1DK2A

Refined solution structure of the n-terminal domain of dna polymerase beta
Total Genus 19
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
19
sequence length
86
structure length
86
Chain Sequence
SKRKAPQETLNGGITDMLVELANFEKNVSQAIHKYNAYRKAASVIAKYPHKIKSGAEAKKLPGVGTKIAEKIDEFLATGKLRKLEK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords DNA POLYMERASE BETA
publication title Backbone dynamics and refined solution structure of the N-terminal domain of DNA polymerase beta. Correlation with DNA binding and dRP lyase activity.
pubmed doi rcsb
source organism Rattus norvegicus
total genus 19
structure length 86
sequence length 86
ec nomenclature ec 2.7.7.7: DNA-directed DNA polymerase.
pdb deposition date 1999-12-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF14716 HHH_8 Helix-hairpin-helix domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.110 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 DNA polymerase beta, N-terminal domain-like 1dk2A00
4UB4A 3GDXA 4DOCA 4PGYA 3UXPA 4QZGA 4YMOA 4YD2A 4KLJA 3LK9A 3PNCA 1BNOA 1KEJA 9ICBA 2FMPA 7ICHA 3RJIA 4KLEA 8ICYA 5IIJA 4RT3A 5DBAA 4YCXA 4NLKA 1BPDA 4K4GA 2BCVA 5J0SA 4PHEA 4F5OA 5IIIA 4O5KA 4IQVA 4MFCA 7ICJA 4QZBA 2ISPA 2W9MA 4K4IA 9ICAA 1BPZA 4DOBA 4KLTA 1ZQDA 3MDAA 4XA5A 3RH6A 3TFRA 4DO9A 4I2CA 1HUZA 5HHHA 4I27A 2BCSA 4M9LA 9ICPA 3RJJA 7ICPA 2PFOA 7ICNA 4RQ0A 5J2EA 3RJEA 7ICTA 3RJHA 4YMNA 1ZJMA 2PFNA 5IIMA 4TUSA 3UQ2A 9ICVA 9ICOA 4RPXA 5DBBA 4UBBA 5CB1A 8ICMA 4PGXA 1ZQQA 5J0OA 7ICLA 1BPEA 3C2MA 4R66A 4UB2A 5DB6A 5J2IA 8ICWA 4JWMA 5DDYA 4M47A 5J0YA 3ISDA 1XSLA 1ZQFA 4Z6FA 4IQTA 4RQ1A 8ICCA 5DB9A 4UB1A 4NXZA 1ZQHA 1TVAA 4RQ4A 1ZQJA 9ICTA 4NLNA 4YN4A 8ICFA 9ICEA 3UPQA 5J0PA 4UBCA 1ZQAA 9ICLA 5IILA 5J2KA 4PHAA 3JPOA 4K4HA 1JMSA 3JPQA 4I28A 4RQ3A 4RQ6A 4I2BA 1ZQPA 4GXJA 3V7LA 8ICQA 4Z6DA 5J0TA 3JPPA 4FO6A 2FMQA 5IINA 2IHMA 4NLZA 5DB8A 5J0WA 3UQ0A 4TUQA 3JPNA 2PFQA 7ICOA 1ZQIA 8ICKA 4RPZA 3TFSA 7ICVA 1ZQLA 9ICHA 1ZQEA 3V7JA 4NM2A 8ICOA 8ICTA 4UB3A 5J2CA 7ICIA 8ICXA 1ZJNA 4M0AA 7ICFA 4M2YA 5J2BA 2BPFA 2FMSA 4QZAA 3PMNA 9ICGA 3MDCA 3UXNA 2BPGA 4RT2A 5J29A 9ICIA 4JWNA 4I2FA 5DKWA 3RJKA 8ICJA 4RQ2A 3RJGA 4I2GA 1ZQKA 1ZQNA 4M9NA 7ICQA 4UB5A 2BCUA 4RPYA 1XSPA 1BPXA 4NM1A 4MF8A 3RJFA 5D4BA 9ICNA 1BNPA 9ICRA 4KLFA 5BOLA 3C5GA 1KDHA 2PFPA 3V72A 4QZ8A 4MFAA 8ICLA 3MGIA 9ICMA 3PMLA 3MGHA 4PH5A 1HUOA 4QZDA 4O5CA 4IQUA 4KLMA 4F5NA 5J2JA 9ICWA 2I9GA 7ICSA 3C2LA 4KLSA 1DK2A 4QZIA 5J2AA 4TUPA 4PGQA 4PHPA 4RQ8A 3C5FA 3JPRA 3JPTA 2KP7A 5CWRA 4P2HA 3B0YA 4QZCA 4UAYA 9ICXA 1RZTA 4QZFA 4KLHA 4I29A 4I2AA 4KLQA 4YD1A 1ZQBA 8ICBA 4GXIA 4O9MA 4X5VA 4KLDA 8ICGA 5J2HA 4M9GA 8ICHA 8ICVA 5TZVA 4LZGA 4I2JA 4R64A 4QZ9A 2GWSA 3MBYA 9ICKA 3RH5A 7ICRA 1ZQTA 8ICNA 4I2IA 5J2DA 4UAZA 1MQ2A 1ZQSA 4M9HA 5J0UA 4QZEA 7ICGA 5D49A 4UAWA 1XSNA 1ZQMA 9ICCA 4QZHA 5J0RA 8ICEA 8ICUA 9ICJA 3AU2A 1ZQOA 8ICRA 2P66A 1ZQGA 5HHIA 4PPXA 4LZDA 4XUSA 7ICKA 5DB7A 4I2EA 3HWTA 3JPSA 5IIKA 3V7KA 4RQ7A 5J2GA 4LVSA 4M04A 4Z6CA 5BPCA 9ICUA 2BCQA 1DK3A 4I2DA 2PXIA 8ICZA 4F5RA 9ICSA 3AU6A 5DBCA 1MQ3A 4PHDA 3HW8A 3AUOA 2ISOA 1TV9A 3RH4A 3OGUA 8ICSA 5J0XA 3B0XA 5J0QA 5D46A 5BOMA 4F5QA 4GXKA 4Z6EA 4MFFA 5EOZA 9ICQA 8ICAA 7ICEA 4KLOA 7ICMA 4O5EA 3ISCA 4TURA 4NY8A 8ICPA 4R65A 2BCRA 3C2KA 4IQWA 7ICUA 3HX0A 1ZQCA 4F5PA 4KLLA 3ISBA 4MF2A 1ZQRA 4KLGA 1NZPA 4KLUA 1BPYA 4I2HA 4M9JA 8ICIA 4YMMA 4KLIA 3UXOA 4R63A 4DOAA 5J2FA 5IIOA 4RQ5A 9ICFA
chains in the Genus database with same CATH superfamily
2K4PA 3WK5A 3BQ7A 3NVYA 4QWDA 1EXNA 5KFJA 1KEJA 3G6VA 2KD1A 1T4GA 3T5LA 3HKZF 4EX6A 3C29A 3RJIA 4KLEA 2YB4A 2Y0SF 5L1MA 5IIJA 2ALZA 3SENA 2H5XA 1PK1B 1NOMA 4KX3A 3OSPA 4OO1J 3FM9A 4O3QA 4K4GA 1DXSA 3PO4A 2BCVA 2HSZA 1B43A 5IIIA 4IQVA 4DFJA 2BQ3A 1AQ6A 2XI9A 4P4MA 3F2DA 2QB0A 2HHWA 1HEKA 5KNIA 9ICAA 5F3XB 2NO4A 1BPZA 5AKJA 2PMZC 2RP5A 1YZ7A 4G9BA 2GOLA 2VA2A 4P4OA 3RH6A 4DO9A 1L8LA 4YP3A 4I2CA 3KHGA 2F3NA 4NL9C 3THVA 1HUZA 1SV0C 2W8KA 4TQSA 2BCSA 1NKBA 1T8EA 4ECXA 3RJJA 2C2DA 3BS5B 7ICPA 5JU5A 2PFOA 4ECZA 2G07A 4RQ0A 5J2EA 3RJEA 7ICTA 5HNKA 3RJHA 2FJ6A 3IG8A 4YMNA 1T3QA 2XCAA 2G09A 5L1IA 3QZ8A 3ZD9A 3GIIA 1UT5A 9ICVA 5AI4A 3BZCA 4J9QA 2HHVA 1XWLA 5DG8A 4ECRA 1ECWA 1L3VA 2RQ5A 3N7PD 4DF8A 1S9FA 4UBBA 4F4ZA 1KKXA 8ICMA 1N60A 4PGXA 5ALLA 1N56A 1ZQQA 3AMZA 4UB2A 1COOA 2DPIA 3D2QA 8ICWA 1ZD2P 4NLCA 5DDYA 1PK1A 2W55A 4CF3A 2ZJAA 3BQTA 4UQGA 1ZQFA 1UCVA 3Q8PB 3MFHA 2LYHA 4IQTA 3IHQB 8ICCA 2R8JA 4UB1A 4KTQA 2XVTA 4JK1A 4DQIA 3Q8QB 1ZQWA 1QSSA 9ICEA 2KKPA 3WKDA 1QQ6A 3DDHA 5IILA 1Z1VA 4ZH4A 3GIKA 3E0FA 1N5WA 3RFAA 3JPQA 4I28A 2YB1A 2CRXA 2EZYA 5CR0A 2K4IA 5KAFU 5KTQA 4ED3A 2XCPA 4Z6DA 2ZUBA 4FO6A 2YN4A 2FMQA 1T3NA 5EWGA 1U47A 4DQPA 3TADA 3UQ0A 2HHXA 2KHVA 7ICOA 1BGXT 1KTQA 2A1JB 2FE9A 5AM1A 1Z4OA 3BS5A 3OSNA 3QEAZ 2LM1A 3TFSA 1S76D 1WUDA 9ICHA 3SYZA 3QUTA 1ZQEA 3V7JA 4NM2A 3KBBA 2EZZA 2D6FC 3UMGA 1QLNA 8ICTA 1Q3VA 1ZQ1C 2R18A 2DKXA 7ICIA 1FIQA 2KICA 1KFSA 4XQ8A 5ALGA 5C5JA 1L3TA 3QU4A 3Q8MA 1TK5A 2BPFA 4O3SA 4QZAA 3PMNA 2C2RA 3KZXA 4ECSA 4GC7A 9ICIA 4I2FA 3BS7A 3RJKA 3SAFA 2ZJ8A 3LWMA 5ALHA 4NWIA 1ZQNA 5F9NA 2Z7JA 5AKGA 4RPYA 1UA1A 5EE9A 3NVZA 2KEYA 1SGGA 1BPXA 4ECQA 4C4RA 2WF6A 1X9WA 3EYZA 4UATA 1NK8A 2ZXHA 3K4GA 5BOLA 3C5GA 3HPOA 2AGOA 4DQSA 2JR5A 3V72A 4MFAA 8ICLA 4KX5A 1WWVA 4KN4A 3GQCA 1S0NA 5KFLA 2BHNA 4Q8EA 4U7CA 3N97B 2F44A 4KN7A 4KLMA 4GFJA 2Q4TA 5J2JA 4F50A 3TAPA 4U6PA 5HR7A 1DK2A 3QUCA 2A1JA 5KFKA 4FBUA 5KFGA 2RDIA 2V4QA 5ALVA 3PZPA 2J6SA 2KMDA 4RQ8A 1P7DA 4IL6U 3C28A 1RQLA 1KL9A 5B5EU 2FI1A 2KP7A 3ETRA 5CWRA 2D8CA 2AU0A 5AKZA 2Y9UA 4DQQA 3H0RB 1RZTA 2FPMA 4J9MA 4KLHA 4PJ0U 3RR7A 1NJYA 3QU5A 2W9CB 4E0DA 4BX9C 4KLQA 2HW3A 1Z00B 4OJOA 2KN7A 5AKLA 1V85A 1ZQBA 3KHHA 5L9XA 5DGAA 2NRTA 2UVUA 2KJ9A 4X5VA 5J2HA 2ZUDA 2EDUA 8ICHA 1RXWA 5TZVA 4LZGA 2W03A 4I2JA 1SIJA 2ZJ5A 3PW7A 3MBYA 4FE3A 8ICNA 3TQ1A 5J2DA 4Y2XA 2RLTA 1NK7A 3IRUA 2PI4A 3LYSA 1ZQSA 4M9HA 2BPCA 5J0UA 4QZEA 2KKVA 2XIDA 3BQ0A 1ZQMA 4QZHA 1UHUA 8ICUA 2V9WA 8ICRA 3RF9A 2BDPA 3Q8LA 4PPXA 2ZTEA 4JV2A 3BZKA 1SWVA 5L1KA 1X40A 2KOBA 4B6JA 1IG6A 2LI6A 3T5HA 2KZ3A 4LVSA 3I28A 5BPCA 9ICUA 1L7PA 4Q43A 3WKAA 3ZDBA 8ICZA 4J03A 3WKCA 4IRCA 1N63A 4F2SA 4TQRA 4EEYA 3AU6A 3HRDD 1D9FA 2W9CA 4B9VA 1MQ3A 4BXOB 3H8WA 1Z00A 5KG3A 4PHDA 3PY8A 5KFDA 3SV3A 4RUAA 3QU9A 2ES6A 4C7ZA 1D8BA 2K4HA 2EAMA 1S8OA 3PW5A 3NUQA 4DL2A 3OTQA 2G5IB 2Y0SC 4F71A 4EEKA 4F5QA 4GXKA 3CNHA 4EENA 2OH2A 1V97A 3N7SC 2AGPA 3ZI4A 4KLOA 2W9BB 1Z1BA 4F3OA 2F1IA 3ISCA 2JV3A 1RG6A 4NY8A 1F44A 2HHTA 5AM5A 2NRVA 4R65A 1T7PA 3HX0A 1ZQCA 4F5PA 2HVHA 5KFIA 5KG6A 2HBJA 3C21A 2F77X 1PVPA 5EE1A 2OHFA 4O3NA 3C1YA 4F2RA 5ALSA 4KLUA 4DFDA 5AI0A 4I2HA 8ICIA 3OHAA 5KFQA 4R63A 4DSLA 2VJ4A 3M7DA 5G5HA 2R8HA 2XY7A 3HT3A 3MR5A 4RQ5A 2YMPA 4UB4A 4PGYA 4QZGA 4YMOA 4CF4A 2F8KA 3LK9A 1BNOA 3PX6A 5ALDA 3H0LB 3GV7B 1TAMA 2LHTA 4BXOA 1CUKA 4RT3A 1B4FA 2DUYA 1S77D 1Q46A 1TK8A 1BPDA 3AQEA 4P4PA 5J0SA 1YT3A 3V6HA 3WK6A 2HI0A 1ZD5A 4J9KA 1C20A 1COKA 1XO0A 2BQUA 2ISPA 2ZIWB 4UW9A 4QIWF 2WB1C 2W9BA 4XA5A 2I1QA 5KG5A 1JRPA 4QW8A 1SXDA 5HHHA 3ZDDA 2OXOA 4M9LA 1U45A 4ECWA 5AICA 9ICPA 3D2SA 3M9OB 5AIBA 5HMMA 7ICNA 2C2EA 1N5XA 2FPLA 3PR4A 2KZMA 1RYUA 1ZJMA 1VDVA 5ALRA 2PFNA 5KFXA 4TUSA 3G6YA 5KFOA 4DSIA 5AIAA 1LKYB 4DS4A 3M6ZA 4FS2A 3ETLA 9ICOA 1L8OA 5G5GA 2DGZA 3OHBA 4BUGA 3M8SA 4IC9A 3Q8KA 1QSYA 4Y2SA 3C2MA 4R66A 3WK4A 2F2AB 1L6NA 4JWMA 1MSWD 2KG5A 2KSOB 3H8SA 4QJFB 2K60A 3ISDA 2HBLA 4Z6FA 4RQ1A 2ATLA 4PZOA 1HJPA 5J8YC 5DB9A 3RB3A 1IV8A 4NXZA 1ED1A 2NRWA 2XICA 3TI0A 4RQ4A 5ALQA 1ZQJA 1TFRA 8ICFA 2KV2A 1NZBA 2OM6A 5KG1A 1S0MA 4UBCA 2K8AA 1UQVA 5KFRA 9ICLA 5AKEA 4B9LA 4UB6U 2C28A 2ZIWA 5J2KA 5C0YA 1Q8KA 4ED1A 4ED7A 3I1YA 5J0TA 3JPPA 4P0QB 2AH5A 3NASA 3IP4B 4DL6A 1PK3A 3O0FA 3K1RB 5J0WA 2AXTU 4TUQA 2PFQA 1C7YA 2K4EA 5KFPA 2KNJA 4MHVA 4DS5A 4DF4A 1ZQIA 1XC9A 4UARA 4QWBA 4NLGA 3KHRA 3ZDCA 1JALA 2ZIXB 3ALRA 1K5OA 2OWOA 2KTQA 2KFZA 5ALFA 4J9OA 8ICXA 3BDPA 3FYHA 2WF9A 1LKYA 4R8UB 4Y2JA 2L5YA 2OYYA 4UAUA 2FMSA 1URJA 5DLFA 2ZIVB 1U9LA 1J97A 2BPGA 2IOFA 5J29A 1D8LA 1BVSA 3IN5A 2W43A 5DKWA 5AKIA 1SKRA 1NNLA 5H2FU 2ODGA 4RQ2A 1DRGA 3AL0B 3RJGA 4I2GA 2KSOA 2IOFK 2E1FA 3H8JA 5EE0A 4UB5A 4HAIA 2BCUA 4CE6A 1AROP 2XGPA 1M6YA 4NM1A 4YXMA 5KG2A 4ELUA 3RJFA 1BNPA 4RQMA 3WK7A 4Y2QA 2JEIA 1IIPA 3N4MB 2W54A 1KDHA 1PVRA 2W7OA 1RM6C 3S6JA 2FLNA 3F2BA 3T5KA 3H4DA 5KFMA 3N7RC 1HUOA 4QZDA 2AHOB 4IQUA 4Y2UA 4P0QA 2YY6A 2VIXA 3NTUA 4F5NA 3SI8A 1CEZA 1OXJA 2I9GA 4ELTA 4KLSA 5CRXA 3KKAC 4QZIA 4PHPA 5ALNA 2VA8A 4O3OA 5ALKA 5CA7A 2ZIXA 5GTHU 3JPRA 3CW2C 3RAXA 5AM0A 1D8YA 2W04A 4EBDA 4UAYA 5KT2A 4R8UA 4QZFA 4I29A 2J6UA 1O08A 2ZIVA 2HDOA 4I2AA 3RR8A 4C7YA 4JB3A 3GFKB 5AKXA 1SL0A 2B0CA 5AKHA 2JMGA 5EE3A 5DQHA 3RRGA 2Y1IA 2UVWA 5AK3A 4EBEA 2G06A 2QLTA 3Q8SB 3FDSA 1H38A 2WHEA 1ZQTA 5KG0A 1QQ5A 1S0VA 3IDWA 1UPHA 4UAZA 1MQ2A 2LYAA 2Q0ZX 4OJLA 2DL0A 4UAWA 1GO3F 1XSNA 5GTIU 4G3IA 1NJXA 2EZXA 1TAUA 9ICJA 3AU2A 4DQRA 2P66A 1TE2A 5HHIA 2EAOA 3E2EA 4DCCA 4EYHB 3QNMA 5JTIA 2WFAA 4Z6CA 3BQ1A 4F8RA 5KFHA 1DK3A 1KSPA 4I2DA 2BGWA 2BKEA 3LWLA 3CRXA 4HYKA 2F76X 2JH1A 3SQIA 4J9LA 3HW8A 1TV9A 8ICSA 3RB6A 2GLEA 1ZQVA 2LYBA 3B0XA 1KN5A 4B9SA 1MA7A 5KG4A 3QX7A 3ICXA 2C22A 5AKYA 4Z6EA 5EWEA 5EOZA 3MC1A 1QH9A 4US8A 3WU2U 2AJQA 2B6GA 9ICQA 8ICAA 4OCZA 2HHSA 4F4XA 1S5LU 3DEEA 3Q8RB 4B9TA 5CP2A 5AK5A 2HBKA 4ACOA 5KAIU 1KLNA 2KJ8A 2VA3A 5ALPA 3H4BA 4ECUA 4ZOHC 3BQ2A 1A76A 3QUQA 3SMVA 1L3SA 4QIWC 3UMCA 2YX8A 3OPXA 3NGDA 5DGBA 4ED8A 2O6KA 1NZPA 4CF5A 4RNNA 2ZUCA 1BPYA 4B9UA 2ZXIA 5TISU 3MR3A 4KLIA 5KT4A 2ESEA 1SKWA 4J9SA 3NS1A 4ED0A 3NRWA 3CP8A 9ICFA 2QB1A 1A77A 4DOCA 4YD2A 1J2NA 4KLJA 1F5SA 1NI3A 2NV3A 1ZD4A 1Y88A 4IRKA 4NV0A 2FMPA 5DLGA 1OUQA 2YMQA 2KVSA 3RRHA 4YCXA 1X2IA 3OJSA 3PX4A 4NLKA 2R8KA 4FFDA 1ZYQA 4CDGA 1NKEA 3MR6A 1PVQA 4F5OA 3ZDEA 5ALJA 4MFCA 1Z3EB 5KFNA 4ICAA 4BJQA 2LKYA 1X42A 2WAQF 4PL1A 1ZD3A 4KITB 4KLTA 4F4KA 2WF7A 3TADC 5FP0A 5L1JA 2FLPA 1ZQDA 4FZLA 3TFRA 5K4LA 1OW5A 3PVXA 3VCBA 5ALTA 4DLGA 2ZTDA 4MEYA 1WCLA 3DV9A 2W3SA 2GO7A 3MGVA 2JRZA 2QARB 5AKKA 5L1LA 1B22A 1NKCA 1VLBA 4AYBF 2UVVA 3HKZC 4OJ6A 4JV0A 1XO1A 2IMWP 4EZ6A 3SAHA 1NK0A 2MRLA 4DEZA 4IR1A 2G0AA 1NK6A 5DBBA 4DSJA 2MUTB 5CB1A 5A0LA 1IXRA 7ICLA 1BPEA 1UA0A 1RYSA 2D3DA 5J2IA 3F53A 2A1AA 3CYMA 4C80A 5J0YA 4M47A 1NJWA 4J9PA 1N2XA 4YVZA 3EPIA 5KFZA 1ZETA 3AM9A 2AQ0A 9ICTA 4NLNA 2JGAA 3UPQA 2E8NA 2M0NA 2VANA 1JMSA 4Y2RA 1KW4A 4I2BA 1ZQPA 4GXJA 3V7LA 4C8MA 1TKDA 8ICQA 4YXJA 3RBEA 4Y2TA 1JIHA 3R9KA 3WKBA 3L4PA 3SEIA 3KHLA 4CNQA 2IHMA 3M9NB 3ONNA 5DB8A 4YQWA 3JPNA 2ASJA 4FZMA 4GC6A 3WK9A 8ICKA 4RPZA 7ICVA 2QARA 1SV0A 1WG8A 3PW2A 2W11A 1IM4A 2H3VA 2R8IA 5E79U 2R8GA 1FO4A 1ZQZA 5J2CA 2YMMA 3H8MA 4C4TA 4YR2A 4M0AA 5AI5A 4ECYA 7ICFA 4M2YA 2EH9A 3TACB 4C8OA 4DL7A 2A19A 2HBMA 2MUTA 4C8KA 3MDCA 3UXNA 5ALMA 1FFUA 2I6XA 3RB4A 3H40A 2DPJA 4JWNA 4C8LA 1ZOLA 2WF5A 3HILA 5KFCA 8ICJA 3NRZA 2MAXA 5CEHA 5AI8A 2JEFA 2JH7A 5AI9A 4C8NA 4M9NA 4C0ZA 4J9NA 3QU7A 1ZRMA 3RTVA 1XSPA 2EANA 5AM2A 9ICNA 3KOOA 3D2NA 1JI7A 2EAPA 3F5AA 4QZ8A 3MGIA 3MGHA 5KFAA 1LB2B 1SWWA 1X9SA 4B9NA 4WJ3B 3OJUA 2ZIUB 1B0XA 2DWQA 3C23A 2XY5A 9ICWA 3TARA 1JROA 4FZNA 4DWIA 5CHGA 3M1YA 4O3PA 4EX7A 2KIVA 2P6UA 1J2MA 3LVVA 5AHXA 3C5FA 2K8BB 3JPTA 3SZ2A 3T79A 4C4SA 1A6SA 5ALWA 1N48A 9ICXA 1PZNA 4QW9A 4NJ8A 3SAGA 3L5KA 1JX4A 2NYVA 1V9PA 1LVHA 2WTFA 2AQ4A 4O3MA 3GV5B 3ZD8A 2LBOA 4O9MA 2E3TA 3EWAA 1DGSA 4JUZA 2A3VA 4KLDA 2ZTCA 4GLXA 1KQQA 2W3RA 1RQNA 4M9GA 8ICVA 5ALYA 3K75D 4R64A 1K1SA 4DSEA 4QZ9A 9ICKA 3GU3A 4QNLA 4IRDA 2JXJA 1Z4NA 1T94A 1NK5A 1VJ5A 5KFBA 1FEZA 2DKZA 4PL2A 4CRXA 2H3FA 2ZIUA 1Q3UA 1RYRA 5J0RA 2YMLA 2K8CB 3M9MB 2IHNA 2JHDA 1ZQGA 4B9MA 4LZDA 3MABA 7ICKA 4RZRA 5HP4A 2P35A 3PX0A 4I2EA 2XY6A 4BWMA 3KZIU 2P6RA 5KFWA 5DDMA 1PUZA 5IIKA 3V7KA 5J2GA 3J81j 1SL2A 2YQEA 4M04A 1RDFA 1ZQYA 1QQ7A 2PXIA 9ICSA 5AM3A 1KRPA 5B66U 3EW9A 1NK9A 4F4WA 2KFNA 2KE7A 3AUOA 2BQRA 5EWFA 3RBDA 3I76A 5J0QA 4O3RA 2FLLA 5D46A 1A0PA 2HOIA 3N28A 2JEJA 4RNMA 4MFFA 2ASDA 2W7PA 1SV4A 4US9A 3C1ZA 1JUDA 4AP9A 2KIWA 2OCEA 4Q45A 3M6KA 3FAHA 1MC8A 4TURA 5KFFA 8ICPA 5ALZA 2WAQC 7ICUA 4DLEA 4Y2PA 2E8PA 5HMLA 2I5HA 3QYPA 4KLLA 1YZ6A 4USAA 3GILA 4Y2VA 1WCNA 2H3QA 2WB1F 3ISBA 1ZXIA 3B9JA 4KLGA 4EBCA 3E58A 3D6JA 5DQIA 2G5HB 4KMOB 3UXOA 4QWCA 2ASLA 3L3FX 1F0MA 5J2FA 5IIOA 4F4YA 2RRDA 2DBYA 3QXGA 3TAQA 3GDXA 3UXPA 1X9MA 2IOHA 5ALOA 4AYBC 3PNCA 4DFMA 2XGQA 2H3IA 9ICBA 2JZBB 7ICHA 8ICYA 5DBAA 2NO5A 4J9RA 4EYIB 4QWEA 4PHEA 2EQYA 3BJYA 3V6KA 4O5KA 1L7OA 7ICJA 4DL3A 4OD0A 4QZBA 5KFUA 1X6JA 2G08A 2W9MA 5CJ7A 3QZ7A 4K4IA 4DOBA 1BPBA 5AK6A 2LMRA 1RXVA 4LJXA 3MDAA 3UM9A 3AEVA 1JN3A 4I27A 3H0MB 5DG7A 3SD7A 5JRTA 2WF8A 2JEGA 5KFEA 1KBUA 4DSFA 5KL8B 1QCKA 2HOQA 5KT5A 4F91B 3TANA 4NLBA 2HHUA 3HP6A 4F93B 5IIMA 3UQ2A 2LM4A 1SXEA 4DFKA 2W8LA 3PSTA 4RPXA 1JXEA 1X6IA 5T14A 5J0OA 4EZ9A 3PSFA 2JZBA 3SV4A 2F1HA 5DB6A 2MU2A 3V6JA 4BWJA 4PZNA 4DFPA 1XSLA 4GIBA 2PMZF 3SR6A 2IA6A 1ZQHA 1TVAA 5KL1B 2XO7A 4YN4A 2H3ZA 5AM4A 3ORYA 1X66A 5J0PA 1ZQAA 4ED2A 1U49A 4PHAA 3JPOA 1DOQA 4K4HA 4RQ3A 4YR0A 4RQ6A 2BDUA 5ALIA 2DF4B 3EZ5A 3F2CA 3VC8A 4BGDA 4YR3A 5IINA 1D9DA 4ECTA 4NLZA 1L5UA 3PO5A 3GV8B 1L7NA 2CN1A 1K1QA 1O03A 1KFTA 1L7MA 1SZPA 1ZQLA 4ECVA 1TK0A 2F1JA 3LDAA 5KT7A 2J6TA 8ICOA 2V4RA 4UB8U 4UB3A 5F9LA 5KT6A 1SB3C 1ZJNA 2BZFA 3HJEA 1JXLA 2IBKA 5J2BA 2BR0A 1X9XA 3RB0A 9ICGA 2FDRA 4UAVA 1QSLA 4RT2A 3ED5A 2GH1A 4YFKA 4OJ5A 2PKEA 3H7IA 1XS9D 2ZG6A 4M6WB 2B21A 5ALEA 1ZQXA 4JV1A 1NK4A 1MN8A 1ZQKA 1V38A 4IR9A 7ICQA 3PV8A 2YTUA 4MF8A 3PW4A 2HCFA 5D4BA 4F92B 3KTQA 9ICRA 2W9AA 4KLFA 1UT8A 5DQGA 1XNSA 3NVWA 2NRZA 2UVRA 1S0OA 4P0PB 2PFPA 5J8YA 2KK0A 3NVVA 9ICMA 3PMLA 4KMUA 4PH5A 4EELA 4DSKA 2K89A 3G6XA 4O5CA 2NRXA 2HHQA 3T3FA 4FS1A 1XU4A 2E8MA 3QEBZ 4ED6A 5HR6A 3PR5B 1CI4A 7ICSA 3C2LA 5J2AA 4TUPA 4PGQA 1N61A 2VJ5A 1S97A 3K1ZA 4RU9A 1L3UA 4XRHA 4RQNA 4P2HA 4O0IA 3B0YA 4QZCA 3MR2A 5KG7A 2RDJA 2FPKA 3PW0A 1Z19A 4RNOA 3PSPA 2AGQA 4MEXA 3ZDAA 2CPRA 2VKQA 3EUB2 4F72A 4YD1A 4YG2A 4RUCA 2KJ5A 8ICBA 4CGZA 3KFUF 4GXIA 4M6WA 2Y9TA 8ICGA 3UMBA 4DL5A 2KVCA 3TKAA 3EPGA 1S10A 3GIJA 4NL9A 1NJZA 2GWSA 3IG5A 3RH5A 4A8EA 7ICRA 5KT3A 4FBTA 5JUMA 4I2IA 1ZQUA 2E8OA 2DFLA 3PSIA 3GZFA 3QE9Y 4P0PA 2CXYA 1SKSA 3AN1A 3IM1A 2KZZA 1WWUA 4JMUA 2MA1A 5AI6A 7ICGA 5D49A 2RHFA 4DL4A 9ICCA 8ICEA 5ALXA 1ZQOA 2XC9A 2N1RA 3U26A 1ZRNA 3F5EA 5DG9A 4XUSA 5DB7A 1LV5A 3GIMA 3HWTA 3JPSA 3T5JA 2OEHA 3WKEA 5KFVA 1SL1A 4RQ7A 4Q8FA 2DQNB 3KKAA 2BCQA 4OJPA 4F5RA 3QUBA 1U4BA 2Y1JA 2E1EA 2HVIA 3IV6A 2KHQA 5DBCA 5KFYA 1RPLA 2E5SA 3QU2A 2ISOA 3A0HU 2M9NA 3RH4A 3OGUA 5ALUA 4CCHA 3FC4A 4UASA 4IS7A 5J0XA 1WYGA 4QWAA 3AQFA 1QTMA 5BOMA 4BDPA 3RAQA 1DGJA 2QB0B 1KFDA 1CRXA 2HMXA 2LPEA 5KFTA 7ICEA 2PI5A 1U48A 7ICMA 2MSNA 4Y2YA 1FFVA 5KFSA 4O5EA 1HIWA 2BCRA 3MFIA 3C2KA 4IQWA 1SZHA 2QKQA 3WK8A 1TAQA 1N62A 4ELVA 4Q44A 4MF2A 3LVWA 3A0BU 2F8LA 1ZQRA 2HOFA 5AK4A 4M9JA 3KD3A 4YMMA 3M8RA 4DOAA
chains in the Genus database with same CATH topology
4UB4A 3GDXA 4DOCA 4PGYA 3UXPA 4QZGA 4YMOA 4YD2A 4KLJA 3LK9A 3PNCA 1BNOA 1KEJA 9ICBA 2FMPA 7ICHA 3RJIA 4KLEA 8ICYA 5IIJA 4RT3A 5DBAA 4YCXA 4NLKA 1BPDA 4K4GA 2BCVA 5J0SA 4PHEA 4F5OA 5IIIA 4O5KA 4IQVA 4MFCA 7ICJA 4QZBA 2ISPA 2W9MA 4K4IA 9ICAA 1BPZA 4DOBA 4KLTA 1ZQDA 3MDAA 4XA5A 3RH6A 3TFRA 4DO9A 4I2CA 1HUZA 5HHHA 4I27A 2BCSA 4M9LA 9ICPA 3RJJA 7ICPA 2PFOA 7ICNA 4RQ0A 5J2EA 3RJEA 7ICTA 3RJHA 4YMNA 1ZJMA 2PFNA 5IIMA 4TUSA 3UQ2A 9ICVA 9ICOA 4RPXA 5DBBA 4UBBA 5CB1A 8ICMA 4PGXA 1ZQQA 5J0OA 7ICLA 1BPEA 3C2MA 4R66A 4UB2A 5DB6A 5J2IA 8ICWA 4JWMA 5DDYA 4M47A 5J0YA 3ISDA 1XSLA 1ZQFA 4Z6FA 4IQTA 4RQ1A 8ICCA 5DB9A 4UB1A 4NXZA 1ZQHA 1TVAA 4RQ4A 1ZQJA 9ICTA 4NLNA 4YN4A 8ICFA 9ICEA 3UPQA 5J0PA 4UBCA 1ZQAA 9ICLA 5IILA 5J2KA 4PHAA 3JPOA 4K4HA 1JMSA 3JPQA 4I28A 4RQ3A 4RQ6A 4I2BA 1ZQPA 4GXJA 3V7LA 8ICQA 4Z6DA 5J0TA 3JPPA 4FO6A 2FMQA 5IINA 2IHMA 4NLZA 5DB8A 5J0WA 3UQ0A 4TUQA 3JPNA 2PFQA 7ICOA 1ZQIA 8ICKA 4RPZA 3TFSA 7ICVA 1ZQLA 9ICHA 1ZQEA 3V7JA 4NM2A 8ICOA 8ICTA 4UB3A 5J2CA 7ICIA 8ICXA 1ZJNA 4M0AA 7ICFA 4M2YA 5J2BA 2BPFA 2FMSA 4QZAA 3PMNA 9ICGA 3MDCA 3UXNA 2BPGA 4RT2A 5J29A 9ICIA 4JWNA 4I2FA 5DKWA 3RJKA 8ICJA 4RQ2A 3RJGA 4I2GA 1ZQKA 1ZQNA 4M9NA 7ICQA 4UB5A 2BCUA 4RPYA 1XSPA 1BPXA 4NM1A 4MF8A 3RJFA 5D4BA 9ICNA 1BNPA 9ICRA 4KLFA 5BOLA 3C5GA 1KDHA 2PFPA 3V72A 4QZ8A 4MFAA 8ICLA 3MGIA 9ICMA 3PMLA 3MGHA 4PH5A 1HUOA 4QZDA 4O5CA 4IQUA 4KLMA 4F5NA 5J2JA 9ICWA 2I9GA 7ICSA 3C2LA 4KLSA 1DK2A 4QZIA 5J2AA 4TUPA 4PGQA 4PHPA 4RQ8A 3C5FA 3JPRA 3JPTA 2KP7A 5CWRA 4P2HA 3B0YA 4QZCA 4UAYA 9ICXA 1RZTA 4QZFA 4KLHA 4I29A 4I2AA 4KLQA 4YD1A 1ZQBA 8ICBA 4GXIA 4O9MA 4X5VA 4KLDA 8ICGA 5J2HA 4M9GA 8ICHA 8ICVA 5TZVA 4LZGA 4I2JA 4R64A 4QZ9A 2GWSA 3MBYA 9ICKA 3RH5A 7ICRA 1ZQTA 8ICNA 4I2IA 5J2DA 4UAZA 1MQ2A 1ZQSA 4M9HA 5J0UA 4QZEA 7ICGA 5D49A 4UAWA 1XSNA 1ZQMA 9ICCA 4QZHA 5J0RA 8ICEA 8ICUA 9ICJA 3AU2A 1ZQOA 8ICRA 2P66A 1ZQGA 5HHIA 4PPXA 4LZDA 4XUSA 7ICKA 5DB7A 4I2EA 3HWTA 3JPSA 5IIKA 3V7KA 4RQ7A 5J2GA 4LVSA 4M04A 4Z6CA 5BPCA 9ICUA 2BCQA 1DK3A 4I2DA 2PXIA 8ICZA 4F5RA 9ICSA 3AU6A 5DBCA 1MQ3A 4PHDA 3HW8A 3AUOA 2ISOA 1TV9A 3RH4A 3OGUA 8ICSA 5J0XA 3B0XA 5J0QA 5D46A 5BOMA 4F5QA 4GXKA 4Z6EA 4MFFA 5EOZA 9ICQA 8ICAA 7ICEA 4KLOA 7ICMA 4O5EA 3ISCA 4TURA 4NY8A 8ICPA 4R65A 2BCRA 3C2KA 4IQWA 7ICUA 3HX0A 1ZQCA 4F5PA 4KLLA 3ISBA 4MF2A 1ZQRA 4KLGA 1NZPA 4KLUA 1BPYA 4I2HA 4M9JA 8ICIA 4YMMA 4KLIA 3UXOA 4R63A 4DOAA 5J2FA 5IIOA 4RQ5A 9ICFA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4UB4 A;  3GDX A;  4DOC A;  4PGY A;  3UXP A;  4QZG A;  4YMO A;  4YD2 A;  4KLJ A;  3LK9 A;  3PNC A;  1BNO A;  1KEJ A;  9ICB A;  2FMP A;  7ICH A;  3RJI A;  4KLE A;  8ICY A;  5IIJ A;  4RT3 A;  5DBA A;  4YCX A;  4NLK A;  1BPD A;  4K4G A;  2BCV A;  5J0S A;  4PHE A;  4F5O A;  5III A;  4O5K A;  4IQV A;  4MFC A;  7ICJ A;  4QZB A;  2ISP A;  2W9M A;  4K4I A;  9ICA A;  1BPZ A;  4DOB A;  4KLT A;  1ZQD A;  3MDA A;  4XA5 A;  3RH6 A;  3TFR A;  4DO9 A;  4I2C A;  1HUZ A;  5HHH A;  4I27 A;  2BCS A;  4M9L A;  9ICP A;  3RJJ A;  7ICP A;  2PFO A;  7ICN A;  4RQ0 A;  5J2E A;  3RJE A;  7ICT A;  3RJH A;  4YMN A;  1ZJM A;  2PFN A;  5IIM A;  4TUS A;  3UQ2 A;  9ICV A;  9ICO A;  4RPX A;  5DBB A;  4UBB A;  5CB1 A;  8ICM A;  4PGX A;  1ZQQ A;  5J0O A;  7ICL A;  1BPE A;  3C2M A;  4R66 A;  4UB2 A;  5DB6 A;  5J2I A;  8ICW A;  4JWM A;  5DDY A;  4M47 A;  5J0Y A;  3ISD A;  1XSL A;  1ZQF A;  4Z6F A;  4IQT A;  4RQ1 A;  8ICC A;  5DB9 A;  4UB1 A;  4NXZ A;  1ZQH A;  1TVA A;  4RQ4 A;  1ZQJ A;  9ICT A;  4NLN A;  4YN4 A;  8ICF A;  9ICE A;  3UPQ A;  5J0P A;  4UBC A;  1ZQA A;  9ICL A;  5IIL A;  5J2K A;  4PHA A;  3JPO A;  4K4H A;  1JMS A;  3JPQ A;  4I28 A;  4RQ3 A;  4RQ6 A;  4I2B A;  1ZQP A;  4GXJ A;  3V7L A;  8ICQ A;  4Z6D A;  5J0T A;  3JPP A;  4FO6 A;  2FMQ A;  5IIN A;  2IHM A;  4NLZ A;  5DB8 A;  5J0W A;  3UQ0 A;  4TUQ A;  3JPN A;  2PFQ A;  7ICO A;  1ZQI A;  8ICK A;  4RPZ A;  3TFS A;  7ICV A;  1ZQL A;  9ICH A;  1ZQE A;  3V7J A;  4NM2 A;  8ICO A;  8ICT A;  4UB3 A;  5J2C A;  7ICI A;  8ICX A;  1ZJN A;  4M0A A;  7ICF A;  4M2Y A;  5J2B A;  2BPF A;  2FMS A;  4QZA A;  3PMN A;  9ICG A;  3MDC A;  3UXN A;  2BPG A;  4RT2 A;  5J29 A;  9ICI A;  4JWN A;  4I2F A;  5DKW A;  3RJK A;  8ICJ A;  4RQ2 A;  3RJG A;  4I2G A;  1ZQK A;  1ZQN A;  4M9N A;  7ICQ A;  4UB5 A;  2BCU A;  4RPY A;  1XSP A;  1BPX A;  4NM1 A;  4MF8 A;  3RJF A;  5D4B A;  9ICN A;  1BNP A;  9ICR A;  4KLF A;  5BOL A;  3C5G A;  1KDH A;  2PFP A;  3V72 A;  4QZ8 A;  4MFA A;  8ICL A;  3MGI A;  9ICM A;  3PML A;  3MGH A;  4PH5 A;  1HUO A;  4QZD A;  4O5C A;  4IQU A;  4KLM A;  4F5N A;  5J2J A;  9ICW A;  2I9G A;  7ICS A;  3C2L A;  4KLS A;  1DK2 A;  4QZI A;  5J2A A;  4TUP A;  4PGQ A;  4PHP A;  4RQ8 A;  3C5F A;  3JPR A;  3JPT A;  2KP7 A;  5CWR A;  4P2H A;  3B0Y A;  4QZC A;  4UAY A;  9ICX A;  1RZT A;  4QZF A;  4KLH A;  4I29 A;  4I2A A;  4KLQ A;  4YD1 A;  1ZQB A;  8ICB A;  4GXI A;  4O9M A;  4X5V A;  4KLD A;  8ICG A;  5J2H A;  4M9G A;  8ICH A;  8ICV A;  5TZV A;  4LZG A;  4I2J A;  4R64 A;  4QZ9 A;  2GWS A;  3MBY A;  9ICK A;  3RH5 A;  7ICR A;  1ZQT A;  8ICN A;  4I2I A;  5J2D A;  4UAZ A;  1MQ2 A;  1ZQS A;  4M9H A;  5J0U A;  4QZE A;  7ICG A;  5D49 A;  4UAW A;  1XSN A;  1ZQM A;  9ICC A;  4QZH A;  5J0R A;  8ICE A;  8ICU A;  9ICJ A;  3AU2 A;  1ZQO A;  8ICR A;  2P66 A;  1ZQG A;  5HHI A;  4PPX A;  4LZD A;  4XUS A;  7ICK A;  5DB7 A;  4I2E A;  3HWT A;  3JPS A;  5IIK A;  3V7K A;  4RQ7 A;  5J2G A;  4LVS A;  4M04 A;  4Z6C A;  5BPC A;  9ICU A;  2BCQ A;  1DK3 A;  4I2D A;  2PXI A;  8ICZ A;  4F5R A;  9ICS A;  3AU6 A;  5DBC A;  1MQ3 A;  4PHD A;  3HW8 A;  3AUO A;  2ISO A;  1TV9 A;  3RH4 A;  3OGU A;  8ICS A;  5J0X A;  3B0X A;  5J0Q A;  5D46 A;  5BOM A;  4F5Q A;  4GXK A;  4Z6E A;  4MFF A;  5EOZ A;  9ICQ A;  8ICA A;  7ICE A;  4KLO A;  7ICM A;  4O5E A;  3ISC A;  4TUR A;  4NY8 A;  8ICP A;  4R65 A;  2BCR A;  3C2K A;  4IQW A;  7ICU A;  3HX0 A;  1ZQC A;  4F5P A;  4KLL A;  3ISB A;  4MF2 A;  1ZQR A;  4KLG A;  1NZP A;  4KLU A;  1BPY A;  4I2H A;  4M9J A;  8ICI A;  4YMM A;  4KLI A;  3UXO A;  4R63 A;  4DOA A;  5J2F A;  5IIO A;  4RQ5 A;  9ICF A; 
#chains in the Genus database with same CATH topology
 2K4P A;  3WK5 A;  3BQ7 A;  3NVY A;  4QWD A;  1EXN A;  5KFJ A;  1KEJ A;  3G6V A;  2KD1 A;  1T4G A;  3T5L A;  3HKZ F;  4EX6 A;  3C29 A;  3RJI A;  4KLE A;  2YB4 A;  2Y0S F;  5L1M A;  5IIJ A;  2ALZ A;  3SEN A;  2H5X A;  1PK1 B;  1NOM A;  4KX3 A;  3OSP A;  4OO1 J;  3FM9 A;  4O3Q A;  4K4G A;  1DXS A;  3PO4 A;  2BCV A;  2HSZ A;  1B43 A;  5III A;  4IQV A;  4DFJ A;  2BQ3 A;  1AQ6 A;  2XI9 A;  4P4M A;  3F2D A;  2QB0 A;  2HHW A;  1HEK A;  5KNI A;  9ICA A;  5F3X B;  2NO4 A;  1BPZ A;  5AKJ A;  2PMZ C;  2RP5 A;  1YZ7 A;  4G9B A;  2GOL A;  2VA2 A;  4P4O A;  3RH6 A;  4DO9 A;  1L8L A;  4YP3 A;  4I2C A;  3KHG A;  2F3N A;  4NL9 C;  3THV A;  1HUZ A;  1SV0 C;  2W8K A;  4TQS A;  2BCS A;  1NKB A;  1T8E A;  4ECX A;  3RJJ A;  2C2D A;  3BS5 B;  7ICP A;  5JU5 A;  2PFO A;  4ECZ A;  2G07 A;  4RQ0 A;  5J2E A;  3RJE A;  7ICT A;  5HNK A;  3RJH A;  2FJ6 A;  3IG8 A;  4YMN A;  1T3Q A;  2XCA A;  2G09 A;  5L1I A;  3QZ8 A;  3ZD9 A;  3GII A;  1UT5 A;  9ICV A;  5AI4 A;  3BZC A;  4J9Q A;  2HHV A;  1XWL A;  5DG8 A;  4ECR A;  1ECW A;  1L3V A;  2RQ5 A;  3N7P D;  4DF8 A;  1S9F A;  4UBB A;  4F4Z A;  1KKX A;  8ICM A;  1N60 A;  4PGX A;  5ALL A;  1N56 A;  1ZQQ A;  3AMZ A;  4UB2 A;  1COO A;  2DPI A;  3D2Q A;  8ICW A;  1ZD2 P;  4NLC A;  5DDY A;  1PK1 A;  2W55 A;  4CF3 A;  2ZJA A;  3BQT A;  4UQG A;  1ZQF A;  1UCV A;  3Q8P B;  3MFH A;  2LYH A;  4IQT A;  3IHQ B;  8ICC A;  2R8J A;  4UB1 A;  4KTQ A;  2XVT A;  4JK1 A;  4DQI A;  3Q8Q B;  1ZQW A;  1QSS A;  9ICE A;  2KKP A;  3WKD A;  1QQ6 A;  3DDH A;  5IIL A;  1Z1V A;  4ZH4 A;  3GIK A;  3E0F A;  1N5W A;  3RFA A;  3JPQ A;  4I28 A;  2YB1 A;  2CRX A;  2EZY A;  5CR0 A;  2K4I A;  5KAF U;  5KTQ A;  4ED3 A;  2XCP A;  4Z6D A;  2ZUB A;  4FO6 A;  2YN4 A;  2FMQ A;  1T3N A;  5EWG A;  1U47 A;  4DQP A;  3TAD A;  3UQ0 A;  2HHX A;  2KHV A;  7ICO A;  1BGX T;  1KTQ A;  2A1J B;  2FE9 A;  5AM1 A;  1Z4O A;  3BS5 A;  3OSN A;  3QEA Z;  2LM1 A;  3TFS A;  1S76 D;  1WUD A;  9ICH A;  3SYZ A;  3QUT A;  1ZQE A;  3V7J A;  4NM2 A;  3KBB A;  2EZZ A;  2D6F C;  3UMG A;  1QLN A;  8ICT A;  1Q3V A;  1ZQ1 C;  2R18 A;  2DKX A;  7ICI A;  1FIQ A;  2KIC A;  1KFS A;  4XQ8 A;  5ALG A;  5C5J A;  1L3T A;  3QU4 A;  3Q8M A;  1TK5 A;  2BPF A;  4O3S A;  4QZA A;  3PMN A;  2C2R A;  3KZX A;  4ECS A;  4GC7 A;  9ICI A;  4I2F A;  3BS7 A;  3RJK A;  3SAF A;  2ZJ8 A;  3LWM A;  5ALH A;  4NWI A;  1ZQN A;  5F9N A;  2Z7J A;  5AKG A;  4RPY A;  1UA1 A;  5EE9 A;  3NVZ A;  2KEY A;  1SGG A;  1BPX A;  4ECQ A;  4C4R A;  2WF6 A;  1X9W A;  3EYZ A;  4UAT A;  1NK8 A;  2ZXH A;  3K4G A;  5BOL A;  3C5G A;  3HPO A;  2AGO A;  4DQS A;  2JR5 A;  3V72 A;  4MFA A;  8ICL A;  4KX5 A;  1WWV A;  4KN4 A;  3GQC A;  1S0N A;  5KFL A;  2BHN A;  4Q8E A;  4U7C A;  3N97 B;  2F44 A;  4KN7 A;  4KLM A;  4GFJ A;  2Q4T A;  5J2J A;  4F50 A;  3TAP A;  4U6P A;  5HR7 A;  1DK2 A;  3QUC A;  2A1J A;  5KFK A;  4FBU A;  5KFG A;  2RDI A;  2V4Q A;  5ALV A;  3PZP A;  2J6S A;  2KMD A;  4RQ8 A;  1P7D A;  4IL6 U;  3C28 A;  1RQL A;  1KL9 A;  5B5E U;  2FI1 A;  2KP7 A;  3ETR A;  5CWR A;  2D8C A;  2AU0 A;  5AKZ A;  2Y9U A;  4DQQ A;  3H0R B;  1RZT A;  2FPM A;  4J9M A;  4KLH A;  4PJ0 U;  3RR7 A;  1NJY A;  3QU5 A;  2W9C B;  4E0D A;  4BX9 C;  4KLQ A;  2HW3 A;  1Z00 B;  4OJO A;  2KN7 A;  5AKL A;  1V85 A;  1ZQB A;  3KHH A;  5L9X A;  5DGA A;  2NRT A;  2UVU A;  2KJ9 A;  4X5V A;  5J2H A;  2ZUD A;  2EDU A;  8ICH A;  1RXW A;  5TZV A;  4LZG A;  2W03 A;  4I2J A;  1SIJ A;  2ZJ5 A;  3PW7 A;  3MBY A;  4FE3 A;  8ICN A;  3TQ1 A;  5J2D A;  4Y2X A;  2RLT A;  1NK7 A;  3IRU A;  2PI4 A;  3LYS A;  1ZQS A;  4M9H A;  2BPC A;  5J0U A;  4QZE A;  2KKV A;  2XID A;  3BQ0 A;  1ZQM A;  4QZH A;  1UHU A;  8ICU A;  2V9W A;  8ICR A;  3RF9 A;  2BDP A;  3Q8L A;  4PPX A;  2ZTE A;  4JV2 A;  3BZK A;  1SWV A;  5L1K A;  1X40 A;  2KOB A;  4B6J A;  1IG6 A;  2LI6 A;  3T5H A;  2KZ3 A;  4LVS A;  3I28 A;  5BPC A;  9ICU A;  1L7P A;  4Q43 A;  3WKA A;  3ZDB A;  8ICZ A;  4J03 A;  3WKC A;  4IRC A;  1N63 A;  4F2S A;  4TQR A;  4EEY A;  3AU6 A;  3HRD D;  1D9F A;  2W9C A;  4B9V A;  1MQ3 A;  4BXO B;  3H8W A;  1Z00 A;  5KG3 A;  4PHD A;  3PY8 A;  5KFD A;  3SV3 A;  4RUA A;  3QU9 A;  2ES6 A;  4C7Z A;  1D8B A;  2K4H A;  2EAM A;  1S8O A;  3PW5 A;  3NUQ A;  4DL2 A;  3OTQ A;  2G5I B;  2Y0S C;  4F71 A;  4EEK A;  4F5Q A;  4GXK A;  3CNH A;  4EEN A;  2OH2 A;  1V97 A;  3N7S C;  2AGP A;  3ZI4 A;  4KLO A;  2W9B B;  1Z1B A;  4F3O A;  2F1I A;  3ISC A;  2JV3 A;  1RG6 A;  4NY8 A;  1F44 A;  2HHT A;  5AM5 A;  2NRV A;  4R65 A;  1T7P A;  3HX0 A;  1ZQC A;  4F5P A;  2HVH A;  5KFI A;  5KG6 A;  2HBJ A;  3C21 A;  2F77 X;  1PVP A;  5EE1 A;  2OHF A;  4O3N A;  3C1Y A;  4F2R A;  5ALS A;  4KLU A;  4DFD A;  5AI0 A;  4I2H A;  8ICI A;  3OHA A;  5KFQ A;  4R63 A;  4DSL A;  2VJ4 A;  3M7D A;  5G5H A;  2R8H A;  2XY7 A;  3HT3 A;  3MR5 A;  4RQ5 A;  2YMP A;  4UB4 A;  4PGY A;  4QZG A;  4YMO A;  4CF4 A;  2F8K A;  3LK9 A;  1BNO A;  3PX6 A;  5ALD A;  3H0L B;  3GV7 B;  1TAM A;  2LHT A;  4BXO A;  1CUK A;  4RT3 A;  1B4F A;  2DUY A;  1S77 D;  1Q46 A;  1TK8 A;  1BPD A;  3AQE A;  4P4P A;  5J0S A;  1YT3 A;  3V6H A;  3WK6 A;  2HI0 A;  1ZD5 A;  4J9K A;  1C20 A;  1COK A;  1XO0 A;  2BQU A;  2ISP A;  2ZIW B;  4UW9 A;  4QIW F;  2WB1 C;  2W9B A;  4XA5 A;  2I1Q A;  5KG5 A;  1JRP A;  4QW8 A;  1SXD A;  5HHH A;  3ZDD A;  2OXO A;  4M9L A;  1U45 A;  4ECW A;  5AIC A;  9ICP A;  3D2S A;  3M9O B;  5AIB A;  5HMM A;  7ICN A;  2C2E A;  1N5X A;  2FPL A;  3PR4 A;  2KZM A;  1RYU A;  1ZJM A;  1VDV A;  5ALR A;  2PFN A;  5KFX A;  4TUS A;  3G6Y A;  5KFO A;  4DSI A;  5AIA A;  1LKY B;  4DS4 A;  3M6Z A;  4FS2 A;  3ETL A;  9ICO A;  1L8O A;  5G5G A;  2DGZ A;  3OHB A;  4BUG A;  3M8S A;  4IC9 A;  3Q8K A;  1QSY A;  4Y2S A;  3C2M A;  4R66 A;  3WK4 A;  2F2A B;  1L6N A;  4JWM A;  1MSW D;  2KG5 A;  2KSO B;  3H8S A;  4QJF B;  2K60 A;  3ISD A;  2HBL A;  4Z6F A;  4RQ1 A;  2ATL A;  4PZO A;  1HJP A;  5J8Y C;  5DB9 A;  3RB3 A;  1IV8 A;  4NXZ A;  1ED1 A;  2NRW A;  2XIC A;  3TI0 A;  4RQ4 A;  5ALQ A;  1ZQJ A;  1TFR A;  8ICF A;  2KV2 A;  1NZB A;  2OM6 A;  5KG1 A;  1S0M A;  4UBC A;  2K8A A;  1UQV A;  5KFR A;  9ICL A;  5AKE A;  4B9L A;  4UB6 U;  2C28 A;  2ZIW A;  5J2K A;  5C0Y A;  1Q8K A;  4ED1 A;  4ED7 A;  3I1Y A;  5J0T A;  3JPP A;  4P0Q B;  2AH5 A;  3NAS A;  3IP4 B;  4DL6 A;  1PK3 A;  3O0F A;  3K1R B;  5J0W A;  2AXT U;  4TUQ A;  2PFQ A;  1C7Y A;  2K4E A;  5KFP A;  2KNJ A;  4MHV A;  4DS5 A;  4DF4 A;  1ZQI A;  1XC9 A;  4UAR A;  4QWB A;  4NLG A;  3KHR A;  3ZDC A;  1JAL A;  2ZIX B;  3ALR A;  1K5O A;  2OWO A;  2KTQ A;  2KFZ A;  5ALF A;  4J9O A;  8ICX A;  3BDP A;  3FYH A;  2WF9 A;  1LKY A;  4R8U B;  4Y2J A;  2L5Y A;  2OYY A;  4UAU A;  2FMS A;  1URJ A;  5DLF A;  2ZIV B;  1U9L A;  1J97 A;  2BPG A;  2IOF A;  5J29 A;  1D8L A;  1BVS A;  3IN5 A;  2W43 A;  5DKW A;  5AKI A;  1SKR A;  1NNL A;  5H2F U;  2ODG A;  4RQ2 A;  1DRG A;  3AL0 B;  3RJG A;  4I2G A;  2KSO A;  2IOF K;  2E1F A;  3H8J A;  5EE0 A;  4UB5 A;  4HAI A;  2BCU A;  4CE6 A;  1ARO P;  2XGP A;  1M6Y A;  4NM1 A;  4YXM A;  5KG2 A;  4ELU A;  3RJF A;  1BNP A;  4RQM A;  3WK7 A;  4Y2Q A;  2JEI A;  1IIP A;  3N4M B;  2W54 A;  1KDH A;  1PVR A;  2W7O A;  1RM6 C;  3S6J A;  2FLN A;  3F2B A;  3T5K A;  3H4D A;  5KFM A;  3N7R C;  1HUO A;  4QZD A;  2AHO B;  4IQU A;  4Y2U A;  4P0Q A;  2YY6 A;  2VIX A;  3NTU A;  4F5N A;  3SI8 A;  1CEZ A;  1OXJ A;  2I9G A;  4ELT A;  4KLS A;  5CRX A;  3KKA C;  4QZI A;  4PHP A;  5ALN A;  2VA8 A;  4O3O A;  5ALK A;  5CA7 A;  2ZIX A;  5GTH U;  3JPR A;  3CW2 C;  3RAX A;  5AM0 A;  1D8Y A;  2W04 A;  4EBD A;  4UAY A;  5KT2 A;  4R8U A;  4QZF A;  4I29 A;  2J6U A;  1O08 A;  2ZIV A;  2HDO A;  4I2A A;  3RR8 A;  4C7Y A;  4JB3 A;  3GFK B;  5AKX A;  1SL0 A;  2B0C A;  5AKH A;  2JMG A;  5EE3 A;  5DQH A;  3RRG A;  2Y1I A;  2UVW A;  5AK3 A;  4EBE A;  2G06 A;  2QLT A;  3Q8S B;  3FDS A;  1H38 A;  2WHE A;  1ZQT A;  5KG0 A;  1QQ5 A;  1S0V A;  3IDW A;  1UPH A;  4UAZ A;  1MQ2 A;  2LYA A;  2Q0Z X;  4OJL A;  2DL0 A;  4UAW A;  1GO3 F;  1XSN A;  5GTI U;  4G3I A;  1NJX A;  2EZX A;  1TAU A;  9ICJ A;  3AU2 A;  4DQR A;  2P66 A;  1TE2 A;  5HHI A;  2EAO A;  3E2E A;  4DCC A;  4EYH B;  3QNM A;  5JTI A;  2WFA A;  4Z6C A;  3BQ1 A;  4F8R A;  5KFH A;  1DK3 A;  1KSP A;  4I2D A;  2BGW A;  2BKE A;  3LWL A;  3CRX A;  4HYK A;  2F76 X;  2JH1 A;  3SQI A;  4J9L A;  3HW8 A;  1TV9 A;  8ICS A;  3RB6 A;  2GLE A;  1ZQV A;  2LYB A;  3B0X A;  1KN5 A;  4B9S A;  1MA7 A;  5KG4 A;  3QX7 A;  3ICX A;  2C22 A;  5AKY A;  4Z6E A;  5EWE A;  5EOZ A;  3MC1 A;  1QH9 A;  4US8 A;  3WU2 U;  2AJQ A;  2B6G A;  9ICQ A;  8ICA A;  4OCZ A;  2HHS A;  4F4X A;  1S5L U;  3DEE A;  3Q8R B;  4B9T A;  5CP2 A;  5AK5 A;  2HBK A;  4ACO A;  5KAI U;  1KLN A;  2KJ8 A;  2VA3 A;  5ALP A;  3H4B A;  4ECU A;  4ZOH C;  3BQ2 A;  1A76 A;  3QUQ A;  3SMV A;  1L3S A;  4QIW C;  3UMC A;  2YX8 A;  3OPX A;  3NGD A;  5DGB A;  4ED8 A;  2O6K A;  1NZP A;  4CF5 A;  4RNN A;  2ZUC A;  1BPY A;  4B9U A;  2ZXI A;  5TIS U;  3MR3 A;  4KLI A;  5KT4 A;  2ESE A;  1SKW A;  4J9S A;  3NS1 A;  4ED0 A;  3NRW A;  3CP8 A;  9ICF A;  2QB1 A;  1A77 A;  4DOC A;  4YD2 A;  1J2N A;  4KLJ A;  1F5S A;  1NI3 A;  2NV3 A;  1ZD4 A;  1Y88 A;  4IRK A;  4NV0 A;  2FMP A;  5DLG A;  1OUQ A;  2YMQ A;  2KVS A;  3RRH A;  4YCX A;  1X2I A;  3OJS A;  3PX4 A;  4NLK A;  2R8K A;  4FFD A;  1ZYQ A;  4CDG A;  1NKE A;  3MR6 A;  1PVQ A;  4F5O A;  3ZDE A;  5ALJ A;  4MFC A;  1Z3E B;  5KFN A;  4ICA A;  4BJQ A;  2LKY A;  1X42 A;  2WAQ F;  4PL1 A;  1ZD3 A;  4KIT B;  4KLT A;  4F4K A;  2WF7 A;  3TAD C;  5FP0 A;  5L1J A;  2FLP A;  1ZQD A;  4FZL A;  3TFR A;  5K4L A;  1OW5 A;  3PVX A;  3VCB A;  5ALT A;  4DLG A;  2ZTD A;  4MEY A;  1WCL A;  3DV9 A;  2W3S A;  2GO7 A;  3MGV A;  2JRZ A;  2QAR B;  5AKK A;  5L1L A;  1B22 A;  1NKC A;  1VLB A;  4AYB F;  2UVV A;  3HKZ C;  4OJ6 A;  4JV0 A;  1XO1 A;  2IMW P;  4EZ6 A;  3SAH A;  1NK0 A;  2MRL A;  4DEZ A;  4IR1 A;  2G0A A;  1NK6 A;  5DBB A;  4DSJ A;  2MUT B;  5CB1 A;  5A0L A;  1IXR A;  7ICL A;  1BPE A;  1UA0 A;  1RYS A;  2D3D A;  5J2I A;  3F53 A;  2A1A A;  3CYM A;  4C80 A;  5J0Y A;  4M47 A;  1NJW A;  4J9P A;  1N2X A;  4YVZ A;  3EPI A;  5KFZ A;  1ZET A;  3AM9 A;  2AQ0 A;  9ICT A;  4NLN A;  2JGA A;  3UPQ A;  2E8N A;  2M0N A;  2VAN A;  1JMS A;  4Y2R A;  1KW4 A;  4I2B A;  1ZQP A;  4GXJ A;  3V7L A;  4C8M A;  1TKD A;  8ICQ A;  4YXJ A;  3RBE A;  4Y2T A;  1JIH A;  3R9K A;  3WKB A;  3L4P A;  3SEI A;  3KHL A;  4CNQ A;  2IHM A;  3M9N B;  3ONN A;  5DB8 A;  4YQW A;  3JPN A;  2ASJ A;  4FZM A;  4GC6 A;  3WK9 A;  8ICK A;  4RPZ A;  7ICV A;  2QAR A;  1SV0 A;  1WG8 A;  3PW2 A;  2W11 A;  1IM4 A;  2H3V A;  2R8I A;  5E79 U;  2R8G A;  1FO4 A;  1ZQZ A;  5J2C A;  2YMM A;  3H8M A;  4C4T A;  4YR2 A;  4M0A A;  5AI5 A;  4ECY A;  7ICF A;  4M2Y A;  2EH9 A;  3TAC B;  4C8O A;  4DL7 A;  2A19 A;  2HBM A;  2MUT A;  4C8K A;  3MDC A;  3UXN A;  5ALM A;  1FFU A;  2I6X A;  3RB4 A;  3H40 A;  2DPJ A;  4JWN A;  4C8L A;  1ZOL A;  2WF5 A;  3HIL A;  5KFC A;  8ICJ A;  3NRZ A;  2MAX A;  5CEH A;  5AI8 A;  2JEF A;  2JH7 A;  5AI9 A;  4C8N A;  4M9N A;  4C0Z A;  4J9N A;  3QU7 A;  1ZRM A;  3RTV A;  1XSP A;  2EAN A;  5AM2 A;  9ICN A;  3KOO A;  3D2N A;  1JI7 A;  2EAP A;  3F5A A;  4QZ8 A;  3MGI A;  3MGH A;  5KFA A;  1LB2 B;  1SWW A;  1X9S A;  4B9N A;  4WJ3 B;  3OJU A;  2ZIU B;  1B0X A;  2DWQ A;  3C23 A;  2XY5 A;  9ICW A;  3TAR A;  1JRO A;  4FZN A;  4DWI A;  5CHG A;  3M1Y A;  4O3P A;  4EX7 A;  2KIV A;  2P6U A;  1J2M A;  3LVV A;  5AHX A;  3C5F A;  2K8B B;  3JPT A;  3SZ2 A;  3T79 A;  4C4S A;  1A6S A;  5ALW A;  1N48 A;  9ICX A;  1PZN A;  4QW9 A;  4NJ8 A;  3SAG A;  3L5K A;  1JX4 A;  2NYV A;  1V9P A;  1LVH A;  2WTF A;  2AQ4 A;  4O3M A;  3GV5 B;  3ZD8 A;  2LBO A;  4O9M A;  2E3T A;  3EWA A;  1DGS A;  4JUZ A;  2A3V A;  4KLD A;  2ZTC A;  4GLX A;  1KQQ A;  2W3R A;  1RQN A;  4M9G A;  8ICV A;  5ALY A;  3K75 D;  4R64 A;  1K1S A;  4DSE A;  4QZ9 A;  9ICK A;  3GU3 A;  4QNL A;  4IRD A;  2JXJ A;  1Z4N A;  1T94 A;  1NK5 A;  1VJ5 A;  5KFB A;  1FEZ A;  2DKZ A;  4PL2 A;  4CRX A;  2H3F A;  2ZIU A;  1Q3U A;  1RYR A;  5J0R A;  2YML A;  2K8C B;  3M9M B;  2IHN A;  2JHD A;  1ZQG A;  4B9M A;  4LZD A;  3MAB A;  7ICK A;  4RZR A;  5HP4 A;  2P35 A;  3PX0 A;  4I2E A;  2XY6 A;  4BWM A;  3KZI U;  2P6R A;  5KFW A;  5DDM A;  1PUZ A;  5IIK A;  3V7K A;  5J2G A;  3J81 j;  1SL2 A;  2YQE A;  4M04 A;  1RDF A;  1ZQY A;  1QQ7 A;  2PXI A;  9ICS A;  5AM3 A;  1KRP A;  5B66 U;  3EW9 A;  1NK9 A;  4F4W A;  2KFN A;  2KE7 A;  3AUO A;  2BQR A;  5EWF A;  3RBD A;  3I76 A;  5J0Q A;  4O3R A;  2FLL A;  5D46 A;  1A0P A;  2HOI A;  3N28 A;  2JEJ A;  4RNM A;  4MFF A;  2ASD A;  2W7P A;  1SV4 A;  4US9 A;  3C1Z A;  1JUD A;  4AP9 A;  2KIW A;  2OCE A;  4Q45 A;  3M6K A;  3FAH A;  1MC8 A;  4TUR A;  5KFF A;  8ICP A;  5ALZ A;  2WAQ C;  7ICU A;  4DLE A;  4Y2P A;  2E8P A;  5HML A;  2I5H A;  3QYP A;  4KLL A;  1YZ6 A;  4USA A;  3GIL A;  4Y2V A;  1WCN A;  2H3Q A;  2WB1 F;  3ISB A;  1ZXI A;  3B9J A;  4KLG A;  4EBC A;  3E58 A;  3D6J A;  5DQI A;  2G5H B;  4KMO B;  3UXO A;  4QWC A;  2ASL A;  3L3F X;  1F0M A;  5J2F A;  5IIO A;  4F4Y A;  2RRD A;  2DBY A;  3QXG A;  3TAQ A;  3GDX A;  3UXP A;  1X9M A;  2IOH A;  5ALO A;  4AYB C;  3PNC A;  4DFM A;  2XGQ A;  2H3I A;  9ICB A;  2JZB B;  7ICH A;  8ICY A;  5DBA A;  2NO5 A;  4J9R A;  4EYI B;  4QWE A;  4PHE A;  2EQY A;  3BJY A;  3V6K A;  4O5K A;  1L7O A;  7ICJ A;  4DL3 A;  4OD0 A;  4QZB A;  5KFU A;  1X6J A;  2G08 A;  2W9M A;  5CJ7 A;  3QZ7 A;  4K4I A;  4DOB A;  1BPB A;  5AK6 A;  2LMR A;  1RXV A;  4LJX A;  3MDA A;  3UM9 A;  3AEV A;  1JN3 A;  4I27 A;  3H0M B;  5DG7 A;  3SD7 A;  5JRT A;  2WF8 A;  2JEG A;  5KFE A;  1KBU A;  4DSF A;  5KL8 B;  1QCK A;  2HOQ A;  5KT5 A;  4F91 B;  3TAN A;  4NLB A;  2HHU A;  3HP6 A;  4F93 B;  5IIM A;  3UQ2 A;  2LM4 A;  1SXE A;  4DFK A;  2W8L A;  3PST A;  4RPX A;  1JXE A;  1X6I A;  5T14 A;  5J0O A;  4EZ9 A;  3PSF A;  2JZB A;  3SV4 A;  2F1H A;  5DB6 A;  2MU2 A;  3V6J A;  4BWJ A;  4PZN A;  4DFP A;  1XSL A;  4GIB A;  2PMZ F;  3SR6 A;  2IA6 A;  1ZQH A;  1TVA A;  5KL1 B;  2XO7 A;  4YN4 A;  2H3Z A;  5AM4 A;  3ORY A;  1X66 A;  5J0P A;  1ZQA A;  4ED2 A;  1U49 A;  4PHA A;  3JPO A;  1DOQ A;  4K4H A;  4RQ3 A;  4YR0 A;  4RQ6 A;  2BDU A;  5ALI A;  2DF4 B;  3EZ5 A;  3F2C A;  3VC8 A;  4BGD A;  4YR3 A;  5IIN A;  1D9D A;  4ECT A;  4NLZ A;  1L5U A;  3PO5 A;  3GV8 B;  1L7N A;  2CN1 A;  1K1Q A;  1O03 A;  1KFT A;  1L7M A;  1SZP A;  1ZQL A;  4ECV A;  1TK0 A;  2F1J A;  3LDA A;  5KT7 A;  2J6T A;  8ICO A;  2V4R A;  4UB8 U;  4UB3 A;  5F9L A;  5KT6 A;  1SB3 C;  1ZJN A;  2BZF A;  3HJE A;  1JXL A;  2IBK A;  5J2B A;  2BR0 A;  1X9X A;  3RB0 A;  9ICG A;  2FDR A;  4UAV A;  1QSL A;  4RT2 A;  3ED5 A;  2GH1 A;  4YFK A;  4OJ5 A;  2PKE A;  3H7I A;  1XS9 D;  2ZG6 A;  4M6W B;  2B21 A;  5ALE A;  1ZQX A;  4JV1 A;  1NK4 A;  1MN8 A;  1ZQK A;  1V38 A;  4IR9 A;  7ICQ A;  3PV8 A;  2YTU A;  4MF8 A;  3PW4 A;  2HCF A;  5D4B A;  4F92 B;  3KTQ A;  9ICR A;  2W9A A;  4KLF A;  1UT8 A;  5DQG A;  1XNS A;  3NVW A;  2NRZ A;  2UVR A;  1S0O A;  4P0P B;  2PFP A;  5J8Y A;  2KK0 A;  3NVV A;  9ICM A;  3PML A;  4KMU A;  4PH5 A;  4EEL A;  4DSK A;  2K89 A;  3G6X A;  4O5C A;  2NRX A;  2HHQ A;  3T3F A;  4FS1 A;  1XU4 A;  2E8M A;  3QEB Z;  4ED6 A;  5HR6 A;  3PR5 B;  1CI4 A;  7ICS A;  3C2L A;  5J2A A;  4TUP A;  4PGQ A;  1N61 A;  2VJ5 A;  1S97 A;  3K1Z A;  4RU9 A;  1L3U A;  4XRH A;  4RQN A;  4P2H A;  4O0I A;  3B0Y A;  4QZC A;  3MR2 A;  5KG7 A;  2RDJ A;  2FPK A;  3PW0 A;  1Z19 A;  4RNO A;  3PSP A;  2AGQ A;  4MEX A;  3ZDA A;  2CPR A;  2VKQ A;  3EUB 2;  4F72 A;  4YD1 A;  4YG2 A;  4RUC A;  2KJ5 A;  8ICB A;  4CGZ A;  3KFU F;  4GXI A;  4M6W A;  2Y9T A;  8ICG A;  3UMB A;  4DL5 A;  2KVC A;  3TKA A;  3EPG A;  1S10 A;  3GIJ A;  4NL9 A;  1NJZ A;  2GWS A;  3IG5 A;  3RH5 A;  4A8E A;  7ICR A;  5KT3 A;  4FBT A;  5JUM A;  4I2I A;  1ZQU A;  2E8O A;  2DFL A;  3PSI A;  3GZF A;  3QE9 Y;  4P0P A;  2CXY A;  1SKS A;  3AN1 A;  3IM1 A;  2KZZ A;  1WWU A;  4JMU A;  2MA1 A;  5AI6 A;  7ICG A;  5D49 A;  2RHF A;  4DL4 A;  9ICC A;  8ICE A;  5ALX A;  1ZQO A;  2XC9 A;  2N1R A;  3U26 A;  1ZRN A;  3F5E A;  5DG9 A;  4XUS A;  5DB7 A;  1LV5 A;  3GIM A;  3HWT A;  3JPS A;  3T5J A;  2OEH A;  3WKE A;  5KFV A;  1SL1 A;  4RQ7 A;  4Q8F A;  2DQN B;  3KKA A;  2BCQ A;  4OJP A;  4F5R A;  3QUB A;  1U4B A;  2Y1J A;  2E1E A;  2HVI A;  3IV6 A;  2KHQ A;  5DBC A;  5KFY A;  1RPL A;  2E5S A;  3QU2 A;  2ISO A;  3A0H U;  2M9N A;  3RH4 A;  3OGU A;  5ALU A;  4CCH A;  3FC4 A;  4UAS A;  4IS7 A;  5J0X A;  1WYG A;  4QWA A;  3AQF A;  1QTM A;  5BOM A;  4BDP A;  3RAQ A;  1DGJ A;  2QB0 B;  1KFD A;  1CRX A;  2HMX A;  2LPE A;  5KFT A;  7ICE A;  2PI5 A;  1U48 A;  7ICM A;  2MSN A;  4Y2Y A;  1FFV A;  5KFS A;  4O5E A;  1HIW A;  2BCR A;  3MFI A;  3C2K A;  4IQW A;  1SZH A;  2QKQ A;  3WK8 A;  1TAQ A;  1N62 A;  4ELV A;  4Q44 A;  4MF2 A;  3LVW A;  3A0B U;  2F8L A;  1ZQR A;  2HOF A;  5AK4 A;  4M9J A;  3KD3 A;  4YMM A;  3M8R A;  4DOA A; 
#chains in the Genus database with same CATH homology
 4UB4 A;  3GDX A;  4DOC A;  4PGY A;  3UXP A;  4QZG A;  4YMO A;  4YD2 A;  4KLJ A;  3LK9 A;  3PNC A;  1BNO A;  1KEJ A;  9ICB A;  2FMP A;  7ICH A;  3RJI A;  4KLE A;  8ICY A;  5IIJ A;  4RT3 A;  5DBA A;  4YCX A;  4NLK A;  1BPD A;  4K4G A;  2BCV A;  5J0S A;  4PHE A;  4F5O A;  5III A;  4O5K A;  4IQV A;  4MFC A;  7ICJ A;  4QZB A;  2ISP A;  2W9M A;  4K4I A;  9ICA A;  1BPZ A;  4DOB A;  4KLT A;  1ZQD A;  3MDA A;  4XA5 A;  3RH6 A;  3TFR A;  4DO9 A;  4I2C A;  1HUZ A;  5HHH A;  4I27 A;  2BCS A;  4M9L A;  9ICP A;  3RJJ A;  7ICP A;  2PFO A;  7ICN A;  4RQ0 A;  5J2E A;  3RJE A;  7ICT A;  3RJH A;  4YMN A;  1ZJM A;  2PFN A;  5IIM A;  4TUS A;  3UQ2 A;  9ICV A;  9ICO A;  4RPX A;  5DBB A;  4UBB A;  5CB1 A;  8ICM A;  4PGX A;  1ZQQ A;  5J0O A;  7ICL A;  1BPE A;  3C2M A;  4R66 A;  4UB2 A;  5DB6 A;  5J2I A;  8ICW A;  4JWM A;  5DDY A;  4M47 A;  5J0Y A;  3ISD A;  1XSL A;  1ZQF A;  4Z6F A;  4IQT A;  4RQ1 A;  8ICC A;  5DB9 A;  4UB1 A;  4NXZ A;  1ZQH A;  1TVA A;  4RQ4 A;  1ZQJ A;  9ICT A;  4NLN A;  4YN4 A;  8ICF A;  9ICE A;  3UPQ A;  5J0P A;  4UBC A;  1ZQA A;  9ICL A;  5IIL A;  5J2K A;  4PHA A;  3JPO A;  4K4H A;  1JMS A;  3JPQ A;  4I28 A;  4RQ3 A;  4RQ6 A;  4I2B A;  1ZQP A;  4GXJ A;  3V7L A;  8ICQ A;  4Z6D A;  5J0T A;  3JPP A;  4FO6 A;  2FMQ A;  5IIN A;  2IHM A;  4NLZ A;  5DB8 A;  5J0W A;  3UQ0 A;  4TUQ A;  3JPN A;  2PFQ A;  7ICO A;  1ZQI A;  8ICK A;  4RPZ A;  3TFS A;  7ICV A;  1ZQL A;  9ICH A;  1ZQE A;  3V7J A;  4NM2 A;  8ICO A;  8ICT A;  4UB3 A;  5J2C A;  7ICI A;  8ICX A;  1ZJN A;  4M0A A;  7ICF A;  4M2Y A;  5J2B A;  2BPF A;  2FMS A;  4QZA A;  3PMN A;  9ICG A;  3MDC A;  3UXN A;  2BPG A;  4RT2 A;  5J29 A;  9ICI A;  4JWN A;  4I2F A;  5DKW A;  3RJK A;  8ICJ A;  4RQ2 A;  3RJG A;  4I2G A;  1ZQK A;  1ZQN A;  4M9N A;  7ICQ A;  4UB5 A;  2BCU A;  4RPY A;  1XSP A;  1BPX A;  4NM1 A;  4MF8 A;  3RJF A;  5D4B A;  9ICN A;  1BNP A;  9ICR A;  4KLF A;  5BOL A;  3C5G A;  1KDH A;  2PFP A;  3V72 A;  4QZ8 A;  4MFA A;  8ICL A;  3MGI A;  9ICM A;  3PML A;  3MGH A;  4PH5 A;  1HUO A;  4QZD A;  4O5C A;  4IQU A;  4KLM A;  4F5N A;  5J2J A;  9ICW A;  2I9G A;  7ICS A;  3C2L A;  4KLS A;  1DK2 A;  4QZI A;  5J2A A;  4TUP A;  4PGQ A;  4PHP A;  4RQ8 A;  3C5F A;  3JPR A;  3JPT A;  2KP7 A;  5CWR A;  4P2H A;  3B0Y A;  4QZC A;  4UAY A;  9ICX A;  1RZT A;  4QZF A;  4KLH A;  4I29 A;  4I2A A;  4KLQ A;  4YD1 A;  1ZQB A;  8ICB A;  4GXI A;  4O9M A;  4X5V A;  4KLD A;  8ICG A;  5J2H A;  4M9G A;  8ICH A;  8ICV A;  5TZV A;  4LZG A;  4I2J A;  4R64 A;  4QZ9 A;  2GWS A;  3MBY A;  9ICK A;  3RH5 A;  7ICR A;  1ZQT A;  8ICN A;  4I2I A;  5J2D A;  4UAZ A;  1MQ2 A;  1ZQS A;  4M9H A;  5J0U A;  4QZE A;  7ICG A;  5D49 A;  4UAW A;  1XSN A;  1ZQM A;  9ICC A;  4QZH A;  5J0R A;  8ICE A;  8ICU A;  9ICJ A;  3AU2 A;  1ZQO A;  8ICR A;  2P66 A;  1ZQG A;  5HHI A;  4PPX A;  4LZD A;  4XUS A;  7ICK A;  5DB7 A;  4I2E A;  3HWT A;  3JPS A;  5IIK A;  3V7K A;  4RQ7 A;  5J2G A;  4LVS A;  4M04 A;  4Z6C A;  5BPC A;  9ICU A;  2BCQ A;  1DK3 A;  4I2D A;  2PXI A;  8ICZ A;  4F5R A;  9ICS A;  3AU6 A;  5DBC A;  1MQ3 A;  4PHD A;  3HW8 A;  3AUO A;  2ISO A;  1TV9 A;  3RH4 A;  3OGU A;  8ICS A;  5J0X A;  3B0X A;  5J0Q A;  5D46 A;  5BOM A;  4F5Q A;  4GXK A;  4Z6E A;  4MFF A;  5EOZ A;  9ICQ A;  8ICA A;  7ICE A;  4KLO A;  7ICM A;  4O5E A;  3ISC A;  4TUR A;  4NY8 A;  8ICP A;  4R65 A;  2BCR A;  3C2K A;  4IQW A;  7ICU A;  3HX0 A;  1ZQC A;  4F5P A;  4KLL A;  3ISB A;  4MF2 A;  1ZQR A;  4KLG A;  1NZP A;  4KLU A;  1BPY A;  4I2H A;  4M9J A;  8ICI A;  4YMM A;  4KLI A;  3UXO A;  4R63 A;  4DOA A;  5J2F A;  5IIO A;  4RQ5 A;  9ICF A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...