1AMPA

Crystal structure of aeromonas proteolytica aminopeptidase: a prototypical member of the co-catalytic zinc enzyme family
Total Genus 112
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
112
sequence length
291
structure length
291
Chain Sequence
MPPITQQATVTAWLPQVDASQITGTISSLESFTNRFYTTTSGAQASDWIASEWQALSASLPNASVKQVSHSGYNQKSVVMTITGSEAPDEWIVIGGHLDSTIGSHTNEQSVAPGADDDASGIAAVTEVIRVLSENNFQPKRSIAFMAYAAEEVGLRGSQDLANQYKSEGKNVVSALQLDMTNYKGSAQDVVFITDYTDSNFTQYLTQLMDEYLPSLTYGFDTCGYACSDHASWHNAGYPAAMPFESKFNDYNPRIHTTQDTLANSDPTGSHAKKFTQLGLAYAIEMGSATG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords AMINOPEPTIDASE
publication title Crystal structure of Aeromonas proteolytica aminopeptidase: a prototypical member of the co-catalytic zinc enzyme family.
pubmed doi rcsb
source organism Vibrio proteolyticus
molecule tags Hydrolase(aminopeptidase)
total genus 112
structure length 291
sequence length 291
ec nomenclature ec 3.4.11.10: Bacterial leucyl aminopeptidase.
pdb deposition date 1994-04-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF04389 Peptidase_M28 Peptidase family M28
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.630.10 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Zn peptidases 1ampA00
4KSIA 3B3VA 1Z8LA 2ZEFA 3SI2A 4ZX9A 2XEGA 3SJEA 1CPXA 2WYRA 4G1PA 4MMOA 2HC9A 3VH9A 2ZEGA 2PJ8A 4MHPA 2PJ6A 3PFEA 5THWA 2AFOA 4FUUA 2PRQA 5LYDA 3T8WA 1Z2LA 3L2NA 2O4HA 3IO1A 3JRUA 2C1CA 2CF4A 2POKA 4P4FA 3DGVA 1FT7A 4PQAA 5LYLA 4R8FA 4FBEA 2ZEMA 4WJBA 2EWBA 3D68A 1YSJA 3D67A 1Y0RA 3KZWA 2NSMA 3WABA 3H8GA 3V7ZA 3TX8A 3FH4A 3HLPA 2PJAA 4MHYA 4NGPA 4MHNA 3FVLA 5JH9A 4ZY0A 3KASA 1IGBA 3WT4A 2V8VA 4UEZA 4DYOA 2Q43A 2Q4ZA 3V38A 2RFHA 4Q7AA 2WZNA 4NFRA 3WC7A 7CPAA 1TKJA 4NJRA 2ANPA 4WWVA 4OMEA 2PJ5A 3DLJA 1UWYA 5J1QA 4OIDA 2ABZA 2RB7A 2ZOGA 3B2YA 6CPAA 2AFWA 3PBEA 4PPZA 3SJXA 4OP4A 4F9UA 1YW4A 4X3RA 2PJ0A 2XEIA 3PBBA 1DE4C 5K8NA 3PB7X 3S9MA 4RUHA 3ISZA 2PIYA 1VGYA 4A38A 2F8HA 1R3NA 2PJ9A 4P45A 5HVFA 2QYVA 2GREA 4OIWA 4X8IA 5HVHA 3IC1A 2FVGA 2ZEPA 3GB0A 2ZELA 3CPXA 4P44A 1LANA 1OBRA 3FECA 2AFXA 3D7HA 1ZG8A 1HDUA 3B3CA 3BXMA 2V8GA 3FEDA 2EK9A 2GLJA 1YMEA 2I3CA 4R7MA 5K8MA 3FX6A 3PEIA 1LOKA 4A94A 3RZAA 5LRJA 5ELYA 4IK2A 4PXBA 2PJ4A 3D7FA 4P4IA 2XEFA 1Z5RA 4R6TA 3H8EA 3I1UA 1JQGA 4NGRA 4UEEA 2ZEOA 3GUXA 1RTQA 3SJFA 3VARA 5I4MA 1QQ9A 2CTCA 3CDXA 2DEAA 2GLFA 3BI1A 1LAPA 5D29A 1YW6A 2QJ8A 2AFSA 1XRYA 2PJ7A 4UF4A 4OC2A 2ZEEA 2CIJA 3S9LA 3RBUA 4PXCA 4OKOA 5LYIA 2AFUA 3D7GA 1BAVA 1F2PA 2BCOA 1ELLP 4EWTA 5F09A 2PVVA 2PJ2A 2QVPA 2PJ3A 2IJZA 3D66A 3PB9X 1ZG9A 4B6ZA 4OC5A 3NH4A 4MHZA 4O23A 3BHXA 3KI9A 4ZYQA 1AMPA 4YWYA 4UEFA 3PB6X 2ZOFA 2VL1A 2IQ6A 1BPMA 4Z65A 3FF3A 2JBKA 1ELMP 1ZLIA 4MXUA 4A37A 4AXVA 3NA6A 1Y7EA 1TKFA 4P4DA 1HDQA 2OR4A 4R76A 3TC8A 1CPSA 2G9DA 4ZY1A 2GU2A 2AFZA 4PXDA 1LAMA 1Y0YA 4IHMA 2PJCA 1ARLA 3FJUA 1KWMA 5HXDA 3GLJA 1EE3P 4CPAA 4TWEA 1VHEA 2PVWA 1VIXA 3KHXA 3QNVA 3KQXA 4NGTA 2CTBA 1ZG7A 2PIZA 3PRTA 4P4JA 3KL9A 1LFWA 2AFMA 3LWUA 2EK8A 4MCRA 3B3WA 3FEEA 3KR5A 4DJLA 1IY7A 3IJ3A 1CP7A 3MRUA 1DTDA 3PFOA 3WC6A 3VATA 2HB6A 3KHZA 4K3NA 1GYTA 4P4EA 2ZEDA 2J9AA 2C6GA 3SI1A 4H2KA 4OC4A 3IFEA 3D4UA 4ZX8A 1H8LA 4OC0A 1F2OA 4TNUA 4FWUA 2F7VA 2PJ1A 5K8PA 1R43A 3CT9A 4P4BA 2NYQA 3ISXA 3B3TA 4MRIA 1XMBA 1XFOA 3IWWA 2C6CA 3B7IA 4LQGA 3H8FA 4OC3A 1F57A 3N5FA 4IAVA 1TF8A 4JZ0A 1CG2A 1CP6A 3NFZA 2C6PA 2Q51A 4UIBA 4NJQA 2O53A 4ZY2A 4BD9A 4NGMA 1XBUA 1TF9A 3B35A 4F8ZA 4UIAA 4MCPA 4P6YA 1CBXA 2IMOA 3LMSA 1YLOA 1HEEA 4A39A 5JM6A 5CBMA 1M4LA 5LYFA 1CX8A 3K2KA 1QMUA 1Q7LA 1LCPA 3CPAA 4X2TA 2ZENA 5LRGA 1NSAA 4GM5A 2JEWA 2V8DA 4P10A 4DUKA 4W9YA 1FNOA 3RAMA 3B3SA 4NGSA 3IEHA 2V77A 3NH5A 4MCQA 4PXEA 5HVGA 5K8OA 4NGNA 2BOAA 4NGQA 4OC1A 3NH8A 5IB9A 1XJOA 3KR4A 3SI0A 3D7DA 5CPAA 4ZI6A 1TXRA 1TKHA 3FMCA 3K9TA 1BLLE 3PB8X 1ARMA 2PJBA 4YU9A 1AYEA 3HUVA 3IIBA 2PCUA 3KGQA 3WC5A 3SJGA 5D8NA 4JYWA 4EMEA 1PCAA 1PYTB 4FAIA 1ZLHA 4F9VA 2BO9A 3BI0A 5LRKA 1VHOA 5DS0A 5JGFA 2ZEHA 8CPAA 4ONWA 1BPNA 3KQZA 2OOTA 4MCSA 3S9NA 3PB4X 2JBJA 2V8HA 4EFDA 2PE3A 2XEJA 3MN8A
chains in the Genus database with same CATH superfamily
4KSIA 3E0KA 3B3VA 2VEZA 1Z8LA 2ZEFA 2R8VA 3GY9A 1S3ZA 2XEGA 4NXYA 4KOVA 4ZX9A 3SI2A 4RS2A 3SJEA 1CPXA 2WYRA 3P2FA 3F0AA 4G1PA 4CGOA 3JVNA 4MMOA 1X12A 3NE7A 5JPHA 2HC9A 4JJXA 1XOVA 3VH9A 3F8KA 5F47A 2ZEGA 2ZW4A 2PJ8A 3DR8A 4KOSA 4MHPA 3RNZA 2PJ6A 3PFEA 4R9MA 1QSOA 5THWA 1ON0A 2AFOA 1Z4EA 2B5GB 4FUUA 2PRQA 5LYDA 3T8WA 4CYNA 1IYKA 1Z2LA 3SXOA 3L2NA 2O4HA 4HNWB 3IO1A 2YNCA 2VI7A 3QAHA 3JRUA 2C1CA 2CF4A 3GYAA 2POKA 2X7BA 4P4FA 3DGVA 3LACA 1FT7A 4KZTA 4PQAA 5LYLA 4CGPA 4R8FA 4MFPA 5J8CA 4FBEA 2ZEMA 4GXHA 5BWAB 4WJBA 2EWBA 3TOBA 3D8PA 4K30A 3D68A 4BBHA 3CZXA 3IU2A 2PR8A 1YSJA 3D67A 4U9ZA 4CAWA 2GFQA 2WUUA 1CM0A 3B8GA 5DWMA 1IB1E 2NSMA 3KZWA 1VKCA 4H6UA 4A2ZA 4C2XA 4OLLA 3WABA 4CRYB 3H8GA 2PRBA 4X5KA 3V7ZA 3TX8A 5A28A 3FH4A 4L8AA 3P2HA 1GHEA 2PJAA 3HLPA 2QIRA 4MFKA 4MHYA 4LX9A 2KCWA 4NGPA 2Z10A 4MHNA 4UA3A 3R9GA 3FVLA 4OADA 5JH9A 2ODFA 4KVXA 4I49A 4ZY0A 3KASA 1IGBA 3WT4A 4KUBA 2Z3LA 4NF1A 1R57A 2V8VA 4DNCA 2O28A 2AJ6A 4UEZA 5EC4A 2Q4VA 2DXQA 2CY2A 4DYOA 3S6HA 2Q43A 2FIAA 5JQ4A 3FXTA 2Q4ZA 3V38A 1YK3A 1B87A 2RFHA 1P0HA 2B4BA 2R7HA 1M44A 1S7FA 2F5IA 4Q7AA 4C2YA 2WZNA 4NFRA 2FT0A 1XMTA 2Z3NA 4HPSA 2OH1A 3T90A 3WC7A 4PK3A 7CPAA 1TKJA 2OZGA 2Q44A 2B3UA 4NJRA 1K4JA 5IV0A 2ANPA 4WWVA 5G1ZA 3G3SA 4YFJA 4OMEA 2PJ5A 3DLJA 3EY5A 1A2ZA 1L0CA 1UWYA 2GANA 5J1QA 2B5GA 2CNTA 4OIDA 1S7LA 2ABZA 2RB7A 2GE3A 2ZOGA 3EXNA 2P6GA 2PC1A 3B2YA 4C7IA 6CPAA 2AFWA 3PBEA 4PPZA 4FD6A 1KUXA 3SJXA 4JWPA 4CYQA 4OP4A 4CYPA 4F9UA 2P6EA 1YW4A 1YX0A 4X3RA 2PJ0A 1Z9UA 2XEIA 4CAXA 3PBBA 1DE4C 4NEXA 1U6MA 4UWIA 5K8NA 1QSRA 1XF8A 5E96A 3PB7X 3S9MA 4RUHA 1RO5A 3ISZA 4QVTA 4XPLA 2PIYA 4FD4A 1VGYA 4A38A 4C2ZA 4U9YA 2F8HA 1R3NA 2PJ9A 4KLWA 4P45A 5HVFA 5ISVA 1LRZA 1MJBA 1WK4A 4H6ZA 3GKRA 4Y49C 1S7KA 4H89A 4UBRA 3S6GA 2REFA 2QYVA 1ZO0A 1Q2YA 2GREA 3NE8A 4XPDB 2DPSA 4OIWA 4X8IA 5HVHA 4YGOA 1Y9WA 2FS5A 2ARHA 3IC1A 2FVGA 2ZEPA 2ZPAA 3GB0A 2ZELA 4Q36A 3CPXA 4KS9A 4P44A 1LANA 1YVOA 2G3TA 5KTDA 1OBRA 3FECA 2AFXA 2FXFA 3D7HA 1ZG8A 1HDUA 3B3CA 3BXMA 2Z0ZA 2V8GA 3TE4A 4MY3A 2I79A 2EK9A 3BLNA 2DPTA 3FEDA 3DSBA 2GLJA 1YMEA 2I3CA 2PQ8A 3G8WA 4R7MA 5K8MA 4A30A 3FX6A 2WPWA 2QMLA 5IX3A 3PEIA 1LOKA 4A94A 3RZAA 5LRJA 5ELYA 2OZHA 4IK2A 1XE4A 3DR6A 4PXBA 2PJ4A 3D7FA 4P4IA 2XEFA 2FIWA 2ZW5A 5EMIA 2JEVA 5C82A 2CXAA 1Z8TA 4AVCA 4B14A 1I12A 4OAEA 1Z5RA 4R6TA 5C88A 1TIQA 3H8EA 3I1UA 1JQGA 4NGRA 3TO6A 4UEEA 2ZEOA 4KVME 3GUXA 3D2MA 1RTQA 3SJFA 3VARA 5I4MA 4KUAA 1QQ9A 4MFJA 3TT2A 2CTCA 3CDXA 3K9UA 4E2AA 4UFXA 2DEAA 2GLFA 3BI1A 2D4OA 4JXRA 1LAPA 2Q0YA 4KOYA 1MK4A 5D29A 4A33A 1YW6A 2QJ8A 3FNCA 2B4DA 2AFSA 1XRYA 2PJ7A 4UF4A 2VQYA 4OC2A 2ZEEA 4UWJA 2VZZA 4KORA 4QC6A 1UFHA 2CIJA 4RN7A 5G20A 3S9LA 3RBUA 3H5ZA 4KVOE 4PXCA 4OKOA 5G21A 5LYIA 2AFUA 3D7GA 4KOWA 4CAEA 1BAVA 1F2PA 1KUYA 2BCOA 1ELLP 2EO8A 4EWTA 5F09A 2PVVA 3MGDA 1M4GA 2PJ2A 2QVPA 2IL4A 3JTKA 4FD5A 5KTCA 1YQEA 2PJ3A 2IJZA 2PDOA 3D66A 3PB9X 4UCNA 1ZG9A 4IUSA 5DWNA 4KOTA 4B6ZA 4LQ6A 2Z3MA 4ZGYB 4CGLA 2HUZA 4ZBGA 4UFWA 4OC5A 2CNSA 1BO4A 3NH4A 4MHZA 3BHXA 4O23A 3KI9A 2PR1A 3R1KA 1AMPA 4ZYQA 1NE9A 2JDDA 3PB6X 2ZOFA 4KSAA 4UEFA 4YWYA 1IIDA 2VL1A 2IQ6A 1BPMA 3F5BA 4Z65A 2XEJA 3FF3A 4MFQA 2JBKA 3CXPA 1ELMP 2WPXA 1ZLIA 4MXUA 4A37A 4AXVA 2Q04A 5EBVA 4CAFA 1M4IA 3JUWA 3KKWA 1IYLA 1TKFA 1Y7EA 3NA6A 4P4DA 1HDQA 4YRHA 2OR4A 4R76A 4CRZB 3TC8A 1CPSA 2G9DA 3CXSA 4ZY1A 5I0CA 4B5PB 1Z8XA 2GU2A 2AFZA 2D4PA 3I3GA 1IU8A 4QUSA 4PXDA 1LAMA 1Y0YA 4IHMA 2PJCA 1ARLA 5AG4A 3FJUA 1KWMA 1BOBA 5HXDA 3ZZIA 3FIXA 3GLJA 1EE3P 1KUVA 2EBJA 3TO9A 4CPAA 1FY7A 4RI1A 1VHEA 2YNCC 2PVWA 4TWEA 2Q7BA 3TO7A 1VIXA 1YGHA 3KHXA 2PSWA 3QNVA 3R9EA 3TCVA 4B11A 3KQXA 4NGTA 2CTBA 4R3KA 5AG7A 4KOXA 2Y0MA 1ZG7A 2PIZA 1V0CA 2RC4A 3KL9A 3IGRA 3PRTA 4P4JA 2J8NA 2HV2A 1LFWA 1N71A 2AFMA 3LWUA 4XNHC 2EK8A 3H4QA 4MCRA 3B3WA 1XIXA 4CAVA 3D2PA 5CNPA 3FEEA 3KR5A 2YNDA 4DJLA 3W6SA 4M6HA 4AVAA 1IY7A 3GIUA 3IJ3A 2G3AA 1CP7A 3EC4A 3MRUA 4B10A 1DTDA 3PFOA 3WC6A 3VATA 1YVKA 2CNMA 2HB6A 1XEBA 2REEA 3KHZA 3RYOA 4R57A 2A4NA 1IOIA 4B5OA 1Z8WA 4K3NA 1GYTA 4P4EA 2ZEDA 1S7NA 2J9AA 4MI4A 4XPDC 4F0XA 2C6GA 2GIVA 3SI1A 4H2KA 3QB8A 4OC4A 3IFEA 3D4UA 2VXKA 3DNSA 4PSXA 4ZX8A 1H8LA 2G0BA 3LODA 4OC0A 1S60A 4R3LA 5H86A 1VHSA 2R1IA 4M85A 1F2OA 4IF5A 5G22A 4TNUA 2FL4A 5AG6A 5A27A 1J4JA 3R95A 4FWUA 5F49A 2F7VA 3R96A 1NMTA 4C7HA 2PJ1A 3N7ZA 5K8PA 1Z4RA 2FSRA 1R43A 3SXNA 3CT9A 4P4BA 1QSNA 2NYQA 3VWEA 4AVBA 2VBQA 3ISXA 2BEIA 3B3TA 4MRIA 1XMBA 5HMNA 1IICA 1XFOA 4LUAA 3IWWA 2J8MA 2C6CA 3FYNA 5AGEA 4B5PA 3B7IA 1IOFA 4LQGA 1SQHA 3H8FA 5HH1A 2R98A 4JXQA 4OC3A 1F57A 3N5FA 4IAVA 4CS0B 1TF8A 4R87A 4JZ0A 2OB0A 4MHDA 1CG2A 1P4NA 4J3GA 2K5TA 1CP6A 3NFZA 4NSQA 1I21A 2JDCA 2ATRA 2C6PA 2Q51A 4UIBA 4NJQA 2O53A 4QBJA 4KSFA 3TOAA 2BL1A 1CJWA 4UCPA 2FCKA 2Z3KA 4B12A 1KZFA 4ZY2A 4BD9A 4NGMA 1JWQA 1XBUA 1PUAA 1TF9A 3PGPA 1QSTA 3B35A 4JD6A 4F8ZA 2WSAA 3V8IA 4UIAA 1Q2CA 1AUGA 4MCPA 4P6YA 1CBXA 3FBUA 3RO0A 4AB7A 2IMOA 4PK2A 4KOUA 3BJ8A 2HQYA 2Z3OA 1YLOA 1HEEA 2BSWA 2H5MA 3LMSA 4A39A 4HNYB 4A95A 5CBMA 1M4LA 5JM6A 2B58A 5GCNA 4A31A 5LYFA 1CX8A 1Y7RA 3K2KA 1QMUA 1Q7LA 1Y9KA 1LCPA 3CPAA 4X2TA 2ZENA 2J8RA 1NSAA 2I00A 4GM5A 2JEWA 2V8DA 4P10A 5LRGA 4AG9A 4W9YA 4DUKA 1FNOA 3RAMA 3B3SA 4B13A 4HNXB 2VZYA 4NGSA 3QAYA 1S5KA 1YR0A 2FE7A 3CXQA 3IEHA 4NCZA 3T9YA 2V77A 2B3VA 3NH5A 4MFLA 4MCQA 4PXEA 4Q38A 5HVGA 5K8OA 1X10A 2BOAA 4NGNA 4E0AA 2DF5A 4E8OA 2ZW7A 4MFZA 4NGQA 2NMTA 4OC1A 1NSLA 2BUEA 3S6KA 3DDDA 3NH8A 3OWCA 5IB9A 1XJOA 2QECA 2ZW6A 1QSMA 2Q7SA 4CYOA 4M6GA 2Q4YA 4UCMA 3KR4A 4KLVA 1I1DA 1M1DA 3IWEA 5J8FA 4CGMA 2ZXVA 3SI0A 3LD2A 3D7DA 4M6IA 5CPAA 3FRMA 4ZI6A 1TXRA 5F48A 3ZJ0A 4PSWA 4C68A 4L89A 2YGWA 4ORFA 1MJ9A 2YNEA 1TKHA 3FMCA 2Z11A 3K9TA 3R9FA 1BLLE 4XPKA 2EVNA 3PB8X 1B6BA 1ARMA 3S6FA 3SHPA 1YLEA 2PJBA 2Z3PA 4YU9A 4HKFA 1AYEA 4MJ8A 4JLYA 4ONUA 3HUVA 1MJAA 3IIBA 4Y49B 2PCUA 3KGQA 3WC5A 4U5YA 1OZPA 2OU2A 3BJ7A 1RXTA 4QB9A 4PV6A 4XNHB 3I9SA 5FVJA 1PU9A 3SJGA 2C27A 4JYWA 5D8NA 3UY5A 4EMEA 1PCAA 1PYTB 3FB3A 4FAIA 1M4DA 1ZLHA 2B4DB 2P0WA 4MBUA 2BO9A 3BI0A 4F9VA 3IU1A 5LRKA 5F46A 1VHOA 3IWGA 3D3SA 5AG5A 5DS0A 2ZEHA 4BINA 4BMHA 4MY0A 5JGFA 8CPAA 4M3SA 2EUIA 4GS4A 3TTHA 4A32A 3TFYA 3EFAA 4ONWA 5KTAA 1BPNA 3VWDA 4II9A 3EO4A 3KQZA 2OOTA 1WWZA 4EVYA 1Q2DA 4MCSA 3S9NA 3C26A 3PP9A 2OZUA 3W6XA 3W91A 5IB0A 2JLMA 4UFVA 4CGNA 4F0YA 3A9LA 3PB4X 1YREA 2JBJA 2V8HA 4AG7A 2PE3A 3PZJA 5H84A 4EFDA 3WR7A 2P6FA 4F6AA 1Y0RA 2AE6A 4FD7A 3MN8A
chains in the Genus database with same CATH topology
4KSIA 3B3VA 1Z8LA 2ZEFA 3SI2A 4ZX9A 2XEGA 3SJEA 1CPXA 2WYRA 4G1PA 4MMOA 2HC9A 3VH9A 2ZEGA 2PJ8A 4MHPA 2PJ6A 3PFEA 5THWA 2AFOA 4FUUA 2PRQA 5LYDA 3T8WA 1Z2LA 3L2NA 2O4HA 3IO1A 3JRUA 2C1CA 2CF4A 2POKA 4P4FA 3DGVA 1FT7A 4PQAA 5LYLA 4R8FA 4FBEA 2ZEMA 4WJBA 2EWBA 3D68A 1YSJA 3D67A 1Y0RA 3KZWA 2NSMA 3WABA 3H8GA 3V7ZA 3TX8A 3FH4A 3HLPA 2PJAA 4MHYA 4NGPA 4MHNA 3FVLA 5JH9A 4ZY0A 3KASA 1IGBA 3WT4A 2V8VA 4UEZA 4DYOA 2Q43A 2Q4ZA 3V38A 2RFHA 4Q7AA 2WZNA 4NFRA 3WC7A 7CPAA 1TKJA 4NJRA 2ANPA 4WWVA 4OMEA 2PJ5A 3DLJA 1UWYA 5J1QA 4OIDA 2ABZA 2RB7A 2ZOGA 3B2YA 6CPAA 2AFWA 3PBEA 4PPZA 3SJXA 4OP4A 4F9UA 1YW4A 4X3RA 2PJ0A 2XEIA 3PBBA 1DE4C 5K8NA 3PB7X 3S9MA 4RUHA 3ISZA 2PIYA 1VGYA 4A38A 2F8HA 1R3NA 2PJ9A 4P45A 5HVFA 2QYVA 2GREA 4OIWA 4X8IA 5HVHA 3IC1A 2FVGA 2ZEPA 3GB0A 2ZELA 3CPXA 4P44A 1LANA 1OBRA 3FECA 2AFXA 3D7HA 1ZG8A 1HDUA 3B3CA 3BXMA 2V8GA 3FEDA 2EK9A 2GLJA 1YMEA 2I3CA 4R7MA 5K8MA 3FX6A 3PEIA 1LOKA 4A94A 3RZAA 5LRJA 5ELYA 4IK2A 4PXBA 2PJ4A 3D7FA 4P4IA 2XEFA 1Z5RA 4R6TA 3H8EA 3I1UA 1JQGA 4NGRA 4UEEA 2ZEOA 3GUXA 1RTQA 3SJFA 3VARA 5I4MA 1QQ9A 2CTCA 3CDXA 2DEAA 2GLFA 3BI1A 1LAPA 5D29A 1YW6A 2QJ8A 2AFSA 1XRYA 2PJ7A 4UF4A 4OC2A 2ZEEA 2CIJA 3S9LA 3RBUA 4PXCA 4OKOA 5LYIA 2AFUA 3D7GA 1BAVA 1F2PA 2BCOA 1ELLP 4EWTA 5F09A 2PVVA 2PJ2A 2QVPA 2PJ3A 2IJZA 3D66A 3PB9X 1ZG9A 4B6ZA 4OC5A 3NH4A 4MHZA 4O23A 3BHXA 3KI9A 4ZYQA 1AMPA 4YWYA 4UEFA 3PB6X 2ZOFA 2VL1A 2IQ6A 1BPMA 4Z65A 3FF3A 2JBKA 1ELMP 1ZLIA 4MXUA 4A37A 4AXVA 3NA6A 1Y7EA 1TKFA 4P4DA 1HDQA 2OR4A 4R76A 3TC8A 1CPSA 2G9DA 4ZY1A 2GU2A 2AFZA 4PXDA 1LAMA 1Y0YA 4IHMA 2PJCA 1ARLA 3FJUA 1KWMA 5HXDA 3GLJA 1EE3P 4CPAA 4TWEA 1VHEA 2PVWA 1VIXA 3KHXA 3QNVA 3KQXA 4NGTA 2CTBA 1ZG7A 2PIZA 3PRTA 4P4JA 3KL9A 1LFWA 2AFMA 3LWUA 2EK8A 4MCRA 3B3WA 3FEEA 3KR5A 4DJLA 1IY7A 3IJ3A 1CP7A 3MRUA 1DTDA 3PFOA 3WC6A 3VATA 2HB6A 3KHZA 4K3NA 1GYTA 4P4EA 2ZEDA 2J9AA 2C6GA 3SI1A 4H2KA 4OC4A 3IFEA 3D4UA 4ZX8A 1H8LA 4OC0A 1F2OA 4TNUA 4FWUA 2F7VA 2PJ1A 5K8PA 1R43A 3CT9A 4P4BA 2NYQA 3ISXA 3B3TA 4MRIA 1XMBA 1XFOA 3IWWA 2C6CA 3B7IA 4LQGA 3H8FA 4OC3A 1F57A 3N5FA 4IAVA 1TF8A 4JZ0A 1CG2A 1CP6A 3NFZA 2C6PA 2Q51A 4UIBA 4NJQA 2O53A 4ZY2A 4BD9A 4NGMA 1XBUA 1TF9A 3B35A 4F8ZA 4UIAA 4MCPA 4P6YA 1CBXA 2IMOA 3LMSA 1YLOA 1HEEA 4A39A 5JM6A 5CBMA 1M4LA 5LYFA 1CX8A 3K2KA 1QMUA 1Q7LA 1LCPA 3CPAA 4X2TA 2ZENA 5LRGA 1NSAA 4GM5A 2JEWA 2V8DA 4P10A 4DUKA 4W9YA 1FNOA 3RAMA 3B3SA 4NGSA 3IEHA 2V77A 3NH5A 4MCQA 4PXEA 5HVGA 5K8OA 4NGNA 2BOAA 4NGQA 4OC1A 3NH8A 5IB9A 1XJOA 3KR4A 3SI0A 3D7DA 5CPAA 4ZI6A 1TXRA 1TKHA 3FMCA 3K9TA 1BLLE 3PB8X 1ARMA 2PJBA 4YU9A 1AYEA 3HUVA 3IIBA 2PCUA 3KGQA 3WC5A 3SJGA 5D8NA 4JYWA 4EMEA 1PCAA 1PYTB 4FAIA 1ZLHA 4F9VA 2BO9A 3BI0A 5LRKA 1VHOA 5DS0A 5JGFA 2ZEHA 8CPAA 4ONWA 1BPNA 3KQZA 2OOTA 4MCSA 3S9NA 3PB4X 2JBJA 2V8HA 4EFDA 2PE3A 2XEJA 3MN8A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4KSI A;  3B3V A;  1Z8L A;  2ZEF A;  3SI2 A;  4ZX9 A;  2XEG A;  3SJE A;  1CPX A;  2WYR A;  4G1P A;  4MMO A;  2HC9 A;  3VH9 A;  2ZEG A;  2PJ8 A;  4MHP A;  2PJ6 A;  3PFE A;  5THW A;  2AFO A;  4FUU A;  2PRQ A;  5LYD A;  3T8W A;  1Z2L A;  3L2N A;  2O4H A;  3IO1 A;  3JRU A;  2C1C A;  2CF4 A;  2POK A;  4P4F A;  3DGV A;  1FT7 A;  4PQA A;  5LYL A;  4R8F A;  4FBE A;  2ZEM A;  4WJB A;  2EWB A;  3D68 A;  1YSJ A;  3D67 A;  1Y0R A;  3KZW A;  2NSM A;  3WAB A;  3H8G A;  3V7Z A;  3TX8 A;  3FH4 A;  3HLP A;  2PJA A;  4MHY A;  4NGP A;  4MHN A;  3FVL A;  5JH9 A;  4ZY0 A;  3KAS A;  1IGB A;  3WT4 A;  2V8V A;  4UEZ A;  4DYO A;  2Q43 A;  2Q4Z A;  3V38 A;  2RFH A;  4Q7A A;  2WZN A;  4NFR A;  3WC7 A;  7CPA A;  1TKJ A;  4NJR A;  2ANP A;  4WWV A;  4OME A;  2PJ5 A;  3DLJ A;  1UWY A;  5J1Q A;  4OID A;  2ABZ A;  2RB7 A;  2ZOG A;  3B2Y A;  6CPA A;  2AFW A;  3PBE A;  4PPZ A;  3SJX A;  4OP4 A;  4F9U A;  1YW4 A;  4X3R A;  2PJ0 A;  2XEI A;  3PBB A;  1DE4 C;  5K8N A;  3PB7 X;  3S9M A;  4RUH A;  3ISZ A;  2PIY A;  1VGY A;  4A38 A;  2F8H A;  1R3N A;  2PJ9 A;  4P45 A;  5HVF A;  2QYV A;  2GRE A;  4OIW A;  4X8I A;  5HVH A;  3IC1 A;  2FVG A;  2ZEP A;  3GB0 A;  2ZEL A;  3CPX A;  4P44 A;  1LAN A;  1OBR A;  3FEC A;  2AFX A;  3D7H A;  1ZG8 A;  1HDU A;  3B3C A;  3BXM A;  2V8G A;  3FED A;  2EK9 A;  2GLJ A;  1YME A;  2I3C A;  4R7M A;  5K8M A;  3FX6 A;  3PEI A;  1LOK A;  4A94 A;  3RZA A;  5LRJ A;  5ELY A;  4IK2 A;  4PXB A;  2PJ4 A;  3D7F A;  4P4I A;  2XEF A;  1Z5R A;  4R6T A;  3H8E A;  3I1U A;  1JQG A;  4NGR A;  4UEE A;  2ZEO A;  3GUX A;  1RTQ A;  3SJF A;  3VAR A;  5I4M A;  1QQ9 A;  2CTC A;  3CDX A;  2DEA A;  2GLF A;  3BI1 A;  1LAP A;  5D29 A;  1YW6 A;  2QJ8 A;  2AFS A;  1XRY A;  2PJ7 A;  4UF4 A;  4OC2 A;  2ZEE A;  2CIJ A;  3S9L A;  3RBU A;  4PXC A;  4OKO A;  5LYI A;  2AFU A;  3D7G A;  1BAV A;  1F2P A;  2BCO A;  1ELL P;  4EWT A;  5F09 A;  2PVV A;  2PJ2 A;  2QVP A;  2PJ3 A;  2IJZ A;  3D66 A;  3PB9 X;  1ZG9 A;  4B6Z A;  4OC5 A;  3NH4 A;  4MHZ A;  4O23 A;  3BHX A;  3KI9 A;  4ZYQ A;  1AMP A;  4YWY A;  4UEF A;  3PB6 X;  2ZOF A;  2VL1 A;  2IQ6 A;  1BPM A;  4Z65 A;  3FF3 A;  2JBK A;  1ELM P;  1ZLI A;  4MXU A;  4A37 A;  4AXV A;  3NA6 A;  1Y7E A;  1TKF A;  4P4D A;  1HDQ A;  2OR4 A;  4R76 A;  3TC8 A;  1CPS A;  2G9D A;  4ZY1 A;  2GU2 A;  2AFZ A;  4PXD A;  1LAM A;  1Y0Y A;  4IHM A;  2PJC A;  1ARL A;  3FJU A;  1KWM A;  5HXD A;  3GLJ A;  1EE3 P;  4CPA A;  4TWE A;  1VHE A;  2PVW A;  1VIX A;  3KHX A;  3QNV A;  3KQX A;  4NGT A;  2CTB A;  1ZG7 A;  2PIZ A;  3PRT A;  4P4J A;  3KL9 A;  1LFW A;  2AFM A;  3LWU A;  2EK8 A;  4MCR A;  3B3W A;  3FEE A;  3KR5 A;  4DJL A;  1IY7 A;  3IJ3 A;  1CP7 A;  3MRU A;  1DTD A;  3PFO A;  3WC6 A;  3VAT A;  2HB6 A;  3KHZ A;  4K3N A;  1GYT A;  4P4E A;  2ZED A;  2J9A A;  2C6G A;  3SI1 A;  4H2K A;  4OC4 A;  3IFE A;  3D4U A;  4ZX8 A;  1H8L A;  4OC0 A;  1F2O A;  4TNU A;  4FWU A;  2F7V A;  2PJ1 A;  5K8P A;  1R43 A;  3CT9 A;  4P4B A;  2NYQ A;  3ISX A;  3B3T A;  4MRI A;  1XMB A;  1XFO A;  3IWW A;  2C6C A;  3B7I A;  4LQG A;  3H8F A;  4OC3 A;  1F57 A;  3N5F A;  4IAV A;  1TF8 A;  4JZ0 A;  1CG2 A;  1CP6 A;  3NFZ A;  2C6P A;  2Q51 A;  4UIB A;  4NJQ A;  2O53 A;  4ZY2 A;  4BD9 A;  4NGM A;  1XBU A;  1TF9 A;  3B35 A;  4F8Z A;  4UIA A;  4MCP A;  4P6Y A;  1CBX A;  2IMO A;  3LMS A;  1YLO A;  1HEE A;  4A39 A;  5JM6 A;  5CBM A;  1M4L A;  5LYF A;  1CX8 A;  3K2K A;  1QMU A;  1Q7L A;  1LCP A;  3CPA A;  4X2T A;  2ZEN A;  5LRG A;  1NSA A;  4GM5 A;  2JEW A;  2V8D A;  4P10 A;  4DUK A;  4W9Y A;  1FNO A;  3RAM A;  3B3S A;  4NGS A;  3IEH A;  2V77 A;  3NH5 A;  4MCQ A;  4PXE A;  5HVG A;  5K8O A;  4NGN A;  2BOA A;  4NGQ A;  4OC1 A;  3NH8 A;  5IB9 A;  1XJO A;  3KR4 A;  3SI0 A;  3D7D A;  5CPA A;  4ZI6 A;  1TXR A;  1TKH A;  3FMC A;  3K9T A;  1BLL E;  3PB8 X;  1ARM A;  2PJB A;  4YU9 A;  1AYE A;  3HUV A;  3IIB A;  2PCU A;  3KGQ A;  3WC5 A;  3SJG A;  5D8N A;  4JYW A;  4EME A;  1PCA A;  1PYT B;  4FAI A;  1ZLH A;  4F9V A;  2BO9 A;  3BI0 A;  5LRK A;  1VHO A;  5DS0 A;  5JGF A;  2ZEH A;  8CPA A;  4ONW A;  1BPN A;  3KQZ A;  2OOT A;  4MCS A;  3S9N A;  3PB4 X;  2JBJ A;  2V8H A;  4EFD A;  2PE3 A;  2XEJ A;  3MN8 A; 
#chains in the Genus database with same CATH topology
 4KSI A;  3E0K A;  3B3V A;  2VEZ A;  1Z8L A;  2ZEF A;  2R8V A;  3GY9 A;  1S3Z A;  2XEG A;  4NXY A;  4KOV A;  4ZX9 A;  3SI2 A;  4RS2 A;  3SJE A;  1CPX A;  2WYR A;  3P2F A;  3F0A A;  4G1P A;  4CGO A;  3JVN A;  4MMO A;  1X12 A;  3NE7 A;  5JPH A;  2HC9 A;  4JJX A;  1XOV A;  3VH9 A;  3F8K A;  5F47 A;  2ZEG A;  2ZW4 A;  2PJ8 A;  3DR8 A;  4KOS A;  4MHP A;  3RNZ A;  2PJ6 A;  3PFE A;  4R9M A;  1QSO A;  5THW A;  1ON0 A;  2AFO A;  1Z4E A;  2B5G B;  4FUU A;  2PRQ A;  5LYD A;  3T8W A;  4CYN A;  1IYK A;  1Z2L A;  3SXO A;  3L2N A;  2O4H A;  4HNW B;  3IO1 A;  2YNC A;  2VI7 A;  3QAH A;  3JRU A;  2C1C A;  2CF4 A;  3GYA A;  2POK A;  2X7B A;  4P4F A;  3DGV A;  3LAC A;  1FT7 A;  4KZT A;  4PQA A;  5LYL A;  4CGP A;  4R8F A;  4MFP A;  5J8C A;  4FBE A;  2ZEM A;  4GXH A;  5BWA B;  4WJB A;  2EWB A;  3TOB A;  3D8P A;  4K30 A;  3D68 A;  4BBH A;  3CZX A;  3IU2 A;  2PR8 A;  1YSJ A;  3D67 A;  4U9Z A;  4CAW A;  2GFQ A;  2WUU A;  1CM0 A;  3B8G A;  5DWM A;  1IB1 E;  2NSM A;  3KZW A;  1VKC A;  4H6U A;  4A2Z A;  4C2X A;  4OLL A;  3WAB A;  4CRY B;  3H8G A;  2PRB A;  4X5K A;  3V7Z A;  3TX8 A;  5A28 A;  3FH4 A;  4L8A A;  3P2H A;  1GHE A;  2PJA A;  3HLP A;  2QIR A;  4MFK A;  4MHY A;  4LX9 A;  2KCW A;  4NGP A;  2Z10 A;  4MHN A;  4UA3 A;  3R9G A;  3FVL A;  4OAD A;  5JH9 A;  2ODF A;  4KVX A;  4I49 A;  4ZY0 A;  3KAS A;  1IGB A;  3WT4 A;  4KUB A;  2Z3L A;  4NF1 A;  1R57 A;  2V8V A;  4DNC A;  2O28 A;  2AJ6 A;  4UEZ A;  5EC4 A;  2Q4V A;  2DXQ A;  2CY2 A;  4DYO A;  3S6H A;  2Q43 A;  2FIA A;  5JQ4 A;  3FXT A;  2Q4Z A;  3V38 A;  1YK3 A;  1B87 A;  2RFH A;  1P0H A;  2B4B A;  2R7H A;  1M44 A;  1S7F A;  2F5I A;  4Q7A A;  4C2Y A;  2WZN A;  4NFR A;  2FT0 A;  1XMT A;  2Z3N A;  4HPS A;  2OH1 A;  3T90 A;  3WC7 A;  4PK3 A;  7CPA A;  1TKJ A;  2OZG A;  2Q44 A;  2B3U A;  4NJR A;  1K4J A;  5IV0 A;  2ANP A;  4WWV A;  5G1Z A;  3G3S A;  4YFJ A;  4OME A;  2PJ5 A;  3DLJ A;  3EY5 A;  1A2Z A;  1L0C A;  1UWY A;  2GAN A;  5J1Q A;  2B5G A;  2CNT A;  4OID A;  1S7L A;  2ABZ A;  2RB7 A;  2GE3 A;  2ZOG A;  3EXN A;  2P6G A;  2PC1 A;  3B2Y A;  4C7I A;  6CPA A;  2AFW A;  3PBE A;  4PPZ A;  4FD6 A;  1KUX A;  3SJX A;  4JWP A;  4CYQ A;  4OP4 A;  4CYP A;  4F9U A;  2P6E A;  1YW4 A;  1YX0 A;  4X3R A;  2PJ0 A;  1Z9U A;  2XEI A;  4CAX A;  3PBB A;  1DE4 C;  4NEX A;  1U6M A;  4UWI A;  5K8N A;  1QSR A;  1XF8 A;  5E96 A;  3PB7 X;  3S9M A;  4RUH A;  1RO5 A;  3ISZ A;  4QVT A;  4XPL A;  2PIY A;  4FD4 A;  1VGY A;  4A38 A;  4C2Z A;  4U9Y A;  2F8H A;  1R3N A;  2PJ9 A;  4KLW A;  4P45 A;  5HVF A;  5ISV A;  1LRZ A;  1MJB A;  1WK4 A;  4H6Z A;  3GKR A;  4Y49 C;  1S7K A;  4H89 A;  4UBR A;  3S6G A;  2REF A;  2QYV A;  1ZO0 A;  1Q2Y A;  2GRE A;  3NE8 A;  4XPD B;  2DPS A;  4OIW A;  4X8I A;  5HVH A;  4YGO A;  1Y9W A;  2FS5 A;  2ARH A;  3IC1 A;  2FVG A;  2ZEP A;  2ZPA A;  3GB0 A;  2ZEL A;  4Q36 A;  3CPX A;  4KS9 A;  4P44 A;  1LAN A;  1YVO A;  2G3T A;  5KTD A;  1OBR A;  3FEC A;  2AFX A;  2FXF A;  3D7H A;  1ZG8 A;  1HDU A;  3B3C A;  3BXM A;  2Z0Z A;  2V8G A;  3TE4 A;  4MY3 A;  2I79 A;  2EK9 A;  3BLN A;  2DPT A;  3FED A;  3DSB A;  2GLJ A;  1YME A;  2I3C A;  2PQ8 A;  3G8W A;  4R7M A;  5K8M A;  4A30 A;  3FX6 A;  2WPW A;  2QML A;  5IX3 A;  3PEI A;  1LOK A;  4A94 A;  3RZA A;  5LRJ A;  5ELY A;  2OZH A;  4IK2 A;  1XE4 A;  3DR6 A;  4PXB A;  2PJ4 A;  3D7F A;  4P4I A;  2XEF A;  2FIW A;  2ZW5 A;  5EMI A;  2JEV A;  5C82 A;  2CXA A;  1Z8T A;  4AVC A;  4B14 A;  1I12 A;  4OAE A;  1Z5R A;  4R6T A;  5C88 A;  1TIQ A;  3H8E A;  3I1U A;  1JQG A;  4NGR A;  3TO6 A;  4UEE A;  2ZEO A;  4KVM E;  3GUX A;  3D2M A;  1RTQ A;  3SJF A;  3VAR A;  5I4M A;  4KUA A;  1QQ9 A;  4MFJ A;  3TT2 A;  2CTC A;  3CDX A;  3K9U A;  4E2A A;  4UFX A;  2DEA A;  2GLF A;  3BI1 A;  2D4O A;  4JXR A;  1LAP A;  2Q0Y A;  4KOY A;  1MK4 A;  5D29 A;  4A33 A;  1YW6 A;  2QJ8 A;  3FNC A;  2B4D A;  2AFS A;  1XRY A;  2PJ7 A;  4UF4 A;  2VQY A;  4OC2 A;  2ZEE A;  4UWJ A;  2VZZ A;  4KOR A;  4QC6 A;  1UFH A;  2CIJ A;  4RN7 A;  5G20 A;  3S9L A;  3RBU A;  3H5Z A;  4KVO E;  4PXC A;  4OKO A;  5G21 A;  5LYI A;  2AFU A;  3D7G A;  4KOW A;  4CAE A;  1BAV A;  1F2P A;  1KUY A;  2BCO A;  1ELL P;  2EO8 A;  4EWT A;  5F09 A;  2PVV A;  3MGD A;  1M4G A;  2PJ2 A;  2QVP A;  2IL4 A;  3JTK A;  4FD5 A;  5KTC A;  1YQE A;  2PJ3 A;  2IJZ A;  2PDO A;  3D66 A;  3PB9 X;  4UCN A;  1ZG9 A;  4IUS A;  5DWN A;  4KOT A;  4B6Z A;  4LQ6 A;  2Z3M A;  4ZGY B;  4CGL A;  2HUZ A;  4ZBG A;  4UFW A;  4OC5 A;  2CNS A;  1BO4 A;  3NH4 A;  4MHZ A;  3BHX A;  4O23 A;  3KI9 A;  2PR1 A;  3R1K A;  1AMP A;  4ZYQ A;  1NE9 A;  2JDD A;  3PB6 X;  2ZOF A;  4KSA A;  4UEF A;  4YWY A;  1IID A;  2VL1 A;  2IQ6 A;  1BPM A;  3F5B A;  4Z65 A;  2XEJ A;  3FF3 A;  4MFQ A;  2JBK A;  3CXP A;  1ELM P;  2WPX A;  1ZLI A;  4MXU A;  4A37 A;  4AXV A;  2Q04 A;  5EBV A;  4CAF A;  1M4I A;  3JUW A;  3KKW A;  1IYL A;  1TKF A;  1Y7E A;  3NA6 A;  4P4D A;  1HDQ A;  4YRH A;  2OR4 A;  4R76 A;  4CRZ B;  3TC8 A;  1CPS A;  2G9D A;  3CXS A;  4ZY1 A;  5I0C A;  4B5P B;  1Z8X A;  2GU2 A;  2AFZ A;  2D4P A;  3I3G A;  1IU8 A;  4QUS A;  4PXD A;  1LAM A;  1Y0Y A;  4IHM A;  2PJC A;  1ARL A;  5AG4 A;  3FJU A;  1KWM A;  1BOB A;  5HXD A;  3ZZI A;  3FIX A;  3GLJ A;  1EE3 P;  1KUV A;  2EBJ A;  3TO9 A;  4CPA A;  1FY7 A;  4RI1 A;  1VHE A;  2YNC C;  2PVW A;  4TWE A;  2Q7B A;  3TO7 A;  1VIX A;  1YGH A;  3KHX A;  2PSW A;  3QNV A;  3R9E A;  3TCV A;  4B11 A;  3KQX A;  4NGT A;  2CTB A;  4R3K A;  5AG7 A;  4KOX A;  2Y0M A;  1ZG7 A;  2PIZ A;  1V0C A;  2RC4 A;  3KL9 A;  3IGR A;  3PRT A;  4P4J A;  2J8N A;  2HV2 A;  1LFW A;  1N71 A;  2AFM A;  3LWU A;  4XNH C;  2EK8 A;  3H4Q A;  4MCR A;  3B3W A;  1XIX A;  4CAV A;  3D2P A;  5CNP A;  3FEE A;  3KR5 A;  2YND A;  4DJL A;  3W6S A;  4M6H A;  4AVA A;  1IY7 A;  3GIU A;  3IJ3 A;  2G3A A;  1CP7 A;  3EC4 A;  3MRU A;  4B10 A;  1DTD A;  3PFO A;  3WC6 A;  3VAT A;  1YVK A;  2CNM A;  2HB6 A;  1XEB A;  2REE A;  3KHZ A;  3RYO A;  4R57 A;  2A4N A;  1IOI A;  4B5O A;  1Z8W A;  4K3N A;  1GYT A;  4P4E A;  2ZED A;  1S7N A;  2J9A A;  4MI4 A;  4XPD C;  4F0X A;  2C6G A;  2GIV A;  3SI1 A;  4H2K A;  3QB8 A;  4OC4 A;  3IFE A;  3D4U A;  2VXK A;  3DNS A;  4PSX A;  4ZX8 A;  1H8L A;  2G0B A;  3LOD A;  4OC0 A;  1S60 A;  4R3L A;  5H86 A;  1VHS A;  2R1I A;  4M85 A;  1F2O A;  4IF5 A;  5G22 A;  4TNU A;  2FL4 A;  5AG6 A;  5A27 A;  1J4J A;  3R95 A;  4FWU A;  5F49 A;  2F7V A;  3R96 A;  1NMT A;  4C7H A;  2PJ1 A;  3N7Z A;  5K8P A;  1Z4R A;  2FSR A;  1R43 A;  3SXN A;  3CT9 A;  4P4B A;  1QSN A;  2NYQ A;  3VWE A;  4AVB A;  2VBQ A;  3ISX A;  2BEI A;  3B3T A;  4MRI A;  1XMB A;  5HMN A;  1IIC A;  1XFO A;  4LUA A;  3IWW A;  2J8M A;  2C6C A;  3FYN A;  5AGE A;  4B5P A;  3B7I A;  1IOF A;  4LQG A;  1SQH A;  3H8F A;  5HH1 A;  2R98 A;  4JXQ A;  4OC3 A;  1F57 A;  3N5F A;  4IAV A;  4CS0 B;  1TF8 A;  4R87 A;  4JZ0 A;  2OB0 A;  4MHD A;  1CG2 A;  1P4N A;  4J3G A;  2K5T A;  1CP6 A;  3NFZ A;  4NSQ A;  1I21 A;  2JDC A;  2ATR A;  2C6P A;  2Q51 A;  4UIB A;  4NJQ A;  2O53 A;  4QBJ A;  4KSF A;  3TOA A;  2BL1 A;  1CJW A;  4UCP A;  2FCK A;  2Z3K A;  4B12 A;  1KZF A;  4ZY2 A;  4BD9 A;  4NGM A;  1JWQ A;  1XBU A;  1PUA A;  1TF9 A;  3PGP A;  1QST A;  3B35 A;  4JD6 A;  4F8Z A;  2WSA A;  3V8I A;  4UIA A;  1Q2C A;  1AUG A;  4MCP A;  4P6Y A;  1CBX A;  3FBU A;  3RO0 A;  4AB7 A;  2IMO A;  4PK2 A;  4KOU A;  3BJ8 A;  2HQY A;  2Z3O A;  1YLO A;  1HEE A;  2BSW A;  2H5M A;  3LMS A;  4A39 A;  4HNY B;  4A95 A;  5CBM A;  1M4L A;  5JM6 A;  2B58 A;  5GCN A;  4A31 A;  5LYF A;  1CX8 A;  1Y7R A;  3K2K A;  1QMU A;  1Q7L A;  1Y9K A;  1LCP A;  3CPA A;  4X2T A;  2ZEN A;  2J8R A;  1NSA A;  2I00 A;  4GM5 A;  2JEW A;  2V8D A;  4P10 A;  5LRG A;  4AG9 A;  4W9Y A;  4DUK A;  1FNO A;  3RAM A;  3B3S A;  4B13 A;  4HNX B;  2VZY A;  4NGS A;  3QAY A;  1S5K A;  1YR0 A;  2FE7 A;  3CXQ A;  3IEH A;  4NCZ A;  3T9Y A;  2V77 A;  2B3V A;  3NH5 A;  4MFL A;  4MCQ A;  4PXE A;  4Q38 A;  5HVG A;  5K8O A;  1X10 A;  2BOA A;  4NGN A;  4E0A A;  2DF5 A;  4E8O A;  2ZW7 A;  4MFZ A;  4NGQ A;  2NMT A;  4OC1 A;  1NSL A;  2BUE A;  3S6K A;  3DDD A;  3NH8 A;  3OWC A;  5IB9 A;  1XJO A;  2QEC A;  2ZW6 A;  1QSM A;  2Q7S A;  4CYO A;  4M6G A;  2Q4Y A;  4UCM A;  3KR4 A;  4KLV A;  1I1D A;  1M1D A;  3IWE A;  5J8F A;  4CGM A;  2ZXV A;  3SI0 A;  3LD2 A;  3D7D A;  4M6I A;  5CPA A;  3FRM A;  4ZI6 A;  1TXR A;  5F48 A;  3ZJ0 A;  4PSW A;  4C68 A;  4L89 A;  2YGW A;  4ORF A;  1MJ9 A;  2YNE A;  1TKH A;  3FMC A;  2Z11 A;  3K9T A;  3R9F A;  1BLL E;  4XPK A;  2EVN A;  3PB8 X;  1B6B A;  1ARM A;  3S6F A;  3SHP A;  1YLE A;  2PJB A;  2Z3P A;  4YU9 A;  4HKF A;  1AYE A;  4MJ8 A;  4JLY A;  4ONU A;  3HUV A;  1MJA A;  3IIB A;  4Y49 B;  2PCU A;  3KGQ A;  3WC5 A;  4U5Y A;  1OZP A;  2OU2 A;  3BJ7 A;  1RXT A;  4QB9 A;  4PV6 A;  4XNH B;  3I9S A;  5FVJ A;  1PU9 A;  3SJG A;  2C27 A;  4JYW A;  5D8N A;  3UY5 A;  4EME A;  1PCA A;  1PYT B;  3FB3 A;  4FAI A;  1M4D A;  1ZLH A;  2B4D B;  2P0W A;  4MBU A;  2BO9 A;  3BI0 A;  4F9V A;  3IU1 A;  5LRK A;  5F46 A;  1VHO A;  3IWG A;  3D3S A;  5AG5 A;  5DS0 A;  2ZEH A;  4BIN A;  4BMH A;  4MY0 A;  5JGF A;  8CPA A;  4M3S A;  2EUI A;  4GS4 A;  3TTH A;  4A32 A;  3TFY A;  3EFA A;  4ONW A;  5KTA A;  1BPN A;  3VWD A;  4II9 A;  3EO4 A;  3KQZ A;  2OOT A;  1WWZ A;  4EVY A;  1Q2D A;  4MCS A;  3S9N A;  3C26 A;  3PP9 A;  2OZU A;  3W6X A;  3W91 A;  5IB0 A;  2JLM A;  4UFV A;  4CGN A;  4F0Y A;  3A9L A;  3PB4 X;  1YRE A;  2JBJ A;  2V8H A;  4AG7 A;  2PE3 A;  3PZJ A;  5H84 A;  4EFD A;  3WR7 A;  2P6F A;  4F6A A;  1Y0R A;  2AE6 A;  4FD7 A;  3MN8 A; 
#chains in the Genus database with same CATH homology
 4KSI A;  3B3V A;  1Z8L A;  2ZEF A;  3SI2 A;  4ZX9 A;  2XEG A;  3SJE A;  1CPX A;  2WYR A;  4G1P A;  4MMO A;  2HC9 A;  3VH9 A;  2ZEG A;  2PJ8 A;  4MHP A;  2PJ6 A;  3PFE A;  5THW A;  2AFO A;  4FUU A;  2PRQ A;  5LYD A;  3T8W A;  1Z2L A;  3L2N A;  2O4H A;  3IO1 A;  3JRU A;  2C1C A;  2CF4 A;  2POK A;  4P4F A;  3DGV A;  1FT7 A;  4PQA A;  5LYL A;  4R8F A;  4FBE A;  2ZEM A;  4WJB A;  2EWB A;  3D68 A;  1YSJ A;  3D67 A;  1Y0R A;  3KZW A;  2NSM A;  3WAB A;  3H8G A;  3V7Z A;  3TX8 A;  3FH4 A;  3HLP A;  2PJA A;  4MHY A;  4NGP A;  4MHN A;  3FVL A;  5JH9 A;  4ZY0 A;  3KAS A;  1IGB A;  3WT4 A;  2V8V A;  4UEZ A;  4DYO A;  2Q43 A;  2Q4Z A;  3V38 A;  2RFH A;  4Q7A A;  2WZN A;  4NFR A;  3WC7 A;  7CPA A;  1TKJ A;  4NJR A;  2ANP A;  4WWV A;  4OME A;  2PJ5 A;  3DLJ A;  1UWY A;  5J1Q A;  4OID A;  2ABZ A;  2RB7 A;  2ZOG A;  3B2Y A;  6CPA A;  2AFW A;  3PBE A;  4PPZ A;  3SJX A;  4OP4 A;  4F9U A;  1YW4 A;  4X3R A;  2PJ0 A;  2XEI A;  3PBB A;  1DE4 C;  5K8N A;  3PB7 X;  3S9M A;  4RUH A;  3ISZ A;  2PIY A;  1VGY A;  4A38 A;  2F8H A;  1R3N A;  2PJ9 A;  4P45 A;  5HVF A;  2QYV A;  2GRE A;  4OIW A;  4X8I A;  5HVH A;  3IC1 A;  2FVG A;  2ZEP A;  3GB0 A;  2ZEL A;  3CPX A;  4P44 A;  1LAN A;  1OBR A;  3FEC A;  2AFX A;  3D7H A;  1ZG8 A;  1HDU A;  3B3C A;  3BXM A;  2V8G A;  3FED A;  2EK9 A;  2GLJ A;  1YME A;  2I3C A;  4R7M A;  5K8M A;  3FX6 A;  3PEI A;  1LOK A;  4A94 A;  3RZA A;  5LRJ A;  5ELY A;  4IK2 A;  4PXB A;  2PJ4 A;  3D7F A;  4P4I A;  2XEF A;  1Z5R A;  4R6T A;  3H8E A;  3I1U A;  1JQG A;  4NGR A;  4UEE A;  2ZEO A;  3GUX A;  1RTQ A;  3SJF A;  3VAR A;  5I4M A;  1QQ9 A;  2CTC A;  3CDX A;  2DEA A;  2GLF A;  3BI1 A;  1LAP A;  5D29 A;  1YW6 A;  2QJ8 A;  2AFS A;  1XRY A;  2PJ7 A;  4UF4 A;  4OC2 A;  2ZEE A;  2CIJ A;  3S9L A;  3RBU A;  4PXC A;  4OKO A;  5LYI A;  2AFU A;  3D7G A;  1BAV A;  1F2P A;  2BCO A;  1ELL P;  4EWT A;  5F09 A;  2PVV A;  2PJ2 A;  2QVP A;  2PJ3 A;  2IJZ A;  3D66 A;  3PB9 X;  1ZG9 A;  4B6Z A;  4OC5 A;  3NH4 A;  4MHZ A;  4O23 A;  3BHX A;  3KI9 A;  4ZYQ A;  1AMP A;  4YWY A;  4UEF A;  3PB6 X;  2ZOF A;  2VL1 A;  2IQ6 A;  1BPM A;  4Z65 A;  3FF3 A;  2JBK A;  1ELM P;  1ZLI A;  4MXU A;  4A37 A;  4AXV A;  3NA6 A;  1Y7E A;  1TKF A;  4P4D A;  1HDQ A;  2OR4 A;  4R76 A;  3TC8 A;  1CPS A;  2G9D A;  4ZY1 A;  2GU2 A;  2AFZ A;  4PXD A;  1LAM A;  1Y0Y A;  4IHM A;  2PJC A;  1ARL A;  3FJU A;  1KWM A;  5HXD A;  3GLJ A;  1EE3 P;  4CPA A;  4TWE A;  1VHE A;  2PVW A;  1VIX A;  3KHX A;  3QNV A;  3KQX A;  4NGT A;  2CTB A;  1ZG7 A;  2PIZ A;  3PRT A;  4P4J A;  3KL9 A;  1LFW A;  2AFM A;  3LWU A;  2EK8 A;  4MCR A;  3B3W A;  3FEE A;  3KR5 A;  4DJL A;  1IY7 A;  3IJ3 A;  1CP7 A;  3MRU A;  1DTD A;  3PFO A;  3WC6 A;  3VAT A;  2HB6 A;  3KHZ A;  4K3N A;  1GYT A;  4P4E A;  2ZED A;  2J9A A;  2C6G A;  3SI1 A;  4H2K A;  4OC4 A;  3IFE A;  3D4U A;  4ZX8 A;  1H8L A;  4OC0 A;  1F2O A;  4TNU A;  4FWU A;  2F7V A;  2PJ1 A;  5K8P A;  1R43 A;  3CT9 A;  4P4B A;  2NYQ A;  3ISX A;  3B3T A;  4MRI A;  1XMB A;  1XFO A;  3IWW A;  2C6C A;  3B7I A;  4LQG A;  3H8F A;  4OC3 A;  1F57 A;  3N5F A;  4IAV A;  1TF8 A;  4JZ0 A;  1CG2 A;  1CP6 A;  3NFZ A;  2C6P A;  2Q51 A;  4UIB A;  4NJQ A;  2O53 A;  4ZY2 A;  4BD9 A;  4NGM A;  1XBU A;  1TF9 A;  3B35 A;  4F8Z A;  4UIA A;  4MCP A;  4P6Y A;  1CBX A;  2IMO A;  3LMS A;  1YLO A;  1HEE A;  4A39 A;  5JM6 A;  5CBM A;  1M4L A;  5LYF A;  1CX8 A;  3K2K A;  1QMU A;  1Q7L A;  1LCP A;  3CPA A;  4X2T A;  2ZEN A;  5LRG A;  1NSA A;  4GM5 A;  2JEW A;  2V8D A;  4P10 A;  4DUK A;  4W9Y A;  1FNO A;  3RAM A;  3B3S A;  4NGS A;  3IEH A;  2V77 A;  3NH5 A;  4MCQ A;  4PXE A;  5HVG A;  5K8O A;  4NGN A;  2BOA A;  4NGQ A;  4OC1 A;  3NH8 A;  5IB9 A;  1XJO A;  3KR4 A;  3SI0 A;  3D7D A;  5CPA A;  4ZI6 A;  1TXR A;  1TKH A;  3FMC A;  3K9T A;  1BLL E;  3PB8 X;  1ARM A;  2PJB A;  4YU9 A;  1AYE A;  3HUV A;  3IIB A;  2PCU A;  3KGQ A;  3WC5 A;  3SJG A;  5D8N A;  4JYW A;  4EME A;  1PCA A;  1PYT B;  4FAI A;  1ZLH A;  4F9V A;  2BO9 A;  3BI0 A;  5LRK A;  1VHO A;  5DS0 A;  5JGF A;  2ZEH A;  8CPA A;  4ONW A;  1BPN A;  3KQZ A;  2OOT A;  4MCS A;  3S9N A;  3PB4 X;  2JBJ A;  2V8H A;  4EFD A;  2PE3 A;  2XEJ A;  3MN8 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...