5B66U

Crystal structure analysis of photosystem ii complex
Total Genus 34
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
34
sequence length
97
structure length
97
Chain Sequence
ELVNVVDEKLGTAYGEKIDLNNTNIAAFIQYRGLYPTLAKLIVKNAPYESVEDVLNIPGLTERQKQILRENLEHFTVTEVETALVEGGDRYNNGLYK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Electron transport, photosynthesis
molecule keywords Photosystem II protein D1
publication title Two Different Structures of the Oxygen-Evolving Complex in the Same Polypeptide Frameworks of Photosystem II
pubmed doi rcsb
total genus 34
structure length 97
sequence length 97
chains with identical sequence u
ec nomenclature
pdb deposition date 2016-05-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
U PF06514 PsbU Photosystem II 12 kDa extrinsic protein (PsbU)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.320 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 Photosystem II 12 kDa extrinsic protein 5b66U01
5B5EU 5KAFU 2DUYA 5GTHU 4UB8U 3KZIU 3A0BU 5E79U 2AXTU 5H2FU 5GTIU 1S5LU 5KAIU 4IL6U 3A0HU 3WU2U 5TISU 4UB6U 4PJ0U 5B66U
chains in the Genus database with same CATH superfamily
7ICTA 4DSKA 9ICCA 2EH9A 3KBBA 3GIIA 1UHUA 4F8RA 1SWVA 2ZXIA 1ZD2P 5HMMA 3RBEA 3D6JA 4JV0A 7ICPA 3PVXA 7ICOA 1SL1A 1WCNA 1N60A 3OSPA 5EE3A 1T8EA 3ISCA 4QZ9A 3KZIU 2A1JB 4RUAA 2Y9TA 9ICUA 3ICXA 4UQGA 1ZQTA 3CRXA 2V9WA 5DLFA 4FBTA 2W03A 2YMPA 1S97A 4EX7A 5KG6A 5KL1B 4BUGA 4LZDA 4I2FA 1M6YA 1SXEA 4GXJA 4UAUA 1SKSA 3UQ0A 4K4HA 1MN8A 4RQ5A 4DQQA 1S0VA 2O6KA 4YD2A 3FM9A 3UQ2A 4US9A 4B9VA 4YMOA 2JZBB 3F2CA 1GO3F 5JU5A 2E5SA 1S76D 5KFNA 3WK9A 2Q4TA 1Z4OA 4O3RA 3LDAA 1NNLA 2J6TA 5GTHU 3RR8A 3N7SC 2ES6A 3WK7A 5BOMA 2YY6A 4F3OA 3C28A 3JPOA 2DKXA 3ONNA 5AI8A 1TAUA 4F4WA 3K75D 4ECVA 1KN5A 3Q8SB 1T94A 3RTVA 9ICIA 4F5PA 2HOFA 2FE9A 2EZYA 4OJPA 2ATLA 3UM9A 5CA7A 7ICIA 1X9SA 4XRHA 3H0RB 3SMVA 2XC9A 4P4MA 1QSYA 4FZNA 4F4YA 3LWLA 5F9NA 2ZG6A 3H8WA 1ZQOA 2CRXA 4Y2RA 2DPJA 1MQ3A 2KIWA 3LVWA 4ECWA 3C23A 3I28A 3ZD9A 3EWAA 3QU5A 5CWRA 4O5EA 2FLLA 1X9XA 2UVWA 4PJ0U 3RR7A 1JALA 1UCVA 3EPIA 4KLGA 2BQRA 2AQ0A 4OJ5A 4C4SA 4YVZA 5KFHA 2FPMA 2HBMA 2HVIA 1QTMA 1KL9A 1ZRMA 5ALIA 4M9GA 3TFRA 1V85A 3NTUA 5AM3A 5L1JA 4C8MA 2YMMA 1YT3A 2R8IA 4KLIA 5IIIA 2DWQA 2HSZA 3M7DA 2XO7A 2R8HA 1XSPA 2PI5A 1QLNA 5KT2A 2VKQA 2ODGA 4G9BA 4GXIA 2H3VA 5KG4A 9ICRA 3ISDA 2GLEA 1ZQHA 4JWNA 3BQ7A 2P35A 5KNIA 3TADA 2K4IA 2NRWA 2P6UA 1LV5A 2XGPA 4ED2A 2F3NA 1RXVA 4C80A 1PVPA 2AGQA 4P2HA 4QWEA 1JUDA 2E8PA 3V7LA 1QQ5A 4YCXA 4PH5A 1ZQBA 4O5CA 2KN7A 2R8GA 1NZPA 1TV9A 1CEZA 3UPQA 1A0PA 1VLBA 1KTQA 4Y2VA 1NK7A 3RB4A 3HILA 3BQ2A 4UW9A 3AU6A 5KFCA 4DFPA 5KG0A 2PI4A 1DGSA 2I6XA 5E79U 1QQ6A 2WAQC 4NL9A 1HUZA 1YZ7A 4IR9A 1BPXA 2F8KA 4BWJA 4R8UA 4RZRA 1HIWA 1F0MA 2KJ8A 2K8BB 2EAMA 5J2DA 3IDWA 5AKEA 4EEYA 1D8YA 1X9MA 2KHQA 5CHGA 4O3MA 4UAZA 1CRXA 4O3QA 5J2EA 4JV1A 1KFTA 2IHNA 9ICMA 2J6SA 5DBBA 3AMZA 4CNQA 5AM5A 5IILA 5DQGA 3G6VA 2KZMA 1Q3UA 2OHFA 2F76X 4KLTA 4QZHA 5CB1A 1ZQWA 2VJ5A 1X9WA 4UBCA 2LPEA 5ALMA 4B9NA 3C2LA 1IV8A 3PMNA 4DS5A 1XS9D 3Q8KA 4DFMA 1L3UA 4R64A 4F2SA 4CF5A 4IRDA 4KLSA 4EYIB 5B66U 5J0TA 1Z00A 2HBLA 8ICVA 1UA0A 3V7JA 2ZIWA 8ICNA 2W9BB 3HP6A 3C1YA 2AGOA 1FEZA 7ICKA 4C7YA 5HMLA 5AM0A 1Z3EB 1D9FA 3AQEA 2KG5A 3OHBA 4O5KA 3PW0A 3GDXA 4FZLA 1QCKA 4UARA 4B9UA 4GFJA 3M9OB 4Y2XA 8ICCA 1ZQJA 3Q8RB 5AIBA 3BJYA 3E0FA 4BXOB 3NRZA 5B5EU 2KOBA 3ORYA 2D3DA 3QU9A 3BZKA 4KX3A 4J9QA 4ZH4A 3T3FA 4YR3A 3ZDCA 2KSOB 1ZQQA 4YR2A 4IRCA 1HUOA 2WAQF 4Q8FA 4NM1A 1S77D 3M8RA 1SZHA 4TUQA 5J29A 3BQ1A 7ICGA 1RYUA 2MA1A 1SXDA 4E0DA 4Z6CA 2VANA 1JMSA 4DLGA 4I27A 9ICHA 1DRGA 4PHAA 1L7OA 4NLCA 5KL8B 4F72A 2FLPA 2PFNA 3RAQA 5J0YA 4O3SA 2KD1A 1NKCA 5F3XB 5KFDA 1UT5A 2F8LA 1N2XA 3JPRA 4XA5A 1L3VA 3MGIA 2KZZA 3WKBA 4C8OA 3H8JA 5KFXA 5ALNA 3RJKA 3NVVA 4U6PA 5KFLA 3SZ2A 3OTQA 1S9FA 2EANA 4NLGA 5AI6A 4PHDA 5J2GA 5KFKA 2EZZA 8ICRA 3NASA 1QSSA 4KLMA 1A76A 2EDUA 4DL3A 3ISBA 2NO4A 4HYKA 7ICNA 3HWTA 1ZQGA 4UAVA 3BS5B 5J8YC 5KFOA 4IL6U 1WG8A 4BWMA 4QW8A 4M2YA 5KG3A 2ZJ8A 2KMDA 4JWMA 3G6XA 2F1HA 2XCPA 1URJA 1TVAA 2E8MA 3UMGA 4QZIA 3N7PD 2K8CB 1ZQLA 3QZ8A 2VA8A 4KLQA 2A3VA 4IQTA 4RQ2A 1U49A 1WCLA 2MUTA 5AM1A 2QB1A 3PNCA 2A19A 3SAHA 4RQNA 2WFAA 3M8SA 3H0LB 2G08A 2ZIUA 2A1AA 3PSIA 5JUMA 2QB0B 5AI0A 3IP4B 1RM6C 1DGJA 3I1YA 2XCAA 5KFYA 4RPZA 2W9CA 4K4GA 4RQMA 1UQVA 7ICSA 3EPGA 1COOA 4NJ8A 5J2HA 2FJ6A 2RHFA 5AKGA 2HW3A 1JN3A 1TAMA 2VA2A 4KTQA 3HKZF 3JPPA 4YP3A 2KIVA 1MQ2A 4MF8A 3RJIA 3QX7A 3MABA 3OJSA 1X66A 4C8LA 3AUOA 4UASA 2C28A 1PK1A 2W8KA 1D8LA 4OJ6A 5J0QA 5DQHA 5DKWA 4NLNA 2W54A 2E1FA 4UBBA 3S6JA 1T3NA 5DB8A 3EZ5A 1MC8A 2G0AA 1TK0A 4Y2UA 3WK8A 4Y2PA 2E8NA 2HHVA 1UPHA 1XNSA 3Q8QB 4DFKA 2RDIA 1PVRA 1ZRNA 2XY5A 2ALZA 2ZTEA 2HBKA 3KOOA 3TANA 3H4BA 1RYRA 1L6NA 1VDVA 2BGWA 2EQYA 5KT5A 5KT7A 2NV3A 2YMLA 4TUSA 2G06A 1ZQNA 8ICQA 2RP5A 4GLXA 4JUZA 4R66A 1OW5A 5HNKA 1ZQXA 4P0QA 3RH5A 5J8YA 2HHXA 4ED0A 4RQ7A 3D2NA 3MDCA 5KFBA 4YMNA 1U45A 4YN4A 1L7NA 2ISOA 5IIMA 2PKEA 2C22A 5EE1A 5AIAA 4J9PA 4RUCA 1NJYA 4YXMA 4YXJA 2KE7A 3CP8A 2HHTA 2HOQA 2XVTA 2YTUA 3PO4A 1ECWA 2QLTA 2ZTDA 4IQWA 2R8KA 4MHVA 3C1ZA 1UT8A 5AKXA 5ALFA 1Q3VA 2GH1A 4A8EA 2WHEA 1KQQA 4QWAA 3TADC 5KT3A 4Q8EA 2CN1A 4KMUA 4KLLA 1C7YA 5KFJA 1TE2A 3GIJA 3L4PA 1TK8A 9ICKA 3PY8A 3Q8PB 3SD7A 9ICFA 2LM4A 3PX4A 4DFJA 4OO1J 1SB3C 3PZPA 3PMLA 2Y0SF 2MU2A 1MSWD 4DF4A 3LYSA 4TUPA 2BCQA 4NWIA 1ZD3A 2LM1A 2BQ3A 2K89A 4NY8A 5J0WA 3WK5A 2FMSA 2OH2A 2JRZA 3CW2C 3A0BU 2W11A 3SV3A 3F2DA 4QZ8A 4NL9C 1U4BA 2ZIXA 1X40A 1RQNA 1PZNA 2JR5A 4DL7A 8ICIA 2FPKA 4RQ3A 3RJGA 4Y2JA 3RJJA 2OM6A 3V72A 4TURA 4DF8A 4M04A 2H3QA 4EBDA 2AHOB 5J0SA 3MFHA 3TI0A 3B0XA 2K60A 4I2DA 2QARA 2AJQA 9ICQA 1LKYB 4MFFA 4AYBC 5ALLA 2HBJA 3QEAZ 1XSNA 1ZJMA 4LJXA 3MC1A 1SGGA 8ICSA 2I9GA 3D2SA 4M6WA 3MR6A 5J0UA 4PHEA 5AKYA 2WF5A 4ECYA 3NGDA 4J9LA 4NLBA 1JI7A 1K1QA 3C2KA 1O03A 2KV2A 4P0PB 5FP0A 4UATA 9ICAA 4IRKA 4PZNA 1KBUA 3M6ZA 2PMZC 2Y1JA 2JV3A 3RH6A 3V7KA 4CF3A 3GILA 1SV0C 4LVSA 3K4GA 4C4TA 1HJPA 2F1IA 3T5JA 2KTQA 4BX9C 2ZIWB 1A77A 4MFAA 3LVVA 5L1LA 3GV8B 4DSFA 9ICNA 2WF7A 4NV0A 2ISPA 4K4IA 4RNOA 4MFCA 4UB5A 3LK9A 2A1JA 3ZI4A 4DOBA 3JPTA 1NZBA 1NK8A 1SV4A 3U26A 4QW9A 3PR5B 4O3OA 3T5HA 4RT3A 1X6IA 3SV4A 4BJQA 3QU7A 4EBEA 1FFUA 1RDFA 3PSFA 4PHPA 8ICTA 1ZQUA 3KHRA 1FIQA 2W3RA 2LHTA 2V4RA 5KFTA 1IIPA 5AKKA 2BCRA 2BPGA 4IQUA 2DFLA 3SENA 3NVWA 3JPQA 5ALZA 3GZFA 2HI0A 2XY6A 1V97A 2Y9UA 1BNOA 5J2KA 4DL6A 1J97A 2G07A 3UXPA 3KD3A 1RZTA 5J2FA 8ICFA 5AK3A 2K4EA 5KFMA 4FE3A 5EWEA 4F93B 3MBYA 4AYBF 1NK6A 5J2BA 2BCSA 2E3TA 4DLEA 3J81j 1L7PA 1PVQA 2HHSA 2KICA 3HRDD 5DG7A 9ICVA 3HW8A 1FO4A 1BPBA 1Y88A 5HHHA 3F5AA 3TAQA 2LKYA 5KT6A 1BPYA 3N4MB 2CXYA 2XI9A 1VJ5A 4GXKA 4FBUA 4EENA 5DGAA 4B9TA 1T7PA 1ZQAA 3AEVA 5IIJA 3KHGA 3SYZA 3RFAA 2D6FC 3PO5A 1LVHA 1X42A 3VCBA 2YQEA 3CYMA 4Y2YA 1ZQZA 4PGQA 2PMZF 4PL2A 3FYHA 1H38A 4J9KA 3C21A 2HVHA 3GQCA 5AKJA 1P7DA 3M9NB 3MFIA 2F44A 1SV0A 3RB3A 2M9NA 4EX6A 2BKEA 1NK5A 3V6KA 2Z7JA 2C2RA 4Q43A 3KKAA 1B0XA 3UXNA 4ED8A 2WF8A 1CUKA 2BQUA 5L1IA 3AQFA 2FDRA 2DUYA 2F1JA 1WWVA 2K8AA 1NJXA 2HMXA 5ALVA 1F5SA 1L8LA 4IC9A 4OD0A 4PPXA 4O0IA 3SAFA 5ALDA 1Z4NA 2RRDA 1IXRA 3QUBA 9ICLA 4DEZA 4TQRA 4CDGA 4P4PA 3C2MA 1F44A 5AKIA 2FMPA 1S10A 2W8LA 4ACOA 3RH4A 3DV9A 4RNNA 9ICSA 1D8BA 8ICKA 1ZXIA 1RQLA 4EZ9A 2P6RA 5ALXA 2KJ5A 5ALQA 3IM1A 1SWWA 1N62A 1PK1B 3HKZC 4F5OA 1TAQA 2BHNA 2BCUA 1S0MA 5KFVA 4YFKA 3UXOA 3E2EA 3E58A 4QZDA 1J2MA 4X5VA 2WF9A 3FAHA 4UB8U 5J2CA 4DQPA 2FI1A 4ECXA 4NM2A 3AN1A 3PSTA 3QXGA 1WWUA 2C2EA 3IN5A 2JEGA 3BQ0A 1QH9A 2IMWP 2YN4A 1TKDA 2DQNB 1ZJNA 2GO7A 3AU2A 3RJEA 4QWDA 4Y2QA 4CE6A 3KFUF 3NVYA 4QIWC 4J9OA 2IOFA 1ZD5A 1T4GA 1ZQFA 2VJ4A 3RRGA 2KEYA 5L1KA 8ICXA 2LMRA 2IBKA 4Y2SA 4GC6A 5KFPA 4QJFB 3TAPA 2VA3A 1KKXA 4QZBA 2DF4B 3WKDA 2YB1A 2ESEA 5TISU 4P0QB 5AK6A 5JRTA 4ED1A 2MRLA 3GIKA 4I2JA 5EWGA 1LB2B 5AKHA 8ICAA 4C8NA 5AM2A 3SAGA 1KDHA 1ZD4A 4DOCA 1SL2A 2W9BA 2B6GA 1L8OA 5KFWA 4RNMA 2KFNA 1U47A 2ZIVA 4CGZA 5A0LA 3NVZA 4ZOHC 1JIHA 4JV2A 1ED1A 2RQ5A 1ZQVA 4I2IA 9ICTA 5EE0A 5DDYA 4BXOA 4NLKA 2L5YA 1ZQ1C 3TQ1A 2V4QA 3H7IA 4UB6U 5HHIA 7ICMA 5KTQA 1KEJA 2AU0A 2NRVA 1FFVA 3ZDEA 1XO1A 1BPEA 2WTFA 4F4XA 1KSPA 2ASDA 4DSLA 2R18A 2XGQA 3IV6A 5CJ7A 5KG1A 5KFGA 2KKVA 1OUQA 5H2FU 5ALEA 4J03A 2BPFA 3THVA 3MR3A 2JEJA 3PW5A 8ICMA 4ECSA 2JXJA 4F71A 5KFIA 5K4LA 5CR0A 2OWOA 4Q44A 5ALJA 4DQRA 4OJLA 1KFSA 4B9LA 4JMUA 1ZQYA 4UAYA 3ETRA 3MGVA 4QIWF 2Y0SC 4XQ8A 4TQSA 5AI9A 4UB3A 7ICJA 4PL1A 2KHVA 5J0PA 2P66A 1Q8KA 2PXIA 4I28A 1DOQA 4IQVA 1NOMA 5J0XA 1ZQPA 3H8SA 4DL4A 1N56A 3QU2A 4F4ZA 3TFSA 9ICXA 2WB1C 5T14A 4WJ3B 3RJHA 2HOIA 3C5GA 2NRTA 3HX0A 5KFZA 1RXWA 4UB2A 1BPZA 1CI4A 7ICEA 4J9SA 3M1YA 4MEXA 9ICEA 4AP9A 8ICWA 4EYHB 3RBDA 4P4OA 8ICLA 5C0YA 4F91B 4M9JA 2OYYA 3L5KA 5KT4A 2NRXA 1N63A 3NS1A 3BS5A 3VC8A 2IA6A 1XU4A 2C2DA 2W43A 3PW2A 1QQ7A 1N5XA 4F5QA 3AM9A 5DB6A 3PX6A 5DDMA 1QSLA 4FO6A 4DQSA 2B21A 1COKA 8ICBA 5EOZA 4EBCA 4ECZA 1NKEA 8ICHA 4CF4A 1XC9A 5J2IA 4F5NA 2UVUA 2AXTU 2JH1A 1JX4A 1PK3A 2ZUDA 2ASJA 1T3QA 2AH5A 8ICPA 1B22A 1V38A 2G5HB 2YX8A 2QB0A 1ZETA 3KHHA 3C5FA 2KK0A 5IIOA 4PGYA 4I2GA 3OSNA 2N1RA 2LI6A 1B4FA 1O08A 5G5HA 5KAIU 3PSPA 1AROP 4EELA 3GV5B 1ZQMA 2F77X 4G3IA 3IRUA 3QNMA 2PFOA 3PW4A 2H5XA 4CCHA 1UA1A 3N97B 2AGPA 2WB1F 5CP2A 3WU2U 4B6JA 1KLNA 4R8UB 2JEIA 9ICPA 1Z1BA 2XY7A 5J0OA 3H40A 3TKAA 3BZCA 4ECTA 4YR0A 3AL0B 1BVSA 4KLEA 2PFPA 3HJEA 5DB9A 2W04A 2KVCA 2NRZA 3JPNA 4GC7A 1RYSA 5DG8A 3DEEA 2WF6A 5KFRA 3UMCA 4ELTA 1NK4A 4RQ8A 3N7RC 4RPYA 4M9NA 2EZXA 4RQ4A 4QZEA 4KITB 3T5LA 2DGZA 2E1EA 2GWSA 4FS2A 3QE9Y 4US8A 5GTIU 5ALYA 4KN7A 3PR4A 8ICYA 4U7CA 4FFDA 2YMQA 2LYHA 3ZDDA 3UMBA 3NUQA 2PFQA 3OHAA 5AK5A 3T79A 2HHWA 4YQWA 2BDUA 1Z00B 3GU3A 4I2CA 3F53A 4DSEA 4I2AA 1SKWA 3KKAC 4M9HA 4Y2TA 5IINA 8ICEA 4ECQA 2ZUBA 3RB6A 3DDHA 4I29A 3QZ7A 5DG9A 1NI3A 1Z19A 3QUTA 2HHUA 5AK4A 3QUCA 5KG7A 2EAOA 4J9MA 4B9SA 4UB1A 7ICUA 4C8KA 4KX5A 8ICOA 5ALSA 5KG2A 1ZQSA 4FS1A 1L5UA 4OCZA 4F4KA 5AHXA 2Q0ZX 1DK2A 1KW4A 2JZBA 3WKEA 4ED7A 3SR6A 3B0YA 5ALPA 5D4BA 2H3ZA 3BDPA 2W55A 2UVRA 2E8OA 2H3IA 3SQIA 4J9NA 2JGAA 4ED3A 3ZDBA 5KAFU 2EAPA 2KKPA 3G6YA 3N28A 3MGHA 4IR1A 4OJOA 3HPOA 1YZ6A 1SZPA 3B9JA 9ICJA 4KLFA 1Q46A 4IS7A 3F2BA 4DSJA 4DL5A 4RPXA 1SL0A 2LBOA 4YMMA 5AKLA 2M0NA 4RU9A 1ZQRA 4I2BA 4F2RA 7ICLA 2LYBA 1N5WA 1LKYA 4C0ZA 1IM4A 2CPRA 2J6UA 1ZOLA 4PGXA 3ALRA 2BR0A 4UB4A 4KLHA 7ICHA 4F5RA 2ZXHA 3QU4A 3OJUA 2XICA 2IOFK 8ICUA 2MAXA 1JRPA 3WKCA 1XWLA 4P0PA 1ZQCA 4QNLA 2MSNA 1N61A 3IG8A 2JH7A 5ALWA 3KTQA 4MF2A 3QUQA 5C5JA 5D46A 2W9MA 3FDSA 9ICBA 3SEIA 5CRXA 1A6SA 4QZCA 1SKRA 1DK3A 1S5LU 3MR2A 3CNHA 5DBAA 5ALKA 4RQ6A 4R65A 2FMQA 4Q45A 5KFAA 1KRPA 3F5EA 2MUTB 5EE9A 3ETLA 3IHQB 4ED6A 3TARA 4JK1A 3GV7B 4KLUA 2I5HA 2B0CA 4O3PA 3EUB2 3WKAA 9ICOA 3TACB 4DL2A 1RG6A 4GIBA 2ZIVB 4J9RA 1NKBA 2ZIUB 4PZOA 1KFDA 5ALUA 2K4PA 2HHQA 2BZFA 3HT3A 3H4DA 3RF9A 4RQ0A 2W9CB 2BDPA 3K1RB 4M47A 2JMGA 4R63A 2ASLA 5J0RA 2D8CA 2XIDA 4KN4A 2BPCA 3L3FX 1U9LA 4RQ1A 4Z6DA 2K4HA 9ICGA 3Q8MA 4RT2A 5G5GA 2OEHA 3K1ZA 1NK9A 5KFEA 5IIKA 2NYVA 2GOLA 1J2NA 5ALTA 8ICZA 5ALGA 3RAXA 1AQ6A 3ZDAA 5AKZA 4I2HA 7ICFA 5CEHA 4BGDA 3MDAA 4DS4A 4JB3A 5KFFA 2KP7A 2OXOA 1X2IA 4Z6EA 2KNJA 3MR5A 4QZAA 5TZVA 5ALRA 1U48A 1XO0A 4O9MA 1V9PA 1K1SA 2VIXA 3GIMA 4YD1A 2R8JA 2HDOA 5KFUA 5AM4A 8ICJA 4YG2A 1SIJA 5J2JA 1ZQIA 4ELVA 4FZMA 1S0OA 2DL0A 5DBCA 2KFZA 4Z6FA 8ICGA 4NLZA 3BS7A 3M9MB 2NO5A 3IG5A 4UAWA 2W7PA 4HAIA 1BNPA 3ZD8A 3KHLA 9ICWA 2KJ9A 5JTIA 1OXJA 2ZUCA 4EZ6A 3WK4A 4NXZA 3EYZA 1RPLA 4F92B 1N48A 1ZQDA 5HR7A 3GFKB 1XSLA 1L3SA 4KMOB 3ED5A 7ICVA 3LWMA 4DOAA 2YB4A 4XUSA 1EXNA 2ZTCA 3H0MB 5KG5A 3PX0A 3I76A 5EWFA 2UVVA 1Z1VA 4KLOA 2ZJ5A 3PW7A 4DWIA 1WYGA 4QZGA 2F2AB 2KZ3A 5AI5A 4EEKA 2RDJA 5AICA 4MEYA 3A0HU 4CRXA 3SI8A 1C20A 3FC4A 5AI4A 4LZGA 5BOLA 2OCEA 2KSOA 2Y1IA 5F9LA 1BGXT 2IOHA 3RJFA 1IG6A 2RLTA 2W9AA 3JPSA 1D9DA 1TK5A 1S0NA 1DXSA 5J2AA 2W3SA 7ICQA 4QWBA 4B9MA 4M9LA 5DGBA 4C7ZA 1ZYQA 4F50A 4DSIA 2G09A 3R9KA 5D49A 3EW9A 2ZJAA 4KLJA 2HCFA 5ALHA 2W7OA 4KLDA 4DQIA 2DBYA 1X6JA 4QWCA 1TFRA 5DQIA 2FLNA 4ICAA 4USAA 4DCCA 3OGUA 1PUZA 2LYAA 1S8OA 4ECUA 4M0AA 2IHMA 3WK6A 3C29A 3QYPA 1MA7A 3KZXA 5DLGA 3PV8A 4I2EA 2QKQA 2ZIXB 3D2QA 5KFQA 1WUDA 5HR6A 1NJZA 2H3FA 2AQ4A 3NRWA 1NK0A 4ELUA 3V6JA 3QEBZ 1JROA 2G5IB 1BPDA 1K5OA 1ZQKA 1JXEA 2KVSA 2DKZA 3H8MA 1NJWA 3OPXA 2FPLA 4C4RA 1L3TA 3BQTA 3O0FA 2DPIA 2QARB 4O3NA 2JHDA 5KFSA 5DB7A 3M6KA 5ALOA 5HP4A 5BPCA 5L1MA 1ZQEA 2I1QA 3RB0A 1B43A 5L9XA 4DFDA 1JXLA 4DO9A 2JEFA 1HEKA 4M6WB 2BCVA 4BDPA 3V6HA 3RRHA 4QZFA 3Q8LA 4ECRA 7ICRA 1L7MA 3T5KA
chains in the Genus database with same CATH topology
5B5EU 5KAFU 2DUYA 5GTHU 4UB8U 3KZIU 3A0BU 5E79U 2AXTU 5H2FU 5GTIU 1S5LU 5KAIU 4IL6U 3A0HU 3WU2U 5TISU 4UB6U 4PJ0U 5B66U
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5B5E U;  5KAF U;  2DUY A;  5GTH U;  4UB8 U;  3KZI U;  3A0B U;  5E79 U;  2AXT U;  5H2F U;  5GTI U;  1S5L U;  5KAI U;  4IL6 U;  3A0H U;  3WU2 U;  5TIS U;  4UB6 U;  4PJ0 U;  5B66 U; 
#chains in the Genus database with same CATH topology
 7ICT A;  4DSK A;  9ICC A;  2EH9 A;  3KBB A;  3GII A;  1UHU A;  4F8R A;  1SWV A;  2ZXI A;  1ZD2 P;  5HMM A;  3RBE A;  3D6J A;  4JV0 A;  7ICP A;  3PVX A;  7ICO A;  1SL1 A;  1WCN A;  1N60 A;  3OSP A;  5EE3 A;  1T8E A;  3ISC A;  4QZ9 A;  3KZI U;  2A1J B;  4RUA A;  2Y9T A;  9ICU A;  3ICX A;  4UQG A;  1ZQT A;  3CRX A;  2V9W A;  5DLF A;  4FBT A;  2W03 A;  2YMP A;  1S97 A;  4EX7 A;  5KG6 A;  5KL1 B;  4BUG A;  4LZD A;  4I2F A;  1M6Y A;  1SXE A;  4GXJ A;  4UAU A;  1SKS A;  3UQ0 A;  4K4H A;  1MN8 A;  4RQ5 A;  4DQQ A;  1S0V A;  2O6K A;  4YD2 A;  3FM9 A;  3UQ2 A;  4US9 A;  4B9V A;  4YMO A;  2JZB B;  3F2C A;  1GO3 F;  5JU5 A;  2E5S A;  1S76 D;  5KFN A;  3WK9 A;  2Q4T A;  1Z4O A;  4O3R A;  3LDA A;  1NNL A;  2J6T A;  5GTH U;  3RR8 A;  3N7S C;  2ES6 A;  3WK7 A;  5BOM A;  2YY6 A;  4F3O A;  3C28 A;  3JPO A;  2DKX A;  3ONN A;  5AI8 A;  1TAU A;  4F4W A;  3K75 D;  4ECV A;  1KN5 A;  3Q8S B;  1T94 A;  3RTV A;  9ICI A;  4F5P A;  2HOF A;  2FE9 A;  2EZY A;  4OJP A;  2ATL A;  3UM9 A;  5CA7 A;  7ICI A;  1X9S A;  4XRH A;  3H0R B;  3SMV A;  2XC9 A;  4P4M A;  1QSY A;  4FZN A;  4F4Y A;  3LWL A;  5F9N A;  2ZG6 A;  3H8W A;  1ZQO A;  2CRX A;  4Y2R A;  2DPJ A;  1MQ3 A;  2KIW A;  3LVW A;  4ECW A;  3C23 A;  3I28 A;  3ZD9 A;  3EWA A;  3QU5 A;  5CWR A;  4O5E A;  2FLL A;  1X9X A;  2UVW A;  4PJ0 U;  3RR7 A;  1JAL A;  1UCV A;  3EPI A;  4KLG A;  2BQR A;  2AQ0 A;  4OJ5 A;  4C4S A;  4YVZ A;  5KFH A;  2FPM A;  2HBM A;  2HVI A;  1QTM A;  1KL9 A;  1ZRM A;  5ALI A;  4M9G A;  3TFR A;  1V85 A;  3NTU A;  5AM3 A;  5L1J A;  4C8M A;  2YMM A;  1YT3 A;  2R8I A;  4KLI A;  5III A;  2DWQ A;  2HSZ A;  3M7D A;  2XO7 A;  2R8H A;  1XSP A;  2PI5 A;  1QLN A;  5KT2 A;  2VKQ A;  2ODG A;  4G9B A;  4GXI A;  2H3V A;  5KG4 A;  9ICR A;  3ISD A;  2GLE A;  1ZQH A;  4JWN A;  3BQ7 A;  2P35 A;  5KNI A;  3TAD A;  2K4I A;  2NRW A;  2P6U A;  1LV5 A;  2XGP A;  4ED2 A;  2F3N A;  1RXV A;  4C80 A;  1PVP A;  2AGQ A;  4P2H A;  4QWE A;  1JUD A;  2E8P A;  3V7L A;  1QQ5 A;  4YCX A;  4PH5 A;  1ZQB A;  4O5C A;  2KN7 A;  2R8G A;  1NZP A;  1TV9 A;  1CEZ A;  3UPQ A;  1A0P A;  1VLB A;  1KTQ A;  4Y2V A;  1NK7 A;  3RB4 A;  3HIL A;  3BQ2 A;  4UW9 A;  3AU6 A;  5KFC A;  4DFP A;  5KG0 A;  2PI4 A;  1DGS A;  2I6X A;  5E79 U;  1QQ6 A;  2WAQ C;  4NL9 A;  1HUZ A;  1YZ7 A;  4IR9 A;  1BPX A;  2F8K A;  4BWJ A;  4R8U A;  4RZR A;  1HIW A;  1F0M A;  2KJ8 A;  2K8B B;  2EAM A;  5J2D A;  3IDW A;  5AKE A;  4EEY A;  1D8Y A;  1X9M A;  2KHQ A;  5CHG A;  4O3M A;  4UAZ A;  1CRX A;  4O3Q A;  5J2E A;  4JV1 A;  1KFT A;  2IHN A;  9ICM A;  2J6S A;  5DBB A;  3AMZ A;  4CNQ A;  5AM5 A;  5IIL A;  5DQG A;  3G6V A;  2KZM A;  1Q3U A;  2OHF A;  2F76 X;  4KLT A;  4QZH A;  5CB1 A;  1ZQW A;  2VJ5 A;  1X9W A;  4UBC A;  2LPE A;  5ALM A;  4B9N A;  3C2L A;  1IV8 A;  3PMN A;  4DS5 A;  1XS9 D;  3Q8K A;  4DFM A;  1L3U A;  4R64 A;  4F2S A;  4CF5 A;  4IRD A;  4KLS A;  4EYI B;  5B66 U;  5J0T A;  1Z00 A;  2HBL A;  8ICV A;  1UA0 A;  3V7J A;  2ZIW A;  8ICN A;  2W9B B;  3HP6 A;  3C1Y A;  2AGO A;  1FEZ A;  7ICK A;  4C7Y A;  5HML A;  5AM0 A;  1Z3E B;  1D9F A;  3AQE A;  2KG5 A;  3OHB A;  4O5K A;  3PW0 A;  3GDX A;  4FZL A;  1QCK A;  4UAR A;  4B9U A;  4GFJ A;  3M9O B;  4Y2X A;  8ICC A;  1ZQJ A;  3Q8R B;  5AIB A;  3BJY A;  3E0F A;  4BXO B;  3NRZ A;  5B5E U;  2KOB A;  3ORY A;  2D3D A;  3QU9 A;  3BZK A;  4KX3 A;  4J9Q A;  4ZH4 A;  3T3F A;  4YR3 A;  3ZDC A;  2KSO B;  1ZQQ A;  4YR2 A;  4IRC A;  1HUO A;  2WAQ F;  4Q8F A;  4NM1 A;  1S77 D;  3M8R A;  1SZH A;  4TUQ A;  5J29 A;  3BQ1 A;  7ICG A;  1RYU A;  2MA1 A;  1SXD A;  4E0D A;  4Z6C A;  2VAN A;  1JMS A;  4DLG A;  4I27 A;  9ICH A;  1DRG A;  4PHA A;  1L7O A;  4NLC A;  5KL8 B;  4F72 A;  2FLP A;  2PFN A;  3RAQ A;  5J0Y A;  4O3S A;  2KD1 A;  1NKC A;  5F3X B;  5KFD A;  1UT5 A;  2F8L A;  1N2X A;  3JPR A;  4XA5 A;  1L3V A;  3MGI A;  2KZZ A;  3WKB A;  4C8O A;  3H8J A;  5KFX A;  5ALN A;  3RJK A;  3NVV A;  4U6P A;  5KFL A;  3SZ2 A;  3OTQ A;  1S9F A;  2EAN A;  4NLG A;  5AI6 A;  4PHD A;  5J2G A;  5KFK A;  2EZZ A;  8ICR A;  3NAS A;  1QSS A;  4KLM A;  1A76 A;  2EDU A;  4DL3 A;  3ISB A;  2NO4 A;  4HYK A;  7ICN A;  3HWT A;  1ZQG A;  4UAV A;  3BS5 B;  5J8Y C;  5KFO A;  4IL6 U;  1WG8 A;  4BWM A;  4QW8 A;  4M2Y A;  5KG3 A;  2ZJ8 A;  2KMD A;  4JWM A;  3G6X A;  2F1H A;  2XCP A;  1URJ A;  1TVA A;  2E8M A;  3UMG A;  4QZI A;  3N7P D;  2K8C B;  1ZQL A;  3QZ8 A;  2VA8 A;  4KLQ A;  2A3V A;  4IQT A;  4RQ2 A;  1U49 A;  1WCL A;  2MUT A;  5AM1 A;  2QB1 A;  3PNC A;  2A19 A;  3SAH A;  4RQN A;  2WFA A;  3M8S A;  3H0L B;  2G08 A;  2ZIU A;  2A1A A;  3PSI A;  5JUM A;  2QB0 B;  5AI0 A;  3IP4 B;  1RM6 C;  1DGJ A;  3I1Y A;  2XCA A;  5KFY A;  4RPZ A;  2W9C A;  4K4G A;  4RQM A;  1UQV A;  7ICS A;  3EPG A;  1COO A;  4NJ8 A;  5J2H A;  2FJ6 A;  2RHF A;  5AKG A;  2HW3 A;  1JN3 A;  1TAM A;  2VA2 A;  4KTQ A;  3HKZ F;  3JPP A;  4YP3 A;  2KIV A;  1MQ2 A;  4MF8 A;  3RJI A;  3QX7 A;  3MAB A;  3OJS A;  1X66 A;  4C8L A;  3AUO A;  4UAS A;  2C28 A;  1PK1 A;  2W8K A;  1D8L A;  4OJ6 A;  5J0Q A;  5DQH A;  5DKW A;  4NLN A;  2W54 A;  2E1F A;  4UBB A;  3S6J A;  1T3N A;  5DB8 A;  3EZ5 A;  1MC8 A;  2G0A A;  1TK0 A;  4Y2U A;  3WK8 A;  4Y2P A;  2E8N A;  2HHV A;  1UPH A;  1XNS A;  3Q8Q B;  4DFK A;  2RDI A;  1PVR A;  1ZRN A;  2XY5 A;  2ALZ A;  2ZTE A;  2HBK A;  3KOO A;  3TAN A;  3H4B A;  1RYR A;  1L6N A;  1VDV A;  2BGW A;  2EQY A;  5KT5 A;  5KT7 A;  2NV3 A;  2YML A;  4TUS A;  2G06 A;  1ZQN A;  8ICQ A;  2RP5 A;  4GLX A;  4JUZ A;  4R66 A;  1OW5 A;  5HNK A;  1ZQX A;  4P0Q A;  3RH5 A;  5J8Y A;  2HHX A;  4ED0 A;  4RQ7 A;  3D2N A;  3MDC A;  5KFB A;  4YMN A;  1U45 A;  4YN4 A;  1L7N A;  2ISO A;  5IIM A;  2PKE A;  2C22 A;  5EE1 A;  5AIA A;  4J9P A;  4RUC A;  1NJY A;  4YXM A;  4YXJ A;  2KE7 A;  3CP8 A;  2HHT A;  2HOQ A;  2XVT A;  2YTU A;  3PO4 A;  1ECW A;  2QLT A;  2ZTD A;  4IQW A;  2R8K A;  4MHV A;  3C1Z A;  1UT8 A;  5AKX A;  5ALF A;  1Q3V A;  2GH1 A;  4A8E A;  2WHE A;  1KQQ A;  4QWA A;  3TAD C;  5KT3 A;  4Q8E A;  2CN1 A;  4KMU A;  4KLL A;  1C7Y A;  5KFJ A;  1TE2 A;  3GIJ A;  3L4P A;  1TK8 A;  9ICK A;  3PY8 A;  3Q8P B;  3SD7 A;  9ICF A;  2LM4 A;  3PX4 A;  4DFJ A;  4OO1 J;  1SB3 C;  3PZP A;  3PML A;  2Y0S F;  2MU2 A;  1MSW D;  4DF4 A;  3LYS A;  4TUP A;  2BCQ A;  4NWI A;  1ZD3 A;  2LM1 A;  2BQ3 A;  2K89 A;  4NY8 A;  5J0W A;  3WK5 A;  2FMS A;  2OH2 A;  2JRZ A;  3CW2 C;  3A0B U;  2W11 A;  3SV3 A;  3F2D A;  4QZ8 A;  4NL9 C;  1U4B A;  2ZIX A;  1X40 A;  1RQN A;  1PZN A;  2JR5 A;  4DL7 A;  8ICI A;  2FPK A;  4RQ3 A;  3RJG A;  4Y2J A;  3RJJ A;  2OM6 A;  3V72 A;  4TUR A;  4DF8 A;  4M04 A;  2H3Q A;  4EBD A;  2AHO B;  5J0S A;  3MFH A;  3TI0 A;  3B0X A;  2K60 A;  4I2D A;  2QAR A;  2AJQ A;  9ICQ A;  1LKY B;  4MFF A;  4AYB C;  5ALL A;  2HBJ A;  3QEA Z;  1XSN A;  1ZJM A;  4LJX A;  3MC1 A;  1SGG A;  8ICS A;  2I9G A;  3D2S A;  4M6W A;  3MR6 A;  5J0U A;  4PHE A;  5AKY A;  2WF5 A;  4ECY A;  3NGD A;  4J9L A;  4NLB A;  1JI7 A;  1K1Q A;  3C2K A;  1O03 A;  2KV2 A;  4P0P B;  5FP0 A;  4UAT A;  9ICA A;  4IRK A;  4PZN A;  1KBU A;  3M6Z A;  2PMZ C;  2Y1J A;  2JV3 A;  3RH6 A;  3V7K A;  4CF3 A;  3GIL A;  1SV0 C;  4LVS A;  3K4G A;  4C4T A;  1HJP A;  2F1I A;  3T5J A;  2KTQ A;  4BX9 C;  2ZIW B;  1A77 A;  4MFA A;  3LVV A;  5L1L A;  3GV8 B;  4DSF A;  9ICN A;  2WF7 A;  4NV0 A;  2ISP A;  4K4I A;  4RNO A;  4MFC A;  4UB5 A;  3LK9 A;  2A1J A;  3ZI4 A;  4DOB A;  3JPT A;  1NZB A;  1NK8 A;  1SV4 A;  3U26 A;  4QW9 A;  3PR5 B;  4O3O A;  3T5H A;  4RT3 A;  1X6I A;  3SV4 A;  4BJQ A;  3QU7 A;  4EBE A;  1FFU A;  1RDF A;  3PSF A;  4PHP A;  8ICT A;  1ZQU A;  3KHR A;  1FIQ A;  2W3R A;  2LHT A;  2V4R A;  5KFT A;  1IIP A;  5AKK A;  2BCR A;  2BPG A;  4IQU A;  2DFL A;  3SEN A;  3NVW A;  3JPQ A;  5ALZ A;  3GZF A;  2HI0 A;  2XY6 A;  1V97 A;  2Y9U A;  1BNO A;  5J2K A;  4DL6 A;  1J97 A;  2G07 A;  3UXP A;  3KD3 A;  1RZT A;  5J2F A;  8ICF A;  5AK3 A;  2K4E A;  5KFM A;  4FE3 A;  5EWE A;  4F93 B;  3MBY A;  4AYB F;  1NK6 A;  5J2B A;  2BCS A;  2E3T A;  4DLE A;  3J81 j;  1L7P A;  1PVQ A;  2HHS A;  2KIC A;  3HRD D;  5DG7 A;  9ICV A;  3HW8 A;  1FO4 A;  1BPB A;  1Y88 A;  5HHH A;  3F5A A;  3TAQ A;  2LKY A;  5KT6 A;  1BPY A;  3N4M B;  2CXY A;  2XI9 A;  1VJ5 A;  4GXK A;  4FBU A;  4EEN A;  5DGA A;  4B9T A;  1T7P A;  1ZQA A;  3AEV A;  5IIJ A;  3KHG A;  3SYZ A;  3RFA A;  2D6F C;  3PO5 A;  1LVH A;  1X42 A;  3VCB A;  2YQE A;  3CYM A;  4Y2Y A;  1ZQZ A;  4PGQ A;  2PMZ F;  4PL2 A;  3FYH A;  1H38 A;  4J9K A;  3C21 A;  2HVH A;  3GQC A;  5AKJ A;  1P7D A;  3M9N B;  3MFI A;  2F44 A;  1SV0 A;  3RB3 A;  2M9N A;  4EX6 A;  2BKE A;  1NK5 A;  3V6K A;  2Z7J A;  2C2R A;  4Q43 A;  3KKA A;  1B0X A;  3UXN A;  4ED8 A;  2WF8 A;  1CUK A;  2BQU A;  5L1I A;  3AQF A;  2FDR A;  2DUY A;  2F1J A;  1WWV A;  2K8A A;  1NJX A;  2HMX A;  5ALV A;  1F5S A;  1L8L A;  4IC9 A;  4OD0 A;  4PPX A;  4O0I A;  3SAF A;  5ALD A;  1Z4N A;  2RRD A;  1IXR A;  3QUB A;  9ICL A;  4DEZ A;  4TQR A;  4CDG A;  4P4P A;  3C2M A;  1F44 A;  5AKI A;  2FMP A;  1S10 A;  2W8L A;  4ACO A;  3RH4 A;  3DV9 A;  4RNN A;  9ICS A;  1D8B A;  8ICK A;  1ZXI A;  1RQL A;  4EZ9 A;  2P6R A;  5ALX A;  2KJ5 A;  5ALQ A;  3IM1 A;  1SWW A;  1N62 A;  1PK1 B;  3HKZ C;  4F5O A;  1TAQ A;  2BHN A;  2BCU A;  1S0M A;  5KFV A;  4YFK A;  3UXO A;  3E2E A;  3E58 A;  4QZD A;  1J2M A;  4X5V A;  2WF9 A;  3FAH A;  4UB8 U;  5J2C A;  4DQP A;  2FI1 A;  4ECX A;  4NM2 A;  3AN1 A;  3PST A;  3QXG A;  1WWU A;  2C2E A;  3IN5 A;  2JEG A;  3BQ0 A;  1QH9 A;  2IMW P;  2YN4 A;  1TKD A;  2DQN B;  1ZJN A;  2GO7 A;  3AU2 A;  3RJE A;  4QWD A;  4Y2Q A;  4CE6 A;  3KFU F;  3NVY A;  4QIW C;  4J9O A;  2IOF A;  1ZD5 A;  1T4G A;  1ZQF A;  2VJ4 A;  3RRG A;  2KEY A;  5L1K A;  8ICX A;  2LMR A;  2IBK A;  4Y2S A;  4GC6 A;  5KFP A;  4QJF B;  3TAP A;  2VA3 A;  1KKX A;  4QZB A;  2DF4 B;  3WKD A;  2YB1 A;  2ESE A;  5TIS U;  4P0Q B;  5AK6 A;  5JRT A;  4ED1 A;  2MRL A;  3GIK A;  4I2J A;  5EWG A;  1LB2 B;  5AKH A;  8ICA A;  4C8N A;  5AM2 A;  3SAG A;  1KDH A;  1ZD4 A;  4DOC A;  1SL2 A;  2W9B A;  2B6G A;  1L8O A;  5KFW A;  4RNM A;  2KFN A;  1U47 A;  2ZIV A;  4CGZ A;  5A0L A;  3NVZ A;  4ZOH C;  1JIH A;  4JV2 A;  1ED1 A;  2RQ5 A;  1ZQV A;  4I2I A;  9ICT A;  5EE0 A;  5DDY A;  4BXO A;  4NLK A;  2L5Y A;  1ZQ1 C;  3TQ1 A;  2V4Q A;  3H7I A;  4UB6 U;  5HHI A;  7ICM A;  5KTQ A;  1KEJ A;  2AU0 A;  2NRV A;  1FFV A;  3ZDE A;  1XO1 A;  1BPE A;  2WTF A;  4F4X A;  1KSP A;  2ASD A;  4DSL A;  2R18 A;  2XGQ A;  3IV6 A;  5CJ7 A;  5KG1 A;  5KFG A;  2KKV A;  1OUQ A;  5H2F U;  5ALE A;  4J03 A;  2BPF A;  3THV A;  3MR3 A;  2JEJ A;  3PW5 A;  8ICM A;  4ECS A;  2JXJ A;  4F71 A;  5KFI A;  5K4L A;  5CR0 A;  2OWO A;  4Q44 A;  5ALJ A;  4DQR A;  4OJL A;  1KFS A;  4B9L A;  4JMU A;  1ZQY A;  4UAY A;  3ETR A;  3MGV A;  4QIW F;  2Y0S C;  4XQ8 A;  4TQS A;  5AI9 A;  4UB3 A;  7ICJ A;  4PL1 A;  2KHV A;  5J0P A;  2P66 A;  1Q8K A;  2PXI A;  4I28 A;  1DOQ A;  4IQV A;  1NOM A;  5J0X A;  1ZQP A;  3H8S A;  4DL4 A;  1N56 A;  3QU2 A;  4F4Z A;  3TFS A;  9ICX A;  2WB1 C;  5T14 A;  4WJ3 B;  3RJH A;  2HOI A;  3C5G A;  2NRT A;  3HX0 A;  5KFZ A;  1RXW A;  4UB2 A;  1BPZ A;  1CI4 A;  7ICE A;  4J9S A;  3M1Y A;  4MEX A;  9ICE A;  4AP9 A;  8ICW A;  4EYH B;  3RBD A;  4P4O A;  8ICL A;  5C0Y A;  4F91 B;  4M9J A;  2OYY A;  3L5K A;  5KT4 A;  2NRX A;  1N63 A;  3NS1 A;  3BS5 A;  3VC8 A;  2IA6 A;  1XU4 A;  2C2D A;  2W43 A;  3PW2 A;  1QQ7 A;  1N5X A;  4F5Q A;  3AM9 A;  5DB6 A;  3PX6 A;  5DDM A;  1QSL A;  4FO6 A;  4DQS A;  2B21 A;  1COK A;  8ICB A;  5EOZ A;  4EBC A;  4ECZ A;  1NKE A;  8ICH A;  4CF4 A;  1XC9 A;  5J2I A;  4F5N A;  2UVU A;  2AXT U;  2JH1 A;  1JX4 A;  1PK3 A;  2ZUD A;  2ASJ A;  1T3Q A;  2AH5 A;  8ICP A;  1B22 A;  1V38 A;  2G5H B;  2YX8 A;  2QB0 A;  1ZET A;  3KHH A;  3C5F A;  2KK0 A;  5IIO A;  4PGY A;  4I2G A;  3OSN A;  2N1R A;  2LI6 A;  1B4F A;  1O08 A;  5G5H A;  5KAI U;  3PSP A;  1ARO P;  4EEL A;  3GV5 B;  1ZQM A;  2F77 X;  4G3I A;  3IRU A;  3QNM A;  2PFO A;  3PW4 A;  2H5X A;  4CCH A;  1UA1 A;  3N97 B;  2AGP A;  2WB1 F;  5CP2 A;  3WU2 U;  4B6J A;  1KLN A;  4R8U B;  2JEI A;  9ICP A;  1Z1B A;  2XY7 A;  5J0O A;  3H40 A;  3TKA A;  3BZC A;  4ECT A;  4YR0 A;  3AL0 B;  1BVS A;  4KLE A;  2PFP A;  3HJE A;  5DB9 A;  2W04 A;  2KVC A;  2NRZ A;  3JPN A;  4GC7 A;  1RYS A;  5DG8 A;  3DEE A;  2WF6 A;  5KFR A;  3UMC A;  4ELT A;  1NK4 A;  4RQ8 A;  3N7R C;  4RPY A;  4M9N A;  2EZX A;  4RQ4 A;  4QZE A;  4KIT B;  3T5L A;  2DGZ A;  2E1E A;  2GWS A;  4FS2 A;  3QE9 Y;  4US8 A;  5GTI U;  5ALY A;  4KN7 A;  3PR4 A;  8ICY A;  4U7C A;  4FFD A;  2YMQ A;  2LYH A;  3ZDD A;  3UMB A;  3NUQ A;  2PFQ A;  3OHA A;  5AK5 A;  3T79 A;  2HHW A;  4YQW A;  2BDU A;  1Z00 B;  3GU3 A;  4I2C A;  3F53 A;  4DSE A;  4I2A A;  1SKW A;  3KKA C;  4M9H A;  4Y2T A;  5IIN A;  8ICE A;  4ECQ A;  2ZUB A;  3RB6 A;  3DDH A;  4I29 A;  3QZ7 A;  5DG9 A;  1NI3 A;  1Z19 A;  3QUT A;  2HHU A;  5AK4 A;  3QUC A;  5KG7 A;  2EAO A;  4J9M A;  4B9S A;  4UB1 A;  7ICU A;  4C8K A;  4KX5 A;  8ICO A;  5ALS A;  5KG2 A;  1ZQS A;  4FS1 A;  1L5U A;  4OCZ A;  4F4K A;  5AHX A;  2Q0Z X;  1DK2 A;  1KW4 A;  2JZB A;  3WKE A;  4ED7 A;  3SR6 A;  3B0Y A;  5ALP A;  5D4B A;  2H3Z A;  3BDP A;  2W55 A;  2UVR A;  2E8O A;  2H3I A;  3SQI A;  4J9N A;  2JGA A;  4ED3 A;  3ZDB A;  5KAF U;  2EAP A;  2KKP A;  3G6Y A;  3N28 A;  3MGH A;  4IR1 A;  4OJO A;  3HPO A;  1YZ6 A;  1SZP A;  3B9J A;  9ICJ A;  4KLF A;  1Q46 A;  4IS7 A;  3F2B A;  4DSJ A;  4DL5 A;  4RPX A;  1SL0 A;  2LBO A;  4YMM A;  5AKL A;  2M0N A;  4RU9 A;  1ZQR A;  4I2B A;  4F2R A;  7ICL A;  2LYB A;  1N5W A;  1LKY A;  4C0Z A;  1IM4 A;  2CPR A;  2J6U A;  1ZOL A;  4PGX A;  3ALR A;  2BR0 A;  4UB4 A;  4KLH A;  7ICH A;  4F5R A;  2ZXH A;  3QU4 A;  3OJU A;  2XIC A;  2IOF K;  8ICU A;  2MAX A;  1JRP A;  3WKC A;  1XWL A;  4P0P A;  1ZQC A;  4QNL A;  2MSN A;  1N61 A;  3IG8 A;  2JH7 A;  5ALW A;  3KTQ A;  4MF2 A;  3QUQ A;  5C5J A;  5D46 A;  2W9M A;  3FDS A;  9ICB A;  3SEI A;  5CRX A;  1A6S A;  4QZC A;  1SKR A;  1DK3 A;  1S5L U;  3MR2 A;  3CNH A;  5DBA A;  5ALK A;  4RQ6 A;  4R65 A;  2FMQ A;  4Q45 A;  5KFA A;  1KRP A;  3F5E A;  2MUT B;  5EE9 A;  3ETL A;  3IHQ B;  4ED6 A;  3TAR A;  4JK1 A;  3GV7 B;  4KLU A;  2I5H A;  2B0C A;  4O3P A;  3EUB 2;  3WKA A;  9ICO A;  3TAC B;  4DL2 A;  1RG6 A;  4GIB A;  2ZIV B;  4J9R A;  1NKB A;  2ZIU B;  4PZO A;  1KFD A;  5ALU A;  2K4P A;  2HHQ A;  2BZF A;  3HT3 A;  3H4D A;  3RF9 A;  4RQ0 A;  2W9C B;  2BDP A;  3K1R B;  4M47 A;  2JMG A;  4R63 A;  2ASL A;  5J0R A;  2D8C A;  2XID A;  4KN4 A;  2BPC A;  3L3F X;  1U9L A;  4RQ1 A;  4Z6D A;  2K4H A;  9ICG A;  3Q8M A;  4RT2 A;  5G5G A;  2OEH A;  3K1Z A;  1NK9 A;  5KFE A;  5IIK A;  2NYV A;  2GOL A;  1J2N A;  5ALT A;  8ICZ A;  5ALG A;  3RAX A;  1AQ6 A;  3ZDA A;  5AKZ A;  4I2H A;  7ICF A;  5CEH A;  4BGD A;  3MDA A;  4DS4 A;  4JB3 A;  5KFF A;  2KP7 A;  2OXO A;  1X2I A;  4Z6E A;  2KNJ A;  3MR5 A;  4QZA A;  5TZV A;  5ALR A;  1U48 A;  1XO0 A;  4O9M A;  1V9P A;  1K1S A;  2VIX A;  3GIM A;  4YD1 A;  2R8J A;  2HDO A;  5KFU A;  5AM4 A;  8ICJ A;  4YG2 A;  1SIJ A;  5J2J A;  1ZQI A;  4ELV A;  4FZM A;  1S0O A;  2DL0 A;  5DBC A;  2KFZ A;  4Z6F A;  8ICG A;  4NLZ A;  3BS7 A;  3M9M B;  2NO5 A;  3IG5 A;  4UAW A;  2W7P A;  4HAI A;  1BNP A;  3ZD8 A;  3KHL A;  9ICW A;  2KJ9 A;  5JTI A;  1OXJ A;  2ZUC A;  4EZ6 A;  3WK4 A;  4NXZ A;  3EYZ A;  1RPL A;  4F92 B;  1N48 A;  1ZQD A;  5HR7 A;  3GFK B;  1XSL A;  1L3S A;  4KMO B;  3ED5 A;  7ICV A;  3LWM A;  4DOA A;  2YB4 A;  4XUS A;  1EXN A;  2ZTC A;  3H0M B;  5KG5 A;  3PX0 A;  3I76 A;  5EWF A;  2UVV A;  1Z1V A;  4KLO A;  2ZJ5 A;  3PW7 A;  4DWI A;  1WYG A;  4QZG A;  2F2A B;  2KZ3 A;  5AI5 A;  4EEK A;  2RDJ A;  5AIC A;  4MEY A;  3A0H U;  4CRX A;  3SI8 A;  1C20 A;  3FC4 A;  5AI4 A;  4LZG A;  5BOL A;  2OCE A;  2KSO A;  2Y1I A;  5F9L A;  1BGX T;  2IOH A;  3RJF A;  1IG6 A;  2RLT A;  2W9A A;  3JPS A;  1D9D A;  1TK5 A;  1S0N A;  1DXS A;  5J2A A;  2W3S A;  7ICQ A;  4QWB A;  4B9M A;  4M9L A;  5DGB A;  4C7Z A;  1ZYQ A;  4F50 A;  4DSI A;  2G09 A;  3R9K A;  5D49 A;  3EW9 A;  2ZJA A;  4KLJ A;  2HCF A;  5ALH A;  2W7O A;  4KLD A;  4DQI A;  2DBY A;  1X6J A;  4QWC A;  1TFR A;  5DQI A;  2FLN A;  4ICA A;  4USA A;  4DCC A;  3OGU A;  1PUZ A;  2LYA A;  1S8O A;  4ECU A;  4M0A A;  2IHM A;  3WK6 A;  3C29 A;  3QYP A;  1MA7 A;  3KZX A;  5DLG A;  3PV8 A;  4I2E A;  2QKQ A;  2ZIX B;  3D2Q A;  5KFQ A;  1WUD A;  5HR6 A;  1NJZ A;  2H3F A;  2AQ4 A;  3NRW A;  1NK0 A;  4ELU A;  3V6J A;  3QEB Z;  1JRO A;  2G5I B;  1BPD A;  1K5O A;  1ZQK A;  1JXE A;  2KVS A;  2DKZ A;  3H8M A;  1NJW A;  3OPX A;  2FPL A;  4C4R A;  1L3T A;  3BQT A;  3O0F A;  2DPI A;  2QAR B;  4O3N A;  2JHD A;  5KFS A;  5DB7 A;  3M6K A;  5ALO A;  5HP4 A;  5BPC A;  5L1M A;  1ZQE A;  2I1Q A;  3RB0 A;  1B43 A;  5L9X A;  4DFD A;  1JXL A;  4DO9 A;  2JEF A;  1HEK A;  4M6W B;  2BCV A;  4BDP A;  3V6H A;  3RRH A;  4QZF A;  3Q8L A;  4ECR A;  7ICR A;  1L7M A;  3T5K A; 
#chains in the Genus database with same CATH homology
 5B5E U;  5KAF U;  2DUY A;  5GTH U;  4UB8 U;  3KZI U;  3A0B U;  5E79 U;  2AXT U;  5H2F U;  5GTI U;  1S5L U;  5KAI U;  4IL6 U;  3A0H U;  3WU2 U;  5TIS U;  4UB6 U;  4PJ0 U;  5B66 U; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...