1AMPA

Crystal structure of aeromonas proteolytica aminopeptidase: a prototypical member of the co-catalytic zinc enzyme family
Total Genus 112
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
112
sequence length
291
structure length
291
Chain Sequence
MPPITQQATVTAWLPQVDASQITGTISSLESFTNRFYTTTSGAQASDWIASEWQALSASLPNASVKQVSHSGYNQKSVVMTITGSEAPDEWIVIGGHLDSTIGSHTNEQSVAPGADDDASGIAAVTEVIRVLSENNFQPKRSIAFMAYAAEEVGLRGSQDLANQYKSEGKNVVSALQLDMTNYKGSAQDVVFITDYTDSNFTQYLTQLMDEYLPSLTYGFDTCGYACSDHASWHNAGYPAAMPFESKFNDYNPRIHTTQDTLANSDPTGSHAKKFTQLGLAYAIEMGSATG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords AMINOPEPTIDASE
publication title Crystal structure of Aeromonas proteolytica aminopeptidase: a prototypical member of the co-catalytic zinc enzyme family.
pubmed doi rcsb
source organism Vibrio proteolyticus
molecule tags Hydrolase(aminopeptidase)
total genus 112
structure length 291
sequence length 291
ec nomenclature ec 3.4.11.10: Bacterial leucyl aminopeptidase.
pdb deposition date 1994-04-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF04389 Peptidase_M28 Peptidase family M28
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.630.10 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Zn peptidases 1ampA00
4EWTA 4UEFA 2RB7A 3TC8A 3L2NA 2V8DA 2V8HA 5JM6A 3K9TA 5K8OA 2PJ2A 4JYWA 4G1PA 1DTDA 4P4JA 2ZEDA 2V77A 1QMUA 2XEIA 2ZEOA 4MCPA 3V38A 5IB9A 2EWBA 1Z5RA 3D67A 1TKHA 2Q51A 2C6GA 3PB7X 3I1UA 3PFEA 4AXVA 2BOAA 1XRYA 4MHPA 4IK2A 2GLFA 4MRIA 2PRQA 4MHNA 1F57A 2AFXA 2OR4A 3NA6A 3K2KA 3SJFA 2ANPA 3FX6A 4IAVA 4R76A 4ZYQA 4OC1A 2F7VA 3KR4A 4F8ZA 3B3CA 4OC4A 2O4HA 3BI1A 4TNUA 1Z8LA 3MN8A 2NYQA 3BI0A 1TF9A 4DYOA 2PJ9A 4PXEA 4PQAA 4IHMA 5LYIA 4W9YA 4OIDA 4R7MA 1R3NA 2PJ1A 3D66A 3KL9A 1YMEA 2G9DA 2V8VA 3FVLA 3RZAA 1XMBA 4R6TA 2Q43A 1ELMP 4NGTA 1EE3P 4WWVA 1LAPA 5CPAA 3NFZA 4ZX8A 2C6CA 2BCOA 2BO9A 2GLJA 2PJ6A 2QYVA 2F8HA 4P4FA 3WC6A 3IWWA 3PRTA 3KHZA 3PFOA 5CBMA 4UIAA 5K8PA 1BLLE 3PB9X 3PEIA 3FEEA 4FBEA 4EMEA 1Y0YA 1Y0RA 1VGYA 3PBBA 1FNOA 2IJZA 2PIZA 2PJ3A 4FAIA 5HVGA 2PJ5A 5JH9A 3S9LA 3ISZA 2AFWA 1HEEA 1RTQA 3FH4A 4ZY0A 4BD9A 1XJOA 3D4UA 5LRGA 2POKA 1CP6A 2NSMA 4CPAA 4OIWA 1TKJA 4MHZA 2C1CA 4OKOA 3NH8A 4PXCA 1VHOA 3NH4A 3B3SA 1F2PA 1Q7LA 1Z2LA 2O53A 2XEFA 3KGQA 2AFOA 1NSAA 3KQZA 3WC7A 2ZELA 1IY7A 4OMEA 1IGBA 4EFDA 3KR5A 4UIBA 2VL1A 5I4MA 3BHXA 2ABZA 3MRUA 1KWMA 4P6YA 3DLJA 3HLPA 2AFMA 4MCQA 4NGRA 4X3RA 5LRKA 4NFRA 1OBRA 3D7GA 4MMOA 1ZLIA 2C6PA 3KHXA 2XEJA 1PYTB 1CBXA 4WJBA 3KZWA 1CPSA 1ZLHA 4UEEA 1XFOA 4OC5A 4K3NA 2QJ8A 6CPAA 2J9AA 1HDUA 3DGVA 2JEWA 1YSJA 4P10A 3CT9A 3CDXA 1DE4C 1R43A 4P4BA 1PCAA 3FMCA 5LRJA 3RBUA 2PJBA 2WZNA 3N5FA 1CX8A 2ZEGA 4LQGA 3D7DA 1JQGA 4FUUA 2PVWA 1ARMA 4R8FA 3FECA 3PB6X 1AYEA 2WYRA 3HUVA 2IQ6A 2GREA 4MHYA 1BAVA 1TF8A 2FVGA 5K8NA 1ZG7A 1TXRA 1ZG8A 1ARLA 3GUXA 3IFEA 2ZEPA 4F9VA 3KI9A 4OC0A 4OC2A 4DUKA 3IC1A 3B2YA 4ONWA 4NJQA 3TX8A 4OP4A 2CIJA 1CPXA 1HDQA 1QQ9A 1LOKA 1UWYA 4GM5A 1YLOA 1F2OA 2ZEEA 3QNVA 1LFWA 2PJCA 2XEGA 5D29A 3B35A 2PJ4A 2AFZA 4ZY1A 3FF3A 4NGQA 4F9UA 3KQXA 3LMSA 4UEZA 2ZENA 1GYTA 3B3VA 4P4IA 4YWYA 5LYDA 2ZOFA 3GLJA 3PB8X 1TKFA 3LWUA 2GU2A 3IJ3A 3BXMA 3KASA 1Y7EA 3CPAA 4P45A 3SI2A 4Z65A 2PCUA 3RAMA 2JBKA 5DS0A 4MCSA 1LANA 2CTCA 4UF4A 4DJLA 1XBUA 4A39A 5LYLA 4MXUA 4ZI6A 3FJUA 2CTBA 1AMPA 3B7IA 4ZY2A 3WT4A 1CP7A 3H8FA 2V8GA 1M4LA 4A37A 3WABA 2AFSA 3FEDA 3CPXA 2HB6A 4PXDA 2PIYA 3IO1A 4NGNA 3H8GA 4KSIA 4A94A 2PJ8A 3JRUA 5HVHA 5D8NA 3D7HA 3PBEA 2DEAA 4ZX9A 1FT7A 3VARA 1CG2A 1H8LA 4OC3A 4TWEA 3SI0A 3ISXA 3SI1A 3T8WA 2RFHA 4MCRA 3SJXA 4P44A 2PJ0A 4RUHA 4PPZA 2EK8A 2Q4ZA 2EK9A 3S9NA 3NH5A 2ZEMA 3IIBA 1LAMA 1BPNA 1BPMA 2HC9A 4YU9A 3WC5A 2QVPA 3VATA 4JZ0A 5JGFA 4H2KA 4P4EA 2ZEFA 3B3WA 2PVVA 3VH9A 2CF4A 5ELYA 4B6ZA 4X8IA 2PJ7A 3D68A 4X2TA 2IMOA 5LYFA 5J1QA 2AFUA 4O23A 3SJEA 1VIXA 5HVFA 2ZEHA 4NJRA 3PB4X 4FWUA 1YW6A 3D7FA 2PE3A 1VHEA 4P4DA 4Q7AA 8CPAA 5F09A 2OOTA 4PXBA 5THWA 1LCPA 4NGMA 1YW4A 3SJGA 3GB0A 4A38A 1ELLP 4NGPA 3S9MA 7CPAA 1ZG9A 3IEHA 3H8EA 4NGSA 2I3CA 3V7ZA 5K8MA 5HXDA 2ZOGA 2PJAA 3B3TA 2JBJA
chains in the Genus database with same CATH superfamily
2ZPAA 2WPWA 4EWTA 2QIRA 3TFYA 2HV2A 4UEFA 2HQYA 1Z4RA 2AE6A 4FD4A 2RB7A 4B11A 1BO4A 2WPXA 4YFJA 1S7KA 5AG5A 3TC8A 3L2NA 3LACA 2V8DA 2V8HA 2Z0ZA 5JM6A 3K9TA 5K8OA 1I1DA 2CNSA 2PJ2A 4JYWA 3S6FA 4CAWA 4QUSA 3F8KA 4G1PA 1YVOA 2REEA 3DSBA 4NF1A 4A2ZA 1DTDA 1KUYA 4P4JA 2ZEDA 4UCPA 3JTKA 4KUBA 2V77A 1QMUA 2XEIA 4NXYA 2ZEOA 2P0WA 3DR8A 4MCPA 1TIQA 3V38A 5IB9A 2EWBA 1Z5RA 3D67A 1TKHA 2Q51A 2C6GA 3PB7X 3GIUA 3I1UA 3PFEA 4AXVA 1Z9UA 4U9YA 3GKRA 2ODFA 3RYOA 1IOFA 2BOAA 2YNEA 1XRYA 4MHPA 2D4OA 4IK2A 3TO9A 2GLFA 4MRIA 1B6BA 2PRQA 4MBUA 4MHNA 2FIAA 1YK3A 3CXQA 3QAHA 4Y49C 1GHEA 2Z3KA 1M4DA 2OZUA 4CYQA 1F57A 2AFXA 1KUVA 2OR4A 3NA6A 3K2KA 1NSLA 3SJFA 4BINA 4CGLA 4QVTA 2B3VA 2G3TA 3D2PA 2ANPA 3FX6A 4H6ZA 4IAVA 4R76A 3LD2A 4OC1A 4CGNA 4ZYQA 2F7VA 3KR4A 4F8ZA 5KTDA 2FXFA 2EO8A 3SXOA 3B3CA 1ON0A 3FYNA 4OC4A 2P6FA 4M6IA 4JLYA 1J4JA 1Y9WA 2O4HA 1V0CA 2Z11A 3BI1A 4F0YA 4R3KA 3B8GA 5AG4A 4TNUA 1Z8LA 4MI4A 5HMNA 3MN8A 4BBHA 1XEBA 3VWDA 4QBJA 1SQHA 2NYQA 3BI0A 1TF9A 2DXQA 4DYOA 4B10A 4CAVA 5KTCA 2PJ9A 4PXEA 4PQAA 4IHMA 4JD6A 3DDDA 2VXKA 3FRMA 5LYIA 4W9YA 4MFQA 2K5TA 1VKCA 1K4JA 4OIDA 4R7MA 1R3NA 4MJ8A 2PJ1A 3D66A 3KL9A 1YMEA 2G9DA 2V8VA 3FVLA 4CYOA 3RZAA 1XMBA 4NCZA 4Q38A 2F5IA 5A27A 5ISVA 5DWMA 1X12A 4LQ6A 4R6TA 3TE4A 4JWPA 2Q43A 2VI7A 1ELMP 1Q2CA 3GYAA 4NGTA 1XF8A 2Q4YA 3EC4A 1B87A 1EE3P 4WWVA 4B5PA 3KKWA 1Z8XA 4HNWB 1LAPA 5EC4A 1QSMA 5CPAA 3NFZA 4ZX8A 2C6CA 1IB1E 2BCOA 2BL1A 2BO9A 2GLJA 2PJ6A 2QYVA 2F8HA 3CXPA 4P4FA 3WC6A 4HNYB 1S7NA 4U9ZA 2BUEA 3IWWA 3PRTA 2WUUA 1YX0A 3KHZA 2GIVA 3R96A 3PFOA 3I9SA 4JJXA 5CBMA 4UIAA 2A4NA 4PV6A 5K8PA 1BLLE 3PB9X 3PEIA 3W91A 3FEEA 4FBEA 4EMEA 5JQ4A 2PQ8A 2CNMA 1Y0YA 1Y0RA 5AGEA 1VGYA 3PBBA 4UCNA 2Z3PA 4YRHA 3R1KA 1FNOA 4UWJA 4B5PB 4L8AA 2IJZA 3SHPA 3T9YA 2PIZA 2PJ3A 4FAIA 5HVGA 3R95A 2PJ5A 4CAEA 4R87A 4XPKA 5JH9A 3S9LA 2J8MA 3IWEA 3ISZA 4EVYA 2AFWA 4A95A 1YQEA 1HEEA 1RTQA 3FH4A 4CYPA 4BD9A 4ZY0A 1XJOA 2B58A 3D4UA 5LRGA 4Z65A 1RO5A 2POKA 4JXRA 5KTAA 2GE3A 2VZZA 1CP6A 2NSMA 3S6KA 1R57A 4UA3A 4OIWA 4CPAA 4CRZB 3QAYA 1TKJA 2Z10A 2C1CA 4MHZA 4OKOA 3NH8A 4PXCA 1VHOA 3NH4A 4KOSA 1L0CA 1I21A 3B3SA 1F2PA 1Q7LA 1Z2LA 2O53A 1FY7A 2XEFA 2AFOA 1NSAA 2QMLA 3KGQA 3KQZA 3TO7A 3WC7A 4H89A 4CYNA 2ZELA 4KOTA 4MFJA 3BJ7A 1IY7A 3PGPA 4KOYA 4OMEA 1IGBA 1Q2YA 4NEXA 4EFDA 4AG9A 4M6HA 5C82A 2D4PA 3KR5A 4UIBA 2VL1A 4CS0B 5I4MA 3W6SA 3BHXA 4OADA 1Z4EA 2ABZA 2YNDA 3MRUA 1KWMA 3RO0A 4P6YA 4DNCA 4XPDB 5GCNA 2YNCA 3DLJA 4CGOA 3HLPA 2AFMA 4MCQA 4NGRA 4X3RA 5LRKA 4NFRA 4R9MA 5F48A 1OBRA 3D7GA 2VBQA 5CNPA 2OB0A 4MMOA 5G20A 1ZLIA 2C6PA 3KHXA 2XEJA 2FT0A 1PYTB 1QSRA 4KS9A 1CBXA 2Q0YA 1AUGA 4M3SA 4B14A 5BWAB 4ZI6A 1XE4A 2EUIA 4WJBA 3KZWA 1CPSA 2IL4A 1IOIA 2VZYA 2C27A 1ZLHA 4CGMA 3D2MA 4UEEA 1XFOA 4OC5A 4K3NA 2QJ8A 5IV0A 1KZFA 2VQYA 5HH1A 6CPAA 1I12A 2J9AA 1QSOA 3BLNA 4ZGYB 5DWNA 1HDUA 3DGVA 2JEWA 1YSJA 4P10A 3CT9A 4AG7A 4M6GA 3CDXA 2I00A 1DE4C 4FD7A 1R43A 3H4QA 4P4BA 1PCAA 1Z8WA 2G0BA 1XIXA 5JGFA 2B5GA 1MK4A 2Q44A 3FMCA 4MHDA 5LRJA 3RBUA 4H6UA 2PJBA 2WZNA 3N5FA 3FIXA 1CX8A 4PSXA 2PRBA 4KZTA 2P6GA 3R9GA 3QB8A 2ZEGA 4LQGA 2YGWA 1JQGA 2PVWA 1ARMA 3D7DA 4FUUA 4R8FA 4A33A 4KORA 3FECA 4MFZA 3PB6X 1QSNA 1AYEA 2WYRA 3HUVA 2OZGA 2IQ6A 2GREA 1KUXA 3UY5A 3PP9A 4MHYA 1P0HA 1BAVA 2ZW5A 1IIDA 1TF8A 2FVGA 4ONUA 2B5GB 3DR6A 4XNHB 1ZG7A 3S6HA 5K8NA 1IU8A 1S5KA 1TXRA 1XMTA 3IGRA 1ZG8A 1ARLA 3GUXA 3JVNA 4MY0A 3IFEA 4UCMA 3D3SA 4KOVA 5H84A 3A9LA 2ZEPA 4F9VA 4UBRA 5G1ZA 3KI9A 4OC0A 4OC2A 5F49A 4DUKA 3IC1A 3P2FA 4Q36A 4ZBGA 5H86A 2VEZA 3ZZIA 3SXNA 3FNCA 3B2YA 2JDDA 4GS4A 4ONWA 5G21A 4NJQA 5AG6A 3TTHA 4C2XA 3TX8A 3N7ZA 4NSQA 3IU1A 4OP4A 4UWIA 2FSRA 4A30A 2I79A 2CIJA 3IU2A 2Y0MA 3NE8A 1YR0A 1CPXA 3ZJ0A 5A28A 4C68A 1HDQA 5J8CA 2ZW7A 4KOUA 3DNSA 3TT2A 1QQ9A 1LOKA 4AVBA 1UWYA 4L89A 1YGHA 4GM5A 3WR7A 1N71A 2HUZA 3H5ZA 1YLOA 3JUWA 4HNXB 1F2OA 4KLVA 2ZEEA 4Y49B 4KLWA 3QNVA 1LFWA 2PDOA 2PJCA 2XEGA 5D29A 4A32A 3B35A 1VHSA 2EBJA 2PJ4A 1S3ZA 2AFZA 4J3GA 3LODA 1PUAA 3F5BA 4ZY1A 3G3SA 3FF3A 4OAEA 2R8VA 4NGQA 4F9UA 2KCWA 3KQXA 1WWZA 2X7BA 4IUSA 2FL4A 3EY5A 3LMSA 4MY3A 4UEZA 2ZENA 3C26A 1GYTA 1QSTA 3B3VA 4JXQA 4P4IA 4YWYA 5LYDA 3F0AA 2ZOFA 3GLJA 4XPLA 3PB8X 1LRZA 1TKFA 3LWUA 1MJ9A 2GU2A 2Z3NA 3EO4A 3BXMA 3IJ3A 3KASA 4KVME 1Y7EA 3T90A 3CPAA 4P45A 1OZPA 4PK3A 2PCUA 4PSWA 3SI2A 3FBUA 3RAMA 3TOBA 4E8OA 2B3UA 2JBKA 1S60A 4E0AA 5DS0A 4MCSA 5AG7A 4RI1A 4LX9A 3TOAA 4CAFA 2PR8A 1LANA 4LUAA 2WSAA 2CTCA 1YLEA 4UF4A 4DJLA 1XBUA 2Q04A 2R98A 2CNTA 4E2AA 4A39A 5LYLA 4MXUA 2RC4A 4B12A 2R1IA 2CTBA 1IYLA 3CZXA 3FJUA 2BEIA 1AMPA 4YGOA 3B7IA 4ZY2A 4BMHA 3MGDA 3WT4A 1CP7A 4X5KA 5C88A 3H8FA 3EFAA 2OU2A 2V8GA 2H5MA 4UFWA 1M4LA 2FS5A 4C2YA 1UFHA 1MJBA 1ZO0A 4K30A 4A37A 3E0KA 1YREA 2CXAA 3IWGA 3WABA 1NE9A 1XOVA 2AFSA 3P2HA 4HPSA 2Q4VA 3FEDA 3CPXA 4IF5A 4F0XA 2HB6A 5I0CA 4B5OA 1CJWA 4PXDA 4KVXA 1Q2DA 3FB3A 3FXTA 2PIYA 3IO1A 4NGNA 2Z3OA 2DPSA 3H8GA 1U6MA 4ORFA 4KSIA 4AB7A 4CRYB 4A94A 1BOBA 2PJ8A 3JRUA 5HVHA 5D8NA 2B4DA 3D7HA 5G22A 3S6GA 2JLMA 3G8WA 2ARHA 3PBEA 1Y7RA 2FCKA 1CM0A 4AVAA 4KOXA 2DEAA 4ZX9A 5JPHA 1FT7A 4FD5A 2QECA 4F6AA 3VARA 1CG2A 1H8LA 4OC3A 4TWEA 3D8PA 4R57A 3SI0A 3ISXA 3GY9A 4KSFA 3V8IA 4C7HA 2BSWA 4U5YA 3SI1A 3T8WA 2RFHA 3RNZA 4B13A 1MJAA 4MCRA 3EXNA 3SJXA 4P44A 3R9EA 1M44A 2PJ0A 4FD6A 4MFKA 4PK2A 4RN7A 4RUHA 4PPZA 4KUAA 2EK8A 2Q4ZA 4QC6A 4MFLA 2DF5A 2EK9A 4XPDC 3VWEA 3S9NA 1IYKA 2Z3MA 2B4DB 3NH5A 3BJ8A 2Z3LA 1RXTA 2JDCA 2ZEMA 4CGPA 3IIBA 4MFPA 3R9FA 4R3LA 1LAMA 1M1DA 1BPNA 1BPMA 2HC9A 4YU9A 3W6XA 5E96A 3WC5A 2QVPA 3VATA 2CY2A 4JZ0A 2GANA 4C2ZA 4H2KA 4P4EA 2PC1A 2PR1A 2ZEFA 3B3WA 2PVVA 4HKFA 3TCVA 3VH9A 5FVJA 2J8RA 2CF4A 2G3AA 3OWCA 2OH1A 3CXSA 1IICA 5ELYA 4B6ZA 1P4NA 2ZXVA 4X8IA 2PJ7A 1A2ZA 2OZHA 1PU9A 2YNCC 3D68A 5IB0A 4RS2A 4X2TA 2ZW4A 5F47A 2ATRA 2R7HA 2IMOA 3NE7A 2DPTA 4AVCA 4CAXA 2FE7A 2REFA 5LYFA 4II9A 3TO6A 4GXHA 4OLLA 2AFUA 4O23A 5J1QA 2J8NA 4UFXA 1M4GA 3SJEA 2AJ6A 1VIXA 1WK4A 5HVFA 4UFVA 2ZEHA 4NJRA 2FIWA 3PB4X 4KSAA 4FWUA 1YW6A 3D7FA 4KVOE 2PE3A 1VHEA 4P4DA 4Q7AA 1YVKA 8CPAA 2OOTA 4PXBA 5THWA 5F09A 2Q7SA 2NMTA 2GFQA 3I3GA 2O28A 1Z8TA 4I49A 1LCPA 2ZW6A 4NGMA 1YW4A 3SJGA 4KOWA 3GB0A 4A38A 2B4BA 5EBVA 1ELLP 1Y9KA 1X10A 5EMIA 2JEVA 1M4IA 1NMTA 1S7LA 1ZG9A 4NGPA 3S9MA 7CPAA 3IEHA 3H8EA 4NGSA 5J8FA 1S7FA 2Q7BA 4M85A 2P6EA 2I3CA 3V7ZA 5IX3A 5HXDA 1JWQA 2ZOGA 3K9UA 2PJAA 5K8MA 3B3TA 4C7IA 4XNHC 3PZJA 4A31A 5F46A 2JBJA 2PSWA 4QB9A 2EVNA
chains in the Genus database with same CATH topology
4EWTA 4UEFA 2RB7A 3TC8A 3L2NA 2V8DA 2V8HA 5JM6A 3K9TA 5K8OA 2PJ2A 4JYWA 4G1PA 1DTDA 4P4JA 2ZEDA 2V77A 1QMUA 2XEIA 2ZEOA 4MCPA 3V38A 5IB9A 2EWBA 1Z5RA 3D67A 1TKHA 2Q51A 2C6GA 3PB7X 3I1UA 3PFEA 4AXVA 2BOAA 1XRYA 4MHPA 4IK2A 2GLFA 4MRIA 2PRQA 4MHNA 1F57A 2AFXA 2OR4A 3NA6A 3K2KA 3SJFA 2ANPA 3FX6A 4IAVA 4R76A 4ZYQA 4OC1A 2F7VA 3KR4A 4F8ZA 3B3CA 4OC4A 2O4HA 3BI1A 4TNUA 1Z8LA 3MN8A 2NYQA 3BI0A 1TF9A 4DYOA 2PJ9A 4PXEA 4PQAA 4IHMA 5LYIA 4W9YA 4OIDA 4R7MA 1R3NA 2PJ1A 3D66A 3KL9A 1YMEA 2G9DA 2V8VA 3FVLA 3RZAA 1XMBA 4R6TA 2Q43A 1ELMP 4NGTA 1EE3P 4WWVA 1LAPA 5CPAA 3NFZA 4ZX8A 2C6CA 2BCOA 2BO9A 2GLJA 2PJ6A 2QYVA 2F8HA 4P4FA 3WC6A 3IWWA 3PRTA 3KHZA 3PFOA 5CBMA 4UIAA 5K8PA 1BLLE 3PB9X 3PEIA 3FEEA 4FBEA 4EMEA 1Y0YA 1Y0RA 1VGYA 3PBBA 1FNOA 2IJZA 2PIZA 2PJ3A 4FAIA 5HVGA 2PJ5A 5JH9A 3S9LA 3ISZA 2AFWA 1HEEA 1RTQA 3FH4A 4ZY0A 4BD9A 1XJOA 3D4UA 5LRGA 2POKA 1CP6A 2NSMA 4CPAA 4OIWA 1TKJA 4MHZA 2C1CA 4OKOA 3NH8A 4PXCA 1VHOA 3NH4A 3B3SA 1F2PA 1Q7LA 1Z2LA 2O53A 2XEFA 3KGQA 2AFOA 1NSAA 3KQZA 3WC7A 2ZELA 1IY7A 4OMEA 1IGBA 4EFDA 3KR5A 4UIBA 2VL1A 5I4MA 3BHXA 2ABZA 3MRUA 1KWMA 4P6YA 3DLJA 3HLPA 2AFMA 4MCQA 4NGRA 4X3RA 5LRKA 4NFRA 1OBRA 3D7GA 4MMOA 1ZLIA 2C6PA 3KHXA 2XEJA 1PYTB 1CBXA 4WJBA 3KZWA 1CPSA 1ZLHA 4UEEA 1XFOA 4OC5A 4K3NA 2QJ8A 6CPAA 2J9AA 1HDUA 3DGVA 2JEWA 1YSJA 4P10A 3CT9A 3CDXA 1DE4C 1R43A 4P4BA 1PCAA 3FMCA 5LRJA 3RBUA 2PJBA 2WZNA 3N5FA 1CX8A 2ZEGA 4LQGA 3D7DA 1JQGA 4FUUA 2PVWA 1ARMA 4R8FA 3FECA 3PB6X 1AYEA 2WYRA 3HUVA 2IQ6A 2GREA 4MHYA 1BAVA 1TF8A 2FVGA 5K8NA 1ZG7A 1TXRA 1ZG8A 1ARLA 3GUXA 3IFEA 2ZEPA 4F9VA 3KI9A 4OC0A 4OC2A 4DUKA 3IC1A 3B2YA 4ONWA 4NJQA 3TX8A 4OP4A 2CIJA 1CPXA 1HDQA 1QQ9A 1LOKA 1UWYA 4GM5A 1YLOA 1F2OA 2ZEEA 3QNVA 1LFWA 2PJCA 2XEGA 5D29A 3B35A 2PJ4A 2AFZA 4ZY1A 3FF3A 4NGQA 4F9UA 3KQXA 3LMSA 4UEZA 2ZENA 1GYTA 3B3VA 4P4IA 4YWYA 5LYDA 2ZOFA 3GLJA 3PB8X 1TKFA 3LWUA 2GU2A 3IJ3A 3BXMA 3KASA 1Y7EA 3CPAA 4P45A 3SI2A 4Z65A 2PCUA 3RAMA 2JBKA 5DS0A 4MCSA 1LANA 2CTCA 4UF4A 4DJLA 1XBUA 4A39A 5LYLA 4MXUA 4ZI6A 3FJUA 2CTBA 1AMPA 3B7IA 4ZY2A 3WT4A 1CP7A 3H8FA 2V8GA 1M4LA 4A37A 3WABA 2AFSA 3FEDA 3CPXA 2HB6A 4PXDA 2PIYA 3IO1A 4NGNA 3H8GA 4KSIA 4A94A 2PJ8A 3JRUA 5HVHA 5D8NA 3D7HA 3PBEA 2DEAA 4ZX9A 1FT7A 3VARA 1CG2A 1H8LA 4OC3A 4TWEA 3SI0A 3ISXA 3SI1A 3T8WA 2RFHA 4MCRA 3SJXA 4P44A 2PJ0A 4RUHA 4PPZA 2EK8A 2Q4ZA 2EK9A 3S9NA 3NH5A 2ZEMA 3IIBA 1LAMA 1BPNA 1BPMA 2HC9A 4YU9A 3WC5A 2QVPA 3VATA 4JZ0A 5JGFA 4H2KA 4P4EA 2ZEFA 3B3WA 2PVVA 3VH9A 2CF4A 5ELYA 4B6ZA 4X8IA 2PJ7A 3D68A 4X2TA 2IMOA 5LYFA 5J1QA 2AFUA 4O23A 3SJEA 1VIXA 5HVFA 2ZEHA 4NJRA 3PB4X 4FWUA 1YW6A 3D7FA 2PE3A 1VHEA 4P4DA 4Q7AA 8CPAA 5F09A 2OOTA 4PXBA 5THWA 1LCPA 4NGMA 1YW4A 3SJGA 3GB0A 4A38A 1ELLP 4NGPA 3S9MA 7CPAA 1ZG9A 3IEHA 3H8EA 4NGSA 2I3CA 3V7ZA 5K8MA 5HXDA 2ZOGA 2PJAA 3B3TA 2JBJA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4EWT A;  4UEF A;  2RB7 A;  3TC8 A;  3L2N A;  2V8D A;  2V8H A;  5JM6 A;  3K9T A;  5K8O A;  2PJ2 A;  4JYW A;  4G1P A;  1DTD A;  4P4J A;  2ZED A;  2V77 A;  1QMU A;  2XEI A;  2ZEO A;  4MCP A;  3V38 A;  5IB9 A;  2EWB A;  1Z5R A;  3D67 A;  1TKH A;  2Q51 A;  2C6G A;  3PB7 X;  3I1U A;  3PFE A;  4AXV A;  2BOA A;  1XRY A;  4MHP A;  4IK2 A;  2GLF A;  4MRI A;  2PRQ A;  4MHN A;  1F57 A;  2AFX A;  2OR4 A;  3NA6 A;  3K2K A;  3SJF A;  2ANP A;  3FX6 A;  4IAV A;  4R76 A;  4ZYQ A;  4OC1 A;  2F7V A;  3KR4 A;  4F8Z A;  3B3C A;  4OC4 A;  2O4H A;  3BI1 A;  4TNU A;  1Z8L A;  3MN8 A;  2NYQ A;  3BI0 A;  1TF9 A;  4DYO A;  2PJ9 A;  4PXE A;  4PQA A;  4IHM A;  5LYI A;  4W9Y A;  4OID A;  4R7M A;  1R3N A;  2PJ1 A;  3D66 A;  3KL9 A;  1YME A;  2G9D A;  2V8V A;  3FVL A;  3RZA A;  1XMB A;  4R6T A;  2Q43 A;  1ELM P;  4NGT A;  1EE3 P;  4WWV A;  1LAP A;  5CPA A;  3NFZ A;  4ZX8 A;  2C6C A;  2BCO A;  2BO9 A;  2GLJ A;  2PJ6 A;  2QYV A;  2F8H A;  4P4F A;  3WC6 A;  3IWW A;  3PRT A;  3KHZ A;  3PFO A;  5CBM A;  4UIA A;  5K8P A;  1BLL E;  3PB9 X;  3PEI A;  3FEE A;  4FBE A;  4EME A;  1Y0Y A;  1Y0R A;  1VGY A;  3PBB A;  1FNO A;  2IJZ A;  2PIZ A;  2PJ3 A;  4FAI A;  5HVG A;  2PJ5 A;  5JH9 A;  3S9L A;  3ISZ A;  2AFW A;  1HEE A;  1RTQ A;  3FH4 A;  4ZY0 A;  4BD9 A;  1XJO A;  3D4U A;  5LRG A;  2POK A;  1CP6 A;  2NSM A;  4CPA A;  4OIW A;  1TKJ A;  4MHZ A;  2C1C A;  4OKO A;  3NH8 A;  4PXC A;  1VHO A;  3NH4 A;  3B3S A;  1F2P A;  1Q7L A;  1Z2L A;  2O53 A;  2XEF A;  3KGQ A;  2AFO A;  1NSA A;  3KQZ A;  3WC7 A;  2ZEL A;  1IY7 A;  4OME A;  1IGB A;  4EFD A;  3KR5 A;  4UIB A;  2VL1 A;  5I4M A;  3BHX A;  2ABZ A;  3MRU A;  1KWM A;  4P6Y A;  3DLJ A;  3HLP A;  2AFM A;  4MCQ A;  4NGR A;  4X3R A;  5LRK A;  4NFR A;  1OBR A;  3D7G A;  4MMO A;  1ZLI A;  2C6P A;  3KHX A;  2XEJ A;  1PYT B;  1CBX A;  4WJB A;  3KZW A;  1CPS A;  1ZLH A;  4UEE A;  1XFO A;  4OC5 A;  4K3N A;  2QJ8 A;  6CPA A;  2J9A A;  1HDU A;  3DGV A;  2JEW A;  1YSJ A;  4P10 A;  3CT9 A;  3CDX A;  1DE4 C;  1R43 A;  4P4B A;  1PCA A;  3FMC A;  5LRJ A;  3RBU A;  2PJB A;  2WZN A;  3N5F A;  1CX8 A;  2ZEG A;  4LQG A;  3D7D A;  1JQG A;  4FUU A;  2PVW A;  1ARM A;  4R8F A;  3FEC A;  3PB6 X;  1AYE A;  2WYR A;  3HUV A;  2IQ6 A;  2GRE A;  4MHY A;  1BAV A;  1TF8 A;  2FVG A;  5K8N A;  1ZG7 A;  1TXR A;  1ZG8 A;  1ARL A;  3GUX A;  3IFE A;  2ZEP A;  4F9V A;  3KI9 A;  4OC0 A;  4OC2 A;  4DUK A;  3IC1 A;  3B2Y A;  4ONW A;  4NJQ A;  3TX8 A;  4OP4 A;  2CIJ A;  1CPX A;  1HDQ A;  1QQ9 A;  1LOK A;  1UWY A;  4GM5 A;  1YLO A;  1F2O A;  2ZEE A;  3QNV A;  1LFW A;  2PJC A;  2XEG A;  5D29 A;  3B35 A;  2PJ4 A;  2AFZ A;  4ZY1 A;  3FF3 A;  4NGQ A;  4F9U A;  3KQX A;  3LMS A;  4UEZ A;  2ZEN A;  1GYT A;  3B3V A;  4P4I A;  4YWY A;  5LYD A;  2ZOF A;  3GLJ A;  3PB8 X;  1TKF A;  3LWU A;  2GU2 A;  3IJ3 A;  3BXM A;  3KAS A;  1Y7E A;  3CPA A;  4P45 A;  3SI2 A;  4Z65 A;  2PCU A;  3RAM A;  2JBK A;  5DS0 A;  4MCS A;  1LAN A;  2CTC A;  4UF4 A;  4DJL A;  1XBU A;  4A39 A;  5LYL A;  4MXU A;  4ZI6 A;  3FJU A;  2CTB A;  1AMP A;  3B7I A;  4ZY2 A;  3WT4 A;  1CP7 A;  3H8F A;  2V8G A;  1M4L A;  4A37 A;  3WAB A;  2AFS A;  3FED A;  3CPX A;  2HB6 A;  4PXD A;  2PIY A;  3IO1 A;  4NGN A;  3H8G A;  4KSI A;  4A94 A;  2PJ8 A;  3JRU A;  5HVH A;  5D8N A;  3D7H A;  3PBE A;  2DEA A;  4ZX9 A;  1FT7 A;  3VAR A;  1CG2 A;  1H8L A;  4OC3 A;  4TWE A;  3SI0 A;  3ISX A;  3SI1 A;  3T8W A;  2RFH A;  4MCR A;  3SJX A;  4P44 A;  2PJ0 A;  4RUH A;  4PPZ A;  2EK8 A;  2Q4Z A;  2EK9 A;  3S9N A;  3NH5 A;  2ZEM A;  3IIB A;  1LAM A;  1BPN A;  1BPM A;  2HC9 A;  4YU9 A;  3WC5 A;  2QVP A;  3VAT A;  4JZ0 A;  5JGF A;  4H2K A;  4P4E A;  2ZEF A;  3B3W A;  2PVV A;  3VH9 A;  2CF4 A;  5ELY A;  4B6Z A;  4X8I A;  2PJ7 A;  3D68 A;  4X2T A;  2IMO A;  5LYF A;  5J1Q A;  2AFU A;  4O23 A;  3SJE A;  1VIX A;  5HVF A;  2ZEH A;  4NJR A;  3PB4 X;  4FWU A;  1YW6 A;  3D7F A;  2PE3 A;  1VHE A;  4P4D A;  4Q7A A;  8CPA A;  5F09 A;  2OOT A;  4PXB A;  5THW A;  1LCP A;  4NGM A;  1YW4 A;  3SJG A;  3GB0 A;  4A38 A;  1ELL P;  4NGP A;  3S9M A;  7CPA A;  1ZG9 A;  3IEH A;  3H8E A;  4NGS A;  2I3C A;  3V7Z A;  5K8M A;  5HXD A;  2ZOG A;  2PJA A;  3B3T A;  2JBJ A; 
#chains in the Genus database with same CATH topology
 2ZPA A;  2WPW A;  4EWT A;  2QIR A;  3TFY A;  2HV2 A;  4UEF A;  2HQY A;  1Z4R A;  2AE6 A;  4FD4 A;  2RB7 A;  4B11 A;  1BO4 A;  2WPX A;  4YFJ A;  1S7K A;  5AG5 A;  3TC8 A;  3L2N A;  3LAC A;  2V8D A;  2V8H A;  2Z0Z A;  5JM6 A;  3K9T A;  5K8O A;  1I1D A;  2CNS A;  2PJ2 A;  4JYW A;  3S6F A;  4CAW A;  4QUS A;  3F8K A;  4G1P A;  1YVO A;  2REE A;  3DSB A;  4NF1 A;  4A2Z A;  1DTD A;  1KUY A;  4P4J A;  2ZED A;  4UCP A;  3JTK A;  4KUB A;  2V77 A;  1QMU A;  2XEI A;  4NXY A;  2ZEO A;  2P0W A;  3DR8 A;  4MCP A;  1TIQ A;  3V38 A;  5IB9 A;  2EWB A;  1Z5R A;  3D67 A;  1TKH A;  2Q51 A;  2C6G A;  3PB7 X;  3GIU A;  3I1U A;  3PFE A;  4AXV A;  1Z9U A;  4U9Y A;  3GKR A;  2ODF A;  3RYO A;  1IOF A;  2BOA A;  2YNE A;  1XRY A;  4MHP A;  2D4O A;  4IK2 A;  3TO9 A;  2GLF A;  4MRI A;  1B6B A;  2PRQ A;  4MBU A;  4MHN A;  2FIA A;  1YK3 A;  3CXQ A;  3QAH A;  4Y49 C;  1GHE A;  2Z3K A;  1M4D A;  2OZU A;  4CYQ A;  1F57 A;  2AFX A;  1KUV A;  2OR4 A;  3NA6 A;  3K2K A;  1NSL A;  3SJF A;  4BIN A;  4CGL A;  4QVT A;  2B3V A;  2G3T A;  3D2P A;  2ANP A;  3FX6 A;  4H6Z A;  4IAV A;  4R76 A;  3LD2 A;  4OC1 A;  4CGN A;  4ZYQ A;  2F7V A;  3KR4 A;  4F8Z A;  5KTD A;  2FXF A;  2EO8 A;  3SXO A;  3B3C A;  1ON0 A;  3FYN A;  4OC4 A;  2P6F A;  4M6I A;  4JLY A;  1J4J A;  1Y9W A;  2O4H A;  1V0C A;  2Z11 A;  3BI1 A;  4F0Y A;  4R3K A;  3B8G A;  5AG4 A;  4TNU A;  1Z8L A;  4MI4 A;  5HMN A;  3MN8 A;  4BBH A;  1XEB A;  3VWD A;  4QBJ A;  1SQH A;  2NYQ A;  3BI0 A;  1TF9 A;  2DXQ A;  4DYO A;  4B10 A;  4CAV A;  5KTC A;  2PJ9 A;  4PXE A;  4PQA A;  4IHM A;  4JD6 A;  3DDD A;  2VXK A;  3FRM A;  5LYI A;  4W9Y A;  4MFQ A;  2K5T A;  1VKC A;  1K4J A;  4OID A;  4R7M A;  1R3N A;  4MJ8 A;  2PJ1 A;  3D66 A;  3KL9 A;  1YME A;  2G9D A;  2V8V A;  3FVL A;  4CYO A;  3RZA A;  1XMB A;  4NCZ A;  4Q38 A;  2F5I A;  5A27 A;  5ISV A;  5DWM A;  1X12 A;  4LQ6 A;  4R6T A;  3TE4 A;  4JWP A;  2Q43 A;  2VI7 A;  1ELM P;  1Q2C A;  3GYA A;  4NGT A;  1XF8 A;  2Q4Y A;  3EC4 A;  1B87 A;  1EE3 P;  4WWV A;  4B5P A;  3KKW A;  1Z8X A;  4HNW B;  1LAP A;  5EC4 A;  1QSM A;  5CPA A;  3NFZ A;  4ZX8 A;  2C6C A;  1IB1 E;  2BCO A;  2BL1 A;  2BO9 A;  2GLJ A;  2PJ6 A;  2QYV A;  2F8H A;  3CXP A;  4P4F A;  3WC6 A;  4HNY B;  1S7N A;  4U9Z A;  2BUE A;  3IWW A;  3PRT A;  2WUU A;  1YX0 A;  3KHZ A;  2GIV A;  3R96 A;  3PFO A;  3I9S A;  4JJX A;  5CBM A;  4UIA A;  2A4N A;  4PV6 A;  5K8P A;  1BLL E;  3PB9 X;  3PEI A;  3W91 A;  3FEE A;  4FBE A;  4EME A;  5JQ4 A;  2PQ8 A;  2CNM A;  1Y0Y A;  1Y0R A;  5AGE A;  1VGY A;  3PBB A;  4UCN A;  2Z3P A;  4YRH A;  3R1K A;  1FNO A;  4UWJ A;  4B5P B;  4L8A A;  2IJZ A;  3SHP A;  3T9Y A;  2PIZ A;  2PJ3 A;  4FAI A;  5HVG A;  3R95 A;  2PJ5 A;  4CAE A;  4R87 A;  4XPK A;  5JH9 A;  3S9L A;  2J8M A;  3IWE A;  3ISZ A;  4EVY A;  2AFW A;  4A95 A;  1YQE A;  1HEE A;  1RTQ A;  3FH4 A;  4CYP A;  4BD9 A;  4ZY0 A;  1XJO A;  2B58 A;  3D4U A;  5LRG A;  4Z65 A;  1RO5 A;  2POK A;  4JXR A;  5KTA A;  2GE3 A;  2VZZ A;  1CP6 A;  2NSM A;  3S6K A;  1R57 A;  4UA3 A;  4OIW A;  4CPA A;  4CRZ B;  3QAY A;  1TKJ A;  2Z10 A;  2C1C A;  4MHZ A;  4OKO A;  3NH8 A;  4PXC A;  1VHO A;  3NH4 A;  4KOS A;  1L0C A;  1I21 A;  3B3S A;  1F2P A;  1Q7L A;  1Z2L A;  2O53 A;  1FY7 A;  2XEF A;  2AFO A;  1NSA A;  2QML A;  3KGQ A;  3KQZ A;  3TO7 A;  3WC7 A;  4H89 A;  4CYN A;  2ZEL A;  4KOT A;  4MFJ A;  3BJ7 A;  1IY7 A;  3PGP A;  4KOY A;  4OME A;  1IGB A;  1Q2Y A;  4NEX A;  4EFD A;  4AG9 A;  4M6H A;  5C82 A;  2D4P A;  3KR5 A;  4UIB A;  2VL1 A;  4CS0 B;  5I4M A;  3W6S A;  3BHX A;  4OAD A;  1Z4E A;  2ABZ A;  2YND A;  3MRU A;  1KWM A;  3RO0 A;  4P6Y A;  4DNC A;  4XPD B;  5GCN A;  2YNC A;  3DLJ A;  4CGO A;  3HLP A;  2AFM A;  4MCQ A;  4NGR A;  4X3R A;  5LRK A;  4NFR A;  4R9M A;  5F48 A;  1OBR A;  3D7G A;  2VBQ A;  5CNP A;  2OB0 A;  4MMO A;  5G20 A;  1ZLI A;  2C6P A;  3KHX A;  2XEJ A;  2FT0 A;  1PYT B;  1QSR A;  4KS9 A;  1CBX A;  2Q0Y A;  1AUG A;  4M3S A;  4B14 A;  5BWA B;  4ZI6 A;  1XE4 A;  2EUI A;  4WJB A;  3KZW A;  1CPS A;  2IL4 A;  1IOI A;  2VZY A;  2C27 A;  1ZLH A;  4CGM A;  3D2M A;  4UEE A;  1XFO A;  4OC5 A;  4K3N A;  2QJ8 A;  5IV0 A;  1KZF A;  2VQY A;  5HH1 A;  6CPA A;  1I12 A;  2J9A A;  1QSO A;  3BLN A;  4ZGY B;  5DWN A;  1HDU A;  3DGV A;  2JEW A;  1YSJ A;  4P10 A;  3CT9 A;  4AG7 A;  4M6G A;  3CDX A;  2I00 A;  1DE4 C;  4FD7 A;  1R43 A;  3H4Q A;  4P4B A;  1PCA A;  1Z8W A;  2G0B A;  1XIX A;  5JGF A;  2B5G A;  1MK4 A;  2Q44 A;  3FMC A;  4MHD A;  5LRJ A;  3RBU A;  4H6U A;  2PJB A;  2WZN A;  3N5F A;  3FIX A;  1CX8 A;  4PSX A;  2PRB A;  4KZT A;  2P6G A;  3R9G A;  3QB8 A;  2ZEG A;  4LQG A;  2YGW A;  1JQG A;  2PVW A;  1ARM A;  3D7D A;  4FUU A;  4R8F A;  4A33 A;  4KOR A;  3FEC A;  4MFZ A;  3PB6 X;  1QSN A;  1AYE A;  2WYR A;  3HUV A;  2OZG A;  2IQ6 A;  2GRE A;  1KUX A;  3UY5 A;  3PP9 A;  4MHY A;  1P0H A;  1BAV A;  2ZW5 A;  1IID A;  1TF8 A;  2FVG A;  4ONU A;  2B5G B;  3DR6 A;  4XNH B;  1ZG7 A;  3S6H A;  5K8N A;  1IU8 A;  1S5K A;  1TXR A;  1XMT A;  3IGR A;  1ZG8 A;  1ARL A;  3GUX A;  3JVN A;  4MY0 A;  3IFE A;  4UCM A;  3D3S A;  4KOV A;  5H84 A;  3A9L A;  2ZEP A;  4F9V A;  4UBR A;  5G1Z A;  3KI9 A;  4OC0 A;  4OC2 A;  5F49 A;  4DUK A;  3IC1 A;  3P2F A;  4Q36 A;  4ZBG A;  5H86 A;  2VEZ A;  3ZZI A;  3SXN A;  3FNC A;  3B2Y A;  2JDD A;  4GS4 A;  4ONW A;  5G21 A;  4NJQ A;  5AG6 A;  3TTH A;  4C2X A;  3TX8 A;  3N7Z A;  4NSQ A;  3IU1 A;  4OP4 A;  4UWI A;  2FSR A;  4A30 A;  2I79 A;  2CIJ A;  3IU2 A;  2Y0M A;  3NE8 A;  1YR0 A;  1CPX A;  3ZJ0 A;  5A28 A;  4C68 A;  1HDQ A;  5J8C A;  2ZW7 A;  4KOU A;  3DNS A;  3TT2 A;  1QQ9 A;  1LOK A;  4AVB A;  1UWY A;  4L89 A;  1YGH A;  4GM5 A;  3WR7 A;  1N71 A;  2HUZ A;  3H5Z A;  1YLO A;  3JUW A;  4HNX B;  1F2O A;  4KLV A;  2ZEE A;  4Y49 B;  4KLW A;  3QNV A;  1LFW A;  2PDO A;  2PJC A;  2XEG A;  5D29 A;  4A32 A;  3B35 A;  1VHS A;  2EBJ A;  2PJ4 A;  1S3Z A;  2AFZ A;  4J3G A;  3LOD A;  1PUA A;  3F5B A;  4ZY1 A;  3G3S A;  3FF3 A;  4OAE A;  2R8V A;  4NGQ A;  4F9U A;  2KCW A;  3KQX A;  1WWZ A;  2X7B A;  4IUS A;  2FL4 A;  3EY5 A;  3LMS A;  4MY3 A;  4UEZ A;  2ZEN A;  3C26 A;  1GYT A;  1QST A;  3B3V A;  4JXQ A;  4P4I A;  4YWY A;  5LYD A;  3F0A A;  2ZOF A;  3GLJ A;  4XPL A;  3PB8 X;  1LRZ A;  1TKF A;  3LWU A;  1MJ9 A;  2GU2 A;  2Z3N A;  3EO4 A;  3BXM A;  3IJ3 A;  3KAS A;  4KVM E;  1Y7E A;  3T90 A;  3CPA A;  4P45 A;  1OZP A;  4PK3 A;  2PCU A;  4PSW A;  3SI2 A;  3FBU A;  3RAM A;  3TOB A;  4E8O A;  2B3U A;  2JBK A;  1S60 A;  4E0A A;  5DS0 A;  4MCS A;  5AG7 A;  4RI1 A;  4LX9 A;  3TOA A;  4CAF A;  2PR8 A;  1LAN A;  4LUA A;  2WSA A;  2CTC A;  1YLE A;  4UF4 A;  4DJL A;  1XBU A;  2Q04 A;  2R98 A;  2CNT A;  4E2A A;  4A39 A;  5LYL A;  4MXU A;  2RC4 A;  4B12 A;  2R1I A;  2CTB A;  1IYL A;  3CZX A;  3FJU A;  2BEI A;  1AMP A;  4YGO A;  3B7I A;  4ZY2 A;  4BMH A;  3MGD A;  3WT4 A;  1CP7 A;  4X5K A;  5C88 A;  3H8F A;  3EFA A;  2OU2 A;  2V8G A;  2H5M A;  4UFW A;  1M4L A;  2FS5 A;  4C2Y A;  1UFH A;  1MJB A;  1ZO0 A;  4K30 A;  4A37 A;  3E0K A;  1YRE A;  2CXA A;  3IWG A;  3WAB A;  1NE9 A;  1XOV A;  2AFS A;  3P2H A;  4HPS A;  2Q4V A;  3FED A;  3CPX A;  4IF5 A;  4F0X A;  2HB6 A;  5I0C A;  4B5O A;  1CJW A;  4PXD A;  4KVX A;  1Q2D A;  3FB3 A;  3FXT A;  2PIY A;  3IO1 A;  4NGN A;  2Z3O A;  2DPS A;  3H8G A;  1U6M A;  4ORF A;  4KSI A;  4AB7 A;  4CRY B;  4A94 A;  1BOB A;  2PJ8 A;  3JRU A;  5HVH A;  5D8N A;  2B4D A;  3D7H A;  5G22 A;  3S6G A;  2JLM A;  3G8W A;  2ARH A;  3PBE A;  1Y7R A;  2FCK A;  1CM0 A;  4AVA A;  4KOX A;  2DEA A;  4ZX9 A;  5JPH A;  1FT7 A;  4FD5 A;  2QEC A;  4F6A A;  3VAR A;  1CG2 A;  1H8L A;  4OC3 A;  4TWE A;  3D8P A;  4R57 A;  3SI0 A;  3ISX A;  3GY9 A;  4KSF A;  3V8I A;  4C7H A;  2BSW A;  4U5Y A;  3SI1 A;  3T8W A;  2RFH A;  3RNZ A;  4B13 A;  1MJA A;  4MCR A;  3EXN A;  3SJX A;  4P44 A;  3R9E A;  1M44 A;  2PJ0 A;  4FD6 A;  4MFK A;  4PK2 A;  4RN7 A;  4RUH A;  4PPZ A;  4KUA A;  2EK8 A;  2Q4Z A;  4QC6 A;  4MFL A;  2DF5 A;  2EK9 A;  4XPD C;  3VWE A;  3S9N A;  1IYK A;  2Z3M A;  2B4D B;  3NH5 A;  3BJ8 A;  2Z3L A;  1RXT A;  2JDC A;  2ZEM A;  4CGP A;  3IIB A;  4MFP A;  3R9F A;  4R3L A;  1LAM A;  1M1D A;  1BPN A;  1BPM A;  2HC9 A;  4YU9 A;  3W6X A;  5E96 A;  3WC5 A;  2QVP A;  3VAT A;  2CY2 A;  4JZ0 A;  2GAN A;  4C2Z A;  4H2K A;  4P4E A;  2PC1 A;  2PR1 A;  2ZEF A;  3B3W A;  2PVV A;  4HKF A;  3TCV A;  3VH9 A;  5FVJ A;  2J8R A;  2CF4 A;  2G3A A;  3OWC A;  2OH1 A;  3CXS A;  1IIC A;  5ELY A;  4B6Z A;  1P4N A;  2ZXV A;  4X8I A;  2PJ7 A;  1A2Z A;  2OZH A;  1PU9 A;  2YNC C;  3D68 A;  5IB0 A;  4RS2 A;  4X2T A;  2ZW4 A;  5F47 A;  2ATR A;  2R7H A;  2IMO A;  3NE7 A;  2DPT A;  4AVC A;  4CAX A;  2FE7 A;  2REF A;  5LYF A;  4II9 A;  3TO6 A;  4GXH A;  4OLL A;  2AFU A;  4O23 A;  5J1Q A;  2J8N A;  4UFX A;  1M4G A;  3SJE A;  2AJ6 A;  1VIX A;  1WK4 A;  5HVF A;  4UFV A;  2ZEH A;  4NJR A;  2FIW A;  3PB4 X;  4KSA A;  4FWU A;  1YW6 A;  3D7F A;  4KVO E;  2PE3 A;  1VHE A;  4P4D A;  4Q7A A;  1YVK A;  8CPA A;  2OOT A;  4PXB A;  5THW A;  5F09 A;  2Q7S A;  2NMT A;  2GFQ A;  3I3G A;  2O28 A;  1Z8T A;  4I49 A;  1LCP A;  2ZW6 A;  4NGM A;  1YW4 A;  3SJG A;  4KOW A;  3GB0 A;  4A38 A;  2B4B A;  5EBV A;  1ELL P;  1Y9K A;  1X10 A;  5EMI A;  2JEV A;  1M4I A;  1NMT A;  1S7L A;  1ZG9 A;  4NGP A;  3S9M A;  7CPA A;  3IEH A;  3H8E A;  4NGS A;  5J8F A;  1S7F A;  2Q7B A;  4M85 A;  2P6E A;  2I3C A;  3V7Z A;  5IX3 A;  5HXD A;  1JWQ A;  2ZOG A;  3K9U A;  2PJA A;  5K8M A;  3B3T A;  4C7I A;  4XNH C;  3PZJ A;  4A31 A;  5F46 A;  2JBJ A;  2PSW A;  4QB9 A;  2EVN A; 
#chains in the Genus database with same CATH homology
 4EWT A;  4UEF A;  2RB7 A;  3TC8 A;  3L2N A;  2V8D A;  2V8H A;  5JM6 A;  3K9T A;  5K8O A;  2PJ2 A;  4JYW A;  4G1P A;  1DTD A;  4P4J A;  2ZED A;  2V77 A;  1QMU A;  2XEI A;  2ZEO A;  4MCP A;  3V38 A;  5IB9 A;  2EWB A;  1Z5R A;  3D67 A;  1TKH A;  2Q51 A;  2C6G A;  3PB7 X;  3I1U A;  3PFE A;  4AXV A;  2BOA A;  1XRY A;  4MHP A;  4IK2 A;  2GLF A;  4MRI A;  2PRQ A;  4MHN A;  1F57 A;  2AFX A;  2OR4 A;  3NA6 A;  3K2K A;  3SJF A;  2ANP A;  3FX6 A;  4IAV A;  4R76 A;  4ZYQ A;  4OC1 A;  2F7V A;  3KR4 A;  4F8Z A;  3B3C A;  4OC4 A;  2O4H A;  3BI1 A;  4TNU A;  1Z8L A;  3MN8 A;  2NYQ A;  3BI0 A;  1TF9 A;  4DYO A;  2PJ9 A;  4PXE A;  4PQA A;  4IHM A;  5LYI A;  4W9Y A;  4OID A;  4R7M A;  1R3N A;  2PJ1 A;  3D66 A;  3KL9 A;  1YME A;  2G9D A;  2V8V A;  3FVL A;  3RZA A;  1XMB A;  4R6T A;  2Q43 A;  1ELM P;  4NGT A;  1EE3 P;  4WWV A;  1LAP A;  5CPA A;  3NFZ A;  4ZX8 A;  2C6C A;  2BCO A;  2BO9 A;  2GLJ A;  2PJ6 A;  2QYV A;  2F8H A;  4P4F A;  3WC6 A;  3IWW A;  3PRT A;  3KHZ A;  3PFO A;  5CBM A;  4UIA A;  5K8P A;  1BLL E;  3PB9 X;  3PEI A;  3FEE A;  4FBE A;  4EME A;  1Y0Y A;  1Y0R A;  1VGY A;  3PBB A;  1FNO A;  2IJZ A;  2PIZ A;  2PJ3 A;  4FAI A;  5HVG A;  2PJ5 A;  5JH9 A;  3S9L A;  3ISZ A;  2AFW A;  1HEE A;  1RTQ A;  3FH4 A;  4ZY0 A;  4BD9 A;  1XJO A;  3D4U A;  5LRG A;  2POK A;  1CP6 A;  2NSM A;  4CPA A;  4OIW A;  1TKJ A;  4MHZ A;  2C1C A;  4OKO A;  3NH8 A;  4PXC A;  1VHO A;  3NH4 A;  3B3S A;  1F2P A;  1Q7L A;  1Z2L A;  2O53 A;  2XEF A;  3KGQ A;  2AFO A;  1NSA A;  3KQZ A;  3WC7 A;  2ZEL A;  1IY7 A;  4OME A;  1IGB A;  4EFD A;  3KR5 A;  4UIB A;  2VL1 A;  5I4M A;  3BHX A;  2ABZ A;  3MRU A;  1KWM A;  4P6Y A;  3DLJ A;  3HLP A;  2AFM A;  4MCQ A;  4NGR A;  4X3R A;  5LRK A;  4NFR A;  1OBR A;  3D7G A;  4MMO A;  1ZLI A;  2C6P A;  3KHX A;  2XEJ A;  1PYT B;  1CBX A;  4WJB A;  3KZW A;  1CPS A;  1ZLH A;  4UEE A;  1XFO A;  4OC5 A;  4K3N A;  2QJ8 A;  6CPA A;  2J9A A;  1HDU A;  3DGV A;  2JEW A;  1YSJ A;  4P10 A;  3CT9 A;  3CDX A;  1DE4 C;  1R43 A;  4P4B A;  1PCA A;  3FMC A;  5LRJ A;  3RBU A;  2PJB A;  2WZN A;  3N5F A;  1CX8 A;  2ZEG A;  4LQG A;  3D7D A;  1JQG A;  4FUU A;  2PVW A;  1ARM A;  4R8F A;  3FEC A;  3PB6 X;  1AYE A;  2WYR A;  3HUV A;  2IQ6 A;  2GRE A;  4MHY A;  1BAV A;  1TF8 A;  2FVG A;  5K8N A;  1ZG7 A;  1TXR A;  1ZG8 A;  1ARL A;  3GUX A;  3IFE A;  2ZEP A;  4F9V A;  3KI9 A;  4OC0 A;  4OC2 A;  4DUK A;  3IC1 A;  3B2Y A;  4ONW A;  4NJQ A;  3TX8 A;  4OP4 A;  2CIJ A;  1CPX A;  1HDQ A;  1QQ9 A;  1LOK A;  1UWY A;  4GM5 A;  1YLO A;  1F2O A;  2ZEE A;  3QNV A;  1LFW A;  2PJC A;  2XEG A;  5D29 A;  3B35 A;  2PJ4 A;  2AFZ A;  4ZY1 A;  3FF3 A;  4NGQ A;  4F9U A;  3KQX A;  3LMS A;  4UEZ A;  2ZEN A;  1GYT A;  3B3V A;  4P4I A;  4YWY A;  5LYD A;  2ZOF A;  3GLJ A;  3PB8 X;  1TKF A;  3LWU A;  2GU2 A;  3IJ3 A;  3BXM A;  3KAS A;  1Y7E A;  3CPA A;  4P45 A;  3SI2 A;  4Z65 A;  2PCU A;  3RAM A;  2JBK A;  5DS0 A;  4MCS A;  1LAN A;  2CTC A;  4UF4 A;  4DJL A;  1XBU A;  4A39 A;  5LYL A;  4MXU A;  4ZI6 A;  3FJU A;  2CTB A;  1AMP A;  3B7I A;  4ZY2 A;  3WT4 A;  1CP7 A;  3H8F A;  2V8G A;  1M4L A;  4A37 A;  3WAB A;  2AFS A;  3FED A;  3CPX A;  2HB6 A;  4PXD A;  2PIY A;  3IO1 A;  4NGN A;  3H8G A;  4KSI A;  4A94 A;  2PJ8 A;  3JRU A;  5HVH A;  5D8N A;  3D7H A;  3PBE A;  2DEA A;  4ZX9 A;  1FT7 A;  3VAR A;  1CG2 A;  1H8L A;  4OC3 A;  4TWE A;  3SI0 A;  3ISX A;  3SI1 A;  3T8W A;  2RFH A;  4MCR A;  3SJX A;  4P44 A;  2PJ0 A;  4RUH A;  4PPZ A;  2EK8 A;  2Q4Z A;  2EK9 A;  3S9N A;  3NH5 A;  2ZEM A;  3IIB A;  1LAM A;  1BPN A;  1BPM A;  2HC9 A;  4YU9 A;  3WC5 A;  2QVP A;  3VAT A;  4JZ0 A;  5JGF A;  4H2K A;  4P4E A;  2ZEF A;  3B3W A;  2PVV A;  3VH9 A;  2CF4 A;  5ELY A;  4B6Z A;  4X8I A;  2PJ7 A;  3D68 A;  4X2T A;  2IMO A;  5LYF A;  5J1Q A;  2AFU A;  4O23 A;  3SJE A;  1VIX A;  5HVF A;  2ZEH A;  4NJR A;  3PB4 X;  4FWU A;  1YW6 A;  3D7F A;  2PE3 A;  1VHE A;  4P4D A;  4Q7A A;  8CPA A;  5F09 A;  2OOT A;  4PXB A;  5THW A;  1LCP A;  4NGM A;  1YW4 A;  3SJG A;  3GB0 A;  4A38 A;  1ELL P;  4NGP A;  3S9M A;  7CPA A;  1ZG9 A;  3IEH A;  3H8E A;  4NGS A;  2I3C A;  3V7Z A;  5K8M A;  5HXD A;  2ZOG A;  2PJA A;  3B3T A;  2JBJ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...