1BNPA

Nmr solution structure of the n-terminal domain of dna polymerase beta, 55 structures
Total Genus 12
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
12
sequence length
87
structure length
87
Chain Sequence
MSKRKAPQETLNGGITDMLVELANFEKNVSQAIHKYNAYRKAASVIAKYPHKIKSGAEAKKLPGVGTKIAEKIDEFLATGKLRKLEK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Nucleotidyltransferase (dna-binding)
molecule keywords DNA POLYMERASE BETA
publication title Three-dimensional solution structure of the N-terminal domain of DNA polymerase beta and mapping of the ssDNA interaction interface.
pubmed doi rcsb
source organism Rattus norvegicus
total genus 12
structure length 87
sequence length 87
ec nomenclature ec 2.7.7.7: DNA-directed DNA polymerase.
pdb deposition date 1996-04-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF14716 HHH_8 Helix-hairpin-helix domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.110 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 DNA polymerase beta, N-terminal domain-like 1bnpA00
4TUPA 3C5FA 2IHMA 7ICHA 3JPTA 5J2BA 4F5RA 3V7LA 4QZ9A 4M9HA 4QZHA 5J2DA 4UB1A 4LZDA 8ICOA 4Z6DA 5DB9A 4X5VA 4XA5A 4PGYA 9ICJA 4KLUA 4MF8A 4Z6FA 1BPZA 9ICNA 1ZJMA 9ICCA 7ICGA 1ZQAA 3C2MA 4RT3A 4RQ4A 3JPSA 3AUOA 3PMNA 1ZQKA 8ICXA 4QZDA 7ICOA 5IIJA 1MQ3A 3JPPA 1ZQEA 4KLLA 4Z6EA 4GXJA 4I29A 4KLOA 4TURA 7ICNA 4JWNA 4PH5A 5J0PA 4PPXA 5J2IA 5D46A 4RT2A 9ICAA 2I9GA 5IIIA 4JWMA 8ICRA 4IQWA 7ICTA 4K4IA 5J2EA 1ZQGA 3RJKA 1JMSA 7ICMA 4O5KA 4KLJA 4RPXA 5J2FA 4I2DA 4I27A 2ISPA 5J0WA 9ICTA 2FMQA 4KLIA 2PFQA 4NXZA 4QZ8A 5DDYA 9ICPA 2BCVA 4RQ0A 5IIKA 5CB1A 3AU2A 2BCRA 4RQ5A 4RQ6A 3V72A 8ICAA 4RQ1A 5BOLA 8ICSA 4DO9A 1ZQOA 8ICLA 4IQTA 1ZQFA 4KLFA 4UB2A 5J29A 7ICQA 4P2HA 8ICKA 4F5OA 1ZQRA 7ICJA 3ISDA 2BCUA 1ZQJA 1XSNA 1TVAA 8ICVA 3RJIA 9ICGA 5J0TA 3JPRA 5BPCA 3UQ2A 8ICEA 9ICHA 4Z6CA 4I2HA 4R63A 1ZQLA 5TZVA 8ICGA 3PNCA 4NLZA 5J0QA 4PHDA 3MDCA 4M2YA 4I2GA 3GDXA 4RQ2A 4M9JA 2BPFA 8ICWA 9ICQA 4UB4A 4O5CA 4KLSA 1HUOA 4I28A 4R66A 5EOZA 8ICPA 5DB8A 4PHPA 4YCXA 5CWRA 4UBCA 4I2EA 4QZBA 2W9MA 4RQ7A 3ISBA 9ICBA 4UAYA 3UXPA 9ICIA 3RJEA 1ZQHA 7ICKA 9ICWA 8ICTA 4YMMA 4PHEA 4QZCA 5J2CA 4M9LA 4O5EA 1ZQBA 7ICLA 3MGIA 4DOAA 4RPYA 3B0YA 5DKWA 9ICLA 1BPEA 1KDHA 7ICIA 7ICUA 2BCSA 9ICKA 1RZTA 4NM1A 4MF2A 8ICUA 5J2JA 4NM2A 1BNPA 3V7JA 1DK2A 5IIOA 5J2HA 1ZQSA 3C2KA 3OGUA 4UAWA 4M04A 4XUSA 4M0AA 4YMOA 4DOBA 4DOCA 4KLDA 3HW8A 9ICMA 1HUZA 3B0XA 4F5PA 5DB6A 2PFNA 5J2AA 1ZQTA 4NLKA 4KLTA 4YMNA 3JPQA 4QZAA 4MFAA 4YD2A 1XSLA 1ZQDA 7ICRA 3C5GA 5J0XA 8ICHA 3UPQA 4K4HA 3RH5A 1ZQIA 3PMLA 4LVSA 7ICFA 4I2FA 9ICSA 3MBYA 4UBBA 4F5NA 4NLNA 4PGQA 4MFCA 3MGHA 1ZQCA 4O9MA 8ICNA 5IINA 3RH6A 4I2CA 4I2BA 4GXKA 4TUQA 1ZQQA 3MDAA 4KLEA 4M47A 4QZIA 5J2GA 5D4BA 8ICFA 4YD1A 4R64A 3UQ0A 4UB3A 4PGXA 1BPXA 7ICSA 5J0OA 3RH4A 5J0YA 5J0RA 4QZGA 4YN4A 2KP7A 2FMSA 1XSPA 4NY8A 4PHAA 3AU6A 4MFFA 3ISCA 8ICMA 3RJFA 4KLMA 1BNOA 5DBBA 5DBCA 1KEJA 2GWSA 2PFPA 5IIMA 5IILA 2ISOA 4R65A 1MQ2A 5D49A 5J2KA 4IQVA 4UB5A 3TFSA 3UXOA 5J0SA 4IQUA 4KLHA 5HHHA 8ICQA 3JPOA 4QZFA 3TFRA 4I2JA 8ICIA 5HHIA 2PXIA 4UAZA 8ICBA 8ICJA 4GXIA 7ICVA 4FO6A 7ICPA 9ICVA 9ICUA 3V7KA 4I2IA 5DB7A 5DBAA 9ICFA 4F5QA 3UXNA 2BCQA 4KLGA 1DK3A 3LK9A 3JPNA 1ZQPA 4M9GA 1ZQNA 9ICXA 1ZJNA 9ICEA 1TV9A 1NZPA 4TUSA 2P66A 3HX0A 2PFOA 1ZQMA 4I2AA 4M9NA 4RQ3A 5J0UA 4RPZA 9ICOA 4K4GA 4KLQA 3RJGA 7ICEA 1BPYA 5BOMA 3HWTA 2FMPA 4LZGA 3RJHA 3C2LA 4RQ8A 3RJJA 1BPDA 4QZEA 9ICRA 2BPGA 8ICYA 8ICZA 8ICCA
chains in the Genus database with same CATH superfamily
2AHOB 4RNMA 4J9QA 5ALGA 1JN3A 4F5RA 2KHQA 4UARA 3V7LA 4M9HA 4QZHA 5J2DA 1JXLA 4P0PA 3SD7A 4Z6DA 2UVWA 1ZQ1C 3PX0A 5KAIU 4MF8A 5L1KA 3IHQB 4DLEA 2KZ3A 9ICNA 3UMGA 4DL5A 9ICCA 3C23A 4KN7A 3OSPA 4US8A 5AM5A 3KTQA 5DGBA 2A3VA 3PW7A 5ALLA 2IA6A 4YVZA 1ZD4A 1D8LA 2HBJA 1RQNA 2EZXA 1L7MA 4EX7A 2W3SA 2H3QA 2VA2A 3NVWA 2NYVA 3F53A 4KLOA 4TURA 3Q8RB 4RU9A 4JWNA 5AKKA 3ALRA 3KD3A 4HYKA 4P0QB 1RXWA 3Q8KA 5IIIA 8ICRA 1V85A 2XGQA 1L7NA 5AM1A 4C80A 3RJKA 3T5JA 2UVRA 7ICMA 2V4RA 4O5KA 3T5HA 2VIXA 2Z7JA 4I27A 2HSZA 3C21A 3L5KA 5ALKA 2XY7A 3VCBA 3G6XA 4DL7A 4DEZA 3NTUA 2ATLA 4RZRA 2AGQA 5DDYA 2KVSA 3K1ZA 2PKEA 1JXEA 5G5GA 3M6KA 5IIKA 1T4GA 5CB1A 2NRVA 2ZG6A 3QU4A 3NRWA 1KSPA 4P4MA 4DS5A 2E8MA 3AMZA 3Q8SB 1KLNA 1C7YA 4KX5A 4DO9A 1DGJA 4Y2RA 8ICLA 3KKAA 4IQTA 3KOOA 3F5AA 3FC4A 3AQFA 4P2HA 1BVSA 3HJEA 1S0NA 4JMUA 1NZBA 3RAXA 3V6KA 5AI6A 2G5IB 3IN5A 1FEZA 3R9KA 3BZCA 4I2HA 2F3NA 3KFUF 2K4IA 5KFTA 8ICGA 3PNCA 2FPLA 3MABA 5KFQA 3TADC 1CRXA 2W9BA 4F4ZA 5ALYA 3T79A 3BS7A 3PW5A 3LVVA 3V6JA 5CP2A 3GILA 3GDXA 4EZ9A 4M9JA 3G6VA 5AM0A 4O5CA 2IOFK 3D6JA 1QSSA 5KNIA 5KG1A 4DQRA 4DSEA 2EQYA 3PSPA 4I2EA 3ETRA 2ZUBA 2L5YA 4F4XA 2AXTU 5KFGA 2W9MA 2F8LA 5KG3A 1NK7A 7ICKA 4YMMA 3HPOA 1LV5A 4QZCA 2YMMA 2WB1F 3SI8A 1VJ5A 3MGIA 4IR1A 4FBTA 4BXOB 1HEKA 4DOAA 2W55A 2YY6A 1KFTA 1RYUA 2UVVA 3TACB 2IOHA 3WU2U 2BCSA 4CRXA 3EPGA 4NM1A 4MF2A 1L5UA 4Y2SA 4LJXA 1L6NA 1NKBA 4J9LA 4XRHA 3NASA 2ZXHA 5IIOA 1XWLA 2JRZA 5J2HA 1ZQSA 2DBYA 4G3IA 4XUSA 4M0AA 1KFSA 4O3SA 4YMOA 5AM2A 4F5PA 3WK7A 4Y2YA 5AM4A 5F9LA 5KG5A 1U49A 1KKXA 2RHFA 4NLKA 4KLTA 1X9MA 3SENA 2PMZC 4YR0A 1CI4A 1MSWD 4QZAA 2KHVA 4YD2A 2W11A 1J2NA 2FPMA 1ZQDA 4DL3A 2LKYA 1S8OA 4Q45A 2KICA 5H2FU 3RH5A 2B0CA 7ICFA 2JH7A 3PR4A 2KG5A 4NLBA 5AK3A 2JMGA 3MBYA 4UBBA 4Q44A 4F5NA 1XO1A 3NVYA 1IIPA 2EAOA 3M9OB 2KFZA 5F3XB 1ZD5A 3HT3A 2A1AA 4DSKA 5KL8B 3RH6A 4DFKA 2NRWA 3N7RC 2QB0A 4QIWF 4GXKA 4US9A 3MDAA 3SQIA 5KT7A 2G06A 4QZIA 2LYBA 3BJYA 5AI9A 1K5OA 2DGZA 4ECUA 3HRDD 4F92B 4YD1A 3MFIA 3GIMA 2KD1A 1U48A 4R64A 2FLPA 4C0ZA 2G5HB 3GV7B 1BPXA 1TAUA 1N60A 4CNQA 1XSPA 3CP8A 1UT5A 5AI8A 3AU6A 3O0FA 4KMUA 2ZIUA 8ICMA 4DFJA 4C8NA 4EENA 4RQNA 5DBBA 3AQEA 2C2RA 4MHVA 1KEJA 2XO7A 5IIMA 5KFDA 2KKVA 5D49A 4UAUA 1X6IA 5J2KA 4IQVA 3EPIA 3TARA 1ZQYA 4DF8A 2WF5A 3LWMA 3OTQA 5CEHA 2DKZA 3UXOA 3K1RB 2YB1A 2AJQA 2LMRA 5HHHA 4BWJA 2GLEA 3ETLA 4QZFA 4ED8A 5HHIA 2XVTA 1FO4A 3FM9A 2PXIA 3IDWA 3QUQA 8ICBA 8ICJA 4F50A 2KNJA 4OJPA 4FO6A 3MR2A 4GC7A 1U9LA 2IBKA 2K8AA 5DQGA 4YXMA 3PV8A 3V7KA 2K4PA 2F8KA 4O3MA 5AIBA 1WWUA 3F2BA 1T8EA 2MUTA 3EYZA 4JV1A 1LB2B 3I1YA 2BCQA 3HKZF 1XS9D 1ZJNA 3D2SA 2LYHA 1TV9A 4Y2UA 2B6GA 2K8BB 2E1FA 2GO7A 3HX0A 3DV9A 2FDRA 4M9NA 4RQ3A 1S76D 2HCFA 5J0UA 5HMLA 4K4GA 2KVCA 2MAXA 2KN7A 1F44A 4F2SA 3C1ZA 4HAIA 4CGZA 4EX6A 3BDPA 1PVPA 5EWEA 3IP4B 5KFCA 2FMPA 3CYMA 4PL1A 4YG2A 1UPHA 4B9TA 3BS5A 1GO3F 9ICRA 1S0VA 8ICCA 3C5FA 4PL2A 1D8YA 2QLTA 1S0MA 4UATA 7ICHA 3JPTA 4UQGA 3TANA 2OXOA 1N48A 4DF4A 4LZDA 1Z19A 1N5WA 4F2RA 1D8BA 4X5VA 3MC1A 4QNLA 4XA5A 4ZOHC 4PGYA 4KLUA 4Y2XA 4Z6FA 2XGPA 2R8IA 3BZKA 2OH2A 3EW9A 4M6WB 4RNOA 4RUCA 3C2MA 4RNNA 3MR3A 4ECRA 4RQ4A 2KE7A 1TAQA 3AUOA 2XICA 1QQ7A 3PMNA 1A77A 8ICXA 2KK0A 7ICOA 1MQ3A 4J9PA 3WK6A 5KFSA 2AGOA 1SXDA 2JZBB 4BX9C 2BGWA 4GXJA 2G0AA 4I29A 2QB1A 2HHSA 2JEGA 1U4BA 2V9WA 7ICNA 1S9FA 4B9LA 2WFAA 2ESEA 4PPXA 3KHGA 2A19A 5D46A 4RT2A 4O3RA 2I9GA 7ICTA 2OEHA 3QU2A 5AI0A 1ZQGA 4DSIA 2IMWP 2ZIXB 3D2NA 5AKYA 4CF5A 1ZRMA 3L4PA 5C0YA 2WAQC 5ALHA 1VLBA 2I1QA 1NK8A 2D6FC 2NO5A 5J0WA 9ICTA 2MU2A 4KLIA 4ELVA 4QW9A 4QZ8A 4GLXA 3LVWA 4TQRA 2D8CA 3AL0B 2BCVA 3KHRA 2Q0ZX 5AI5A 3H8SA 4ECTA 2DF4B 1XNSA 2F2AB 1M6YA 4RQ6A 3V72A 8ICAA 4RQ1A 2E3TA 1B43A 3L3FX 5BOLA 5KFIA 5K4LA 1ZQFA 5KG0A 2UVUA 2E5SA 5DLGA 9ICGA 3Q8LA 1HIWA 2AH5A 5HR6A 1NJWA 5BPCA 3QZ7A 3KKAC 4Z6CA 1JRPA 4DWIA 2EAPA 5TZVA 3GQCA 1V9PA 4NLZA 5CJ7A 1O03A 4FS1A 4DQPA 1WYGA 5KG2A 4KN4A 2AU0A 4A8EA 3QX7A 4RQ2A 4F4YA 8ICWA 3SAHA 3QUCA 1B4FA 5EOZA 8ICPA 4EEYA 5KFJA 3K4GA 5EE9A 2E1EA 4QZBA 4NL9C 4RQ7A 3ISBA 4F3OA 9ICBA 9ICIA 5ALJA 1MA7A 2HDOA 1ZQHA 3RJEA 3GIIA 3RR8A 1UA1A 2MSNA 4QW8A 2HOQA 1L3VA 2GH1A 3RB4A 2F1HA 2BQUA 3UMCA 4IL6U 1ZQBA 4NJ8A 2BZFA 4USAA 1SGGA 1ZQXA 4J9RA 2E8NA 1T3QA 4U6PA 4F71A 3RBEA 2C28A 5DKWA 1BPEA 1KDHA 5ALRA 3NVVA 1URJA 1ZQVA 2QARA 5A0LA 7ICUA 4OJ6A 2ZIWB 4ED2A 1J2MA 2C2EA 2AQ0A 2HMXA 4PZNA 2DQNB 4NM2A 2ASDA 3V7JA 1ZYQA 5T14A 5KFNA 1UA0A 3OGUA 4B9SA 2HHTA 4Y2VA 2P6RA 1FFVA 4DOCA 5ALSA 2DWQA 2W3RA 3G6YA 3A0BU 2YMPA 2F77X 4Y2PA 4DLGA 5AM3A 2BHNA 1ZQTA 1QSLA 3NUQA 3JPQA 3E0FA 3NRZA 5J0XA 4P0QA 3AEVA 3RF9A 3SAFA 4DFPA 3SYZA 2NV3A 1ZD3A 3M9MB 3MR6A 4B9NA 5J8YA 4NLNA 4PGQA 3TAQA 1ZQCA 4O9MA 2OM6A 2HHVA 2RDJA 5IINA 1D9FA 3BQ2A 2WB1C 4I2BA 4I2CA 3TI0A 1XC9A 4OJOA 3WKDA 4ZH4A 4C8LA 4ED3A 4KLEA 3T5KA 1LVHA 3BQ1A 1NK6A 1NJXA 5J2GA 4DL2A 4DSFA 1LKYA 3CW2C 1U45A 4R8UB 1RXVA 3N7PD 3H4DA 2YQEA 1RM6C 4ED1A 5ALOA 3UQ0A 3WKBA 4CDGA 2HHWA 2KV2A 4FZMA 2K89A 5J0OA 5J0YA 1DGSA 4YN4A 2FE9A 4NY8A 4PHAA 5DDMA 5ALZA 1XU4A 4JUZA 3F2CA 2ODGA 1JALA 2P6UA 4WJ3B 1QTMA 3RJFA 4KLMA 2OHFA 5DBCA 1TK5A 3WKCA 2W9CA 2IHNA 4DSLA 1B22A 5IILA 5E79U 5KT6A 1KL9A 3OJSA 3KHLA 2HBMA 1MQ2A 3TFSA 2Y1IA 1NNLA 1SL0A 4C7YA 5KFEA 5L1LA 3PW2A 4O3PA 3H4BA 1Q3VA 1V97A 4Q43A 1NK9A 2KKPA 4I2JA 5AICA 8ICIA 2KIWA 1PK1A 4YXJA 2ZXIA 2JXJA 4GXIA 2ASJA 3RR7A 1PUZA 4EELA 2A1JB 3A0HU 5ALIA 5DQIA 1ZXIA 5DBAA 9ICFA 3ZDEA 4MEXA 1J97A 1KTQA 1ZRNA 3ONNA 3C28A 5F9NA 2RRDA 4Y2TA 1Z3EB 1A76A 2K4HA 1TKDA 3WKEA 9ICXA 3QXGA 3J81j 3PX4A 2ES6A 4ED7A 1PK3A 3IG5A 1AQ6A 2JH1A 1F5SA 4AYBF 3THVA 1PZNA 1X42A 2KEYA 4ECWA 1Z1BA 2ZUDA 1IV8A 5ALPA 1TFRA 4RPZA 5HMMA 9ICOA 3M8SA 1RG6A 5B5EU 4YP3A 5KFFA 4RUAA 1X9WA 4FFDA 4C8KA 1BPYA 5DQHA 4NWIA 1X40A 3SEIA 2D3DA 2W04A 3M8RA 2W54A 2ZIUB 2NRZA 1RQLA 2JGAA 5ALDA 2BPGA 2KFNA 8ICZA 4DQIA 3S6JA 1ZOLA 2LM4A 2Q4TA 4CE6A 4QZ9A 8ICOA 2PMZF 5C5JA 1QSYA 4YR2A 3QE9Y 4GFJA 4ECYA 2Y0SC 1JUDA 2HHQA 1ZJMA 2XIDA 1TAMA 5KT5A 7ICGA 3TAPA 4ICAA 1ZQAA 4OJ5A 4RT3A 1AROP 1DXSA 1VDVA 3JPSA 3PO4A 3CRXA 4DFMA 2OYYA 1ZQKA 2MRLA 1SZPA 4BUGA 5DLFA 3PZPA 3KZIU 4KLLA 4EBDA 4QWAA 1N5XA 4J9MA 4EYHB 2MUTB 1WG8A 4FS2A 5L1JA 4JK1A 2HBLA 2ZUCA 4KTQA 2BDPA 4IRDA 2MA1A 9ICAA 4JWMA 4E0DA 3RTVA 5AK5A 4J9SA 4YFKA 2GOLA 5J2EA 3M1YA 5KFAA 1JMSA 2DPIA 3WK8A 3VC8A 4EEKA 5JU5A 4JV2A 5HP4A 2V4QA 2ZTCA 2ISPA 2KSOB 2BQ3A 2DFLA 1S10A 2PFQA 4NXZA 1N56A 1NJZA 2W7PA 3N28A 2XC9A 2VJ4A 4F72A 4ECVA 2LBOA 4GC6A 1SV0C 2HHUA 2VKQA 1UQVA 3RB3A 3DEEA 3QU5A 2HBKA 5KT3A 2C2DA 3QNMA 2R8JA 2HVHA 3TKAA 1YT3A 1Z00B 1D9DA 1JX4A 3F5EA 1FFUA 4KLFA 4Y2JA 3V6HA 2N1RA 3Q8QB 4UB2A 5J29A 7ICQA 4EYIB 8ICKA 3FYHA 5EE1A 1WWVA 3FDSA 1FIQA 2EZYA 3KHHA 3ISDA 7ICJA 8ICVA 2M9NA 1XSNA 3RJIA 5J0TA 3WK5A 9ICHA 2CN1A 2BDUA 4YQWA 2DKXA 5J0QA 1SWVA 3PSFA 3QU9A 4M2YA 2JR5A 5AKXA 4I2GA 1V38A 5KT4A 2BPFA 2WF6A 1HUOA 3ZDCA 4R66A 4OD0A 4CCHA 5DB8A 4UBCA 3GZFA 2W43A 4BGDA 4C4SA 1SKRA 2ZTEA 1NJYA 5L1MA 4UAYA 3UXPA 2P35A 2WF9A 5ALFA 9ICWA 5KFOA 4F4KA 1U47A 4M9LA 4O5EA 1KFDA 4UAVA 1Y88A 1Z1VA 3BQ7A 2LPEA 2ASLA 4RPYA 5GTIU 1CEZA 9ICLA 2F76X 2EZZA 4DQSA 1S77D 5KAFU 3OSNA 4BJQA 1EXNA 3H0LB 1Z4OA 4BWMA 2Y9UA 2DUYA 1JROA 9ICKA 3WK9A 1S97A 8ICUA 2WF7A 1T7PA 3IRUA 4M6WA 3SAGA 5J2JA 2KJ9A 1BNPA 3F2DA 3GU3A 1JI7A 4QJFB 2H3IA 4DOBA 4KLDA 1RPLA 1HUZA 2ZIVA 5DG9A 2JZBA 2VA3A 3CNHA 1ZQZA 3ZDBA 3LYSA 2KZZA 5J2AA 4NLGA 5KFLA 4B6JA 5GTHU 5L9XA 3ED5A 1OW5A 3D2QA 4MFAA 2OCEA 1XSLA 7ICRA 3C5GA 3PVXA 4DQQA 3NVZA 4K4HA 5ALQA 2HI0A 3PMLA 2KTQA 2R8HA 3SV3A 4AP9A 4P0PB 3ICXA 3QYPA 4OJLA 1IXRA 2J6TA 3Q8MA 1NK5A 4YR3A 2EDUA 3WK4A 1RYSA 8ICNA 4Q8EA 5DGAA 3RB6A 2J6SA 1BPBA 5TISU 1ZQQA 1RDFA 2R8KA 3IG8A 4M47A 4UW9A 2KJ8A 5L1IA 4IS7A 3ORYA 1WCNA 1QQ6A 4NLCA 5J8YC 2F1JA 4KITB 4EBCA 4UB3A 4XQ8A 3QUTA 7ICSA 3H7IA 3RH4A 2FMSA 3ZDDA 2WF8A 5CRXA 2LI6A 3QUBA 4C4TA 5G5HA 2XCAA 2QARB 3PW4A 3H40A 3T3FA 2W7OA 3U26A 2GWSA 1F0MA 5AIAA 3OHAA 3SV4A 2ISOA 3M7DA 2C22A 2LHTA 4ECZA 2K60A 3Q8PB 3QEAZ 4O3NA 1MN8A 1X66A 1O08A 3B9JA 3H8MA 1Q46A 4IRCA 1NK0A 2WTFA 2IOFA 8ICQA 3JPOA 4F8RA 3OPXA 3M9NB 1K1SA 1N61A 2JHDA 2W8LA 1KW4A 7ICPA 1PVRA 2BPCA 4ED6A 2VANA 1B0XA 3KZXA 3NGDA 1L3SA 5EWFA 4B9VA 9ICUA 3I28A 5DB7A 3NS1A 1NI3A 4DSJA 4F5QA 4ACOA 4KLGA 4JV0A 3ZD8A 1SWWA 2DPJA 1ZQPA 1ZQNA 3RAQA 4QWDA 1QH9A 9ICEA 2ZIWA 2W9BB 2P66A 2PFOA 1ZQMA 4F91B 4I2AA 1LKYB 3RB0A 4B9MA 3HP6A 5KFYA 1X6JA 3ZDAA 1ZETA 2R18A 3RJGA 2HVIA 7ICEA 4TQSA 1SL1A 2ZJ5A 4LZGA 1NKEA 3T5LA 3C2LA 1OXJA 4UASA 4RQ8A 1BPDA 2F44A 3H0RB 4TUPA 5ALMA 2IHMA 2H3VA 5KTQA 2W9CB 5J2BA 1HJPA 3EZ5A 3C29A 3UM9A 4UB1A 5DB9A 1ED1A 4NL9A 5ALWA 1IG6A 5ALUA 3PSIA 1TE2A 9ICJA 1QLNA 1BPZA 4OCZA 2YTUA 1S0OA 1N2XA 1P7DA 4ELTA 1YZ6A 4J9NA 5EE0A 1L3UA 1L3TA 1PK1B 5KFVA 1NK4A 2RP5A 4MEYA 1OUQA 2NO4A 3H8JA 5HR7A 4QZDA 4R8UA 5IIJA 2YB4A 3JPPA 1CUKA 1ZQEA 5EE3A 3EUB2 3QEBZ 4Z6EA 2YMQA 1WCLA 4AYBC 4FZNA 4CF3A 1UCVA 5KL1B 4QWEA 2EAMA 4PH5A 2G07A 5J0PA 5AK4A 3OJUA 5J2IA 1N62A 4IQWA 1PVQA 4QIWC 5KFKA 4K4IA 1L8LA 4KLJA 1COOA 1SKWA 2RLTA 4RPXA 2JEIA 5J2FA 1SB3C 4I2DA 3UMBA 1T94A 4BXOA 3H8WA 3AM9A 2FMQA 1WUDA 2QB0B 3PY8A 9ICPA 2YMLA 3K75D 2VA8A 2BQRA 4DFDA 4RQ0A 5AKEA 1X2IA 1X9SA 3AU2A 2BCRA 5KFWA 1ZD2P 4RQ5A 3RFAA 2W03A 1A6SA 2I6XA 3RRGA 8ICSA 1ZQOA 1XO0A 3H0MB 2A1JA 4DL6A 3LWLA 2E8OA 3TADA 4F5OA 2Y1JA 5AKJA 1ZQRA 2BCUA 1SKSA 1TVAA 1ZQJA 1L8OA 3ZI4A 1ZQUA 1MC8A 3RRHA 1UT8A 2YN4A 3JPRA 3UQ2A 8ICEA 2CXYA 4ELUA 2BR0A 2YX8A 5JTIA 1K1QA 2AGPA 4KX3A 4DCCA 4R63A 4UB8U 1ZQLA 1IM4A 3GIJA 2RQ5A 3M6ZA 1N63A 4RQMA 4F4WA 4DS4A 4PHDA 3MDCA 2XI9A 2ZTDA 3AN1A 4QWCA 2FLNA 3SMVA 5AKLA 2XY6A 2KMDA 9ICQA 4UB4A 2J6UA 4KLSA 5HNKA 4I28A 1SIJA 2LYAA 4O0IA 4C4RA 4Q8FA 4OO1J 5AI4A 4ED0A 4PHPA 4J03A 4YCXA 5CWRA 2Y9TA 5KFUA 4BDPA 2M0NA 3MGVA 4C7ZA 4IRKA 3HKZC 8ICTA 4PHEA 3PSTA 1QCKA 5J2CA 7ICLA 2FPKA 1JIHA 3QZ8A 2FJ6A 3B0YA 2PI5A 1QQ5A 2BKEA 5KFZA 1NOMA 1Q8KA 5KFMA 7ICIA 2HOFA 4P4PA 1RZTA 2JV3A 2KIVA 2H5XA 2KZMA 3SR6A 1H38A 3KBBA 1X9XA 2E8PA 2HHXA 1DK2A 3C2KA 4UAWA 4P4OA 4M04A 1BGXT 2HW3A 5AK6A 3HW8A 4C8OA 1SXEA 4PJ0U 9ICMA 5JRTA 4ECXA 3B0XA 2Y0SF 2QKQA 2W9AA 3HILA 5DB6A 2PFNA 2DL0A 4YMNA 3BS5B 1RYRA 4J9OA 1C20A 5KT2A 5FP0A 8ICHA 3UPQA 2OWOA 4DL4A 4IC9A 2WHEA 1ZQIA 2HOIA 4LVSA 4I2FA 5JUMA 9ICSA 4J9KA 2O6KA 2ZJ8A 2PI4A 4EZ6A 4O3OA 2B21A 1T3NA 4MFCA 3MGHA 5DG7A 2KSOA 3FAHA 3MFHA 1Z4NA 3PO5A 2JEFA 2H3FA 5CA7A 4TUQA 2W8KA 5KFRA 1ZQWA 3GV8B 5D4BA 3N4MB 1KRPA 1UHUA 3LDAA 2XY5A 8ICFA 4F93B 1KN5A 1Z00A 5KFXA 4CF4A 4G9BA 3GFKB 1KBUA 4PGXA 3GV5B 2NRXA 5J0RA 4QZGA 2EANA 1L7OA 2KP7A 5KG4A 2VJ5A 3PW0A 4ECQA 2KOBA 2CRXA 4MFFA 3ISCA 5ALEA 5DG8A 2F1IA 1TK8A 2R8GA 4FE3A 1BNOA 1KQQA 3GIKA 5AKHA 3E2EA 2PFPA 4C8MA 4R65A 1ECWA 3PX6A 4UB5A 5CHGA 5AKGA 1DOQA 2ZIVB 5J0SA 5ALVA 4IQUA 2ALZA 4KLHA 3C1YA 1Q3UA 4FZLA 2ZJAA 3TFRA 5CR0A 1COKA 2K8CB 2H3ZA 4KMOB 4O3QA 2JEJA 2RDIA 3WKAA 1YZ7A 5KFPA 1SL2A 4UAZA 3E58A 3SZ2A 3ZD9A 1SZHA 3RBDA 7ICVA 1L7PA 3EWAA 2FLLA 9ICVA 4GIBA 2LM1A 4B9UA 4IR9A 4Y2QA 3IV6A 2I5HA 3MR5A 2AQ4A 3QU7A 4I2IA 1SV0A 5AKIA 4NV0A 1A0PA 2KJ5A 4JB3A 2NRTA 3IM1A 3UXNA 4U7CA 1DK3A 3LK9A 5AKZA 1TK0A 2CPRA 3JPNA 4UB6U 5AHXA 4M9GA 1S5LU 1DRGA 1SV4A 2XCPA 3BQ0A 1NZPA 5KG7A 4TUSA 5ALTA 5ALXA 2ZIXA 2G09A 3N7SC 4EBEA 4QWBA 2G08A 4FBUA 3N97B 5B66U 4KLQA 2EH9A 2K4EA 4PZOA 5BOMA 3DDHA 3HWTA 3I76A 5KG6A 2WAQF 3OHBA 3RJHA 3PR5B 1NKCA 3BQTA 2FI1A 3RJJA 4QZEA 5KFBA 5EWGA 5KFHA 8ICYA 4ECSA 5ALNA 3TQ1A
chains in the Genus database with same CATH topology
4TUPA 3C5FA 2IHMA 7ICHA 3JPTA 5J2BA 4F5RA 3V7LA 4QZ9A 4M9HA 4QZHA 5J2DA 4UB1A 4LZDA 8ICOA 4Z6DA 5DB9A 4X5VA 4XA5A 4PGYA 9ICJA 4KLUA 4MF8A 4Z6FA 1BPZA 9ICNA 1ZJMA 9ICCA 7ICGA 1ZQAA 3C2MA 4RT3A 4RQ4A 3JPSA 3AUOA 3PMNA 1ZQKA 8ICXA 4QZDA 7ICOA 5IIJA 1MQ3A 3JPPA 1ZQEA 4KLLA 4Z6EA 4GXJA 4I29A 4KLOA 4TURA 7ICNA 4JWNA 4PH5A 5J0PA 4PPXA 5J2IA 5D46A 4RT2A 9ICAA 2I9GA 5IIIA 4JWMA 8ICRA 4IQWA 7ICTA 4K4IA 5J2EA 1ZQGA 3RJKA 1JMSA 7ICMA 4O5KA 4KLJA 4RPXA 5J2FA 4I2DA 4I27A 2ISPA 5J0WA 9ICTA 2FMQA 4KLIA 2PFQA 4NXZA 4QZ8A 5DDYA 9ICPA 2BCVA 4RQ0A 5IIKA 5CB1A 3AU2A 2BCRA 4RQ5A 4RQ6A 3V72A 8ICAA 4RQ1A 5BOLA 8ICSA 4DO9A 1ZQOA 8ICLA 4IQTA 1ZQFA 4KLFA 4UB2A 5J29A 7ICQA 4P2HA 8ICKA 4F5OA 1ZQRA 7ICJA 3ISDA 2BCUA 1ZQJA 1XSNA 1TVAA 8ICVA 3RJIA 9ICGA 5J0TA 3JPRA 5BPCA 3UQ2A 8ICEA 9ICHA 4Z6CA 4I2HA 4R63A 1ZQLA 5TZVA 8ICGA 3PNCA 4NLZA 5J0QA 4PHDA 3MDCA 4M2YA 4I2GA 3GDXA 4RQ2A 4M9JA 2BPFA 8ICWA 9ICQA 4UB4A 4O5CA 4KLSA 1HUOA 4I28A 4R66A 5EOZA 8ICPA 5DB8A 4PHPA 4YCXA 5CWRA 4UBCA 4I2EA 4QZBA 2W9MA 4RQ7A 3ISBA 9ICBA 4UAYA 3UXPA 9ICIA 3RJEA 1ZQHA 7ICKA 9ICWA 8ICTA 4YMMA 4PHEA 4QZCA 5J2CA 4M9LA 4O5EA 1ZQBA 7ICLA 3MGIA 4DOAA 4RPYA 3B0YA 5DKWA 9ICLA 1BPEA 1KDHA 7ICIA 7ICUA 2BCSA 9ICKA 1RZTA 4NM1A 4MF2A 8ICUA 5J2JA 4NM2A 1BNPA 3V7JA 1DK2A 5IIOA 5J2HA 1ZQSA 3C2KA 3OGUA 4UAWA 4M04A 4XUSA 4M0AA 4YMOA 4DOBA 4DOCA 4KLDA 3HW8A 9ICMA 1HUZA 3B0XA 4F5PA 5DB6A 2PFNA 5J2AA 1ZQTA 4NLKA 4KLTA 4YMNA 3JPQA 4QZAA 4MFAA 4YD2A 1XSLA 1ZQDA 7ICRA 3C5GA 5J0XA 8ICHA 3UPQA 4K4HA 3RH5A 1ZQIA 3PMLA 4LVSA 7ICFA 4I2FA 9ICSA 3MBYA 4UBBA 4F5NA 4NLNA 4PGQA 4MFCA 3MGHA 1ZQCA 4O9MA 8ICNA 5IINA 3RH6A 4I2CA 4I2BA 4GXKA 4TUQA 1ZQQA 3MDAA 4KLEA 4M47A 4QZIA 5J2GA 5D4BA 8ICFA 4YD1A 4R64A 3UQ0A 4UB3A 4PGXA 1BPXA 7ICSA 5J0OA 3RH4A 5J0YA 5J0RA 4QZGA 4YN4A 2KP7A 2FMSA 1XSPA 4NY8A 4PHAA 3AU6A 4MFFA 3ISCA 8ICMA 3RJFA 4KLMA 1BNOA 5DBBA 5DBCA 1KEJA 2GWSA 2PFPA 5IIMA 5IILA 2ISOA 4R65A 1MQ2A 5D49A 5J2KA 4IQVA 4UB5A 3TFSA 3UXOA 5J0SA 4IQUA 4KLHA 5HHHA 8ICQA 3JPOA 4QZFA 3TFRA 4I2JA 8ICIA 5HHIA 2PXIA 4UAZA 8ICBA 8ICJA 4GXIA 7ICVA 4FO6A 7ICPA 9ICVA 9ICUA 3V7KA 4I2IA 5DB7A 5DBAA 9ICFA 4F5QA 3UXNA 2BCQA 4KLGA 1DK3A 3LK9A 3JPNA 1ZQPA 4M9GA 1ZQNA 9ICXA 1ZJNA 9ICEA 1TV9A 1NZPA 4TUSA 2P66A 3HX0A 2PFOA 1ZQMA 4I2AA 4M9NA 4RQ3A 5J0UA 4RPZA 9ICOA 4K4GA 4KLQA 3RJGA 7ICEA 1BPYA 5BOMA 3HWTA 2FMPA 4LZGA 3RJHA 3C2LA 4RQ8A 3RJJA 1BPDA 4QZEA 9ICRA 2BPGA 8ICYA 8ICZA 8ICCA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4TUP A;  3C5F A;  2IHM A;  7ICH A;  3JPT A;  5J2B A;  4F5R A;  3V7L A;  4QZ9 A;  4M9H A;  4QZH A;  5J2D A;  4UB1 A;  4LZD A;  8ICO A;  4Z6D A;  5DB9 A;  4X5V A;  4XA5 A;  4PGY A;  9ICJ A;  4KLU A;  4MF8 A;  4Z6F A;  1BPZ A;  9ICN A;  1ZJM A;  9ICC A;  7ICG A;  1ZQA A;  3C2M A;  4RT3 A;  4RQ4 A;  3JPS A;  3AUO A;  3PMN A;  1ZQK A;  8ICX A;  4QZD A;  7ICO A;  5IIJ A;  1MQ3 A;  3JPP A;  1ZQE A;  4KLL A;  4Z6E A;  4GXJ A;  4I29 A;  4KLO A;  4TUR A;  7ICN A;  4JWN A;  4PH5 A;  5J0P A;  4PPX A;  5J2I A;  5D46 A;  4RT2 A;  9ICA A;  2I9G A;  5III A;  4JWM A;  8ICR A;  4IQW A;  7ICT A;  4K4I A;  5J2E A;  1ZQG A;  3RJK A;  1JMS A;  7ICM A;  4O5K A;  4KLJ A;  4RPX A;  5J2F A;  4I2D A;  4I27 A;  2ISP A;  5J0W A;  9ICT A;  2FMQ A;  4KLI A;  2PFQ A;  4NXZ A;  4QZ8 A;  5DDY A;  9ICP A;  2BCV A;  4RQ0 A;  5IIK A;  5CB1 A;  3AU2 A;  2BCR A;  4RQ5 A;  4RQ6 A;  3V72 A;  8ICA A;  4RQ1 A;  5BOL A;  8ICS A;  4DO9 A;  1ZQO A;  8ICL A;  4IQT A;  1ZQF A;  4KLF A;  4UB2 A;  5J29 A;  7ICQ A;  4P2H A;  8ICK A;  4F5O A;  1ZQR A;  7ICJ A;  3ISD A;  2BCU A;  1ZQJ A;  1XSN A;  1TVA A;  8ICV A;  3RJI A;  9ICG A;  5J0T A;  3JPR A;  5BPC A;  3UQ2 A;  8ICE A;  9ICH A;  4Z6C A;  4I2H A;  4R63 A;  1ZQL A;  5TZV A;  8ICG A;  3PNC A;  4NLZ A;  5J0Q A;  4PHD A;  3MDC A;  4M2Y A;  4I2G A;  3GDX A;  4RQ2 A;  4M9J A;  2BPF A;  8ICW A;  9ICQ A;  4UB4 A;  4O5C A;  4KLS A;  1HUO A;  4I28 A;  4R66 A;  5EOZ A;  8ICP A;  5DB8 A;  4PHP A;  4YCX A;  5CWR A;  4UBC A;  4I2E A;  4QZB A;  2W9M A;  4RQ7 A;  3ISB A;  9ICB A;  4UAY A;  3UXP A;  9ICI A;  3RJE A;  1ZQH A;  7ICK A;  9ICW A;  8ICT A;  4YMM A;  4PHE A;  4QZC A;  5J2C A;  4M9L A;  4O5E A;  1ZQB A;  7ICL A;  3MGI A;  4DOA A;  4RPY A;  3B0Y A;  5DKW A;  9ICL A;  1BPE A;  1KDH A;  7ICI A;  7ICU A;  2BCS A;  9ICK A;  1RZT A;  4NM1 A;  4MF2 A;  8ICU A;  5J2J A;  4NM2 A;  1BNP A;  3V7J A;  1DK2 A;  5IIO A;  5J2H A;  1ZQS A;  3C2K A;  3OGU A;  4UAW A;  4M04 A;  4XUS A;  4M0A A;  4YMO A;  4DOB A;  4DOC A;  4KLD A;  3HW8 A;  9ICM A;  1HUZ A;  3B0X A;  4F5P A;  5DB6 A;  2PFN A;  5J2A A;  1ZQT A;  4NLK A;  4KLT A;  4YMN A;  3JPQ A;  4QZA A;  4MFA A;  4YD2 A;  1XSL A;  1ZQD A;  7ICR A;  3C5G A;  5J0X A;  8ICH A;  3UPQ A;  4K4H A;  3RH5 A;  1ZQI A;  3PML A;  4LVS A;  7ICF A;  4I2F A;  9ICS A;  3MBY A;  4UBB A;  4F5N A;  4NLN A;  4PGQ A;  4MFC A;  3MGH A;  1ZQC A;  4O9M A;  8ICN A;  5IIN A;  3RH6 A;  4I2C A;  4I2B A;  4GXK A;  4TUQ A;  1ZQQ A;  3MDA A;  4KLE A;  4M47 A;  4QZI A;  5J2G A;  5D4B A;  8ICF A;  4YD1 A;  4R64 A;  3UQ0 A;  4UB3 A;  4PGX A;  1BPX A;  7ICS A;  5J0O A;  3RH4 A;  5J0Y A;  5J0R A;  4QZG A;  4YN4 A;  2KP7 A;  2FMS A;  1XSP A;  4NY8 A;  4PHA A;  3AU6 A;  4MFF A;  3ISC A;  8ICM A;  3RJF A;  4KLM A;  1BNO A;  5DBB A;  5DBC A;  1KEJ A;  2GWS A;  2PFP A;  5IIM A;  5IIL A;  2ISO A;  4R65 A;  1MQ2 A;  5D49 A;  5J2K A;  4IQV A;  4UB5 A;  3TFS A;  3UXO A;  5J0S A;  4IQU A;  4KLH A;  5HHH A;  8ICQ A;  3JPO A;  4QZF A;  3TFR A;  4I2J A;  8ICI A;  5HHI A;  2PXI A;  4UAZ A;  8ICB A;  8ICJ A;  4GXI A;  7ICV A;  4FO6 A;  7ICP A;  9ICV A;  9ICU A;  3V7K A;  4I2I A;  5DB7 A;  5DBA A;  9ICF A;  4F5Q A;  3UXN A;  2BCQ A;  4KLG A;  1DK3 A;  3LK9 A;  3JPN A;  1ZQP A;  4M9G A;  1ZQN A;  9ICX A;  1ZJN A;  9ICE A;  1TV9 A;  1NZP A;  4TUS A;  2P66 A;  3HX0 A;  2PFO A;  1ZQM A;  4I2A A;  4M9N A;  4RQ3 A;  5J0U A;  4RPZ A;  9ICO A;  4K4G A;  4KLQ A;  3RJG A;  7ICE A;  1BPY A;  5BOM A;  3HWT A;  2FMP A;  4LZG A;  3RJH A;  3C2L A;  4RQ8 A;  3RJJ A;  1BPD A;  4QZE A;  9ICR A;  2BPG A;  8ICY A;  8ICZ A;  8ICC A; 
#chains in the Genus database with same CATH topology
 2AHO B;  4RNM A;  4J9Q A;  5ALG A;  1JN3 A;  4F5R A;  2KHQ A;  4UAR A;  3V7L A;  4M9H A;  4QZH A;  5J2D A;  1JXL A;  4P0P A;  3SD7 A;  4Z6D A;  2UVW A;  1ZQ1 C;  3PX0 A;  5KAI U;  4MF8 A;  5L1K A;  3IHQ B;  4DLE A;  2KZ3 A;  9ICN A;  3UMG A;  4DL5 A;  9ICC A;  3C23 A;  4KN7 A;  3OSP A;  4US8 A;  5AM5 A;  3KTQ A;  5DGB A;  2A3V A;  3PW7 A;  5ALL A;  2IA6 A;  4YVZ A;  1ZD4 A;  1D8L A;  2HBJ A;  1RQN A;  2EZX A;  1L7M A;  4EX7 A;  2W3S A;  2H3Q A;  2VA2 A;  3NVW A;  2NYV A;  3F53 A;  4KLO A;  4TUR A;  3Q8R B;  4RU9 A;  4JWN A;  5AKK A;  3ALR A;  3KD3 A;  4HYK A;  4P0Q B;  1RXW A;  3Q8K A;  5III A;  8ICR A;  1V85 A;  2XGQ A;  1L7N A;  5AM1 A;  4C80 A;  3RJK A;  3T5J A;  2UVR A;  7ICM A;  2V4R A;  4O5K A;  3T5H A;  2VIX A;  2Z7J A;  4I27 A;  2HSZ A;  3C21 A;  3L5K A;  5ALK A;  2XY7 A;  3VCB A;  3G6X A;  4DL7 A;  4DEZ A;  3NTU A;  2ATL A;  4RZR A;  2AGQ A;  5DDY A;  2KVS A;  3K1Z A;  2PKE A;  1JXE A;  5G5G A;  3M6K A;  5IIK A;  1T4G A;  5CB1 A;  2NRV A;  2ZG6 A;  3QU4 A;  3NRW A;  1KSP A;  4P4M A;  4DS5 A;  2E8M A;  3AMZ A;  3Q8S B;  1KLN A;  1C7Y A;  4KX5 A;  4DO9 A;  1DGJ A;  4Y2R A;  8ICL A;  3KKA A;  4IQT A;  3KOO A;  3F5A A;  3FC4 A;  3AQF A;  4P2H A;  1BVS A;  3HJE A;  1S0N A;  4JMU A;  1NZB A;  3RAX A;  3V6K A;  5AI6 A;  2G5I B;  3IN5 A;  1FEZ A;  3R9K A;  3BZC A;  4I2H A;  2F3N A;  3KFU F;  2K4I A;  5KFT A;  8ICG A;  3PNC A;  2FPL A;  3MAB A;  5KFQ A;  3TAD C;  1CRX A;  2W9B A;  4F4Z A;  5ALY A;  3T79 A;  3BS7 A;  3PW5 A;  3LVV A;  3V6J A;  5CP2 A;  3GIL A;  3GDX A;  4EZ9 A;  4M9J A;  3G6V A;  5AM0 A;  4O5C A;  2IOF K;  3D6J A;  1QSS A;  5KNI A;  5KG1 A;  4DQR A;  4DSE A;  2EQY A;  3PSP A;  4I2E A;  3ETR A;  2ZUB A;  2L5Y A;  4F4X A;  2AXT U;  5KFG A;  2W9M A;  2F8L A;  5KG3 A;  1NK7 A;  7ICK A;  4YMM A;  3HPO A;  1LV5 A;  4QZC A;  2YMM A;  2WB1 F;  3SI8 A;  1VJ5 A;  3MGI A;  4IR1 A;  4FBT A;  4BXO B;  1HEK A;  4DOA A;  2W55 A;  2YY6 A;  1KFT A;  1RYU A;  2UVV A;  3TAC B;  2IOH A;  3WU2 U;  2BCS A;  4CRX A;  3EPG A;  4NM1 A;  4MF2 A;  1L5U A;  4Y2S A;  4LJX A;  1L6N A;  1NKB A;  4J9L A;  4XRH A;  3NAS A;  2ZXH A;  5IIO A;  1XWL A;  2JRZ A;  5J2H A;  1ZQS A;  2DBY A;  4G3I A;  4XUS A;  4M0A A;  1KFS A;  4O3S A;  4YMO A;  5AM2 A;  4F5P A;  3WK7 A;  4Y2Y A;  5AM4 A;  5F9L A;  5KG5 A;  1U49 A;  1KKX A;  2RHF A;  4NLK A;  4KLT A;  1X9M A;  3SEN A;  2PMZ C;  4YR0 A;  1CI4 A;  1MSW D;  4QZA A;  2KHV A;  4YD2 A;  2W11 A;  1J2N A;  2FPM A;  1ZQD A;  4DL3 A;  2LKY A;  1S8O A;  4Q45 A;  2KIC A;  5H2F U;  3RH5 A;  2B0C A;  7ICF A;  2JH7 A;  3PR4 A;  2KG5 A;  4NLB A;  5AK3 A;  2JMG A;  3MBY A;  4UBB A;  4Q44 A;  4F5N A;  1XO1 A;  3NVY A;  1IIP A;  2EAO A;  3M9O B;  2KFZ A;  5F3X B;  1ZD5 A;  3HT3 A;  2A1A A;  4DSK A;  5KL8 B;  3RH6 A;  4DFK A;  2NRW A;  3N7R C;  2QB0 A;  4QIW F;  4GXK A;  4US9 A;  3MDA A;  3SQI A;  5KT7 A;  2G06 A;  4QZI A;  2LYB A;  3BJY A;  5AI9 A;  1K5O A;  2DGZ A;  4ECU A;  3HRD D;  4F92 B;  4YD1 A;  3MFI A;  3GIM A;  2KD1 A;  1U48 A;  4R64 A;  2FLP A;  4C0Z A;  2G5H B;  3GV7 B;  1BPX A;  1TAU A;  1N60 A;  4CNQ A;  1XSP A;  3CP8 A;  1UT5 A;  5AI8 A;  3AU6 A;  3O0F A;  4KMU A;  2ZIU A;  8ICM A;  4DFJ A;  4C8N A;  4EEN A;  4RQN A;  5DBB A;  3AQE A;  2C2R A;  4MHV A;  1KEJ A;  2XO7 A;  5IIM A;  5KFD A;  2KKV A;  5D49 A;  4UAU A;  1X6I A;  5J2K A;  4IQV A;  3EPI A;  3TAR A;  1ZQY A;  4DF8 A;  2WF5 A;  3LWM A;  3OTQ A;  5CEH A;  2DKZ A;  3UXO A;  3K1R B;  2YB1 A;  2AJQ A;  2LMR A;  5HHH A;  4BWJ A;  2GLE A;  3ETL A;  4QZF A;  4ED8 A;  5HHI A;  2XVT A;  1FO4 A;  3FM9 A;  2PXI A;  3IDW A;  3QUQ A;  8ICB A;  8ICJ A;  4F50 A;  2KNJ A;  4OJP A;  4FO6 A;  3MR2 A;  4GC7 A;  1U9L A;  2IBK A;  2K8A A;  5DQG A;  4YXM A;  3PV8 A;  3V7K A;  2K4P A;  2F8K A;  4O3M A;  5AIB A;  1WWU A;  3F2B A;  1T8E A;  2MUT A;  3EYZ A;  4JV1 A;  1LB2 B;  3I1Y A;  2BCQ A;  3HKZ F;  1XS9 D;  1ZJN A;  3D2S A;  2LYH A;  1TV9 A;  4Y2U A;  2B6G A;  2K8B B;  2E1F A;  2GO7 A;  3HX0 A;  3DV9 A;  2FDR A;  4M9N A;  4RQ3 A;  1S76 D;  2HCF A;  5J0U A;  5HML A;  4K4G A;  2KVC A;  2MAX A;  2KN7 A;  1F44 A;  4F2S A;  3C1Z A;  4HAI A;  4CGZ A;  4EX6 A;  3BDP A;  1PVP A;  5EWE A;  3IP4 B;  5KFC A;  2FMP A;  3CYM A;  4PL1 A;  4YG2 A;  1UPH A;  4B9T A;  3BS5 A;  1GO3 F;  9ICR A;  1S0V A;  8ICC A;  3C5F A;  4PL2 A;  1D8Y A;  2QLT A;  1S0M A;  4UAT A;  7ICH A;  3JPT A;  4UQG A;  3TAN A;  2OXO A;  1N48 A;  4DF4 A;  4LZD A;  1Z19 A;  1N5W A;  4F2R A;  1D8B A;  4X5V A;  3MC1 A;  4QNL A;  4XA5 A;  4ZOH C;  4PGY A;  4KLU A;  4Y2X A;  4Z6F A;  2XGP A;  2R8I A;  3BZK A;  2OH2 A;  3EW9 A;  4M6W B;  4RNO A;  4RUC A;  3C2M A;  4RNN A;  3MR3 A;  4ECR A;  4RQ4 A;  2KE7 A;  1TAQ A;  3AUO A;  2XIC A;  1QQ7 A;  3PMN A;  1A77 A;  8ICX A;  2KK0 A;  7ICO A;  1MQ3 A;  4J9P A;  3WK6 A;  5KFS A;  2AGO A;  1SXD A;  2JZB B;  4BX9 C;  2BGW A;  4GXJ A;  2G0A A;  4I29 A;  2QB1 A;  2HHS A;  2JEG A;  1U4B A;  2V9W A;  7ICN A;  1S9F A;  4B9L A;  2WFA A;  2ESE A;  4PPX A;  3KHG A;  2A19 A;  5D46 A;  4RT2 A;  4O3R A;  2I9G A;  7ICT A;  2OEH A;  3QU2 A;  5AI0 A;  1ZQG A;  4DSI A;  2IMW P;  2ZIX B;  3D2N A;  5AKY A;  4CF5 A;  1ZRM A;  3L4P A;  5C0Y A;  2WAQ C;  5ALH A;  1VLB A;  2I1Q A;  1NK8 A;  2D6F C;  2NO5 A;  5J0W A;  9ICT A;  2MU2 A;  4KLI A;  4ELV A;  4QW9 A;  4QZ8 A;  4GLX A;  3LVW A;  4TQR A;  2D8C A;  3AL0 B;  2BCV A;  3KHR A;  2Q0Z X;  5AI5 A;  3H8S A;  4ECT A;  2DF4 B;  1XNS A;  2F2A B;  1M6Y A;  4RQ6 A;  3V72 A;  8ICA A;  4RQ1 A;  2E3T A;  1B43 A;  3L3F X;  5BOL A;  5KFI A;  5K4L A;  1ZQF A;  5KG0 A;  2UVU A;  2E5S A;  5DLG A;  9ICG A;  3Q8L A;  1HIW A;  2AH5 A;  5HR6 A;  1NJW A;  5BPC A;  3QZ7 A;  3KKA C;  4Z6C A;  1JRP A;  4DWI A;  2EAP A;  5TZV A;  3GQC A;  1V9P A;  4NLZ A;  5CJ7 A;  1O03 A;  4FS1 A;  4DQP A;  1WYG A;  5KG2 A;  4KN4 A;  2AU0 A;  4A8E A;  3QX7 A;  4RQ2 A;  4F4Y A;  8ICW A;  3SAH A;  3QUC A;  1B4F A;  5EOZ A;  8ICP A;  4EEY A;  5KFJ A;  3K4G A;  5EE9 A;  2E1E A;  4QZB A;  4NL9 C;  4RQ7 A;  3ISB A;  4F3O A;  9ICB A;  9ICI A;  5ALJ A;  1MA7 A;  2HDO A;  1ZQH A;  3RJE A;  3GII A;  3RR8 A;  1UA1 A;  2MSN A;  4QW8 A;  2HOQ A;  1L3V A;  2GH1 A;  3RB4 A;  2F1H A;  2BQU A;  3UMC A;  4IL6 U;  1ZQB A;  4NJ8 A;  2BZF A;  4USA A;  1SGG A;  1ZQX A;  4J9R A;  2E8N A;  1T3Q A;  4U6P A;  4F71 A;  3RBE A;  2C28 A;  5DKW A;  1BPE A;  1KDH A;  5ALR A;  3NVV A;  1URJ A;  1ZQV A;  2QAR A;  5A0L A;  7ICU A;  4OJ6 A;  2ZIW B;  4ED2 A;  1J2M A;  2C2E A;  2AQ0 A;  2HMX A;  4PZN A;  2DQN B;  4NM2 A;  2ASD A;  3V7J A;  1ZYQ A;  5T14 A;  5KFN A;  1UA0 A;  3OGU A;  4B9S A;  2HHT A;  4Y2V A;  2P6R A;  1FFV A;  4DOC A;  5ALS A;  2DWQ A;  2W3R A;  3G6Y A;  3A0B U;  2YMP A;  2F77 X;  4Y2P A;  4DLG A;  5AM3 A;  2BHN A;  1ZQT A;  1QSL A;  3NUQ A;  3JPQ A;  3E0F A;  3NRZ A;  5J0X A;  4P0Q A;  3AEV A;  3RF9 A;  3SAF A;  4DFP A;  3SYZ A;  2NV3 A;  1ZD3 A;  3M9M B;  3MR6 A;  4B9N A;  5J8Y A;  4NLN A;  4PGQ A;  3TAQ A;  1ZQC A;  4O9M A;  2OM6 A;  2HHV A;  2RDJ A;  5IIN A;  1D9F A;  3BQ2 A;  2WB1 C;  4I2B A;  4I2C A;  3TI0 A;  1XC9 A;  4OJO A;  3WKD A;  4ZH4 A;  4C8L A;  4ED3 A;  4KLE A;  3T5K A;  1LVH A;  3BQ1 A;  1NK6 A;  1NJX A;  5J2G A;  4DL2 A;  4DSF A;  1LKY A;  3CW2 C;  1U45 A;  4R8U B;  1RXV A;  3N7P D;  3H4D A;  2YQE A;  1RM6 C;  4ED1 A;  5ALO A;  3UQ0 A;  3WKB A;  4CDG A;  2HHW A;  2KV2 A;  4FZM A;  2K89 A;  5J0O A;  5J0Y A;  1DGS A;  4YN4 A;  2FE9 A;  4NY8 A;  4PHA A;  5DDM A;  5ALZ A;  1XU4 A;  4JUZ A;  3F2C A;  2ODG A;  1JAL A;  2P6U A;  4WJ3 B;  1QTM A;  3RJF A;  4KLM A;  2OHF A;  5DBC A;  1TK5 A;  3WKC A;  2W9C A;  2IHN A;  4DSL A;  1B22 A;  5IIL A;  5E79 U;  5KT6 A;  1KL9 A;  3OJS A;  3KHL A;  2HBM A;  1MQ2 A;  3TFS A;  2Y1I A;  1NNL A;  1SL0 A;  4C7Y A;  5KFE A;  5L1L A;  3PW2 A;  4O3P A;  3H4B A;  1Q3V A;  1V97 A;  4Q43 A;  1NK9 A;  2KKP A;  4I2J A;  5AIC A;  8ICI A;  2KIW A;  1PK1 A;  4YXJ A;  2ZXI A;  2JXJ A;  4GXI A;  2ASJ A;  3RR7 A;  1PUZ A;  4EEL A;  2A1J B;  3A0H U;  5ALI A;  5DQI A;  1ZXI A;  5DBA A;  9ICF A;  3ZDE A;  4MEX A;  1J97 A;  1KTQ A;  1ZRN A;  3ONN A;  3C28 A;  5F9N A;  2RRD A;  4Y2T A;  1Z3E B;  1A76 A;  2K4H A;  1TKD A;  3WKE A;  9ICX A;  3QXG A;  3J81 j;  3PX4 A;  2ES6 A;  4ED7 A;  1PK3 A;  3IG5 A;  1AQ6 A;  2JH1 A;  1F5S A;  4AYB F;  3THV A;  1PZN A;  1X42 A;  2KEY A;  4ECW A;  1Z1B A;  2ZUD A;  1IV8 A;  5ALP A;  1TFR A;  4RPZ A;  5HMM A;  9ICO A;  3M8S A;  1RG6 A;  5B5E U;  4YP3 A;  5KFF A;  4RUA A;  1X9W A;  4FFD A;  4C8K A;  1BPY A;  5DQH A;  4NWI A;  1X40 A;  3SEI A;  2D3D A;  2W04 A;  3M8R A;  2W54 A;  2ZIU B;  2NRZ A;  1RQL A;  2JGA A;  5ALD A;  2BPG A;  2KFN A;  8ICZ A;  4DQI A;  3S6J A;  1ZOL A;  2LM4 A;  2Q4T A;  4CE6 A;  4QZ9 A;  8ICO A;  2PMZ F;  5C5J A;  1QSY A;  4YR2 A;  3QE9 Y;  4GFJ A;  4ECY A;  2Y0S C;  1JUD A;  2HHQ A;  1ZJM A;  2XID A;  1TAM A;  5KT5 A;  7ICG A;  3TAP A;  4ICA A;  1ZQA A;  4OJ5 A;  4RT3 A;  1ARO P;  1DXS A;  1VDV A;  3JPS A;  3PO4 A;  3CRX A;  4DFM A;  2OYY A;  1ZQK A;  2MRL A;  1SZP A;  4BUG A;  5DLF A;  3PZP A;  3KZI U;  4KLL A;  4EBD A;  4QWA A;  1N5X A;  4J9M A;  4EYH B;  2MUT B;  1WG8 A;  4FS2 A;  5L1J A;  4JK1 A;  2HBL A;  2ZUC A;  4KTQ A;  2BDP A;  4IRD A;  2MA1 A;  9ICA A;  4JWM A;  4E0D A;  3RTV A;  5AK5 A;  4J9S A;  4YFK A;  2GOL A;  5J2E A;  3M1Y A;  5KFA A;  1JMS A;  2DPI A;  3WK8 A;  3VC8 A;  4EEK A;  5JU5 A;  4JV2 A;  5HP4 A;  2V4Q A;  2ZTC A;  2ISP A;  2KSO B;  2BQ3 A;  2DFL A;  1S10 A;  2PFQ A;  4NXZ A;  1N56 A;  1NJZ A;  2W7P A;  3N28 A;  2XC9 A;  2VJ4 A;  4F72 A;  4ECV A;  2LBO A;  4GC6 A;  1SV0 C;  2HHU A;  2VKQ A;  1UQV A;  3RB3 A;  3DEE A;  3QU5 A;  2HBK A;  5KT3 A;  2C2D A;  3QNM A;  2R8J A;  2HVH A;  3TKA A;  1YT3 A;  1Z00 B;  1D9D A;  1JX4 A;  3F5E A;  1FFU A;  4KLF A;  4Y2J A;  3V6H A;  2N1R A;  3Q8Q B;  4UB2 A;  5J29 A;  7ICQ A;  4EYI B;  8ICK A;  3FYH A;  5EE1 A;  1WWV A;  3FDS A;  1FIQ A;  2EZY A;  3KHH A;  3ISD A;  7ICJ A;  8ICV A;  2M9N A;  1XSN A;  3RJI A;  5J0T A;  3WK5 A;  9ICH A;  2CN1 A;  2BDU A;  4YQW A;  2DKX A;  5J0Q A;  1SWV A;  3PSF A;  3QU9 A;  4M2Y A;  2JR5 A;  5AKX A;  4I2G A;  1V38 A;  5KT4 A;  2BPF A;  2WF6 A;  1HUO A;  3ZDC A;  4R66 A;  4OD0 A;  4CCH A;  5DB8 A;  4UBC A;  3GZF A;  2W43 A;  4BGD A;  4C4S A;  1SKR A;  2ZTE A;  1NJY A;  5L1M A;  4UAY A;  3UXP A;  2P35 A;  2WF9 A;  5ALF A;  9ICW A;  5KFO A;  4F4K A;  1U47 A;  4M9L A;  4O5E A;  1KFD A;  4UAV A;  1Y88 A;  1Z1V A;  3BQ7 A;  2LPE A;  2ASL A;  4RPY A;  5GTI U;  1CEZ A;  9ICL A;  2F76 X;  2EZZ A;  4DQS A;  1S77 D;  5KAF U;  3OSN A;  4BJQ A;  1EXN A;  3H0L B;  1Z4O A;  4BWM A;  2Y9U A;  2DUY A;  1JRO A;  9ICK A;  3WK9 A;  1S97 A;  8ICU A;  2WF7 A;  1T7P A;  3IRU A;  4M6W A;  3SAG A;  5J2J A;  2KJ9 A;  1BNP A;  3F2D A;  3GU3 A;  1JI7 A;  4QJF B;  2H3I A;  4DOB A;  4KLD A;  1RPL A;  1HUZ A;  2ZIV A;  5DG9 A;  2JZB A;  2VA3 A;  3CNH A;  1ZQZ A;  3ZDB A;  3LYS A;  2KZZ A;  5J2A A;  4NLG A;  5KFL A;  4B6J A;  5GTH U;  5L9X A;  3ED5 A;  1OW5 A;  3D2Q A;  4MFA A;  2OCE A;  1XSL A;  7ICR A;  3C5G A;  3PVX A;  4DQQ A;  3NVZ A;  4K4H A;  5ALQ A;  2HI0 A;  3PML A;  2KTQ A;  2R8H A;  3SV3 A;  4AP9 A;  4P0P B;  3ICX A;  3QYP A;  4OJL A;  1IXR A;  2J6T A;  3Q8M A;  1NK5 A;  4YR3 A;  2EDU A;  3WK4 A;  1RYS A;  8ICN A;  4Q8E A;  5DGA A;  3RB6 A;  2J6S A;  1BPB A;  5TIS U;  1ZQQ A;  1RDF A;  2R8K A;  3IG8 A;  4M47 A;  4UW9 A;  2KJ8 A;  5L1I A;  4IS7 A;  3ORY A;  1WCN A;  1QQ6 A;  4NLC A;  5J8Y C;  2F1J A;  4KIT B;  4EBC A;  4UB3 A;  4XQ8 A;  3QUT A;  7ICS A;  3H7I A;  3RH4 A;  2FMS A;  3ZDD A;  2WF8 A;  5CRX A;  2LI6 A;  3QUB A;  4C4T A;  5G5H A;  2XCA A;  2QAR B;  3PW4 A;  3H40 A;  3T3F A;  2W7O A;  3U26 A;  2GWS A;  1F0M A;  5AIA A;  3OHA A;  3SV4 A;  2ISO A;  3M7D A;  2C22 A;  2LHT A;  4ECZ A;  2K60 A;  3Q8P B;  3QEA Z;  4O3N A;  1MN8 A;  1X66 A;  1O08 A;  3B9J A;  3H8M A;  1Q46 A;  4IRC A;  1NK0 A;  2WTF A;  2IOF A;  8ICQ A;  3JPO A;  4F8R A;  3OPX A;  3M9N B;  1K1S A;  1N61 A;  2JHD A;  2W8L A;  1KW4 A;  7ICP A;  1PVR A;  2BPC A;  4ED6 A;  2VAN A;  1B0X A;  3KZX A;  3NGD A;  1L3S A;  5EWF A;  4B9V A;  9ICU A;  3I28 A;  5DB7 A;  3NS1 A;  1NI3 A;  4DSJ A;  4F5Q A;  4ACO A;  4KLG A;  4JV0 A;  3ZD8 A;  1SWW A;  2DPJ A;  1ZQP A;  1ZQN A;  3RAQ A;  4QWD A;  1QH9 A;  9ICE A;  2ZIW A;  2W9B B;  2P66 A;  2PFO A;  1ZQM A;  4F91 B;  4I2A A;  1LKY B;  3RB0 A;  4B9M A;  3HP6 A;  5KFY A;  1X6J A;  3ZDA A;  1ZET A;  2R18 A;  3RJG A;  2HVI A;  7ICE A;  4TQS A;  1SL1 A;  2ZJ5 A;  4LZG A;  1NKE A;  3T5L A;  3C2L A;  1OXJ A;  4UAS A;  4RQ8 A;  1BPD A;  2F44 A;  3H0R B;  4TUP A;  5ALM A;  2IHM A;  2H3V A;  5KTQ A;  2W9C B;  5J2B A;  1HJP A;  3EZ5 A;  3C29 A;  3UM9 A;  4UB1 A;  5DB9 A;  1ED1 A;  4NL9 A;  5ALW A;  1IG6 A;  5ALU A;  3PSI A;  1TE2 A;  9ICJ A;  1QLN A;  1BPZ A;  4OCZ A;  2YTU A;  1S0O A;  1N2X A;  1P7D A;  4ELT A;  1YZ6 A;  4J9N A;  5EE0 A;  1L3U A;  1L3T A;  1PK1 B;  5KFV A;  1NK4 A;  2RP5 A;  4MEY A;  1OUQ A;  2NO4 A;  3H8J A;  5HR7 A;  4QZD A;  4R8U A;  5IIJ A;  2YB4 A;  3JPP A;  1CUK A;  1ZQE A;  5EE3 A;  3EUB 2;  3QEB Z;  4Z6E A;  2YMQ A;  1WCL A;  4AYB C;  4FZN A;  4CF3 A;  1UCV A;  5KL1 B;  4QWE A;  2EAM A;  4PH5 A;  2G07 A;  5J0P A;  5AK4 A;  3OJU A;  5J2I A;  1N62 A;  4IQW A;  1PVQ A;  4QIW C;  5KFK A;  4K4I A;  1L8L A;  4KLJ A;  1COO A;  1SKW A;  2RLT A;  4RPX A;  2JEI A;  5J2F A;  1SB3 C;  4I2D A;  3UMB A;  1T94 A;  4BXO A;  3H8W A;  3AM9 A;  2FMQ A;  1WUD A;  2QB0 B;  3PY8 A;  9ICP A;  2YML A;  3K75 D;  2VA8 A;  2BQR A;  4DFD A;  4RQ0 A;  5AKE A;  1X2I A;  1X9S A;  3AU2 A;  2BCR A;  5KFW A;  1ZD2 P;  4RQ5 A;  3RFA A;  2W03 A;  1A6S A;  2I6X A;  3RRG A;  8ICS A;  1ZQO A;  1XO0 A;  3H0M B;  2A1J A;  4DL6 A;  3LWL A;  2E8O A;  3TAD A;  4F5O A;  2Y1J A;  5AKJ A;  1ZQR A;  2BCU A;  1SKS A;  1TVA A;  1ZQJ A;  1L8O A;  3ZI4 A;  1ZQU A;  1MC8 A;  3RRH A;  1UT8 A;  2YN4 A;  3JPR A;  3UQ2 A;  8ICE A;  2CXY A;  4ELU A;  2BR0 A;  2YX8 A;  5JTI A;  1K1Q A;  2AGP A;  4KX3 A;  4DCC A;  4R63 A;  4UB8 U;  1ZQL A;  1IM4 A;  3GIJ A;  2RQ5 A;  3M6Z A;  1N63 A;  4RQM A;  4F4W A;  4DS4 A;  4PHD A;  3MDC A;  2XI9 A;  2ZTD A;  3AN1 A;  4QWC A;  2FLN A;  3SMV A;  5AKL A;  2XY6 A;  2KMD A;  9ICQ A;  4UB4 A;  2J6U A;  4KLS A;  5HNK A;  4I28 A;  1SIJ A;  2LYA A;  4O0I A;  4C4R A;  4Q8F A;  4OO1 J;  5AI4 A;  4ED0 A;  4PHP A;  4J03 A;  4YCX A;  5CWR A;  2Y9T A;  5KFU A;  4BDP A;  2M0N A;  3MGV A;  4C7Z A;  4IRK A;  3HKZ C;  8ICT A;  4PHE A;  3PST A;  1QCK A;  5J2C A;  7ICL A;  2FPK A;  1JIH A;  3QZ8 A;  2FJ6 A;  3B0Y A;  2PI5 A;  1QQ5 A;  2BKE A;  5KFZ A;  1NOM A;  1Q8K A;  5KFM A;  7ICI A;  2HOF A;  4P4P A;  1RZT A;  2JV3 A;  2KIV A;  2H5X A;  2KZM A;  3SR6 A;  1H38 A;  3KBB A;  1X9X A;  2E8P A;  2HHX A;  1DK2 A;  3C2K A;  4UAW A;  4P4O A;  4M04 A;  1BGX T;  2HW3 A;  5AK6 A;  3HW8 A;  4C8O A;  1SXE A;  4PJ0 U;  9ICM A;  5JRT A;  4ECX A;  3B0X A;  2Y0S F;  2QKQ A;  2W9A A;  3HIL A;  5DB6 A;  2PFN A;  2DL0 A;  4YMN A;  3BS5 B;  1RYR A;  4J9O A;  1C20 A;  5KT2 A;  5FP0 A;  8ICH A;  3UPQ A;  2OWO A;  4DL4 A;  4IC9 A;  2WHE A;  1ZQI A;  2HOI A;  4LVS A;  4I2F A;  5JUM A;  9ICS A;  4J9K A;  2O6K A;  2ZJ8 A;  2PI4 A;  4EZ6 A;  4O3O A;  2B21 A;  1T3N A;  4MFC A;  3MGH A;  5DG7 A;  2KSO A;  3FAH A;  3MFH A;  1Z4N A;  3PO5 A;  2JEF A;  2H3F A;  5CA7 A;  4TUQ A;  2W8K A;  5KFR A;  1ZQW A;  3GV8 B;  5D4B A;  3N4M B;  1KRP A;  1UHU A;  3LDA A;  2XY5 A;  8ICF A;  4F93 B;  1KN5 A;  1Z00 A;  5KFX A;  4CF4 A;  4G9B A;  3GFK B;  1KBU A;  4PGX A;  3GV5 B;  2NRX A;  5J0R A;  4QZG A;  2EAN A;  1L7O A;  2KP7 A;  5KG4 A;  2VJ5 A;  3PW0 A;  4ECQ A;  2KOB A;  2CRX A;  4MFF A;  3ISC A;  5ALE A;  5DG8 A;  2F1I A;  1TK8 A;  2R8G A;  4FE3 A;  1BNO A;  1KQQ A;  3GIK A;  5AKH A;  3E2E A;  2PFP A;  4C8M A;  4R65 A;  1ECW A;  3PX6 A;  4UB5 A;  5CHG A;  5AKG A;  1DOQ A;  2ZIV B;  5J0S A;  5ALV A;  4IQU A;  2ALZ A;  4KLH A;  3C1Y A;  1Q3U A;  4FZL A;  2ZJA A;  3TFR A;  5CR0 A;  1COK A;  2K8C B;  2H3Z A;  4KMO B;  4O3Q A;  2JEJ A;  2RDI A;  3WKA A;  1YZ7 A;  5KFP A;  1SL2 A;  4UAZ A;  3E58 A;  3SZ2 A;  3ZD9 A;  1SZH A;  3RBD A;  7ICV A;  1L7P A;  3EWA A;  2FLL A;  9ICV A;  4GIB A;  2LM1 A;  4B9U A;  4IR9 A;  4Y2Q A;  3IV6 A;  2I5H A;  3MR5 A;  2AQ4 A;  3QU7 A;  4I2I A;  1SV0 A;  5AKI A;  4NV0 A;  1A0P A;  2KJ5 A;  4JB3 A;  2NRT A;  3IM1 A;  3UXN A;  4U7C A;  1DK3 A;  3LK9 A;  5AKZ A;  1TK0 A;  2CPR A;  3JPN A;  4UB6 U;  5AHX A;  4M9G A;  1S5L U;  1DRG A;  1SV4 A;  2XCP A;  3BQ0 A;  1NZP A;  5KG7 A;  4TUS A;  5ALT A;  5ALX A;  2ZIX A;  2G09 A;  3N7S C;  4EBE A;  4QWB A;  2G08 A;  4FBU A;  3N97 B;  5B66 U;  4KLQ A;  2EH9 A;  2K4E A;  4PZO A;  5BOM A;  3DDH A;  3HWT A;  3I76 A;  5KG6 A;  2WAQ F;  3OHB A;  3RJH A;  3PR5 B;  1NKC A;  3BQT A;  2FI1 A;  3RJJ A;  4QZE A;  5KFB A;  5EWG A;  5KFH A;  8ICY A;  4ECS A;  5ALN A;  3TQ1 A; 
#chains in the Genus database with same CATH homology
 4TUP A;  3C5F A;  2IHM A;  7ICH A;  3JPT A;  5J2B A;  4F5R A;  3V7L A;  4QZ9 A;  4M9H A;  4QZH A;  5J2D A;  4UB1 A;  4LZD A;  8ICO A;  4Z6D A;  5DB9 A;  4X5V A;  4XA5 A;  4PGY A;  9ICJ A;  4KLU A;  4MF8 A;  4Z6F A;  1BPZ A;  9ICN A;  1ZJM A;  9ICC A;  7ICG A;  1ZQA A;  3C2M A;  4RT3 A;  4RQ4 A;  3JPS A;  3AUO A;  3PMN A;  1ZQK A;  8ICX A;  4QZD A;  7ICO A;  5IIJ A;  1MQ3 A;  3JPP A;  1ZQE A;  4KLL A;  4Z6E A;  4GXJ A;  4I29 A;  4KLO A;  4TUR A;  7ICN A;  4JWN A;  4PH5 A;  5J0P A;  4PPX A;  5J2I A;  5D46 A;  4RT2 A;  9ICA A;  2I9G A;  5III A;  4JWM A;  8ICR A;  4IQW A;  7ICT A;  4K4I A;  5J2E A;  1ZQG A;  3RJK A;  1JMS A;  7ICM A;  4O5K A;  4KLJ A;  4RPX A;  5J2F A;  4I2D A;  4I27 A;  2ISP A;  5J0W A;  9ICT A;  2FMQ A;  4KLI A;  2PFQ A;  4NXZ A;  4QZ8 A;  5DDY A;  9ICP A;  2BCV A;  4RQ0 A;  5IIK A;  5CB1 A;  3AU2 A;  2BCR A;  4RQ5 A;  4RQ6 A;  3V72 A;  8ICA A;  4RQ1 A;  5BOL A;  8ICS A;  4DO9 A;  1ZQO A;  8ICL A;  4IQT A;  1ZQF A;  4KLF A;  4UB2 A;  5J29 A;  7ICQ A;  4P2H A;  8ICK A;  4F5O A;  1ZQR A;  7ICJ A;  3ISD A;  2BCU A;  1ZQJ A;  1XSN A;  1TVA A;  8ICV A;  3RJI A;  9ICG A;  5J0T A;  3JPR A;  5BPC A;  3UQ2 A;  8ICE A;  9ICH A;  4Z6C A;  4I2H A;  4R63 A;  1ZQL A;  5TZV A;  8ICG A;  3PNC A;  4NLZ A;  5J0Q A;  4PHD A;  3MDC A;  4M2Y A;  4I2G A;  3GDX A;  4RQ2 A;  4M9J A;  2BPF A;  8ICW A;  9ICQ A;  4UB4 A;  4O5C A;  4KLS A;  1HUO A;  4I28 A;  4R66 A;  5EOZ A;  8ICP A;  5DB8 A;  4PHP A;  4YCX A;  5CWR A;  4UBC A;  4I2E A;  4QZB A;  2W9M A;  4RQ7 A;  3ISB A;  9ICB A;  4UAY A;  3UXP A;  9ICI A;  3RJE A;  1ZQH A;  7ICK A;  9ICW A;  8ICT A;  4YMM A;  4PHE A;  4QZC A;  5J2C A;  4M9L A;  4O5E A;  1ZQB A;  7ICL A;  3MGI A;  4DOA A;  4RPY A;  3B0Y A;  5DKW A;  9ICL A;  1BPE A;  1KDH A;  7ICI A;  7ICU A;  2BCS A;  9ICK A;  1RZT A;  4NM1 A;  4MF2 A;  8ICU A;  5J2J A;  4NM2 A;  1BNP A;  3V7J A;  1DK2 A;  5IIO A;  5J2H A;  1ZQS A;  3C2K A;  3OGU A;  4UAW A;  4M04 A;  4XUS A;  4M0A A;  4YMO A;  4DOB A;  4DOC A;  4KLD A;  3HW8 A;  9ICM A;  1HUZ A;  3B0X A;  4F5P A;  5DB6 A;  2PFN A;  5J2A A;  1ZQT A;  4NLK A;  4KLT A;  4YMN A;  3JPQ A;  4QZA A;  4MFA A;  4YD2 A;  1XSL A;  1ZQD A;  7ICR A;  3C5G A;  5J0X A;  8ICH A;  3UPQ A;  4K4H A;  3RH5 A;  1ZQI A;  3PML A;  4LVS A;  7ICF A;  4I2F A;  9ICS A;  3MBY A;  4UBB A;  4F5N A;  4NLN A;  4PGQ A;  4MFC A;  3MGH A;  1ZQC A;  4O9M A;  8ICN A;  5IIN A;  3RH6 A;  4I2C A;  4I2B A;  4GXK A;  4TUQ A;  1ZQQ A;  3MDA A;  4KLE A;  4M47 A;  4QZI A;  5J2G A;  5D4B A;  8ICF A;  4YD1 A;  4R64 A;  3UQ0 A;  4UB3 A;  4PGX A;  1BPX A;  7ICS A;  5J0O A;  3RH4 A;  5J0Y A;  5J0R A;  4QZG A;  4YN4 A;  2KP7 A;  2FMS A;  1XSP A;  4NY8 A;  4PHA A;  3AU6 A;  4MFF A;  3ISC A;  8ICM A;  3RJF A;  4KLM A;  1BNO A;  5DBB A;  5DBC A;  1KEJ A;  2GWS A;  2PFP A;  5IIM A;  5IIL A;  2ISO A;  4R65 A;  1MQ2 A;  5D49 A;  5J2K A;  4IQV A;  4UB5 A;  3TFS A;  3UXO A;  5J0S A;  4IQU A;  4KLH A;  5HHH A;  8ICQ A;  3JPO A;  4QZF A;  3TFR A;  4I2J A;  8ICI A;  5HHI A;  2PXI A;  4UAZ A;  8ICB A;  8ICJ A;  4GXI A;  7ICV A;  4FO6 A;  7ICP A;  9ICV A;  9ICU A;  3V7K A;  4I2I A;  5DB7 A;  5DBA A;  9ICF A;  4F5Q A;  3UXN A;  2BCQ A;  4KLG A;  1DK3 A;  3LK9 A;  3JPN A;  1ZQP A;  4M9G A;  1ZQN A;  9ICX A;  1ZJN A;  9ICE A;  1TV9 A;  1NZP A;  4TUS A;  2P66 A;  3HX0 A;  2PFO A;  1ZQM A;  4I2A A;  4M9N A;  4RQ3 A;  5J0U A;  4RPZ A;  9ICO A;  4K4G A;  4KLQ A;  3RJG A;  7ICE A;  1BPY A;  5BOM A;  3HWT A;  2FMP A;  4LZG A;  3RJH A;  3C2L A;  4RQ8 A;  3RJJ A;  1BPD A;  4QZE A;  9ICR A;  2BPG A;  8ICY A;  8ICZ A;  8ICC A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...