1AMPA

Crystal structure of aeromonas proteolytica aminopeptidase: a prototypical member of the co-catalytic zinc enzyme family
Total Genus 112
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
112
sequence length
291
structure length
291
Chain Sequence
MPPITQQATVTAWLPQVDASQITGTISSLESFTNRFYTTTSGAQASDWIASEWQALSASLPNASVKQVSHSGYNQKSVVMTITGSEAPDEWIVIGGHLDSTIGSHTNEQSVAPGADDDASGIAAVTEVIRVLSENNFQPKRSIAFMAYAAEEVGLRGSQDLANQYKSEGKNVVSALQLDMTNYKGSAQDVVFITDYTDSNFTQYLTQLMDEYLPSLTYGFDTCGYACSDHASWHNAGYPAAMPFESKFNDYNPRIHTTQDTLANSDPTGSHAKKFTQLGLAYAIEMGSATG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase(aminopeptidase)
molecule keywords AMINOPEPTIDASE
publication title Crystal structure of Aeromonas proteolytica aminopeptidase: a prototypical member of the co-catalytic zinc enzyme family.
pubmed doi rcsb
source organism Vibrio proteolyticus
total genus 112
structure length 291
sequence length 291
ec nomenclature ec 3.4.11.10: Bacterial leucyl aminopeptidase.
pdb deposition date 1994-04-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF04389 Peptidase_M28 Peptidase family M28
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.630.10 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Zn peptidases 1ampA00
2V8HA 4NGQA 2ZEFA 2HB6A 3H8EA 3KR5A 3NH8A 4O23A 1PCAA 2IMOA 4P4IA 4YU9A 3FECA 2PJ0A 6CPAA 3FJUA 3QNVA 5LYIA 4FAIA 2WZNA 3RAMA 2ZELA 2ABZA 4DJLA 1Z8LA 2PJ1A 3KQZA 3PFOA 2OR4A 4DYOA 1ZG8A 1EE3P 1LAMA 1XMBA 4Q7AA 2QYVA 2CTBA 3CPXA 1M4LA 3H8FA 1CG2A 4EWTA 2F7VA 4MHPA 4X2TA 4JYWA 1Q7LA 1H8LA 1DE4C 3SI1A 4P44A 3GB0A 2C1CA 2ZEGA 5JGFA 4OC4A 3IFEA 4MCQA 1CPSA 2QVPA 1YW6A 4F9VA 2AFZA 3FMCA 4F9UA 2BOAA 3VARA 4OC3A 4EFDA 3SJGA 1LCPA 3ISZA 2CTCA 5J1QA 1VGYA 3IJ3A 3PB9X 4OC1A 1RTQA 2AFOA 2C6PA 2ZENA 4R76A 2GU2A 5HVGA 3D67A 3NH4A 4X8IA 3DGVA 5I4MA 3WABA 1BAVA 2PJBA 3PBEA 3CPAA 4TWEA 7CPAA 3B3CA 4OIDA 2QJ8A 4NGRA 2RFHA 2NYQA 1VIXA 1CP6A 2PVWA 8CPAA 1ZG7A 2I3CA 1DTDA 2EK8A 2HC9A 1XFOA 1TKJA 4ZI6A 3MN8A 2PJ2A 1TXRA 2IJZA 1ZLIA 2O4HA 4AXVA 4IHMA 3TC8A 2AFXA 5THWA 2PJ4A 1NSAA 1YMEA 2O53A 2AFWA 3D68A 2OOTA 1YLOA 1FT7A 4X3RA 3I1UA 1F57A 4K3NA 1OBRA 4ZX8A 4UIBA 2PJ3A 2FVGA 2GREA 2BO9A 3BHXA 2POKA 4CPAA 2PVVA 5K8PA 4JZ0A 3PB6X 4OP4A 2C6CA 4FWUA 1IY7A 3KHZA 5LRJA 4WWVA 4NGPA 5IB9A 2V77A 3WC5A 3H8GA 2C6GA 1QMUA 4UIAA 1AYEA 1YW4A 1UWYA 1BPNA 1GYTA 1ZLHA 1CBXA 5CPAA 4PXDA 2WYRA 4OKOA 1HDUA 2ZEMA 4A94A 5JH9A 1TF9A 4NGSA 5ELYA 4DUKA 1QQ9A 3FH4A 3KASA 3T8WA 2PJCA 4YWYA 4P4DA 1KWMA 1TKFA 1TKHA 4PQAA 3MRUA 3FVLA 5D8NA 4TNUA 3PFEA 5K8OA 3D7DA 4NJQA 5K8MA 5HVHA 4P4FA 3IIBA 3LMSA 3RZAA 4NGMA 4ZX9A 4OC0A 3TX8A 3SJEA 4P10A 2JEWA 4PXEA 4B6ZA 4IK2A 4UF4A 1ARLA 1VHOA 2PJ9A 1BPMA 4A38A 4P4EA 2PE3A 3D4UA 2PIYA 3VATA 5LYDA 4PXBA 2ZOGA 3B3SA 4W9YA 1F2OA 1ZG9A 3BI1A 3NH5A 3N5FA 4UEFA 1CPXA 2J9AA 1LANA 4ONWA 2EWBA 2AFUA 1Y7EA 4A39A 1ELMP 5F09A 3JRUA 2XEJA 4NFRA 4F8ZA 4MCSA 5JM6A 3NA6A 4R6TA 3S9LA 1CX8A 2NSMA 3D7HA 4P4JA 3FF3A 3LWUA 3WT4A 4Z65A 4RUHA 3S9NA 3KI9A 3L2NA 5D29A 4MHYA 3WC6A 4FBEA 1Y0YA 4R8FA 3B3TA 3PB7X 1ARMA 3B35A 2JBKA 5LRKA 2PRQA 3KQXA 3B7IA 3CT9A 2XEGA 2EK9A 4P4BA 4MCRA 3HUVA 1AMPA 1Z5RA 2ZEHA 5CBMA 3SJXA 1PYTB 3V7ZA 4ZY1A 4ZY2A 2AFMA 2BCOA 4MCPA 2PCUA 3D7GA 3ISXA 1XJOA 2V8DA 2CIJA 1XBUA 4UEEA 2RB7A 4MMOA 1HDQA 2XEFA 3IEHA 3SJFA 3K9TA 2GLFA 4P45A 4FUUA 3IWWA 4OC2A 2F8HA 1LOKA 3DLJA 5HVFA 2G9DA 4G1PA 2XEIA 3FEEA 4BD9A 4R7MA 4UEZA 3D7FA 4LQGA 1FNOA 3IC1A 2V8VA 3FX6A 3IO1A 3KR4A 2ZOFA 3SI0A 1HEEA 1JQGA 2Q43A 1F2PA 4EMEA 1TF8A 4P6YA 4A37A 3S9MA 4WJBA 3CDXA 3FEDA 3K2KA 4MHNA 4MRIA 4NGNA 3GUXA 3B3WA 3NFZA 4GM5A 3RBUA 3PB8X 4ZY0A 2AFSA 4OMEA 1LFWA 2ZEDA 4PPZA 1ELLP 1YSJA 3GLJA 3PB4X 3D66A 5LRGA 3KL9A 5DS0A 1CP7A 4IAVA 3KGQA 1BLLE 3SI2A 2PJ5A 1R43A 3BXMA 2ZEEA 4OIWA 3BI0A 2ANPA 2Q4ZA 5LYFA 2PJ6A 2PJ8A 5HXDA 1IGBA 3HLPA 4H2KA 3WC7A 2GLJA 4ZYQA 1XRYA 4MHZA 4NGTA 1Y0RA 2PJ7A 4OC5A 3V38A 3KHXA 5LYLA 3B3VA 1LAPA 1VHEA 2VL1A 4KSIA 2Q51A 2IQ6A 1R3NA 4PXCA 4NJRA 2ZEPA 2PJAA 3PBBA 4MXUA 1Z2LA 3KZWA 5K8NA 2JBJA 3PEIA 2ZEOA 3B2YA 2CF4A 3VH9A 2DEAA 2PIZA 3PRTA 2V8GA
chains in the Genus database with same CATH superfamily
2V8HA 5A27A 4NGQA 2ZEFA 5G1ZA 2HB6A 3H8EA 4H6UA 4K30A 2DF5A 3KR5A 3NH8A 4AG7A 4NF1A 2AE6A 3IU2A 5KTDA 4KVOE 4O23A 1PCAA 2FIWA 2IMOA 4P4IA 5G20A 4YU9A 3FECA 4U9ZA 2J8MA 2PJ0A 4R3LA 1Z9UA 3RYOA 4QVTA 6CPAA 2PC1A 5AG4A 3CXPA 3FJUA 4PK2A 4NSQA 2VXKA 2Z3PA 3WR7A 4Q38A 2B5GB 2AJ6A 2Z3KA 2D4PA 3QNVA 5LYIA 4FAIA 2WZNA 4CYPA 3RAMA 2ZELA 2V8GA 4MFPA 1R57A 2DPTA 2ABZA 3TO7A 2ODFA 4DJLA 1Z8LA 2PJ1A 4KORA 2G0BA 1S7NA 2YNCC 3KQZA 3PFOA 2OR4A 4DYOA 1ZG8A 1EE3P 1LAMA 3D8PA 4HNWB 3S6HA 1XMBA 4Q7AA 4MFZA 2JEVA 3I9SA 2QYVA 2CTBA 1CM0A 3CPXA 4OLLA 1M4LA 2Z3OA 3TOBA 3H8FA 1CG2A 4A32A 4EWTA 1S60A 3K9UA 3LACA 2FS5A 2F7VA 4CAWA 2PR1A 4MHPA 2RC4A 4X2TA 4JYWA 4KOYA 1Q7LA 1H8LA 4KUBA 4JXRA 3QAHA 1DE4C 1N71A 3SI1A 4P44A 4KOVA 4ONUA 3GB0A 4MHDA 2C1CA 1PUAA 1V0CA 2ZEGA 5JGFA 3DR6A 4OC4A 3IFEA 4C7IA 3JUWA 4MCQA 1CPSA 2QVPA 1YX0A 4LUAA 4U5YA 1YW6A 3G3SA 1X12A 4F9VA 2AFZA 3FMCA 4B13A 4F9UA 2BOAA 1KZFA 3IWGA 4OC3A 3VARA 4EFDA 3SJGA 1LCPA 5C88A 1I12A 2CNSA 3ISZA 2CTCA 3E0KA 5J1QA 4UCMA 2OZGA 4II9A 1VGYA 1QSRA 2K5TA 3IJ3A 4MFKA 2REFA 3PB9X 4KVME 4OC1A 1QSOA 1RTQA 2YGWA 2AFOA 2R1IA 2R98A 4KUAA 4AVBA 2C6PA 1Q2CA 2Q4VA 4NXYA 2EUIA 2ZENA 4R76A 1M4IA 2GU2A 4XPKA 5HMNA 2HQYA 5HVGA 3TE4A 3D67A 3KKWA 1XMTA 3DGVA 3NH4A 2IL4A 4M3SA 4X8IA 5AG6A 3R9GA 3WABA 4B5PB 1BAVA 4JD6A 2PJBA 2REEA 2NMTA 3PBEA 5I0CA 4YRHA 3CPAA 3DSBA 3H5ZA 4KOUA 4TWEA 7CPAA 3B3CA 2YNCA 4OIDA 3TO9A 2ZW5A 2DPSA 2QJ8A 3BJ8A 1BO4A 4NGRA 4ZGYB 2BUEA 2YNEA 2RFHA 4XNHB 5DWNA 3P2HA 2Z3NA 3W6SA 1SQHA 2NYQA 4MJ8A 4E8OA 1IYLA 1VIXA 3EFAA 3RNZA 4CAEA 1CP6A 2OU2A 3S6FA 2BEIA 2PVWA 2JDCA 1ZG7A 5G22A 8CPAA 2I3CA 1DTDA 1X10A 2EK8A 3VWEA 4IF5A 4AG9A 2HC9A 1XFOA 5IX3A 4LX9A 1TKJA 4ZI6A 3MN8A 4C2YA 2J8RA 2CY2A 1GHEA 2PJ2A 3W91A 2C27A 1TXRA 2IJZA 3GKRA 1MJAA 1MJ9A 1ZLIA 2VEZA 1Q2DA 4MFQA 4CYNA 2O4HA 3NE8A 4H6ZA 4UWIA 3C26A 4IHMA 5EC4A 3TC8A 4AXVA 5KTAA 2AFXA 5THWA 2PJ4A 3DR8A 2GE3A 2WSAA 1NSAA 1YMEA 2O53A 1IOIA 2P0WA 4M6GA 1NSLA 3FYNA 2AFWA 3D68A 3TOAA 3QAYA 4CAVA 4XPLA 1Z8WA 3TT2A 3IWEA 2ZW7A 2OOTA 5ISVA 1YLOA 4UCNA 4F0XA 1FT7A 4X3RA 3PZJA 3I1UA 1F57A 2G3TA 4K3NA 1OBRA 5H86A 3R96A 4ZX8A 4UIBA 4CGLA 5JPHA 2PJ3A 2JLMA 3S6KA 3R9FA 3ZJ0A 1IB1E 2FVGA 2R8VA 1Y9WA 2F5IA 2GREA 2KCWA 2BO9A 4R9MA 3BHXA 3SXNA 3V8IA 1YQEA 2POKA 3TCVA 4CPAA 1I1DA 2OB0A 2PVVA 5K8PA 4FD7A 4JZ0A 3PB6X 5GCNA 4RI1A 4OP4A 2C6CA 1XOVA 1IY7A 2CNTA 3KHZA 1QSTA 4FWUA 4JXQA 4KOTA 5LRJA 4PSWA 2B4DA 4WWVA 3OWCA 4NGPA 4JJXA 5H84A 2HV2A 3CXQA 5IB9A 2V77A 3WC5A 1KUVA 2C6GA 1QMUA 3H8GA 4UIAA 1AYEA 1YW4A 2ZPAA 1KUYA 1K4JA 3EXNA 5DWMA 1UWYA 1MK4A 1BPNA 1GYTA 1ZLHA 4MBUA 2HUZA 2PRBA 4UFXA 4A33A 1CBXA 5CPAA 4PXDA 2WYRA 1M4GA 4B10A 4OKOA 1HDUA 2GFQA 2ZEMA 4A94A 5JH9A 1J4JA 1TF9A 4NGSA 5ELYA 4DUKA 2A4NA 2FT0A 2QIRA 1QQ9A 2P6GA 2DXQA 3FH4A 1YR0A 2VZYA 4RN7A 3KASA 3T8WA 2Q04A 2PJCA 3F8KA 4M6HA 4YWYA 4P4DA 1KWMA 1TKFA 4QUSA 4FD4A 5IB0A 1XIXA 4KLVA 4YGOA 1TKHA 4PQAA 4ZBGA 4A30A 3MRUA 4B14A 4F6AA 3FVLA 5D8NA 2Q7BA 3DNSA 3H4QA 3PFEA 1Z8TA 2CXAA 4TNUA 4BMHA 5K8OA 4XPDC 1P4NA 3D7DA 2Q0YA 4NJQA 3UY5A 5HVHA 4UWJA 5K8MA 4KS9A 3IIBA 2Q44A 4P4FA 3LMSA 2B4BA 4Q36A 5CNPA 3RZAA 3BLNA 3SXOA 4NGMA 2BL1A 3W6XA 4ZX9A 4OC0A 3TX8A 2I79A 2WPWA 3SJEA 3DDDA 1QSNA 4P10A 3P2FA 2JEWA 4NEXA 4PXEA 4C7HA 4B6ZA 4IK2A 4KZTA 4UF4A 1ARLA 2PQ8A 5IV0A 4UFVA 1VHOA 2PJ9A 1BPMA 4A38A 4R87A 4P4EA 2Z11A 2PE3A 4JLYA 3D4UA 1KUXA 2PIYA 2EO8A 3VATA 1Q2YA 3R1KA 4FD5A 5LYDA 4PXBA 2ZOGA 3B3SA 4W9YA 2B3UA 4MI4A 1F2OA 1ZG9A 1IU8A 3BI1A 4UBRA 3NH5A 4MY3A 3N5FA 2X7BA 4UEFA 2QMLA 1CPXA 2ATRA 2J9AA 1AUGA 1LANA 4IUSA 5G21A 4BBHA 2CNMA 4ONWA 2EWBA 2AFUA 4KSAA 1Y7EA 2Q7SA 2PR8A 4A39A 1ELMP 5F09A 4L89A 5HH1A 4YFJA 1UFHA 1IICA 3JRUA 2XEJA 3EO4A 3T9YA 4NFRA 4C68A 4CAXA 4A31A 4L8AA 4F8ZA 2VQYA 4MCSA 2BSWA 5JM6A 2H5MA 3NA6A 4Y49B 5J8FA 4R6TA 2ZW6A 3JVNA 4JWPA 4CS0B 5AGEA 1YLEA 4CRYB 3S9LA 1CX8A 1Z4EA 2NSMA 5F47A 3D7HA 4P4JA 3BJ7A 3D3SA 2VI7A 3FF3A 3LWUA 4GS4A 5F46A 3WT4A 2B58A 3F5BA 4Z65A 3S6GA 4RUHA 3S9NA 3KI9A 3L2NA 4UCPA 1S5KA 5D29A 4MHYA 3WC6A 2EVNA 1S7KA 2OZHA 2VBQA 2QECA 4UFWA 3ZZIA 1XF8A 4FBEA 2ZW4A 3FBUA 2EBJA 2ARHA 3R9EA 1Y0YA 4R8FA 1XE4A 2OH1A 4H89A 3B3TA 3GYAA 2B5GA 2P6EA 3PB7X 1YVOA 1ARMA 2YNDA 3B35A 1M4DA 4R57A 2JBKA 2GANA 5LRKA 4E2AA 4PK3A 2PRQA 1S7LA 4KVXA 3KQXA 4CGOA 3B7IA 4A2ZA 3CT9A 1BOBA 2P6FA 4PV6A 1P0HA 4KOXA 2XEGA 2EK9A 4P4BA 4QC6A 1NMTA 4MCRA 3HUVA 4CAFA 3CXSA 1YREA 4XNHC 1AMPA 1Z5RA 2ZEHA 4HKFA 2FSRA 5CBMA 3FXTA 3CZXA 1PYTB 3B8GA 3SJXA 3V7ZA 4CGMA 1Z4RA 1YK3A 3D2PA 1Y9KA 1PU9A 4ZY2A 4ZY1A 2AFMA 2BCOA 2I00A 2OZUA 4MCPA 2PCUA 3JTKA 3D7GA 3ISXA 4EVYA 1XJOA 2V8DA 1LRZA 3N7ZA 4U9YA 2CIJA 1QSMA 1XBUA 4UEEA 4I49A 4ORFA 2VZZA 2GIVA 3A9LA 2RB7A 4BINA 4LQ6A 2D4OA 4MMOA 2J8NA 1HDQA 4HPSA 4KSFA 4XPDB 2XEFA 2Z10A 3IEHA 4HNYB 5F48A 3D2MA 3EY5A 3FRMA 3K9TA 1IIDA 2GLFA 4MY0A 3SJFA 4P45A 3F0AA 3MGDA 4FUUA 3IWWA 4HNXB 2WUUA 4M6IA 4OC2A 4MFJA 2F8HA 1LOKA 3I3GA 3DLJA 5HVFA 2G9DA 4G1PA 2Z0ZA 2XEIA 4MFLA 4NCZA 3FEEA 3T90A 3NE7A 1RXTA 4BD9A 5C82A 4R7MA 4UEZA 3D7FA 1NE9A 4LQGA 1FNOA 3IC1A 3RO0A 3IU1A 4B5PA 2V8VA 3VWDA 3FX6A 3IO1A 1A2ZA 3KR4A 5E96A 2ZOFA 3SI0A 1HEEA 2FL4A 4OADA 1JQGA 2Q43A 5F49A 4A95A 1F2PA 3GY9A 3QB8A 2G3AA 1YGHA 4KLWA 4EMEA 2Q4YA 1TF8A 4M85A 4P6YA 4A37A 3G8WA 1TIQA 1WWZA 3S9MA 4WJBA 5KTCA 4B11A 3CDXA 3FEDA 2Y0MA 3K2KA 4MHNA 1Z8XA 1ON0A 2B4DB 4MRIA 4NGNA 3GUXA 4B5OA 3TTHA 1YVKA 1MJBA 3GIUA 3B3WA 4E0AA 3NFZA 4GM5A 3RBUA 1I21A 3IGRA 3PB8X 4ZY0A 2AFSA 3FB3A 4OMEA 1LFWA 4CRZB 2FIAA 2ZEDA 3PGPA 3LD2A 4PPZA 1L0CA 1ELLP 3TO6A 1YSJA 3GLJA 3PB4X 2ZXVA 3D66A 1U6MA 4GXHA 5J8CA 4X5KA 4CYOA 5LRGA 3KL9A 5JQ4A 1OZPA 4UA3A 4AB7A 5A28A 5I4MA 5DS0A 1CP7A 4IAVA 4B12A 3KGQA 1BLLE 4CYQA 3SI2A 2PJ5A 1R43A 3BXMA 4QBJA 4F0YA 2ZEEA 4OIWA 3EC4A 5EBVA 3BI0A 2ANPA 2Q4ZA 1JWQA 5LYFA 2FE7A 2JDDA 2PJ6A 2PJ8A 4R3KA 5HXDA 1IGBA 3HLPA 4H2KA 2FCKA 3WC7A 1CJWA 4AVAA 1IOFA 2GLJA 4ZYQA 1XRYA 2WPXA 4MHZA 1XEBA 4NGTA 1S3ZA 1Y0RA 2PSWA 2PJ7A 3PP9A 4OC5A 4RS2A 3V38A 4J3GA 3KHXA 4AVCA 2PDOA 3R95A 4KOSA 5LYLA 1Y7RA 4C2XA 3B3VA 1LAPA 2Z3MA 5EMIA 3LODA 1VHEA 1VHSA 3FNCA 4OAEA 2VL1A 4KSIA 2Q51A 2IQ6A 4CGPA 1R3NA 4DNCA 4PXCA 5FVJA 4CGNA 5AG5A 3TFYA 4C2ZA 2Z3LA 1M1DA 4NJRA 1FY7A 4FD6A 5AG7A 2FXFA 2ZEPA 1ZO0A 2PJAA 3PBBA 5BWAB 1B87A 4QB9A 1M44A 1WK4A 4MXUA 1Z2LA 3KZWA 1S7FA 4Y49C 5K8NA 2O28A 2R7HA 1B6BA 2JBJA 3PEIA 4PSXA 2ZEOA 1IYKA 1RO5A 3FIXA 3B2YA 2B3VA 2CF4A 3SHPA 3VH9A 2DEAA 2PIZA 3PRTA 4KOWA 1VKCA
chains in the Genus database with same CATH topology
2V8HA 4NGQA 2ZEFA 2HB6A 3H8EA 3KR5A 3NH8A 4O23A 1PCAA 2IMOA 4P4IA 4YU9A 3FECA 2PJ0A 6CPAA 3FJUA 3QNVA 5LYIA 4FAIA 2WZNA 3RAMA 2ZELA 2ABZA 4DJLA 1Z8LA 2PJ1A 3KQZA 3PFOA 2OR4A 4DYOA 1ZG8A 1EE3P 1LAMA 1XMBA 4Q7AA 2QYVA 2CTBA 3CPXA 1M4LA 3H8FA 1CG2A 4EWTA 2F7VA 4MHPA 4X2TA 4JYWA 1Q7LA 1H8LA 1DE4C 3SI1A 4P44A 3GB0A 2C1CA 2ZEGA 5JGFA 4OC4A 3IFEA 4MCQA 1CPSA 2QVPA 1YW6A 4F9VA 2AFZA 3FMCA 4F9UA 2BOAA 3VARA 4OC3A 4EFDA 3SJGA 1LCPA 3ISZA 2CTCA 5J1QA 1VGYA 3IJ3A 3PB9X 4OC1A 1RTQA 2AFOA 2C6PA 2ZENA 4R76A 2GU2A 5HVGA 3D67A 3NH4A 4X8IA 3DGVA 5I4MA 3WABA 1BAVA 2PJBA 3PBEA 3CPAA 4TWEA 7CPAA 3B3CA 4OIDA 2QJ8A 4NGRA 2RFHA 2NYQA 1VIXA 1CP6A 2PVWA 8CPAA 1ZG7A 2I3CA 1DTDA 2EK8A 2HC9A 1XFOA 1TKJA 4ZI6A 3MN8A 2PJ2A 1TXRA 2IJZA 1ZLIA 2O4HA 4AXVA 4IHMA 3TC8A 2AFXA 5THWA 2PJ4A 1NSAA 1YMEA 2O53A 2AFWA 3D68A 2OOTA 1YLOA 1FT7A 4X3RA 3I1UA 1F57A 4K3NA 1OBRA 4ZX8A 4UIBA 2PJ3A 2FVGA 2GREA 2BO9A 3BHXA 2POKA 4CPAA 2PVVA 5K8PA 4JZ0A 3PB6X 4OP4A 2C6CA 4FWUA 1IY7A 3KHZA 5LRJA 4WWVA 4NGPA 5IB9A 2V77A 3WC5A 3H8GA 2C6GA 1QMUA 4UIAA 1AYEA 1YW4A 1UWYA 1BPNA 1GYTA 1ZLHA 1CBXA 5CPAA 4PXDA 2WYRA 4OKOA 1HDUA 2ZEMA 4A94A 5JH9A 1TF9A 4NGSA 5ELYA 4DUKA 1QQ9A 3FH4A 3KASA 3T8WA 2PJCA 4YWYA 4P4DA 1KWMA 1TKFA 1TKHA 4PQAA 3MRUA 3FVLA 5D8NA 4TNUA 3PFEA 5K8OA 3D7DA 4NJQA 5K8MA 5HVHA 4P4FA 3IIBA 3LMSA 3RZAA 4NGMA 4ZX9A 4OC0A 3TX8A 3SJEA 4P10A 2JEWA 4PXEA 4B6ZA 4IK2A 4UF4A 1ARLA 1VHOA 2PJ9A 1BPMA 4A38A 4P4EA 2PE3A 3D4UA 2PIYA 3VATA 5LYDA 4PXBA 2ZOGA 3B3SA 4W9YA 1F2OA 1ZG9A 3BI1A 3NH5A 3N5FA 4UEFA 1CPXA 2J9AA 1LANA 4ONWA 2EWBA 2AFUA 1Y7EA 4A39A 1ELMP 5F09A 3JRUA 2XEJA 4NFRA 4F8ZA 4MCSA 5JM6A 3NA6A 4R6TA 3S9LA 1CX8A 2NSMA 3D7HA 4P4JA 3FF3A 3LWUA 3WT4A 4Z65A 4RUHA 3S9NA 3KI9A 3L2NA 5D29A 4MHYA 3WC6A 4FBEA 1Y0YA 4R8FA 3B3TA 3PB7X 1ARMA 3B35A 2JBKA 5LRKA 2PRQA 3KQXA 3B7IA 3CT9A 2XEGA 2EK9A 4P4BA 4MCRA 3HUVA 1AMPA 1Z5RA 2ZEHA 5CBMA 3SJXA 1PYTB 3V7ZA 4ZY1A 4ZY2A 2AFMA 2BCOA 4MCPA 2PCUA 3D7GA 3ISXA 1XJOA 2V8DA 2CIJA 1XBUA 4UEEA 2RB7A 4MMOA 1HDQA 2XEFA 3IEHA 3SJFA 3K9TA 2GLFA 4P45A 4FUUA 3IWWA 4OC2A 2F8HA 1LOKA 3DLJA 5HVFA 2G9DA 4G1PA 2XEIA 3FEEA 4BD9A 4R7MA 4UEZA 3D7FA 4LQGA 1FNOA 3IC1A 2V8VA 3FX6A 3IO1A 3KR4A 2ZOFA 3SI0A 1HEEA 1JQGA 2Q43A 1F2PA 4EMEA 1TF8A 4P6YA 4A37A 3S9MA 4WJBA 3CDXA 3FEDA 3K2KA 4MHNA 4MRIA 4NGNA 3GUXA 3B3WA 3NFZA 4GM5A 3RBUA 3PB8X 4ZY0A 2AFSA 4OMEA 1LFWA 2ZEDA 4PPZA 1ELLP 1YSJA 3GLJA 3PB4X 3D66A 5LRGA 3KL9A 5DS0A 1CP7A 4IAVA 3KGQA 1BLLE 3SI2A 2PJ5A 1R43A 3BXMA 2ZEEA 4OIWA 3BI0A 2ANPA 2Q4ZA 5LYFA 2PJ6A 2PJ8A 5HXDA 1IGBA 3HLPA 4H2KA 3WC7A 2GLJA 4ZYQA 1XRYA 4MHZA 4NGTA 1Y0RA 2PJ7A 4OC5A 3V38A 3KHXA 5LYLA 3B3VA 1LAPA 1VHEA 2VL1A 4KSIA 2Q51A 2IQ6A 1R3NA 4PXCA 4NJRA 2ZEPA 2PJAA 3PBBA 4MXUA 1Z2LA 3KZWA 5K8NA 2JBJA 3PEIA 2ZEOA 3B2YA 2CF4A 3VH9A 2DEAA 2PIZA 3PRTA 2V8GA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2V8H A;  4NGQ A;  2ZEF A;  2HB6 A;  3H8E A;  3KR5 A;  3NH8 A;  4O23 A;  1PCA A;  2IMO A;  4P4I A;  4YU9 A;  3FEC A;  2PJ0 A;  6CPA A;  3FJU A;  3QNV A;  5LYI A;  4FAI A;  2WZN A;  3RAM A;  2ZEL A;  2ABZ A;  4DJL A;  1Z8L A;  2PJ1 A;  3KQZ A;  3PFO A;  2OR4 A;  4DYO A;  1ZG8 A;  1EE3 P;  1LAM A;  1XMB A;  4Q7A A;  2QYV A;  2CTB A;  3CPX A;  1M4L A;  3H8F A;  1CG2 A;  4EWT A;  2F7V A;  4MHP A;  4X2T A;  4JYW A;  1Q7L A;  1H8L A;  1DE4 C;  3SI1 A;  4P44 A;  3GB0 A;  2C1C A;  2ZEG A;  5JGF A;  4OC4 A;  3IFE A;  4MCQ A;  1CPS A;  2QVP A;  1YW6 A;  4F9V A;  2AFZ A;  3FMC A;  4F9U A;  2BOA A;  3VAR A;  4OC3 A;  4EFD A;  3SJG A;  1LCP A;  3ISZ A;  2CTC A;  5J1Q A;  1VGY A;  3IJ3 A;  3PB9 X;  4OC1 A;  1RTQ A;  2AFO A;  2C6P A;  2ZEN A;  4R76 A;  2GU2 A;  5HVG A;  3D67 A;  3NH4 A;  4X8I A;  3DGV A;  5I4M A;  3WAB A;  1BAV A;  2PJB A;  3PBE A;  3CPA A;  4TWE A;  7CPA A;  3B3C A;  4OID A;  2QJ8 A;  4NGR A;  2RFH A;  2NYQ A;  1VIX A;  1CP6 A;  2PVW A;  8CPA A;  1ZG7 A;  2I3C A;  1DTD A;  2EK8 A;  2HC9 A;  1XFO A;  1TKJ A;  4ZI6 A;  3MN8 A;  2PJ2 A;  1TXR A;  2IJZ A;  1ZLI A;  2O4H A;  4AXV A;  4IHM A;  3TC8 A;  2AFX A;  5THW A;  2PJ4 A;  1NSA A;  1YME A;  2O53 A;  2AFW A;  3D68 A;  2OOT A;  1YLO A;  1FT7 A;  4X3R A;  3I1U A;  1F57 A;  4K3N A;  1OBR A;  4ZX8 A;  4UIB A;  2PJ3 A;  2FVG A;  2GRE A;  2BO9 A;  3BHX A;  2POK A;  4CPA A;  2PVV A;  5K8P A;  4JZ0 A;  3PB6 X;  4OP4 A;  2C6C A;  4FWU A;  1IY7 A;  3KHZ A;  5LRJ A;  4WWV A;  4NGP A;  5IB9 A;  2V77 A;  3WC5 A;  3H8G A;  2C6G A;  1QMU A;  4UIA A;  1AYE A;  1YW4 A;  1UWY A;  1BPN A;  1GYT A;  1ZLH A;  1CBX A;  5CPA A;  4PXD A;  2WYR A;  4OKO A;  1HDU A;  2ZEM A;  4A94 A;  5JH9 A;  1TF9 A;  4NGS A;  5ELY A;  4DUK A;  1QQ9 A;  3FH4 A;  3KAS A;  3T8W A;  2PJC A;  4YWY A;  4P4D A;  1KWM A;  1TKF A;  1TKH A;  4PQA A;  3MRU A;  3FVL A;  5D8N A;  4TNU A;  3PFE A;  5K8O A;  3D7D A;  4NJQ A;  5K8M A;  5HVH A;  4P4F A;  3IIB A;  3LMS A;  3RZA A;  4NGM A;  4ZX9 A;  4OC0 A;  3TX8 A;  3SJE A;  4P10 A;  2JEW A;  4PXE A;  4B6Z A;  4IK2 A;  4UF4 A;  1ARL A;  1VHO A;  2PJ9 A;  1BPM A;  4A38 A;  4P4E A;  2PE3 A;  3D4U A;  2PIY A;  3VAT A;  5LYD A;  4PXB A;  2ZOG A;  3B3S A;  4W9Y A;  1F2O A;  1ZG9 A;  3BI1 A;  3NH5 A;  3N5F A;  4UEF A;  1CPX A;  2J9A A;  1LAN A;  4ONW A;  2EWB A;  2AFU A;  1Y7E A;  4A39 A;  1ELM P;  5F09 A;  3JRU A;  2XEJ A;  4NFR A;  4F8Z A;  4MCS A;  5JM6 A;  3NA6 A;  4R6T A;  3S9L A;  1CX8 A;  2NSM A;  3D7H A;  4P4J A;  3FF3 A;  3LWU A;  3WT4 A;  4Z65 A;  4RUH A;  3S9N A;  3KI9 A;  3L2N A;  5D29 A;  4MHY A;  3WC6 A;  4FBE A;  1Y0Y A;  4R8F A;  3B3T A;  3PB7 X;  1ARM A;  3B35 A;  2JBK A;  5LRK A;  2PRQ A;  3KQX A;  3B7I A;  3CT9 A;  2XEG A;  2EK9 A;  4P4B A;  4MCR A;  3HUV A;  1AMP A;  1Z5R A;  2ZEH A;  5CBM A;  3SJX A;  1PYT B;  3V7Z A;  4ZY1 A;  4ZY2 A;  2AFM A;  2BCO A;  4MCP A;  2PCU A;  3D7G A;  3ISX A;  1XJO A;  2V8D A;  2CIJ A;  1XBU A;  4UEE A;  2RB7 A;  4MMO A;  1HDQ A;  2XEF A;  3IEH A;  3SJF A;  3K9T A;  2GLF A;  4P45 A;  4FUU A;  3IWW A;  4OC2 A;  2F8H A;  1LOK A;  3DLJ A;  5HVF A;  2G9D A;  4G1P A;  2XEI A;  3FEE A;  4BD9 A;  4R7M A;  4UEZ A;  3D7F A;  4LQG A;  1FNO A;  3IC1 A;  2V8V A;  3FX6 A;  3IO1 A;  3KR4 A;  2ZOF A;  3SI0 A;  1HEE A;  1JQG A;  2Q43 A;  1F2P A;  4EME A;  1TF8 A;  4P6Y A;  4A37 A;  3S9M A;  4WJB A;  3CDX A;  3FED A;  3K2K A;  4MHN A;  4MRI A;  4NGN A;  3GUX A;  3B3W A;  3NFZ A;  4GM5 A;  3RBU A;  3PB8 X;  4ZY0 A;  2AFS A;  4OME A;  1LFW A;  2ZED A;  4PPZ A;  1ELL P;  1YSJ A;  3GLJ A;  3PB4 X;  3D66 A;  5LRG A;  3KL9 A;  5DS0 A;  1CP7 A;  4IAV A;  3KGQ A;  1BLL E;  3SI2 A;  2PJ5 A;  1R43 A;  3BXM A;  2ZEE A;  4OIW A;  3BI0 A;  2ANP A;  2Q4Z A;  5LYF A;  2PJ6 A;  2PJ8 A;  5HXD A;  1IGB A;  3HLP A;  4H2K A;  3WC7 A;  2GLJ A;  4ZYQ A;  1XRY A;  4MHZ A;  4NGT A;  1Y0R A;  2PJ7 A;  4OC5 A;  3V38 A;  3KHX A;  5LYL A;  3B3V A;  1LAP A;  1VHE A;  2VL1 A;  4KSI A;  2Q51 A;  2IQ6 A;  1R3N A;  4PXC A;  4NJR A;  2ZEP A;  2PJA A;  3PBB A;  4MXU A;  1Z2L A;  3KZW A;  5K8N A;  2JBJ A;  3PEI A;  2ZEO A;  3B2Y A;  2CF4 A;  3VH9 A;  2DEA A;  2PIZ A;  3PRT A;  2V8G A; 
#chains in the Genus database with same CATH topology
 2V8H A;  5A27 A;  4NGQ A;  2ZEF A;  5G1Z A;  2HB6 A;  3H8E A;  4H6U A;  4K30 A;  2DF5 A;  3KR5 A;  3NH8 A;  4AG7 A;  4NF1 A;  2AE6 A;  3IU2 A;  5KTD A;  4KVO E;  4O23 A;  1PCA A;  2FIW A;  2IMO A;  4P4I A;  5G20 A;  4YU9 A;  3FEC A;  4U9Z A;  2J8M A;  2PJ0 A;  4R3L A;  1Z9U A;  3RYO A;  4QVT A;  6CPA A;  2PC1 A;  5AG4 A;  3CXP A;  3FJU A;  4PK2 A;  4NSQ A;  2VXK A;  2Z3P A;  3WR7 A;  4Q38 A;  2B5G B;  2AJ6 A;  2Z3K A;  2D4P A;  3QNV A;  5LYI A;  4FAI A;  2WZN A;  4CYP A;  3RAM A;  2ZEL A;  2V8G A;  4MFP A;  1R57 A;  2DPT A;  2ABZ A;  3TO7 A;  2ODF A;  4DJL A;  1Z8L A;  2PJ1 A;  4KOR A;  2G0B A;  1S7N A;  2YNC C;  3KQZ A;  3PFO A;  2OR4 A;  4DYO A;  1ZG8 A;  1EE3 P;  1LAM A;  3D8P A;  4HNW B;  3S6H A;  1XMB A;  4Q7A A;  4MFZ A;  2JEV A;  3I9S A;  2QYV A;  2CTB A;  1CM0 A;  3CPX A;  4OLL A;  1M4L A;  2Z3O A;  3TOB A;  3H8F A;  1CG2 A;  4A32 A;  4EWT A;  1S60 A;  3K9U A;  3LAC A;  2FS5 A;  2F7V A;  4CAW A;  2PR1 A;  4MHP A;  2RC4 A;  4X2T A;  4JYW A;  4KOY A;  1Q7L A;  1H8L A;  4KUB A;  4JXR A;  3QAH A;  1DE4 C;  1N71 A;  3SI1 A;  4P44 A;  4KOV A;  4ONU A;  3GB0 A;  4MHD A;  2C1C A;  1PUA A;  1V0C A;  2ZEG A;  5JGF A;  3DR6 A;  4OC4 A;  3IFE A;  4C7I A;  3JUW A;  4MCQ A;  1CPS A;  2QVP A;  1YX0 A;  4LUA A;  4U5Y A;  1YW6 A;  3G3S A;  1X12 A;  4F9V A;  2AFZ A;  3FMC A;  4B13 A;  4F9U A;  2BOA A;  1KZF A;  3IWG A;  4OC3 A;  3VAR A;  4EFD A;  3SJG A;  1LCP A;  5C88 A;  1I12 A;  2CNS A;  3ISZ A;  2CTC A;  3E0K A;  5J1Q A;  4UCM A;  2OZG A;  4II9 A;  1VGY A;  1QSR A;  2K5T A;  3IJ3 A;  4MFK A;  2REF A;  3PB9 X;  4KVM E;  4OC1 A;  1QSO A;  1RTQ A;  2YGW A;  2AFO A;  2R1I A;  2R98 A;  4KUA A;  4AVB A;  2C6P A;  1Q2C A;  2Q4V A;  4NXY A;  2EUI A;  2ZEN A;  4R76 A;  1M4I A;  2GU2 A;  4XPK A;  5HMN A;  2HQY A;  5HVG A;  3TE4 A;  3D67 A;  3KKW A;  1XMT A;  3DGV A;  3NH4 A;  2IL4 A;  4M3S A;  4X8I A;  5AG6 A;  3R9G A;  3WAB A;  4B5P B;  1BAV A;  4JD6 A;  2PJB A;  2REE A;  2NMT A;  3PBE A;  5I0C A;  4YRH A;  3CPA A;  3DSB A;  3H5Z A;  4KOU A;  4TWE A;  7CPA A;  3B3C A;  2YNC A;  4OID A;  3TO9 A;  2ZW5 A;  2DPS A;  2QJ8 A;  3BJ8 A;  1BO4 A;  4NGR A;  4ZGY B;  2BUE A;  2YNE A;  2RFH A;  4XNH B;  5DWN A;  3P2H A;  2Z3N A;  3W6S A;  1SQH A;  2NYQ A;  4MJ8 A;  4E8O A;  1IYL A;  1VIX A;  3EFA A;  3RNZ A;  4CAE A;  1CP6 A;  2OU2 A;  3S6F A;  2BEI A;  2PVW A;  2JDC A;  1ZG7 A;  5G22 A;  8CPA A;  2I3C A;  1DTD A;  1X10 A;  2EK8 A;  3VWE A;  4IF5 A;  4AG9 A;  2HC9 A;  1XFO A;  5IX3 A;  4LX9 A;  1TKJ A;  4ZI6 A;  3MN8 A;  4C2Y A;  2J8R A;  2CY2 A;  1GHE A;  2PJ2 A;  3W91 A;  2C27 A;  1TXR A;  2IJZ A;  3GKR A;  1MJA A;  1MJ9 A;  1ZLI A;  2VEZ A;  1Q2D A;  4MFQ A;  4CYN A;  2O4H A;  3NE8 A;  4H6Z A;  4UWI A;  3C26 A;  4IHM A;  5EC4 A;  3TC8 A;  4AXV A;  5KTA A;  2AFX A;  5THW A;  2PJ4 A;  3DR8 A;  2GE3 A;  2WSA A;  1NSA A;  1YME A;  2O53 A;  1IOI A;  2P0W A;  4M6G A;  1NSL A;  3FYN A;  2AFW A;  3D68 A;  3TOA A;  3QAY A;  4CAV A;  4XPL A;  1Z8W A;  3TT2 A;  3IWE A;  2ZW7 A;  2OOT A;  5ISV A;  1YLO A;  4UCN A;  4F0X A;  1FT7 A;  4X3R A;  3PZJ A;  3I1U A;  1F57 A;  2G3T A;  4K3N A;  1OBR A;  5H86 A;  3R96 A;  4ZX8 A;  4UIB A;  4CGL A;  5JPH A;  2PJ3 A;  2JLM A;  3S6K A;  3R9F A;  3ZJ0 A;  1IB1 E;  2FVG A;  2R8V A;  1Y9W A;  2F5I A;  2GRE A;  2KCW A;  2BO9 A;  4R9M A;  3BHX A;  3SXN A;  3V8I A;  1YQE A;  2POK A;  3TCV A;  4CPA A;  1I1D A;  2OB0 A;  2PVV A;  5K8P A;  4FD7 A;  4JZ0 A;  3PB6 X;  5GCN A;  4RI1 A;  4OP4 A;  2C6C A;  1XOV A;  1IY7 A;  2CNT A;  3KHZ A;  1QST A;  4FWU A;  4JXQ A;  4KOT A;  5LRJ A;  4PSW A;  2B4D A;  4WWV A;  3OWC A;  4NGP A;  4JJX A;  5H84 A;  2HV2 A;  3CXQ A;  5IB9 A;  2V77 A;  3WC5 A;  1KUV A;  2C6G A;  1QMU A;  3H8G A;  4UIA A;  1AYE A;  1YW4 A;  2ZPA A;  1KUY A;  1K4J A;  3EXN A;  5DWM A;  1UWY A;  1MK4 A;  1BPN A;  1GYT A;  1ZLH A;  4MBU A;  2HUZ A;  2PRB A;  4UFX A;  4A33 A;  1CBX A;  5CPA A;  4PXD A;  2WYR A;  1M4G A;  4B10 A;  4OKO A;  1HDU A;  2GFQ A;  2ZEM A;  4A94 A;  5JH9 A;  1J4J A;  1TF9 A;  4NGS A;  5ELY A;  4DUK A;  2A4N A;  2FT0 A;  2QIR A;  1QQ9 A;  2P6G A;  2DXQ A;  3FH4 A;  1YR0 A;  2VZY A;  4RN7 A;  3KAS A;  3T8W A;  2Q04 A;  2PJC A;  3F8K A;  4M6H A;  4YWY A;  4P4D A;  1KWM A;  1TKF A;  4QUS A;  4FD4 A;  5IB0 A;  1XIX A;  4KLV A;  4YGO A;  1TKH A;  4PQA A;  4ZBG A;  4A30 A;  3MRU A;  4B14 A;  4F6A A;  3FVL A;  5D8N A;  2Q7B A;  3DNS A;  3H4Q A;  3PFE A;  1Z8T A;  2CXA A;  4TNU A;  4BMH A;  5K8O A;  4XPD C;  1P4N A;  3D7D A;  2Q0Y A;  4NJQ A;  3UY5 A;  5HVH A;  4UWJ A;  5K8M A;  4KS9 A;  3IIB A;  2Q44 A;  4P4F A;  3LMS A;  2B4B A;  4Q36 A;  5CNP A;  3RZA A;  3BLN A;  3SXO A;  4NGM A;  2BL1 A;  3W6X A;  4ZX9 A;  4OC0 A;  3TX8 A;  2I79 A;  2WPW A;  3SJE A;  3DDD A;  1QSN A;  4P10 A;  3P2F A;  2JEW A;  4NEX A;  4PXE A;  4C7H A;  4B6Z A;  4IK2 A;  4KZT A;  4UF4 A;  1ARL A;  2PQ8 A;  5IV0 A;  4UFV A;  1VHO A;  2PJ9 A;  1BPM A;  4A38 A;  4R87 A;  4P4E A;  2Z11 A;  2PE3 A;  4JLY A;  3D4U A;  1KUX A;  2PIY A;  2EO8 A;  3VAT A;  1Q2Y A;  3R1K A;  4FD5 A;  5LYD A;  4PXB A;  2ZOG A;  3B3S A;  4W9Y A;  2B3U A;  4MI4 A;  1F2O A;  1ZG9 A;  1IU8 A;  3BI1 A;  4UBR A;  3NH5 A;  4MY3 A;  3N5F A;  2X7B A;  4UEF A;  2QML A;  1CPX A;  2ATR A;  2J9A A;  1AUG A;  1LAN A;  4IUS A;  5G21 A;  4BBH A;  2CNM A;  4ONW A;  2EWB A;  2AFU A;  4KSA A;  1Y7E A;  2Q7S A;  2PR8 A;  4A39 A;  1ELM P;  5F09 A;  4L89 A;  5HH1 A;  4YFJ A;  1UFH A;  1IIC A;  3JRU A;  2XEJ A;  3EO4 A;  3T9Y A;  4NFR A;  4C68 A;  4CAX A;  4A31 A;  4L8A A;  4F8Z A;  2VQY A;  4MCS A;  2BSW A;  5JM6 A;  2H5M A;  3NA6 A;  4Y49 B;  5J8F A;  4R6T A;  2ZW6 A;  3JVN A;  4JWP A;  4CS0 B;  5AGE A;  1YLE A;  4CRY B;  3S9L A;  1CX8 A;  1Z4E A;  2NSM A;  5F47 A;  3D7H A;  4P4J A;  3BJ7 A;  3D3S A;  2VI7 A;  3FF3 A;  3LWU A;  4GS4 A;  5F46 A;  3WT4 A;  2B58 A;  3F5B A;  4Z65 A;  3S6G A;  4RUH A;  3S9N A;  3KI9 A;  3L2N A;  4UCP A;  1S5K A;  5D29 A;  4MHY A;  3WC6 A;  2EVN A;  1S7K A;  2OZH A;  2VBQ A;  2QEC A;  4UFW A;  3ZZI A;  1XF8 A;  4FBE A;  2ZW4 A;  3FBU A;  2EBJ A;  2ARH A;  3R9E A;  1Y0Y A;  4R8F A;  1XE4 A;  2OH1 A;  4H89 A;  3B3T A;  3GYA A;  2B5G A;  2P6E A;  3PB7 X;  1YVO A;  1ARM A;  2YND A;  3B35 A;  1M4D A;  4R57 A;  2JBK A;  2GAN A;  5LRK A;  4E2A A;  4PK3 A;  2PRQ A;  1S7L A;  4KVX A;  3KQX A;  4CGO A;  3B7I A;  4A2Z A;  3CT9 A;  1BOB A;  2P6F A;  4PV6 A;  1P0H A;  4KOX A;  2XEG A;  2EK9 A;  4P4B A;  4QC6 A;  1NMT A;  4MCR A;  3HUV A;  4CAF A;  3CXS A;  1YRE A;  4XNH C;  1AMP A;  1Z5R A;  2ZEH A;  4HKF A;  2FSR A;  5CBM A;  3FXT A;  3CZX A;  1PYT B;  3B8G A;  3SJX A;  3V7Z A;  4CGM A;  1Z4R A;  1YK3 A;  3D2P A;  1Y9K A;  1PU9 A;  4ZY2 A;  4ZY1 A;  2AFM A;  2BCO A;  2I00 A;  2OZU A;  4MCP A;  2PCU A;  3JTK A;  3D7G A;  3ISX A;  4EVY A;  1XJO A;  2V8D A;  1LRZ A;  3N7Z A;  4U9Y A;  2CIJ A;  1QSM A;  1XBU A;  4UEE A;  4I49 A;  4ORF A;  2VZZ A;  2GIV A;  3A9L A;  2RB7 A;  4BIN A;  4LQ6 A;  2D4O A;  4MMO A;  2J8N A;  1HDQ A;  4HPS A;  4KSF A;  4XPD B;  2XEF A;  2Z10 A;  3IEH A;  4HNY B;  5F48 A;  3D2M A;  3EY5 A;  3FRM A;  3K9T A;  1IID A;  2GLF A;  4MY0 A;  3SJF A;  4P45 A;  3F0A A;  3MGD A;  4FUU A;  3IWW A;  4HNX B;  2WUU A;  4M6I A;  4OC2 A;  4MFJ A;  2F8H A;  1LOK A;  3I3G A;  3DLJ A;  5HVF A;  2G9D A;  4G1P A;  2Z0Z A;  2XEI A;  4MFL A;  4NCZ A;  3FEE A;  3T90 A;  3NE7 A;  1RXT A;  4BD9 A;  5C82 A;  4R7M A;  4UEZ A;  3D7F A;  1NE9 A;  4LQG A;  1FNO A;  3IC1 A;  3RO0 A;  3IU1 A;  4B5P A;  2V8V A;  3VWD A;  3FX6 A;  3IO1 A;  1A2Z A;  3KR4 A;  5E96 A;  2ZOF A;  3SI0 A;  1HEE A;  2FL4 A;  4OAD A;  1JQG A;  2Q43 A;  5F49 A;  4A95 A;  1F2P A;  3GY9 A;  3QB8 A;  2G3A A;  1YGH A;  4KLW A;  4EME A;  2Q4Y A;  1TF8 A;  4M85 A;  4P6Y A;  4A37 A;  3G8W A;  1TIQ A;  1WWZ A;  3S9M A;  4WJB A;  5KTC A;  4B11 A;  3CDX A;  3FED A;  2Y0M A;  3K2K A;  4MHN A;  1Z8X A;  1ON0 A;  2B4D B;  4MRI A;  4NGN A;  3GUX A;  4B5O A;  3TTH A;  1YVK A;  1MJB A;  3GIU A;  3B3W A;  4E0A A;  3NFZ A;  4GM5 A;  3RBU A;  1I21 A;  3IGR A;  3PB8 X;  4ZY0 A;  2AFS A;  3FB3 A;  4OME A;  1LFW A;  4CRZ B;  2FIA A;  2ZED A;  3PGP A;  3LD2 A;  4PPZ A;  1L0C A;  1ELL P;  3TO6 A;  1YSJ A;  3GLJ A;  3PB4 X;  2ZXV A;  3D66 A;  1U6M A;  4GXH A;  5J8C A;  4X5K A;  4CYO A;  5LRG A;  3KL9 A;  5JQ4 A;  1OZP A;  4UA3 A;  4AB7 A;  5A28 A;  5I4M A;  5DS0 A;  1CP7 A;  4IAV A;  4B12 A;  3KGQ A;  1BLL E;  4CYQ A;  3SI2 A;  2PJ5 A;  1R43 A;  3BXM A;  4QBJ A;  4F0Y A;  2ZEE A;  4OIW A;  3EC4 A;  5EBV A;  3BI0 A;  2ANP A;  2Q4Z A;  1JWQ A;  5LYF A;  2FE7 A;  2JDD A;  2PJ6 A;  2PJ8 A;  4R3K A;  5HXD A;  1IGB A;  3HLP A;  4H2K A;  2FCK A;  3WC7 A;  1CJW A;  4AVA A;  1IOF A;  2GLJ A;  4ZYQ A;  1XRY A;  2WPX A;  4MHZ A;  1XEB A;  4NGT A;  1S3Z A;  1Y0R A;  2PSW A;  2PJ7 A;  3PP9 A;  4OC5 A;  4RS2 A;  3V38 A;  4J3G A;  3KHX A;  4AVC A;  2PDO A;  3R95 A;  4KOS A;  5LYL A;  1Y7R A;  4C2X A;  3B3V A;  1LAP A;  2Z3M A;  5EMI A;  3LOD A;  1VHE A;  1VHS A;  3FNC A;  4OAE A;  2VL1 A;  4KSI A;  2Q51 A;  2IQ6 A;  4CGP A;  1R3N A;  4DNC A;  4PXC A;  5FVJ A;  4CGN A;  5AG5 A;  3TFY A;  4C2Z A;  2Z3L A;  1M1D A;  4NJR A;  1FY7 A;  4FD6 A;  5AG7 A;  2FXF A;  2ZEP A;  1ZO0 A;  2PJA A;  3PBB A;  5BWA B;  1B87 A;  4QB9 A;  1M44 A;  1WK4 A;  4MXU A;  1Z2L A;  3KZW A;  1S7F A;  4Y49 C;  5K8N A;  2O28 A;  2R7H A;  1B6B A;  2JBJ A;  3PEI A;  4PSX A;  2ZEO A;  1IYK A;  1RO5 A;  3FIX A;  3B2Y A;  2B3V A;  2CF4 A;  3SHP A;  3VH9 A;  2DEA A;  2PIZ A;  3PRT A;  4KOW A;  1VKC A; 
#chains in the Genus database with same CATH homology
 2V8H A;  4NGQ A;  2ZEF A;  2HB6 A;  3H8E A;  3KR5 A;  3NH8 A;  4O23 A;  1PCA A;  2IMO A;  4P4I A;  4YU9 A;  3FEC A;  2PJ0 A;  6CPA A;  3FJU A;  3QNV A;  5LYI A;  4FAI A;  2WZN A;  3RAM A;  2ZEL A;  2ABZ A;  4DJL A;  1Z8L A;  2PJ1 A;  3KQZ A;  3PFO A;  2OR4 A;  4DYO A;  1ZG8 A;  1EE3 P;  1LAM A;  1XMB A;  4Q7A A;  2QYV A;  2CTB A;  3CPX A;  1M4L A;  3H8F A;  1CG2 A;  4EWT A;  2F7V A;  4MHP A;  4X2T A;  4JYW A;  1Q7L A;  1H8L A;  1DE4 C;  3SI1 A;  4P44 A;  3GB0 A;  2C1C A;  2ZEG A;  5JGF A;  4OC4 A;  3IFE A;  4MCQ A;  1CPS A;  2QVP A;  1YW6 A;  4F9V A;  2AFZ A;  3FMC A;  4F9U A;  2BOA A;  3VAR A;  4OC3 A;  4EFD A;  3SJG A;  1LCP A;  3ISZ A;  2CTC A;  5J1Q A;  1VGY A;  3IJ3 A;  3PB9 X;  4OC1 A;  1RTQ A;  2AFO A;  2C6P A;  2ZEN A;  4R76 A;  2GU2 A;  5HVG A;  3D67 A;  3NH4 A;  4X8I A;  3DGV A;  5I4M A;  3WAB A;  1BAV A;  2PJB A;  3PBE A;  3CPA A;  4TWE A;  7CPA A;  3B3C A;  4OID A;  2QJ8 A;  4NGR A;  2RFH A;  2NYQ A;  1VIX A;  1CP6 A;  2PVW A;  8CPA A;  1ZG7 A;  2I3C A;  1DTD A;  2EK8 A;  2HC9 A;  1XFO A;  1TKJ A;  4ZI6 A;  3MN8 A;  2PJ2 A;  1TXR A;  2IJZ A;  1ZLI A;  2O4H A;  4AXV A;  4IHM A;  3TC8 A;  2AFX A;  5THW A;  2PJ4 A;  1NSA A;  1YME A;  2O53 A;  2AFW A;  3D68 A;  2OOT A;  1YLO A;  1FT7 A;  4X3R A;  3I1U A;  1F57 A;  4K3N A;  1OBR A;  4ZX8 A;  4UIB A;  2PJ3 A;  2FVG A;  2GRE A;  2BO9 A;  3BHX A;  2POK A;  4CPA A;  2PVV A;  5K8P A;  4JZ0 A;  3PB6 X;  4OP4 A;  2C6C A;  4FWU A;  1IY7 A;  3KHZ A;  5LRJ A;  4WWV A;  4NGP A;  5IB9 A;  2V77 A;  3WC5 A;  3H8G A;  2C6G A;  1QMU A;  4UIA A;  1AYE A;  1YW4 A;  1UWY A;  1BPN A;  1GYT A;  1ZLH A;  1CBX A;  5CPA A;  4PXD A;  2WYR A;  4OKO A;  1HDU A;  2ZEM A;  4A94 A;  5JH9 A;  1TF9 A;  4NGS A;  5ELY A;  4DUK A;  1QQ9 A;  3FH4 A;  3KAS A;  3T8W A;  2PJC A;  4YWY A;  4P4D A;  1KWM A;  1TKF A;  1TKH A;  4PQA A;  3MRU A;  3FVL A;  5D8N A;  4TNU A;  3PFE A;  5K8O A;  3D7D A;  4NJQ A;  5K8M A;  5HVH A;  4P4F A;  3IIB A;  3LMS A;  3RZA A;  4NGM A;  4ZX9 A;  4OC0 A;  3TX8 A;  3SJE A;  4P10 A;  2JEW A;  4PXE A;  4B6Z A;  4IK2 A;  4UF4 A;  1ARL A;  1VHO A;  2PJ9 A;  1BPM A;  4A38 A;  4P4E A;  2PE3 A;  3D4U A;  2PIY A;  3VAT A;  5LYD A;  4PXB A;  2ZOG A;  3B3S A;  4W9Y A;  1F2O A;  1ZG9 A;  3BI1 A;  3NH5 A;  3N5F A;  4UEF A;  1CPX A;  2J9A A;  1LAN A;  4ONW A;  2EWB A;  2AFU A;  1Y7E A;  4A39 A;  1ELM P;  5F09 A;  3JRU A;  2XEJ A;  4NFR A;  4F8Z A;  4MCS A;  5JM6 A;  3NA6 A;  4R6T A;  3S9L A;  1CX8 A;  2NSM A;  3D7H A;  4P4J A;  3FF3 A;  3LWU A;  3WT4 A;  4Z65 A;  4RUH A;  3S9N A;  3KI9 A;  3L2N A;  5D29 A;  4MHY A;  3WC6 A;  4FBE A;  1Y0Y A;  4R8F A;  3B3T A;  3PB7 X;  1ARM A;  3B35 A;  2JBK A;  5LRK A;  2PRQ A;  3KQX A;  3B7I A;  3CT9 A;  2XEG A;  2EK9 A;  4P4B A;  4MCR A;  3HUV A;  1AMP A;  1Z5R A;  2ZEH A;  5CBM A;  3SJX A;  1PYT B;  3V7Z A;  4ZY1 A;  4ZY2 A;  2AFM A;  2BCO A;  4MCP A;  2PCU A;  3D7G A;  3ISX A;  1XJO A;  2V8D A;  2CIJ A;  1XBU A;  4UEE A;  2RB7 A;  4MMO A;  1HDQ A;  2XEF A;  3IEH A;  3SJF A;  3K9T A;  2GLF A;  4P45 A;  4FUU A;  3IWW A;  4OC2 A;  2F8H A;  1LOK A;  3DLJ A;  5HVF A;  2G9D A;  4G1P A;  2XEI A;  3FEE A;  4BD9 A;  4R7M A;  4UEZ A;  3D7F A;  4LQG A;  1FNO A;  3IC1 A;  2V8V A;  3FX6 A;  3IO1 A;  3KR4 A;  2ZOF A;  3SI0 A;  1HEE A;  1JQG A;  2Q43 A;  1F2P A;  4EME A;  1TF8 A;  4P6Y A;  4A37 A;  3S9M A;  4WJB A;  3CDX A;  3FED A;  3K2K A;  4MHN A;  4MRI A;  4NGN A;  3GUX A;  3B3W A;  3NFZ A;  4GM5 A;  3RBU A;  3PB8 X;  4ZY0 A;  2AFS A;  4OME A;  1LFW A;  2ZED A;  4PPZ A;  1ELL P;  1YSJ A;  3GLJ A;  3PB4 X;  3D66 A;  5LRG A;  3KL9 A;  5DS0 A;  1CP7 A;  4IAV A;  3KGQ A;  1BLL E;  3SI2 A;  2PJ5 A;  1R43 A;  3BXM A;  2ZEE A;  4OIW A;  3BI0 A;  2ANP A;  2Q4Z A;  5LYF A;  2PJ6 A;  2PJ8 A;  5HXD A;  1IGB A;  3HLP A;  4H2K A;  3WC7 A;  2GLJ A;  4ZYQ A;  1XRY A;  4MHZ A;  4NGT A;  1Y0R A;  2PJ7 A;  4OC5 A;  3V38 A;  3KHX A;  5LYL A;  3B3V A;  1LAP A;  1VHE A;  2VL1 A;  4KSI A;  2Q51 A;  2IQ6 A;  1R3N A;  4PXC A;  4NJR A;  2ZEP A;  2PJA A;  3PBB A;  4MXU A;  1Z2L A;  3KZW A;  5K8N A;  2JBJ A;  3PEI A;  2ZEO A;  3B2Y A;  2CF4 A;  3VH9 A;  2DEA A;  2PIZ A;  3PRT A;  2V8G A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...