5B5EU

Crystal structure analysis of photosystem ii complex
Total Genus 33
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
33
sequence length
97
structure length
97
Chain Sequence
ELVNVVDEKLGTAYGEKIDLNNTNIAAFIQYRGLYPTLAKLIVKNAPYESVEDVLNIPGLTERQKQILRENLEHFTVTEVETALVEGGDRYNNGLYK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Electron transport, photosynthesis
molecule keywords Photosystem II protein D1
publication title Two Different Structures of the Oxygen-Evolving Complex in the Same Polypeptide Frameworks of Photosystem II
pubmed doi rcsb
total genus 33
structure length 97
sequence length 97
chains with identical sequence u
ec nomenclature
pdb deposition date 2016-05-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
U PF06514 PsbU Photosystem II 12 kDa extrinsic protein (PsbU)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.320 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 Photosystem II 12 kDa extrinsic protein 5b5eU01
4PJ0U 5KAFU 5B5EU 3A0BU 2AXTU 5GTHU 5E79U 2DUYA 1S5LU 5TISU 4IL6U 3KZIU 3A0HU 5GTIU 5KAIU 5H2FU 3WU2U 4UB8U 4UB6U 5B66U
chains in the Genus database with same CATH superfamily
4YCXA 4DWIA 1ZQWA 2EAPA 1NK9A 4RQ4A 1U47A 5AKEA 4DS5A 1V9PA 4DOAA 1V38A 4KLUA 2DKZA 3M6ZA 4O0IA 2EZZA 1L3UA 5KT2A 2XVTA 4NL9C 4YMOA 2NRWA 4IQTA 4KX3A 4DQPA 2RDJA 5AM0A 2AGOA 2FLLA 5KFMA 2A1JA 3QXGA 5DDYA 1YT3A 4J9PA 4F5QA 4EBDA 2EAOA 5J2AA 3HP6A 4F2RA 2YMQA 2YMLA 2ZIUA 2A3VA 1H38A 1ZQFA 2E8NA 5DDMA 4UQGA 1QCKA 1TAUA 5KFZA 1LVHA 2H3IA 5KG5A 4PGXA 3RBEA 2BPGA 3HT3A 5KFGA 1SKWA 5EE1A 4BDPA 2BHNA 1NJXA 2K8AA 3N7RC 3ZI4A 1ZQCA 2YX8A 3T79A 2I6XA 1SV0A 3M8SA 5DB6A 1JMSA 3PW0A 3HRDD 3K75D 1TK5A 3OHAA 5ALTA 3Q8RB 2MAXA 1K5OA 3PW7A 1CRXA 3ONNA 3EPGA 2F44A 3IDWA 5KG0A 1J97A 5ALUA 2IHMA 4C0ZA 1A0PA 3UQ2A 2J6UA 2CPRA 2OEHA 1Z4NA 3D6JA 2IMWP 3G6YA 3KHHA 4C4SA 1X2IA 1S9FA 3SAFA 1S10A 1X42A 2LKYA 2W55A 3R9KA 5AM4A 2HMXA 5AM1A 3IG8A 2F3NA 5ALKA 2WF5A 4F5OA 5J0OA 3MGVA 5AKIA 7ICUA 3NTUA 2ZIWA 1N62A 2QLTA 2A1JB 5EWFA 3MR5A 2LM4A 2W43A 1WWUA 4PPXA 2ZTCA 5BOMA 4J03A 4OCZA 2ZTDA 4GC6A 1JXEA 2M0NA 1SV4A 2F8LA 4M9HA 4TQRA 3SYZA 2Z7JA 5J0XA 4UAVA 2A19A 2F1IA 3I76A 1P7DA 3PX0A 4ECSA 3PO4A 8ICZA 1X66A 5J29A 1UHUA 3RJGA 3PSIA 3ETLA 5J0YA 1IG6A 4O3NA 4CE6A 5ALYA 5AM5A 4IQVA 4F2SA 2HSZA 4OJOA 3SEIA 2WB1F 4QWEA 1D9DA 5IIJA 1ZQVA 4EEYA 3H0LB 4WJ3B 5AI0A 2IOHA 2W9CA 3BQ0A 4KLSA 3TFRA 3AQFA 3IHQB 2N1RA 4LVSA 3ISCA 3FM9A 2ZIVA 3AUOA 2JV3A 1CI4A 5AI5A 1Z4OA 2JH7A 2OH2A 4R64A 4QWBA 2ZIWB 1FFUA 1LB2B 3WKAA 4JV2A 4KMOB 4IRKA 3AU6A 5H2FU 4B9LA 4NLNA 3F53A 1MQ3A 5AKKA 4M9NA 3PW2A 1SL2A 3TADC 2ZXHA 3OTQA 1GO3F 1S8OA 4PHDA 3BQ7A 3T5KA 2RHFA 4Y2VA 3OPXA 8ICRA 2XY6A 4YG2A 2PMZF 1SB3C 3SAGA 5AK5A 4DFJA 3QEBZ 5AK4A 2DBYA 2XCAA 2MRLA 2LM1A 5F9NA 1S97A 7ICLA 2ES6A 2LPEA 1VLBA 5KT4A 3PO5A 3QX7A 1FO4A 4GXJA 3H7IA 3N4MB 8ICCA 5AICA 1XC9A 5KFSA 1XWLA 4DSIA 3L4PA 4NLCA 5GTIU 2W9CB 4K4HA 5KFFA 4ELUA 2DF4B 2HHQA 1PVRA 1PZNA 3H0MB 3RB3A 4P2HA 4I2HA 9ICBA 4P0PB 2OXOA 1S0MA 3ZDCA 5ALZA 3PSPA 1S0NA 4P0QA 3UMBA 3KHGA 2KIVA 2NYVA 3C2LA 3RJHA 3E0FA 1MSWD 4RNMA 1TKDA 2D3DA 8ICWA 2I5HA 3PX4A 3MBYA 5ALSA 9ICQA 4I27A 2G0AA 1MQ2A 4ELTA 2F1HA 2B6GA 2A1AA 4MF8A 2YTUA 5AIAA 1N2XA 5KFUA 4IRDA 3RB6A 4UB6U 1Z1BA 1NJWA 4AYBF 2EZYA 1KFTA 2LYAA 2ZG6A 2JZBA 1RXWA 1RPLA 1XNSA 5E79U 2F2AB 8ICXA 4IQUA 3UXNA 4FS2A 1KLNA 1PK1B 2F1JA 3WK6A 8ICNA 4ECWA 4BJQA 4MEXA 4R8UA 1NKBA 3E2EA 3KZXA 2QB0A 1COKA 5B5EU 4NM1A 8ICVA 8ICSA 2O6KA 3PX6A 1DK2A 4ECQA 5CR0A 4QZBA 1N60A 2K89A 4EYIB 5DB7A 1UA1A 2KZ3A 4I2EA 4P0QB 5AKYA 2F77X 1F44A 1ZD5A 3M8RA 5ALNA 5J2DA 5B66U 5CEHA 1PVQA 4Q8EA 7ICTA 4QZCA 1SGGA 5JTIA 1SKSA 5KG1A 5KFJA 5KFDA 2IOFK 3IN5A 3RAQA 5JRTA 5T14A 3GV5B 1ZQTA 4UAYA 4DL4A 3MR2A 4UB1A 3TACB 1B22A 4Z6CA 4RQMA 5ALDA 4EELA 4QW9A 5GTHU 2IA6A 4QZIA 2JZBB 2FMSA 3KHRA 4Z6FA 2AGPA 1RXVA 9ICIA 4F72A 2AQ0A 4OJPA 1TV9A 1NZBA 4YD1A 2GLEA 4I2CA 5DG8A 4B9SA 4R8UB 1S77D 2BCSA 4RNOA 3LVWA 4FZMA 4LZDA 4JV1A 4DQQA 4KLDA 3PR5B 2W3RA 5KFEA 1FFVA 3BJYA 1X9XA 2QB0B 3SZ2A 3C1YA 2B21A 2BDUA 1ZQEA 4F3OA 5EWEA 2XY7A 8ICKA 4F5RA 3V7LA 1NOMA 2VJ4A 1Z19A 4P4OA 3RAXA 4DL7A 2C22A 5KFVA 3C5FA 2WB1C 4QZEA 3PZPA 1RQNA 1L3VA 1T3NA 1RYSA 1ZQMA 2KEYA 2G5HB 4OO1J 3QEAZ 2DGZA 3A0BU 5HR7A 2CXYA 3MABA 2PKEA 3Q8PB 1NK4A 1ZJNA 2KD1A 2IHNA 3TARA 1NI3A 1B4FA 1N5XA 4KLLA 2V4QA 3H8SA 1ZQHA 3NVZA 5KFTA 3L5KA 5KFLA 1XSLA 2BCRA 4PZNA 3MGIA 3SR6A 1F5SA 5KFNA 2W8LA 2KHVA 4ELVA 3RRHA 4UW9A 4B9NA 1X9SA 5J2HA 4O3RA 4Y2QA 2NO4A 1ZQJA 1D8LA 4RQ0A 4IQWA 2BCQA 2JH1A 1FEZA 3N97B 4KLIA 5ALVA 3KOOA 4I2BA 2H3QA 3RB0A 1U48A 1EXNA 2JRZA 2KSOA 2NRTA 2KE7A 4US8A 2E8PA 2PMZC 3WK5A 3ZDAA 3GU3A 3Q8LA 4ED0A 5ALGA 4B9MA 7ICJA 5IIKA 5KT5A 3H4BA 5JUMA 4O9MA 2AGQA 4C80A 2Y1IA 4DFDA 5L9XA 2DFLA 2M9NA 2FJ6A 2W8KA 4PJ0U 1WWVA 2E8MA 4I28A 2KN7A 2GOLA 5DBBA 3C21A 4MFAA 4OJLA 4MHVA 1VJ5A 5IINA 8ICUA 4OJ6A 4YMMA 1TVAA 2AJQA 2BQ3A 1ZQLA 3CRXA 2MSNA 4QZDA 1L8LA 1S0OA 4NXZA 4Z6DA 4RT3A 9ICVA 8ICBA 4EENA 5J8YC 3PR4A 4Q43A 4DSEA 4EZ9A 5KFIA 5A0LA 1IIPA 3LVVA 1UQVA 1U9LA 4C7YA 4ECZA 1Z00A 7ICPA 1HUZA 3RRGA 3E58A 3V7KA 4J9MA 1Z3EB 5CWRA 2BPCA 5G5HA 2G5IB 5ALQA 4F92B 2PFOA 2DPJA 3RR8A 5KAFU 4ECXA 3KHLA 2KSOB 8ICAA 1T3QA 4AYBC 9ICXA 5AI8A 4I2FA 1CEZA 4NL9A 1PK3A 1N5WA 2XY5A 3C29A 2HHXA 3H8JA 4DF4A 2ISOA 5G5GA 2ESEA 4KX5A 1Q3VA 4RPZA 1HIWA 4YR3A 2GWSA 4KLEA 2PFNA 2NRZA 5DGBA 4EZ6A 1X6JA 5CJ7A 2F8KA 4QJFB 2BDPA 3H8MA 4DLEA 3KKAC 5KFCA 3K4GA 4ZH4A 4ACOA 1T7PA 2HOIA 1NK8A 1NK5A 2KKVA 4M6WA 3NASA 2R18A 2BQUA 3RJIA 5KFAA 8ICLA 1HUOA 3GIMA 3M9MB 3KZIU 4I29A 1ZD3A 1Z00B 1JN3A 3F5AA 1QTMA 9ICLA 4NLKA 4QZ8A 2HI0A 3SAHA 2BZFA 1BPXA 3L3FX 5AKZA 5DBCA 2HBMA 4Z6EA 1TK8A 2YMPA 3WK7A 3CNHA 3BZKA 1ZQXA 5HNKA 4RPYA 5EWGA 4M2YA 3C2MA 2JEIA 2UVWA 2W7OA 3C5GA 2Y1JA 4YVZA 2ZIUB 1KTQA 1QQ5A 2VANA 4M9JA 5L1JA 3M1YA 5L1KA 1BPEA 4EBEA 2KHQA 3WK4A 3UM9A 2LMRA 1JX4A 4C7ZA 2Y9UA 5KL1B 3F2CA 8ICTA 4TUQA 3D2QA 2YB4A 3J81j 3BQ1A 4CDGA 9ICMA 5AI6A 2HHTA 3C2KA 2ISPA 5AIBA 4OJ5A 3ZDEA 3EYZA 4M47A 3KTQA 2PXIA 8ICGA 4R65A 2P6RA 1V97A 2ZJAA 4RU9A 4RQ3A 1N56A 4UARA 1L5UA 1DXSA 4QIWF 4R63A 3C1ZA 3EW9A 5ALXA 4G3IA 4XUSA 5C0YA 3QU2A 1T8EA 4UBCA 1LKYA 8ICMA 2NV3A 1ZQZA 4PGYA 1X40A 2K4PA 1D8BA 1UA0A 2KJ5A 2KVSA 4R66A 1SL1A 2UVVA 2QB1A 3MFIA 5ALFA 5J2CA 1L7MA 3WKCA 1L7NA 3DV9A 3OJUA 3HWTA 3BZCA 3M9NB 3QYPA 3D2SA 4XQ8A 3Q8SB 1QSLA 2JXJA 2FLNA 2KZZA 4ECYA 3GZFA 2HOFA 2HVIA 7ICSA 5DLGA 2WF6A 1PVPA 1K1QA 2WF8A 1NK7A 2UVUA 1ZXIA 3VCBA 3FDSA 2H3VA 2WF9A 3Q8QB 4CF4A 2BCVA 5KT3A 2WHEA 2ODGA 3H4DA 4M9GA 3HJEA 4NLBA 2V9WA 4DL3A 4J9LA 3GILA 2EANA 5AI9A 3GIIA 2VA8A 4US9A 3TQ1A 2K8BB 4RQ7A 4DSFA 2QARA 4QZAA 3ETRA 2EH9A 3TADA 4DS4A 4RUCA 4FZNA 3WK9A 3H40A 1NKEA 4P4PA 1MN8A 4FE3A 1ZQBA 4PHAA 3ZD9A 4CCHA 1SZHA 1UT5A 3GIKA 1ZYQA 2CN1A 4MFFA 5J2EA 3TAPA 4CNQA 1QQ6A 3QU7A 2ZIVB 3HW8A 4ECRA 2AXTU 3HKZF 5DB9A 4J9QA 2G06A 1ECWA 4C8MA 4DEZA 3RJFA 1SKRA 1JXLA 3RB4A 4NM2A 1C7YA 4LZGA 2W9MA 5HR6A 1IM4A 2EZXA 2K4HA 9ICAA 2ZUCA 3UMGA 3NUQA 4Y2XA 4ECVA 4PHEA 5CHGA 4ED2A 5KG6A 1KN5A 4IL6U 2ZTEA 1SL0A 1XU4A 3B0XA 3UXPA 4KLOA 2FMQA 4RT2A 5ALMA 4RQ5A 2AQ4A 4MFCA 2NRXA 4C8NA 3SV4A 2FI1A 3JPQA 7ICGA 4UAUA 4DL5A 2W3SA 5CRXA 1DOQA 2FPKA 1J2NA 4EBCA 2G07A 2P66A 4K4IA 4DSKA 3ED5A 4YR2A 2JEFA 1ZD4A 2XI9A 3ICXA 5DKWA 1KKXA 2HBKA 3MDAA 4KLFA 5IIOA 1ZETA 4I2IA 5KG4A 4DQIA 4KLTA 1ZQSA 3AL0B 2ASJA 1KRPA 4EX7A 3BQ2A 1M6YA 1BPYA 3I28A 4X5VA 1IXRA 1TAMA 3TKAA 3WK8A 1KDHA 4KITB 2W54A 2KV2A 4O5KA 2NRVA 3F5EA 2KIWA 1ZRNA 4Y2SA 4XA5A 3AM9A 1RM6C 1WCLA 4DQRA 1ZQOA 3K1ZA 2G08A 2KJ8A 4PHPA 5J0PA 4QWAA 2YN4A 5EE9A 2KTQA 3LWLA 1L7OA 5J0UA 4GXIA 2VA3A 4LJXA 5ALOA 2E8OA 5KFBA 2IBKA 3N7PD 3V6HA 5AK6A 1U45A 4PZOA 5AKXA 4UB3A 4BXOA 5AK3A 3PV8A 1UT8A 1Q3UA 4RQ1A 2W7PA 1NZPA 3SQIA 5HHIA 3RH5A 1YZ6A 1N48A 4DFKA 5DB8A 2FLPA 3QNMA 5J2BA 4M0AA 2KP7A 2Q0ZX 4UATA 5CP2A 4U6PA 4YQWA 3QUBA 3H0RB 3BS5A 2KFNA 1Z1VA 3TI0A 3RF9A 1BVSA 2AH5A 2E1FA 4JB3A 4KN7A 1T94A 3CYMA 8ICFA 3FYHA 3QE9Y 3UPQA 4J9OA 3THVA 2WFAA 3KD3A 4RUAA 1ZJMA 1D9FA 2KKPA 1RYUA 2JR5A 3IP4B 4QIWC 4B9TA 2FMPA 4I2DA 3QUTA 3IRUA 4Y2UA 4ED8A 2JGAA 4F4XA 3SV3A 5AI4A 2W03A 5DBAA 3HX0A 4M9LA 2HHVA 5EE3A 4FBTA 1S0VA 4CGZA 3T5JA 1NK0A 4C8KA 1B43A 2RDIA 2J6TA 2HVHA 4NWIA 5J0WA 4O3OA 2PFQA 3NVYA 2K8CB 2WF7A 4KLQA 2R8HA 5DLFA 3Q8KA 3RBDA 4Q8FA 2C2RA 1FIQA 2P6UA 4PL1A 2JEJA 1ZQYA 3LWMA 4QZGA 1V85A 1XO1A 4YMNA 2PI5A 1NK6A 4I2GA 4ZOHC 4I2JA 3F2DA 1DK3A 1JRPA 9ICTA 1F0MA 4OD0A 4ED3A 1NJYA 3AEVA 3PVXA 2DWQA 5FP0A 3EUB2 5D4BA 4XRHA 3BS5B 4I2AA 4HAIA 2HDOA 7ICEA 4C4RA 4MEYA 7ICRA 1N63A 2IOFA 3FC4A 1WYGA 5AKGA 2ATLA 1S5LU 1RG6A 3C23A 9ICRA 2XIDA 3JPNA 4NV0A 2ZJ8A 5AM3A 4UB2A 2V4RA 1KL9A 3SD7A 5AM2A 4O5CA 5L1LA 3RTVA 3H8WA 4DCCA 4Q45A 3V7JA 2YQEA 1XSNA 2XCPA 2KFZA 4DFPA 4UAWA 5KG7A 4QZFA 1TK0A 1JROA 4HYKA 3ZD8A 1OXJA 1HJPA 1UCVA 5KFOA 3HKZC 4G9BA 7ICOA 4FS1A 2HHSA 9ICEA 4CF5A 2R8JA 5AKHA 4Y2PA 3ISDA 3TFSA 3B9JA 1YZ7A 3A0HU 1Q46A 2FDRA 3MGHA 3QU5A 5ALHA 2Y0SF 2GH1A 5J8YA 2OM6A 2LYBA 1BGXT 2XGPA 3JPRA 2KVCA 3RJKA 2W11A 4PGQA 4DFMA 2XGQA 3AMZA 2K60A 2KICA 5K4LA 3SI8A 4DOCA 2H3FA 2ZXIA 2ALZA 3RJJA 2ASDA 5ALJA 4E0DA 2RQ5A 2K4EA 3RJEA 2BQRA 5KTQA 3GDXA 2E3TA 5ALWA 1LV5A 7ICMA 1O08A 4IR1A 1JALA 1SV0C 3BQTA 3N7SC 7ICQA 4F93B 2R8GA 3TAQA 8ICEA 4UBBA 4O3QA 1QLNA 2QKQA 2DQNB 2VJ5A 5KFXA 5KFYA 3CW2C 1ZRMA 2KZMA 4DSLA 4RQ2A 3JPSA 2BGWA 3GV8B 4Y2YA 1RDFA 3KKAA 5KFHA 3HPOA 4BGDA 3IV6A 4RZRA 1A76A 1ZQ1C 4A8EA 5HMMA 3RFAA 7ICNA 8ICQA 4O5EA 4QW8A 2DPIA 2MA1A 4GIBA 5CA7A 2FPMA 4NLGA 2E1EA 1BNOA 3WKDA 3TANA 3JPOA 2Y9TA 3LK9A 1SZPA 2CRXA 4YP3A 3MFHA 2MU2A 1XO0A 1HEKA 2JHDA 1SWVA 3EWAA 4RNNA 1O03A 3QU4A 5BPCA 2GO7A 2YY6A 3ZDBA 3JPPA 4GC7A 2BKEA 9ICOA 2H3ZA 3VC8A 3PW4A 1KW4A 2KK0A 4FFDA 4CRXA 4DSJA 1U49A 7ICFA 1KEJA 2VA2A 4QZHA 3PMNA 3IM1A 3G6VA 3V72A 5HHHA 2WTFA 1D8YA 1NKCA 1COOA 1S76D 4NY8A 4FZLA 2EQYA 5IIMA 5HP4A 3AN1A 2JMGA 8ICPA 4M6WB 2WAQF 3QZ7A 4Y2RA 1ED1A 3UQ0A 1AQ6A 4FBUA 3PNCA 1JI7A 5KFQA 3MR6A 3KFUF 3CP8A 7ICIA 3SENA 4JV0A 5JU5A 2UVRA 1KBUA 5KG2A 4TQSA 4F4KA 3NVWA 2LYHA 5D49A 3K1RB 3GFKB 3T5HA 1K1SA 2C2DA 1KFSA 1L3TA 1ZQDA 1OUQA 3PMLA 1SWWA 4BX9C 1T4GA 3NRZA 5ALIA 2R8KA 2HOQA 4C8LA 2PI4A 1BPBA 1NNLA 3WKEA 4P0PA 4DL6A 9ICWA 3WKBA 2MUTA 3JPTA 4O3PA 1J2MA 1KQQA 1KSPA 3MC1A 4DLGA 9ICNA 4KLHA 1DGJA 4IRCA 2ZJ5A 4TUPA 3AU2A 1ZQAA 3EPIA 1KFDA 5J2JA 2Q4TA 1RYRA 5J2FA 5C5JA 3PSFA 2AHOB 2XC9A 4F5PA 2LBOA 2KG5A 4DL2A 2AU0A 4J9KA 1WG8A 4C4TA 1LKYB 4USAA 4YN4A 3ORYA 1Y88A 2D6FC 3QZ8A 2HCFA 1JUDA 9ICFA 9ICGA 9ICJA 2OCEA 4DQSA 1PK1A 2RP5A 5DGAA 2XO7A 5DQHA 1OW5A 2K4IA 2NO5A 1U4BA 5CB1A 4ED1A 5ALLA 1L8OA 4F4YA 4EX6A 4F8RA 1IV8A 3ALRA 5IILA 7ICKA 5F9LA 2YB1A 2C2EA 4C8OA 4RQNA 2HBJA 1L6NA 2I9GA 2MUTB 2Y0SC 3QU9A 8ICIA 4BWJA 4KLGA 2W9AA 3GIJA 2HBLA 2H5XA 5D46A 1L7PA 5J2KA 5BOLA 4JWMA 4KLMA 5EOZA 3BS7A 1ZQIA 2D8CA 1B0XA 3MR3A 1ZQGA 2QARB 4TURA 4J9NA 5AKLA 1N61A 1QSSA 3I1YA 1NJZA 2RLTA 2FE9A 2XICA 4GLXA 4Y2TA 2DUYA 3GQCA 9ICUA 3UMCA 4Y2JA 5AKJA 1TFRA 4UB4A 2ASLA 2J6SA 4IS7A 1ZOLA 3NGDA 1ZQPA 4ED6A 5TZVA 1C20A 3MDCA 4DOBA 3NS1A 2KNJA 3V6KA 5KT7A 3RH6A 5F3XB 2VKQA 5DG7A 5J0QA 9ICHA 2KOBA 4ECUA 1ZQQA 3OSPA 3WU2U 3DEEA 3FAHA 4RQ6A 4DO9A 2JEGA 5KL8B 4GFJA 4F91B 3ISBA 4F50A 3OGUA 5KG3A 1A77A 4EYHB 2HW3A 2RRDA 4ECTA 1WUDA 3OJSA 5TISU 4M04A 4YXMA 5KAIU 5L1IA 3PW5A 3ZDDA 3DDHA 4YR0A 1PUZA 3M9OB 8ICJA 1ZQNA 4Q44A 7ICVA 5AHXA 4AP9A 4EEKA 2ZUBA 1RQLA 3IG5A 4J9SA 2FPLA 4O3MA 2YMMA 1L3SA 4YFKA 1DRGA 4K4GA 3SMVA 4KMUA 1SXDA 2ZUDA 4B9UA 3B0YA 4IC9A 3PY8A 1X9WA 2ZIXA 4JWNA 3U26A 8ICYA 1UPHA 1WCNA 4JK1A 3LDAA 4J9RA 4F71A 5J2GA 2B0CA 1SIJA 5EE0A 4UAZA 1X6IA 2OYYA 9ICSA 1ZQUA 5ALEA 2DL0A 1XS9D 2W04A 2W9BA 4QWCA 1QSYA 2WAQC 1DGSA 1TAQA 3O0FA 3V6JA 3QUCA 2BR0A 4JMUA 4DF8A 2BCUA 2F76X 4FO6A 3KBBA 1A6SA 3RH4A 3M6KA 1RZTA 4UB5A 4QNLA 1SXEA 1QQ7A 5KFRA 2LHTA 5DG9A 4UB8U 2DKXA 4B6JA 4BXOB 4ED7A 9ICKA 1MA7A 5J2IA 4JUZA 4BWMA 4KN4A 4PL2A 2P35A 5J0RA 4QWDA 4O3SA 9ICCA 4PH5A 3BDPA 3C28A 5KFPA 3NRWA 3AQEA 3LYSA 3EZ5A 4YXJA 5KT6A 3OHBA 5KFWA 1X9MA 4CF3A 8ICOA 2BPFA 2OWOA 5DQGA 1Q8KA 3HILA 4P4MA 7ICHA 2HHUA 5KFKA 2ZIXB 1JIHA 5ALRA 4NLZA 3F2BA 5L1MA 2VIXA 1QH9A 4NJ8A 3G6XA 1CUKA 3NVVA 4ICAA 5IIIA 3QUQA 5DQIA 9ICPA 4B9VA 4MF2A 2KJ9A 5HMLA 2L5YA 2W9BB 1ZQRA 3T3FA 4BUGA 2C28A 2EAMA 5J0SA 3Q8MA 2R8IA 4F5NA 4RPXA 1URJA 3OSNA 2PFPA 1TE2A 3N28A 1MC8A 3PSTA 3T5LA 2E5SA 1BPDA 4UASA 3S6JA 1VDVA 8ICHA 4QZ9A 2LI6A 2G09A 1AROP 5KNIA 3M7DA 1BPZA 3RR7A 4IR9A 2KMDA 4U7CA 4TUSA 4KLJA 4RQ8A 1XSPA 3UXOA 2OHFA 4YD2A 2I1QA 2HHWA 3GV7B 4KTQA 1BNPA 5J0TA 5ALPA 4F4WA 4F4ZA 3D2NA 1ZD2P 4GXKA 1ZQKA 2EDUA
chains in the Genus database with same CATH topology
4PJ0U 5KAFU 5B5EU 3A0BU 2AXTU 5GTHU 5E79U 2DUYA 1S5LU 5TISU 4IL6U 3KZIU 3A0HU 5GTIU 5KAIU 5H2FU 3WU2U 4UB8U 4UB6U 5B66U
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4PJ0 U;  5KAF U;  5B5E U;  3A0B U;  2AXT U;  5GTH U;  5E79 U;  2DUY A;  1S5L U;  5TIS U;  4IL6 U;  3KZI U;  3A0H U;  5GTI U;  5KAI U;  5H2F U;  3WU2 U;  4UB8 U;  4UB6 U;  5B66 U; 
#chains in the Genus database with same CATH topology
 4YCX A;  4DWI A;  1ZQW A;  2EAP A;  1NK9 A;  4RQ4 A;  1U47 A;  5AKE A;  4DS5 A;  1V9P A;  4DOA A;  1V38 A;  4KLU A;  2DKZ A;  3M6Z A;  4O0I A;  2EZZ A;  1L3U A;  5KT2 A;  2XVT A;  4NL9 C;  4YMO A;  2NRW A;  4IQT A;  4KX3 A;  4DQP A;  2RDJ A;  5AM0 A;  2AGO A;  2FLL A;  5KFM A;  2A1J A;  3QXG A;  5DDY A;  1YT3 A;  4J9P A;  4F5Q A;  4EBD A;  2EAO A;  5J2A A;  3HP6 A;  4F2R A;  2YMQ A;  2YML A;  2ZIU A;  2A3V A;  1H38 A;  1ZQF A;  2E8N A;  5DDM A;  4UQG A;  1QCK A;  1TAU A;  5KFZ A;  1LVH A;  2H3I A;  5KG5 A;  4PGX A;  3RBE A;  2BPG A;  3HT3 A;  5KFG A;  1SKW A;  5EE1 A;  4BDP A;  2BHN A;  1NJX A;  2K8A A;  3N7R C;  3ZI4 A;  1ZQC A;  2YX8 A;  3T79 A;  2I6X A;  1SV0 A;  3M8S A;  5DB6 A;  1JMS A;  3PW0 A;  3HRD D;  3K75 D;  1TK5 A;  3OHA A;  5ALT A;  3Q8R B;  2MAX A;  1K5O A;  3PW7 A;  1CRX A;  3ONN A;  3EPG A;  2F44 A;  3IDW A;  5KG0 A;  1J97 A;  5ALU A;  2IHM A;  4C0Z A;  1A0P A;  3UQ2 A;  2J6U A;  2CPR A;  2OEH A;  1Z4N A;  3D6J A;  2IMW P;  3G6Y A;  3KHH A;  4C4S A;  1X2I A;  1S9F A;  3SAF A;  1S10 A;  1X42 A;  2LKY A;  2W55 A;  3R9K A;  5AM4 A;  2HMX A;  5AM1 A;  3IG8 A;  2F3N A;  5ALK A;  2WF5 A;  4F5O A;  5J0O A;  3MGV A;  5AKI A;  7ICU A;  3NTU A;  2ZIW A;  1N62 A;  2QLT A;  2A1J B;  5EWF A;  3MR5 A;  2LM4 A;  2W43 A;  1WWU A;  4PPX A;  2ZTC A;  5BOM A;  4J03 A;  4OCZ A;  2ZTD A;  4GC6 A;  1JXE A;  2M0N A;  1SV4 A;  2F8L A;  4M9H A;  4TQR A;  3SYZ A;  2Z7J A;  5J0X A;  4UAV A;  2A19 A;  2F1I A;  3I76 A;  1P7D A;  3PX0 A;  4ECS A;  3PO4 A;  8ICZ A;  1X66 A;  5J29 A;  1UHU A;  3RJG A;  3PSI A;  3ETL A;  5J0Y A;  1IG6 A;  4O3N A;  4CE6 A;  5ALY A;  5AM5 A;  4IQV A;  4F2S A;  2HSZ A;  4OJO A;  3SEI A;  2WB1 F;  4QWE A;  1D9D A;  5IIJ A;  1ZQV A;  4EEY A;  3H0L B;  4WJ3 B;  5AI0 A;  2IOH A;  2W9C A;  3BQ0 A;  4KLS A;  3TFR A;  3AQF A;  3IHQ B;  2N1R A;  4LVS A;  3ISC A;  3FM9 A;  2ZIV A;  3AUO A;  2JV3 A;  1CI4 A;  5AI5 A;  1Z4O A;  2JH7 A;  2OH2 A;  4R64 A;  4QWB A;  2ZIW B;  1FFU A;  1LB2 B;  3WKA A;  4JV2 A;  4KMO B;  4IRK A;  3AU6 A;  5H2F U;  4B9L A;  4NLN A;  3F53 A;  1MQ3 A;  5AKK A;  4M9N A;  3PW2 A;  1SL2 A;  3TAD C;  2ZXH A;  3OTQ A;  1GO3 F;  1S8O A;  4PHD A;  3BQ7 A;  3T5K A;  2RHF A;  4Y2V A;  3OPX A;  8ICR A;  2XY6 A;  4YG2 A;  2PMZ F;  1SB3 C;  3SAG A;  5AK5 A;  4DFJ A;  3QEB Z;  5AK4 A;  2DBY A;  2XCA A;  2MRL A;  2LM1 A;  5F9N A;  1S97 A;  7ICL A;  2ES6 A;  2LPE A;  1VLB A;  5KT4 A;  3PO5 A;  3QX7 A;  1FO4 A;  4GXJ A;  3H7I A;  3N4M B;  8ICC A;  5AIC A;  1XC9 A;  5KFS A;  1XWL A;  4DSI A;  3L4P A;  4NLC A;  5GTI U;  2W9C B;  4K4H A;  5KFF A;  4ELU A;  2DF4 B;  2HHQ A;  1PVR A;  1PZN A;  3H0M B;  3RB3 A;  4P2H A;  4I2H A;  9ICB A;  4P0P B;  2OXO A;  1S0M A;  3ZDC A;  5ALZ A;  3PSP A;  1S0N A;  4P0Q A;  3UMB A;  3KHG A;  2KIV A;  2NYV A;  3C2L A;  3RJH A;  3E0F A;  1MSW D;  4RNM A;  1TKD A;  2D3D A;  8ICW A;  2I5H A;  3PX4 A;  3MBY A;  5ALS A;  9ICQ A;  4I27 A;  2G0A A;  1MQ2 A;  4ELT A;  2F1H A;  2B6G A;  2A1A A;  4MF8 A;  2YTU A;  5AIA A;  1N2X A;  5KFU A;  4IRD A;  3RB6 A;  4UB6 U;  1Z1B A;  1NJW A;  4AYB F;  2EZY A;  1KFT A;  2LYA A;  2ZG6 A;  2JZB A;  1RXW A;  1RPL A;  1XNS A;  5E79 U;  2F2A B;  8ICX A;  4IQU A;  3UXN A;  4FS2 A;  1KLN A;  1PK1 B;  2F1J A;  3WK6 A;  8ICN A;  4ECW A;  4BJQ A;  4MEX A;  4R8U A;  1NKB A;  3E2E A;  3KZX A;  2QB0 A;  1COK A;  5B5E U;  4NM1 A;  8ICV A;  8ICS A;  2O6K A;  3PX6 A;  1DK2 A;  4ECQ A;  5CR0 A;  4QZB A;  1N60 A;  2K89 A;  4EYI B;  5DB7 A;  1UA1 A;  2KZ3 A;  4I2E A;  4P0Q B;  5AKY A;  2F77 X;  1F44 A;  1ZD5 A;  3M8R A;  5ALN A;  5J2D A;  5B66 U;  5CEH A;  1PVQ A;  4Q8E A;  7ICT A;  4QZC A;  1SGG A;  5JTI A;  1SKS A;  5KG1 A;  5KFJ A;  5KFD A;  2IOF K;  3IN5 A;  3RAQ A;  5JRT A;  5T14 A;  3GV5 B;  1ZQT A;  4UAY A;  4DL4 A;  3MR2 A;  4UB1 A;  3TAC B;  1B22 A;  4Z6C A;  4RQM A;  5ALD A;  4EEL A;  4QW9 A;  5GTH U;  2IA6 A;  4QZI A;  2JZB B;  2FMS A;  3KHR A;  4Z6F A;  2AGP A;  1RXV A;  9ICI A;  4F72 A;  2AQ0 A;  4OJP A;  1TV9 A;  1NZB A;  4YD1 A;  2GLE A;  4I2C A;  5DG8 A;  4B9S A;  4R8U B;  1S77 D;  2BCS A;  4RNO A;  3LVW A;  4FZM A;  4LZD A;  4JV1 A;  4DQQ A;  4KLD A;  3PR5 B;  2W3R A;  5KFE A;  1FFV A;  3BJY A;  1X9X A;  2QB0 B;  3SZ2 A;  3C1Y A;  2B21 A;  2BDU A;  1ZQE A;  4F3O A;  5EWE A;  2XY7 A;  8ICK A;  4F5R A;  3V7L A;  1NOM A;  2VJ4 A;  1Z19 A;  4P4O A;  3RAX A;  4DL7 A;  2C22 A;  5KFV A;  3C5F A;  2WB1 C;  4QZE A;  3PZP A;  1RQN A;  1L3V A;  1T3N A;  1RYS A;  1ZQM A;  2KEY A;  2G5H B;  4OO1 J;  3QEA Z;  2DGZ A;  3A0B U;  5HR7 A;  2CXY A;  3MAB A;  2PKE A;  3Q8P B;  1NK4 A;  1ZJN A;  2KD1 A;  2IHN A;  3TAR A;  1NI3 A;  1B4F A;  1N5X A;  4KLL A;  2V4Q A;  3H8S A;  1ZQH A;  3NVZ A;  5KFT A;  3L5K A;  5KFL A;  1XSL A;  2BCR A;  4PZN A;  3MGI A;  3SR6 A;  1F5S A;  5KFN A;  2W8L A;  2KHV A;  4ELV A;  3RRH A;  4UW9 A;  4B9N A;  1X9S A;  5J2H A;  4O3R A;  4Y2Q A;  2NO4 A;  1ZQJ A;  1D8L A;  4RQ0 A;  4IQW A;  2BCQ A;  2JH1 A;  1FEZ A;  3N97 B;  4KLI A;  5ALV A;  3KOO A;  4I2B A;  2H3Q A;  3RB0 A;  1U48 A;  1EXN A;  2JRZ A;  2KSO A;  2NRT A;  2KE7 A;  4US8 A;  2E8P A;  2PMZ C;  3WK5 A;  3ZDA A;  3GU3 A;  3Q8L A;  4ED0 A;  5ALG A;  4B9M A;  7ICJ A;  5IIK A;  5KT5 A;  3H4B A;  5JUM A;  4O9M A;  2AGQ A;  4C80 A;  2Y1I A;  4DFD A;  5L9X A;  2DFL A;  2M9N A;  2FJ6 A;  2W8K A;  4PJ0 U;  1WWV A;  2E8M A;  4I28 A;  2KN7 A;  2GOL A;  5DBB A;  3C21 A;  4MFA A;  4OJL A;  4MHV A;  1VJ5 A;  5IIN A;  8ICU A;  4OJ6 A;  4YMM A;  1TVA A;  2AJQ A;  2BQ3 A;  1ZQL A;  3CRX A;  2MSN A;  4QZD A;  1L8L A;  1S0O A;  4NXZ A;  4Z6D A;  4RT3 A;  9ICV A;  8ICB A;  4EEN A;  5J8Y C;  3PR4 A;  4Q43 A;  4DSE A;  4EZ9 A;  5KFI A;  5A0L A;  1IIP A;  3LVV A;  1UQV A;  1U9L A;  4C7Y A;  4ECZ A;  1Z00 A;  7ICP A;  1HUZ A;  3RRG A;  3E58 A;  3V7K A;  4J9M A;  1Z3E B;  5CWR A;  2BPC A;  5G5H A;  2G5I B;  5ALQ A;  4F92 B;  2PFO A;  2DPJ A;  3RR8 A;  5KAF U;  4ECX A;  3KHL A;  2KSO B;  8ICA A;  1T3Q A;  4AYB C;  9ICX A;  5AI8 A;  4I2F A;  1CEZ A;  4NL9 A;  1PK3 A;  1N5W A;  2XY5 A;  3C29 A;  2HHX A;  3H8J A;  4DF4 A;  2ISO A;  5G5G A;  2ESE A;  4KX5 A;  1Q3V A;  4RPZ A;  1HIW A;  4YR3 A;  2GWS A;  4KLE A;  2PFN A;  2NRZ A;  5DGB A;  4EZ6 A;  1X6J A;  5CJ7 A;  2F8K A;  4QJF B;  2BDP A;  3H8M A;  4DLE A;  3KKA C;  5KFC A;  3K4G A;  4ZH4 A;  4ACO A;  1T7P A;  2HOI A;  1NK8 A;  1NK5 A;  2KKV A;  4M6W A;  3NAS A;  2R18 A;  2BQU A;  3RJI A;  5KFA A;  8ICL A;  1HUO A;  3GIM A;  3M9M B;  3KZI U;  4I29 A;  1ZD3 A;  1Z00 B;  1JN3 A;  3F5A A;  1QTM A;  9ICL A;  4NLK A;  4QZ8 A;  2HI0 A;  3SAH A;  2BZF A;  1BPX A;  3L3F X;  5AKZ A;  5DBC A;  2HBM A;  4Z6E A;  1TK8 A;  2YMP A;  3WK7 A;  3CNH A;  3BZK A;  1ZQX A;  5HNK A;  4RPY A;  5EWG A;  4M2Y A;  3C2M A;  2JEI A;  2UVW A;  2W7O A;  3C5G A;  2Y1J A;  4YVZ A;  2ZIU B;  1KTQ A;  1QQ5 A;  2VAN A;  4M9J A;  5L1J A;  3M1Y A;  5L1K A;  1BPE A;  4EBE A;  2KHQ A;  3WK4 A;  3UM9 A;  2LMR A;  1JX4 A;  4C7Z A;  2Y9U A;  5KL1 B;  3F2C A;  8ICT A;  4TUQ A;  3D2Q A;  2YB4 A;  3J81 j;  3BQ1 A;  4CDG A;  9ICM A;  5AI6 A;  2HHT A;  3C2K A;  2ISP A;  5AIB A;  4OJ5 A;  3ZDE A;  3EYZ A;  4M47 A;  3KTQ A;  2PXI A;  8ICG A;  4R65 A;  2P6R A;  1V97 A;  2ZJA A;  4RU9 A;  4RQ3 A;  1N56 A;  4UAR A;  1L5U A;  1DXS A;  4QIW F;  4R63 A;  3C1Z A;  3EW9 A;  5ALX A;  4G3I A;  4XUS A;  5C0Y A;  3QU2 A;  1T8E A;  4UBC A;  1LKY A;  8ICM A;  2NV3 A;  1ZQZ A;  4PGY A;  1X40 A;  2K4P A;  1D8B A;  1UA0 A;  2KJ5 A;  2KVS A;  4R66 A;  1SL1 A;  2UVV A;  2QB1 A;  3MFI A;  5ALF A;  5J2C A;  1L7M A;  3WKC A;  1L7N A;  3DV9 A;  3OJU A;  3HWT A;  3BZC A;  3M9N B;  3QYP A;  3D2S A;  4XQ8 A;  3Q8S B;  1QSL A;  2JXJ A;  2FLN A;  2KZZ A;  4ECY A;  3GZF A;  2HOF A;  2HVI A;  7ICS A;  5DLG A;  2WF6 A;  1PVP A;  1K1Q A;  2WF8 A;  1NK7 A;  2UVU A;  1ZXI A;  3VCB A;  3FDS A;  2H3V A;  2WF9 A;  3Q8Q B;  4CF4 A;  2BCV A;  5KT3 A;  2WHE A;  2ODG A;  3H4D A;  4M9G A;  3HJE A;  4NLB A;  2V9W A;  4DL3 A;  4J9L A;  3GIL A;  2EAN A;  5AI9 A;  3GII A;  2VA8 A;  4US9 A;  3TQ1 A;  2K8B B;  4RQ7 A;  4DSF A;  2QAR A;  4QZA A;  3ETR A;  2EH9 A;  3TAD A;  4DS4 A;  4RUC A;  4FZN A;  3WK9 A;  3H40 A;  1NKE A;  4P4P A;  1MN8 A;  4FE3 A;  1ZQB A;  4PHA A;  3ZD9 A;  4CCH A;  1SZH A;  1UT5 A;  3GIK A;  1ZYQ A;  2CN1 A;  4MFF A;  5J2E A;  3TAP A;  4CNQ A;  1QQ6 A;  3QU7 A;  2ZIV B;  3HW8 A;  4ECR A;  2AXT U;  3HKZ F;  5DB9 A;  4J9Q A;  2G06 A;  1ECW A;  4C8M A;  4DEZ A;  3RJF A;  1SKR A;  1JXL A;  3RB4 A;  4NM2 A;  1C7Y A;  4LZG A;  2W9M A;  5HR6 A;  1IM4 A;  2EZX A;  2K4H A;  9ICA A;  2ZUC A;  3UMG A;  3NUQ A;  4Y2X A;  4ECV A;  4PHE A;  5CHG A;  4ED2 A;  5KG6 A;  1KN5 A;  4IL6 U;  2ZTE A;  1SL0 A;  1XU4 A;  3B0X A;  3UXP A;  4KLO A;  2FMQ A;  4RT2 A;  5ALM A;  4RQ5 A;  2AQ4 A;  4MFC A;  2NRX A;  4C8N A;  3SV4 A;  2FI1 A;  3JPQ A;  7ICG A;  4UAU A;  4DL5 A;  2W3S A;  5CRX A;  1DOQ A;  2FPK A;  1J2N A;  4EBC A;  2G07 A;  2P66 A;  4K4I A;  4DSK A;  3ED5 A;  4YR2 A;  2JEF A;  1ZD4 A;  2XI9 A;  3ICX A;  5DKW A;  1KKX A;  2HBK A;  3MDA A;  4KLF A;  5IIO A;  1ZET A;  4I2I A;  5KG4 A;  4DQI A;  4KLT A;  1ZQS A;  3AL0 B;  2ASJ A;  1KRP A;  4EX7 A;  3BQ2 A;  1M6Y A;  1BPY A;  3I28 A;  4X5V A;  1IXR A;  1TAM A;  3TKA A;  3WK8 A;  1KDH A;  4KIT B;  2W54 A;  2KV2 A;  4O5K A;  2NRV A;  3F5E A;  2KIW A;  1ZRN A;  4Y2S A;  4XA5 A;  3AM9 A;  1RM6 C;  1WCL A;  4DQR A;  1ZQO A;  3K1Z A;  2G08 A;  2KJ8 A;  4PHP A;  5J0P A;  4QWA A;  2YN4 A;  5EE9 A;  2KTQ A;  3LWL A;  1L7O A;  5J0U A;  4GXI A;  2VA3 A;  4LJX A;  5ALO A;  2E8O A;  5KFB A;  2IBK A;  3N7P D;  3V6H A;  5AK6 A;  1U45 A;  4PZO A;  5AKX A;  4UB3 A;  4BXO A;  5AK3 A;  3PV8 A;  1UT8 A;  1Q3U A;  4RQ1 A;  2W7P A;  1NZP A;  3SQI A;  5HHI A;  3RH5 A;  1YZ6 A;  1N48 A;  4DFK A;  5DB8 A;  2FLP A;  3QNM A;  5J2B A;  4M0A A;  2KP7 A;  2Q0Z X;  4UAT A;  5CP2 A;  4U6P A;  4YQW A;  3QUB A;  3H0R B;  3BS5 A;  2KFN A;  1Z1V A;  3TI0 A;  3RF9 A;  1BVS A;  2AH5 A;  2E1F A;  4JB3 A;  4KN7 A;  1T94 A;  3CYM A;  8ICF A;  3FYH A;  3QE9 Y;  3UPQ A;  4J9O A;  3THV A;  2WFA A;  3KD3 A;  4RUA A;  1ZJM A;  1D9F A;  2KKP A;  1RYU A;  2JR5 A;  3IP4 B;  4QIW C;  4B9T A;  2FMP A;  4I2D A;  3QUT A;  3IRU A;  4Y2U A;  4ED8 A;  2JGA A;  4F4X A;  3SV3 A;  5AI4 A;  2W03 A;  5DBA A;  3HX0 A;  4M9L A;  2HHV A;  5EE3 A;  4FBT A;  1S0V A;  4CGZ A;  3T5J A;  1NK0 A;  4C8K A;  1B43 A;  2RDI A;  2J6T A;  2HVH A;  4NWI A;  5J0W A;  4O3O A;  2PFQ A;  3NVY A;  2K8C B;  2WF7 A;  4KLQ A;  2R8H A;  5DLF A;  3Q8K A;  3RBD A;  4Q8F A;  2C2R A;  1FIQ A;  2P6U A;  4PL1 A;  2JEJ A;  1ZQY A;  3LWM A;  4QZG A;  1V85 A;  1XO1 A;  4YMN A;  2PI5 A;  1NK6 A;  4I2G A;  4ZOH C;  4I2J A;  3F2D A;  1DK3 A;  1JRP A;  9ICT A;  1F0M A;  4OD0 A;  4ED3 A;  1NJY A;  3AEV A;  3PVX A;  2DWQ A;  5FP0 A;  3EUB 2;  5D4B A;  4XRH A;  3BS5 B;  4I2A A;  4HAI A;  2HDO A;  7ICE A;  4C4R A;  4MEY A;  7ICR A;  1N63 A;  2IOF A;  3FC4 A;  1WYG A;  5AKG A;  2ATL A;  1S5L U;  1RG6 A;  3C23 A;  9ICR A;  2XID A;  3JPN A;  4NV0 A;  2ZJ8 A;  5AM3 A;  4UB2 A;  2V4R A;  1KL9 A;  3SD7 A;  5AM2 A;  4O5C A;  5L1L A;  3RTV A;  3H8W A;  4DCC A;  4Q45 A;  3V7J A;  2YQE A;  1XSN A;  2XCP A;  2KFZ A;  4DFP A;  4UAW A;  5KG7 A;  4QZF A;  1TK0 A;  1JRO A;  4HYK A;  3ZD8 A;  1OXJ A;  1HJP A;  1UCV A;  5KFO A;  3HKZ C;  4G9B A;  7ICO A;  4FS1 A;  2HHS A;  9ICE A;  4CF5 A;  2R8J A;  5AKH A;  4Y2P A;  3ISD A;  3TFS A;  3B9J A;  1YZ7 A;  3A0H U;  1Q46 A;  2FDR A;  3MGH A;  3QU5 A;  5ALH A;  2Y0S F;  2GH1 A;  5J8Y A;  2OM6 A;  2LYB A;  1BGX T;  2XGP A;  3JPR A;  2KVC A;  3RJK A;  2W11 A;  4PGQ A;  4DFM A;  2XGQ A;  3AMZ A;  2K60 A;  2KIC A;  5K4L A;  3SI8 A;  4DOC A;  2H3F A;  2ZXI A;  2ALZ A;  3RJJ A;  2ASD A;  5ALJ A;  4E0D A;  2RQ5 A;  2K4E A;  3RJE A;  2BQR A;  5KTQ A;  3GDX A;  2E3T A;  5ALW A;  1LV5 A;  7ICM A;  1O08 A;  4IR1 A;  1JAL A;  1SV0 C;  3BQT A;  3N7S C;  7ICQ A;  4F93 B;  2R8G A;  3TAQ A;  8ICE A;  4UBB A;  4O3Q A;  1QLN A;  2QKQ A;  2DQN B;  2VJ5 A;  5KFX A;  5KFY A;  3CW2 C;  1ZRM A;  2KZM A;  4DSL A;  4RQ2 A;  3JPS A;  2BGW A;  3GV8 B;  4Y2Y A;  1RDF A;  3KKA A;  5KFH A;  3HPO A;  4BGD A;  3IV6 A;  4RZR A;  1A76 A;  1ZQ1 C;  4A8E A;  5HMM A;  3RFA A;  7ICN A;  8ICQ A;  4O5E A;  4QW8 A;  2DPI A;  2MA1 A;  4GIB A;  5CA7 A;  2FPM A;  4NLG A;  2E1E A;  1BNO A;  3WKD A;  3TAN A;  3JPO A;  2Y9T A;  3LK9 A;  1SZP A;  2CRX A;  4YP3 A;  3MFH A;  2MU2 A;  1XO0 A;  1HEK A;  2JHD A;  1SWV A;  3EWA A;  4RNN A;  1O03 A;  3QU4 A;  5BPC A;  2GO7 A;  2YY6 A;  3ZDB A;  3JPP A;  4GC7 A;  2BKE A;  9ICO A;  2H3Z A;  3VC8 A;  3PW4 A;  1KW4 A;  2KK0 A;  4FFD A;  4CRX A;  4DSJ A;  1U49 A;  7ICF A;  1KEJ A;  2VA2 A;  4QZH A;  3PMN A;  3IM1 A;  3G6V A;  3V72 A;  5HHH A;  2WTF A;  1D8Y A;  1NKC A;  1COO A;  1S76 D;  4NY8 A;  4FZL A;  2EQY A;  5IIM A;  5HP4 A;  3AN1 A;  2JMG A;  8ICP A;  4M6W B;  2WAQ F;  3QZ7 A;  4Y2R A;  1ED1 A;  3UQ0 A;  1AQ6 A;  4FBU A;  3PNC A;  1JI7 A;  5KFQ A;  3MR6 A;  3KFU F;  3CP8 A;  7ICI A;  3SEN A;  4JV0 A;  5JU5 A;  2UVR A;  1KBU A;  5KG2 A;  4TQS A;  4F4K A;  3NVW A;  2LYH A;  5D49 A;  3K1R B;  3GFK B;  3T5H A;  1K1S A;  2C2D A;  1KFS A;  1L3T A;  1ZQD A;  1OUQ A;  3PML A;  1SWW A;  4BX9 C;  1T4G A;  3NRZ A;  5ALI A;  2R8K A;  2HOQ A;  4C8L A;  2PI4 A;  1BPB A;  1NNL A;  3WKE A;  4P0P A;  4DL6 A;  9ICW A;  3WKB A;  2MUT A;  3JPT A;  4O3P A;  1J2M A;  1KQQ A;  1KSP A;  3MC1 A;  4DLG A;  9ICN A;  4KLH A;  1DGJ A;  4IRC A;  2ZJ5 A;  4TUP A;  3AU2 A;  1ZQA A;  3EPI A;  1KFD A;  5J2J A;  2Q4T A;  1RYR A;  5J2F A;  5C5J A;  3PSF A;  2AHO B;  2XC9 A;  4F5P A;  2LBO A;  2KG5 A;  4DL2 A;  2AU0 A;  4J9K A;  1WG8 A;  4C4T A;  1LKY B;  4USA A;  4YN4 A;  3ORY A;  1Y88 A;  2D6F C;  3QZ8 A;  2HCF A;  1JUD A;  9ICF A;  9ICG A;  9ICJ A;  2OCE A;  4DQS A;  1PK1 A;  2RP5 A;  5DGA A;  2XO7 A;  5DQH A;  1OW5 A;  2K4I A;  2NO5 A;  1U4B A;  5CB1 A;  4ED1 A;  5ALL A;  1L8O A;  4F4Y A;  4EX6 A;  4F8R A;  1IV8 A;  3ALR A;  5IIL A;  7ICK A;  5F9L A;  2YB1 A;  2C2E A;  4C8O A;  4RQN A;  2HBJ A;  1L6N A;  2I9G A;  2MUT B;  2Y0S C;  3QU9 A;  8ICI A;  4BWJ A;  4KLG A;  2W9A A;  3GIJ A;  2HBL A;  2H5X A;  5D46 A;  1L7P A;  5J2K A;  5BOL A;  4JWM A;  4KLM A;  5EOZ A;  3BS7 A;  1ZQI A;  2D8C A;  1B0X A;  3MR3 A;  1ZQG A;  2QAR B;  4TUR A;  4J9N A;  5AKL A;  1N61 A;  1QSS A;  3I1Y A;  1NJZ A;  2RLT A;  2FE9 A;  2XIC A;  4GLX A;  4Y2T A;  2DUY A;  3GQC A;  9ICU A;  3UMC A;  4Y2J A;  5AKJ A;  1TFR A;  4UB4 A;  2ASL A;  2J6S A;  4IS7 A;  1ZOL A;  3NGD A;  1ZQP A;  4ED6 A;  5TZV A;  1C20 A;  3MDC A;  4DOB A;  3NS1 A;  2KNJ A;  3V6K A;  5KT7 A;  3RH6 A;  5F3X B;  2VKQ A;  5DG7 A;  5J0Q A;  9ICH A;  2KOB A;  4ECU A;  1ZQQ A;  3OSP A;  3WU2 U;  3DEE A;  3FAH A;  4RQ6 A;  4DO9 A;  2JEG A;  5KL8 B;  4GFJ A;  4F91 B;  3ISB A;  4F50 A;  3OGU A;  5KG3 A;  1A77 A;  4EYH B;  2HW3 A;  2RRD A;  4ECT A;  1WUD A;  3OJS A;  5TIS U;  4M04 A;  4YXM A;  5KAI U;  5L1I A;  3PW5 A;  3ZDD A;  3DDH A;  4YR0 A;  1PUZ A;  3M9O B;  8ICJ A;  1ZQN A;  4Q44 A;  7ICV A;  5AHX A;  4AP9 A;  4EEK A;  2ZUB A;  1RQL A;  3IG5 A;  4J9S A;  2FPL A;  4O3M A;  2YMM A;  1L3S A;  4YFK A;  1DRG A;  4K4G A;  3SMV A;  4KMU A;  1SXD A;  2ZUD A;  4B9U A;  3B0Y A;  4IC9 A;  3PY8 A;  1X9W A;  2ZIX A;  4JWN A;  3U26 A;  8ICY A;  1UPH A;  1WCN A;  4JK1 A;  3LDA A;  4J9R A;  4F71 A;  5J2G A;  2B0C A;  1SIJ A;  5EE0 A;  4UAZ A;  1X6I A;  2OYY A;  9ICS A;  1ZQU A;  5ALE A;  2DL0 A;  1XS9 D;  2W04 A;  2W9B A;  4QWC A;  1QSY A;  2WAQ C;  1DGS A;  1TAQ A;  3O0F A;  3V6J A;  3QUC A;  2BR0 A;  4JMU A;  4DF8 A;  2BCU A;  2F76 X;  4FO6 A;  3KBB A;  1A6S A;  3RH4 A;  3M6K A;  1RZT A;  4UB5 A;  4QNL A;  1SXE A;  1QQ7 A;  5KFR A;  2LHT A;  5DG9 A;  4UB8 U;  2DKX A;  4B6J A;  4BXO B;  4ED7 A;  9ICK A;  1MA7 A;  5J2I A;  4JUZ A;  4BWM A;  4KN4 A;  4PL2 A;  2P35 A;  5J0R A;  4QWD A;  4O3S A;  9ICC A;  4PH5 A;  3BDP A;  3C28 A;  5KFP A;  3NRW A;  3AQE A;  3LYS A;  3EZ5 A;  4YXJ A;  5KT6 A;  3OHB A;  5KFW A;  1X9M A;  4CF3 A;  8ICO A;  2BPF A;  2OWO A;  5DQG A;  1Q8K A;  3HIL A;  4P4M A;  7ICH A;  2HHU A;  5KFK A;  2ZIX B;  1JIH A;  5ALR A;  4NLZ A;  3F2B A;  5L1M A;  2VIX A;  1QH9 A;  4NJ8 A;  3G6X A;  1CUK A;  3NVV A;  4ICA A;  5III A;  3QUQ A;  5DQI A;  9ICP A;  4B9V A;  4MF2 A;  2KJ9 A;  5HML A;  2L5Y A;  2W9B B;  1ZQR A;  3T3F A;  4BUG A;  2C28 A;  2EAM A;  5J0S A;  3Q8M A;  2R8I A;  4F5N A;  4RPX A;  1URJ A;  3OSN A;  2PFP A;  1TE2 A;  3N28 A;  1MC8 A;  3PST A;  3T5L A;  2E5S A;  1BPD A;  4UAS A;  3S6J A;  1VDV A;  8ICH A;  4QZ9 A;  2LI6 A;  2G09 A;  1ARO P;  5KNI A;  3M7D A;  1BPZ A;  3RR7 A;  4IR9 A;  2KMD A;  4U7C A;  4TUS A;  4KLJ A;  4RQ8 A;  1XSP A;  3UXO A;  2OHF A;  4YD2 A;  2I1Q A;  2HHW A;  3GV7 B;  4KTQ A;  1BNP A;  5J0T A;  5ALP A;  4F4W A;  4F4Z A;  3D2N A;  1ZD2 P;  4GXK A;  1ZQK A;  2EDU A; 
#chains in the Genus database with same CATH homology
 4PJ0 U;  5KAF U;  5B5E U;  3A0B U;  2AXT U;  5GTH U;  5E79 U;  2DUY A;  1S5L U;  5TIS U;  4IL6 U;  3KZI U;  3A0H U;  5GTI U;  5KAI U;  5H2F U;  3WU2 U;  4UB8 U;  4UB6 U;  5B66 U; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...