1AMPA

Crystal structure of aeromonas proteolytica aminopeptidase: a prototypical member of the co-catalytic zinc enzyme family
Total Genus 112
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
112
sequence length
291
structure length
291
Chain Sequence
b'MPPITQQATVTAWLPQVDASQITGTISSLESFTNRFYTTTSGAQASDWIASEWQALSASLPNASVKQVSHSGYNQKSVVMTITGSEAPDEWIVIGGHLDSTIGSHTNEQSVAPGADDDASGIAAVTEVIRVLSENNFQPKRSIAFMAYAAEEVGLRGSQDLANQYKSEGKNVVSALQLDMTNYKGSAQDVVFITDYTDSNFTQYLTQLMDEYLPSLTYGFDTCGYACSDHASWHNAGYPAAMPFESKFNDYNPRIHTTQDTLANSDPTGSHAKKFTQLGLAYAIEMGSATG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords AMINOPEPTIDASE
molecule tags Hydrolase(aminopeptidase)
source organism Vibrio proteolyticus
publication title Crystal structure of Aeromonas proteolytica aminopeptidase: a prototypical member of the co-catalytic zinc enzyme family.
pubmed doi rcsb
total genus 112
structure length 291
sequence length 291
ec nomenclature ec 3.4.11.10: Bacterial leucyl aminopeptidase.
pdb deposition date 1994-04-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF04389 Peptidase_M28 Peptidase family M28
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.630.10 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Zn peptidases 1ampA00
4UEEA 2AFMA 1BPNA 2PIYA 2XEIA 2WYRA 4F9VA 3B2YA 3VH9A 3FH4A 2RFHA 1F57A 3FF3A 3L2NA 4WWVA 2EK8A 4A37A 4TNUA 2ZOGA 4A38A 3B3WA 3H8EA 4K3NA 3SI0A 4OC2A 1YW4A 4X3RA 4WJBA 4FAIA 3KL9A 4AXVA 3VARA 2AFOA 5F09A 1GYTA 3HLPA 3D66A 4UIBA 4MCSA 4KSIA 2DEAA 3CT9A 3KR5A 4JZ0A 4MXUA 2QYVA 2O53A 4NFRA 4NGRA 1TXRA 3FEEA 4P4BA 1ARMA 2PJ6A 1XFOA 4O23A 1FNOA 3B35A 3WC5A 4PXBA 3B3SA 4R6TA 4UF4A 1Z8LA 5K8MA 2AFSA 1UWYA 1PYTB 1ZG7A 2JEWA 3KQXA 1ZG8A 3D7FA 3KI9A 1YLOA 4Z65A 2AFXA 2I3CA 1TF9A 1ELLP 4P44A 4OC0A 1XJOA 3B3VA 4JYWA 2C6GA 3CPAA 1XBUA 4OC1A 4UEFA 1Q7LA 3WC6A 4MHZA 4B6ZA 5D29A 2PVVA 2PJ1A 3KQZA 4GM5A 1RTQA 3SJXA 4A94A 1PCAA 3H8FA 2ZEPA 5LYIA 5JH9A 2OOTA 4BD9A 3SJGA 2AFWA 4PXDA 4PXEA 4NGMA 3SI2A 3RAMA 5LRKA 3D7DA 2PE3A 5I4MA 4ZY1A 3B7IA 2ANPA 1YW6A 1F2OA 4ONWA 3HUVA 2PIZA 3ISZA 5LRGA 4NGNA 5K8PA 2XEJA 3D68A 1HDQA 3PRTA 1LAMA 1Y7EA 4OIWA 3D67A 4PXCA 3S9LA 1VHOA 2VL1A 1VGYA 3IEHA 1HEEA 3IFEA 2ZENA 1LAPA 2FVGA 2GU2A 5CPAA 2ZEMA 2NSMA 5CBMA 2CIJA 1TKJA 4OC5A 2AFUA 6CPAA 1ZG9A 3PB9X 1XRYA 1AMPA 3D7HA 1TKFA 2PRQA 5THWA 3SJFA 4MMOA 1LANA 4EWTA 4DUKA 2ZEGA 1OBRA 2PJBA 3KGQA 4ZY0A 2HC9A 1YMEA 4OMEA 2C6CA 2V8GA 5LRJA 2ZEEA 3V38A 4IK2A 2C1CA 2CTCA 3BI0A 4MCQA 4OIDA 4P4IA 5HVFA 3D7GA 1CPSA 5K8NA 3FECA 3FMCA 3RBUA 3CPXA 2WZNA 1ZLHA 4LQGA 2RB7A 3B3TA 4PQAA 3PFOA 1LCPA 1BLLE 1NSAA 2V8DA 2JBJA 1EE3P 4ZYQA 4OKOA 3DLJA 2Q4ZA 5K8OA 1CBXA 1KWMA 1F2PA 1FT7A 4YWYA 4ZY2A 3KASA 3VATA 2JBKA 2IJZA 3KZWA 2PJ0A 2V77A 3B3CA 2IMOA 1TKHA 3BXMA 1DTDA 3QNVA 4R76A 5LYLA 4R7MA 5LYDA 3GLJA 3KHXA 4P4EA 1DE4C 5IB9A 2GREA 2Q51A 4IAVA 4MHYA 7CPAA 1ARLA 2XEGA 4P4DA 4FUUA 2BO9A 4NGSA 4DYOA 1CX8A 3NA6A 1ELMP 2PJ9A 1AYEA 3NFZA 4IHMA 4MHPA 2PJ7A 1IGBA 4OP4A 4P6YA 1LOKA 3FX6A 4OC3A 5HXDA 3PFEA 2NYQA 2V8HA 4MCPA 2J9AA 4YU9A 3NH5A 4PPZA 1HDUA 1BPMA 2HB6A 3PBBA 1XMBA 3BHXA 3FVLA 4G1PA 1ZLIA 3V7ZA 4MHNA 3TC8A 2PJ3A 3IIBA 4P45A 2AFZA 4EFDA 2PCUA 4A39A 4ZI6A 3IWWA 1CPXA 2PVWA 4MCRA 4DJLA 4P4JA 5ELYA 3MRUA 3H8GA 4X8IA 2ZEOA 5JGFA 1CG2A 2BCOA 4P4FA 4P10A 4UEZA 5LYFA 4Q7AA 4FBEA 3WT4A 4ZX8A 2ZEHA 4NGTA 1QMUA 3IJ3A 3WC7A 2POKA 4W9YA 2F8HA 2XEFA 2PJAA 3PB8X 4R8FA 3S9NA 3FJUA 1H8LA 2CTBA 3LMSA 2PJ2A 4NGPA 2G9DA 2CF4A 2QJ8A 2PJ4A 2ZEFA 4NJRA 4NGQA 2ZOFA 2O4HA 3TX8A 3IO1A 4NJQA 3N5FA 1IY7A 1Z5RA 1Z2LA 5HVGA 1BAVA 1CP6A 2ZEDA 3D4UA 5J1QA 1QQ9A 4UIAA 2BOAA 1Y0YA 4CPAA 1TF8A 3JRUA 1CP7A 2PJ8A 4EMEA 1YSJA 3DGVA 3SJEA 3SI1A 1JQGA 1R3NA 3PB4X 3LWUA 3I1UA 1M4LA 2PJCA 2ZELA 3PBEA 3S9MA 4F8ZA 4F9UA 3PB6X 3GB0A 3WABA 3KR4A 3IC1A 2PJ5A 4FWUA 2GLFA 2GLJA 3NH4A 3K9TA 3KHZA 3BI1A 3RZAA 2EK9A 2V8VA 8CPAA 1LFWA 2ABZA 2Q43A 3GUXA 3FEDA 4X2TA 4ZX9A 5JM6A 1VHEA 5D8NA 2F7VA 2QVPA 1VIXA 4RUHA 3MN8A 2C6PA 4H2KA 4MRIA 4TWEA 1Y0RA 4OC4A 3NH8A 2IQ6A 3PEIA 1R43A 5HVHA 2OR4A 3ISXA 3PB7X 3T8WA 2EWBA 3K2KA 5DS0A 3CDXA
chains in the Genus database with same CATH superfamily
4Y49C 4UEEA 5A28A 4CAWA 2AFMA 2JDDA 1PU9A 4C2YA 1MJBA 3MGDA 3P2HA 4MJ8A 2GANA 4QUSA 4B11A 1BPNA 5BWAB 2PIYA 2XEIA 2B5GB 2EO8A 2WYRA 1B6BA 2REEA 3G8WA 4F9VA 4A2ZA 3B2YA 4KOUA 1J4JA 3FH4A 2RFHA 2D4OA 4M3SA 2BEIA 1F57A 3EC4A 3VH9A 4CAFA 4CGLA 3FF3A 5F46A 3L2NA 4IUSA 4WWVA 2EK8A 1MK4A 4A37A 4UBRA 4TNUA 4H6ZA 1V0CA 2PSWA 1L0CA 4Y49B 2ZOGA 4A38A 3B3WA 4CGOA 3H8EA 4K3NA 3SI0A 4OC2A 4OADA 1YW4A 1XMTA 2D4PA 3GKRA 4XPDC 4X3RA 3DNSA 3QAHA 4WJBA 3RO0A 4FAIA 1K4JA 1Z8XA 4R57A 1KZFA 3KL9A 4AXVA 4CYQA 3TOBA 3VARA 3T9YA 2Q44A 1S7NA 2AFOA 4KUAA 4KS9A 5F09A 2Q0YA 1GYTA 3SXNA 4JWPA 3HLPA 4JLYA 1IIDA 3D66A 4UIBA 2I79A 2JEVA 4YRHA 4MCSA 4KSIA 4QB9A 2DEAA 5CNPA 3CT9A 2R8VA 3KR5A 4JZ0A 4LUAA 4M6HA 4MXUA 2QYVA 3TT2A 2O53A 2PR1A 3R95A 5AG6A 2QMLA 2YNEA 2WPWA 4B5OA 3TFYA 4NFRA 4UWIA 2YNCA 4NGRA 1Z4RA 2VQYA 1M4IA 1TXRA 4KVME 1Z9UA 2Q7BA 3FEEA 4P4BA 1ARMA 2PJ6A 5HH1A 1XFOA 4O23A 4PK2A 1FNOA 3B35A 3IWEA 3W6XA 1IU8A 1KUYA 2WPXA 3CXPA 3VWEA 1RXTA 2BSWA 2Y0MA 4U9YA 3V8IA 3WC5A 4PXBA 3B3SA 1YLEA 1B87A 4R6TA 4UF4A 1Z8LA 4UFVA 2DPSA 5K8MA 3SXOA 2AFSA 1UWYA 4AB7A 1PYTB 1ZG7A 2JEWA 1ZG8A 3D7FA 3KQXA 3KI9A 2Q4YA 4E2AA 1YLOA 4Z65A 4AVAA 2AFXA 2VXKA 2I3CA 2ZW4A 4MI4A 4M6GA 1TF9A 1ELLP 4QC6A 4P44A 4OC0A 1XIXA 2Z11A 1XJOA 3B3VA 3TOAA 4BINA 4JYWA 2C6GA 2FE7A 2ZPAA 3CPAA 1XBUA 4OC1A 4UEFA 4F0YA 4MY0A 1Q7LA 1XE4A 3WC6A 4MHZA 3H4QA 4MFKA 4MHDA 1QSTA 1Q2DA 2EUIA 2OZUA 2VI7A 4B6ZA 5D29A 3GYAA 2PVVA 3TCVA 2PJ1A 3KQZA 4GM5A 4C2XA 4KSAA 4RS2A 1RTQA 3I9SA 4XNHB 1PCAA 3H8FA 3SJXA 2ZEPA 3LODA 5LYIA 4A94A 5JH9A 2OOTA 1UFHA 1IB1E 4BD9A 3SJGA 1YVKA 2AFWA 3PGPA 2J8MA 1IICA 2K5TA 3D2PA 4PXDA 4PXEA 4NGMA 3SI2A 3RAMA 5LRKA 3IU1A 5DWMA 3D7DA 2PE3A 5I4MA 2VEZA 2Z3LA 3B7IA 4C7HA 4ZY1A 2ANPA 2JDCA 1CJWA 4KZTA 4AVBA 5EC4A 4MFJA 2ZXVA 5A27A 1YW6A 1F2OA 3QB8A 4ONWA 4X5KA 4KLVA 5J8CA 3HUVA 2PIZA 1BO4A 3ISZA 2AE6A 4NGNA 4JD6A 5LRGA 4CAXA 5K8PA 3EFAA 2PRBA 1S7LA 2XEJA 3D68A 1HDQA 5F49A 4BMHA 4PSWA 3PRTA 1LAMA 3FIXA 3NE7A 1Y7EA 4GS4A 4MY3A 1RO5A 3D67A 4OIWA 4U9ZA 3BJ8A 4PXCA 3S9LA 1VHOA 2ARHA 3ZJ0A 2VL1A 3S6KA 1VGYA 4BBHA 1LRZA 1S5KA 4KOWA 3JUWA 4UA3A 5DWNA 2ZW5A 3IEHA 4PSXA 1M4DA 1HEEA 2WSAA 3IFEA 2ZENA 4JXQA 3EY5A 1JWQA 1LAPA 1XF8A 2FVGA 2GU2A 2Q7SA 1FY7A 5CPAA 2HV2A 2X7BA 2ZEMA 2NSMA 5CBMA 2CIJA 1YREA 1TKJA 4OC5A 4A31A 2AFUA 2OZHA 6CPAA 1ZG9A 4C2ZA 3PB9X 3PP9A 1XRYA 1AMPA 2PR8A 3D7HA 4R87A 4MBUA 1TKFA 3TO9A 2PRQA 5THWA 4CRYB 1KUVA 3DSBA 3SJFA 4CGNA 4MMOA 2FT0A 1LANA 5IX3A 4EWTA 2OU2A 3N7ZA 4NEXA 2GE3A 2PDOA 2P6GA 2R7HA 4DUKA 2ZEGA 4B13A 1OBRA 2PJBA 3KGQA 3DR6A 3FYNA 3CZXA 3FNCA 2B3UA 4IF5A 3IWGA 4A95A 4K30A 3BLNA 4FD6A 4ZY0A 2HC9A 1YMEA 2I00A 1VHSA 4OMEA 2C6CA 2V8GA 5LRJA 2YNCC 2ZEEA 3V38A 4IK2A 2FIWA 4H89A 5AG7A 4CYPA 2B4DB 2C1CA 3F0AA 3SHPA 2Z10A 4CAVA 2CTCA 2YNDA 4OAEA 3LACA 3BI0A 4MCQA 2P0WA 4F6AA 2FIAA 3I3GA 1YQEA 2ZW6A 2OH1A 4OIDA 1IYLA 4P4IA 5HVFA 3D7GA 1CPSA 3DDDA 5K8NA 3FECA 3FXTA 1I21A 2A4NA 3FMCA 4ZBGA 3F8KA 4KOVA 3RBUA 5ISVA 3CPXA 2WZNA 1ZLHA 4LQGA 5AG5A 2R1IA 1X12A 4KVOE 4NXYA 2RB7A 3D2MA 2R98A 2Z3MA 1NSLA 2DXQA 5AG4A 2NMTA 2G3TA 3B3TA 4KOYA 4PQAA 1LCPA 1BLLE 1NSAA 2V8DA 3PFOA 1I1DA 2JBJA 3W6SA 2P6FA 1EE3P 1S3ZA 4ZYQA 3GIUA 1M44A 2B3VA 2CNTA 4OKOA 3DLJA 2Q4ZA 5K8OA 1CBXA 1KWMA 4CS0B 1F2PA 2O28A 1FT7A 4MFPA 4YWYA 4ZY2A 4UFXA 3KASA 1KUXA 2KCWA 2CNSA 2J8RA 3R9FA 1X10A 3VATA 2JBKA 2IJZA 3KZWA 3D8PA 2PJ0A 2V77A 2B4DA 2H5MA 3B3CA 1NMTA 5F48A 2IMOA 3NE8A 1TKHA 4AG7A 3R9GA 1VKCA 2REFA 4F0XA 4CAEA 3BXMA 1DTDA 2ZW7A 3QNVA 4R76A 4PK3A 4UWJA 5AGEA 4A33A 4Q38A 1GHEA 4CGPA 5LYLA 4R7MA 5LYDA 3GLJA 3KHXA 4P4EA 1DE4C 5IB9A 2GREA 2Q51A 4IAVA 4MHYA 7CPAA 1Y9WA 1ARLA 1M4GA 1P0HA 2XEGA 4P4DA 4FUUA 4OLLA 4UCPA 1MJ9A 2BO9A 5E96A 1YX0A 3LD2A 2CNMA 2Q4VA 1PUAA 4C68A 4NGSA 4JJXA 4DYOA 2CY2A 1CX8A 5G20A 3NA6A 4M6IA 1ELMP 2B4BA 2PJ9A 1AYEA 3B8GA 3NFZA 4IHMA 4LQ6A 4MHPA 4B14A 2HUZA 2PJ7A 1IGBA 4OP4A 4B5PA 1QSNA 5G1ZA 4P6YA 5HMNA 1LOKA 4KOXA 3FX6A 4OC3A 2C27A 2G0BA 3R96A 5HXDA 3PFEA 2NYQA 2PQ8A 2V8HA 2VZZA 3DR8A 2J9AA 3PZJA 4MCPA 5JPHA 3EO4A 4YU9A 4GXHA 3P2FA 3NH5A 4HNWB 4PPZA 1HDUA 2QECA 2Z3PA 2G3AA 1BPMA 2Q04A 4NSQA 4DNCA 1OZPA 2HB6A 3EXNA 1XMBA 3PBBA 3R1KA 3BHXA 3FVLA 4I49A 4XPKA 4G1PA 3TE4A 3S6GA 1Q2YA 1S7KA 3F5BA 1ZLIA 2Z3NA 3FBUA 3V7ZA 3QAYA 4MHNA 1Y7RA 1P4NA 2WUUA 4L8AA 1WK4A 2PJ3A 5EBVA 3TC8A 4EVYA 2DF5A 3IIBA 5IV0A 4P45A 3FRMA 2AFZA 4EFDA 4R9MA 5EMIA 1Q2CA 2PCUA 3JTKA 4XPDB 4PV6A 5G22A 2AJ6A 4A39A 2FXFA 2PC1A 4H6UA 3VWDA 3IWWA 4ZI6A 1XOVA 1QSRA 1CPXA 1R57A 1Z4EA 2EVNA 2PVWA 2YGWA 2QIRA 4MCRA 5IB0A 4DJLA 4P4JA 2P6EA 3CXSA 4FD5A 4LX9A 5H86A 5ELYA 1XEBA 3MRUA 4CYOA 2BL1A 4KVXA 4YFJA 3H8GA 2Z3KA 2GFQA 4X8IA 4AG9A 2ZEOA 5JGFA 1CG2A 4FD4A 3JVNA 2BCOA 4M85A 4P10A 4P4FA 4UEZA 3UY5A 5LYFA 4Q7AA 4FBEA 2ODFA 3WT4A 4R3KA 4ZX8A 4A30A 2ZEHA 4FD7A 4NGTA 2HQYA 1QMUA 1Y9KA 4CYNA 4QBJA 4NF1A 3IJ3A 4J3GA 4RN7A 3WC7A 4B10A 2POKA 2JLMA 4W9YA 5GCNA 5KTAA 2F8HA 4KUBA 3OWCA 2XEFA 2PJAA 4E8OA 3PB8X 4R8FA 3IGRA 3S9NA 1IYKA 3S6HA 1CM0A 4ORFA 3FJUA 1YVOA 1H8LA 2CTBA 3A9LA 1TIQA 2PJ2A 3LMSA 2G9DA 2CF4A 2QJ8A 4NGPA 2PJ4A 4ONUA 2ZEFA 1S7FA 3K9UA 3RYOA 3E0KA 4NJRA 3ZZIA 4UCMA 4NGQA 2ZOFA 3CXQA 2O4HA 1Z8TA 2OB0A 3TX8A 3R9EA 2ATRA 4KSFA 5G21A 3IO1A 4AVCA 5J8FA 3D3SA 4NJQA 1QSOA 1A2ZA 3N5FA 3TTHA 1IY7A 1Z2LA 1Z5RA 3WR7A 2FS5A 2VBQA 2B58A 5HVGA 1BAVA 1CP6A 2ZEDA 3D4UA 5J1QA 3TO7A 1AUGA 1QQ9A 2B5GA 1I12A 4U5YA 4UIAA 2BOAA 4JXRA 1Y0YA 3T90A 4CPAA 4ZGYB 4UCNA 1WWZA 2IL4A 2VZYA 1TF8A 3JRUA 1ZO0A 1YK3A 1YR0A 1IOFA 1CP7A 2PJ8A 4EMEA 4MFLA 1M1DA 4CRZB 2RC4A 5JQ4A 3RNZA 1YSJA 3DGVA 3G3SA 4Q36A 1MJAA 3SJEA 3SI1A 5KTCA 1ON0A 2Z0ZA 1JQGA 1R3NA 3PB4X 3LWUA 3I1UA 5H84A 3GY9A 1IOIA 5F47A 4R3LA 1M4LA 2PJCA 2ZELA 3PBEA 4NCZA 3S9MA 2F5IA 1N71A 3PB6X 4HPSA 3IU2A 4KOTA 4F8ZA 4F9UA 3KKWA 1U6MA 1YGHA 3GB0A 2EBJA 4KLWA 4XPLA 3WABA 3KR4A 3IC1A 2FSRA 2PJ5A 2DPTA 1NE9A 2GLFA 4FWUA 4HKFA 4II9A 2BUEA 4B12A 2Z3OA 4KORA 5KTDA 4CGMA 2GLJA 3NH4A 3K9TA 3KHZA 2OZGA 3BI1A 3RZAA 5C82A 2EK9A 2V8VA 3S6FA 3FB3A 1S60A 2GIVA 1LFWA 2ABZA 2Q43A 3GUXA 4YGOA 8CPAA 3FEDA 4L89A 4X2TA 4ZX9A 5JM6A 1VHEA 5D8NA 1SQHA 2F7VA 2QVPA 1VIXA 2J8NA 4A32A 4RUHA 3MN8A 5C88A 2CXAA 1Z8WA 2C6PA 4H2KA 4E0AA 5I0CA 4MRIA 4TWEA 1Y0RA 4RI1A 3W91A 4OC4A 1QSMA 3NH8A 2IQ6A 3PEIA 5FVJA 4MFQA 1R43A 4XNHC 4UFWA 3C26A 4KOSA 4B5PB 4HNXB 4HNYB 1BOBA 4QVTA 5HVHA 4MFZA 2OR4A 3BJ7A 3ISXA 3PB7X 3T8WA 3H5ZA 3TO6A 2EWBA 3K2KA 5DS0A 2FCKA 4C7IA 3CDXA 2FL4A
chains in the Genus database with same CATH topology
4UEEA 2AFMA 1BPNA 2PIYA 2XEIA 2WYRA 4F9VA 3B2YA 3VH9A 3FH4A 2RFHA 1F57A 3FF3A 3L2NA 4WWVA 2EK8A 4A37A 4TNUA 2ZOGA 4A38A 3B3WA 3H8EA 4K3NA 3SI0A 4OC2A 1YW4A 4X3RA 4WJBA 4FAIA 3KL9A 4AXVA 3VARA 2AFOA 5F09A 1GYTA 3HLPA 3D66A 4UIBA 4MCSA 4KSIA 2DEAA 3CT9A 3KR5A 4JZ0A 4MXUA 2QYVA 2O53A 4NFRA 4NGRA 1TXRA 3FEEA 4P4BA 1ARMA 2PJ6A 1XFOA 4O23A 1FNOA 3B35A 3WC5A 4PXBA 3B3SA 4R6TA 4UF4A 1Z8LA 5K8MA 2AFSA 1UWYA 1PYTB 1ZG7A 2JEWA 3KQXA 1ZG8A 3D7FA 3KI9A 1YLOA 4Z65A 2AFXA 2I3CA 1TF9A 1ELLP 4P44A 4OC0A 1XJOA 3B3VA 4JYWA 2C6GA 3CPAA 1XBUA 4OC1A 4UEFA 1Q7LA 3WC6A 4MHZA 4B6ZA 5D29A 2PVVA 2PJ1A 3KQZA 4GM5A 1RTQA 3SJXA 4A94A 1PCAA 3H8FA 2ZEPA 5LYIA 5JH9A 2OOTA 4BD9A 3SJGA 2AFWA 4PXDA 4PXEA 4NGMA 3SI2A 3RAMA 5LRKA 3D7DA 2PE3A 5I4MA 4ZY1A 3B7IA 2ANPA 1YW6A 1F2OA 4ONWA 3HUVA 2PIZA 3ISZA 5LRGA 4NGNA 5K8PA 2XEJA 3D68A 1HDQA 3PRTA 1LAMA 1Y7EA 4OIWA 3D67A 4PXCA 3S9LA 1VHOA 2VL1A 1VGYA 3IEHA 1HEEA 3IFEA 2ZENA 1LAPA 2FVGA 2GU2A 5CPAA 2ZEMA 2NSMA 5CBMA 2CIJA 1TKJA 4OC5A 2AFUA 6CPAA 1ZG9A 3PB9X 1XRYA 1AMPA 3D7HA 1TKFA 2PRQA 5THWA 3SJFA 4MMOA 1LANA 4EWTA 4DUKA 2ZEGA 1OBRA 2PJBA 3KGQA 4ZY0A 2HC9A 1YMEA 4OMEA 2C6CA 2V8GA 5LRJA 2ZEEA 3V38A 4IK2A 2C1CA 2CTCA 3BI0A 4MCQA 4OIDA 4P4IA 5HVFA 3D7GA 1CPSA 5K8NA 3FECA 3FMCA 3RBUA 3CPXA 2WZNA 1ZLHA 4LQGA 2RB7A 3B3TA 4PQAA 3PFOA 1LCPA 1BLLE 1NSAA 2V8DA 2JBJA 1EE3P 4ZYQA 4OKOA 3DLJA 2Q4ZA 5K8OA 1CBXA 1KWMA 1F2PA 1FT7A 4YWYA 4ZY2A 3KASA 3VATA 2JBKA 2IJZA 3KZWA 2PJ0A 2V77A 3B3CA 2IMOA 1TKHA 3BXMA 1DTDA 3QNVA 4R76A 5LYLA 4R7MA 5LYDA 3GLJA 3KHXA 4P4EA 1DE4C 5IB9A 2GREA 2Q51A 4IAVA 4MHYA 7CPAA 1ARLA 2XEGA 4P4DA 4FUUA 2BO9A 4NGSA 4DYOA 1CX8A 3NA6A 1ELMP 2PJ9A 1AYEA 3NFZA 4IHMA 4MHPA 2PJ7A 1IGBA 4OP4A 4P6YA 1LOKA 3FX6A 4OC3A 5HXDA 3PFEA 2NYQA 2V8HA 4MCPA 2J9AA 4YU9A 3NH5A 4PPZA 1HDUA 1BPMA 2HB6A 3PBBA 1XMBA 3BHXA 3FVLA 4G1PA 1ZLIA 3V7ZA 4MHNA 3TC8A 2PJ3A 3IIBA 4P45A 2AFZA 4EFDA 2PCUA 4A39A 4ZI6A 3IWWA 1CPXA 2PVWA 4MCRA 4DJLA 4P4JA 5ELYA 3MRUA 3H8GA 4X8IA 2ZEOA 5JGFA 1CG2A 2BCOA 4P4FA 4P10A 4UEZA 5LYFA 4Q7AA 4FBEA 3WT4A 4ZX8A 2ZEHA 4NGTA 1QMUA 3IJ3A 3WC7A 2POKA 4W9YA 2F8HA 2XEFA 2PJAA 3PB8X 4R8FA 3S9NA 3FJUA 1H8LA 2CTBA 3LMSA 2PJ2A 4NGPA 2G9DA 2CF4A 2QJ8A 2PJ4A 2ZEFA 4NJRA 4NGQA 2ZOFA 2O4HA 3TX8A 3IO1A 4NJQA 3N5FA 1IY7A 1Z5RA 1Z2LA 5HVGA 1BAVA 1CP6A 2ZEDA 3D4UA 5J1QA 1QQ9A 4UIAA 2BOAA 1Y0YA 4CPAA 1TF8A 3JRUA 1CP7A 2PJ8A 4EMEA 1YSJA 3DGVA 3SJEA 3SI1A 1JQGA 1R3NA 3PB4X 3LWUA 3I1UA 1M4LA 2PJCA 2ZELA 3PBEA 3S9MA 4F8ZA 4F9UA 3PB6X 3GB0A 3WABA 3KR4A 3IC1A 2PJ5A 4FWUA 2GLFA 2GLJA 3NH4A 3K9TA 3KHZA 3BI1A 3RZAA 2EK9A 2V8VA 8CPAA 1LFWA 2ABZA 2Q43A 3GUXA 3FEDA 4X2TA 4ZX9A 5JM6A 1VHEA 5D8NA 2F7VA 2QVPA 1VIXA 4RUHA 3MN8A 2C6PA 4H2KA 4MRIA 4TWEA 1Y0RA 4OC4A 3NH8A 2IQ6A 3PEIA 1R43A 5HVHA 2OR4A 3ISXA 3PB7X 3T8WA 2EWBA 3K2KA 5DS0A 3CDXA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4UEE A;  2AFM A;  1BPN A;  2PIY A;  2XEI A;  2WYR A;  4F9V A;  3B2Y A;  3VH9 A;  3FH4 A;  2RFH A;  1F57 A;  3FF3 A;  3L2N A;  4WWV A;  2EK8 A;  4A37 A;  4TNU A;  2ZOG A;  4A38 A;  3B3W A;  3H8E A;  4K3N A;  3SI0 A;  4OC2 A;  1YW4 A;  4X3R A;  4WJB A;  4FAI A;  3KL9 A;  4AXV A;  3VAR A;  2AFO A;  5F09 A;  1GYT A;  3HLP A;  3D66 A;  4UIB A;  4MCS A;  4KSI A;  2DEA A;  3CT9 A;  3KR5 A;  4JZ0 A;  4MXU A;  2QYV A;  2O53 A;  4NFR A;  4NGR A;  1TXR A;  3FEE A;  4P4B A;  1ARM A;  2PJ6 A;  1XFO A;  4O23 A;  1FNO A;  3B35 A;  3WC5 A;  4PXB A;  3B3S A;  4R6T A;  4UF4 A;  1Z8L A;  5K8M A;  2AFS A;  1UWY A;  1PYT B;  1ZG7 A;  2JEW A;  3KQX A;  1ZG8 A;  3D7F A;  3KI9 A;  1YLO A;  4Z65 A;  2AFX A;  2I3C A;  1TF9 A;  1ELL P;  4P44 A;  4OC0 A;  1XJO A;  3B3V A;  4JYW A;  2C6G A;  3CPA A;  1XBU A;  4OC1 A;  4UEF A;  1Q7L A;  3WC6 A;  4MHZ A;  4B6Z A;  5D29 A;  2PVV A;  2PJ1 A;  3KQZ A;  4GM5 A;  1RTQ A;  3SJX A;  4A94 A;  1PCA A;  3H8F A;  2ZEP A;  5LYI A;  5JH9 A;  2OOT A;  4BD9 A;  3SJG A;  2AFW A;  4PXD A;  4PXE A;  4NGM A;  3SI2 A;  3RAM A;  5LRK A;  3D7D A;  2PE3 A;  5I4M A;  4ZY1 A;  3B7I A;  2ANP A;  1YW6 A;  1F2O A;  4ONW A;  3HUV A;  2PIZ A;  3ISZ A;  5LRG A;  4NGN A;  5K8P A;  2XEJ A;  3D68 A;  1HDQ A;  3PRT A;  1LAM A;  1Y7E A;  4OIW A;  3D67 A;  4PXC A;  3S9L A;  1VHO A;  2VL1 A;  1VGY A;  3IEH A;  1HEE A;  3IFE A;  2ZEN A;  1LAP A;  2FVG A;  2GU2 A;  5CPA A;  2ZEM A;  2NSM A;  5CBM A;  2CIJ A;  1TKJ A;  4OC5 A;  2AFU A;  6CPA A;  1ZG9 A;  3PB9 X;  1XRY A;  1AMP A;  3D7H A;  1TKF A;  2PRQ A;  5THW A;  3SJF A;  4MMO A;  1LAN A;  4EWT A;  4DUK A;  2ZEG A;  1OBR A;  2PJB A;  3KGQ A;  4ZY0 A;  2HC9 A;  1YME A;  4OME A;  2C6C A;  2V8G A;  5LRJ A;  2ZEE A;  3V38 A;  4IK2 A;  2C1C A;  2CTC A;  3BI0 A;  4MCQ A;  4OID A;  4P4I A;  5HVF A;  3D7G A;  1CPS A;  5K8N A;  3FEC A;  3FMC A;  3RBU A;  3CPX A;  2WZN A;  1ZLH A;  4LQG A;  2RB7 A;  3B3T A;  4PQA A;  3PFO A;  1LCP A;  1BLL E;  1NSA A;  2V8D A;  2JBJ A;  1EE3 P;  4ZYQ A;  4OKO A;  3DLJ A;  2Q4Z A;  5K8O A;  1CBX A;  1KWM A;  1F2P A;  1FT7 A;  4YWY A;  4ZY2 A;  3KAS A;  3VAT A;  2JBK A;  2IJZ A;  3KZW A;  2PJ0 A;  2V77 A;  3B3C A;  2IMO A;  1TKH A;  3BXM A;  1DTD A;  3QNV A;  4R76 A;  5LYL A;  4R7M A;  5LYD A;  3GLJ A;  3KHX A;  4P4E A;  1DE4 C;  5IB9 A;  2GRE A;  2Q51 A;  4IAV A;  4MHY A;  7CPA A;  1ARL A;  2XEG A;  4P4D A;  4FUU A;  2BO9 A;  4NGS A;  4DYO A;  1CX8 A;  3NA6 A;  1ELM P;  2PJ9 A;  1AYE A;  3NFZ A;  4IHM A;  4MHP A;  2PJ7 A;  1IGB A;  4OP4 A;  4P6Y A;  1LOK A;  3FX6 A;  4OC3 A;  5HXD A;  3PFE A;  2NYQ A;  2V8H A;  4MCP A;  2J9A A;  4YU9 A;  3NH5 A;  4PPZ A;  1HDU A;  1BPM A;  2HB6 A;  3PBB A;  1XMB A;  3BHX A;  3FVL A;  4G1P A;  1ZLI A;  3V7Z A;  4MHN A;  3TC8 A;  2PJ3 A;  3IIB A;  4P45 A;  2AFZ A;  4EFD A;  2PCU A;  4A39 A;  4ZI6 A;  3IWW A;  1CPX A;  2PVW A;  4MCR A;  4DJL A;  4P4J A;  5ELY A;  3MRU A;  3H8G A;  4X8I A;  2ZEO A;  5JGF A;  1CG2 A;  2BCO A;  4P4F A;  4P10 A;  4UEZ A;  5LYF A;  4Q7A A;  4FBE A;  3WT4 A;  4ZX8 A;  2ZEH A;  4NGT A;  1QMU A;  3IJ3 A;  3WC7 A;  2POK A;  4W9Y A;  2F8H A;  2XEF A;  2PJA A;  3PB8 X;  4R8F A;  3S9N A;  3FJU A;  1H8L A;  2CTB A;  3LMS A;  2PJ2 A;  4NGP A;  2G9D A;  2CF4 A;  2QJ8 A;  2PJ4 A;  2ZEF A;  4NJR A;  4NGQ A;  2ZOF A;  2O4H A;  3TX8 A;  3IO1 A;  4NJQ A;  3N5F A;  1IY7 A;  1Z5R A;  1Z2L A;  5HVG A;  1BAV A;  1CP6 A;  2ZED A;  3D4U A;  5J1Q A;  1QQ9 A;  4UIA A;  2BOA A;  1Y0Y A;  4CPA A;  1TF8 A;  3JRU A;  1CP7 A;  2PJ8 A;  4EME A;  1YSJ A;  3DGV A;  3SJE A;  3SI1 A;  1JQG A;  1R3N A;  3PB4 X;  3LWU A;  3I1U A;  1M4L A;  2PJC A;  2ZEL A;  3PBE A;  3S9M A;  4F8Z A;  4F9U A;  3PB6 X;  3GB0 A;  3WAB A;  3KR4 A;  3IC1 A;  2PJ5 A;  4FWU A;  2GLF A;  2GLJ A;  3NH4 A;  3K9T A;  3KHZ A;  3BI1 A;  3RZA A;  2EK9 A;  2V8V A;  8CPA A;  1LFW A;  2ABZ A;  2Q43 A;  3GUX A;  3FED A;  4X2T A;  4ZX9 A;  5JM6 A;  1VHE A;  5D8N A;  2F7V A;  2QVP A;  1VIX A;  4RUH A;  3MN8 A;  2C6P A;  4H2K A;  4MRI A;  4TWE A;  1Y0R A;  4OC4 A;  3NH8 A;  2IQ6 A;  3PEI A;  1R43 A;  5HVH A;  2OR4 A;  3ISX A;  3PB7 X;  3T8W A;  2EWB A;  3K2K A;  5DS0 A;  3CDX A; 
#chains in the Genus database with same CATH topology
 4Y49 C;  4UEE A;  5A28 A;  4CAW A;  2AFM A;  2JDD A;  1PU9 A;  4C2Y A;  1MJB A;  3MGD A;  3P2H A;  4MJ8 A;  2GAN A;  4QUS A;  4B11 A;  1BPN A;  5BWA B;  2PIY A;  2XEI A;  2B5G B;  2EO8 A;  2WYR A;  1B6B A;  2REE A;  3G8W A;  4F9V A;  4A2Z A;  3B2Y A;  4KOU A;  1J4J A;  3FH4 A;  2RFH A;  2D4O A;  4M3S A;  2BEI A;  1F57 A;  3EC4 A;  3VH9 A;  4CAF A;  4CGL A;  3FF3 A;  5F46 A;  3L2N A;  4IUS A;  4WWV A;  2EK8 A;  1MK4 A;  4A37 A;  4UBR A;  4TNU A;  4H6Z A;  1V0C A;  2PSW A;  1L0C A;  4Y49 B;  2ZOG A;  4A38 A;  3B3W A;  4CGO A;  3H8E A;  4K3N A;  3SI0 A;  4OC2 A;  4OAD A;  1YW4 A;  1XMT A;  2D4P A;  3GKR A;  4XPD C;  4X3R A;  3DNS A;  3QAH A;  4WJB A;  3RO0 A;  4FAI A;  1K4J A;  1Z8X A;  4R57 A;  1KZF A;  3KL9 A;  4AXV A;  4CYQ A;  3TOB A;  3VAR A;  3T9Y A;  2Q44 A;  1S7N A;  2AFO A;  4KUA A;  4KS9 A;  5F09 A;  2Q0Y A;  1GYT A;  3SXN A;  4JWP A;  3HLP A;  4JLY A;  1IID A;  3D66 A;  4UIB A;  2I79 A;  2JEV A;  4YRH A;  4MCS A;  4KSI A;  4QB9 A;  2DEA A;  5CNP A;  3CT9 A;  2R8V A;  3KR5 A;  4JZ0 A;  4LUA A;  4M6H A;  4MXU A;  2QYV A;  3TT2 A;  2O53 A;  2PR1 A;  3R95 A;  5AG6 A;  2QML A;  2YNE A;  2WPW A;  4B5O A;  3TFY A;  4NFR A;  4UWI A;  2YNC A;  4NGR A;  1Z4R A;  2VQY A;  1M4I A;  1TXR A;  4KVM E;  1Z9U A;  2Q7B A;  3FEE A;  4P4B A;  1ARM A;  2PJ6 A;  5HH1 A;  1XFO A;  4O23 A;  4PK2 A;  1FNO A;  3B35 A;  3IWE A;  3W6X A;  1IU8 A;  1KUY A;  2WPX A;  3CXP A;  3VWE A;  1RXT A;  2BSW A;  2Y0M A;  4U9Y A;  3V8I A;  3WC5 A;  4PXB A;  3B3S A;  1YLE A;  1B87 A;  4R6T A;  4UF4 A;  1Z8L A;  4UFV A;  2DPS A;  5K8M A;  3SXO A;  2AFS A;  1UWY A;  4AB7 A;  1PYT B;  1ZG7 A;  2JEW A;  1ZG8 A;  3D7F A;  3KQX A;  3KI9 A;  2Q4Y A;  4E2A A;  1YLO A;  4Z65 A;  4AVA A;  2AFX A;  2VXK A;  2I3C A;  2ZW4 A;  4MI4 A;  4M6G A;  1TF9 A;  1ELL P;  4QC6 A;  4P44 A;  4OC0 A;  1XIX A;  2Z11 A;  1XJO A;  3B3V A;  3TOA A;  4BIN A;  4JYW A;  2C6G A;  2FE7 A;  2ZPA A;  3CPA A;  1XBU A;  4OC1 A;  4UEF A;  4F0Y A;  4MY0 A;  1Q7L A;  1XE4 A;  3WC6 A;  4MHZ A;  3H4Q A;  4MFK A;  4MHD A;  1QST A;  1Q2D A;  2EUI A;  2OZU A;  2VI7 A;  4B6Z A;  5D29 A;  3GYA A;  2PVV A;  3TCV A;  2PJ1 A;  3KQZ A;  4GM5 A;  4C2X A;  4KSA A;  4RS2 A;  1RTQ A;  3I9S A;  4XNH B;  1PCA A;  3H8F A;  3SJX A;  2ZEP A;  3LOD A;  5LYI A;  4A94 A;  5JH9 A;  2OOT A;  1UFH A;  1IB1 E;  4BD9 A;  3SJG A;  1YVK A;  2AFW A;  3PGP A;  2J8M A;  1IIC A;  2K5T A;  3D2P A;  4PXD A;  4PXE A;  4NGM A;  3SI2 A;  3RAM A;  5LRK A;  3IU1 A;  5DWM A;  3D7D A;  2PE3 A;  5I4M A;  2VEZ A;  2Z3L A;  3B7I A;  4C7H A;  4ZY1 A;  2ANP A;  2JDC A;  1CJW A;  4KZT A;  4AVB A;  5EC4 A;  4MFJ A;  2ZXV A;  5A27 A;  1YW6 A;  1F2O A;  3QB8 A;  4ONW A;  4X5K A;  4KLV A;  5J8C A;  3HUV A;  2PIZ A;  1BO4 A;  3ISZ A;  2AE6 A;  4NGN A;  4JD6 A;  5LRG A;  4CAX A;  5K8P A;  3EFA A;  2PRB A;  1S7L A;  2XEJ A;  3D68 A;  1HDQ A;  5F49 A;  4BMH A;  4PSW A;  3PRT A;  1LAM A;  3FIX A;  3NE7 A;  1Y7E A;  4GS4 A;  4MY3 A;  1RO5 A;  3D67 A;  4OIW A;  4U9Z A;  3BJ8 A;  4PXC A;  3S9L A;  1VHO A;  2ARH A;  3ZJ0 A;  2VL1 A;  3S6K A;  1VGY A;  4BBH A;  1LRZ A;  1S5K A;  4KOW A;  3JUW A;  4UA3 A;  5DWN A;  2ZW5 A;  3IEH A;  4PSX A;  1M4D A;  1HEE A;  2WSA A;  3IFE A;  2ZEN A;  4JXQ A;  3EY5 A;  1JWQ A;  1LAP A;  1XF8 A;  2FVG A;  2GU2 A;  2Q7S A;  1FY7 A;  5CPA A;  2HV2 A;  2X7B A;  2ZEM A;  2NSM A;  5CBM A;  2CIJ A;  1YRE A;  1TKJ A;  4OC5 A;  4A31 A;  2AFU A;  2OZH A;  6CPA A;  1ZG9 A;  4C2Z A;  3PB9 X;  3PP9 A;  1XRY A;  1AMP A;  2PR8 A;  3D7H A;  4R87 A;  4MBU A;  1TKF A;  3TO9 A;  2PRQ A;  5THW A;  4CRY B;  1KUV A;  3DSB A;  3SJF A;  4CGN A;  4MMO A;  2FT0 A;  1LAN A;  5IX3 A;  4EWT A;  2OU2 A;  3N7Z A;  4NEX A;  2GE3 A;  2PDO A;  2P6G A;  2R7H A;  4DUK A;  2ZEG A;  4B13 A;  1OBR A;  2PJB A;  3KGQ A;  3DR6 A;  3FYN A;  3CZX A;  3FNC A;  2B3U A;  4IF5 A;  3IWG A;  4A95 A;  4K30 A;  3BLN A;  4FD6 A;  4ZY0 A;  2HC9 A;  1YME A;  2I00 A;  1VHS A;  4OME A;  2C6C A;  2V8G A;  5LRJ A;  2YNC C;  2ZEE A;  3V38 A;  4IK2 A;  2FIW A;  4H89 A;  5AG7 A;  4CYP A;  2B4D B;  2C1C A;  3F0A A;  3SHP A;  2Z10 A;  4CAV A;  2CTC A;  2YND A;  4OAE A;  3LAC A;  3BI0 A;  4MCQ A;  2P0W A;  4F6A A;  2FIA A;  3I3G A;  1YQE A;  2ZW6 A;  2OH1 A;  4OID A;  1IYL A;  4P4I A;  5HVF A;  3D7G A;  1CPS A;  3DDD A;  5K8N A;  3FEC A;  3FXT A;  1I21 A;  2A4N A;  3FMC A;  4ZBG A;  3F8K A;  4KOV A;  3RBU A;  5ISV A;  3CPX A;  2WZN A;  1ZLH A;  4LQG A;  5AG5 A;  2R1I A;  1X12 A;  4KVO E;  4NXY A;  2RB7 A;  3D2M A;  2R98 A;  2Z3M A;  1NSL A;  2DXQ A;  5AG4 A;  2NMT A;  2G3T A;  3B3T A;  4KOY A;  4PQA A;  1LCP A;  1BLL E;  1NSA A;  2V8D A;  3PFO A;  1I1D A;  2JBJ A;  3W6S A;  2P6F A;  1EE3 P;  1S3Z A;  4ZYQ A;  3GIU A;  1M44 A;  2B3V A;  2CNT A;  4OKO A;  3DLJ A;  2Q4Z A;  5K8O A;  1CBX A;  1KWM A;  4CS0 B;  1F2P A;  2O28 A;  1FT7 A;  4MFP A;  4YWY A;  4ZY2 A;  4UFX A;  3KAS A;  1KUX A;  2KCW A;  2CNS A;  2J8R A;  3R9F A;  1X10 A;  3VAT A;  2JBK A;  2IJZ A;  3KZW A;  3D8P A;  2PJ0 A;  2V77 A;  2B4D A;  2H5M A;  3B3C A;  1NMT A;  5F48 A;  2IMO A;  3NE8 A;  1TKH A;  4AG7 A;  3R9G A;  1VKC A;  2REF A;  4F0X A;  4CAE A;  3BXM A;  1DTD A;  2ZW7 A;  3QNV A;  4R76 A;  4PK3 A;  4UWJ A;  5AGE A;  4A33 A;  4Q38 A;  1GHE A;  4CGP A;  5LYL A;  4R7M A;  5LYD A;  3GLJ A;  3KHX A;  4P4E A;  1DE4 C;  5IB9 A;  2GRE A;  2Q51 A;  4IAV A;  4MHY A;  7CPA A;  1Y9W A;  1ARL A;  1M4G A;  1P0H A;  2XEG A;  4P4D A;  4FUU A;  4OLL A;  4UCP A;  1MJ9 A;  2BO9 A;  5E96 A;  1YX0 A;  3LD2 A;  2CNM A;  2Q4V A;  1PUA A;  4C68 A;  4NGS A;  4JJX A;  4DYO A;  2CY2 A;  1CX8 A;  5G20 A;  3NA6 A;  4M6I A;  1ELM P;  2B4B A;  2PJ9 A;  1AYE A;  3B8G A;  3NFZ A;  4IHM A;  4LQ6 A;  4MHP A;  4B14 A;  2HUZ A;  2PJ7 A;  1IGB A;  4OP4 A;  4B5P A;  1QSN A;  5G1Z A;  4P6Y A;  5HMN A;  1LOK A;  4KOX A;  3FX6 A;  4OC3 A;  2C27 A;  2G0B A;  3R96 A;  5HXD A;  3PFE A;  2NYQ A;  2PQ8 A;  2V8H A;  2VZZ A;  3DR8 A;  2J9A A;  3PZJ A;  4MCP A;  5JPH A;  3EO4 A;  4YU9 A;  4GXH A;  3P2F A;  3NH5 A;  4HNW B;  4PPZ A;  1HDU A;  2QEC A;  2Z3P A;  2G3A A;  1BPM A;  2Q04 A;  4NSQ A;  4DNC A;  1OZP A;  2HB6 A;  3EXN A;  1XMB A;  3PBB A;  3R1K A;  3BHX A;  3FVL A;  4I49 A;  4XPK A;  4G1P A;  3TE4 A;  3S6G A;  1Q2Y A;  1S7K A;  3F5B A;  1ZLI A;  2Z3N A;  3FBU A;  3V7Z A;  3QAY A;  4MHN A;  1Y7R A;  1P4N A;  2WUU A;  4L8A A;  1WK4 A;  2PJ3 A;  5EBV A;  3TC8 A;  4EVY A;  2DF5 A;  3IIB A;  5IV0 A;  4P45 A;  3FRM A;  2AFZ A;  4EFD A;  4R9M A;  5EMI A;  1Q2C A;  2PCU A;  3JTK A;  4XPD B;  4PV6 A;  5G22 A;  2AJ6 A;  4A39 A;  2FXF A;  2PC1 A;  4H6U A;  3VWD A;  3IWW A;  4ZI6 A;  1XOV A;  1QSR A;  1CPX A;  1R57 A;  1Z4E A;  2EVN A;  2PVW A;  2YGW A;  2QIR A;  4MCR A;  5IB0 A;  4DJL A;  4P4J A;  2P6E A;  3CXS A;  4FD5 A;  4LX9 A;  5H86 A;  5ELY A;  1XEB A;  3MRU A;  4CYO A;  2BL1 A;  4KVX A;  4YFJ A;  3H8G A;  2Z3K A;  2GFQ A;  4X8I A;  4AG9 A;  2ZEO A;  5JGF A;  1CG2 A;  4FD4 A;  3JVN A;  2BCO A;  4M85 A;  4P10 A;  4P4F A;  4UEZ A;  3UY5 A;  5LYF A;  4Q7A A;  4FBE A;  2ODF A;  3WT4 A;  4R3K A;  4ZX8 A;  4A30 A;  2ZEH A;  4FD7 A;  4NGT A;  2HQY A;  1QMU A;  1Y9K A;  4CYN A;  4QBJ A;  4NF1 A;  3IJ3 A;  4J3G A;  4RN7 A;  3WC7 A;  4B10 A;  2POK A;  2JLM A;  4W9Y A;  5GCN A;  5KTA A;  2F8H A;  4KUB A;  3OWC A;  2XEF A;  2PJA A;  4E8O A;  3PB8 X;  4R8F A;  3IGR A;  3S9N A;  1IYK A;  3S6H A;  1CM0 A;  4ORF A;  3FJU A;  1YVO A;  1H8L A;  2CTB A;  3A9L A;  1TIQ A;  2PJ2 A;  3LMS A;  2G9D A;  2CF4 A;  2QJ8 A;  4NGP A;  2PJ4 A;  4ONU A;  2ZEF A;  1S7F A;  3K9U A;  3RYO A;  3E0K A;  4NJR A;  3ZZI A;  4UCM A;  4NGQ A;  2ZOF A;  3CXQ A;  2O4H A;  1Z8T A;  2OB0 A;  3TX8 A;  3R9E A;  2ATR A;  4KSF A;  5G21 A;  3IO1 A;  4AVC A;  5J8F A;  3D3S A;  4NJQ A;  1QSO A;  1A2Z A;  3N5F A;  3TTH A;  1IY7 A;  1Z2L A;  1Z5R A;  3WR7 A;  2FS5 A;  2VBQ A;  2B58 A;  5HVG A;  1BAV A;  1CP6 A;  2ZED A;  3D4U A;  5J1Q A;  3TO7 A;  1AUG A;  1QQ9 A;  2B5G A;  1I12 A;  4U5Y A;  4UIA A;  2BOA A;  4JXR A;  1Y0Y A;  3T90 A;  4CPA A;  4ZGY B;  4UCN A;  1WWZ A;  2IL4 A;  2VZY A;  1TF8 A;  3JRU A;  1ZO0 A;  1YK3 A;  1YR0 A;  1IOF A;  1CP7 A;  2PJ8 A;  4EME A;  4MFL A;  1M1D A;  4CRZ B;  2RC4 A;  5JQ4 A;  3RNZ A;  1YSJ A;  3DGV A;  3G3S A;  4Q36 A;  1MJA A;  3SJE A;  3SI1 A;  5KTC A;  1ON0 A;  2Z0Z A;  1JQG A;  1R3N A;  3PB4 X;  3LWU A;  3I1U A;  5H84 A;  3GY9 A;  1IOI A;  5F47 A;  4R3L A;  1M4L A;  2PJC A;  2ZEL A;  3PBE A;  4NCZ A;  3S9M A;  2F5I A;  1N71 A;  3PB6 X;  4HPS A;  3IU2 A;  4KOT A;  4F8Z A;  4F9U A;  3KKW A;  1U6M A;  1YGH A;  3GB0 A;  2EBJ A;  4KLW A;  4XPL A;  3WAB A;  3KR4 A;  3IC1 A;  2FSR A;  2PJ5 A;  2DPT A;  1NE9 A;  2GLF A;  4FWU A;  4HKF A;  4II9 A;  2BUE A;  4B12 A;  2Z3O A;  4KOR A;  5KTD A;  4CGM A;  2GLJ A;  3NH4 A;  3K9T A;  3KHZ A;  2OZG A;  3BI1 A;  3RZA A;  5C82 A;  2EK9 A;  2V8V A;  3S6F A;  3FB3 A;  1S60 A;  2GIV A;  1LFW A;  2ABZ A;  2Q43 A;  3GUX A;  4YGO A;  8CPA A;  3FED A;  4L89 A;  4X2T A;  4ZX9 A;  5JM6 A;  1VHE A;  5D8N A;  1SQH A;  2F7V A;  2QVP A;  1VIX A;  2J8N A;  4A32 A;  4RUH A;  3MN8 A;  5C88 A;  2CXA A;  1Z8W A;  2C6P A;  4H2K A;  4E0A A;  5I0C A;  4MRI A;  4TWE A;  1Y0R A;  4RI1 A;  3W91 A;  4OC4 A;  1QSM A;  3NH8 A;  2IQ6 A;  3PEI A;  5FVJ A;  4MFQ A;  1R43 A;  4XNH C;  4UFW A;  3C26 A;  4KOS A;  4B5P B;  4HNX B;  4HNY B;  1BOB A;  4QVT A;  5HVH A;  4MFZ A;  2OR4 A;  3BJ7 A;  3ISX A;  3PB7 X;  3T8W A;  3H5Z A;  3TO6 A;  2EWB A;  3K2K A;  5DS0 A;  2FCK A;  4C7I A;  3CDX A;  2FL4 A; 
#chains in the Genus database with same CATH homology
 4UEE A;  2AFM A;  1BPN A;  2PIY A;  2XEI A;  2WYR A;  4F9V A;  3B2Y A;  3VH9 A;  3FH4 A;  2RFH A;  1F57 A;  3FF3 A;  3L2N A;  4WWV A;  2EK8 A;  4A37 A;  4TNU A;  2ZOG A;  4A38 A;  3B3W A;  3H8E A;  4K3N A;  3SI0 A;  4OC2 A;  1YW4 A;  4X3R A;  4WJB A;  4FAI A;  3KL9 A;  4AXV A;  3VAR A;  2AFO A;  5F09 A;  1GYT A;  3HLP A;  3D66 A;  4UIB A;  4MCS A;  4KSI A;  2DEA A;  3CT9 A;  3KR5 A;  4JZ0 A;  4MXU A;  2QYV A;  2O53 A;  4NFR A;  4NGR A;  1TXR A;  3FEE A;  4P4B A;  1ARM A;  2PJ6 A;  1XFO A;  4O23 A;  1FNO A;  3B35 A;  3WC5 A;  4PXB A;  3B3S A;  4R6T A;  4UF4 A;  1Z8L A;  5K8M A;  2AFS A;  1UWY A;  1PYT B;  1ZG7 A;  2JEW A;  3KQX A;  1ZG8 A;  3D7F A;  3KI9 A;  1YLO A;  4Z65 A;  2AFX A;  2I3C A;  1TF9 A;  1ELL P;  4P44 A;  4OC0 A;  1XJO A;  3B3V A;  4JYW A;  2C6G A;  3CPA A;  1XBU A;  4OC1 A;  4UEF A;  1Q7L A;  3WC6 A;  4MHZ A;  4B6Z A;  5D29 A;  2PVV A;  2PJ1 A;  3KQZ A;  4GM5 A;  1RTQ A;  3SJX A;  4A94 A;  1PCA A;  3H8F A;  2ZEP A;  5LYI A;  5JH9 A;  2OOT A;  4BD9 A;  3SJG A;  2AFW A;  4PXD A;  4PXE A;  4NGM A;  3SI2 A;  3RAM A;  5LRK A;  3D7D A;  2PE3 A;  5I4M A;  4ZY1 A;  3B7I A;  2ANP A;  1YW6 A;  1F2O A;  4ONW A;  3HUV A;  2PIZ A;  3ISZ A;  5LRG A;  4NGN A;  5K8P A;  2XEJ A;  3D68 A;  1HDQ A;  3PRT A;  1LAM A;  1Y7E A;  4OIW A;  3D67 A;  4PXC A;  3S9L A;  1VHO A;  2VL1 A;  1VGY A;  3IEH A;  1HEE A;  3IFE A;  2ZEN A;  1LAP A;  2FVG A;  2GU2 A;  5CPA A;  2ZEM A;  2NSM A;  5CBM A;  2CIJ A;  1TKJ A;  4OC5 A;  2AFU A;  6CPA A;  1ZG9 A;  3PB9 X;  1XRY A;  1AMP A;  3D7H A;  1TKF A;  2PRQ A;  5THW A;  3SJF A;  4MMO A;  1LAN A;  4EWT A;  4DUK A;  2ZEG A;  1OBR A;  2PJB A;  3KGQ A;  4ZY0 A;  2HC9 A;  1YME A;  4OME A;  2C6C A;  2V8G A;  5LRJ A;  2ZEE A;  3V38 A;  4IK2 A;  2C1C A;  2CTC A;  3BI0 A;  4MCQ A;  4OID A;  4P4I A;  5HVF A;  3D7G A;  1CPS A;  5K8N A;  3FEC A;  3FMC A;  3RBU A;  3CPX A;  2WZN A;  1ZLH A;  4LQG A;  2RB7 A;  3B3T A;  4PQA A;  3PFO A;  1LCP A;  1BLL E;  1NSA A;  2V8D A;  2JBJ A;  1EE3 P;  4ZYQ A;  4OKO A;  3DLJ A;  2Q4Z A;  5K8O A;  1CBX A;  1KWM A;  1F2P A;  1FT7 A;  4YWY A;  4ZY2 A;  3KAS A;  3VAT A;  2JBK A;  2IJZ A;  3KZW A;  2PJ0 A;  2V77 A;  3B3C A;  2IMO A;  1TKH A;  3BXM A;  1DTD A;  3QNV A;  4R76 A;  5LYL A;  4R7M A;  5LYD A;  3GLJ A;  3KHX A;  4P4E A;  1DE4 C;  5IB9 A;  2GRE A;  2Q51 A;  4IAV A;  4MHY A;  7CPA A;  1ARL A;  2XEG A;  4P4D A;  4FUU A;  2BO9 A;  4NGS A;  4DYO A;  1CX8 A;  3NA6 A;  1ELM P;  2PJ9 A;  1AYE A;  3NFZ A;  4IHM A;  4MHP A;  2PJ7 A;  1IGB A;  4OP4 A;  4P6Y A;  1LOK A;  3FX6 A;  4OC3 A;  5HXD A;  3PFE A;  2NYQ A;  2V8H A;  4MCP A;  2J9A A;  4YU9 A;  3NH5 A;  4PPZ A;  1HDU A;  1BPM A;  2HB6 A;  3PBB A;  1XMB A;  3BHX A;  3FVL A;  4G1P A;  1ZLI A;  3V7Z A;  4MHN A;  3TC8 A;  2PJ3 A;  3IIB A;  4P45 A;  2AFZ A;  4EFD A;  2PCU A;  4A39 A;  4ZI6 A;  3IWW A;  1CPX A;  2PVW A;  4MCR A;  4DJL A;  4P4J A;  5ELY A;  3MRU A;  3H8G A;  4X8I A;  2ZEO A;  5JGF A;  1CG2 A;  2BCO A;  4P4F A;  4P10 A;  4UEZ A;  5LYF A;  4Q7A A;  4FBE A;  3WT4 A;  4ZX8 A;  2ZEH A;  4NGT A;  1QMU A;  3IJ3 A;  3WC7 A;  2POK A;  4W9Y A;  2F8H A;  2XEF A;  2PJA A;  3PB8 X;  4R8F A;  3S9N A;  3FJU A;  1H8L A;  2CTB A;  3LMS A;  2PJ2 A;  4NGP A;  2G9D A;  2CF4 A;  2QJ8 A;  2PJ4 A;  2ZEF A;  4NJR A;  4NGQ A;  2ZOF A;  2O4H A;  3TX8 A;  3IO1 A;  4NJQ A;  3N5F A;  1IY7 A;  1Z5R A;  1Z2L A;  5HVG A;  1BAV A;  1CP6 A;  2ZED A;  3D4U A;  5J1Q A;  1QQ9 A;  4UIA A;  2BOA A;  1Y0Y A;  4CPA A;  1TF8 A;  3JRU A;  1CP7 A;  2PJ8 A;  4EME A;  1YSJ A;  3DGV A;  3SJE A;  3SI1 A;  1JQG A;  1R3N A;  3PB4 X;  3LWU A;  3I1U A;  1M4L A;  2PJC A;  2ZEL A;  3PBE A;  3S9M A;  4F8Z A;  4F9U A;  3PB6 X;  3GB0 A;  3WAB A;  3KR4 A;  3IC1 A;  2PJ5 A;  4FWU A;  2GLF A;  2GLJ A;  3NH4 A;  3K9T A;  3KHZ A;  3BI1 A;  3RZA A;  2EK9 A;  2V8V A;  8CPA A;  1LFW A;  2ABZ A;  2Q43 A;  3GUX A;  3FED A;  4X2T A;  4ZX9 A;  5JM6 A;  1VHE A;  5D8N A;  2F7V A;  2QVP A;  1VIX A;  4RUH A;  3MN8 A;  2C6P A;  4H2K A;  4MRI A;  4TWE A;  1Y0R A;  4OC4 A;  3NH8 A;  2IQ6 A;  3PEI A;  1R43 A;  5HVH A;  2OR4 A;  3ISX A;  3PB7 X;  3T8W A;  2EWB A;  3K2K A;  5DS0 A;  3CDX A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...