3KFUF

Crystal structure of the transamidosome
Total Genus 111
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
111
sequence length
453
structure length
447
Chain Sequence
MYEAVIGLEVHLHLKTRTKMFCGCRADYFGAEPNTHTCPVCLGLPGALPVPNRVAVEHGLRLALALGAEVPERLVFHRKNYFYPDLPKNYQISQYDLPLGRGGSLPLGERRVRIKRLHLEEDAGKSLHLEGRTLLDLNRAGSPLIELVTEPDLKTPEEARLFLQRIQALVQTLGISDASPEEGKLRADVNVSVRRVGEPLGTKVEIKNLNSFKSVQRALEYEIRRQTEILRRGEKVKQATMGFEEGSGKTYPMADYRYFPEPDLPPVAIPRDWLEEVRRSLPELPWEKEARYRALGIKEKDAEVLAYTPSLARFLDQALPLGLASPQALANWLLADVAGLLHERGLRLEETRLSPEGLARLVGLFERGEVTSRVAKSLLPEVLEGQDPEAXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Ligase/rna
molecule keywords Non-discriminating and archaeal-type aspartyl-tRNA synthetas
publication title Crystal structure of a transfer-ribonucleoprotein particle that promotes asparagine formation.
pubmed doi rcsb
source organism Thermus thermophilus
total genus 111
structure length 447
sequence length 453
chains with identical sequence I
ec nomenclature
pdb deposition date 2009-10-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
F PF02934 GatB_N GatB/GatE catalytic domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.380 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 DNA polymerase; domain 1 3kfuF02
3H0MB 2D6FC 2DF4B 3H0LB 3H0RB 3IP4B 2G5IB 2G5HB 3KFUF 2F2AB 4WJ3B 1ZQ1C 3AL0B 2DQNB
chains in the Genus database with same CATH superfamily
2Q4TA 2IHNA 4KLHA 4O5CA 1V85A 1T94A 1KFSA 1IV8A 2ZJ8A 9ICCA 2K60A 3ETRA 2DKZA 1KEJA 3J81j 4OJ6A 1RG6A 2W9MA 1N5WA 3GIIA 4EEYA 3CNHA 1N56A 5KFPA 4RPZA 2YX8A 2V4RA 3N4MB 4ECVA 2BPCA 4DOAA 3T5KA 1X42A 1RM6C 4RQ5A 3KD3A 4A8EA 4EELA 3FYHA 1WCLA 4M9GA 2Y1IA 9ICAA 5DB9A 2LMRA 4DFPA 1Z3EB 1PUZA 5AM3A 7ICKA 3C23A 1WYGA 5KFAA 2K4EA 1RZTA 4ICAA 4QZ9A 2W3RA 5J2AA 3RJIA 3RH4A 2RRDA 1L8LA 4QJFB 2OXOA 2GWSA 3SENA 1TKDA 5CB1A 4OJ5A 5HMMA 2OWOA 5KT2A 7ICFA 1N62A 2ZJ5A 1QQ6A 3EPIA 2W9CA 2LHTA 2I6XA 4FZNA 2Y9UA 3RRGA 3T5HA 1V38A 3MABA 4BGDA 4RQ7A 3M8SA 2DPIA 2JEGA 3H0RB 2A1JB 3JPPA 4DWIA 3V6JA 3ZI4A 2DL0A 5J2FA 1Z4OA 5IIIA 4O3OA 3KOOA 4P4MA 1ZQFA 5J0PA 1N2XA 4B6JA 1L7MA 4RQ6A 4ECSA 2AH5A 5KFCA 2B6GA 4YQWA 5CP2A 5C0YA 2FDRA 4ECTA 9ICOA 1S0MA 4NLBA 2WB1C 2NRXA 1LVHA 3C21A 2J6TA 4R8UB 4USAA 4M9LA 5B5EU 1IG6A 5ALYA 4YFKA 4TURA 5EWFA 4J9NA 2XGQA 2EAMA 2W8LA 1RYSA 4P0PB 1D8YA 4KLUA 4KLSA 1JXEA 7ICJA 4RQNA 4JV2A 3TANA 4DQQA 2EAOA 2QARA 1KKXA 1OUQA 8ICNA 3SV4A 2W3SA 4KMUA 3IG5A 2F1JA 2BPFA 2HHUA 4UB4A 4ED1A 4OO1J 2ZJAA 4NLCA 4M9NA 3N7PD 1RYRA 5AI8A 3RR8A 7ICOA 1XSNA 4QNLA 3DDHA 2PXIA 1L8OA 2IBKA 1L7PA 3WK4A 3JPRA 5KG6A 2KG5A 4JK1A 3RB0A 4NLKA 3K75D 4J03A 1XS9D 3GILA 4EBEA 3NVWA 2FLPA 3H8WA 4I2GA 4QZDA 3HKZC 4ED2A 1TK5A 1D9FA 4UATA 2BQ3A 2BKEA 4F50A 2MAXA 4YN4A 3IV6A 2XY5A 4O0IA 1L3SA 1OXJA 1TV9A 4YMOA 2JMGA 4O3QA 2MU2A 4O3NA 1ZXIA 2C2EA 1HJPA 9ICHA 4BWMA 5ALIA 4M04A 1CEZA 5KFQA 2E8PA 5C5JA 2W9BA 1ZQUA 4OCZA 1SZHA 2KVCA 1IIPA 8ICZA 4QW9A 4I2FA 3UM9A 2AGOA 4KLQA 4DSIA 1SXDA 7ICVA 2KV2A 5HNKA 4Q43A 2G09A 2FE9A 5HP4A 4EZ6A 2GH1A 1FEZA 4QZFA 4DS5A 1PK1B 2H3VA 8ICGA 2ZUBA 3OGUA 1BPZA 1PK3A 2MRLA 2IOHA 3OSNA 4J9RA 2F76X 3TFSA 4O5EA 4LZGA 4R64A 2FPMA 4M6WA 1F0MA 2Q0ZX 5ALZA 5HR7A 9ICIA 4P2HA 2OEHA 5ALVA 5DG9A 4PHEA 1JROA 1KL9A 5EWGA 2G06A 1L7OA 3ORYA 4P0QA 3BZKA 5DB8A 2E8MA 4CF3A 4OJPA 3JPSA 1ZQRA 4UAWA 1DGSA 4Y2UA 7ICPA 4IQUA 1ZQIA 4RQ0A 4Z6DA 2NRTA 1J2NA 1QQ7A 3UXNA 1NJZA 3F53A 4J9SA 2K4PA 3G6XA 2KICA 1SIJA 1XO0A 3FDSA 5ALMA 3GV8B 1Q8KA 3D2QA 5KFBA 9ICFA 4M9HA 3ZDEA 4NWIA 2K8BB 2FI1A 2LM1A 9ICVA 1TE2A 2Z7JA 2KFZA 5JRTA 4QZHA 3ISBA 3RJFA 7ICTA 4I2JA 1ZQEA 1AQ6A 4I2EA 2KSOB 4Y2PA 3PO4A 1UCVA 1NK4A 1N61A 2QB1A 3O0FA 4MEXA 1KFDA 2HOIA 3RTVA 2HDOA 1COOA 1HUOA 9ICBA 5KG1A 2EANA 1NNLA 3A0BU 3Q8SB 2ISPA 3QYPA 4K4GA 3Q8RB 1X9WA 5DKWA 4NLZA 4G3IA 5KFNA 3TARA 3RJGA 1ZETA 4FZLA 4LJXA 1XSLA 2G08A 1Z00A 3RH5A 2GLEA 3JPOA 2JZBB 1O03A 4LZDA 2LM4A 1BPYA 4BXOB 1V9PA 1X6IA 1ZQTA 3C28A 3MFIA 2DKXA 3THVA 4QWCA 1T3NA 5DQGA 5J2DA 4Y2RA 1ZRMA 4U6PA 8ICMA 2PMZC 2C22A 2DPJA 5HHHA 2XIDA 4IS7A 4ELVA 5AM1A 4KN7A 3RJKA 3CYMA 2HW3A 1ZQDA 3PVXA 1NI3A 3ALRA 5GTIU 2OHFA 8ICIA 1ZQCA 4DL7A 3LK9A 1SL1A 4Q8EA 8ICQA 2NRVA 2ZUCA 1D9DA 5KT6A 4UAUA 3T5JA 1HIWA 4TUQA 2YB4A 1QCKA 2F8KA 1Z19A 4Y2XA 4GXIA 2N1RA 2GOLA 4ECWA 4KITB 4O3SA 8ICTA 4ED7A 4Y2SA 1A6SA 1U4BA 4UAYA 3F5AA 5D4BA 2ZIUA 4DO9A 1SB3C 5EE9A 9ICUA 5AKZA 4KLMA 2BQUA 2P6RA 5HMLA 2W11A 5B66U 9ICXA 2NO5A 4MFCA 3V7LA 1DRGA 3I28A 1ZOLA 1X6JA 1L3TA 2M0NA 3B0XA 5AKLA 5DBAA 5KFMA 1Z1VA 8ICFA 5ALNA 5KFIA 1S0OA 1F5SA 3OHBA 4C4RA 4IR1A 4ED3A 4F2SA 1IM4A 4J9KA 2AU0A 5KFDA 4P4PA 1DOQA 3Q8LA 1RQLA 2JH1A 3LVVA 2JHDA 3UMGA 3RJJA 4UW9A 3UXOA 3MGHA 3CRXA 4PL2A 5KFXA 5KFJA 2M9NA 2FPKA 3ONNA 5KFTA 2CPRA 4M0AA 5ALSA 3H4DA 5KT7A 1N63A 2R18A 2XC9A 4RNMA 2WF8A 4O3PA 1NK5A 5J2KA 2BR0A 7ICMA 1ZD4A 3QU9A 2EZXA 3MR2A 1PVQA 5D46A 3QU4A 4F4XA 4QZCA 1RQNA 3N7SC 5IIKA 5IIOA 3LWMA 5CHGA 1L3UA 2ZIXB 3C5FA 4BDPA 3V6HA 4ECQA 1BPDA 1A77A 1ZQHA 8ICYA 3AM9A 1ZQOA 4Y2YA 1MSWD 3L4PA 5FP0A 4ZOHC 3TQ1A 4PGQA 4HAIA 4UASA 1L5UA 5J0SA 3RBDA 3WK6A 1ZJMA 1UT5A 3M8RA 3LVWA 3L3FX 2BCRA 4FFDA 4CCHA 1TK8A 4UB6U 3QUBA 1TFRA 4EBDA 2XGPA 1Y88A 1C7YA 4BX9C 3V7KA 4HYKA 2NRWA 3IN5A 2EZZA 4C8LA 2QB0A 3ISCA 2OM6A 2J6UA 4QWDA 2YY6A 4MFAA 4PZNA 5ALKA 5K4LA 4I29A 1RDFA 3RRHA 5AK3A 2KE7A 4PHPA 1ZQNA 4O3RA 5ALFA 2HVHA 1BNPA 2W03A 1QH9A 3WK5A 3PSFA 3UMBA 7ICRA 1VLBA 3IM1A 5AK4A 4MF8A 4C4TA 3MBYA 1NK8A 3K1ZA 4YR3A 2RQ5A 8ICEA 4J9PA 3GV5B 2HHQA 4O9MA 3IP4B 1N48A 2ZIWA 3IRUA 2AGPA 4Z6FA 4UB8U 4UBBA 1SKRA 2ZTCA 3FC4A 3RB4A 5CJ7A 3NGDA 4CE6A 3E2EA 8ICKA 4UB2A 3UPQA 2KZMA 3MR6A 4TUPA 1CUKA 4K4IA 2ZXHA 9ICSA 4RQ4A 3QU2A 1RYUA 8ICCA 4DOBA 5DGBA 2JR5A 3BQTA 4YMMA 5D49A 5IIJA 2P35A 1H38A 5DDYA 4J9OA 4M47A 2WF9A 2PMZF 5H2FU 1V97A 4KLGA 3PNCA 4PPXA 4YXJA 1HEKA 3QUCA 4R66A 3SD7A 2ALZA 4DFKA 7ICEA 4QZGA 4RZRA 8ICVA 3OJUA 1U9LA 3QZ7A 2HVIA 4R63A 1RXWA 5TISU 5ALOA 1ZQZA 5KNIA 2MUTB 2ES6A 3ICXA 3NVYA 8ICPA 3TADA 5DG7A 1B4FA 2ZXIA 2AXTU 1U49A 7ICQA 1T4GA 2MSNA 3OHAA 3V6KA 2V9WA 8ICSA 2KIWA 4GC7A 3E58A 5L1KA 1JN3A 2ZIVB 4KLJA 4Q44A 2BDUA 4B9TA 4F4KA 1NKEA 5F9NA 4NL9A 8ICRA 1M6YA 1IXRA 4YMNA 3Q8KA 1ED1A 1Q3UA 4FO6A 4KX5A 4EZ9A 4NM1A 1SKSA 3D2SA 3I1YA 4RQ3A 4IQTA 2B0CA 1U45A 2DF4B 4ECZA 4R65A 5DLFA 5KFSA 5IILA 3AQFA 3H4BA 3KKAA 3PX4A 4RNOA 4Y2VA 5BPCA 2PFQA 1ZD5A 2LI6A 1QTMA 4OJOA 3WK9A 4RQ8A 2KZ3A 4PHDA 3NS1A 2ASJA 2KKVA 4YR2A 3BQ2A 2CN1A 2DFLA 4IC9A 5AI0A 4Y2JA 4QIWC 3RB6A 3V7JA 3HILA 2A19A 8ICUA 5KFVA 3EW9A 2ZTDA 1SGGA 4KLDA 2PI4A 3E0FA 1EXNA 5ALGA 2C28A 5EE3A 5AI5A 1TAUA 2K8CB 4XUSA 4OJLA 5AKIA 1Z1BA 4PL1A 1YZ6A 2W9CB 2XO7A 4RU9A 2RDIA 4DOCA 4QWBA 4QZBA 1U48A 5AHXA 4MEYA 4IQWA 2F1IA 3M1YA 1SV0A 5KFWA 1NK7A 4QZEA 2YMPA 5KFZA 1X9SA 3NRZA 2R8KA 9ICLA 4GC6A 3WKAA 3HW8A 4DFDA 5J2JA 3RAXA 4RT3A 4QWAA 4FS1A 3LYSA 1NK0A 3WK7A 4ECYA 3M9OB 3H8SA 3AU6A 5KG5A 4DL3A 5J29A 4DSLA 4UB1A 1S9FA 2WAQF 1K5OA 3RAQA 2YN4A 2H3IA 1JI7A 5J2HA 2LBOA 2CXYA 4DSFA 1BVSA 5J2BA 1DK3A 1ZQQA 4I2IA 3SAFA 4OD0A 3OTQA 2FMQA 4DQIA 3QU5A 1NZBA 2AHOB 3M9MB 5KFKA 3KFUF 1J97A 2E8NA 2FMSA 4RQMA 2QARB 2H5XA 3PO5A 2HOQA 3MDCA 5G5GA 2J6SA 4F4ZA 2BZFA 3C5GA 2BCQA 5J0UA 2Y0SC 4C4SA 3F2CA 4RUCA 3N97B 3ISDA 3HRDD 1C20A 4FBUA 5ALEA 3RB3A 4J9LA 1NJYA 9ICGA 1URJA 4I27A 2MA1A 7ICNA 3BJYA 3AL0B 2BCVA 3VCBA 4MFFA 1CRXA 5DBBA 2KJ5A 2DGZA 5EE0A 1S77D 1F44A 4CF5A 2PKEA 4C80A 4I28A 4DL5A 1TVAA 4EYIB 4BJQA 1ZQKA 5DQIA 4DQPA 4IRKA 1FIQA 5TZVA 5L9XA 5HHIA 5DDMA 3U26A 3RR7A 3CP8A 5KFHA 2ZTEA 1ZJNA 2K89A 4EX6A 2D8CA 1XSPA 5DB6A 4DEZA 3K4GA 4XRHA 3SAGA 4NLNA 4I2BA 4C0ZA 5AIBA 3RF9A 3PW5A 1LKYA 4UBCA 5L1IA 4FBTA 2W9BB 2VA3A 1COKA 4AP9A 3MR3A 4QZAA 5ALDA 5AKKA 4GIBA 1QSLA 2F8LA 5ALRA 5AM4A 4NM2A 4O5KA 5J0QA 3QUQA 1Z4NA 1MN8A 5KFUA 3LWLA 3G6YA 2KVSA 3KZIU 4KLLA 3D2NA 4F4YA 4EX7A 2V4QA 1ZQGA 3TI0A 3BS5A 4US8A 1NOMA 3ZD9A 5DB7A 1T7PA 4DQRA 4FZMA 5J0WA 4M6WB 2F2AB 5AKHA 2BPGA 4UAVA 2I9GA 1UT8A 3Q8QB 4NV0A 3SMVA 4F5OA 3KHRA 1S5LU 3PV8A 2IA6A 1UA0A 4P0QB 1QSYA 3PW7A 3A0HU 4ED8A 3H0MB 1ZD3A 1X40A 2HBMA 4F2RA 2HBKA 1ZQMA 2C2DA 4F93B 1T8EA 3IHQB 3MC1A 3BQ7A 4RPXA 2BCSA 4JB3A 5DQHA 2I1QA 1X9MA 5ALTA 4C8NA 2W7PA 3H7IA 9ICTA 4Z6CA 3R9KA 4QIWF 3KBBA 4AYBC 1P7DA 2IMWP 4YCXA 2PFPA 2EZYA 1B43A 3MR5A 5KG4A 2ASLA 1KBUA 1CI4A 2WTFA 2YB1A 5KFFA 3VC8A 5JUMA 2DBYA 2YQEA 3SQIA 1ZQAA 2VA8A 2F3NA 1ZQYA 2WF7A 4RNNA 5KFRA 7ICSA 2LKYA 3KHLA 4YG2A 5EWEA 1BPEA 1XC9A 4B9VA 4IRCA 5E79U 5J2CA 2XI9A 3PX6A 3RJEA 3T3FA 2UVWA 1JUDA 5J0TA 4JV1A 5L1MA 1VJ5A 1LB2B 2KD1A 2W55A 1S0NA 3GIKA 1Z00B 8ICAA 1DXSA 3UQ0A 2A1JA 5BOMA 4RT2A 4UARA 7ICUA 4XA5A 1DGJA 2W43A 4Q8FA 4F91B 2IHMA 4YD1A 3PSTA 2NO4A 2R8JA 1S8OA 1X2IA 3SV3A 5KG7A 2NYVA 2VJ4A 4ACOA 4NJ8A 3OSPA 5L1LA 4Q45A 4IRDA 4GXJA 2HMXA 5CWRA 3QZ8A 1S97A 5CRXA 2IOFA 8ICLA 5AM2A 5JU5A 2JGAA 4C7ZA 3JPQA 2E1FA 1ZQWA 4R8UA 5HR6A 2YMQA 7ICIA 9ICMA 2RLTA 4Y2QA 1JMSA 3PZPA 4US9A 4RQ1A 4B9NA 2WAQC 3M6KA 4Y2TA 1SKWA 1KW4A 3GZFA 1DK2A 2BHNA 4P0PA 2ESEA 2XCAA 2L5YA 5F3XB 2KP7A 3B0YA 5ALWA 2A3VA 1TAQA 3C2MA 2Y0SF 1PVPA 1KFTA 1WUDA 5J0XA 2K8AA 1QQ5A 1NZPA 3SI8A 4ECRA 3K1RB 4YP3A 5DGAA 5J0RA 3OPXA 4B9LA 4KMOB 2FLNA 4PH5A 2PFNA 1N5XA 5AK5A 2ZIUB 1WG8A 4RUAA 9ICKA 3AQEA 5J2EA 5KFEA 4DL6A 3RFAA 5A0LA 9ICRA 3ETLA 4DS4A 2QKQA 3T79A 5AK6A 4F5PA 3RJHA 1PVRA 3WKDA 5AKJA 1SV0C 9ICNA 2NV3A 2R8GA 1WCNA 2WFAA 3QXGA 2KOBA 5T14A 3WKCA 4C8OA 4C8MA 7ICHA 1SXEA 1QLNA 2H3FA 3H8JA 4ZH4A 3V72A 1SL2A 2G5HB 3Q8MA 5ALHA 2G0AA 3D6JA 3NASA 1TK0A 5GTHU 5J2IA 8ICWA 2Y1JA 1NJWA 3PW2A 1D8LA 2EDUA 3FM9A 4ED6A 2G07A 1Q3VA 2P66A 1D8BA 1ZQSA 1XO1A 4XQ8A 2HHWA 5DLGA 4JMUA 1FFVA 3TFRA 2JEJA 1XU4A 1UHUA 2KJ9A 1O08A 4UAZA 4KLEA 2RP5A 4DCCA 4U7CA 2KMDA 2LYAA 2CRXA 3UXPA 1LV5A 2E3TA 4KN4A 4E0DA 2VKQA 3QX7A 4BWJA 1PK1A 2JRZA 3NUQA 2XICA 5AI9A 3F5EA 3HT3A 3C1ZA 2E1EA 4DL2A 3WKEA 1BGXT 2PI5A 5KL1B 4I2CA 4CGZA 2HHSA 3NVVA 2KKPA 3PR4A 4B9UA 4B9SA 2IOFK 4ED0A 2VIXA 4QWEA 4DL4A 8ICBA 4EENA 4KLFA 4YR0A 1XWLA 9ICJA 5KT5A 3HWTA 1X9XA 2B21A 5CEHA 3QEAZ 3EWAA 4JWNA 1KLNA 1XNSA 3WK8A 4QZ8A 3Q8PB 1J2MA 3ZDAA 3GIMA 3BZCA 5AI4A 5J8YA 5KAIU 2AQ0A 3MDAA 3BQ1A 3PY8A 1JIHA 1S76D 4WJ3B 1RPLA 1KTQA 3GFKB 4NY8A 4PJ0U 1KQQA 3HX0A 2HHXA 2LYHA 1L3VA 3EZ5A 2FPLA 4JV0A 4AYBF 2JXJA 2QB0B 3NTUA 2ZUDA 2RDJA 3L5KA 1ZQPA 3F2BA 2UVUA 2OH2A 1MA7A 1WWUA 4DFMA 1FO4A 4F92B 2KSOA 2HBLA 5AM0A 4IL6U 5ALPA 3PX0A 4RPYA 4CF4A 2HOFA 3I76A 2EQYA 2LPEA 3ED5A 1ZRNA 1MQ3A 5J0OA 1BPBA 2ZIWB 2JV3A 3QNMA 2G5IB 3SYZA 5KG3A 2R8IA 2W04A 4G9BA 5CA7A 5AKEA 2UVVA 4QW8A 4NXZA 2AQ4A 2DUYA 2JH7A 4ELUA 7ICLA 4FS2A 1SL0A 3MFHA 2JZBA 3RBEA 1T3QA 5J0YA 2E5SA 1K1SA 2D6FC 4BXOA 3GQCA 2LYBA 4GXKA 4NLGA 1BPXA 3M9NB 4DFJA 2JEFA 2WF6A 1SWWA 4B9MA 1X66A 9ICPA 2XCPA 5EOZA 3IDWA 2W7OA 2GO7A 2KEYA 4BUGA 1UQVA 3QUTA 3HPOA 3G6VA 2C2RA 5ALXA 2WHEA 1JX4A 2DWQA 1ZYQA 3PSIA 9ICQA 3N7RC 2EH9A 1GO3F 4I2HA 4F71A 2KTQA 1ZQLA 3QEBZ 3SEIA 4QZIA 5AKYA 2F77X 2K4IA 3KHHA 5DG8A 2XY7A 4I2DA 5G5HA 1NJXA 3UMCA 1PZNA 1SV4A 3ZD8A 1ZQBA 2RHFA 5KL8B 5AKXA 3JPTA 1UPHA 3TACB 4TQRA 3B9JA 4F5QA 2HSZA 3C29A 3MGIA 4TUSA 3NRWA 2P6UA 4KLTA 2KN7A 4TQSA 4IR9A 2HHVA 3KTQA 3TAQA 1B22A 3ZDDA 3AEVA 4JWMA 2HBJA 4ECXA 3FAHA 4LVSA 5J2GA 1UA1A 8ICJA 3SZ2A 5IINA 4YD2A 4PZOA 2BDPA 4F3OA 3NVZA 3C2LA 2Y9TA 4K4HA 2OCEA 5AIAA 1NK9A 2ISOA 2ATLA 2E8OA 3EPGA 3AN1A 2JEIA 4KLIA 4CRXA 5KT4A 4F72A 4DLGA 3M7DA 5AICA 2BGWA 3SAHA 4DSEA 4GLXA 5ALQA 2W9AA 2AJQA 2A1AA 1ZQXA 1A76A 1WWVA 5KFOA 5KG2A 1ZQVA 2XVTA 3H8MA 7ICGA 5ALUA 1FFUA 4DQSA 2QLTA 3M6ZA 5IIMA 3PW0A 3PSPA 2AGQA 3H0LB 9ICWA 5KT3A 3DEEA 3PMNA 3IG8A 4EEKA 3BQ0A 3JPNA 1SZPA 3TKAA 1NK6A 1S0VA 2K4HA 3S6JA 4PHAA 4DSJA 2DQNB 1ECWA 5EE1A 1L6NA 5KTQA 2PFOA 1KRPA 1B0XA 3HJEA 8ICHA 5AI6A 2BCUA 4IQVA 1OW5A 1JALA 3WU2U 5KFLA 4PGXA 1JRPA 4JUZA 2ZIXA 2WB1F 4P4OA 4MHVA 4C7YA 3GV7B 2H3ZA 4ECUA 2OYYA 4UB5A 4J9QA 3KHGA 1JXLA 4I2AA 2KIVA 2VANA 4DF4A 5KG0A 2NRZA 4Z6EA 2BQRA 4O3MA 1NKCA 3H40A 4KX3A 3GU3A 3PW4A 1KN5A 1MC8A 5KFGA 8ICOA 3C2KA 2H3QA 2HHTA 5ALJA 2F44A 5AM5A 3RH6A 3DV9A 1ZQ1C 2KJ8A 1MQ2A 4UQGA 3GIJA 2KHQA 3AU2A 2WF5A 3N28A 4DSKA 5ALLA 4C8KA 1YT3A 4X5VA 5JTIA 2KZZA 4EYHB 3QU7A 2KFNA 2KNJA 4YVZA 1VDVA 2F1HA 3UQ2A 3CW2C 4F5NA 3F2DA 1U47A 1ZQJA 1N60A 1ZD2P 1KDHA 2EAPA 5KFYA 1L7NA 2KHVA 4J9MA 2I5HA 3GDXA 3HKZF 4KTQA 2O6KA 3PR5B 1BNOA 3MGVA 3EUB2 3ZDCA 2FMPA 4CDGA 4PGYA 4GFJA 4EBCA 2W8KA 3AUOA 9ICEA 4CNQA 3TADC 2HCFA 2ZG6A 5BOLA 1K1QA 5DBCA 2D3DA 2W54A 2FJ6A 1YZ7A 3C1YA 3TAPA 3BS7A 4MF2A 1S10A 2YTUA 3BDPA 2R8HA 1KSPA 1QSSA 5L1JA 4F8RA 2YMLA 3KZXA 3WKBA 4FE3A 4M9JA 1LKYB 4NL9C 3ZDBA 5KAFU 5F9LA 1AROP 5CR0A 3T5LA 3QE9Y 4DLEA 4YXMA 5J8YC 3LDAA 4ELTA 2VA2A 1Q46A 4UB3A 3PMLA 2UVRA 4KLOA 2VJ5A 2YMMA 1A0PA 3EYZA 2MUTA 2XY6A 4M2YA 1TAMA 5AKGA 4DF8A 3OJSA 2HI0A 1SWVA 2ASDA 1RXVA 3KKAC 3HP6A 4F4WA 3AMZA 3SR6A 3BS5B 2ODGA 8ICXA 2KK0A 2ZIVA 1HUZA 4RQ2A 1NKBA 2FLLA 4F5RA
chains in the Genus database with same CATH topology
3F2DA 2JMGA 1HIWA 3AQEA 2YB4A 2Q4TA 3AQFA 3SAFA 3RFAA 2Z7JA 2XI9A 1Z19A 3PSIA 5A0LA 3M6ZA 1XNSA 2ZXHA 2N1RA 2KHVA 3N7SC 3N7RC 1NZBA 2GOLA 1T94A 3PSPA 3H0LB 4OJOA 3T79A 1GO3F 3DEEA 3KFUF 3IG8A 2KD1A 4AYBC 5C0YA 2ZIXB 1PVRA 3HKZF 2F77X 4NLBA 2K4IA 2KKVA 2NV3A 2PMZF 4WJ3B 2WB1C 1SZHA 2KVCA 2CN1A 3D2NA 1IIPA 4IC9A 3O0FA 4OJ6A 2KOBA 3MGVA 4QIWC 5T14A 2HOIA 1A6SA 2K4HA 2HOQA 3F5AA 2DQNB 2ZIUA 1ECWA 1HEKA 2H3FA 2RHFA 5KL8B 4CDGA 1UPHA 4FZMA 1L6NA 3PSTA 2KV2A 2Y0SC 4GFJA 2G5HB 2G09A 2YX8A 2F2AB 4AYBF 3E0FA 3F2CA 2GH1A 2G0AA 3C29A 3NRWA 2VJ4A 2ZG6A 4A8EA 4ACOA 2K8CB 3F2BA 4NV0A 2OH2A 3SMVA 2HMXA 4OJLA 4P0PB 3LVWA 1MA7A 3L3FX 2H3VA 4FZLA 1DRGA 2G07A 2ZIXA 2WB1F 5CRXA 2G08A 2HBLA 1URJA 1Q3VA 2M0NA 1Z1BA 4P0QB 2JGAA 4PL1A 2MA1A 2H3ZA 1D8BA 2OYYA 2HOFA 2E1FA 2MRLA 3ICXA 3AL0B 2HBJA 2K4EA 4JMUA 3H0MB 5HR6A 2F76X 4ICAA 3VCBA 4BX9C 2KJ9A 1CRXA 2HBMA 3IN5A 2HBKA 3C28A 2ZXIA 2RP5A 2KJ5A 3KZXA 1OUQA 4FE3A 2DGZA 4U7CA 4O3MA 2ZIWB 3PZPA 3IG5A 2OM6A 4KX3A 1F44A 2LYAA 2G5IB 2RRDA 3GU3A 2CRXA 2JH1A 4QJFB 3LVVA 2JHDA 2WAQC 1P7DA 4BJQA 2OXOA 4U6PA 3M6KA 5HR7A 2W04A 2VKQA 3GZFA 4OO1J 2KIWA 2PMZC 3CRXA 4PL2A 2W03A 4OJ5A 4P0PA 2ZIVB 3PSFA 2H3QA 4NLCA 2JH7A 2BDUA 3N7PD 2XICA 2G06A 3NUQA 2W7PA 2XIDA 4QIWF 3CP8A 3F5EA 2VJ5A 4P0QA 2KJ8A 1ZQ1C 2E1EA 1A0PA 2K89A 2A3VA 3ONNA 3CYMA 2LHTA 2CPRA 1TAMA 3K1ZA 3LYSA 4OJPA 2KHQA 4QNLA 5KL1B 2E5SA 4CRXA 4CGZA 2Y0SF 1PVPA 4FZNA 2KKPA 3SAGA 2D6FC 1WUDA 2LYBA 2K8AA 3M7DA 2R18A 1ED1A 4C0ZA 3IP4B 1Q3UA 3RF9A 3SAHA 2ZIWA 2VIXA 3ALRA 1KBUA 3F53A 2WAQF 4KX5A 2YB1A 2KICA 1YT3A 3VC8A 1XO0A 3HKZC 3H0RB 3OPXA 2W7OA 3D2SA 2KEYA 3SQIA 2H3IA 4BUGA 4KMOB 3D2QA 2LBOA 2KNJA 2DF4B 2ZIVA 2ZIUB 2F8LA 1PVQA 2LKYA 4NWIA 2K8BB 2XVTA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3H0M B;  2D6F C;  2DF4 B;  3H0L B;  3H0R B;  3IP4 B;  2G5I B;  2G5H B;  3KFU F;  2F2A B;  4WJ3 B;  1ZQ1 C;  3AL0 B;  2DQN B; 
#chains in the Genus database with same CATH topology
 2Q4T A;  2IHN A;  4KLH A;  4O5C A;  1V85 A;  1T94 A;  1KFS A;  1IV8 A;  2ZJ8 A;  9ICC A;  2K60 A;  3ETR A;  2DKZ A;  1KEJ A;  3J81 j;  4OJ6 A;  1RG6 A;  2W9M A;  1N5W A;  3GII A;  4EEY A;  3CNH A;  1N56 A;  5KFP A;  4RPZ A;  2YX8 A;  2V4R A;  3N4M B;  4ECV A;  2BPC A;  4DOA A;  3T5K A;  1X42 A;  1RM6 C;  4RQ5 A;  3KD3 A;  4A8E A;  4EEL A;  3FYH A;  1WCL A;  4M9G A;  2Y1I A;  9ICA A;  5DB9 A;  2LMR A;  4DFP A;  1Z3E B;  1PUZ A;  5AM3 A;  7ICK A;  3C23 A;  1WYG A;  5KFA A;  2K4E A;  1RZT A;  4ICA A;  4QZ9 A;  2W3R A;  5J2A A;  3RJI A;  3RH4 A;  2RRD A;  1L8L A;  4QJF B;  2OXO A;  2GWS A;  3SEN A;  1TKD A;  5CB1 A;  4OJ5 A;  5HMM A;  2OWO A;  5KT2 A;  7ICF A;  1N62 A;  2ZJ5 A;  1QQ6 A;  3EPI A;  2W9C A;  2LHT A;  2I6X A;  4FZN A;  2Y9U A;  3RRG A;  3T5H A;  1V38 A;  3MAB A;  4BGD A;  4RQ7 A;  3M8S A;  2DPI A;  2JEG A;  3H0R B;  2A1J B;  3JPP A;  4DWI A;  3V6J A;  3ZI4 A;  2DL0 A;  5J2F A;  1Z4O A;  5III A;  4O3O A;  3KOO A;  4P4M A;  1ZQF A;  5J0P A;  1N2X A;  4B6J A;  1L7M A;  4RQ6 A;  4ECS A;  2AH5 A;  5KFC A;  2B6G A;  4YQW A;  5CP2 A;  5C0Y A;  2FDR A;  4ECT A;  9ICO A;  1S0M A;  4NLB A;  2WB1 C;  2NRX A;  1LVH A;  3C21 A;  2J6T A;  4R8U B;  4USA A;  4M9L A;  5B5E U;  1IG6 A;  5ALY A;  4YFK A;  4TUR A;  5EWF A;  4J9N A;  2XGQ A;  2EAM A;  2W8L A;  1RYS A;  4P0P B;  1D8Y A;  4KLU A;  4KLS A;  1JXE A;  7ICJ A;  4RQN A;  4JV2 A;  3TAN A;  4DQQ A;  2EAO A;  2QAR A;  1KKX A;  1OUQ A;  8ICN A;  3SV4 A;  2W3S A;  4KMU A;  3IG5 A;  2F1J A;  2BPF A;  2HHU A;  4UB4 A;  4ED1 A;  4OO1 J;  2ZJA A;  4NLC A;  4M9N A;  3N7P D;  1RYR A;  5AI8 A;  3RR8 A;  7ICO A;  1XSN A;  4QNL A;  3DDH A;  2PXI A;  1L8O A;  2IBK A;  1L7P A;  3WK4 A;  3JPR A;  5KG6 A;  2KG5 A;  4JK1 A;  3RB0 A;  4NLK A;  3K75 D;  4J03 A;  1XS9 D;  3GIL A;  4EBE A;  3NVW A;  2FLP A;  3H8W A;  4I2G A;  4QZD A;  3HKZ C;  4ED2 A;  1TK5 A;  1D9F A;  4UAT A;  2BQ3 A;  2BKE A;  4F50 A;  2MAX A;  4YN4 A;  3IV6 A;  2XY5 A;  4O0I A;  1L3S A;  1OXJ A;  1TV9 A;  4YMO A;  2JMG A;  4O3Q A;  2MU2 A;  4O3N A;  1ZXI A;  2C2E A;  1HJP A;  9ICH A;  4BWM A;  5ALI A;  4M04 A;  1CEZ A;  5KFQ A;  2E8P A;  5C5J A;  2W9B A;  1ZQU A;  4OCZ A;  1SZH A;  2KVC A;  1IIP A;  8ICZ A;  4QW9 A;  4I2F A;  3UM9 A;  2AGO A;  4KLQ A;  4DSI A;  1SXD A;  7ICV A;  2KV2 A;  5HNK A;  4Q43 A;  2G09 A;  2FE9 A;  5HP4 A;  4EZ6 A;  2GH1 A;  1FEZ A;  4QZF A;  4DS5 A;  1PK1 B;  2H3V A;  8ICG A;  2ZUB A;  3OGU A;  1BPZ A;  1PK3 A;  2MRL A;  2IOH A;  3OSN A;  4J9R A;  2F76 X;  3TFS A;  4O5E A;  4LZG A;  4R64 A;  2FPM A;  4M6W A;  1F0M A;  2Q0Z X;  5ALZ A;  5HR7 A;  9ICI A;  4P2H A;  2OEH A;  5ALV A;  5DG9 A;  4PHE A;  1JRO A;  1KL9 A;  5EWG A;  2G06 A;  1L7O A;  3ORY A;  4P0Q A;  3BZK A;  5DB8 A;  2E8M A;  4CF3 A;  4OJP A;  3JPS A;  1ZQR A;  4UAW A;  1DGS A;  4Y2U A;  7ICP A;  4IQU A;  1ZQI A;  4RQ0 A;  4Z6D A;  2NRT A;  1J2N A;  1QQ7 A;  3UXN A;  1NJZ A;  3F53 A;  4J9S A;  2K4P A;  3G6X A;  2KIC A;  1SIJ A;  1XO0 A;  3FDS A;  5ALM A;  3GV8 B;  1Q8K A;  3D2Q A;  5KFB A;  9ICF A;  4M9H A;  3ZDE A;  4NWI A;  2K8B B;  2FI1 A;  2LM1 A;  9ICV A;  1TE2 A;  2Z7J A;  2KFZ A;  5JRT A;  4QZH A;  3ISB A;  3RJF A;  7ICT A;  4I2J A;  1ZQE A;  1AQ6 A;  4I2E A;  2KSO B;  4Y2P A;  3PO4 A;  1UCV A;  1NK4 A;  1N61 A;  2QB1 A;  3O0F A;  4MEX A;  1KFD A;  2HOI A;  3RTV A;  2HDO A;  1COO A;  1HUO A;  9ICB A;  5KG1 A;  2EAN A;  1NNL A;  3A0B U;  3Q8S B;  2ISP A;  3QYP A;  4K4G A;  3Q8R B;  1X9W A;  5DKW A;  4NLZ A;  4G3I A;  5KFN A;  3TAR A;  3RJG A;  1ZET A;  4FZL A;  4LJX A;  1XSL A;  2G08 A;  1Z00 A;  3RH5 A;  2GLE A;  3JPO A;  2JZB B;  1O03 A;  4LZD A;  2LM4 A;  1BPY A;  4BXO B;  1V9P A;  1X6I A;  1ZQT A;  3C28 A;  3MFI A;  2DKX A;  3THV A;  4QWC A;  1T3N A;  5DQG A;  5J2D A;  4Y2R A;  1ZRM A;  4U6P A;  8ICM A;  2PMZ C;  2C22 A;  2DPJ A;  5HHH A;  2XID A;  4IS7 A;  4ELV A;  5AM1 A;  4KN7 A;  3RJK A;  3CYM A;  2HW3 A;  1ZQD A;  3PVX A;  1NI3 A;  3ALR A;  5GTI U;  2OHF A;  8ICI A;  1ZQC A;  4DL7 A;  3LK9 A;  1SL1 A;  4Q8E A;  8ICQ A;  2NRV A;  2ZUC A;  1D9D A;  5KT6 A;  4UAU A;  3T5J A;  1HIW A;  4TUQ A;  2YB4 A;  1QCK A;  2F8K A;  1Z19 A;  4Y2X A;  4GXI A;  2N1R A;  2GOL A;  4ECW A;  4KIT B;  4O3S A;  8ICT A;  4ED7 A;  4Y2S A;  1A6S A;  1U4B A;  4UAY A;  3F5A A;  5D4B A;  2ZIU A;  4DO9 A;  1SB3 C;  5EE9 A;  9ICU A;  5AKZ A;  4KLM A;  2BQU A;  2P6R A;  5HML A;  2W11 A;  5B66 U;  9ICX A;  2NO5 A;  4MFC A;  3V7L A;  1DRG A;  3I28 A;  1ZOL A;  1X6J A;  1L3T A;  2M0N A;  3B0X A;  5AKL A;  5DBA A;  5KFM A;  1Z1V A;  8ICF A;  5ALN A;  5KFI A;  1S0O A;  1F5S A;  3OHB A;  4C4R A;  4IR1 A;  4ED3 A;  4F2S A;  1IM4 A;  4J9K A;  2AU0 A;  5KFD A;  4P4P A;  1DOQ A;  3Q8L A;  1RQL A;  2JH1 A;  3LVV A;  2JHD A;  3UMG A;  3RJJ A;  4UW9 A;  3UXO A;  3MGH A;  3CRX A;  4PL2 A;  5KFX A;  5KFJ A;  2M9N A;  2FPK A;  3ONN A;  5KFT A;  2CPR A;  4M0A A;  5ALS A;  3H4D A;  5KT7 A;  1N63 A;  2R18 A;  2XC9 A;  4RNM A;  2WF8 A;  4O3P A;  1NK5 A;  5J2K A;  2BR0 A;  7ICM A;  1ZD4 A;  3QU9 A;  2EZX A;  3MR2 A;  1PVQ A;  5D46 A;  3QU4 A;  4F4X A;  4QZC A;  1RQN A;  3N7S C;  5IIK A;  5IIO A;  3LWM A;  5CHG A;  1L3U A;  2ZIX B;  3C5F A;  4BDP A;  3V6H A;  4ECQ A;  1BPD A;  1A77 A;  1ZQH A;  8ICY A;  3AM9 A;  1ZQO A;  4Y2Y A;  1MSW D;  3L4P A;  5FP0 A;  4ZOH C;  3TQ1 A;  4PGQ A;  4HAI A;  4UAS A;  1L5U A;  5J0S A;  3RBD A;  3WK6 A;  1ZJM A;  1UT5 A;  3M8R A;  3LVW A;  3L3F X;  2BCR A;  4FFD A;  4CCH A;  1TK8 A;  4UB6 U;  3QUB A;  1TFR A;  4EBD A;  2XGP A;  1Y88 A;  1C7Y A;  4BX9 C;  3V7K A;  4HYK A;  2NRW A;  3IN5 A;  2EZZ A;  4C8L A;  2QB0 A;  3ISC A;  2OM6 A;  2J6U A;  4QWD A;  2YY6 A;  4MFA A;  4PZN A;  5ALK A;  5K4L A;  4I29 A;  1RDF A;  3RRH A;  5AK3 A;  2KE7 A;  4PHP A;  1ZQN A;  4O3R A;  5ALF A;  2HVH A;  1BNP A;  2W03 A;  1QH9 A;  3WK5 A;  3PSF A;  3UMB A;  7ICR A;  1VLB A;  3IM1 A;  5AK4 A;  4MF8 A;  4C4T A;  3MBY A;  1NK8 A;  3K1Z A;  4YR3 A;  2RQ5 A;  8ICE A;  4J9P A;  3GV5 B;  2HHQ A;  4O9M A;  3IP4 B;  1N48 A;  2ZIW A;  3IRU A;  2AGP A;  4Z6F A;  4UB8 U;  4UBB A;  1SKR A;  2ZTC A;  3FC4 A;  3RB4 A;  5CJ7 A;  3NGD A;  4CE6 A;  3E2E A;  8ICK A;  4UB2 A;  3UPQ A;  2KZM A;  3MR6 A;  4TUP A;  1CUK A;  4K4I A;  2ZXH A;  9ICS A;  4RQ4 A;  3QU2 A;  1RYU A;  8ICC A;  4DOB A;  5DGB A;  2JR5 A;  3BQT A;  4YMM A;  5D49 A;  5IIJ A;  2P35 A;  1H38 A;  5DDY A;  4J9O A;  4M47 A;  2WF9 A;  2PMZ F;  5H2F U;  1V97 A;  4KLG A;  3PNC A;  4PPX A;  4YXJ A;  1HEK A;  3QUC A;  4R66 A;  3SD7 A;  2ALZ A;  4DFK A;  7ICE A;  4QZG A;  4RZR A;  8ICV A;  3OJU A;  1U9L A;  3QZ7 A;  2HVI A;  4R63 A;  1RXW A;  5TIS U;  5ALO A;  1ZQZ A;  5KNI A;  2MUT B;  2ES6 A;  3ICX A;  3NVY A;  8ICP A;  3TAD A;  5DG7 A;  1B4F A;  2ZXI A;  2AXT U;  1U49 A;  7ICQ A;  1T4G A;  2MSN A;  3OHA A;  3V6K A;  2V9W A;  8ICS A;  2KIW A;  4GC7 A;  3E58 A;  5L1K A;  1JN3 A;  2ZIV B;  4KLJ A;  4Q44 A;  2BDU A;  4B9T A;  4F4K A;  1NKE A;  5F9N A;  4NL9 A;  8ICR A;  1M6Y A;  1IXR A;  4YMN A;  3Q8K A;  1ED1 A;  1Q3U A;  4FO6 A;  4KX5 A;  4EZ9 A;  4NM1 A;  1SKS A;  3D2S A;  3I1Y A;  4RQ3 A;  4IQT A;  2B0C A;  1U45 A;  2DF4 B;  4ECZ A;  4R65 A;  5DLF A;  5KFS A;  5IIL A;  3AQF A;  3H4B A;  3KKA A;  3PX4 A;  4RNO A;  4Y2V A;  5BPC A;  2PFQ A;  1ZD5 A;  2LI6 A;  1QTM A;  4OJO A;  3WK9 A;  4RQ8 A;  2KZ3 A;  4PHD A;  3NS1 A;  2ASJ A;  2KKV A;  4YR2 A;  3BQ2 A;  2CN1 A;  2DFL A;  4IC9 A;  5AI0 A;  4Y2J A;  4QIW C;  3RB6 A;  3V7J A;  3HIL A;  2A19 A;  8ICU A;  5KFV A;  3EW9 A;  2ZTD A;  1SGG A;  4KLD A;  2PI4 A;  3E0F A;  1EXN A;  5ALG A;  2C28 A;  5EE3 A;  5AI5 A;  1TAU A;  2K8C B;  4XUS A;  4OJL A;  5AKI A;  1Z1B A;  4PL1 A;  1YZ6 A;  2W9C B;  2XO7 A;  4RU9 A;  2RDI A;  4DOC A;  4QWB A;  4QZB A;  1U48 A;  5AHX A;  4MEY A;  4IQW A;  2F1I A;  3M1Y A;  1SV0 A;  5KFW A;  1NK7 A;  4QZE A;  2YMP A;  5KFZ A;  1X9S A;  3NRZ A;  2R8K A;  9ICL A;  4GC6 A;  3WKA A;  3HW8 A;  4DFD A;  5J2J A;  3RAX A;  4RT3 A;  4QWA A;  4FS1 A;  3LYS A;  1NK0 A;  3WK7 A;  4ECY A;  3M9O B;  3H8S A;  3AU6 A;  5KG5 A;  4DL3 A;  5J29 A;  4DSL A;  4UB1 A;  1S9F A;  2WAQ F;  1K5O A;  3RAQ A;  2YN4 A;  2H3I A;  1JI7 A;  5J2H A;  2LBO A;  2CXY A;  4DSF A;  1BVS A;  5J2B A;  1DK3 A;  1ZQQ A;  4I2I A;  3SAF A;  4OD0 A;  3OTQ A;  2FMQ A;  4DQI A;  3QU5 A;  1NZB A;  2AHO B;  3M9M B;  5KFK A;  3KFU F;  1J97 A;  2E8N A;  2FMS A;  4RQM A;  2QAR B;  2H5X A;  3PO5 A;  2HOQ A;  3MDC A;  5G5G A;  2J6S A;  4F4Z A;  2BZF A;  3C5G A;  2BCQ A;  5J0U A;  2Y0S C;  4C4S A;  3F2C A;  4RUC A;  3N97 B;  3ISD A;  3HRD D;  1C20 A;  4FBU A;  5ALE A;  3RB3 A;  4J9L A;  1NJY A;  9ICG A;  1URJ A;  4I27 A;  2MA1 A;  7ICN A;  3BJY A;  3AL0 B;  2BCV A;  3VCB A;  4MFF A;  1CRX A;  5DBB A;  2KJ5 A;  2DGZ A;  5EE0 A;  1S77 D;  1F44 A;  4CF5 A;  2PKE A;  4C80 A;  4I28 A;  4DL5 A;  1TVA A;  4EYI B;  4BJQ A;  1ZQK A;  5DQI A;  4DQP A;  4IRK A;  1FIQ A;  5TZV A;  5L9X A;  5HHI A;  5DDM A;  3U26 A;  3RR7 A;  3CP8 A;  5KFH A;  2ZTE A;  1ZJN A;  2K89 A;  4EX6 A;  2D8C A;  1XSP A;  5DB6 A;  4DEZ A;  3K4G A;  4XRH A;  3SAG A;  4NLN A;  4I2B A;  4C0Z A;  5AIB A;  3RF9 A;  3PW5 A;  1LKY A;  4UBC A;  5L1I A;  4FBT A;  2W9B B;  2VA3 A;  1COK A;  4AP9 A;  3MR3 A;  4QZA A;  5ALD A;  5AKK A;  4GIB A;  1QSL A;  2F8L A;  5ALR A;  5AM4 A;  4NM2 A;  4O5K A;  5J0Q A;  3QUQ A;  1Z4N A;  1MN8 A;  5KFU A;  3LWL A;  3G6Y A;  2KVS A;  3KZI U;  4KLL A;  3D2N A;  4F4Y A;  4EX7 A;  2V4Q A;  1ZQG A;  3TI0 A;  3BS5 A;  4US8 A;  1NOM A;  3ZD9 A;  5DB7 A;  1T7P A;  4DQR A;  4FZM A;  5J0W A;  4M6W B;  2F2A B;  5AKH A;  2BPG A;  4UAV A;  2I9G A;  1UT8 A;  3Q8Q B;  4NV0 A;  3SMV A;  4F5O A;  3KHR A;  1S5L U;  3PV8 A;  2IA6 A;  1UA0 A;  4P0Q B;  1QSY A;  3PW7 A;  3A0H U;  4ED8 A;  3H0M B;  1ZD3 A;  1X40 A;  2HBM A;  4F2R A;  2HBK A;  1ZQM A;  2C2D A;  4F93 B;  1T8E A;  3IHQ B;  3MC1 A;  3BQ7 A;  4RPX A;  2BCS A;  4JB3 A;  5DQH A;  2I1Q A;  1X9M A;  5ALT A;  4C8N A;  2W7P A;  3H7I A;  9ICT A;  4Z6C A;  3R9K A;  4QIW F;  3KBB A;  4AYB C;  1P7D A;  2IMW P;  4YCX A;  2PFP A;  2EZY A;  1B43 A;  3MR5 A;  5KG4 A;  2ASL A;  1KBU A;  1CI4 A;  2WTF A;  2YB1 A;  5KFF A;  3VC8 A;  5JUM A;  2DBY A;  2YQE A;  3SQI A;  1ZQA A;  2VA8 A;  2F3N A;  1ZQY A;  2WF7 A;  4RNN A;  5KFR A;  7ICS A;  2LKY A;  3KHL A;  4YG2 A;  5EWE A;  1BPE A;  1XC9 A;  4B9V A;  4IRC A;  5E79 U;  5J2C A;  2XI9 A;  3PX6 A;  3RJE A;  3T3F A;  2UVW A;  1JUD A;  5J0T A;  4JV1 A;  5L1M A;  1VJ5 A;  1LB2 B;  2KD1 A;  2W55 A;  1S0N A;  3GIK A;  1Z00 B;  8ICA A;  1DXS A;  3UQ0 A;  2A1J A;  5BOM A;  4RT2 A;  4UAR A;  7ICU A;  4XA5 A;  1DGJ A;  2W43 A;  4Q8F A;  4F91 B;  2IHM A;  4YD1 A;  3PST A;  2NO4 A;  2R8J A;  1S8O A;  1X2I A;  3SV3 A;  5KG7 A;  2NYV A;  2VJ4 A;  4ACO A;  4NJ8 A;  3OSP A;  5L1L A;  4Q45 A;  4IRD A;  4GXJ A;  2HMX A;  5CWR A;  3QZ8 A;  1S97 A;  5CRX A;  2IOF A;  8ICL A;  5AM2 A;  5JU5 A;  2JGA A;  4C7Z A;  3JPQ A;  2E1F A;  1ZQW A;  4R8U A;  5HR6 A;  2YMQ A;  7ICI A;  9ICM A;  2RLT A;  4Y2Q A;  1JMS A;  3PZP A;  4US9 A;  4RQ1 A;  4B9N A;  2WAQ C;  3M6K A;  4Y2T A;  1SKW A;  1KW4 A;  3GZF A;  1DK2 A;  2BHN A;  4P0P A;  2ESE A;  2XCA A;  2L5Y A;  5F3X B;  2KP7 A;  3B0Y A;  5ALW A;  2A3V A;  1TAQ A;  3C2M A;  2Y0S F;  1PVP A;  1KFT A;  1WUD A;  5J0X A;  2K8A A;  1QQ5 A;  1NZP A;  3SI8 A;  4ECR A;  3K1R B;  4YP3 A;  5DGA A;  5J0R A;  3OPX A;  4B9L A;  4KMO B;  2FLN A;  4PH5 A;  2PFN A;  1N5X A;  5AK5 A;  2ZIU B;  1WG8 A;  4RUA A;  9ICK A;  3AQE A;  5J2E A;  5KFE A;  4DL6 A;  3RFA A;  5A0L A;  9ICR A;  3ETL A;  4DS4 A;  2QKQ A;  3T79 A;  5AK6 A;  4F5P A;  3RJH A;  1PVR A;  3WKD A;  5AKJ A;  1SV0 C;  9ICN A;  2NV3 A;  2R8G A;  1WCN A;  2WFA A;  3QXG A;  2KOB A;  5T14 A;  3WKC A;  4C8O A;  4C8M A;  7ICH A;  1SXE A;  1QLN A;  2H3F A;  3H8J A;  4ZH4 A;  3V72 A;  1SL2 A;  2G5H B;  3Q8M A;  5ALH A;  2G0A A;  3D6J A;  3NAS A;  1TK0 A;  5GTH U;  5J2I A;  8ICW A;  2Y1J A;  1NJW A;  3PW2 A;  1D8L A;  2EDU A;  3FM9 A;  4ED6 A;  2G07 A;  1Q3V A;  2P66 A;  1D8B A;  1ZQS A;  1XO1 A;  4XQ8 A;  2HHW A;  5DLG A;  4JMU A;  1FFV A;  3TFR A;  2JEJ A;  1XU4 A;  1UHU A;  2KJ9 A;  1O08 A;  4UAZ A;  4KLE A;  2RP5 A;  4DCC A;  4U7C A;  2KMD A;  2LYA A;  2CRX A;  3UXP A;  1LV5 A;  2E3T A;  4KN4 A;  4E0D A;  2VKQ A;  3QX7 A;  4BWJ A;  1PK1 A;  2JRZ A;  3NUQ A;  2XIC A;  5AI9 A;  3F5E A;  3HT3 A;  3C1Z A;  2E1E A;  4DL2 A;  3WKE A;  1BGX T;  2PI5 A;  5KL1 B;  4I2C A;  4CGZ A;  2HHS A;  3NVV A;  2KKP A;  3PR4 A;  4B9U A;  4B9S A;  2IOF K;  4ED0 A;  2VIX A;  4QWE A;  4DL4 A;  8ICB A;  4EEN A;  4KLF A;  4YR0 A;  1XWL A;  9ICJ A;  5KT5 A;  3HWT A;  1X9X A;  2B21 A;  5CEH A;  3QEA Z;  3EWA A;  4JWN A;  1KLN A;  1XNS A;  3WK8 A;  4QZ8 A;  3Q8P B;  1J2M A;  3ZDA A;  3GIM A;  3BZC A;  5AI4 A;  5J8Y A;  5KAI U;  2AQ0 A;  3MDA A;  3BQ1 A;  3PY8 A;  1JIH A;  1S76 D;  4WJ3 B;  1RPL A;  1KTQ A;  3GFK B;  4NY8 A;  4PJ0 U;  1KQQ A;  3HX0 A;  2HHX A;  2LYH A;  1L3V A;  3EZ5 A;  2FPL A;  4JV0 A;  4AYB F;  2JXJ A;  2QB0 B;  3NTU A;  2ZUD A;  2RDJ A;  3L5K A;  1ZQP A;  3F2B A;  2UVU A;  2OH2 A;  1MA7 A;  1WWU A;  4DFM A;  1FO4 A;  4F92 B;  2KSO A;  2HBL A;  5AM0 A;  4IL6 U;  5ALP A;  3PX0 A;  4RPY A;  4CF4 A;  2HOF A;  3I76 A;  2EQY A;  2LPE A;  3ED5 A;  1ZRN A;  1MQ3 A;  5J0O A;  1BPB A;  2ZIW B;  2JV3 A;  3QNM A;  2G5I B;  3SYZ A;  5KG3 A;  2R8I A;  2W04 A;  4G9B A;  5CA7 A;  5AKE A;  2UVV A;  4QW8 A;  4NXZ A;  2AQ4 A;  2DUY A;  2JH7 A;  4ELU A;  7ICL A;  4FS2 A;  1SL0 A;  3MFH A;  2JZB A;  3RBE A;  1T3Q A;  5J0Y A;  2E5S A;  1K1S A;  2D6F C;  4BXO A;  3GQC A;  2LYB A;  4GXK A;  4NLG A;  1BPX A;  3M9N B;  4DFJ A;  2JEF A;  2WF6 A;  1SWW A;  4B9M A;  1X66 A;  9ICP A;  2XCP A;  5EOZ A;  3IDW A;  2W7O A;  2GO7 A;  2KEY A;  4BUG A;  1UQV A;  3QUT A;  3HPO A;  3G6V A;  2C2R A;  5ALX A;  2WHE A;  1JX4 A;  2DWQ A;  1ZYQ A;  3PSI A;  9ICQ A;  3N7R C;  2EH9 A;  1GO3 F;  4I2H A;  4F71 A;  2KTQ A;  1ZQL A;  3QEB Z;  3SEI A;  4QZI A;  5AKY A;  2F77 X;  2K4I A;  3KHH A;  5DG8 A;  2XY7 A;  4I2D A;  5G5H A;  1NJX A;  3UMC A;  1PZN A;  1SV4 A;  3ZD8 A;  1ZQB A;  2RHF A;  5KL8 B;  5AKX A;  3JPT A;  1UPH A;  3TAC B;  4TQR A;  3B9J A;  4F5Q A;  2HSZ A;  3C29 A;  3MGI A;  4TUS A;  3NRW A;  2P6U A;  4KLT A;  2KN7 A;  4TQS A;  4IR9 A;  2HHV A;  3KTQ A;  3TAQ A;  1B22 A;  3ZDD A;  3AEV A;  4JWM A;  2HBJ A;  4ECX A;  3FAH A;  4LVS A;  5J2G A;  1UA1 A;  8ICJ A;  3SZ2 A;  5IIN A;  4YD2 A;  4PZO A;  2BDP A;  4F3O A;  3NVZ A;  3C2L A;  2Y9T A;  4K4H A;  2OCE A;  5AIA A;  1NK9 A;  2ISO A;  2ATL A;  2E8O A;  3EPG A;  3AN1 A;  2JEI A;  4KLI A;  4CRX A;  5KT4 A;  4F72 A;  4DLG A;  3M7D A;  5AIC A;  2BGW A;  3SAH A;  4DSE A;  4GLX A;  5ALQ A;  2W9A A;  2AJQ A;  2A1A A;  1ZQX A;  1A76 A;  1WWV A;  5KFO A;  5KG2 A;  1ZQV A;  2XVT A;  3H8M A;  7ICG A;  5ALU A;  1FFU A;  4DQS A;  2QLT A;  3M6Z A;  5IIM A;  3PW0 A;  3PSP A;  2AGQ A;  3H0L B;  9ICW A;  5KT3 A;  3DEE A;  3PMN A;  3IG8 A;  4EEK A;  3BQ0 A;  3JPN A;  1SZP A;  3TKA A;  1NK6 A;  1S0V A;  2K4H A;  3S6J A;  4PHA A;  4DSJ A;  2DQN B;  1ECW A;  5EE1 A;  1L6N A;  5KTQ A;  2PFO A;  1KRP A;  1B0X A;  3HJE A;  8ICH A;  5AI6 A;  2BCU A;  4IQV A;  1OW5 A;  1JAL A;  3WU2 U;  5KFL A;  4PGX A;  1JRP A;  4JUZ A;  2ZIX A;  2WB1 F;  4P4O A;  4MHV A;  4C7Y A;  3GV7 B;  2H3Z A;  4ECU A;  2OYY A;  4UB5 A;  4J9Q A;  3KHG A;  1JXL A;  4I2A A;  2KIV A;  2VAN A;  4DF4 A;  5KG0 A;  2NRZ A;  4Z6E A;  2BQR A;  4O3M A;  1NKC A;  3H40 A;  4KX3 A;  3GU3 A;  3PW4 A;  1KN5 A;  1MC8 A;  5KFG A;  8ICO A;  3C2K A;  2H3Q A;  2HHT A;  5ALJ A;  2F44 A;  5AM5 A;  3RH6 A;  3DV9 A;  1ZQ1 C;  2KJ8 A;  1MQ2 A;  4UQG A;  3GIJ A;  2KHQ A;  3AU2 A;  2WF5 A;  3N28 A;  4DSK A;  5ALL A;  4C8K A;  1YT3 A;  4X5V A;  5JTI A;  2KZZ A;  4EYH B;  3QU7 A;  2KFN A;  2KNJ A;  4YVZ A;  1VDV A;  2F1H A;  3UQ2 A;  3CW2 C;  4F5N A;  3F2D A;  1U47 A;  1ZQJ A;  1N60 A;  1ZD2 P;  1KDH A;  2EAP A;  5KFY A;  1L7N A;  2KHV A;  4J9M A;  2I5H A;  3GDX A;  3HKZ F;  4KTQ A;  2O6K A;  3PR5 B;  1BNO A;  3MGV A;  3EUB 2;  3ZDC A;  2FMP A;  4CDG A;  4PGY A;  4GFJ A;  4EBC A;  2W8K A;  3AUO A;  9ICE A;  4CNQ A;  3TAD C;  2HCF A;  2ZG6 A;  5BOL A;  1K1Q A;  5DBC A;  2D3D A;  2W54 A;  2FJ6 A;  1YZ7 A;  3C1Y A;  3TAP A;  3BS7 A;  4MF2 A;  1S10 A;  2YTU A;  3BDP A;  2R8H A;  1KSP A;  1QSS A;  5L1J A;  4F8R A;  2YML A;  3KZX A;  3WKB A;  4FE3 A;  4M9J A;  1LKY B;  4NL9 C;  3ZDB A;  5KAF U;  5F9L A;  1ARO P;  5CR0 A;  3T5L A;  3QE9 Y;  4DLE A;  4YXM A;  5J8Y C;  3LDA A;  4ELT A;  2VA2 A;  1Q46 A;  4UB3 A;  3PML A;  2UVR A;  4KLO A;  2VJ5 A;  2YMM A;  1A0P A;  3EYZ A;  2MUT A;  2XY6 A;  4M2Y A;  1TAM A;  5AKG A;  4DF8 A;  3OJS A;  2HI0 A;  1SWV A;  2ASD A;  1RXV A;  3KKA C;  3HP6 A;  4F4W A;  3AMZ A;  3SR6 A;  3BS5 B;  2ODG A;  8ICX A;  2KK0 A;  2ZIV A;  1HUZ A;  4RQ2 A;  1NKB A;  2FLL A;  4F5R A; 
#chains in the Genus database with same CATH homology
 3F2D A;  2JMG A;  1HIW A;  3AQE A;  2YB4 A;  2Q4T A;  3AQF A;  3SAF A;  3RFA A;  2Z7J A;  2XI9 A;  1Z19 A;  3PSI A;  5A0L A;  3M6Z A;  1XNS A;  2ZXH A;  2N1R A;  2KHV A;  3N7S C;  3N7R C;  1NZB A;  2GOL A;  1T94 A;  3PSP A;  3H0L B;  4OJO A;  3T79 A;  1GO3 F;  3DEE A;  3KFU F;  3IG8 A;  2KD1 A;  4AYB C;  5C0Y A;  2ZIX B;  1PVR A;  3HKZ F;  2F77 X;  4NLB A;  2K4I A;  2KKV A;  2NV3 A;  2PMZ F;  4WJ3 B;  2WB1 C;  1SZH A;  2KVC A;  2CN1 A;  3D2N A;  1IIP A;  4IC9 A;  3O0F A;  4OJ6 A;  2KOB A;  3MGV A;  4QIW C;  5T14 A;  2HOI A;  1A6S A;  2K4H A;  2HOQ A;  3F5A A;  2DQN B;  2ZIU A;  1ECW A;  1HEK A;  2H3F A;  2RHF A;  5KL8 B;  4CDG A;  1UPH A;  4FZM A;  1L6N A;  3PST A;  2KV2 A;  2Y0S C;  4GFJ A;  2G5H B;  2G09 A;  2YX8 A;  2F2A B;  4AYB F;  3E0F A;  3F2C A;  2GH1 A;  2G0A A;  3C29 A;  3NRW A;  2VJ4 A;  2ZG6 A;  4A8E A;  4ACO A;  2K8C B;  3F2B A;  4NV0 A;  2OH2 A;  3SMV A;  2HMX A;  4OJL A;  4P0P B;  3LVW A;  1MA7 A;  3L3F X;  2H3V A;  4FZL A;  1DRG A;  2G07 A;  2ZIX A;  2WB1 F;  5CRX A;  2G08 A;  2HBL A;  1URJ A;  1Q3V A;  2M0N A;  1Z1B A;  4P0Q B;  2JGA A;  4PL1 A;  2MA1 A;  2H3Z A;  1D8B A;  2OYY A;  2HOF A;  2E1F A;  2MRL A;  3ICX A;  3AL0 B;  2HBJ A;  2K4E A;  4JMU A;  3H0M B;  5HR6 A;  2F76 X;  4ICA A;  3VCB A;  4BX9 C;  2KJ9 A;  1CRX A;  2HBM A;  3IN5 A;  2HBK A;  3C28 A;  2ZXI A;  2RP5 A;  2KJ5 A;  3KZX A;  1OUQ A;  4FE3 A;  2DGZ A;  4U7C A;  4O3M A;  2ZIW B;  3PZP A;  3IG5 A;  2OM6 A;  4KX3 A;  1F44 A;  2LYA A;  2G5I B;  2RRD A;  3GU3 A;  2CRX A;  2JH1 A;  4QJF B;  3LVV A;  2JHD A;  2WAQ C;  1P7D A;  4BJQ A;  2OXO A;  4U6P A;  3M6K A;  5HR7 A;  2W04 A;  2VKQ A;  3GZF A;  4OO1 J;  2KIW A;  2PMZ C;  3CRX A;  4PL2 A;  2W03 A;  4OJ5 A;  4P0P A;  2ZIV B;  3PSF A;  2H3Q A;  4NLC A;  2JH7 A;  2BDU A;  3N7P D;  2XIC A;  2G06 A;  3NUQ A;  2W7P A;  2XID A;  4QIW F;  3CP8 A;  3F5E A;  2VJ5 A;  4P0Q A;  2KJ8 A;  1ZQ1 C;  2E1E A;  1A0P A;  2K89 A;  2A3V A;  3ONN A;  3CYM A;  2LHT A;  2CPR A;  1TAM A;  3K1Z A;  3LYS A;  4OJP A;  2KHQ A;  4QNL A;  5KL1 B;  2E5S A;  4CRX A;  4CGZ A;  2Y0S F;  1PVP A;  4FZN A;  2KKP A;  3SAG A;  2D6F C;  1WUD A;  2LYB A;  2K8A A;  3M7D A;  2R18 A;  1ED1 A;  4C0Z A;  3IP4 B;  1Q3U A;  3RF9 A;  3SAH A;  2ZIW A;  2VIX A;  3ALR A;  1KBU A;  3F53 A;  2WAQ F;  4KX5 A;  2YB1 A;  2KIC A;  1YT3 A;  3VC8 A;  1XO0 A;  3HKZ C;  3H0R B;  3OPX A;  2W7O A;  3D2S A;  2KEY A;  3SQI A;  2H3I A;  4BUG A;  4KMO B;  3D2Q A;  2LBO A;  2KNJ A;  2DF4 B;  2ZIV A;  2ZIU B;  2F8L A;  1PVQ A;  2LKY A;  4NWI A;  2K8B B;  2XVT A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...