3WU2U

Crystal structure analysis of photosystem ii complex
Total Genus 32
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
32
sequence length
97
structure length
97
Chain Sequence
ELVNVVDEKLGTAYGEKIDLNNTNIAAFIQYRGLYPTLAKLIVKNAPYESVEDVLNIPGLTERQKQILRENLEHFTVTEVETALVEGGDRYNNGLYK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Electron transport, photosynthesis
molecule keywords Photosystem Q(B) protein
publication title Crystal structure of oxygen-evolving photosystem II at a resolution of 1.9 A
pubmed doi rcsb
total genus 32
structure length 97
sequence length 97
chains with identical sequence u
ec nomenclature
pdb deposition date 2014-04-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
U PF06514 PsbU Photosystem II 12 kDa extrinsic protein (PsbU)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.320 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 Photosystem II 12 kDa extrinsic protein 3wu2U01
5GTIU 5TISU 5B66U 4UB8U 5B5EU 5KAFU 3KZIU 4IL6U 5E79U 5KAIU 4UB6U 3A0BU 5H2FU 1S5LU 5GTHU 4PJ0U 2AXTU 2DUYA 3WU2U 3A0HU
chains in the Genus database with same CATH superfamily
4KLEA 1K1SA 3C23A 4OJOA 5AI9A 2Y0SC 3HT3A 7ICIA 3GZFA 1KRPA 5KFTA 4PL2A 2WTFA 2YMQA 1X9WA 3PSIA 1MSWD 9ICUA 1RDFA 4R65A 3H0RB 3OGUA 2XIDA 3PSTA 4CF3A 2VJ4A 4J9OA 5A0LA 5F3XB 8ICYA 4F50A 5AIAA 4EX6A 4F2SA 4K4HA 3RF9A 1QSSA 5AKXA 1T94A 4J03A 3TADA 5AM5A 7ICNA 4IRKA 2HBMA 3GFKB 1DGSA 2ASJA 5T14A 3PR4A 1N62A 5AI5A 2BDPA 3FYHA 2E5SA 4DSJA 2W9CA 2AH5A 4QZIA 5J0TA 2JHDA 4BJQA 1HEKA 2EZYA 2KD1A 5KG2A 1N2XA 4PHEA 4R8UA 4B9TA 5KFLA 4QWCA 2HHVA 1NJYA 5J2JA 3N97B 2CPRA 3QU4A 4PPXA 1JALA 4UB5A 2DL0A 1BPDA 5IIIA 3T5LA 9ICEA 3QE9Y 4KLHA 4CF5A 4F4YA 3PW7A 1PK1A 2KSOA 1RYRA 4NM1A 1KEJA 3KKAC 7ICQA 1SKSA 4ECRA 3ISDA 1NKCA 4NY8A 4MF8A 1UA0A 5ALFA 4QZ8A 4QIWC 3EZ5A 1JMSA 4ED8A 2EZXA 2JGAA 4U6PA 2BR0A 2W8KA 3KZIU 2EQYA 3RJKA 2ZJ5A 5AICA 2EAOA 3QU2A 4KITB 5J2GA 1N63A 1ZRMA 2HDOA 3U26A 4YD1A 2FJ6A 2PFPA 2AJQA 4BXOA 5ALTA 4HYKA 2ZIXA 4QZBA 2H3ZA 5AM0A 1COOA 2K4IA 7ICEA 2WF7A 4RZRA 2XY6A 1WWVA 3BJYA 2G5HB 5AIBA 5KFEA 2RHFA 1FFUA 2HOQA 3N4MB 2I9GA 4M9LA 4RU9A 4R64A 5ALVA 4Q8EA 4QW8A 3C1ZA 4PZOA 1X6IA 2AGQA 1ZQLA 1ZQ1C 1ZYQA 1VJ5A 1X9MA 1L5UA 3K4GA 1XNSA 4FZNA 2E8MA 2ZJ8A 2EAMA 4UAVA 2A1JB 4PZNA 4EBCA 5IIJA 7ICJA 5KFIA 2QARB 4J9QA 3AN1A 3WKDA 4CDGA 2OWOA 2EDUA 1RQNA 1UPHA 3G6XA 1RXWA 4MF2A 1S97A 3UM9A 2P66A 1ZQHA 3CNHA 2KVSA 4CE6A 2KEYA 4DSFA 9ICRA 2GLEA 5KFSA 3M9OB 3OJSA 3MR5A 2G5IB 1B22A 4EZ6A 3DDHA 3BQ0A 3LDAA 4MHVA 2HOIA 3IG8A 5ALGA 1NKBA 5DQIA 3QUCA 4NV0A 3TQ1A 8ICLA 1KKXA 3ETLA 3MGHA 4I29A 1ZQWA 1ZD2P 2H3FA 3L3FX 5ALWA 5JUMA 4F5RA 3SR6A 5J2KA 1JN3A 2AQ4A 2BGWA 5AKEA 1L7MA 4YN4A 8ICJA 3G6VA 1PVRA 4KLLA 4O0IA 4Y2QA 7ICUA 5AI8A 3C21A 5KFXA 1KQQA 2KHQA 2P35A 1U45A 4R63A 3EUB2 5J2FA 2BHNA 3TKAA 4P4PA 5D4BA 2C22A 1ZQEA 3NVYA 1ZJNA 1ZQRA 2D8CA 3EPGA 5AM3A 2ISOA 1RYSA 1RG6A 3QYPA 2CRXA 3RAXA 2OH2A 2K89A 1A77A 3OHBA 1XWLA 3RRHA 1X9XA 4M6WB 5ALEA 2FLLA 2JMGA 3V7LA 4CGZA 4DFMA 2VKQA 3UPQA 3TFRA 1OXJA 2LI6A 3PX4A 2RQ5A 5BOLA 3C2MA 2F1HA 5ALYA 4Y2TA 8ICOA 3F2CA 4KLUA 5J2DA 1NKEA 2IBKA 5GTIU 2XC9A 4MEXA 3OJUA 8ICIA 2W04A 3QZ7A 3C2LA 4DLGA 1ZQIA 4F4WA 2K8BB 4PGQA 3LYSA 8ICAA 2ZJAA 3D6JA 3F5AA 2JRZA 2VIXA 4QNLA 2Q0ZX 5KFQA 4QWEA 5EE3A 1A0PA 3MR6A 8ICUA 5CR0A 3F2DA 4C8KA 1KL9A 4B9LA 3V7JA 1QLNA 4LZDA 2WF6A 3PO5A 1DRGA 3H8WA 4EX7A 8ICRA 3NTUA 4Q45A 3IN5A 1SV4A 4DO9A 4X5VA 4RPXA 3IRUA 3ONNA 4EELA 3C1YA 5KG4A 2KHVA 5ALDA 2DQNB 4QZ9A 3IV6A 3SAHA 2LHTA 4MEYA 4RNNA 1QSLA 3H0LB 2FLPA 4NLGA 5KT3A 3ORYA 5ALLA 2F1IA 3SI8A 1PVQA 3KHHA 2VJ5A 3R9KA 3NVZA 1X40A 8ICEA 4KLMA 5J8YC 4RQ7A 1IIPA 3SD7A 2KV2A 3KZXA 3C5FA 3V6KA 2R8KA 1L3SA 5IIOA 1PK3A 1SV0C 3QZ8A 1HUOA 4P0PB 4P0QA 1P7DA 5C5JA 1X42A 3MFHA 5ALQA 2VA2A 4O5EA 1F0MA 5EE0A 1B0XA 4RPZA 3THVA 2A1AA 2QKQA 1X6JA 5J0WA 4KLIA 1PK1B 4UBBA 1NOMA 3JPOA 4ELUA 5KFUA 3RRGA 5C0YA 2GOLA 3RR7A 2MUTB 4CNQA 2LPEA 2AGOA 8ICTA 4UAZA 4F4XA 3SYZA 1ZQZA 5J0SA 1WG8A 3HX0A 1TAUA 1NK8A 3C2KA 5ALRA 3T5JA 2UVRA 3AQFA 5ALOA 1ZQJA 9ICPA 5JTIA 1SXEA 4DQQA 3NGDA 2NO5A 3B9JA 2NRXA 3A0HU 8ICCA 3MGIA 1C20A 5CEHA 3JPNA 3LWMA 2KJ9A 1CI4A 5KT5A 1D9DA 2W3SA 2KZ3A 1BVSA 1YT3A 5ALIA 1QCKA 4GXJA 3RJFA 2W11A 3I1YA 4UB4A 3QEBZ 1K1QA 2JEFA 4IS7A 3M1YA 8ICNA 4KLQA 4UB1A 4KMUA 5J2CA 3UXNA 3V6JA 1MN8A 4JV0A 5DG7A 3FC4A 1NK0A 4RUCA 1S8OA 4C8MA 3VC8A 4KX5A 1JUDA 2FLNA 1UCVA 4ECQA 8ICHA 1X66A 2W54A 3PO4A 5CB1A 5J0OA 2BCRA 1K5OA 2L5YA 4LZGA 1LKYB 2KVCA 4EEKA 1MQ3A 3DEEA 5DDYA 3PW5A 3UXPA 2ZIWA 5KFKA 4Y2XA 3SQIA 3AQEA 1RXVA 1HUZA 4YR0A 1GO3F 5KAFU 2HOFA 3E2EA 4QZCA 1KTQA 4F5PA 2IOFA 4NLZA 1S0MA 1QTMA 2V9WA 1KSPA 2LM1A 1L7PA 3A0BU 4F4ZA 3FAHA 3IP4B 2XGPA 5J8YA 4QZAA 2HBKA 1A6SA 1A76A 4BWJA 9ICOA 4DQPA 3RB4A 1D8LA 4F5OA 2ASLA 7ICMA 4EYIB 5DQHA 4B9VA 2H3IA 1U47A 2W9MA 3ZDBA 3RH6A 3S6JA 4NWIA 4Y2VA 2ATLA 3LVWA 3T3FA 4J9LA 3ZDAA 4DOBA 2XCPA 1SL1A 4ED0A 2K8AA 5CRXA 2HCFA 3BQTA 3RJEA 3AMZA 3HRDD 2K4EA 4CF4A 2DUYA 2IHNA 3GQCA 4OJPA 3T5HA 9ICIA 4Y2UA 9ICSA 3ZDEA 3EWAA 5EWFA 2VANA 4DL6A 2UVVA 2JEGA 3QX7A 4YQWA 2XY7A 3M9NB 5EE9A 3M8RA 4YD2A 4EBDA 4IRCA 3H8JA 1U49A 4B9MA 5J2BA 2HVHA 1ZD3A 4DOCA 5KTQA 3KD3A 1ZQAA 2OXOA 1V97A 1ZQMA 2YB4A 3EPIA 4JV2A 1SB3C 1O08A 3K75D 2J6SA 2HI0A 1IV8A 5DLFA 4DS4A 1ZQTA 1SWVA 1SKWA 4NL9A 1OUQA 5J2AA 3WKEA 3UQ2A 2KIWA 2W7PA 1SZHA 2LYAA 1Z1VA 3H8SA 2E1EA 3H0MB 1ZJMA 3M6KA 3ISCA 1N48A 4RQ0A 5AKHA 5KFGA 3RH5A 5GTHU 3C5GA 4US9A 2LBOA 8ICWA 2HHQA 9ICXA 4RQ4A 2F1JA 2ZTEA 5HR7A 4ED3A 3ALRA 3BQ1A 4B6JA 1V38A 3Q8MA 4NLCA 5E79U 4O3NA 2YTUA 4IQUA 2KFNA 5IIKA 2ZIUB 4Q43A 4UW9A 5L1LA 2GO7A 5DGBA 3WKBA 5AKJA 3MR3A 4RNMA 5KG5A 1D8BA 1O03A 5KG0A 3HPOA 3RBDA 5AKKA 5AI6A 5CP2A 1UQVA 4P0QB 1XU4A 3PMLA 2GWSA 1ED1A 1JXLA 4F4KA 4XA5A 1S10A 4P4MA 1N60A 7ICVA 1SWWA 3IM1A 2PMZF 1S76D 3PW4A 3AL0B 2ZIVA 7ICOA 4YVZA 3NVVA 1X2IA 1V9PA 1F5SA 2E1FA 1KLNA 4AP9A 1TVAA 4GXIA 3I28A 3PSFA 4PHAA 1L3UA 4IR9A 1COKA 2AXTU 3QU7A 3QUQA 4QJFB 9ICVA 3SV3A 3G6YA 4FO6A 3N7RC 1D8YA 2IMWP 1BPXA 2AHOB 4NXZA 1URJA 4F5NA 2F44A 2W9BA 3GU3A 9ICLA 1RPLA 5HP4A 1BPZA 3AM9A 1NK5A 4M0AA 4PH5A 3IG5A 3HILA 5KFHA 3BDPA 1H38A 2WF5A 2W3RA 3EYZA 1ZQNA 4K4GA 2QB0A 3EW9A 2BPCA 2WAQC 3UXOA 4DQRA 4EBEA 4M9HA 2EANA 2HBLA 2G07A 4MFCA 1XO1A 2Y0SF 3H7IA 2G08A 2PI5A 3UQ0A 3AUOA 4CCHA 1LVHA 1Z4NA 3MGVA 5KFBA 5J0XA 2F8LA 3ISBA 1MC8A 2DBYA 2G09A 4NLBA 4GC7A 1L7NA 2WB1C 2ZTDA 3MFIA 3C28A 1TV9A 4ZH4A 1ZOLA 2JH1A 4P2HA 9ICNA 3GILA 3KKAA 5KG7A 1V85A 3CW2C 4K4IA 5JRTA 4I2IA 5AK5A 2E3TA 5HMMA 5IILA 2YY6A 5HHHA 4YFKA 2BCVA 5AHXA 3RJGA 4O3PA 3WK7A 2FPKA 8ICMA 4QZDA 4DL4A 2IOHA 1JRPA 2ZG6A 1Q46A 3HJEA 2WF8A 2VA3A 5EWGA 4DFDA 4O5CA 1KFSA 2XGQA 4F8RA 2YQEA 2YMLA 2JEJA 3GIJA 5L9XA 5EWEA 4RQ8A 2BPFA 3KHLA 2WFAA 2NO4A 3B0YA 4KX3A 3Q8RB 4ECTA 4RQ1A 2NRTA 1XSLA 2MSNA 4FBUA 3PVXA 2PFOA 3QEAZ 4DFKA 4OJLA 5ALZA 4QIWF 4WJ3B 1UA1A 3AU6A 2PFNA 3H4BA 4QZFA 5G5HA 4TQRA 2B6GA 3FDSA 4UAWA 4Q44A 3GIMA 4YCXA 2KJ5A 4F2RA 5F9NA 1FEZA 2OEHA 3RAQA 2ZTCA 1PVPA 3ZDDA 4PJ0U 1DOQA 1YZ7A 4KN4A 3M9MB 7ICSA 1FIQA 1T3QA 2OYYA 5KL8B 3TFSA 3RBEA 9ICTA 4JMUA 2MU2A 4XRHA 4NJ8A 3V6HA 2Y9TA 3F5EA 3Q8QB 3RJIA 4FBTA 3UMBA 1Q3VA 5AKZA 2NRZA 2W55A 2NRVA 4O3QA 1S5LU 3KHGA 1AROP 4RQ5A 4JWMA 3JPRA 2W9CB 2KZMA 2XO7A 4OCZA 2NV3A 2FI1A 2DPIA 8ICGA 4GLXA 4ED2A 3TAPA 5EOZA 4R8UB 3LWLA 8ICKA 2A19A 2Q4TA 5DB9A 1Q8KA 3RFAA 5KFZA 3BS5A 4QWAA 1C7YA 2BPGA 2JH7A 1XSNA 4KTQA 1NZBA 1ZQVA 2R8IA 5DBCA 2RDIA 3PNCA 1ZQGA 1TAMA 4B9SA 1QH9A 1SL0A 2O6KA 4GIBA 2KSOB 1NK7A 5D49A 2BCQA 2QB1A 4YP3A 1ZXIA 3PZPA 5KT6A 3GV5B 2NRWA 4C7ZA 1NNLA 1SXDA 2OCEA 4DSIA 4TUPA 1AQ6A 5KL1B 3NS1A 5J2HA 3L4PA 3NRWA 2JR5A 1Z1BA 4RT3A 3OTQA 3QXGA 2PXIA 2XI9A 3UMGA 4C0ZA 1WCNA 4OD0A 2AGPA 2A1JA 1VDVA 2YB1A 3E0FA 1NK9A 4BXOB 1DK2A 2I1QA 2MA1A 4B9UA 2ZIXB 1TKDA 4M9JA 3HKZC 5AKIA 3SV4A 4IQVA 3V7KA 4O9MA 2H5XA 4C4RA 1BNPA 3D2NA 1ZQSA 3LK9A 5HHIA 4OJ6A 1SIJA 4I2HA 1KFDA 5KFJA 4DWIA 1Z19A 3ED5A 2ZIVB 2HW3A 4DEZA 4ECSA 3H40A 3PW0A 3Q8SB 4M04A 1PZNA 5AK6A 3JPTA 2F2AB 3QU5A 4ECXA 2EZZA 1IXRA 5ALKA 1KFTA 4DL5A 3AEVA 1NJZA 1U48A 3NASA 4I2GA 3SMVA 2UVUA 3N7PD 4KMOB 4JWNA 1S0VA 4XUSA 1MQ2A 1ZQUA 4RQ6A 1WYGA 2K8CB 4C7YA 3ICXA 9ICQA 1BPBA 1YZ6A 2WF9A 4O3SA 5ALUA 2FPMA 2JZBA 2DFLA 1ZQCA 1Z00A 5L1MA 3PR5B 5DKWA 8ICPA 4UB6U 3BZKA 2KNJA 5CJ7A 1L3TA 1S0OA 3TAQA 2GH1A 2QB0B 5KT4A 2ZUCA 4I2JA 3DV9A 5CA7A 2KTQA 3HW8A 5KFPA 2B0CA 4JUZA 2G0AA 4Y2PA 1ZQBA 3WK9A 1ZQQA 3V72A 2V4QA 3SEIA 5KFRA 2WHEA 1SV0A 2J6TA 5KG6A 3JPQA 4DL2A 7ICFA 2LM4A 3F53A 3HP6A 1UT5A 2BCUA 4IQTA 1ZETA 3BS7A 4IQWA 4YMOA 4Z6DA 2ZUBA 1JROA 1RM6C 4DCCA 4PHDA 3SZ2A 3RJHA 4C8OA 2KP7A 2F3NA 2N1RA 4XQ8A 3GDXA 3Q8PB 4R66A 3CP8A 1LV5A 2QLTA 3Q8KA 4I2DA 2JXJA 2F76X 5KFMA 3MDAA 4J9MA 3MR2A 3MBYA 1TAQA 2W43A 8ICZA 8ICVA 4KN7A 1WWUA 3KOOA 3CRXA 5J29A 4US8A 4Y2SA 4M9NA 4I2EA 1ZQKA 5EE1A 5DGAA 1JI7A 4GXKA 2BDUA 1FO4A 3T5KA 5DG9A 4DQIA 4FS2A 4FZLA 4ELTA 2ZXIA 3PY8A 8ICSA 4G3IA 5KG3A 4DOAA 2ZUDA 5IINA 2UVWA 4RUAA 3BQ2A 4KLJA 4YR2A 4DSKA 5AK3A 2RDJA 3RB6A 7ICLA 2LYHA 2C2RA 2FDRA 4LVSA 5H2FU 2KE7A 4TUSA 5KT7A 2BQRA 9ICGA 2E8PA 3ZD9A 8ICBA 4NLNA 1IG6A 4DF4A 5D46A 5J0RA 1NK4A 3QUTA 5B66U 3SAFA 3WK4A 1J2MA 4F92B 2IA6A 2AQ0A 3PSPA 2YX8A 4P0PA 7ICPA 4AYBC 2ZXHA 2W7OA 4P4OA 2CN1A 2HSZA 3WK5A 2RRDA 4PGYA 4RQ2A 4YMMA 3HKZF 4YR3A 2C2DA 4FS1A 5HNKA 2D3DA 1QSYA 4F71A 2OHFA 2ASDA 5AKGA 3UMCA 4DL3A 1XO0A 1CEZA 4QZGA 4J9NA 5KFCA 1WUDA 4KLFA 1ZQDA 1ZQPA 2MUTA 2MAXA 5KFDA 2RP5A 4UARA 2F8KA 3K1ZA 3WKCA 2EAPA 7ICHA 2K4PA 3ETRA 4EZ9A 2HVIA 9ICWA 4RNOA 5DG8A 5L1KA 1SKRA 2HHUA 2KG5A 9ICJA 7ICGA 3BS5B 4C8NA 1DGJA 3MC1A 5KFYA 4UAYA 3BQ7A 2ES6A 1N56A 2PFQA 4FE3A 3Q8LA 2YMPA 4F5QA 4DFPA 1NJXA 1XC9A 2EH9A 2ALZA 2KMDA 1T8EA 1KW4A 2HBJA 1B43A 4DS5A 5BPCA 1RYUA 5AI4A 4QWDA 5IIMA 4JV1A 5AI0A 1L3VA 2P6RA 3FM9A 3T79A 4TURA 4IC9A 1QQ6A 4M2YA 4LJXA 1S9FA 5KAIU 2BQUA 1NK6A 4PHPA 3OSNA 2F77X 5ALMA 3JPSA 1ECWA 7ICKA 3OHAA 2JEIA 1KBUA 5KFAA 5ALHA 2LMRA 2BZFA 2BKEA 1WCLA 2XY5A 4YXJA 5KT2A 4KLGA 5DB7A 4MFFA 2J6UA 3BZCA 1U9LA 4J9PA 4ZOHC 5AK4A 4JB3A 2FMPA 4ED7A 4EYHB 2DF4B 5J0PA 1HIWA 4FFDA 4I28A 1TK5A 2AU0A 5J0UA 2Y9UA 1NI3A 2KICA 2W9AA 1LKYA 2XICA 3M7DA 1OW5A 5J2IA 2KKPA 1NJWA 3E58A 5HR6A 3RTVA 1J2NA 2ODGA 5J2EA 2Y1JA 5DDMA 1ZD5A 4ECVA 2C2EA 1SZPA 1T3NA 5DLGA 3GIKA 9ICAA 4UAUA 1ZQFA 7ICRA 3F2BA 2D6FC 3LVVA 3CYMA 1TK8A 3C29A 2XCAA 2K4HA 3MABA 2W03A 1T4GA 2VA8A 4ECZA 1M6YA 2HHXA 3I76A 2I6XA 3ZI4A 5G5GA 4F72A 3SAGA 1TE2A 4UASA 4F91B 1Z3EB 2R8GA 4BUGA 4HAIA 1ZQXA 2BCSA 1B4FA 2XVTA 2DPJA 2ZIWB 5K4LA 3M8SA 3AU2A 5CWRA 2H3VA 2JZBB 1XS9D 1N5XA 4Y2RA 1MA7A 1Z00B 3RR8A 1TFRA 4RT2A 1J97A 4JK1A 1SGGA 2KFZA 3PV8A 8ICQA 1QQ5A 2R8JA 2BQ3A 4KLTA 1HJPA 2KKVA 4BGDA 1CUKA 5ALSA 4O3RA 2KIVA 2P6UA 4UB8U 5J0YA 2MRLA 4A8EA 2FPLA 1ZD4A 4Y2YA 1ZQYA 1UHUA 3J81j 1JXEA 5L1IA 2YN4A 5KFVA 5F9LA 4ACOA 3QNMA 4AYBF 3SENA 4Y2JA 2IOFK 1LB2B 3NUQA 3N7SC 4OJ5A 1D9FA 2Y1IA 4Z6FA 1BPYA 4O3OA 4Z6EA 3H4DA 1L8OA 5AM2A 2RLTA 1CRXA 1T7PA 2G06A 5AKYA 3D2SA 4IL6U 2R18A 3IHQB 4BWMA 5JU5A 4CRXA 3WKAA 1TK0A 4C4SA 4DFJA 1RZTA 1QQ7A 1S77D 5ALXA 5AKLA 5KNIA 1S0NA 3KFUF 4PL1A 3GIIA 2FMSA 5DB8A 3IDWA 5FP0A 4PGXA 1RQLA 3NVWA 2M9NA 4RQNA 3HWTA 5KG1A 4DL7A 4DLEA 5DBBA 2KK0A 4I2FA 2HMXA 4J9SA 4ELVA 4C80A 8ICFA 3KHRA 4UB3A 5KFWA 3GV8B 3RB3A 3ZD8A 2FMQA 4NLKA 4UB2A 4M9GA 4ECUA 2ZIUA 2KN7A 2FE9A 9ICBA 4RQMA 3L5KA 3RJJA 1L8LA 1BPEA 3QUBA 3WK6A 4Q8FA 4J9RA 1XSPA 2V4RA 1N5WA 5DBAA 4I2AA 4NM2A 4O5KA 1L7OA 2LKYA 4MFAA 5DB6A 1FFVA 3B0XA 4QZHA 2A3VA 2E8OA 3D2QA 2DKXA 1Z4OA 2WAQF 4GFJA 2DWQA 5KFOA 3KTQA 4F3OA 4EENA 1F44A 1EXNA 2OM6A 4E0DA 4F93B 1Q3UA 3H8MA 5ALNA 3OSPA 4ICAA 3ZDCA 4OO1J 4Z6CA 2PI4A 3PMNA 1PUZA 2QARA 5TISU 2WB1F 5B5EU 1ZQOA 2M0NA 5KFFA 4BDPA 2B21A 4USAA 2W8LA 4GC6A 5AM4A 3TADC 4QW9A 1BNOA 5CHGA 4FZMA 2HHSA 4O3MA 4M47A 4I27A 1ZRNA 5AM1A 2R8HA 2PKEA 2ISPA 3KBBA 3PX6A 1U4BA 1SL2A 5L1JA 4UATA 1N61A 3MDCA 3PW2A 4KLSA 5DQGA 2DKZA 4KLDA 5BOMA 3VCBA 2HHTA 3M6ZA 4G9BA 4QZEA 1BGXT 1DK3A 3WK8A 5HMLA 5ALPA 4UBCA 4ED1A 4DQSA 9ICFA 2DGZA 2C28A 1L6NA 2H3QA 4I2BA 2I5HA 1IM4A 4NL9C 3RB0A 2CXYA 4IR1A 4RQ3A 2W9BB 1X9SA 2IHMA 9ICKA 4DSEA 4YG2A 3O0FA 1DXSA 4U7CA 1NZPA 9ICMA 2NYVA 3GV7B 5KFNA 4UQGA 1VLBA 4YXMA 8ICXA 2K60A 2ESEA 4I2CA 4YMNA 2JV3A 2PMZC 3OPXA 3PX0A 2KZZA 9ICCA 1Y88A 4TUQA 3RH4A 2HHWA 4KLOA 7ICTA 9ICHA 4C4TA 4M6WA 3TACB 4ED6A 2KJ8A 4RPYA 4B9NA 2KOBA 4BX9C 5ALJA 4ECYA 3TANA 5TZVA 4C8LA 3NRZA 3QU9A 3WU2U 1KN5A 2YMMA 4EEYA 2Z7JA 3JPPA 4J9KA 3TARA 4DF8A 1JIHA 4DSLA 5J0QA 1KDHA 4QWBA 4IRDA 1UT8A 3N28A 4TQSA 4ECWA 3TI0A 2LYBA 1JX4A 3K1RB 2E8NA
chains in the Genus database with same CATH topology
5GTIU 5TISU 5B66U 4UB8U 5B5EU 5KAFU 3KZIU 4IL6U 5E79U 5KAIU 4UB6U 3A0BU 5H2FU 1S5LU 5GTHU 4PJ0U 2AXTU 2DUYA 3WU2U 3A0HU
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5GTI U;  5TIS U;  5B66 U;  4UB8 U;  5B5E U;  5KAF U;  3KZI U;  4IL6 U;  5E79 U;  5KAI U;  4UB6 U;  3A0B U;  5H2F U;  1S5L U;  5GTH U;  4PJ0 U;  2AXT U;  2DUY A;  3WU2 U;  3A0H U; 
#chains in the Genus database with same CATH topology
 4KLE A;  1K1S A;  3C23 A;  4OJO A;  5AI9 A;  2Y0S C;  3HT3 A;  7ICI A;  3GZF A;  1KRP A;  5KFT A;  4PL2 A;  2WTF A;  2YMQ A;  1X9W A;  3PSI A;  1MSW D;  9ICU A;  1RDF A;  4R65 A;  3H0R B;  3OGU A;  2XID A;  3PST A;  4CF3 A;  2VJ4 A;  4J9O A;  5A0L A;  5F3X B;  8ICY A;  4F50 A;  5AIA A;  4EX6 A;  4F2S A;  4K4H A;  3RF9 A;  1QSS A;  5AKX A;  1T94 A;  4J03 A;  3TAD A;  5AM5 A;  7ICN A;  4IRK A;  2HBM A;  3GFK B;  1DGS A;  2ASJ A;  5T14 A;  3PR4 A;  1N62 A;  5AI5 A;  2BDP A;  3FYH A;  2E5S A;  4DSJ A;  2W9C A;  2AH5 A;  4QZI A;  5J0T A;  2JHD A;  4BJQ A;  1HEK A;  2EZY A;  2KD1 A;  5KG2 A;  1N2X A;  4PHE A;  4R8U A;  4B9T A;  5KFL A;  4QWC A;  2HHV A;  1NJY A;  5J2J A;  3N97 B;  2CPR A;  3QU4 A;  4PPX A;  1JAL A;  4UB5 A;  2DL0 A;  1BPD A;  5III A;  3T5L A;  9ICE A;  3QE9 Y;  4KLH A;  4CF5 A;  4F4Y A;  3PW7 A;  1PK1 A;  2KSO A;  1RYR A;  4NM1 A;  1KEJ A;  3KKA C;  7ICQ A;  1SKS A;  4ECR A;  3ISD A;  1NKC A;  4NY8 A;  4MF8 A;  1UA0 A;  5ALF A;  4QZ8 A;  4QIW C;  3EZ5 A;  1JMS A;  4ED8 A;  2EZX A;  2JGA A;  4U6P A;  2BR0 A;  2W8K A;  3KZI U;  2EQY A;  3RJK A;  2ZJ5 A;  5AIC A;  2EAO A;  3QU2 A;  4KIT B;  5J2G A;  1N63 A;  1ZRM A;  2HDO A;  3U26 A;  4YD1 A;  2FJ6 A;  2PFP A;  2AJQ A;  4BXO A;  5ALT A;  4HYK A;  2ZIX A;  4QZB A;  2H3Z A;  5AM0 A;  1COO A;  2K4I A;  7ICE A;  2WF7 A;  4RZR A;  2XY6 A;  1WWV A;  3BJY A;  2G5H B;  5AIB A;  5KFE A;  2RHF A;  1FFU A;  2HOQ A;  3N4M B;  2I9G A;  4M9L A;  4RU9 A;  4R64 A;  5ALV A;  4Q8E A;  4QW8 A;  3C1Z A;  4PZO A;  1X6I A;  2AGQ A;  1ZQL A;  1ZQ1 C;  1ZYQ A;  1VJ5 A;  1X9M A;  1L5U A;  3K4G A;  1XNS A;  4FZN A;  2E8M A;  2ZJ8 A;  2EAM A;  4UAV A;  2A1J B;  4PZN A;  4EBC A;  5IIJ A;  7ICJ A;  5KFI A;  2QAR B;  4J9Q A;  3AN1 A;  3WKD A;  4CDG A;  2OWO A;  2EDU A;  1RQN A;  1UPH A;  3G6X A;  1RXW A;  4MF2 A;  1S97 A;  3UM9 A;  2P66 A;  1ZQH A;  3CNH A;  2KVS A;  4CE6 A;  2KEY A;  4DSF A;  9ICR A;  2GLE A;  5KFS A;  3M9O B;  3OJS A;  3MR5 A;  2G5I B;  1B22 A;  4EZ6 A;  3DDH A;  3BQ0 A;  3LDA A;  4MHV A;  2HOI A;  3IG8 A;  5ALG A;  1NKB A;  5DQI A;  3QUC A;  4NV0 A;  3TQ1 A;  8ICL A;  1KKX A;  3ETL A;  3MGH A;  4I29 A;  1ZQW A;  1ZD2 P;  2H3F A;  3L3F X;  5ALW A;  5JUM A;  4F5R A;  3SR6 A;  5J2K A;  1JN3 A;  2AQ4 A;  2BGW A;  5AKE A;  1L7M A;  4YN4 A;  8ICJ A;  3G6V A;  1PVR A;  4KLL A;  4O0I A;  4Y2Q A;  7ICU A;  5AI8 A;  3C21 A;  5KFX A;  1KQQ A;  2KHQ A;  2P35 A;  1U45 A;  4R63 A;  3EUB 2;  5J2F A;  2BHN A;  3TKA A;  4P4P A;  5D4B A;  2C22 A;  1ZQE A;  3NVY A;  1ZJN A;  1ZQR A;  2D8C A;  3EPG A;  5AM3 A;  2ISO A;  1RYS A;  1RG6 A;  3QYP A;  2CRX A;  3RAX A;  2OH2 A;  2K89 A;  1A77 A;  3OHB A;  1XWL A;  3RRH A;  1X9X A;  4M6W B;  5ALE A;  2FLL A;  2JMG A;  3V7L A;  4CGZ A;  4DFM A;  2VKQ A;  3UPQ A;  3TFR A;  1OXJ A;  2LI6 A;  3PX4 A;  2RQ5 A;  5BOL A;  3C2M A;  2F1H A;  5ALY A;  4Y2T A;  8ICO A;  3F2C A;  4KLU A;  5J2D A;  1NKE A;  2IBK A;  5GTI U;  2XC9 A;  4MEX A;  3OJU A;  8ICI A;  2W04 A;  3QZ7 A;  3C2L A;  4DLG A;  1ZQI A;  4F4W A;  2K8B B;  4PGQ A;  3LYS A;  8ICA A;  2ZJA A;  3D6J A;  3F5A A;  2JRZ A;  2VIX A;  4QNL A;  2Q0Z X;  5KFQ A;  4QWE A;  5EE3 A;  1A0P A;  3MR6 A;  8ICU A;  5CR0 A;  3F2D A;  4C8K A;  1KL9 A;  4B9L A;  3V7J A;  1QLN A;  4LZD A;  2WF6 A;  3PO5 A;  1DRG A;  3H8W A;  4EX7 A;  8ICR A;  3NTU A;  4Q45 A;  3IN5 A;  1SV4 A;  4DO9 A;  4X5V A;  4RPX A;  3IRU A;  3ONN A;  4EEL A;  3C1Y A;  5KG4 A;  2KHV A;  5ALD A;  2DQN B;  4QZ9 A;  3IV6 A;  3SAH A;  2LHT A;  4MEY A;  4RNN A;  1QSL A;  3H0L B;  2FLP A;  4NLG A;  5KT3 A;  3ORY A;  5ALL A;  2F1I A;  3SI8 A;  1PVQ A;  3KHH A;  2VJ5 A;  3R9K A;  3NVZ A;  1X40 A;  8ICE A;  4KLM A;  5J8Y C;  4RQ7 A;  1IIP A;  3SD7 A;  2KV2 A;  3KZX A;  3C5F A;  3V6K A;  2R8K A;  1L3S A;  5IIO A;  1PK3 A;  1SV0 C;  3QZ8 A;  1HUO A;  4P0P B;  4P0Q A;  1P7D A;  5C5J A;  1X42 A;  3MFH A;  5ALQ A;  2VA2 A;  4O5E A;  1F0M A;  5EE0 A;  1B0X A;  4RPZ A;  3THV A;  2A1A A;  2QKQ A;  1X6J A;  5J0W A;  4KLI A;  1PK1 B;  4UBB A;  1NOM A;  3JPO A;  4ELU A;  5KFU A;  3RRG A;  5C0Y A;  2GOL A;  3RR7 A;  2MUT B;  4CNQ A;  2LPE A;  2AGO A;  8ICT A;  4UAZ A;  4F4X A;  3SYZ A;  1ZQZ A;  5J0S A;  1WG8 A;  3HX0 A;  1TAU A;  1NK8 A;  3C2K A;  5ALR A;  3T5J A;  2UVR A;  3AQF A;  5ALO A;  1ZQJ A;  9ICP A;  5JTI A;  1SXE A;  4DQQ A;  3NGD A;  2NO5 A;  3B9J A;  2NRX A;  3A0H U;  8ICC A;  3MGI A;  1C20 A;  5CEH A;  3JPN A;  3LWM A;  2KJ9 A;  1CI4 A;  5KT5 A;  1D9D A;  2W3S A;  2KZ3 A;  1BVS A;  1YT3 A;  5ALI A;  1QCK A;  4GXJ A;  3RJF A;  2W11 A;  3I1Y A;  4UB4 A;  3QEB Z;  1K1Q A;  2JEF A;  4IS7 A;  3M1Y A;  8ICN A;  4KLQ A;  4UB1 A;  4KMU A;  5J2C A;  3UXN A;  3V6J A;  1MN8 A;  4JV0 A;  5DG7 A;  3FC4 A;  1NK0 A;  4RUC A;  1S8O A;  4C8M A;  3VC8 A;  4KX5 A;  1JUD A;  2FLN A;  1UCV A;  4ECQ A;  8ICH A;  1X66 A;  2W54 A;  3PO4 A;  5CB1 A;  5J0O A;  2BCR A;  1K5O A;  2L5Y A;  4LZG A;  1LKY B;  2KVC A;  4EEK A;  1MQ3 A;  3DEE A;  5DDY A;  3PW5 A;  3UXP A;  2ZIW A;  5KFK A;  4Y2X A;  3SQI A;  3AQE A;  1RXV A;  1HUZ A;  4YR0 A;  1GO3 F;  5KAF U;  2HOF A;  3E2E A;  4QZC A;  1KTQ A;  4F5P A;  2IOF A;  4NLZ A;  1S0M A;  1QTM A;  2V9W A;  1KSP A;  2LM1 A;  1L7P A;  3A0B U;  4F4Z A;  3FAH A;  3IP4 B;  2XGP A;  5J8Y A;  4QZA A;  2HBK A;  1A6S A;  1A76 A;  4BWJ A;  9ICO A;  4DQP A;  3RB4 A;  1D8L A;  4F5O A;  2ASL A;  7ICM A;  4EYI B;  5DQH A;  4B9V A;  2H3I A;  1U47 A;  2W9M A;  3ZDB A;  3RH6 A;  3S6J A;  4NWI A;  4Y2V A;  2ATL A;  3LVW A;  3T3F A;  4J9L A;  3ZDA A;  4DOB A;  2XCP A;  1SL1 A;  4ED0 A;  2K8A A;  5CRX A;  2HCF A;  3BQT A;  3RJE A;  3AMZ A;  3HRD D;  2K4E A;  4CF4 A;  2DUY A;  2IHN A;  3GQC A;  4OJP A;  3T5H A;  9ICI A;  4Y2U A;  9ICS A;  3ZDE A;  3EWA A;  5EWF A;  2VAN A;  4DL6 A;  2UVV A;  2JEG A;  3QX7 A;  4YQW A;  2XY7 A;  3M9N B;  5EE9 A;  3M8R A;  4YD2 A;  4EBD A;  4IRC A;  3H8J A;  1U49 A;  4B9M A;  5J2B A;  2HVH A;  1ZD3 A;  4DOC A;  5KTQ A;  3KD3 A;  1ZQA A;  2OXO A;  1V97 A;  1ZQM A;  2YB4 A;  3EPI A;  4JV2 A;  1SB3 C;  1O08 A;  3K75 D;  2J6S A;  2HI0 A;  1IV8 A;  5DLF A;  4DS4 A;  1ZQT A;  1SWV A;  1SKW A;  4NL9 A;  1OUQ A;  5J2A A;  3WKE A;  3UQ2 A;  2KIW A;  2W7P A;  1SZH A;  2LYA A;  1Z1V A;  3H8S A;  2E1E A;  3H0M B;  1ZJM A;  3M6K A;  3ISC A;  1N48 A;  4RQ0 A;  5AKH A;  5KFG A;  3RH5 A;  5GTH U;  3C5G A;  4US9 A;  2LBO A;  8ICW A;  2HHQ A;  9ICX A;  4RQ4 A;  2F1J A;  2ZTE A;  5HR7 A;  4ED3 A;  3ALR A;  3BQ1 A;  4B6J A;  1V38 A;  3Q8M A;  4NLC A;  5E79 U;  4O3N A;  2YTU A;  4IQU A;  2KFN A;  5IIK A;  2ZIU B;  4Q43 A;  4UW9 A;  5L1L A;  2GO7 A;  5DGB A;  3WKB A;  5AKJ A;  3MR3 A;  4RNM A;  5KG5 A;  1D8B A;  1O03 A;  5KG0 A;  3HPO A;  3RBD A;  5AKK A;  5AI6 A;  5CP2 A;  1UQV A;  4P0Q B;  1XU4 A;  3PML A;  2GWS A;  1ED1 A;  1JXL A;  4F4K A;  4XA5 A;  1S10 A;  4P4M A;  1N60 A;  7ICV A;  1SWW A;  3IM1 A;  2PMZ F;  1S76 D;  3PW4 A;  3AL0 B;  2ZIV A;  7ICO A;  4YVZ A;  3NVV A;  1X2I A;  1V9P A;  1F5S A;  2E1F A;  1KLN A;  4AP9 A;  1TVA A;  4GXI A;  3I28 A;  3PSF A;  4PHA A;  1L3U A;  4IR9 A;  1COK A;  2AXT U;  3QU7 A;  3QUQ A;  4QJF B;  9ICV A;  3SV3 A;  3G6Y A;  4FO6 A;  3N7R C;  1D8Y A;  2IMW P;  1BPX A;  2AHO B;  4NXZ A;  1URJ A;  4F5N A;  2F44 A;  2W9B A;  3GU3 A;  9ICL A;  1RPL A;  5HP4 A;  1BPZ A;  3AM9 A;  1NK5 A;  4M0A A;  4PH5 A;  3IG5 A;  3HIL A;  5KFH A;  3BDP A;  1H38 A;  2WF5 A;  2W3R A;  3EYZ A;  1ZQN A;  4K4G A;  2QB0 A;  3EW9 A;  2BPC A;  2WAQ C;  3UXO A;  4DQR A;  4EBE A;  4M9H A;  2EAN A;  2HBL A;  2G07 A;  4MFC A;  1XO1 A;  2Y0S F;  3H7I A;  2G08 A;  2PI5 A;  3UQ0 A;  3AUO A;  4CCH A;  1LVH A;  1Z4N A;  3MGV A;  5KFB A;  5J0X A;  2F8L A;  3ISB A;  1MC8 A;  2DBY A;  2G09 A;  4NLB A;  4GC7 A;  1L7N A;  2WB1 C;  2ZTD A;  3MFI A;  3C28 A;  1TV9 A;  4ZH4 A;  1ZOL A;  2JH1 A;  4P2H A;  9ICN A;  3GIL A;  3KKA A;  5KG7 A;  1V85 A;  3CW2 C;  4K4I A;  5JRT A;  4I2I A;  5AK5 A;  2E3T A;  5HMM A;  5IIL A;  2YY6 A;  5HHH A;  4YFK A;  2BCV A;  5AHX A;  3RJG A;  4O3P A;  3WK7 A;  2FPK A;  8ICM A;  4QZD A;  4DL4 A;  2IOH A;  1JRP A;  2ZG6 A;  1Q46 A;  3HJE A;  2WF8 A;  2VA3 A;  5EWG A;  4DFD A;  4O5C A;  1KFS A;  2XGQ A;  4F8R A;  2YQE A;  2YML A;  2JEJ A;  3GIJ A;  5L9X A;  5EWE A;  4RQ8 A;  2BPF A;  3KHL A;  2WFA A;  2NO4 A;  3B0Y A;  4KX3 A;  3Q8R B;  4ECT A;  4RQ1 A;  2NRT A;  1XSL A;  2MSN A;  4FBU A;  3PVX A;  2PFO A;  3QEA Z;  4DFK A;  4OJL A;  5ALZ A;  4QIW F;  4WJ3 B;  1UA1 A;  3AU6 A;  2PFN A;  3H4B A;  4QZF A;  5G5H A;  4TQR A;  2B6G A;  3FDS A;  4UAW A;  4Q44 A;  3GIM A;  4YCX A;  2KJ5 A;  4F2R A;  5F9N A;  1FEZ A;  2OEH A;  3RAQ A;  2ZTC A;  1PVP A;  3ZDD A;  4PJ0 U;  1DOQ A;  1YZ7 A;  4KN4 A;  3M9M B;  7ICS A;  1FIQ A;  1T3Q A;  2OYY A;  5KL8 B;  3TFS A;  3RBE A;  9ICT A;  4JMU A;  2MU2 A;  4XRH A;  4NJ8 A;  3V6H A;  2Y9T A;  3F5E A;  3Q8Q B;  3RJI A;  4FBT A;  3UMB A;  1Q3V A;  5AKZ A;  2NRZ A;  2W55 A;  2NRV A;  4O3Q A;  1S5L U;  3KHG A;  1ARO P;  4RQ5 A;  4JWM A;  3JPR A;  2W9C B;  2KZM A;  2XO7 A;  4OCZ A;  2NV3 A;  2FI1 A;  2DPI A;  8ICG A;  4GLX A;  4ED2 A;  3TAP A;  5EOZ A;  4R8U B;  3LWL A;  8ICK A;  2A19 A;  2Q4T A;  5DB9 A;  1Q8K A;  3RFA A;  5KFZ A;  3BS5 A;  4QWA A;  1C7Y A;  2BPG A;  2JH7 A;  1XSN A;  4KTQ A;  1NZB A;  1ZQV A;  2R8I A;  5DBC A;  2RDI A;  3PNC A;  1ZQG A;  1TAM A;  4B9S A;  1QH9 A;  1SL0 A;  2O6K A;  4GIB A;  2KSO B;  1NK7 A;  5D49 A;  2BCQ A;  2QB1 A;  4YP3 A;  1ZXI A;  3PZP A;  5KT6 A;  3GV5 B;  2NRW A;  4C7Z A;  1NNL A;  1SXD A;  2OCE A;  4DSI A;  4TUP A;  1AQ6 A;  5KL1 B;  3NS1 A;  5J2H A;  3L4P A;  3NRW A;  2JR5 A;  1Z1B A;  4RT3 A;  3OTQ A;  3QXG A;  2PXI A;  2XI9 A;  3UMG A;  4C0Z A;  1WCN A;  4OD0 A;  2AGP A;  2A1J A;  1VDV A;  2YB1 A;  3E0F A;  1NK9 A;  4BXO B;  1DK2 A;  2I1Q A;  2MA1 A;  4B9U A;  2ZIX B;  1TKD A;  4M9J A;  3HKZ C;  5AKI A;  3SV4 A;  4IQV A;  3V7K A;  4O9M A;  2H5X A;  4C4R A;  1BNP A;  3D2N A;  1ZQS A;  3LK9 A;  5HHI A;  4OJ6 A;  1SIJ A;  4I2H A;  1KFD A;  5KFJ A;  4DWI A;  1Z19 A;  3ED5 A;  2ZIV B;  2HW3 A;  4DEZ A;  4ECS A;  3H40 A;  3PW0 A;  3Q8S B;  4M04 A;  1PZN A;  5AK6 A;  3JPT A;  2F2A B;  3QU5 A;  4ECX A;  2EZZ A;  1IXR A;  5ALK A;  1KFT A;  4DL5 A;  3AEV A;  1NJZ A;  1U48 A;  3NAS A;  4I2G A;  3SMV A;  2UVU A;  3N7P D;  4KMO B;  4JWN A;  1S0V A;  4XUS A;  1MQ2 A;  1ZQU A;  4RQ6 A;  1WYG A;  2K8C B;  4C7Y A;  3ICX A;  9ICQ A;  1BPB A;  1YZ6 A;  2WF9 A;  4O3S A;  5ALU A;  2FPM A;  2JZB A;  2DFL A;  1ZQC A;  1Z00 A;  5L1M A;  3PR5 B;  5DKW A;  8ICP A;  4UB6 U;  3BZK A;  2KNJ A;  5CJ7 A;  1L3T A;  1S0O A;  3TAQ A;  2GH1 A;  2QB0 B;  5KT4 A;  2ZUC A;  4I2J A;  3DV9 A;  5CA7 A;  2KTQ A;  3HW8 A;  5KFP A;  2B0C A;  4JUZ A;  2G0A A;  4Y2P A;  1ZQB A;  3WK9 A;  1ZQQ A;  3V72 A;  2V4Q A;  3SEI A;  5KFR A;  2WHE A;  1SV0 A;  2J6T A;  5KG6 A;  3JPQ A;  4DL2 A;  7ICF A;  2LM4 A;  3F53 A;  3HP6 A;  1UT5 A;  2BCU A;  4IQT A;  1ZET A;  3BS7 A;  4IQW A;  4YMO A;  4Z6D A;  2ZUB A;  1JRO A;  1RM6 C;  4DCC A;  4PHD A;  3SZ2 A;  3RJH A;  4C8O A;  2KP7 A;  2F3N A;  2N1R A;  4XQ8 A;  3GDX A;  3Q8P B;  4R66 A;  3CP8 A;  1LV5 A;  2QLT A;  3Q8K A;  4I2D A;  2JXJ A;  2F76 X;  5KFM A;  3MDA A;  4J9M A;  3MR2 A;  3MBY A;  1TAQ A;  2W43 A;  8ICZ A;  8ICV A;  4KN7 A;  1WWU A;  3KOO A;  3CRX A;  5J29 A;  4US8 A;  4Y2S A;  4M9N A;  4I2E A;  1ZQK A;  5EE1 A;  5DGA A;  1JI7 A;  4GXK A;  2BDU A;  1FO4 A;  3T5K A;  5DG9 A;  4DQI A;  4FS2 A;  4FZL A;  4ELT A;  2ZXI A;  3PY8 A;  8ICS A;  4G3I A;  5KG3 A;  4DOA A;  2ZUD A;  5IIN A;  2UVW A;  4RUA A;  3BQ2 A;  4KLJ A;  4YR2 A;  4DSK A;  5AK3 A;  2RDJ A;  3RB6 A;  7ICL A;  2LYH A;  2C2R A;  2FDR A;  4LVS A;  5H2F U;  2KE7 A;  4TUS A;  5KT7 A;  2BQR A;  9ICG A;  2E8P A;  3ZD9 A;  8ICB A;  4NLN A;  1IG6 A;  4DF4 A;  5D46 A;  5J0R A;  1NK4 A;  3QUT A;  5B66 U;  3SAF A;  3WK4 A;  1J2M A;  4F92 B;  2IA6 A;  2AQ0 A;  3PSP A;  2YX8 A;  4P0P A;  7ICP A;  4AYB C;  2ZXH A;  2W7O A;  4P4O A;  2CN1 A;  2HSZ A;  3WK5 A;  2RRD A;  4PGY A;  4RQ2 A;  4YMM A;  3HKZ F;  4YR3 A;  2C2D A;  4FS1 A;  5HNK A;  2D3D A;  1QSY A;  4F71 A;  2OHF A;  2ASD A;  5AKG A;  3UMC A;  4DL3 A;  1XO0 A;  1CEZ A;  4QZG A;  4J9N A;  5KFC A;  1WUD A;  4KLF A;  1ZQD A;  1ZQP A;  2MUT A;  2MAX A;  5KFD A;  2RP5 A;  4UAR A;  2F8K A;  3K1Z A;  3WKC A;  2EAP A;  7ICH A;  2K4P A;  3ETR A;  4EZ9 A;  2HVI A;  9ICW A;  4RNO A;  5DG8 A;  5L1K A;  1SKR A;  2HHU A;  2KG5 A;  9ICJ A;  7ICG A;  3BS5 B;  4C8N A;  1DGJ A;  3MC1 A;  5KFY A;  4UAY A;  3BQ7 A;  2ES6 A;  1N56 A;  2PFQ A;  4FE3 A;  3Q8L A;  2YMP A;  4F5Q A;  4DFP A;  1NJX A;  1XC9 A;  2EH9 A;  2ALZ A;  2KMD A;  1T8E A;  1KW4 A;  2HBJ A;  1B43 A;  4DS5 A;  5BPC A;  1RYU A;  5AI4 A;  4QWD A;  5IIM A;  4JV1 A;  5AI0 A;  1L3V A;  2P6R A;  3FM9 A;  3T79 A;  4TUR A;  4IC9 A;  1QQ6 A;  4M2Y A;  4LJX A;  1S9F A;  5KAI U;  2BQU A;  1NK6 A;  4PHP A;  3OSN A;  2F77 X;  5ALM A;  3JPS A;  1ECW A;  7ICK A;  3OHA A;  2JEI A;  1KBU A;  5KFA A;  5ALH A;  2LMR A;  2BZF A;  2BKE A;  1WCL A;  2XY5 A;  4YXJ A;  5KT2 A;  4KLG A;  5DB7 A;  4MFF A;  2J6U A;  3BZC A;  1U9L A;  4J9P A;  4ZOH C;  5AK4 A;  4JB3 A;  2FMP A;  4ED7 A;  4EYH B;  2DF4 B;  5J0P A;  1HIW A;  4FFD A;  4I28 A;  1TK5 A;  2AU0 A;  5J0U A;  2Y9U A;  1NI3 A;  2KIC A;  2W9A A;  1LKY A;  2XIC A;  3M7D A;  1OW5 A;  5J2I A;  2KKP A;  1NJW A;  3E58 A;  5HR6 A;  3RTV A;  1J2N A;  2ODG A;  5J2E A;  2Y1J A;  5DDM A;  1ZD5 A;  4ECV A;  2C2E A;  1SZP A;  1T3N A;  5DLG A;  3GIK A;  9ICA A;  4UAU A;  1ZQF A;  7ICR A;  3F2B A;  2D6F C;  3LVV A;  3CYM A;  1TK8 A;  3C29 A;  2XCA A;  2K4H A;  3MAB A;  2W03 A;  1T4G A;  2VA8 A;  4ECZ A;  1M6Y A;  2HHX A;  3I76 A;  2I6X A;  3ZI4 A;  5G5G A;  4F72 A;  3SAG A;  1TE2 A;  4UAS A;  4F91 B;  1Z3E B;  2R8G A;  4BUG A;  4HAI A;  1ZQX A;  2BCS A;  1B4F A;  2XVT A;  2DPJ A;  2ZIW B;  5K4L A;  3M8S A;  3AU2 A;  5CWR A;  2H3V A;  2JZB B;  1XS9 D;  1N5X A;  4Y2R A;  1MA7 A;  1Z00 B;  3RR8 A;  1TFR A;  4RT2 A;  1J97 A;  4JK1 A;  1SGG A;  2KFZ A;  3PV8 A;  8ICQ A;  1QQ5 A;  2R8J A;  2BQ3 A;  4KLT A;  1HJP A;  2KKV A;  4BGD A;  1CUK A;  5ALS A;  4O3R A;  2KIV A;  2P6U A;  4UB8 U;  5J0Y A;  2MRL A;  4A8E A;  2FPL A;  1ZD4 A;  4Y2Y A;  1ZQY A;  1UHU A;  3J81 j;  1JXE A;  5L1I A;  2YN4 A;  5KFV A;  5F9L A;  4ACO A;  3QNM A;  4AYB F;  3SEN A;  4Y2J A;  2IOF K;  1LB2 B;  3NUQ A;  3N7S C;  4OJ5 A;  1D9F A;  2Y1I A;  4Z6F A;  1BPY A;  4O3O A;  4Z6E A;  3H4D A;  1L8O A;  5AM2 A;  2RLT A;  1CRX A;  1T7P A;  2G06 A;  5AKY A;  3D2S A;  4IL6 U;  2R18 A;  3IHQ B;  4BWM A;  5JU5 A;  4CRX A;  3WKA A;  1TK0 A;  4C4S A;  4DFJ A;  1RZT A;  1QQ7 A;  1S77 D;  5ALX A;  5AKL A;  5KNI A;  1S0N A;  3KFU F;  4PL1 A;  3GII A;  2FMS A;  5DB8 A;  3IDW A;  5FP0 A;  4PGX A;  1RQL A;  3NVW A;  2M9N A;  4RQN A;  3HWT A;  5KG1 A;  4DL7 A;  4DLE A;  5DBB A;  2KK0 A;  4I2F A;  2HMX A;  4J9S A;  4ELV A;  4C80 A;  8ICF A;  3KHR A;  4UB3 A;  5KFW A;  3GV8 B;  3RB3 A;  3ZD8 A;  2FMQ A;  4NLK A;  4UB2 A;  4M9G A;  4ECU A;  2ZIU A;  2KN7 A;  2FE9 A;  9ICB A;  4RQM A;  3L5K A;  3RJJ A;  1L8L A;  1BPE A;  3QUB A;  3WK6 A;  4Q8F A;  4J9R A;  1XSP A;  2V4R A;  1N5W A;  5DBA A;  4I2A A;  4NM2 A;  4O5K A;  1L7O A;  2LKY A;  4MFA A;  5DB6 A;  1FFV A;  3B0X A;  4QZH A;  2A3V A;  2E8O A;  3D2Q A;  2DKX A;  1Z4O A;  2WAQ F;  4GFJ A;  2DWQ A;  5KFO A;  3KTQ A;  4F3O A;  4EEN A;  1F44 A;  1EXN A;  2OM6 A;  4E0D A;  4F93 B;  1Q3U A;  3H8M A;  5ALN A;  3OSP A;  4ICA A;  3ZDC A;  4OO1 J;  4Z6C A;  2PI4 A;  3PMN A;  1PUZ A;  2QAR A;  5TIS U;  2WB1 F;  5B5E U;  1ZQO A;  2M0N A;  5KFF A;  4BDP A;  2B21 A;  4USA A;  2W8L A;  4GC6 A;  5AM4 A;  3TAD C;  4QW9 A;  1BNO A;  5CHG A;  4FZM A;  2HHS A;  4O3M A;  4M47 A;  4I27 A;  1ZRN A;  5AM1 A;  2R8H A;  2PKE A;  2ISP A;  3KBB A;  3PX6 A;  1U4B A;  1SL2 A;  5L1J A;  4UAT A;  1N61 A;  3MDC A;  3PW2 A;  4KLS A;  5DQG A;  2DKZ A;  4KLD A;  5BOM A;  3VCB A;  2HHT A;  3M6Z A;  4G9B A;  4QZE A;  1BGX T;  1DK3 A;  3WK8 A;  5HML A;  5ALP A;  4UBC A;  4ED1 A;  4DQS A;  9ICF A;  2DGZ A;  2C28 A;  1L6N A;  2H3Q A;  4I2B A;  2I5H A;  1IM4 A;  4NL9 C;  3RB0 A;  2CXY A;  4IR1 A;  4RQ3 A;  2W9B B;  1X9S A;  2IHM A;  9ICK A;  4DSE A;  4YG2 A;  3O0F A;  1DXS A;  4U7C A;  1NZP A;  9ICM A;  2NYV A;  3GV7 B;  5KFN A;  4UQG A;  1VLB A;  4YXM A;  8ICX A;  2K60 A;  2ESE A;  4I2C A;  4YMN A;  2JV3 A;  2PMZ C;  3OPX A;  3PX0 A;  2KZZ A;  9ICC A;  1Y88 A;  4TUQ A;  3RH4 A;  2HHW A;  4KLO A;  7ICT A;  9ICH A;  4C4T A;  4M6W A;  3TAC B;  4ED6 A;  2KJ8 A;  4RPY A;  4B9N A;  2KOB A;  4BX9 C;  5ALJ A;  4ECY A;  3TAN A;  5TZV A;  4C8L A;  3NRZ A;  3QU9 A;  3WU2 U;  1KN5 A;  2YMM A;  4EEY A;  2Z7J A;  3JPP A;  4J9K A;  3TAR A;  4DF8 A;  1JIH A;  4DSL A;  5J0Q A;  1KDH A;  4QWB A;  4IRD A;  1UT8 A;  3N28 A;  4TQS A;  4ECW A;  3TI0 A;  2LYB A;  1JX4 A;  3K1R B;  2E8N A; 
#chains in the Genus database with same CATH homology
 5GTI U;  5TIS U;  5B66 U;  4UB8 U;  5B5E U;  5KAF U;  3KZI U;  4IL6 U;  5E79 U;  5KAI U;  4UB6 U;  3A0B U;  5H2F U;  1S5L U;  5GTH U;  4PJ0 U;  2AXT U;  2DUY A;  3WU2 U;  3A0H U; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...