1RG6A 1B4FA 2Y9TA 2EAPA 3HILA 2EAMA 1SXDA 1B0XA 2DKXA 2KIVA 2ES6A 2E8PA 2YTUA 1PK1B 5JTIA 2KSOA 2LMRA 3KKAA 2QB0A 2QB1A 2QB0B 1UCVA 2E8NA 2QKQA 1DXSA 2E8MA 2D8CA 1V38A 1LKYA 2F8KA 5JRTA 2LPEA 4NL9A 3TADA 1PK3A 2EAOA 2D3DA 1COKA 1SV0C 2L5YA 1SGGA 3BS7A 2K4PA 2DKZA 2F3NA 2KMDA 3SENA 4NL9C 1UQVA 2FE9A 4MHVA 2KG5A 2B6GA 3K1RB 5L1MA 1V85A 3BQ7A 5F3XB 3TADC 1JI7A 1WWVA 2F44A 1OXJA 3KKAC 4IS7A 4RQNA 2E8OA 1F0MA 1X40A 2K60A 5J8YA 2JV3A 3BS5A 2Y9UA 1X9XA 2KE7A 3IDWA 1PK1A 2EANA 3SEIA 1KW4A 2KSOB 3TACB 3H8MA 1OW5A 1Z1VA 2QARA 1SXEA 4PZOA 5KNIA 1LKYB 1WWUA 3BS5B 5J8YC 2DL0A 4RQMA 1X66A 2ESEA 4NJ8A
chains in the Genus database with same CATH superfamily
5KFEA 4Y2QA 1VJ5A 4FS2A 4PZNA 5ALPA 1NKCA 2YX8A 4ECXA 1D8YA 8ICIA 3NVVA 5HR7A 3OSPA 2AGQA 1B4FA 2W43A 4LZDA 2YQEA 2P6UA 2I9GA 1BNPA 3G6XA 5AIBA 1RZTA 1ZQRA 3B9JA 2Y1JA 1S77D 2IBKA 2WAQC 4BJQA 2FLNA 5ALLA 4KLOA 2HMXA 4Y2PA 2LPEA 4UAUA 3F2CA 5IIOA 3V6KA 5KG3A 3RB4A 5AM0A 3MGIA 4KLEA 1UPHA 1KFTA 2RDIA 4U7CA 2IOFA 1XWLA 2FMQA 3EPIA 3HRDD 3RB6A 2FPKA 2ISOA 2ZIVA 4I28A 2GWSA 4QJFB 2FPLA 3MR6A 7ICFA 2AXTU 1D9DA 2XO7A 2MA1A 3PW5A 1PZNA 2D6FC 3KFUF 3HW8A 3MR3A 3BS5A 1X2IA 2Y9UA 3TI0A 3PO5A 2ZTDA 4NLZA 5BOMA 2KTQA 2KP7A 2F1JA 4F4ZA 3NVYA 2WF6A 1UA1A 5AIAA 4TUSA 4PZOA 2AQ4A 2EZXA 2RP5A 3WK8A 4JMUA 1ZQYA 1CI4A 4QNLA 3L5KA 1PVRA 4RZRA 1TE2A 1X66A 4YXMA 4O5EA 4UB3A 4QZDA 4C80A 8ICWA 5DQIA 2GLEA 5EWEA 2RDJA 5KG6A 2AGPA 5DGAA 4DS4A 3MFIA 5HMLA 4F72A 1JX4A 2B21A 3RH6A 5EE1A 1SZPA 1FEZA 1B0XA 2ES6A 2I6XA 5J0TA 3OJSA 5JTIA 5EE9A 5DB7A 4FZMA 3JPPA 2DGZA 8ICFA 3QUTA 3NRWA 7ICJA 4O3OA 4NLGA 4PHAA 3EYZA 1ZRNA 3TFSA 1HIWA 2R8KA 2HBJA 2A19A 2DBYA 4DFDA 1NK9A 5KFBA 4DL3A 4M0AA 2JH1A 2K4PA 2XVTA 2W8LA 4KLTA 3ZDEA 5J2AA 3SENA 3RH4A 4DSLA 4IRKA 3HX0A 2HVHA 2KVSA 2DF4B 2P6RA 1MSWD 3WK4A 1WWVA 4BWMA 4QWDA 4QZAA 2F44A 3H0MB 1UA0A 3V7KA 5DB6A 4Z6DA 3LVVA 8ICGA 4DQRA 2KKVA 4ED8A 5J29A 1JXEA 4F4XA 4PGQA 2CPRA 2H3ZA 2ISPA 3GQCA 5DDMA 3GIIA 3ISDA 4M9JA 4QWEA 2ZIWB 5AK6A 1TKDA 2ZIXB 2O6KA 3RTVA 3PZPA 4UQGA 4EEKA 1RM6C 4YD2A 3H7IA 2ASLA 1Q46A 5KAFU 2K8CB 2JZBA 3B0YA 1ZD4A 1ZQWA 4PHPA 5DQGA 4DEZA 2KZZA 2Y9TA 4CRXA 8ICRA 2MSNA 3HILA 3WKCA 2DFLA 4GXKA 1L3SA 5DLGA 4RPZA 3HJEA 2ZJAA 4DL6A 1F44A 4NLNA 4RQ7A 3JPSA 4PL2A 1XSPA 4I29A 4KLIA 5KT3A 3SZ2A 1NK7A 4EYHB 4MEYA 2F8KA 1RYUA 3L3FX 2MUTB 4J9MA 1FFVA 2R8HA 1D8LA 1WUDA 1FIQA 4BDPA 2W55A 4GFJA 1J2MA 1ZQHA 9ICPA 4RUAA 1U9LA 2H3FA 2ZIXA 2AJQA 3M7DA 7ICNA 2A3VA 2KG5A 2AHOB 3AUOA 3PSIA 2AH5A 4GC7A 5KG7A 2P35A 5KFXA 4I2DA 2FMSA 3C1ZA 4CDGA 2KJ9A 5J0SA 4KLDA 2A1JA 1Z00B 3KKAC 4DFPA 3B0XA 5K4LA 2HHUA 1YZ7A 2K60A 4DLEA 1N5WA 5J8YA 2HVIA 3M9OB 1ZQSA 9ICGA 3N28A 4KLLA 2VA8A 4MEXA 2JGAA 3SI8A 2Y0SF 9ICQA 3M8SA 4JV1A 9ICSA 3TACB 3FDSA 3H8MA 2WFAA 2OYYA 3UM9A 5ALJA 5AM3A 2XC9A 4Z6CA 2IHNA 4UASA 4NJ8A 1N60A 2HW3A 3L4PA 5AICA 1RG6A 2B0CA 3IN5A 2R8GA 4F3OA 5J2DA 4KLUA 1NK0A 4DSIA 3PSTA 3UXOA 2LKYA 5F9NA 3ZD9A 3MDCA 4KN4A 4QZEA 3MGHA 3SQIA 4RNMA 3RJGA 1V38A 5L1JA 3GILA 5ALZA 1BPDA 1Z3EB 9ICVA 2PFOA 3TAPA 5IIJA 4P0QA 1BPEA 4ZH4A 2NYVA 4UB8U 5C0YA 5FP0A 1DGSA 4ECUA 1ZQ1C 4JWNA 4DS5A 1ZQOA 2DKZA 1K1QA 3M6ZA 4MHVA 3C1YA 4YMNA 2J6UA 4B9MA 2KJ5A 5EWFA 3UMGA 3TADC 5KFUA 4UBCA 4DL5A 2WB1F 5CB1A 1ZQBA 5AK3A 4UAVA 1CEZA 3CW2C 3SYZA 1F0MA 1NK6A 5AI5A 3IDWA 3WU2U 3QX7A 2V9WA 1TK5A 4DQSA 1KL9A 8ICUA 1C7YA 4KLHA 5D4BA 3H0RB 4KMOB 3AM9A 2P66A 9ICBA 3TKAA 4RNNA 2G5IB 3UQ2A 1J2NA 4QZ9A 5J8YC 5D49A 2W9CB 4ECRA 3WKBA 1Q8KA 5B5EU 4US8A 4DWIA 8ICQA 1DRGA 3MFHA 3F2BA 1SV4A 5AM4A 4MFFA 1QSLA 1SIJA 2PXIA 5KFWA 4PGYA 1D9FA 1ZQVA 2W8KA 4P4MA 5DB8A 2H3VA 1SWWA 4EX7A 2EQYA 1S10A 3RJHA 5J0RA 4KLGA 4M9LA 3HT3A 4UAWA 2G5HB 2BCVA 1L7PA 5KFOA 4UAZA 3QEBZ 2EAOA 4IRCA 3V6JA 3WK6A 4C7YA 4C0ZA 2UVVA 1SL2A 7ICQA 4FZNA 2FPMA 5JUMA 1X9MA 1L5UA 7ICGA 1UQVA 4ED1A 2KZMA 3RJJA 8ICKA 2EDUA 1WCNA 1ZQFA 2HHVA 4ECSA 3RBDA 2EH9A 1FO4A 5KT4A 3ZDAA 3PR4A 4B9TA 3U26A 3JPRA 5KFSA 1L6NA 2ZIUB 3GV8B 2IOHA 3JPOA 4KN7A 4IS7A 1Z00A 4I2FA 5DG9A 9ICJA 3E2EA 5KT5A 3QYPA 4O3RA 3AQEA 1TAQA 2ZIVB 4UB1A 3SAGA 5ALTA 3R9KA 4GXJA 1RPLA 1OW5A 1JALA 5KL1B 4M47A 3GDXA 2K8AA 1NZPA 3GU3A 3M1YA 1WWUA 1S9FA 8ICBA 1A0PA 2PMZF 1ZQAA 2IHMA 2JXJA 4RQ4A 1WCLA 5HP4A 3EUB2 2ZIUA 1ZJMA 5ALWA 4KLSA 5ALEA 3RFAA 5IIMA 3DEEA 3F5EA 2V4RA 4K4HA 2MU2A 5J2IA 1COOA 1S0MA 2KSOA 1X6JA 1MQ2A 3KKAA 4QZBA 3K1ZA 4RUCA 1UCVA 2KZ3A 1M6YA 8ICNA 2BCSA 5CWRA 3WK9A 2HHSA 1ZQQA 3H8SA 5JRTA 1N56A 3ZD8A 5DBCA 3N7RC 3N7PD 1ED1A 1SV0C 8ICVA 4JV2A 1IIPA 1V9PA 3HP6A 9ICCA 5J0XA 4UAYA 4USAA 3SR6A 1O08A 3Q8QB 4B9SA 1ZQNA 2B6GA 3RB0A 2NO4A 4AYBF 5IIIA 1ZQLA 2KHQA 4C4SA 3QU7A 4R64A 3RR8A 2J6SA 3K4GA 1BGXT 1ZQXA 3BQ0A 1NJZA 5IILA 3UXNA 2JEJA 1YT3A 1RYRA 2W9BA 4I2CA 3SV3A 5J0PA 3QUQA 3BQ1A 1Q3UA 4JV0A 9ICRA 4I2IA 4F91B 4UB4A 2W04A 4GXIA 1KTQA 1KRPA 2GO7A 2W7PA 8ICAA 2DWQA 1D8BA 3IG5A 4QZHA 1ECWA 1RXWA 4M04A 3BDPA 7ICRA 1L8OA 3NS1A 4M9HA 4R63A 5F9LA 3M8RA 4BXOA 3V7JA 2ESEA 2JH7A 2ZUCA 1TAMA 3NGDA 3KOOA 5ALHA 3MR2A 2Y1IA 3CRXA 3QU5A 3H8WA 3OTQA 5L1LA 1UT8A 2KFNA 1HJPA 4NLBA 2WF7A 4DSFA 5DKWA 3KHGA 4KLMA 5CR0A 2E8NA 4R65A 4MF8A 1FFUA 4IQWA 2G0AA 4OCZA 4B9VA 2PI4A 4LVSA 2D8CA 4DSEA 4ELVA 3QEAZ 7ICIA 4J9KA 4NV0A 1L7MA 1Z4NA 3A0BU 2LHTA 1U49A 1UHUA 4KMUA 4DL4A 2NRVA 4JB3A 2L5YA 2OM6A 4KITB 4ECTA 1L3UA 5KG5A 5ALRA 3LVWA 4QZCA 1SB3C 4QWBA 4ECZA 5GTHU 4TQSA 4UW9A 3QNMA 2LYAA 1KFSA 1ZYQA 4EZ9A 5AKKA 3QUCA 4PL1A 3Q8KA 2ZUDA 4O0IA 5D46A 8ICPA 4PHDA 4ED2A 4YR3A 4DQPA 1ZQUA 3UMCA 2PKEA 1RDFA 1XSLA 3QU2A 3RJEA 4XRHA 5DG7A 3ETRA 4FE3A 4NM2A 4Y2VA 3Q8MA 2PI5A 4F5QA 2LYHA 3V6HA 2W7OA 3ZDCA 3V72A 5TISU 3SD7A 3RJKA 4DFMA 2XY6A 1S8OA 5CJ7A 2HCFA 2ZUBA 3PMNA 4KTQA 2ZJ5A 4EBCA 4ZOHC 2GOLA 3G6VA 2CXYA 4CGZA 3I28A 4Y2JA 5KFCA 4ICAA 2BCUA 5J2EA 4RU9A 5DQHA 2EAMA 1L3VA 1PK1B 1CUKA 3ICXA 3C2MA 1L7NA 2YMMA 4QZ8A 1URJA 2VANA 4R66A 9ICTA 2ZXHA 3T79A 4C8NA 3ZDDA 5ALUA 2VA2A 3DV9A 3J81j 3AU6A 2HOIA 2D3DA 3UPQA 2ZTCA 5L1KA 3OJUA 3SV4A 4AP9A 2NRZA 4DL2A 1NK4A 3SAFA 4UBBA 2WF5A 3IM1A 4FBUA 5L1MA 4IQVA 1SZHA 4Y2XA 2EZZA 4Q44A 2DPIA 3Q8PB 3C21A 4F71A 1SL1A 2BPFA 2FLLA 2Y0SC 3PSPA 9ICOA 2BHNA 1U47A 5ALDA 4K4IA 1HUOA 2GH1A 1VDVA 5HR6A 1KEJA 2XIDA 1X40A 4NXZA 3V7LA 2BZFA 3H4BA 4DSJA 2OWOA 2EANA 2NV3A 5KG1A 7ICVA 4NM1A 3C5GA 3K75D 1IG6A 3KTQA 2CRXA 8ICMA 1KN5A 9ICMA 3RRGA 2XI9A 5J2FA 9ICKA 1O03A 5KG2A 3NTUA 2UVUA 3PX0A 2VIXA 2RHFA 5J0UA 1ZD3A 4GIBA 4UATA 1SV0A 2HBMA 1SKSA 7ICUA 1ZOLA 2C22A 3ORYA 4EBDA 2K8BB 1Z19A 4OD0A 2H3QA 4EYIB 2DKXA 5AM2A 5CA7A 2W9AA 2MAXA 3IG8A 3RB3A 2RLTA 5KT7A 1T8EA 4FZLA 2QB0B 4I2BA 2C28A 4TQRA 2IOFK 1DXSA 5GTIU 4ECVA 1NKEA 3C28A 4EEYA 4GLXA 3IRUA 1JRPA 3M9MB 2NO5A 4OJ5A 2KFZA 3RAQA 3ALRA 2OCEA 1ZQIA 1RYSA 5AKEA 5KFAA 3NASA 5J0QA 1NZBA 4EZ6A 5IIKA 4IL6U 4O5KA 4OJLA 4RQ0A 4Z6FA 2ODGA 1SKRA 4JK1A 4F93B 4NLCA 4B6JA 5F3XB 9ICXA 1NI3A 1NNLA 1JIHA 3N7SC 5H2FU 4RT3A 5ALSA 2KKPA 1TAUA 2F76X 2W3SA 4M6WB 4YD1A 4FFDA 3H0LB 7ICMA 2C2DA 4FS1A 1Q3VA 2KVCA 2KV2A 4ELTA 2YMQA 3WKDA 5A0LA 5KFHA 5AK5A 4F4YA 1Z1VA 4FBTA 4NY8A 3GV5B 2HDOA 1C20A 8ICOA 3AN1A 3OPXA 5KFDA 1KSPA 5AK4A 1JXLA 1DK2A 3ETLA 4C8LA 2R8IA 2JEFA 2VA3A 3LYSA 5AI4A 2F1IA 1ZXIA 3ED5A 4IR9A 2W11A 3D2SA 1N62A 2XCAA 1XSNA 2HHQA 2JEGA 1S0OA 2QARB 4CNQA 5CHGA 2KICA 2C2RA 4Z6EA 3O0FA 3F2DA 3H40A 5AKIA 3T5KA 4DQQA 2E8PA 2YTUA 4DOAA 4XUSA 3RBEA 4I2GA 4WJ3B 7ICOA 3PV8A 8ICJA 3NVZA 3KBBA 1ZQKA 3RRHA 2VJ4A 5DDYA 5ALNA 3OHAA 2N1RA 1TK8A 4P2HA 2KD1A 1N61A 4G3IA 4YCXA 5ALYA 4YFKA 2F2AB 5T14A 2CN1A 3M9NB 4Y2YA 2F3NA 3VCBA 2G09A 1S0NA 3RJFA 4C8OA 8ICHA 4P0PB 1L3TA 3QXGA 4C8KA 2ASJA 5J2GA 5KFKA 7ICPA 3BQ7A 1X6IA 2DUYA 4M9GA 5EWGA 3HWTA 3WKAA 5DBAA 2JEIA 2ATLA 4PGXA 1Z4OA 5AKJA 3SMVA 5KL8B 1Y88A 1X9XA 1PK1A 1ZQDA 5EE3A 2J6TA 5AKZA 2VJ5A 1RXVA 1S76D 4J9OA 1NK5A 2R18A 5KFLA 4OO1J 4YXJA 4F4KA 1N2XA 5ALMA 4EX6A 2BGWA 3RJIA 1KFDA 1AQ6A 2KHVA 1QSYA 3C5FA 1ZQZA 1RQNA 4US9A 7ICSA 4KLQA 5J2BA 3AMZA 4O9MA 3JPQA 4DF4A 2KOBA 1ZRMA 5C5JA 3NRZA 4ED0A 4RPXA 1SXDA 2MUTA 2HHXA 4F5OA 4RQ8A 4ECYA 3MR5A 3ONNA 4QW9A 1GO3F 2QB0A 4Q8FA 4Q8EA 5AHXA 2E8MA 3PVXA 4DOCA 1AROP 4DLGA 1PK3A 2BPGA 2XGPA 1TV9A 2BR0A 3Q8SB 2A1JB 3WK7A 5AKXA 1KQQA 2KMDA 2ASDA 4K4GA 2HBLA 4P4OA 2UVWA 1RQLA 4NL9C 5B66U 1QQ7A 2Q0ZX 4LZGA 4B9NA 5AKLA 2YN4A 2F8LA 4OJPA 5E79U 1BVSA 1Z1BA 3PW0A 7ICLA 5KFYA 3QU9A 1PVQA 1BNOA 5G5HA 2FMPA 4PH5A 1BPZA 3C2KA 9ICFA 1LV5A 4ECWA 3NVWA 3BJYA 4I2HA 4M6WA 4O3QA 1ZQGA 2ZG6A 3PX6A 3E58A 2E1FA 4NLKA 3TAQA 3SEIA 2KSOB 2JHDA 1SL0A 4IR1A 5ALKA 3UXPA 2LBOA 1SXEA 4QZIA 4F2SA 3I76A 5KNIA 4RPYA 1ZJNA 5EE0A 4BGDA 1JUDA 3GIKA 5KTQA 1X9SA 3H8JA 1NK8A 4PJ0U 4F2RA 3M6KA 3MDAA 4RQ6A 2XCPA 1A6SA 2V4QA 4O3MA 7ICEA 8ICXA 3HPOA 3CNHA 2KIVA 3GIJA 2BCQA 1QTMA 4YMOA 3KD3A 2HOFA 2QB1A 3C23A 2OHFA 3A0HU 4I2EA 5J0WA 4IRDA 2UVRA 4QIWF 5L9XA 2W9BB 2KIWA 1J97A 2WB1C 3BQTA 4IC9A 2HOQA 2XY5A 3C2LA 1S0VA 2AGOA 4ED7A 4RQ5A 8ICCA 5DB9A 4LJXA 4EBEA 9ICNA 4UB2A 4TUPA 2BDUA 3PO4A 2H5XA 3AU2A 3N4MB 2XGQA 3PMLA 2G07A 1SWVA 4JUZA 4O3SA 3WKEA 5KT6A 2RQ5A 5J2JA 5AI9A 7ICKA 4RNOA 3FC4A 2E8OA 4DFJA 5BPCA 2BDPA 2FJ6A 2I5HA 5KFVA 4KX5A 3MGVA 4EENA 5KFPA 5TZVA 5EOZA 2K4IA 3F5AA 5J2HA 2G08A 5ALVA 2OH2A 3UMBA 4CF3A 1QSSA 2FLPA 2EZYA 5AI0A 5J0OA 4RQMA 1N5XA 4BXOB 3PY8A 1S5LU 2VKQA 3I1YA 1B43A 5HHIA 4FO6A 1DGJA 1S97A 2E5SA 2G06A 4O5CA 3Q8RB 4QIWC 4J9NA 3WK5A 4J9QA 3T5JA 4CE6A 5DGBA 3JPTA 1XU4A 8ICYA 4PHEA 8ICTA 4BX9C 2YB4A 3LWLA 1ZQMA 4I2JA 1WG8A 1P7DA 5ALFA 3TADA 4JWMA 3MABA 2YMPA 4Y2UA 1COKA 3DDHA 3BS7A 4ACOA 3KHRA 4I27A 8ICLA 4DFKA 5ALGA 2R8JA 5KFNA 4MF2A 2NRWA 4J9PA 5DBBA 2W03A 3S6JA 3PSFA 3EPGA 2HHWA 1F5SA 9ICIA 3RH5A 4B9UA 3PR5B 1JN3A 4QZGA 8ICSA 2BCRA 3JPNA 2JRZA 4RQNA 4MFCA 1XNSA 1B22A 4P0QB 2KE7A 2WF8A 4Y2RA 2JMGA 1KW4A 4RQ2A 4RT2A 3AQFA 1MQ3A 2LYBA 1VLBA 2K89A 2QARA 5ALQA 1BPXA 3CYMA 9ICUA 1T3NA 2Q4TA 3QZ8A 1DK3A 1OUQA 1X42A 1LKYB 3BS5B 3KZXA 1ZD5A 2E1EA 2ZXIA 1QCKA 4TURA 4O3PA 3EW9A 3MC1A 1X9WA 2KN7A 5HHHA 1MA7A 1IXRA 2BKEA 5G5GA 4F4WA 1PVPA 5CEHA 2HHTA 4CF4A 2Z7JA 5AKHA 1N63A 5JU5A 1KKXA 1SKWA 2PFPA 2JR5A 2EAPA 5KFRA 1ZQPA 5J0YA 3F53A 2PFNA 1V97A 2IMWP 4BUGA 2WAQF 3RR7A 2K4EA 1MN8A 9ICWA 2W54A 5ALOA 4ELUA 5KT2A 5CRXA 2K4HA 1JMSA 1U4BA 3GFKB 3KZIU 4CF5A 4QWAA 1LKYA 1KBUA 3HKZC 4C8MA 2NRTA 1T3QA 4YR2A 1H38A 1DOQA 1ZQEA 2LM1A 1T7PA 3IP4B 1QH9A 2F77X 4R8UA 3G6YA 4Q43A 4F5RA 1N48A 1IM4A 1T4GA 1T94A 1QQ5A 2YB1A 5KG0A 3Q8LA 2FE9A 1A76A 2W9CA 2QLTA 3T3FA 2WTFA 4UARA 5KFJA 3NUQA 4Q45A 3QE9Y 3HKZF 2BQUA 3PNCA 2OEHA 4X5VA 3ZDBA 4DQIA 1XO1A 3EWAA 4HAIA 4YN4A 4YVZA 1QQ6A 4XQ8A 2HSZA 2E3TA 1MC8A 4BWJA 2ALZA 1CRXA 3QUBA 3PW7A 5HMMA 4A8EA 2PFQA 1PUZA 5KG4A 4ED6A 7ICTA 1KLNA 4OJ6A 4KLJA 2FDRA 4DL7A 1XO0A 1L8LA 1L7OA 1XS9D 2XY7A 4E0DA 5KFQA 3N97B 3TFRA 4DOBA 4IQUA 3PW2A 3MBYA 3VC8A 3GZFA 3T5HA 9ICLA 3OGUA 3ISCA 3SAHA 4TUQA 1LB2B 5IINA 1U45A 3OHBA 3LWMA 4YR0A 2W9MA 4UB6U 1HEKA 3TARA 2ZTEA 4I2AA 2BQ3A 2M0NA 3THVA 4AYBC 3KHLA 4DCCA 2KNJA 4QZFA 4ECQA 5AI8A 3H4DA 4P4PA 3E0FA 1ZQCA 4U6PA 4YMMA 3FAHA 4C7ZA 1A77A 2M9NA 3QU4A 5KFZA 1V85A 4J9SA 5KFFA 9ICEA 2YY6A 4M2YA 1JI7A 5BOLA 3D6JA 3ISBA 5AI6A 1KDHA 1LVHA 5J2KA 3TQ1A 3EZ5A 4YP3A 2WF9A 1NKBA 4RQ3A 4RQ1A 1NJYA 4C4TA 2HI0A 4HYKA 4QWCA 3AEVA 3D2NA 3FYHA 2MRLA 2DQNB 4J03A 4Y2SA 2RRDA 4ED3A 1BPYA 3C29A 8ICZA 4F92B 5AM1A 2BPCA 2XICA 5DG8A 2AU0A 2BQRA 1EXNA 1NJXA 1IV8A 3RF9A 4GC6A 4F5NA 4O3NA 4M9NA 2FI1A 1ZQTA 3D2QA 3BQ2A 2PMZC 4F8RA 2IA6A 5KFTA 5ALIA 1TVAA 2H3IA 3AL0B 4YQWA 3GV7B 2WHEA 3BZKA 4OJOA 2AQ0A 2KJ8A 2LMRA 2W3RA 2F1HA 4R8UB 3OSNA 3BZCA 4F5PA 1JROA 8ICEA 4PPXA 1ZQJA 2QKQA 5DLFA 4DO9A 4MFAA 2LI6A 9ICAA 1HUZA 4KLFA 3CP8A 5L1IA 2DPJA 4IQTA 4NL9A 1YZ6A 5AKGA 1UT5A 3IV6A 5AKYA 2ZJ8A 3T5LA 5AM5A 1SGGA 4G9BA 2JZBB 2LM4A 1ZD2P 2I1QA 2NRXA 9ICHA 4CCHA 4YG2A 1TFRA 1NJWA 3K1RB 4DSKA 3LK9A 1BPBA 2OXOA 3FM9A 5KFGA 4Y2TA 4QW8A 3ZI4A 4F50A 5ALXA 3QZ7A 2KEYA 4DF8A 1NOMA 1K5OA 2YMLA 2ZIWA 5KFIA 3LDAA 1OXJA 3UQ0A 3PX4A 1XC9A 1ZETA 4KX3A 4P0PA 2JV3A 3IHQB 1U48A 4XA5A 4J9RA 2A1AA 3KHHA 1QLNA 1TK0A 5KAIU 5J2CA 5HNKA 7ICHA 2KK0A 3RAXA 2HBKA 3TANA 5CP2A 1WYGA 4UB5A 3PW4A 4J9LA 4B9LA 2DL0A 3GIMA 4NWIA 4C4RA 5KFMA 1K1SA 2C2EA 4EELA
chains in the Genus database with same CATH topology
1SV4A 2GLEA 4PZNA 5JU5A 2QARB 1SV0A 1RG6A 1B4FA 2Y9TA 2EAPA 3HILA 2EAMA 1SXDA 1B0XA 2DKXA 2KIVA 2ES6A 2E8PA 2YTUA 1PK1B 5JTIA 2KSOA 2LMRA 3KKAA 2QB0A 2QB1A 2QB0B 1UCVA 2E8NA 2QKQA 1DXSA 2E8MA 2D8CA 1V38A 1LKYA 2F8KA 5JRTA 2LPEA 4NL9A 3TADA 1PK3A 2EAOA 2D3DA 1COKA 1SV0C 2L5YA 1SGGA 3BS7A 2K4PA 2DKZA 2F3NA 2KMDA 3SENA 4NL9C 1UQVA 2FE9A 4MHVA 2KG5A 2B6GA 3K1RB 5L1MA 1V85A 3BQ7A 5F3XB 3TADC 1JI7A 1WWVA 2F44A 1OXJA 3KKAC 4IS7A 4RQNA 2E8OA 1F0MA 1X40A 2K60A 5J8YA 2JV3A 3BS5A 2Y9UA 1X9XA 2KE7A 3IDWA 1PK1A 2EANA 3SEIA 1KW4A 2KSOB 3TACB 3H8MA 1OW5A 1Z1VA 2QARA 1SXEA 4PZOA 5KNIA 1LKYB 1WWUA 3BS5B 5J8YC 2DL0A 4RQMA 1X66A 2ESEA 4NJ8A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1SV4 A;  2GLE A;  4PZN A;  5JU5 A;  2QAR B;  1SV0 A;  1RG6 A;  1B4F A;  2Y9T A;  2EAP A;  3HIL A;  2EAM A;  1SXD A;  1B0X A;  2DKX A;  2KIV A;  2ES6 A;  2E8P A;  2YTU A;  1PK1 B;  5JTI A;  2KSO A;  2LMR A;  3KKA A;  2QB0 A;  2QB1 A;  2QB0 B;  1UCV A;  2E8N A;  2QKQ A;  1DXS A;  2E8M A;  2D8C A;  1V38 A;  1LKY A;  2F8K A;  5JRT A;  2LPE A;  4NL9 A;  3TAD A;  1PK3 A;  2EAO A;  2D3D A;  1COK A;  1SV0 C;  2L5Y A;  1SGG A;  3BS7 A;  2K4P A;  2DKZ A;  2F3N A;  2KMD A;  3SEN A;  4NL9 C;  1UQV A;  2FE9 A;  4MHV A;  2KG5 A;  2B6G A;  3K1R B;  5L1M A;  1V85 A;  3BQ7 A;  5F3X B;  3TAD C;  1JI7 A;  1WWV A;  2F44 A;  1OXJ A;  3KKA C;  4IS7 A;  4RQN A;  2E8O A;  1F0M A;  1X40 A;  2K60 A;  5J8Y A;  2JV3 A;  3BS5 A;  2Y9U A;  1X9X A;  2KE7 A;  3IDW A;  1PK1 A;  2EAN A;  3SEI A;  1KW4 A;  2KSO B;  3TAC B;  3H8M A;  1OW5 A;  1Z1V A;  2QAR A;  1SXE A;  4PZO A;  5KNI A;  1LKY B;  1WWU A;  3BS5 B;  5J8Y C;  2DL0 A;  4RQM A;  1X66 A;  2ESE A;  4NJ8 A; 
#chains in the Genus database with same CATH topology
 5KFE A;  4Y2Q A;  1VJ5 A;  4FS2 A;  4PZN A;  5ALP A;  1NKC A;  2YX8 A;  4ECX A;  1D8Y A;  8ICI A;  3NVV A;  5HR7 A;  3OSP A;  2AGQ A;  1B4F A;  2W43 A;  4LZD A;  2YQE A;  2P6U A;  2I9G A;  1BNP A;  3G6X A;  5AIB A;  1RZT A;  1ZQR A;  3B9J A;  2Y1J A;  1S77 D;  2IBK A;  2WAQ C;  4BJQ A;  2FLN A;  5ALL A;  4KLO A;  2HMX A;  4Y2P A;  2LPE A;  4UAU A;  3F2C A;  5IIO A;  3V6K A;  5KG3 A;  3RB4 A;  5AM0 A;  3MGI A;  4KLE A;  1UPH A;  1KFT A;  2RDI A;  4U7C A;  2IOF A;  1XWL A;  2FMQ A;  3EPI A;  3HRD D;  3RB6 A;  2FPK A;  2ISO A;  2ZIV A;  4I28 A;  2GWS A;  4QJF B;  2FPL A;  3MR6 A;  7ICF A;  2AXT U;  1D9D A;  2XO7 A;  2MA1 A;  3PW5 A;  1PZN A;  2D6F C;  3KFU F;  3HW8 A;  3MR3 A;  3BS5 A;  1X2I A;  2Y9U A;  3TI0 A;  3PO5 A;  2ZTD A;  4NLZ A;  5BOM A;  2KTQ A;  2KP7 A;  2F1J A;  4F4Z A;  3NVY A;  2WF6 A;  1UA1 A;  5AIA A;  4TUS A;  4PZO A;  2AQ4 A;  2EZX A;  2RP5 A;  3WK8 A;  4JMU A;  1ZQY A;  1CI4 A;  4QNL A;  3L5K A;  1PVR A;  4RZR A;  1TE2 A;  1X66 A;  4YXM A;  4O5E A;  4UB3 A;  4QZD A;  4C80 A;  8ICW A;  5DQI A;  2GLE A;  5EWE A;  2RDJ A;  5KG6 A;  2AGP A;  5DGA A;  4DS4 A;  3MFI A;  5HML A;  4F72 A;  1JX4 A;  2B21 A;  3RH6 A;  5EE1 A;  1SZP A;  1FEZ A;  1B0X A;  2ES6 A;  2I6X A;  5J0T A;  3OJS A;  5JTI A;  5EE9 A;  5DB7 A;  4FZM A;  3JPP A;  2DGZ A;  8ICF A;  3QUT A;  3NRW A;  7ICJ A;  4O3O A;  4NLG A;  4PHA A;  3EYZ A;  1ZRN A;  3TFS A;  1HIW A;  2R8K A;  2HBJ A;  2A19 A;  2DBY A;  4DFD A;  1NK9 A;  5KFB A;  4DL3 A;  4M0A A;  2JH1 A;  2K4P A;  2XVT A;  2W8L A;  4KLT A;  3ZDE A;  5J2A A;  3SEN A;  3RH4 A;  4DSL A;  4IRK A;  3HX0 A;  2HVH A;  2KVS A;  2DF4 B;  2P6R A;  1MSW D;  3WK4 A;  1WWV A;  4BWM A;  4QWD A;  4QZA A;  2F44 A;  3H0M B;  1UA0 A;  3V7K A;  5DB6 A;  4Z6D A;  3LVV A;  8ICG A;  4DQR A;  2KKV A;  4ED8 A;  5J29 A;  1JXE A;  4F4X A;  4PGQ A;  2CPR A;  2H3Z A;  2ISP A;  3GQC A;  5DDM A;  3GII A;  3ISD A;  4M9J A;  4QWE A;  2ZIW B;  5AK6 A;  1TKD A;  2ZIX B;  2O6K A;  3RTV A;  3PZP A;  4UQG A;  4EEK A;  1RM6 C;  4YD2 A;  3H7I A;  2ASL A;  1Q46 A;  5KAF U;  2K8C B;  2JZB A;  3B0Y A;  1ZD4 A;  1ZQW A;  4PHP A;  5DQG A;  4DEZ A;  2KZZ A;  2Y9T A;  4CRX A;  8ICR A;  2MSN A;  3HIL A;  3WKC A;  2DFL A;  4GXK A;  1L3S A;  5DLG A;  4RPZ A;  3HJE A;  2ZJA A;  4DL6 A;  1F44 A;  4NLN A;  4RQ7 A;  3JPS A;  4PL2 A;  1XSP A;  4I29 A;  4KLI A;  5KT3 A;  3SZ2 A;  1NK7 A;  4EYH B;  4MEY A;  2F8K A;  1RYU A;  3L3F X;  2MUT B;  4J9M A;  1FFV A;  2R8H A;  1D8L A;  1WUD A;  1FIQ A;  4BDP A;  2W55 A;  4GFJ A;  1J2M A;  1ZQH A;  9ICP A;  4RUA A;  1U9L A;  2H3F A;  2ZIX A;  2AJQ A;  3M7D A;  7ICN A;  2A3V A;  2KG5 A;  2AHO B;  3AUO A;  3PSI A;  2AH5 A;  4GC7 A;  5KG7 A;  2P35 A;  5KFX A;  4I2D A;  2FMS A;  3C1Z A;  4CDG A;  2KJ9 A;  5J0S A;  4KLD A;  2A1J A;  1Z00 B;  3KKA C;  4DFP A;  3B0X A;  5K4L A;  2HHU A;  1YZ7 A;  2K60 A;  4DLE A;  1N5W A;  5J8Y A;  2HVI A;  3M9O B;  1ZQS A;  9ICG A;  3N28 A;  4KLL A;  2VA8 A;  4MEX A;  2JGA A;  3SI8 A;  2Y0S F;  9ICQ A;  3M8S A;  4JV1 A;  9ICS A;  3TAC B;  3FDS A;  3H8M A;  2WFA A;  2OYY A;  3UM9 A;  5ALJ A;  5AM3 A;  2XC9 A;  4Z6C A;  2IHN A;  4UAS A;  4NJ8 A;  1N60 A;  2HW3 A;  3L4P A;  5AIC A;  1RG6 A;  2B0C A;  3IN5 A;  2R8G A;  4F3O A;  5J2D A;  4KLU A;  1NK0 A;  4DSI A;  3PST A;  3UXO A;  2LKY A;  5F9N A;  3ZD9 A;  3MDC A;  4KN4 A;  4QZE A;  3MGH A;  3SQI A;  4RNM A;  3RJG A;  1V38 A;  5L1J A;  3GIL A;  5ALZ A;  1BPD A;  1Z3E B;  9ICV A;  2PFO A;  3TAP A;  5IIJ A;  4P0Q A;  1BPE A;  4ZH4 A;  2NYV A;  4UB8 U;  5C0Y A;  5FP0 A;  1DGS A;  4ECU A;  1ZQ1 C;  4JWN A;  4DS5 A;  1ZQO A;  2DKZ A;  1K1Q A;  3M6Z A;  4MHV A;  3C1Y A;  4YMN A;  2J6U A;  4B9M A;  2KJ5 A;  5EWF A;  3UMG A;  3TAD C;  5KFU A;  4UBC A;  4DL5 A;  2WB1 F;  5CB1 A;  1ZQB A;  5AK3 A;  4UAV A;  1CEZ A;  3CW2 C;  3SYZ A;  1F0M A;  1NK6 A;  5AI5 A;  3IDW A;  3WU2 U;  3QX7 A;  2V9W A;  1TK5 A;  4DQS A;  1KL9 A;  8ICU A;  1C7Y A;  4KLH A;  5D4B A;  3H0R B;  4KMO B;  3AM9 A;  2P66 A;  9ICB A;  3TKA A;  4RNN A;  2G5I B;  3UQ2 A;  1J2N A;  4QZ9 A;  5J8Y C;  5D49 A;  2W9C B;  4ECR A;  3WKB A;  1Q8K A;  5B5E U;  4US8 A;  4DWI A;  8ICQ A;  1DRG A;  3MFH A;  3F2B A;  1SV4 A;  5AM4 A;  4MFF A;  1QSL A;  1SIJ A;  2PXI A;  5KFW A;  4PGY A;  1D9F A;  1ZQV A;  2W8K A;  4P4M A;  5DB8 A;  2H3V A;  1SWW A;  4EX7 A;  2EQY A;  1S10 A;  3RJH A;  5J0R A;  4KLG A;  4M9L A;  3HT3 A;  4UAW A;  2G5H B;  2BCV A;  1L7P A;  5KFO A;  4UAZ A;  3QEB Z;  2EAO A;  4IRC A;  3V6J A;  3WK6 A;  4C7Y A;  4C0Z A;  2UVV A;  1SL2 A;  7ICQ A;  4FZN A;  2FPM A;  5JUM A;  1X9M A;  1L5U A;  7ICG A;  1UQV A;  4ED1 A;  2KZM A;  3RJJ A;  8ICK A;  2EDU A;  1WCN A;  1ZQF A;  2HHV A;  4ECS A;  3RBD A;  2EH9 A;  1FO4 A;  5KT4 A;  3ZDA A;  3PR4 A;  4B9T A;  3U26 A;  3JPR A;  5KFS A;  1L6N A;  2ZIU B;  3GV8 B;  2IOH A;  3JPO A;  4KN7 A;  4IS7 A;  1Z00 A;  4I2F A;  5DG9 A;  9ICJ A;  3E2E A;  5KT5 A;  3QYP A;  4O3R A;  3AQE A;  1TAQ A;  2ZIV B;  4UB1 A;  3SAG A;  5ALT A;  3R9K A;  4GXJ A;  1RPL A;  1OW5 A;  1JAL A;  5KL1 B;  4M47 A;  3GDX A;  2K8A A;  1NZP A;  3GU3 A;  3M1Y A;  1WWU A;  1S9F A;  8ICB A;  1A0P A;  2PMZ F;  1ZQA A;  2IHM A;  2JXJ A;  4RQ4 A;  1WCL A;  5HP4 A;  3EUB 2;  2ZIU A;  1ZJM A;  5ALW A;  4KLS A;  5ALE A;  3RFA A;  5IIM A;  3DEE A;  3F5E A;  2V4R A;  4K4H A;  2MU2 A;  5J2I A;  1COO A;  1S0M A;  2KSO A;  1X6J A;  1MQ2 A;  3KKA A;  4QZB A;  3K1Z A;  4RUC A;  1UCV A;  2KZ3 A;  1M6Y A;  8ICN A;  2BCS A;  5CWR A;  3WK9 A;  2HHS A;  1ZQQ A;  3H8S A;  5JRT A;  1N56 A;  3ZD8 A;  5DBC A;  3N7R C;  3N7P D;  1ED1 A;  1SV0 C;  8ICV A;  4JV2 A;  1IIP A;  1V9P A;  3HP6 A;  9ICC A;  5J0X A;  4UAY A;  4USA A;  3SR6 A;  1O08 A;  3Q8Q B;  4B9S A;  1ZQN A;  2B6G A;  3RB0 A;  2NO4 A;  4AYB F;  5III A;  1ZQL A;  2KHQ A;  4C4S A;  3QU7 A;  4R64 A;  3RR8 A;  2J6S A;  3K4G A;  1BGX T;  1ZQX A;  3BQ0 A;  1NJZ A;  5IIL A;  3UXN A;  2JEJ A;  1YT3 A;  1RYR A;  2W9B A;  4I2C A;  3SV3 A;  5J0P A;  3QUQ A;  3BQ1 A;  1Q3U A;  4JV0 A;  9ICR A;  4I2I A;  4F91 B;  4UB4 A;  2W04 A;  4GXI A;  1KTQ A;  1KRP A;  2GO7 A;  2W7P A;  8ICA A;  2DWQ A;  1D8B A;  3IG5 A;  4QZH A;  1ECW A;  1RXW A;  4M04 A;  3BDP A;  7ICR A;  1L8O A;  3NS1 A;  4M9H A;  4R63 A;  5F9L A;  3M8R A;  4BXO A;  3V7J A;  2ESE A;  2JH7 A;  2ZUC A;  1TAM A;  3NGD A;  3KOO A;  5ALH A;  3MR2 A;  2Y1I A;  3CRX A;  3QU5 A;  3H8W A;  3OTQ A;  5L1L A;  1UT8 A;  2KFN A;  1HJP A;  4NLB A;  2WF7 A;  4DSF A;  5DKW A;  3KHG A;  4KLM A;  5CR0 A;  2E8N A;  4R65 A;  4MF8 A;  1FFU A;  4IQW A;  2G0A A;  4OCZ A;  4B9V A;  2PI4 A;  4LVS A;  2D8C A;  4DSE A;  4ELV A;  3QEA Z;  7ICI A;  4J9K A;  4NV0 A;  1L7M A;  1Z4N A;  3A0B U;  2LHT A;  1U49 A;  1UHU A;  4KMU A;  4DL4 A;  2NRV A;  4JB3 A;  2L5Y A;  2OM6 A;  4KIT B;  4ECT A;  1L3U A;  5KG5 A;  5ALR A;  3LVW A;  4QZC A;  1SB3 C;  4QWB A;  4ECZ A;  5GTH U;  4TQS A;  4UW9 A;  3QNM A;  2LYA A;  1KFS A;  1ZYQ A;  4EZ9 A;  5AKK A;  3QUC A;  4PL1 A;  3Q8K A;  2ZUD A;  4O0I A;  5D46 A;  8ICP A;  4PHD A;  4ED2 A;  4YR3 A;  4DQP A;  1ZQU A;  3UMC A;  2PKE A;  1RDF A;  1XSL A;  3QU2 A;  3RJE A;  4XRH A;  5DG7 A;  3ETR A;  4FE3 A;  4NM2 A;  4Y2V A;  3Q8M A;  2PI5 A;  4F5Q A;  2LYH A;  3V6H A;  2W7O A;  3ZDC A;  3V72 A;  5TIS U;  3SD7 A;  3RJK A;  4DFM A;  2XY6 A;  1S8O A;  5CJ7 A;  2HCF A;  2ZUB A;  3PMN A;  4KTQ A;  2ZJ5 A;  4EBC A;  4ZOH C;  2GOL A;  3G6V A;  2CXY A;  4CGZ A;  3I28 A;  4Y2J A;  5KFC A;  4ICA A;  2BCU A;  5J2E A;  4RU9 A;  5DQH A;  2EAM A;  1L3V A;  1PK1 B;  1CUK A;  3ICX A;  3C2M A;  1L7N A;  2YMM A;  4QZ8 A;  1URJ A;  2VAN A;  4R66 A;  9ICT A;  2ZXH A;  3T79 A;  4C8N A;  3ZDD A;  5ALU A;  2VA2 A;  3DV9 A;  3J81 j;  3AU6 A;  2HOI A;  2D3D A;  3UPQ A;  2ZTC A;  5L1K A;  3OJU A;  3SV4 A;  4AP9 A;  2NRZ A;  4DL2 A;  1NK4 A;  3SAF A;  4UBB A;  2WF5 A;  3IM1 A;  4FBU A;  5L1M A;  4IQV A;  1SZH A;  4Y2X A;  2EZZ A;  4Q44 A;  2DPI A;  3Q8P B;  3C21 A;  4F71 A;  1SL1 A;  2BPF A;  2FLL A;  2Y0S C;  3PSP A;  9ICO A;  2BHN A;  1U47 A;  5ALD A;  4K4I A;  1HUO A;  2GH1 A;  1VDV A;  5HR6 A;  1KEJ A;  2XID A;  1X40 A;  4NXZ A;  3V7L A;  2BZF A;  3H4B A;  4DSJ A;  2OWO A;  2EAN A;  2NV3 A;  5KG1 A;  7ICV A;  4NM1 A;  3C5G A;  3K75 D;  1IG6 A;  3KTQ A;  2CRX A;  8ICM A;  1KN5 A;  9ICM A;  3RRG A;  2XI9 A;  5J2F A;  9ICK A;  1O03 A;  5KG2 A;  3NTU A;  2UVU A;  3PX0 A;  2VIX A;  2RHF A;  5J0U A;  1ZD3 A;  4GIB A;  4UAT A;  1SV0 A;  2HBM A;  1SKS A;  7ICU A;  1ZOL A;  2C22 A;  3ORY A;  4EBD A;  2K8B B;  1Z19 A;  4OD0 A;  2H3Q A;  4EYI B;  2DKX A;  5AM2 A;  5CA7 A;  2W9A A;  2MAX A;  3IG8 A;  3RB3 A;  2RLT A;  5KT7 A;  1T8E A;  4FZL A;  2QB0 B;  4I2B A;  2C28 A;  4TQR A;  2IOF K;  1DXS A;  5GTI U;  4ECV A;  1NKE A;  3C28 A;  4EEY A;  4GLX A;  3IRU A;  1JRP A;  3M9M B;  2NO5 A;  4OJ5 A;  2KFZ A;  3RAQ A;  3ALR A;  2OCE A;  1ZQI A;  1RYS A;  5AKE A;  5KFA A;  3NAS A;  5J0Q A;  1NZB A;  4EZ6 A;  5IIK A;  4IL6 U;  4O5K A;  4OJL A;  4RQ0 A;  4Z6F A;  2ODG A;  1SKR A;  4JK1 A;  4F93 B;  4NLC A;  4B6J A;  5F3X B;  9ICX A;  1NI3 A;  1NNL A;  1JIH A;  3N7S C;  5H2F U;  4RT3 A;  5ALS A;  2KKP A;  1TAU A;  2F76 X;  2W3S A;  4M6W B;  4YD1 A;  4FFD A;  3H0L B;  7ICM A;  2C2D A;  4FS1 A;  1Q3V A;  2KVC A;  2KV2 A;  4ELT A;  2YMQ A;  3WKD A;  5A0L A;  5KFH A;  5AK5 A;  4F4Y A;  1Z1V A;  4FBT A;  4NY8 A;  3GV5 B;  2HDO A;  1C20 A;  8ICO A;  3AN1 A;  3OPX A;  5KFD A;  1KSP A;  5AK4 A;  1JXL A;  1DK2 A;  3ETL A;  4C8L A;  2R8I A;  2JEF A;  2VA3 A;  3LYS A;  5AI4 A;  2F1I A;  1ZXI A;  3ED5 A;  4IR9 A;  2W11 A;  3D2S A;  1N62 A;  2XCA A;  1XSN A;  2HHQ A;  2JEG A;  1S0O A;  2QAR B;  4CNQ A;  5CHG A;  2KIC A;  2C2R A;  4Z6E A;  3O0F A;  3F2D A;  3H40 A;  5AKI A;  3T5K A;  4DQQ A;  2E8P A;  2YTU A;  4DOA A;  4XUS A;  3RBE A;  4I2G A;  4WJ3 B;  7ICO A;  3PV8 A;  8ICJ A;  3NVZ A;  3KBB A;  1ZQK A;  3RRH A;  2VJ4 A;  5DDY A;  5ALN A;  3OHA A;  2N1R A;  1TK8 A;  4P2H A;  2KD1 A;  1N61 A;  4G3I A;  4YCX A;  5ALY A;  4YFK A;  2F2A B;  5T14 A;  2CN1 A;  3M9N B;  4Y2Y A;  2F3N A;  3VCB A;  2G09 A;  1S0N A;  3RJF A;  4C8O A;  8ICH A;  4P0P B;  1L3T A;  3QXG A;  4C8K A;  2ASJ A;  5J2G A;  5KFK A;  7ICP A;  3BQ7 A;  1X6I A;  2DUY A;  4M9G A;  5EWG A;  3HWT A;  3WKA A;  5DBA A;  2JEI A;  2ATL A;  4PGX A;  1Z4O A;  5AKJ A;  3SMV A;  5KL8 B;  1Y88 A;  1X9X A;  1PK1 A;  1ZQD A;  5EE3 A;  2J6T A;  5AKZ A;  2VJ5 A;  1RXV A;  1S76 D;  4J9O A;  1NK5 A;  2R18 A;  5KFL A;  4OO1 J;  4YXJ A;  4F4K A;  1N2X A;  5ALM A;  4EX6 A;  2BGW A;  3RJI A;  1KFD A;  1AQ6 A;  2KHV A;  1QSY A;  3C5F A;  1ZQZ A;  1RQN A;  4US9 A;  7ICS A;  4KLQ A;  5J2B A;  3AMZ A;  4O9M A;  3JPQ A;  4DF4 A;  2KOB A;  1ZRM A;  5C5J A;  3NRZ A;  4ED0 A;  4RPX A;  1SXD A;  2MUT A;  2HHX A;  4F5O A;  4RQ8 A;  4ECY A;  3MR5 A;  3ONN A;  4QW9 A;  1GO3 F;  2QB0 A;  4Q8F A;  4Q8E A;  5AHX A;  2E8M A;  3PVX A;  4DOC A;  1ARO P;  4DLG A;  1PK3 A;  2BPG A;  2XGP A;  1TV9 A;  2BR0 A;  3Q8S B;  2A1J B;  3WK7 A;  5AKX A;  1KQQ A;  2KMD A;  2ASD A;  4K4G A;  2HBL A;  4P4O A;  2UVW A;  1RQL A;  4NL9 C;  5B66 U;  1QQ7 A;  2Q0Z X;  4LZG A;  4B9N A;  5AKL A;  2YN4 A;  2F8L A;  4OJP A;  5E79 U;  1BVS A;  1Z1B A;  3PW0 A;  7ICL A;  5KFY A;  3QU9 A;  1PVQ A;  1BNO A;  5G5H A;  2FMP A;  4PH5 A;  1BPZ A;  3C2K A;  9ICF A;  1LV5 A;  4ECW A;  3NVW A;  3BJY A;  4I2H A;  4M6W A;  4O3Q A;  1ZQG A;  2ZG6 A;  3PX6 A;  3E58 A;  2E1F A;  4NLK A;  3TAQ A;  3SEI A;  2KSO B;  2JHD A;  1SL0 A;  4IR1 A;  5ALK A;  3UXP A;  2LBO A;  1SXE A;  4QZI A;  4F2S A;  3I76 A;  5KNI A;  4RPY A;  1ZJN A;  5EE0 A;  4BGD A;  1JUD A;  3GIK A;  5KTQ A;  1X9S A;  3H8J A;  1NK8 A;  4PJ0 U;  4F2R A;  3M6K A;  3MDA A;  4RQ6 A;  2XCP A;  1A6S A;  2V4Q A;  4O3M A;  7ICE A;  8ICX A;  3HPO A;  3CNH A;  2KIV A;  3GIJ A;  2BCQ A;  1QTM A;  4YMO A;  3KD3 A;  2HOF A;  2QB1 A;  3C23 A;  2OHF A;  3A0H U;  4I2E A;  5J0W A;  4IRD A;  2UVR A;  4QIW F;  5L9X A;  2W9B B;  2KIW A;  1J97 A;  2WB1 C;  3BQT A;  4IC9 A;  2HOQ A;  2XY5 A;  3C2L A;  1S0V A;  2AGO A;  4ED7 A;  4RQ5 A;  8ICC A;  5DB9 A;  4LJX A;  4EBE A;  9ICN A;  4UB2 A;  4TUP A;  2BDU A;  3PO4 A;  2H5X A;  3AU2 A;  3N4M B;  2XGQ A;  3PML A;  2G07 A;  1SWV A;  4JUZ A;  4O3S A;  3WKE A;  5KT6 A;  2RQ5 A;  5J2J A;  5AI9 A;  7ICK A;  4RNO A;  3FC4 A;  2E8O A;  4DFJ A;  5BPC A;  2BDP A;  2FJ6 A;  2I5H A;  5KFV A;  4KX5 A;  3MGV A;  4EEN A;  5KFP A;  5TZV A;  5EOZ A;  2K4I A;  3F5A A;  5J2H A;  2G08 A;  5ALV A;  2OH2 A;  3UMB A;  4CF3 A;  1QSS A;  2FLP A;  2EZY A;  5AI0 A;  5J0O A;  4RQM A;  1N5X A;  4BXO B;  3PY8 A;  1S5L U;  2VKQ A;  3I1Y A;  1B43 A;  5HHI A;  4FO6 A;  1DGJ A;  1S97 A;  2E5S A;  2G06 A;  4O5C A;  3Q8R B;  4QIW C;  4J9N A;  3WK5 A;  4J9Q A;  3T5J A;  4CE6 A;  5DGB A;  3JPT A;  1XU4 A;  8ICY A;  4PHE A;  8ICT A;  4BX9 C;  2YB4 A;  3LWL A;  1ZQM A;  4I2J A;  1WG8 A;  1P7D A;  5ALF A;  3TAD A;  4JWM A;  3MAB A;  2YMP A;  4Y2U A;  1COK A;  3DDH A;  3BS7 A;  4ACO A;  3KHR A;  4I27 A;  8ICL A;  4DFK A;  5ALG A;  2R8J A;  5KFN A;  4MF2 A;  2NRW A;  4J9P A;  5DBB A;  2W03 A;  3S6J A;  3PSF A;  3EPG A;  2HHW A;  1F5S A;  9ICI A;  3RH5 A;  4B9U A;  3PR5 B;  1JN3 A;  4QZG A;  8ICS A;  2BCR A;  3JPN A;  2JRZ A;  4RQN A;  4MFC A;  1XNS A;  1B22 A;  4P0Q B;  2KE7 A;  2WF8 A;  4Y2R A;  2JMG A;  1KW4 A;  4RQ2 A;  4RT2 A;  3AQF A;  1MQ3 A;  2LYB A;  1VLB A;  2K89 A;  2QAR A;  5ALQ A;  1BPX A;  3CYM A;  9ICU A;  1T3N A;  2Q4T A;  3QZ8 A;  1DK3 A;  1OUQ A;  1X42 A;  1LKY B;  3BS5 B;  3KZX A;  1ZD5 A;  2E1E A;  2ZXI A;  1QCK A;  4TUR A;  4O3P A;  3EW9 A;  3MC1 A;  1X9W A;  2KN7 A;  5HHH A;  1MA7 A;  1IXR A;  2BKE A;  5G5G A;  4F4W A;  1PVP A;  5CEH A;  2HHT A;  4CF4 A;  2Z7J A;  5AKH A;  1N63 A;  5JU5 A;  1KKX A;  1SKW A;  2PFP A;  2JR5 A;  2EAP A;  5KFR A;  1ZQP A;  5J0Y A;  3F53 A;  2PFN A;  1V97 A;  2IMW P;  4BUG A;  2WAQ F;  3RR7 A;  2K4E A;  1MN8 A;  9ICW A;  2W54 A;  5ALO A;  4ELU A;  5KT2 A;  5CRX A;  2K4H A;  1JMS A;  1U4B A;  3GFK B;  3KZI U;  4CF5 A;  4QWA A;  1LKY A;  1KBU A;  3HKZ C;  4C8M A;  2NRT A;  1T3Q A;  4YR2 A;  1H38 A;  1DOQ A;  1ZQE A;  2LM1 A;  1T7P A;  3IP4 B;  1QH9 A;  2F77 X;  4R8U A;  3G6Y A;  4Q43 A;  4F5R A;  1N48 A;  1IM4 A;  1T4G A;  1T94 A;  1QQ5 A;  2YB1 A;  5KG0 A;  3Q8L A;  2FE9 A;  1A76 A;  2W9C A;  2QLT A;  3T3F A;  2WTF A;  4UAR A;  5KFJ A;  3NUQ A;  4Q45 A;  3QE9 Y;  3HKZ F;  2BQU A;  3PNC A;  2OEH A;  4X5V A;  3ZDB A;  4DQI A;  1XO1 A;  3EWA A;  4HAI A;  4YN4 A;  4YVZ A;  1QQ6 A;  4XQ8 A;  2HSZ A;  2E3T A;  1MC8 A;  4BWJ A;  2ALZ A;  1CRX A;  3QUB A;  3PW7 A;  5HMM A;  4A8E A;  2PFQ A;  1PUZ A;  5KG4 A;  4ED6 A;  7ICT A;  1KLN A;  4OJ6 A;  4KLJ A;  2FDR A;  4DL7 A;  1XO0 A;  1L8L A;  1L7O A;  1XS9 D;  2XY7 A;  4E0D A;  5KFQ A;  3N97 B;  3TFR A;  4DOB A;  4IQU A;  3PW2 A;  3MBY A;  3VC8 A;  3GZF A;  3T5H A;  9ICL A;  3OGU A;  3ISC A;  3SAH A;  4TUQ A;  1LB2 B;  5IIN A;  1U45 A;  3OHB A;  3LWM A;  4YR0 A;  2W9M A;  4UB6 U;  1HEK A;  3TAR A;  2ZTE A;  4I2A A;  2BQ3 A;  2M0N A;  3THV A;  4AYB C;  3KHL A;  4DCC A;  2KNJ A;  4QZF A;  4ECQ A;  5AI8 A;  3H4D A;  4P4P A;  3E0F A;  1ZQC A;  4U6P A;  4YMM A;  3FAH A;  4C7Z A;  1A77 A;  2M9N A;  3QU4 A;  5KFZ A;  1V85 A;  4J9S A;  5KFF A;  9ICE A;  2YY6 A;  4M2Y A;  1JI7 A;  5BOL A;  3D6J A;  3ISB A;  5AI6 A;  1KDH A;  1LVH A;  5J2K A;  3TQ1 A;  3EZ5 A;  4YP3 A;  2WF9 A;  1NKB A;  4RQ3 A;  4RQ1 A;  1NJY A;  4C4T A;  2HI0 A;  4HYK A;  4QWC A;  3AEV A;  3D2N A;  3FYH A;  2MRL A;  2DQN B;  4J03 A;  4Y2S A;  2RRD A;  4ED3 A;  1BPY A;  3C29 A;  8ICZ A;  4F92 B;  5AM1 A;  2BPC A;  2XIC A;  5DG8 A;  2AU0 A;  2BQR A;  1EXN A;  1NJX A;  1IV8 A;  3RF9 A;  4GC6 A;  4F5N A;  4O3N A;  4M9N A;  2FI1 A;  1ZQT A;  3D2Q A;  3BQ2 A;  2PMZ C;  4F8R A;  2IA6 A;  5KFT A;  5ALI A;  1TVA A;  2H3I A;  3AL0 B;  4YQW A;  3GV7 B;  2WHE A;  3BZK A;  4OJO A;  2AQ0 A;  2KJ8 A;  2LMR A;  2W3R A;  2F1H A;  4R8U B;  3OSN A;  3BZC A;  4F5P A;  1JRO A;  8ICE A;  4PPX A;  1ZQJ A;  2QKQ A;  5DLF A;  4DO9 A;  4MFA A;  2LI6 A;  9ICA A;  1HUZ A;  4KLF A;  3CP8 A;  5L1I A;  2DPJ A;  4IQT A;  4NL9 A;  1YZ6 A;  5AKG A;  1UT5 A;  3IV6 A;  5AKY A;  2ZJ8 A;  3T5L A;  5AM5 A;  1SGG A;  4G9B A;  2JZB B;  2LM4 A;  1ZD2 P;  2I1Q A;  2NRX A;  9ICH A;  4CCH A;  4YG2 A;  1TFR A;  1NJW A;  3K1R B;  4DSK A;  3LK9 A;  1BPB A;  2OXO A;  3FM9 A;  5KFG A;  4Y2T A;  4QW8 A;  3ZI4 A;  4F50 A;  5ALX A;  3QZ7 A;  2KEY A;  4DF8 A;  1NOM A;  1K5O A;  2YML A;  2ZIW A;  5KFI A;  3LDA A;  1OXJ A;  3UQ0 A;  3PX4 A;  1XC9 A;  1ZET A;  4KX3 A;  4P0P A;  2JV3 A;  3IHQ B;  1U48 A;  4XA5 A;  4J9R A;  2A1A A;  3KHH A;  1QLN A;  1TK0 A;  5KAI U;  5J2C A;  5HNK A;  7ICH A;  2KK0 A;  3RAX A;  2HBK A;  3TAN A;  5CP2 A;  1WYG A;  4UB5 A;  3PW4 A;  4J9L A;  4B9L A;  2DL0 A;  3GIM A;  4NWI A;  4C4R A;  5KFM A;  1K1S A;  2C2E A;  4EEL A; 
#chains in the Genus database with same CATH homology
 1SV4 A;  2GLE A;  4PZN A;  5JU5 A;  2QAR B;  1SV0 A;  1RG6 A;  1B4F A;  2Y9T A;  2EAP A;  3HIL A;  2EAM A;  1SXD A;  1B0X A;  2DKX A;  2KIV A;  2ES6 A;  2E8P A;  2YTU A;  1PK1 B;  5JTI A;  2KSO A;  2LMR A;  3KKA A;  2QB0 A;  2QB1 A;  2QB0 B;  1UCV A;  2E8N A;  2QKQ A;  1DXS A;  2E8M A;  2D8C A;  1V38 A;  1LKY A;  2F8K A;  5JRT A;  2LPE A;  4NL9 A;  3TAD A;  1PK3 A;  2EAO A;  2D3D A;  1COK A;  1SV0 C;  2L5Y A;  1SGG A;  3BS7 A;  2K4P A;  2DKZ A;  2F3N A;  2KMD A;  3SEN A;  4NL9 C;  1UQV A;  2FE9 A;  4MHV A;  2KG5 A;  2B6G A;  3K1R B;  5L1M A;  1V85 A;  3BQ7 A;  5F3X B;  3TAD C;  1JI7 A;  1WWV A;  2F44 A;  1OXJ A;  3KKA C;  4IS7 A;  4RQN A;  2E8O A;  1F0M A;  1X40 A;  2K60 A;  5J8Y A;  2JV3 A;  3BS5 A;  2Y9U A;  1X9X A;  2KE7 A;  3IDW A;  1PK1 A;  2EAN A;  3SEI A;  1KW4 A;  2KSO B;  3TAC B;  3H8M A;  1OW5 A;  1Z1V A;  2QAR A;  1SXE A;  4PZO A;  5KNI A;  1LKY B;  1WWU A;  3BS5 B;  5J8Y C;  2DL0 A;  4RQM A;  1X66 A;  2ESE A;  4NJ8 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...