1SV0C

Crystal structure of yan-sam/mae-sam complex
Total Genus 27
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
27
sequence length
82
structure length
82
Chain Sequence
PLGSDGLPLDPRDWTRADVWKWLINMAVSEGLEVTAELPQKFPMNGKALCLMSLDMYLCRVPVGGKMLYRDFRVRLARAMSR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Ets DNA-binding protein pokkuri
publication title Derepression by depolymerization; structural insights into the regulation of yan by mae.
pubmed doi rcsb
source organism Drosophila melanogaster
molecule tags Transcription
total genus 27
structure length 82
sequence length 82
chains with identical sequence D
ec nomenclature
pdb deposition date 2004-03-26
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.50 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 Transcription Factor, Ets-1 1sv0C00
2E8PA 2ES6A 2K4PA 2QARB 2ESEA 3KKAC 2KIVA 1UQVA 1JI7A 2DL0A 1B0XA 2F8KA 2K60A 4NL9C 1RG6A 2DKXA 1Z1VA 2QB0B 2QB1A 2EAOA 1COKA 1X66A 1OW5A 2QKQA 1SXDA 2KMDA 1DXSA 2GLEA 1X40A 2EAPA 1X9XA 2B6GA 4NJ8A 2Y9TA 1PK1B 4PZOA 2JV3A 5JRTA 2YTUA 3IDWA 1UCVA 2F44A 2KG5A 3SEIA 3TADC 2Y9UA 3BS5B 5L1MA 3TADA 1SV4A 1V85A 4PZNA 3SENA 5JTIA 1SV0A 2FE9A 2L5YA 1B4FA 2E8OA 2EANA 2KSOA 1SXEA 5F3XB 3TACB 5KNIA 4RQNA 1F0MA 1LKYA 4RQMA 1PK3A 2LMRA 2E8NA 1WWVA 3BS7A 1SV0C 2E8MA 2F3NA 2D8CA 2EAMA 5J8YA 1SGGA 1OXJA 2QARA 1PK1A 1V38A 2KSOB 2LPEA 3KKAA 3BQ7A 2KE7A 2QB0A 3BS5A 3K1RB 4NL9A 5JU5A 1KW4A 1WWUA 3H8MA 1LKYB 4MHVA 2D3DA 3HILA 5J8YC 4IS7A 2DKZA
chains in the Genus database with same CATH superfamily
4ECVA 2ES6A 2K4PA 1PVRA 4RUAA 4M9LA 1Y88A 4O3NA 4GC7A 7ICHA 1ZQYA 1QQ5A 1L3UA 3K1ZA 4NM1A 2DUYA 8ICRA 4RQ7A 5EWGA 4FZLA 3HJEA 1ZOLA 2XCPA 3OTQA 5IIIA 1DXSA 3Q8LA 3QUQA 4J9KA 3TARA 2A1AA 2BPCA 4NLNA 5DQGA 1Q3UA 3IN5A 2JV3A 2AHOB 5BPCA 2ZIXA 4F92B 4F5OA 3RH6A 5DLFA 2LYAA 3UXPA 7ICTA 5J0OA 1CEZA 2W8KA 1ZXIA 5AKZA 3NUQA 4DLEA 4DQRA 3KD3A 3H8SA 2XC9A 1KLNA 4MEXA 3BQ2A 2HMXA 3H4BA 3CW2C 3MC1A 3H0MB 2N1RA 3WK8A 2HHXA 2EH9A 5DB6A 2PKEA 3IRUA 1ZQUA 5DLGA 3SAGA 5KFCA 1MC8A 4QIWF 3NVZA 1ZQGA 2LHTA 1ZQOA 5J2GA 4OJOA 1Z00A 4I2GA 4I2DA 4K4HA 1SGGA 4UAZA 2VA8A 2KSOB 3NASA 4DL4A 1NOMA 4NLBA 2EQYA 1K1QA 2P6UA 1FO4A 2HBMA 4QZ9A 3KHLA 3MR3A 2NV3A 4FBTA 1NJYA 2F1IA 8ICGA 2P35A 5L9XA 2E8PA 4Q8EA 5EE1A 2C22A 5EE3A 3RFAA 4UBCA 5KFOA 3KOOA 1Z1VA 5AIAA 1OW5A 2WHEA 3TFRA 2CN1A 4Q8FA 4BUGA 2ASJA 5AKXA 4BDPA 9ICRA 2DF4B 9ICIA 3C1ZA 2PFPA 2KZMA 2UVRA 4BXOB 4RUCA 3OHAA 4DLGA 2NRVA 1N56A 1UCVA 2RQ5A 2KZ3A 3H8JA 2G07A 5H2FU 2FMSA 5KG1A 2Q0ZX 7ICPA 1ZRNA 4YXMA 3GZFA 5AI4A 4PZNA 4B9NA 4ED6A 1QQ7A 4C80A 5J2CA 1S0NA 4CDGA 4JWMA 1NK7A 4KLLA 2ZIWB 2K8AA 2XICA 4RNOA 1NK0A 9ICAA 2E3TA 2W9CA 1ZQRA 3Q8QB 2IA6A 1J97A 3VCBA 4F91B 4IRDA 2ZJAA 8ICPA 3KHHA 2YMLA 3QE9Y 4KX3A 2BQ3A 4ECZA 2ODGA 4NXZA 2F2AB 1TK5A 2HBLA 9ICMA 1SB3C 2DWQA 3QUBA 2FLPA 2H3IA 2WAQC 4RQ3A 3RJFA 2LM4A 2F76X 2VIXA 2ZTEA 1WYGA 3H7IA 4IS7A 4RNMA 4ZOHC 2JZBB 1ZQAA 2YY6A 3KKAC 2ISPA 1ZD3A 2K4IA 4UB3A 8ICBA 4NLZA 3OSNA 4ED1A 1COOA 1D8YA 1X6IA 4Q45A 2W43A 9ICXA 5AKGA 8ICSA 3V6HA 3RJHA 1RQNA 2RDJA 7ICNA 2HW3A 1JROA 2ASLA 4I2BA 4YMOA 4IRCA 1DK3A 4YP3A 4DSKA 1U49A 2ISOA 3RRHA 4RQ0A 4ECUA 3EYZA 3SEIA 4QW9A 4KTQA 9ICVA 5ALSA 1SV4A 4JK1A 1YT3A 4FE3A 3MR2A 3AU6A 4IRKA 5KFNA 3MBYA 4GXKA 4ELTA 5ALMA 2B0CA 3PO4A 3ZDEA 4P4PA 5IIKA 2G06A 5KL8B 2W3RA 4RQNA 3Q8SB 1ZQXA 1EXNA 4UAWA 1M6YA 5AK3A 2FPKA 3ALRA 2OM6A 1UT5A 3KBBA 1DRGA 2EAMA 4MF2A 4B9SA 4PHAA 2W8LA 5AKEA 1PK1A 3J81j 2BR0A 4Q43A 2PI4A 3ISDA 1DK2A 1SWWA 2XCAA 3KKAA 1WCLA 4OCZA 4UARA 4OD0A 3BQ7A 3SQIA 4KMUA 4DWIA 3M1YA 1L7OA 5IIMA 4QZFA 4F4ZA 9ICWA 4ZH4A 1CRXA 3ORYA 4EX7A 2A3VA 2OHFA 4WJ3B 3HILA 4Y2VA 4C4TA 5KT7A 4ICAA 1KRPA 1KKXA 4P0PB 4F5RA 4NLCA 3F2DA 3PMLA 1Z3EB 1ZQBA 2MSNA 3SV3A 2NYVA 1X6JA 4QZDA 2QB1A 4GLXA 3O0FA 4CGZA 1BVSA 3KFUF 7ICSA 1Q46A 2W55A 4HAIA 4DS5A 2IOFA 4JB3A 2V4RA 2NRXA 3Q8KA 5KFQA 3PZPA 1KSPA 7ICIA 7ICQA 8ICMA 4YR0A 4GXIA 3QXGA 4R8UA 5KFUA 2ASDA 5ALYA 2ZUBA 4PHDA 4F2SA 3EPIA 1ZETA 3PSTA 5J2FA 1NKCA 2JEJA 4P4OA 2HOIA 1PVPA 1S0MA 4J9MA 2HBKA 2EANA 2NRWA 4MFAA 4YFKA 3TACB 5KNIA 3PW4A 2ZIXB 3AQFA 7ICMA 5KG7A 1N63A 3JPOA 4DEZA 1LB2B 5D46A 4EBEA 4KLOA 1PK3A 3D2NA 4RT2A 4JMUA 1Z4NA 3BS7A 2G09A 5J2KA 5AI8A 2GH1A 1BGXT 2WF5A 3F5EA 4M2YA 5G5HA 2IHMA 2KEYA 4P0QB 3T5JA 4AYBF 1SWVA 3TI0A 3T5HA 2FI1A 3PY8A 2W9MA 5BOMA 1JRPA 2WF8A 5D49A 1Z00B 4DFPA 3SZ2A 5KG4A 3L5KA 2HHTA 2K4HA 2Y0SF 4OJ5A 2ESEA 2KIVA 2EZYA 1NJXA 4O5KA 1RG6A 1KTQA 3TFSA 1C20A 4C8OA 1T4GA 1AROP 3M6KA 4NLGA 4F4YA 1N5WA 2MAXA 1X40A 3UQ2A 3M7DA 5HR6A 4DFMA 4C8NA 4NJ8A 3PNCA 4IQUA 4OJ6A 4DQQA 3H0LB 4IC9A 2A19A 2AH5A 4ELVA 3RR7A 3TADA 5KFHA 5J29A 2M0NA 4KLDA 2OXOA 2J6TA 9ICNA 1L7NA 3RBEA 5AHXA 2PMZF 5DGBA 4F4KA 2KD1A 5J0RA 1MA7A 3GIKA 4IR1A 4QWAA 5AI6A 2I9GA 1SV0C 3EUB2 1NJWA 3PX6A 2F3NA 4RPZA 2IOHA 3UMGA 4JUZA 8ICJA 5B66U 2KKVA 3HP6A 1U47A 2HOFA 4IQTA 4OJLA 3N7RC 4IL6U 3DDHA 3WKCA 5J0WA 2WTFA 1TAQA 3M9MB 2CPRA 3NRWA 3C2KA 1D8LA 1KL9A 4RPYA 5KFZA 4FO6A 2E1EA 2M9NA 2C2RA 1ZJNA 7ICOA 3C21A 3ONNA 2P6RA 4Q44A 4US9A 4Y2JA 1ZQ1C 2H3QA 2RRDA 5KFYA 4Z6EA 8ICTA 5KG3A 3V6KA 9ICPA 1JI7A 4C4SA 4F93B 3NGDA 1RYUA 3CYMA 4RT3A 3QNMA 4KLJA 1X66A 1VJ5A 2F8LA 5KAFU 1X9WA 4EZ9A 1TK8A 4FS1A 2KMDA 4DQIA 2GLEA 4FZMA 5HMMA 5ALUA 2Z7JA 3JPNA 2BCRA 4QWBA 5DDMA 1OUQA 5HR7A 2BDPA 3BZCA 1QQ6A 5KFSA 5DBBA 2OEHA 4IQVA 3PSIA 5KFBA 2K8BB 9ICTA 1GO3F 2IBKA 4CCHA 3V6JA 1SV0A 3RJIA 3F5AA 4C4RA 2ZJ5A 3N4MB 1HUZA 5CHGA 1L3TA 4Y2QA 8ICZA 4TUPA 5DKWA 2BPFA 2NRTA 2JGAA 5DB7A 4OJPA 3QU5A 1C7YA 2CRXA 2GO7A 1L5UA 4M6WA 5J0UA 3QX7A 2R8GA 2HOQA 2KN7A 2WB1F 3BS5A 1QSLA 2XY7A 4TQRA 5KFAA 3GIJA 4C8KA 2WFAA 5KT5A 4MHVA 3ZDDA 4I2AA 1MSWD 4UB1A 2H3FA 3FC4A 5DDYA 3RB0A 4P2HA 4R65A 2RLTA 4Z6DA 3IG8A 1A76A 3RRGA 1TE2A 4OO1J 5DBCA 4RPXA 3NVVA 1SKSA 5KT2A 3RJJA 2BKEA 2R8HA 2LKYA 4O0IA 3N7SC 3MGIA 1ZQZA 5AKYA 3K75D 1WCNA 8ICAA 2EDUA 2KP7A 4Y2YA 1D9FA 4I2JA 3ED5A 4J9QA 7ICKA 3S6JA 3WKBA 5AM2A 4PPXA 4MFFA 5IILA 4RQ8A 3V7KA 7ICUA 4USAA 2LM1A 4QZHA 2KG5A 1Z4OA 4ECYA 3AM9A 1X9SA 2PXIA 4Y2PA 3K4GA 3JPPA 4BWJA 1DGJA 4KLTA 3OHBA 4TUQA 2K4EA 5ALJA 1NZPA 4US8A 4R66A 4IQWA 5J0SA 3H40A 2G08A 1JALA 3IP4B 1O08A 5G5GA 4YR3A 5J0XA 2ZXHA 3F53A 2DPJA 2G5IB 2JEFA 4J9NA 2ALZA 2VJ5A 1XSNA 1T8EA 4M9GA 3ZDCA 4LZGA 2D8CA 4DL2A 3LDAA 1QH9A 2VKQA 1TAUA 2J6SA 1PVQA 2LPEA 5CA7A 2KJ8A 3UMBA 3QU2A 4MF8A 2QB0A 4EENA 4J9SA 2VA3A 1IIPA 5E79U 5HHIA 3C1YA 4ED3A 9ICOA 2DBYA 3OPXA 3QZ7A 5KG2A 5AM3A 3HPOA 2K60A 2BDUA 1UHUA 2OYYA 5KFLA 4ED0A 3F2CA 4YMMA 3C2LA 4NLKA 4I27A 2QKQA 2OWOA 3RJKA 8ICIA 3M8RA 2H5XA 2LYBA 4GFJA 3UQ0A 3E58A 2B6GA 2Y9TA 3CP8A 1RXVA 3G6VA 2F44A 3THVA 5EWEA 4O9MA 1JN3A 1SZPA 4EYIB 3I1YA 3PW0A 5ALZA 4PJ0U 3B0YA 5ALLA 4NWIA 2KVCA 2IMWP 2R8JA 2ZG6A 2PFNA 1ZQKA 3TQ1A 1NK8A 2RHFA 2AQ4A 3AL0B 3VC8A 4C7ZA 1VDVA 5DQIA 3SAHA 4B9TA 5KFEA 2YMQA 4YVZA 1XSLA 3MGHA 3HRDD 3IHQB 5IIOA 4CF4A 2H3ZA 4UW9A 3E2EA 4J9RA 2LMRA 2BCVA 8ICKA 2E8MA 1BPBA 5EOZA 2KICA 1TK0A 3GV7B 8ICOA 1T3QA 5DG7A 3LWMA 4EX6A 1V38A 3GQCA 3H0RB 5ALWA 4Y2TA 4Y2SA 4AYBC 3AUOA 2W9BA 3M6ZA 4DO9A 1RZTA 3LK9A 1KEJA 4YD2A 1T94A 5J8YC 4M9JA 1WG8A 2JEIA 2FDRA 4EBCA 2BQUA 1U45A 1BPDA 2RP5A 4FZNA 1XSPA 1N2XA 2KFZA 3BQTA 4A8EA 4F8RA 5T14A 4JV0A 3SD7A 1KFDA 1ZQFA 8ICLA 3V7LA 1JMSA 5KG0A 1XU4A 3JPTA 4EELA 1A0PA 2BHNA 5AKHA 5F9LA 5HMLA 4F4WA 7ICVA 5DG9A 5ALHA 5CP2A 4B6JA 4PL1A 2A1JB 2VANA 2W11A 4KN7A 4LJXA 4Y2XA 3SMVA 4QZGA 4O3OA 5DQHA 1V85A 3HKZF 4RQ5A 2PMZC 1U48A 1HJPA 2HVIA 8ICCA 4XA5A 1RM6C 2KJ9A 3GIMA 1IV8A 7ICRA 3QU4A 4C8MA 4F71A 4U6PA 4FBUA 1FIQA 3D6JA 4TQSA 1N48A 5J8YA 3PSFA 4YN4A 4BXOA 4KLIA 3F2BA 3EZ5A 4YQWA 4RU9A 4DF8A 1BPYA 3CRXA 2AXTU 3KHGA 5AKKA 5J2HA 1K5OA 1RQLA 1YZ6A 3SR6A 3RTVA 1X9MA 1B22A 1BPZA 4BX9C 5D4BA 5CEHA 2BCSA 4B9VA 4Y2UA 3RR8A 3RB6A 3PW7A 4PHEA 1SL1A 9ICJA 2JEGA 4FS2A 1UA1A 1SZHA 1ZQCA 4M6WB 4PGYA 2F8KA 2HSZA 2ZIWA 5ALTA 4I2CA 5KFJA 1RPLA 1XWLA 1U4BA 4QZ8A 3UXNA 4QZEA 3LVWA 5AK4A 2AGOA 1O03A 2NO5A 4DL6A 4I2IA 4AP9A 4B9MA 5KAIU 2W04A 5F9NA 1Q8KA 1NNLA 5ALQA 3SAFA 2B21A 3N7PD 5DGAA 3LYSA 4JWNA 4M04A 2W9AA 3KHRA 1S0VA 2F1JA 3BQ1A 3PR5B 1ZD5A 3V72A 3ZI4A 2FLLA 4TUSA 4DOCA 4UBBA 2JZBA 3V7JA 2RDIA 3PW5A 2L5YA 3MDCA 1B4FA 3NTUA 2C2DA 1S8OA 2Y1IA 4MFCA 4ECQA 4BWMA 1SKRA 5J2AA 4B9UA 1BNOA 4C8LA 4O3SA 4RQMA 1RDFA 9ICCA 5KL1B 1L3VA 2IHNA 2YMPA 2ZJ8A 1V97A 9ICUA 3WKAA 4R64A 5KFWA 4FFDA 5KG6A 1A77A 3GV8B 2QARA 2JH7A 2WB1C 1ZD4A 4QWEA 3GV5B 5JUMA 4I29A 2KE7A 3ETRA 2KIWA 5KFXA 3M9NB 4ELUA 3MR5A 4QIWC 4O3PA 2GWSA 1CUKA 3A0HU 3QYPA 4I28A 3RBDA 3G6YA 4F4XA 5ALFA 2D6FC 1NK6A 3E0FA 2HDOA 5DB8A 1MQ2A 2DL0A 1NJZA 4NL9C 3DV9A 5KFKA 3RAXA 2DGZA 2QB0B 1TVAA 4YMNA 5ALEA 4C7YA 2KV2A 4DSEA 1URJA 4UB4A 3LWLA 2W9CB 1S97A 3Q8RB 2JMGA 4J9PA 3N28A 3JPRA 5EE9A 2HVHA 1ZYQA 4NV0A 5L1KA 4ED2A 4C0ZA 8ICYA 4CRXA 2ZUCA 4LZDA 4UAYA 3WK6A 2XO7A 3SI8A 2ZTCA 2KZZA 4F2RA 5ALXA 2HHSA 3IV6A 1HIWA 7ICFA 4I2EA 4DFKA 5TZVA 2LBOA 1VLBA 2I5HA 1QSYA 3KZXA 2P66A 2HCFA 4QNLA 4RQ2A 5J0YA 2ZIVA 2KK0A 2YB4A 1FEZA 3H8WA 2KHQA 5AK5A 1NZBA 1QLNA 4QZBA 1LV5A 2W54A 4UAVA 2KVSA 2BPGA 2C2EA 1NI3A 1TAMA 5HP4A 4NL9A 1JXEA 1KW4A 2DPIA 3FAHA 9ICLA 4RQ6A 5AIBA 3T3FA 2HBJA 2I6XA 4F3OA 1KDHA 2K89A 2NO4A 3D2QA 5ALDA 3M8SA 9ICFA 3MR6A 5J2JA 4F5NA 3PSPA 2MRLA 3A0BU 3C2MA 3BJYA 1B0XA 2R8IA 2FMQA 8ICHA 3QU9A 3KZIU 3QEAZ 4KN4A 2W9BB 8ICEA 1DGSA 4KMOB 3ISCA 3M9OB 4KLMA 2UVWA 2UVVA 5KFGA 2HHQA 4BGDA 3G6XA 3MABA 4ECTA 2R18A 3GIIA 2AGPA 9ICQA 4G3IA 2E1FA 2W3SA 1KBUA 1PUZA 2FJ6A 3MFIA 1PK1B 3NS1A 5JRTA 2YTUA 4NM2A 3IDWA 3GILA 1CI4A 1YZ7A 3B9JA 4P0QA 2KTQA 4ECWA 1NK9A 3L3FX 1ZQQA 1N61A 8ICVA 5ALNA 1F44A 3BZKA 1QCKA 2XGPA 5KT6A 4J9OA 5J2IA 9ICKA 5HNKA 1ZQMA 4ACOA 4XQ8A 4RQ4A 5CWRA 1L7MA 2HHUA 4DSIA 1XO0A 2BZFA 2AQ0A 3PX4A 2JXJA 4CF3A 1J2NA 4KLEA 1FFUA 2GOLA 4O3RA 3C28A 4DSJA 3RB3A 1Z1BA 4QJFB 4O3QA 5KFTA 2YN4A 4R8UB 3EWAA 1ECWA 2LYHA 2MUTA 3T5KA 8ICQA 2W7OA 1S10A 2ZUDA 1PZNA 4EYHB 3AQEA 2UVUA 3TANA 4ECSA 4GC6A 3GDXA 3UPQA 2YQEA 1NK4A 3BDPA 3QEBZ 3RH4A 3ZD8A 4F50A 2R8KA 3GU3A 3OGUA 1BPXA 5A0LA 5CB1A 7ICJA 1TV9A 2KOBA 1UQVA 4Y2RA 4NY8A 2G0AA 2HI0A 3FDSA 2XY6A 1KFSA 3MGVA 1ZQWA 4UATA 4DFJA 1S5LU 1L3SA 4E0DA 5AI5A 5AI0A 1KFTA 1IM4A 2WF7A 4XUSA 5J2EA 4PHPA 3ICXA 1QSSA 4MEYA 8ICXA 3Q8PB 4O5CA 2Q4TA 2OH2A 2YB1A 2ZTDA 2MA1A 1HEKA 4KLFA 9ICBA 2ATLA 5K4LA 3HKZC 2VA2A 3HW8A 1SL2A 5J0QA 2VJ4A 5J0TA 3T5LA 3KTQA 1Z19A 3MFHA 4M0AA 1KN5A 1A6SA 3TAPA 4IR9A 3QU7A 1ZD2P 4M9NA 1NKEA 2E5SA 5JTIA 2KFNA 3C5GA 2E8OA 4F5QA 2FLNA 2Y1JA 1L7PA 1ZQLA 5KFIA 1BPEA 1S0OA 2ZIUA 3AEVA 1ZQSA 3PV8A 5KFFA 1LKYA 4DS4A 1ZQVA 3T79A 3SV4A 5AM1A 1UPHA 1J2MA 2FPLA 5AICA 2FPMA 1OXJA 3OJUA 4YCXA 3PR4A 4RQ1A 7ICLA 4PH5A 3AU2A 1S77D 5C5JA 1ZQTA 3ETLA 2WF6A 1H38A 3LVVA 1N62A 4DCCA 5KTQA 1AQ6A 2XVTA 2ZXIA 2NRZA 5AI9A 4QZCA 5ALKA 5KT3A 3TKAA 1WUDA 1B43A 2O6KA 2QARB 3RJEA 4EEYA 2PI5A 1X2IA 4EEKA 5AM4A 5AM0A 2DKXA 1L6NA 4J9LA 5TISU 4UASA 4UB8U 2BQRA 1L8LA 2JHDA 5CJ7A 4G9BA 3IM1A 3PMNA 2Y0SC 1NK5A 4YR2A 3IG5A 2EAPA 5ALVA 2V4QA 4DL7A 2PFQA 2DQNB 2WF9A 1MQ3A 4PZOA 1XNSA 3OJSA 2CXYA 5CR0A 3QUCA 5J2DA 5AKIA 1T3NA 2Y9UA 2OCEA 4BJQA 4TURA 5KFMA 5L1MA 5ALPA 1LVHA 5KFPA 1N5XA 3ZD9A 1Q3VA 3I76A 1TKDA 4Z6CA 1JX4A 5CRXA 9ICSA 3RF9A 1RYSA 4DFDA 4O5EA 4GIBA 3PO5A 2FE9A 2KSOA 3D2SA 5AKLA 3UMCA 4LVSA 4QWCA 3NVYA 4P4MA 5DG8A 1ZJMA 3WK4A 1L8OA 3I28A 3BQ0A 5FP0A 5KFDA 5J0PA 8ICNA 2K8CB 3TAQA 1JIHA 5ALIA 3WU2U 3EW9A 3MDAA 1JUDA 4CE6A 2QLTA 1ZQIA 4F72A 4GXJA 1HUOA 1D9DA 4KLHA 1FFVA 5ALOA 2F1HA 4DQPA 3K1RB 4KLQA 3WKDA 2XIDA 3RB4A 9ICGA 2XI9A 4R63A 4Z6FA 4CF5A 3ZDAA 2FMPA 1MN8A 2ZIVB 1X42A 5EE0A 3N97B 3R9KA 5EWFA 2WAQF 4DSLA 1N60A 2HHWA 3GFKB 4JV1A 4PGQA 3HT3A 4I2HA 4KLGA 1T7PA 4QZIA 4KITB 1TFRA 1COKA 2YX8A 4YG2A 8ICWA 1DOQA 1S9FA 1XS9D 4ECXA 2W03A 1SXDA 3WK7A 4K4IA 1UT8A 4UAUA 1X9XA 4DQSA 3RJGA 4DOBA 5DBAA 3UM9A 3ISBA 1S76D 1K1SA 3TADC 3BS5B 1KQQA 2EZZA 2HHVA 4ED7A 4PL2A 4KLSA 1SIJA 4RZRA 4PGXA 5GTIU 1IG6A 1ED1A 2KJ5A 3B0XA 2KHVA 5AKJA 3SENA 4HYKA 1BNPA 1NKBA 3DEEA 4DL5A 4X5VA 1SXEA 4ECRA 2JH1A 2F77X 4DSFA 7ICGA 1QTMA 1ZQEA 4U7CA 5J2BA 8ICUA 4DF4A 3JPQA 1ZQJA 3AMZA 4O3MA 3UXOA 1V9PA 3QZ8A 1SL0A 4B9LA 2JRZA 9ICEA 5AK6A 3WK9A 5B5EU 1ZQPA 5DB9A 4QW8A 1U9LA 4K4GA 4RNNA 1IXRA 3SYZA 1WWUA 3H8MA 3PW2A 4DOAA 1P7DA 4QWDA 2H3VA 5HHHA 2I1QA 2AJQA 4XRHA 5ALRA 5AM5A 2BGWA 3RAQA 1XO1A 2PFOA 3AN1A 3RH5A 4KLUA 3U26A 4DL3A 2MU2A 1JXLA 3FYHA 2BCQA 2MUTB 5KFVA 2C28A 2EAOA 2XY5A 2JR5A 5ALGA 1F5SA 4QZAA 4I2FA 2DFLA 2J6UA 4UB2A 3EPGA 2IOFK 2XGQA 2AGQA 1ZQHA 4F5PA 3QUTA 5C0YA 3FM9A 2AU0A 4YXJA 3OSPA 4EZ6A 4UB5A 3JPSA 2LI6A 3CNHA 2KNJA 2BCUA 4CNQA 4JV2A 4EBDA 1RXWA 4J03A 5GTHU 2V9WA 3WKEA 4YD1A 3C29A 4ED8A 4M9HA 1RYRA 5KG5A 5F3XB 3Q8MA 3NVWA 1UA0A 1ZRMA 2YMMA 3NRZA 3ZDBA 1F0MA 3WK5A 5IINA 3L4PA 4KX5A 1SKWA 2E8NA 1WWVA 3H4DA 2W7PA 4P0PA 3C5FA 3PX0A 2G5HB 8ICFA 3PVXA 1ZQDA 2A1JA 5KFRA 4M47A 5L1IA 7ICEA 3HWTA 5L1JA 3C23A 5L1LA 5JU5A 2ZIUB 2KKPA 2EZXA 1LKYB 5BOLA 1D8BA 4UB6U 2D3DA 1ZQNA 9ICHA 1XC9A 3HX0A 5IIJA 4UQGA 5KT4A 2DKZA
chains in the Genus database with same CATH topology
2E8PA 2ES6A 2K4PA 2QARB 2ESEA 3KKAC 2KIVA 1UQVA 1JI7A 2DL0A 1B0XA 2F8KA 2K60A 4NL9C 1RG6A 2DKXA 1Z1VA 2QB0B 2QB1A 2EAOA 1COKA 1X66A 1OW5A 2QKQA 1SXDA 2KMDA 1DXSA 2GLEA 1X40A 2EAPA 1X9XA 2B6GA 4NJ8A 2Y9TA 1PK1B 4PZOA 2JV3A 5JRTA 2YTUA 3IDWA 1UCVA 2F44A 2KG5A 3SEIA 3TADC 2Y9UA 3BS5B 5L1MA 3TADA 1SV4A 1V85A 4PZNA 3SENA 5JTIA 1SV0A 2FE9A 2L5YA 1B4FA 2E8OA 2EANA 2KSOA 1SXEA 5F3XB 3TACB 5KNIA 4RQNA 1F0MA 1LKYA 4RQMA 1PK3A 2LMRA 2E8NA 1WWVA 3BS7A 1SV0C 2E8MA 2F3NA 2D8CA 2EAMA 5J8YA 1SGGA 1OXJA 2QARA 1PK1A 1V38A 2KSOB 2LPEA 3KKAA 3BQ7A 2KE7A 2QB0A 3BS5A 3K1RB 4NL9A 5JU5A 1KW4A 1WWUA 3H8MA 1LKYB 4MHVA 2D3DA 3HILA 5J8YC 4IS7A 2DKZA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2E8P A;  2ES6 A;  2K4P A;  2QAR B;  2ESE A;  3KKA C;  2KIV A;  1UQV A;  1JI7 A;  2DL0 A;  1B0X A;  2F8K A;  2K60 A;  4NL9 C;  1RG6 A;  2DKX A;  1Z1V A;  2QB0 B;  2QB1 A;  2EAO A;  1COK A;  1X66 A;  1OW5 A;  2QKQ A;  1SXD A;  2KMD A;  1DXS A;  2GLE A;  1X40 A;  2EAP A;  1X9X A;  2B6G A;  4NJ8 A;  2Y9T A;  1PK1 B;  4PZO A;  2JV3 A;  5JRT A;  2YTU A;  3IDW A;  1UCV A;  2F44 A;  2KG5 A;  3SEI A;  3TAD C;  2Y9U A;  3BS5 B;  5L1M A;  3TAD A;  1SV4 A;  1V85 A;  4PZN A;  3SEN A;  5JTI A;  1SV0 A;  2FE9 A;  2L5Y A;  1B4F A;  2E8O A;  2EAN A;  2KSO A;  1SXE A;  5F3X B;  3TAC B;  5KNI A;  4RQN A;  1F0M A;  1LKY A;  4RQM A;  1PK3 A;  2LMR A;  2E8N A;  1WWV A;  3BS7 A;  1SV0 C;  2E8M A;  2F3N A;  2D8C A;  2EAM A;  5J8Y A;  1SGG A;  1OXJ A;  2QAR A;  1PK1 A;  1V38 A;  2KSO B;  2LPE A;  3KKA A;  3BQ7 A;  2KE7 A;  2QB0 A;  3BS5 A;  3K1R B;  4NL9 A;  5JU5 A;  1KW4 A;  1WWU A;  3H8M A;  1LKY B;  4MHV A;  2D3D A;  3HIL A;  5J8Y C;  4IS7 A;  2DKZ A; 
#chains in the Genus database with same CATH topology
 4ECV A;  2ES6 A;  2K4P A;  1PVR A;  4RUA A;  4M9L A;  1Y88 A;  4O3N A;  4GC7 A;  7ICH A;  1ZQY A;  1QQ5 A;  1L3U A;  3K1Z A;  4NM1 A;  2DUY A;  8ICR A;  4RQ7 A;  5EWG A;  4FZL A;  3HJE A;  1ZOL A;  2XCP A;  3OTQ A;  5III A;  1DXS A;  3Q8L A;  3QUQ A;  4J9K A;  3TAR A;  2A1A A;  2BPC A;  4NLN A;  5DQG A;  1Q3U A;  3IN5 A;  2JV3 A;  2AHO B;  5BPC A;  2ZIX A;  4F92 B;  4F5O A;  3RH6 A;  5DLF A;  2LYA A;  3UXP A;  7ICT A;  5J0O A;  1CEZ A;  2W8K A;  1ZXI A;  5AKZ A;  3NUQ A;  4DLE A;  4DQR A;  3KD3 A;  3H8S A;  2XC9 A;  1KLN A;  4MEX A;  3BQ2 A;  2HMX A;  3H4B A;  3CW2 C;  3MC1 A;  3H0M B;  2N1R A;  3WK8 A;  2HHX A;  2EH9 A;  5DB6 A;  2PKE A;  3IRU A;  1ZQU A;  5DLG A;  3SAG A;  5KFC A;  1MC8 A;  4QIW F;  3NVZ A;  1ZQG A;  2LHT A;  1ZQO A;  5J2G A;  4OJO A;  1Z00 A;  4I2G A;  4I2D A;  4K4H A;  1SGG A;  4UAZ A;  2VA8 A;  2KSO B;  3NAS A;  4DL4 A;  1NOM A;  4NLB A;  2EQY A;  1K1Q A;  2P6U A;  1FO4 A;  2HBM A;  4QZ9 A;  3KHL A;  3MR3 A;  2NV3 A;  4FBT A;  1NJY A;  2F1I A;  8ICG A;  2P35 A;  5L9X A;  2E8P A;  4Q8E A;  5EE1 A;  2C22 A;  5EE3 A;  3RFA A;  4UBC A;  5KFO A;  3KOO A;  1Z1V A;  5AIA A;  1OW5 A;  2WHE A;  3TFR A;  2CN1 A;  4Q8F A;  4BUG A;  2ASJ A;  5AKX A;  4BDP A;  9ICR A;  2DF4 B;  9ICI A;  3C1Z A;  2PFP A;  2KZM A;  2UVR A;  4BXO B;  4RUC A;  3OHA A;  4DLG A;  2NRV A;  1N56 A;  1UCV A;  2RQ5 A;  2KZ3 A;  3H8J A;  2G07 A;  5H2F U;  2FMS A;  5KG1 A;  2Q0Z X;  7ICP A;  1ZRN A;  4YXM A;  3GZF A;  5AI4 A;  4PZN A;  4B9N A;  4ED6 A;  1QQ7 A;  4C80 A;  5J2C A;  1S0N A;  4CDG A;  4JWM A;  1NK7 A;  4KLL A;  2ZIW B;  2K8A A;  2XIC A;  4RNO A;  1NK0 A;  9ICA A;  2E3T A;  2W9C A;  1ZQR A;  3Q8Q B;  2IA6 A;  1J97 A;  3VCB A;  4F91 B;  4IRD A;  2ZJA A;  8ICP A;  3KHH A;  2YML A;  3QE9 Y;  4KX3 A;  2BQ3 A;  4ECZ A;  2ODG A;  4NXZ A;  2F2A B;  1TK5 A;  2HBL A;  9ICM A;  1SB3 C;  2DWQ A;  3QUB A;  2FLP A;  2H3I A;  2WAQ C;  4RQ3 A;  3RJF A;  2LM4 A;  2F76 X;  2VIX A;  2ZTE A;  1WYG A;  3H7I A;  4IS7 A;  4RNM A;  4ZOH C;  2JZB B;  1ZQA A;  2YY6 A;  3KKA C;  2ISP A;  1ZD3 A;  2K4I A;  4UB3 A;  8ICB A;  4NLZ A;  3OSN A;  4ED1 A;  1COO A;  1D8Y A;  1X6I A;  4Q45 A;  2W43 A;  9ICX A;  5AKG A;  8ICS A;  3V6H A;  3RJH A;  1RQN A;  2RDJ A;  7ICN A;  2HW3 A;  1JRO A;  2ASL A;  4I2B A;  4YMO A;  4IRC A;  1DK3 A;  4YP3 A;  4DSK A;  1U49 A;  2ISO A;  3RRH A;  4RQ0 A;  4ECU A;  3EYZ A;  3SEI A;  4QW9 A;  4KTQ A;  9ICV A;  5ALS A;  1SV4 A;  4JK1 A;  1YT3 A;  4FE3 A;  3MR2 A;  3AU6 A;  4IRK A;  5KFN A;  3MBY A;  4GXK A;  4ELT A;  5ALM A;  2B0C A;  3PO4 A;  3ZDE A;  4P4P A;  5IIK A;  2G06 A;  5KL8 B;  2W3R A;  4RQN A;  3Q8S B;  1ZQX A;  1EXN A;  4UAW A;  1M6Y A;  5AK3 A;  2FPK A;  3ALR A;  2OM6 A;  1UT5 A;  3KBB A;  1DRG A;  2EAM A;  4MF2 A;  4B9S A;  4PHA A;  2W8L A;  5AKE A;  1PK1 A;  3J81 j;  2BR0 A;  4Q43 A;  2PI4 A;  3ISD A;  1DK2 A;  1SWW A;  2XCA A;  3KKA A;  1WCL A;  4OCZ A;  4UAR A;  4OD0 A;  3BQ7 A;  3SQI A;  4KMU A;  4DWI A;  3M1Y A;  1L7O A;  5IIM A;  4QZF A;  4F4Z A;  9ICW A;  4ZH4 A;  1CRX A;  3ORY A;  4EX7 A;  2A3V A;  2OHF A;  4WJ3 B;  3HIL A;  4Y2V A;  4C4T A;  5KT7 A;  4ICA A;  1KRP A;  1KKX A;  4P0P B;  4F5R A;  4NLC A;  3F2D A;  3PML A;  1Z3E B;  1ZQB A;  2MSN A;  3SV3 A;  2NYV A;  1X6J A;  4QZD A;  2QB1 A;  4GLX A;  3O0F A;  4CGZ A;  1BVS A;  3KFU F;  7ICS A;  1Q46 A;  2W55 A;  4HAI A;  4DS5 A;  2IOF A;  4JB3 A;  2V4R A;  2NRX A;  3Q8K A;  5KFQ A;  3PZP A;  1KSP A;  7ICI A;  7ICQ A;  8ICM A;  4YR0 A;  4GXI A;  3QXG A;  4R8U A;  5KFU A;  2ASD A;  5ALY A;  2ZUB A;  4PHD A;  4F2S A;  3EPI A;  1ZET A;  3PST A;  5J2F A;  1NKC A;  2JEJ A;  4P4O A;  2HOI A;  1PVP A;  1S0M A;  4J9M A;  2HBK A;  2EAN A;  2NRW A;  4MFA A;  4YFK A;  3TAC B;  5KNI A;  3PW4 A;  2ZIX B;  3AQF A;  7ICM A;  5KG7 A;  1N63 A;  3JPO A;  4DEZ A;  1LB2 B;  5D46 A;  4EBE A;  4KLO A;  1PK3 A;  3D2N A;  4RT2 A;  4JMU A;  1Z4N A;  3BS7 A;  2G09 A;  5J2K A;  5AI8 A;  2GH1 A;  1BGX T;  2WF5 A;  3F5E A;  4M2Y A;  5G5H A;  2IHM A;  2KEY A;  4P0Q B;  3T5J A;  4AYB F;  1SWV A;  3TI0 A;  3T5H A;  2FI1 A;  3PY8 A;  2W9M A;  5BOM A;  1JRP A;  2WF8 A;  5D49 A;  1Z00 B;  4DFP A;  3SZ2 A;  5KG4 A;  3L5K A;  2HHT A;  2K4H A;  2Y0S F;  4OJ5 A;  2ESE A;  2KIV A;  2EZY A;  1NJX A;  4O5K A;  1RG6 A;  1KTQ A;  3TFS A;  1C20 A;  4C8O A;  1T4G A;  1ARO P;  3M6K A;  4NLG A;  4F4Y A;  1N5W A;  2MAX A;  1X40 A;  3UQ2 A;  3M7D A;  5HR6 A;  4DFM A;  4C8N A;  4NJ8 A;  3PNC A;  4IQU A;  4OJ6 A;  4DQQ A;  3H0L B;  4IC9 A;  2A19 A;  2AH5 A;  4ELV A;  3RR7 A;  3TAD A;  5KFH A;  5J29 A;  2M0N A;  4KLD A;  2OXO A;  2J6T A;  9ICN A;  1L7N A;  3RBE A;  5AHX A;  2PMZ F;  5DGB A;  4F4K A;  2KD1 A;  5J0R A;  1MA7 A;  3GIK A;  4IR1 A;  4QWA A;  5AI6 A;  2I9G A;  1SV0 C;  3EUB 2;  1NJW A;  3PX6 A;  2F3N A;  4RPZ A;  2IOH A;  3UMG A;  4JUZ A;  8ICJ A;  5B66 U;  2KKV A;  3HP6 A;  1U47 A;  2HOF A;  4IQT A;  4OJL A;  3N7R C;  4IL6 U;  3DDH A;  3WKC A;  5J0W A;  2WTF A;  1TAQ A;  3M9M B;  2CPR A;  3NRW A;  3C2K A;  1D8L A;  1KL9 A;  4RPY A;  5KFZ A;  4FO6 A;  2E1E A;  2M9N A;  2C2R A;  1ZJN A;  7ICO A;  3C21 A;  3ONN A;  2P6R A;  4Q44 A;  4US9 A;  4Y2J A;  1ZQ1 C;  2H3Q A;  2RRD A;  5KFY A;  4Z6E A;  8ICT A;  5KG3 A;  3V6K A;  9ICP A;  1JI7 A;  4C4S A;  4F93 B;  3NGD A;  1RYU A;  3CYM A;  4RT3 A;  3QNM A;  4KLJ A;  1X66 A;  1VJ5 A;  2F8L A;  5KAF U;  1X9W A;  4EZ9 A;  1TK8 A;  4FS1 A;  2KMD A;  4DQI A;  2GLE A;  4FZM A;  5HMM A;  5ALU A;  2Z7J A;  3JPN A;  2BCR A;  4QWB A;  5DDM A;  1OUQ A;  5HR7 A;  2BDP A;  3BZC A;  1QQ6 A;  5KFS A;  5DBB A;  2OEH A;  4IQV A;  3PSI A;  5KFB A;  2K8B B;  9ICT A;  1GO3 F;  2IBK A;  4CCH A;  3V6J A;  1SV0 A;  3RJI A;  3F5A A;  4C4R A;  2ZJ5 A;  3N4M B;  1HUZ A;  5CHG A;  1L3T A;  4Y2Q A;  8ICZ A;  4TUP A;  5DKW A;  2BPF A;  2NRT A;  2JGA A;  5DB7 A;  4OJP A;  3QU5 A;  1C7Y A;  2CRX A;  2GO7 A;  1L5U A;  4M6W A;  5J0U A;  3QX7 A;  2R8G A;  2HOQ A;  2KN7 A;  2WB1 F;  3BS5 A;  1QSL A;  2XY7 A;  4TQR A;  5KFA A;  3GIJ A;  4C8K A;  2WFA A;  5KT5 A;  4MHV A;  3ZDD A;  4I2A A;  1MSW D;  4UB1 A;  2H3F A;  3FC4 A;  5DDY A;  3RB0 A;  4P2H A;  4R65 A;  2RLT A;  4Z6D A;  3IG8 A;  1A76 A;  3RRG A;  1TE2 A;  4OO1 J;  5DBC A;  4RPX A;  3NVV A;  1SKS A;  5KT2 A;  3RJJ A;  2BKE A;  2R8H A;  2LKY A;  4O0I A;  3N7S C;  3MGI A;  1ZQZ A;  5AKY A;  3K75 D;  1WCN A;  8ICA A;  2EDU A;  2KP7 A;  4Y2Y A;  1D9F A;  4I2J A;  3ED5 A;  4J9Q A;  7ICK A;  3S6J A;  3WKB A;  5AM2 A;  4PPX A;  4MFF A;  5IIL A;  4RQ8 A;  3V7K A;  7ICU A;  4USA A;  2LM1 A;  4QZH A;  2KG5 A;  1Z4O A;  4ECY A;  3AM9 A;  1X9S A;  2PXI A;  4Y2P A;  3K4G A;  3JPP A;  4BWJ A;  1DGJ A;  4KLT A;  3OHB A;  4TUQ A;  2K4E A;  5ALJ A;  1NZP A;  4US8 A;  4R66 A;  4IQW A;  5J0S A;  3H40 A;  2G08 A;  1JAL A;  3IP4 B;  1O08 A;  5G5G A;  4YR3 A;  5J0X A;  2ZXH A;  3F53 A;  2DPJ A;  2G5I B;  2JEF A;  4J9N A;  2ALZ A;  2VJ5 A;  1XSN A;  1T8E A;  4M9G A;  3ZDC A;  4LZG A;  2D8C A;  4DL2 A;  3LDA A;  1QH9 A;  2VKQ A;  1TAU A;  2J6S A;  1PVQ A;  2LPE A;  5CA7 A;  2KJ8 A;  3UMB A;  3QU2 A;  4MF8 A;  2QB0 A;  4EEN A;  4J9S A;  2VA3 A;  1IIP A;  5E79 U;  5HHI A;  3C1Y A;  4ED3 A;  9ICO A;  2DBY A;  3OPX A;  3QZ7 A;  5KG2 A;  5AM3 A;  3HPO A;  2K60 A;  2BDU A;  1UHU A;  2OYY A;  5KFL A;  4ED0 A;  3F2C A;  4YMM A;  3C2L A;  4NLK A;  4I27 A;  2QKQ A;  2OWO A;  3RJK A;  8ICI A;  3M8R A;  2H5X A;  2LYB A;  4GFJ A;  3UQ0 A;  3E58 A;  2B6G A;  2Y9T A;  3CP8 A;  1RXV A;  3G6V A;  2F44 A;  3THV A;  5EWE A;  4O9M A;  1JN3 A;  1SZP A;  4EYI B;  3I1Y A;  3PW0 A;  5ALZ A;  4PJ0 U;  3B0Y A;  5ALL A;  4NWI A;  2KVC A;  2IMW P;  2R8J A;  2ZG6 A;  2PFN A;  1ZQK A;  3TQ1 A;  1NK8 A;  2RHF A;  2AQ4 A;  3AL0 B;  3VC8 A;  4C7Z A;  1VDV A;  5DQI A;  3SAH A;  4B9T A;  5KFE A;  2YMQ A;  4YVZ A;  1XSL A;  3MGH A;  3HRD D;  3IHQ B;  5IIO A;  4CF4 A;  2H3Z A;  4UW9 A;  3E2E A;  4J9R A;  2LMR A;  2BCV A;  8ICK A;  2E8M A;  1BPB A;  5EOZ A;  2KIC A;  1TK0 A;  3GV7 B;  8ICO A;  1T3Q A;  5DG7 A;  3LWM A;  4EX6 A;  1V38 A;  3GQC A;  3H0R B;  5ALW A;  4Y2T A;  4Y2S A;  4AYB C;  3AUO A;  2W9B A;  3M6Z A;  4DO9 A;  1RZT A;  3LK9 A;  1KEJ A;  4YD2 A;  1T94 A;  5J8Y C;  4M9J A;  1WG8 A;  2JEI A;  2FDR A;  4EBC A;  2BQU A;  1U45 A;  1BPD A;  2RP5 A;  4FZN A;  1XSP A;  1N2X A;  2KFZ A;  3BQT A;  4A8E A;  4F8R A;  5T14 A;  4JV0 A;  3SD7 A;  1KFD A;  1ZQF A;  8ICL A;  3V7L A;  1JMS A;  5KG0 A;  1XU4 A;  3JPT A;  4EEL A;  1A0P A;  2BHN A;  5AKH A;  5F9L A;  5HML A;  4F4W A;  7ICV A;  5DG9 A;  5ALH A;  5CP2 A;  4B6J A;  4PL1 A;  2A1J B;  2VAN A;  2W11 A;  4KN7 A;  4LJX A;  4Y2X A;  3SMV A;  4QZG A;  4O3O A;  5DQH A;  1V85 A;  3HKZ F;  4RQ5 A;  2PMZ C;  1U48 A;  1HJP A;  2HVI A;  8ICC A;  4XA5 A;  1RM6 C;  2KJ9 A;  3GIM A;  1IV8 A;  7ICR A;  3QU4 A;  4C8M A;  4F71 A;  4U6P A;  4FBU A;  1FIQ A;  3D6J A;  4TQS A;  1N48 A;  5J8Y A;  3PSF A;  4YN4 A;  4BXO A;  4KLI A;  3F2B A;  3EZ5 A;  4YQW A;  4RU9 A;  4DF8 A;  1BPY A;  3CRX A;  2AXT U;  3KHG A;  5AKK A;  5J2H A;  1K5O A;  1RQL A;  1YZ6 A;  3SR6 A;  3RTV A;  1X9M A;  1B22 A;  1BPZ A;  4BX9 C;  5D4B A;  5CEH A;  2BCS A;  4B9V A;  4Y2U A;  3RR8 A;  3RB6 A;  3PW7 A;  4PHE A;  1SL1 A;  9ICJ A;  2JEG A;  4FS2 A;  1UA1 A;  1SZH A;  1ZQC A;  4M6W B;  4PGY A;  2F8K A;  2HSZ A;  2ZIW A;  5ALT A;  4I2C A;  5KFJ A;  1RPL A;  1XWL A;  1U4B A;  4QZ8 A;  3UXN A;  4QZE A;  3LVW A;  5AK4 A;  2AGO A;  1O03 A;  2NO5 A;  4DL6 A;  4I2I A;  4AP9 A;  4B9M A;  5KAI U;  2W04 A;  5F9N A;  1Q8K A;  1NNL A;  5ALQ A;  3SAF A;  2B21 A;  3N7P D;  5DGA A;  3LYS A;  4JWN A;  4M04 A;  2W9A A;  3KHR A;  1S0V A;  2F1J A;  3BQ1 A;  3PR5 B;  1ZD5 A;  3V72 A;  3ZI4 A;  2FLL A;  4TUS A;  4DOC A;  4UBB A;  2JZB A;  3V7J A;  2RDI A;  3PW5 A;  2L5Y A;  3MDC A;  1B4F A;  3NTU A;  2C2D A;  1S8O A;  2Y1I A;  4MFC A;  4ECQ A;  4BWM A;  1SKR A;  5J2A A;  4B9U A;  1BNO A;  4C8L A;  4O3S A;  4RQM A;  1RDF A;  9ICC A;  5KL1 B;  1L3V A;  2IHN A;  2YMP A;  2ZJ8 A;  1V97 A;  9ICU A;  3WKA A;  4R64 A;  5KFW A;  4FFD A;  5KG6 A;  1A77 A;  3GV8 B;  2QAR A;  2JH7 A;  2WB1 C;  1ZD4 A;  4QWE A;  3GV5 B;  5JUM A;  4I29 A;  2KE7 A;  3ETR A;  2KIW A;  5KFX A;  3M9N B;  4ELU A;  3MR5 A;  4QIW C;  4O3P A;  2GWS A;  1CUK A;  3A0H U;  3QYP A;  4I28 A;  3RBD A;  3G6Y A;  4F4X A;  5ALF A;  2D6F C;  1NK6 A;  3E0F A;  2HDO A;  5DB8 A;  1MQ2 A;  2DL0 A;  1NJZ A;  4NL9 C;  3DV9 A;  5KFK A;  3RAX A;  2DGZ A;  2QB0 B;  1TVA A;  4YMN A;  5ALE A;  4C7Y A;  2KV2 A;  4DSE A;  1URJ A;  4UB4 A;  3LWL A;  2W9C B;  1S97 A;  3Q8R B;  2JMG A;  4J9P A;  3N28 A;  3JPR A;  5EE9 A;  2HVH A;  1ZYQ A;  4NV0 A;  5L1K A;  4ED2 A;  4C0Z A;  8ICY A;  4CRX A;  2ZUC A;  4LZD A;  4UAY A;  3WK6 A;  2XO7 A;  3SI8 A;  2ZTC A;  2KZZ A;  4F2R A;  5ALX A;  2HHS A;  3IV6 A;  1HIW A;  7ICF A;  4I2E A;  4DFK A;  5TZV A;  2LBO A;  1VLB A;  2I5H A;  1QSY A;  3KZX A;  2P66 A;  2HCF A;  4QNL A;  4RQ2 A;  5J0Y A;  2ZIV A;  2KK0 A;  2YB4 A;  1FEZ A;  3H8W A;  2KHQ A;  5AK5 A;  1NZB A;  1QLN A;  4QZB A;  1LV5 A;  2W54 A;  4UAV A;  2KVS A;  2BPG A;  2C2E A;  1NI3 A;  1TAM A;  5HP4 A;  4NL9 A;  1JXE A;  1KW4 A;  2DPI A;  3FAH A;  9ICL A;  4RQ6 A;  5AIB A;  3T3F A;  2HBJ A;  2I6X A;  4F3O A;  1KDH A;  2K89 A;  2NO4 A;  3D2Q A;  5ALD A;  3M8S A;  9ICF A;  3MR6 A;  5J2J A;  4F5N A;  3PSP A;  2MRL A;  3A0B U;  3C2M A;  3BJY A;  1B0X A;  2R8I A;  2FMQ A;  8ICH A;  3QU9 A;  3KZI U;  3QEA Z;  4KN4 A;  2W9B B;  8ICE A;  1DGS A;  4KMO B;  3ISC A;  3M9O B;  4KLM A;  2UVW A;  2UVV A;  5KFG A;  2HHQ A;  4BGD A;  3G6X A;  3MAB A;  4ECT A;  2R18 A;  3GII A;  2AGP A;  9ICQ A;  4G3I A;  2E1F A;  2W3S A;  1KBU A;  1PUZ A;  2FJ6 A;  3MFI A;  1PK1 B;  3NS1 A;  5JRT A;  2YTU A;  4NM2 A;  3IDW A;  3GIL A;  1CI4 A;  1YZ7 A;  3B9J A;  4P0Q A;  2KTQ A;  4ECW A;  1NK9 A;  3L3F X;  1ZQQ A;  1N61 A;  8ICV A;  5ALN A;  1F44 A;  3BZK A;  1QCK A;  2XGP A;  5KT6 A;  4J9O A;  5J2I A;  9ICK A;  5HNK A;  1ZQM A;  4ACO A;  4XQ8 A;  4RQ4 A;  5CWR A;  1L7M A;  2HHU A;  4DSI A;  1XO0 A;  2BZF A;  2AQ0 A;  3PX4 A;  2JXJ A;  4CF3 A;  1J2N A;  4KLE A;  1FFU A;  2GOL A;  4O3R A;  3C28 A;  4DSJ A;  3RB3 A;  1Z1B A;  4QJF B;  4O3Q A;  5KFT A;  2YN4 A;  4R8U B;  3EWA A;  1ECW A;  2LYH A;  2MUT A;  3T5K A;  8ICQ A;  2W7O A;  1S10 A;  2ZUD A;  1PZN A;  4EYH B;  3AQE A;  2UVU A;  3TAN A;  4ECS A;  4GC6 A;  3GDX A;  3UPQ A;  2YQE A;  1NK4 A;  3BDP A;  3QEB Z;  3RH4 A;  3ZD8 A;  4F50 A;  2R8K A;  3GU3 A;  3OGU A;  1BPX A;  5A0L A;  5CB1 A;  7ICJ A;  1TV9 A;  2KOB A;  1UQV A;  4Y2R A;  4NY8 A;  2G0A A;  2HI0 A;  3FDS A;  2XY6 A;  1KFS A;  3MGV A;  1ZQW A;  4UAT A;  4DFJ A;  1S5L U;  1L3S A;  4E0D A;  5AI5 A;  5AI0 A;  1KFT A;  1IM4 A;  2WF7 A;  4XUS A;  5J2E A;  4PHP A;  3ICX A;  1QSS A;  4MEY A;  8ICX A;  3Q8P B;  4O5C A;  2Q4T A;  2OH2 A;  2YB1 A;  2ZTD A;  2MA1 A;  1HEK A;  4KLF A;  9ICB A;  2ATL A;  5K4L A;  3HKZ C;  2VA2 A;  3HW8 A;  1SL2 A;  5J0Q A;  2VJ4 A;  5J0T A;  3T5L A;  3KTQ A;  1Z19 A;  3MFH A;  4M0A A;  1KN5 A;  1A6S A;  3TAP A;  4IR9 A;  3QU7 A;  1ZD2 P;  4M9N A;  1NKE A;  2E5S A;  5JTI A;  2KFN A;  3C5G A;  2E8O A;  4F5Q A;  2FLN A;  2Y1J A;  1L7P A;  1ZQL A;  5KFI A;  1BPE A;  1S0O A;  2ZIU A;  3AEV A;  1ZQS A;  3PV8 A;  5KFF A;  1LKY A;  4DS4 A;  1ZQV A;  3T79 A;  3SV4 A;  5AM1 A;  1UPH A;  1J2M A;  2FPL A;  5AIC A;  2FPM A;  1OXJ A;  3OJU A;  4YCX A;  3PR4 A;  4RQ1 A;  7ICL A;  4PH5 A;  3AU2 A;  1S77 D;  5C5J A;  1ZQT A;  3ETL A;  2WF6 A;  1H38 A;  3LVV A;  1N62 A;  4DCC A;  5KTQ A;  1AQ6 A;  2XVT A;  2ZXI A;  2NRZ A;  5AI9 A;  4QZC A;  5ALK A;  5KT3 A;  3TKA A;  1WUD A;  1B43 A;  2O6K A;  2QAR B;  3RJE A;  4EEY A;  2PI5 A;  1X2I A;  4EEK A;  5AM4 A;  5AM0 A;  2DKX A;  1L6N A;  4J9L A;  5TIS U;  4UAS A;  4UB8 U;  2BQR A;  1L8L A;  2JHD A;  5CJ7 A;  4G9B A;  3IM1 A;  3PMN A;  2Y0S C;  1NK5 A;  4YR2 A;  3IG5 A;  2EAP A;  5ALV A;  2V4Q A;  4DL7 A;  2PFQ A;  2DQN B;  2WF9 A;  1MQ3 A;  4PZO A;  1XNS A;  3OJS A;  2CXY A;  5CR0 A;  3QUC A;  5J2D A;  5AKI A;  1T3N A;  2Y9U A;  2OCE A;  4BJQ A;  4TUR A;  5KFM A;  5L1M A;  5ALP A;  1LVH A;  5KFP A;  1N5X A;  3ZD9 A;  1Q3V A;  3I76 A;  1TKD A;  4Z6C A;  1JX4 A;  5CRX A;  9ICS A;  3RF9 A;  1RYS A;  4DFD A;  4O5E A;  4GIB A;  3PO5 A;  2FE9 A;  2KSO A;  3D2S A;  5AKL A;  3UMC A;  4LVS A;  4QWC A;  3NVY A;  4P4M A;  5DG8 A;  1ZJM A;  3WK4 A;  1L8O A;  3I28 A;  3BQ0 A;  5FP0 A;  5KFD A;  5J0P A;  8ICN A;  2K8C B;  3TAQ A;  1JIH A;  5ALI A;  3WU2 U;  3EW9 A;  3MDA A;  1JUD A;  4CE6 A;  2QLT A;  1ZQI A;  4F72 A;  4GXJ A;  1HUO A;  1D9D A;  4KLH A;  1FFV A;  5ALO A;  2F1H A;  4DQP A;  3K1R B;  4KLQ A;  3WKD A;  2XID A;  3RB4 A;  9ICG A;  2XI9 A;  4R63 A;  4Z6F A;  4CF5 A;  3ZDA A;  2FMP A;  1MN8 A;  2ZIV B;  1X42 A;  5EE0 A;  3N97 B;  3R9K A;  5EWF A;  2WAQ F;  4DSL A;  1N60 A;  2HHW A;  3GFK B;  4JV1 A;  4PGQ A;  3HT3 A;  4I2H A;  4KLG A;  1T7P A;  4QZI A;  4KIT B;  1TFR A;  1COK A;  2YX8 A;  4YG2 A;  8ICW A;  1DOQ A;  1S9F A;  1XS9 D;  4ECX A;  2W03 A;  1SXD A;  3WK7 A;  4K4I A;  1UT8 A;  4UAU A;  1X9X A;  4DQS A;  3RJG A;  4DOB A;  5DBA A;  3UM9 A;  3ISB A;  1S76 D;  1K1S A;  3TAD C;  3BS5 B;  1KQQ A;  2EZZ A;  2HHV A;  4ED7 A;  4PL2 A;  4KLS A;  1SIJ A;  4RZR A;  4PGX A;  5GTI U;  1IG6 A;  1ED1 A;  2KJ5 A;  3B0X A;  2KHV A;  5AKJ A;  3SEN A;  4HYK A;  1BNP A;  1NKB A;  3DEE A;  4DL5 A;  4X5V A;  1SXE A;  4ECR A;  2JH1 A;  2F77 X;  4DSF A;  7ICG A;  1QTM A;  1ZQE A;  4U7C A;  5J2B A;  8ICU A;  4DF4 A;  3JPQ A;  1ZQJ A;  3AMZ A;  4O3M A;  3UXO A;  1V9P A;  3QZ8 A;  1SL0 A;  4B9L A;  2JRZ A;  9ICE A;  5AK6 A;  3WK9 A;  5B5E U;  1ZQP A;  5DB9 A;  4QW8 A;  1U9L A;  4K4G A;  4RNN A;  1IXR A;  3SYZ A;  1WWU A;  3H8M A;  3PW2 A;  4DOA A;  1P7D A;  4QWD A;  2H3V A;  5HHH A;  2I1Q A;  2AJQ A;  4XRH A;  5ALR A;  5AM5 A;  2BGW A;  3RAQ A;  1XO1 A;  2PFO A;  3AN1 A;  3RH5 A;  4KLU A;  3U26 A;  4DL3 A;  2MU2 A;  1JXL A;  3FYH A;  2BCQ A;  2MUT B;  5KFV A;  2C28 A;  2EAO A;  2XY5 A;  2JR5 A;  5ALG A;  1F5S A;  4QZA A;  4I2F A;  2DFL A;  2J6U A;  4UB2 A;  3EPG A;  2IOF K;  2XGQ A;  2AGQ A;  1ZQH A;  4F5P A;  3QUT A;  5C0Y A;  3FM9 A;  2AU0 A;  4YXJ A;  3OSP A;  4EZ6 A;  4UB5 A;  3JPS A;  2LI6 A;  3CNH A;  2KNJ A;  2BCU A;  4CNQ A;  4JV2 A;  4EBD A;  1RXW A;  4J03 A;  5GTH U;  2V9W A;  3WKE A;  4YD1 A;  3C29 A;  4ED8 A;  4M9H A;  1RYR A;  5KG5 A;  5F3X B;  3Q8M A;  3NVW A;  1UA0 A;  1ZRM A;  2YMM A;  3NRZ A;  3ZDB A;  1F0M A;  3WK5 A;  5IIN A;  3L4P A;  4KX5 A;  1SKW A;  2E8N A;  1WWV A;  3H4D A;  2W7P A;  4P0P A;  3C5F A;  3PX0 A;  2G5H B;  8ICF A;  3PVX A;  1ZQD A;  2A1J A;  5KFR A;  4M47 A;  5L1I A;  7ICE A;  3HWT A;  5L1J A;  3C23 A;  5L1L A;  5JU5 A;  2ZIU B;  2KKP A;  2EZX A;  1LKY B;  5BOL A;  1D8B A;  4UB6 U;  2D3D A;  1ZQN A;  9ICH A;  1XC9 A;  3HX0 A;  5IIJ A;  4UQG A;  5KT4 A;  2DKZ A; 
#chains in the Genus database with same CATH homology
 2E8P A;  2ES6 A;  2K4P A;  2QAR B;  2ESE A;  3KKA C;  2KIV A;  1UQV A;  1JI7 A;  2DL0 A;  1B0X A;  2F8K A;  2K60 A;  4NL9 C;  1RG6 A;  2DKX A;  1Z1V A;  2QB0 B;  2QB1 A;  2EAO A;  1COK A;  1X66 A;  1OW5 A;  2QKQ A;  1SXD A;  2KMD A;  1DXS A;  2GLE A;  1X40 A;  2EAP A;  1X9X A;  2B6G A;  4NJ8 A;  2Y9T A;  1PK1 B;  4PZO A;  2JV3 A;  5JRT A;  2YTU A;  3IDW A;  1UCV A;  2F44 A;  2KG5 A;  3SEI A;  3TAD C;  2Y9U A;  3BS5 B;  5L1M A;  3TAD A;  1SV4 A;  1V85 A;  4PZN A;  3SEN A;  5JTI A;  1SV0 A;  2FE9 A;  2L5Y A;  1B4F A;  2E8O A;  2EAN A;  2KSO A;  1SXE A;  5F3X B;  3TAC B;  5KNI A;  4RQN A;  1F0M A;  1LKY A;  4RQM A;  1PK3 A;  2LMR A;  2E8N A;  1WWV A;  3BS7 A;  1SV0 C;  2E8M A;  2F3N A;  2D8C A;  2EAM A;  5J8Y A;  1SGG A;  1OXJ A;  2QAR A;  1PK1 A;  1V38 A;  2KSO B;  2LPE A;  3KKA A;  3BQ7 A;  2KE7 A;  2QB0 A;  3BS5 A;  3K1R B;  4NL9 A;  5JU5 A;  1KW4 A;  1WWU A;  3H8M A;  1LKY B;  4MHV A;  2D3D A;  3HIL A;  5J8Y C;  4IS7 A;  2DKZ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...