1AMPA

Crystal structure of aeromonas proteolytica aminopeptidase: a prototypical member of the co-catalytic zinc enzyme family
Total Genus 112
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
112
sequence length
291
structure length
291
Chain Sequence
MPPITQQATVTAWLPQVDASQITGTISSLESFTNRFYTTTSGAQASDWIASEWQALSASLPNASVKQVSHSGYNQKSVVMTITGSEAPDEWIVIGGHLDSTIGSHTNEQSVAPGADDDASGIAAVTEVIRVLSENNFQPKRSIAFMAYAAEEVGLRGSQDLANQYKSEGKNVVSALQLDMTNYKGSAQDVVFITDYTDSNFTQYLTQLMDEYLPSLTYGFDTCGYACSDHASWHNAGYPAAMPFESKFNDYNPRIHTTQDTLANSDPTGSHAKKFTQLGLAYAIEMGSATG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of Aeromonas proteolytica aminopeptidase: a prototypical member of the co-catalytic zinc enzyme family.
pubmed doi rcsb
source organism Vibrio proteolyticus
molecule tags Hydrolase(aminopeptidase)
molecule keywords AMINOPEPTIDASE
total genus 112
structure length 291
sequence length 291
ec nomenclature ec 3.4.11.10: Bacterial leucyl aminopeptidase.
pdb deposition date 1994-04-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF04389 Peptidase_M28 Peptidase family M28
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.630.10 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Zn peptidases 1ampA00
4Z65A 2EK8A 3PFOA 3NH4A 4OMEA 2XEGA 4UIAA 2QYVA 4NGPA 4PXDA 3PEIA 2O4HA 2PJ6A 4FAIA 1ZG9A 2GLFA 3KQZA 2NYQA 3KZWA 4AXVA 5K8NA 1H8LA 3H8GA 2XEFA 3KI9A 2I3CA 4OIWA 2PCUA 3B7IA 2GREA 2PVWA 1Z2LA 5DS0A 3IFEA 3FMCA 1PYTB 1QQ9A 5HXDA 2CIJA 2PJ1A 4TNUA 2ZEOA 2AFZA 2XEJA 3B3VA 4UEFA 3S9LA 1R43A 4OC3A 5CBMA 4IK2A 3NH5A 1CP7A 4H2KA 4R8FA 1Y0RA 1AMPA 2G9DA 2PJ9A 5LYLA 4P45A 1VIXA 3DLJA 4ZYQA 2F8HA 3PB4X 1Z8LA 1BAVA 2J9AA 1TF9A 3SJGA 1AYEA 2EK9A 4NJQA 1Q7LA 2ZELA 2EWBA 4W9YA 2PJ5A 3D68A 4JZ0A 4OC5A 1NSAA 1XBUA 2V8HA 1XRYA 2IMOA 5LRJA 5LYIA 5J1QA 2NSMA 3NFZA 3WC7A 1YLOA 3D7FA 4EFDA 1F2OA 3K9TA 2AFUA 1LOKA 1TKHA 4MMOA 2WZNA 2FVGA 1PCAA 2ZEMA 2ZEDA 4DYOA 3FECA 1CPSA 2OOTA 2PRQA 3NH8A 4PPZA 5THWA 4JYWA 4G1PA 4MHZA 1IGBA 4KSIA 4ZX8A 1XFOA 2PJBA 3KL9A 3SI0A 3PBBA 2CF4A 3RAMA 1IY7A 4UF4A 2ZENA 1TF8A 4GM5A 5JH9A 2PJ2A 1F2PA 1TKJA 3SJEA 3ISXA 5IB9A 4A39A 4F9UA 4ZY0A 4R76A 4PQAA 4IHMA 1GYTA 4OP4A 4TWEA 3T8WA 3VARA 4ZI6A 1OBRA 4ONWA 3IJ3A 3KR4A 3KHZA 2JBKA 1VGYA 1Y7EA 3DGVA 2PJCA 4NJRA 2AFMA 4CPAA 5D8NA 3GUXA 5K8PA 2CTBA 2Q43A 2ZEPA 4MHYA 2IJZA 3WABA 2JEWA 1BPNA 2VL1A 4FBEA 4ZY1A 3TC8A 2QJ8A 4NGMA 5F09A 1ZLIA 3MN8A 1BPMA 1XMBA 4P4EA 2BCOA 4X8IA 8CPAA 3D7DA 4PXCA 5CPAA 3IEHA 3ISZA 2PJAA 4A37A 3JRUA 5LRGA 4P4FA 3RBUA 2PIYA 3WC6A 4Q7AA 4LQGA 3BHXA 4OC0A 2V8VA 4NFRA 1TKFA 4OIDA 3D7GA 2PJ3A 4NGRA 2Q4ZA 4MHNA 4DUKA 3NA6A 5D29A 4IAVA 2V77A 4OC2A 1LANA 3S9NA 3SI2A 2PJ7A 3PB8X 2ABZA 5LYFA 2V8GA 2HC9A 2C1CA 1ZG8A 1ARMA 4MCRA 2PE3A 1YW6A 3PB9X 2AFSA 4MCPA 3D7HA 4R7MA 1VHEA 3SJFA 2BOAA 1QMUA 4P4DA 2O53A 3B3CA 2AFXA 4MCSA 2AFOA 2GU2A 1VHOA 3CT9A 3FJUA 4ZX9A 2WYRA 1RTQA 1ARLA 4YU9A 1LCPA 4MRIA 2RB7A 4WJBA 1UWYA 3FH4A 4EWTA 3LWUA 1LAMA 1Z5RA 1ELLP 3KHXA 3V38A 2AFWA 5LRKA 3IIBA 3K2KA 2ZOFA 6CPAA 1HEEA 2Q51A 2PJ8A 3VH9A 4B6ZA 3KASA 3L2NA 4P4BA 2ZOGA 1YSJA 2JBJA 3V7ZA 5K8OA 4FWUA 1CG2A 3H8FA 4A38A 4PXBA 4O23A 3IC1A 5JM6A 4K3NA 1TXRA 3LMSA 2POKA 1HDUA 2DEAA 4F9VA 3VATA 4UEEA 2XEIA 3D4UA 3TX8A 1CBXA 1LFWA 1YW4A 1M4LA 1R3NA 3BI1A 3HUVA 5ELYA 3CDXA 4BD9A 2PJ0A 4MHPA 3B3TA 4NGSA 4NGQA 1JQGA 1KWMA 4WWVA 2PJ4A 4RUHA 3N5FA 2ZEGA 4P4JA 3MRUA 3BI0A 2GLJA 3B3SA 4MXUA 4X3RA 2ANPA 3IO1A 4EMEA 2PVVA 4F8ZA 2CTCA 3FEEA 3SI1A 1HDQA 4ZY2A 3WT4A 3PFEA 5I4MA 2ZEFA 1CX8A 3GLJA 2C6PA 3SJXA 3CPAA 3FX6A 1YMEA 3PBEA 1BLLE 1EE3P 3FVLA 3FF3A 2RFHA 3GB0A 2F7VA 2HB6A 5HVFA 2C6GA 1XJOA 3BXMA 3D66A 4OC1A 1CP6A 4R6TA 4MCQA 1DTDA 4UIBA 3HLPA 3KGQA 3CPXA 2C6CA 4A94A 5JGFA 1F57A 3I1UA 4OKOA 3B2YA 3KQXA 2QVPA 4P10A 3S9MA 2ZEEA 2PIZA 4PXEA 3PB7X 4P6YA 5HVHA 3PB6X 4FUUA 4NGTA 3KR5A 2V8DA 1FNOA 5HVGA 4DJLA 3RZAA 3WC5A 4OC4A 1ELMP 3QNVA 1LAPA 3PRTA 4YWYA 1CPXA 5LYDA 7CPAA 1ZLHA 3D67A 4UEZA 1Y0YA 4P4IA 3IWWA 1DE4C 2ZEHA 3B3WA 2IQ6A 4NGNA 2BO9A 2OR4A 4X2TA 3B35A 5K8MA 3FEDA 1ZG7A 3H8EA 4P44A 1FT7A
chains in the Genus database with same CATH superfamily
2JLMA 4Z65A 2EK8A 1YREA 2F5IA 3PFOA 3NH4A 1YR0A 4MFJA 4OMEA 2XEGA 2EBJA 4UIAA 4U9ZA 4L8AA 1Y9KA 2QYVA 1I21A 3K9UA 3S6KA 3SXNA 2Q7BA 1YQEA 4NGPA 5GCNA 4PXDA 4HPSA 3PEIA 5JQ4A 1Z8XA 4MFLA 2O4HA 4NSQA 5H84A 2B58A 2PJ6A 5C82A 4FAIA 4M6GA 1QSNA 1ZG9A 2GLFA 4Y49C 1K4JA 1S3ZA 3KQZA 2NYQA 3KZWA 4AXVA 5K8NA 2WSAA 2ARHA 5EC4A 1VKCA 1H8LA 1YX0A 2BL1A 1IICA 2XEFA 3H8GA 3KI9A 4AVAA 2HUZA 1Z9UA 2I3CA 4KZTA 4OIWA 4OLLA 2PCUA 4H6ZA 4LQ6A 3B7IA 2GREA 2PVWA 2YGWA 1Z2LA 4KS9A 5DS0A 2YNEA 3IFEA 1BOBA 3FBUA 4GS4A 3FMCA 3R9EA 1PYTB 5F49A 1QQ9A 4B5PB 5HXDA 2CIJA 2PJ1A 4TNUA 2ZEOA 1IYKA 4CYPA 2AFZA 2XEJA 3B3VA 3NE8A 4UEFA 3S9LA 3TOAA 2VBQA 1R43A 4OC3A 5CBMA 4IK2A 3LD2A 1CP7A 3NH5A 4Q38A 2B3VA 2FCKA 4H2KA 4R8FA 3TOBA 3DDDA 1P0HA 1IOFA 2B5GB 4B14A 1Y0RA 1AMPA 3DR6A 4EVYA 2G9DA 2PJ9A 3I9SA 5LYLA 2FXFA 4P45A 3R9GA 1VIXA 4E2AA 3DLJA 2VXKA 3EXNA 4ZYQA 3IU2A 2F8HA 3PB4X 1Z8LA 1BAVA 2J9AA 4B12A 5FVJA 1TF9A 3SJGA 3ZJ0A 4I49A 3CXSA 3DR8A 1AYEA 4KOYA 4H6UA 1Q2CA 4LUAA 4R3LA 1Y7RA 1AUGA 2EK9A 3DNSA 4NJQA 1Q7LA 2DF5A 2ZELA 2EWBA 4W9YA 1QSMA 2PJ5A 3D68A 4JZ0A 3QAYA 4CGNA 4OC5A 1NSAA 1XBUA 2V8HA 1P4NA 3GIUA 1XRYA 2IMOA 3FNCA 5LRJA 5LYIA 5J1QA 3TCVA 2NSMA 5G20A 4NXYA 2RC4A 4OAEA 5J8FA 3NFZA 3WC7A 1YLOA 4M6IA 2WUUA 3D7FA 2R1IA 2PRBA 4EFDA 4XPKA 2H5MA 2P0WA 3D3SA 1F2OA 3K9TA 4K30A 2AFUA 1LOKA 1TKHA 2QIRA 1IU8A 2YNCC 2WZNA 4FD4A 4MMOA 4XNHB 2FVGA 2OU2A 1PCAA 2ZEMA 3RO0A 2ZEDA 3TE4A 4KOVA 5AG4A 4DYOA 3MGDA 5DWMA 3FECA 1CPSA 2VZZA 2OOTA 2PRQA 2ZW4A 3NH8A 3H4QA 2CNTA 4PPZA 5THWA 3GYAA 2WPWA 4JYWA 4G1PA 3TO9A 4AVCA 4MHZA 1IGBA 4KSIA 1TIQA 4YRHA 3IGRA 1XFOA 1Z4RA 4ZX8A 2PJBA 3GY9A 3I3GA 3D2PA 1FY7A 1YVKA 5IV0A 3KL9A 2B4DA 3SI0A 3PBBA 2ZW6A 1QSTA 2I79A 4QC6A 4A31A 2CF4A 4QB9A 3EFAA 3RAMA 2Z11A 1IY7A 4UF4A 1M4DA 5JPHA 2ZENA 3RNZA 4KLWA 4UCPA 1TF8A 4GM5A 4CGLA 5JH9A 2PJ2A 1F2PA 1KUXA 1TKJA 3P2HA 4XPLA 5KTDA 3SJEA 3ISXA 5IB9A 1R57A 5LRGA 4A39A 1QSRA 4F9UA 4ZY0A 5KTCA 2OZHA 4R76A 4KOTA 1I12A 2B5GA 1PU9A 4IHMA 4PQAA 3TO6A 1IYLA 1GYTA 4FD6A 4M3SA 2GFQA 4MI4A 2HQYA 4OP4A 1I1DA 2BUEA 3FB3A 4HNXB 4R3KA 4TWEA 3RYOA 3T8WA 3VARA 3N7ZA 4ZI6A 3TFYA 1NMTA 2Q04A 3EY5A 1OBRA 4ONWA 3IJ3A 3KR4A 4QVTA 3IWGA 3CZXA 3VWEA 3KHZA 2JBKA 1VGYA 1M4IA 1QSOA 1Y7EA 1NSLA 4MFZA 4CRZB 2ZW7A 2PJCA 2Z3KA 3DGVA 4ZBGA 4NJRA 2AFMA 2ATRA 5IB0A 3FYNA 4CPAA 3FIXA 5AG5A 3GUXA 5D8NA 2CTBA 2Q43A 2ZEPA 5K8PA 2CNMA 4MHYA 2IJZA 3WABA 4JWPA 2JEWA 2Z3MA 2JDCA 5A28A 5KTAA 1BPNA 2VL1A 4FBEA 4ZY1A 1U6MA 4HNYB 2Z10A 2FIWA 5BWAB 4ORFA 3TC8A 1X12A 2QJ8A 4OADA 3SHPA 2J8NA 4NGMA 4BBHA 5F09A 1M4GA 1ZLIA 5G1ZA 3MN8A 1BPMA 2ODFA 4QBJA 1WWZA 4MFKA 1XMBA 1KUVA 1VHSA 4P4EA 2BCOA 4X8IA 8CPAA 4B13A 4UWJA 1MK4A 3D7DA 1XMTA 4PXCA 2VEZA 5CPAA 2BEIA 3IEHA 3ISZA 2PJAA 4A37A 3JRUA 4PSWA 4P4FA 5AG7A 2CY2A 2PIYA 2PSWA 3D8PA 4FD7A 4Q7AA 4LQGA 1MJ9A 3BHXA 4OC0A 4CAFA 4J3GA 1XIXA 4PV6A 2O28A 4HKFA 2PDOA 2V8VA 4F0XA 5ISVA 4NFRA 1TKFA 2ZXVA 3D7GA 4OIDA 5DWNA 1JWQA 4JLYA 2PJ3A 4NGRA 2OH1A 2Q4ZA 2Z3PA 4XNHC 3BLNA 4MHNA 2WPXA 4DUKA 3JTKA 3NA6A 1RO5A 4C2ZA 5D29A 2P6GA 4IAVA 2G0BA 4CS0B 2NMTA 2EO8A 4E8OA 1S7LA 2V77A 4OC2A 1CM0A 1KZFA 2EVNA 3S6FA 3W6XA 1LANA 3KKWA 3S9NA 4JJXA 3SI2A 4NEXA 2Q44A 3FRMA 2PJ7A 5HH1A 3PB8X 2ABZA 5LYFA 2V8GA 4IUSA 4JXQA 2GIVA 2J8RA 4M85A 2HC9A 4BD9A 3R1KA 3R96A 2C1CA 2FL4A 3C26A 4YFJA 2REFA 1B6BA 1ZG8A 4UA3A 3VWDA 1ARMA 3JVNA 4MCRA 4B5PA 3TO7A 2PE3A 1YW6A 3PB9X 2AFSA 4MCPA 3D7HA 2G3AA 4R7MA 1KUYA 1VHEA 2YNDA 3SJFA 4CGPA 3CXQA 2BOAA 1QMUA 2GANA 1YVOA 4P4DA 2O53A 3B3CA 2AFXA 2FT0A 4UBRA 4MCSA 3F5BA 2PQ8A 5F46A 2AFOA 2GU2A 4CAVA 1VHOA 3CT9A 4XPDC 2VQYA 3BJ8A 4KORA 2Z0ZA 4B11A 3FJUA 4CAWA 4ZX9A 2WYRA 3TT2A 4Q36A 2OB0A 4C2XA 1RTQA 2PR8A 3JUWA 5AGEA 5I0CA 1ARLA 4YU9A 4R57A 1LCPA 5E96A 4MRIA 5CNPA 4PK2A 2B3UA 1J4JA 2RB7A 4WJBA 1UWYA 1UFHA 3FH4A 4F6AA 4GXHA 4RI1A 4U9YA 4UCMA 4EWTA 1B87A 3LWUA 5A27A 1LAMA 1Z5RA 1ELLP 4C2YA 4A95A 4A2ZA 3EC4A 3V8IA 3KHXA 3FXTA 4NF1A 1XEBA 3V38A 4PSXA 2AFWA 5LRKA 3IIBA 3S6HA 3T9YA 3K2KA 4H89A 3TTHA 2ZOFA 6CPAA 2Z3LA 3LACA 4MBUA 4L89A 2B4DB 1IB1E 1BO4A 1HEEA 4KUAA 2HV2A 2Q51A 2PJ8A 2I00A 3VH9A 4KOUA 4A32A 4B6ZA 2YNCA 3KASA 3L2NA 2R98A 4KSFA 4P4BA 2ZOGA 1YSJA 2JBJA 2PC1A 3V7ZA 4FWUA 3CXPA 5K8OA 1ON0A 4C7HA 1YK3A 1CG2A 4FD5A 3R9FA 3H8FA 4A38A 2KCWA 1Z8TA 5IX3A 1L0CA 4PXBA 4O23A 3IC1A 2R8VA 4AG7A 4AB7A 5JM6A 3SXOA 1XOVA 1Z4EA 4K3NA 3BJ7A 1XE4A 1TXRA 3LMSA 2POKA 4MY0A 1HDUA 2DEAA 4KVOE 3R95A 2A4NA 3VATA 4MY3A 4F9VA 1YGHA 3OWCA 4UEEA 2XEIA 3PZJA 3WR7A 4BINA 3D4UA 3G8WA 3TX8A 4QUSA 1CBXA 1LFWA 1YW4A 1A2ZA 1M4LA 4DNCA 2BSWA 1R3NA 3BI1A 3HUVA 5ELYA 2B4BA 3CDXA 3W91A 3WC6A 2PJ0A 3D2MA 4MHPA 3B3TA 4R87A 3F0AA 4NGQA 4NGSA 1JQGA 1KWMA 4WWVA 2PJ4A 5HMNA 4RUHA 4MHDA 3N5FA 3IU1A 2ZEGA 4P4JA 2JDDA 2Z3NA 1S7FA 1MJAA 3MRUA 4KLVA 2DXQA 1X10A 3BI0A 2GLJA 2ZPAA 3B3SA 4MXUA 4X3RA 2ANPA 2QECA 3IO1A 3A9LA 3QB8A 2PVVA 4NCZA 2DPTA 4EMEA 2REEA 4F8ZA 4MFQA 2EUIA 2CTCA 4ONUA 4BMHA 3FEEA 4CAXA 3SI1A 1YLEA 5F48A 1HDQA 4YGOA 4E0AA 5H86A 3IWEA 4ZY2A 3PFEA 3WT4A 5C88A 5I4MA 2ZEFA 1CX8A 2Y0MA 3GLJA 2OZGA 2C6PA 4XPDB 3SJXA 3CPAA 3FX6A 1IOIA 2OZUA 4B5OA 1YMEA 4RN7A 3GKRA 4KVME 2D4PA 4MFPA 2JEVA 3S6GA 3PP9A 3W6SA 3PBEA 1BLLE 1V0CA 1Q2DA 1EE3P 4CGMA 3FVLA 5G21A 4HNWB 4C68A 3G3SA 1S7KA 4UWIA 2ZW5A 4B10A 5AG6A 5J8CA 4AG9A 3FF3A 2RFHA 3GB0A 4Y49B 2F7VA 2VI7A 4CRYB 2HB6A 3PGPA 1M1DA 5HVFA 1MJBA 2C6GA 1XJOA 3BXMA 3D66A 3EO4A 2P6FA 1Q2YA 4OC1A 1S5KA 5EBVA 3H5ZA 1CP6A 4KUBA 4R6TA 4UFXA 5G22A 4MJ8A 1NE9A 4MCQA 3F8KA 1DTDA 4A30A 4UIBA 4LX9A 1S7NA 3HLPA 4IF5A 4KOXA 3KGQA 2Q4VA 4CYNA 2AJ6A 3CPXA 2C6CA 3B8GA 4A94A 1Y9WA 5JGFA 2AE6A 1WK4A 4JD6A 4RS2A 1F57A 2D4OA 3I1UA 4KSAA 3B2YA 4OKOA 3KQXA 2QVPA 4P10A 3RBUA 2X7BA 2FE7A 4KVXA 3S9MA 4CYOA 2ZEEA 2PIZA 4CYQA 2CXAA 4PXEA 2Q7SA 4AVBA 3PB7X 4P6YA 1GHEA 5HVHA 3PB6X 3LODA 4FUUA 3T90A 1ZO0A 2DPSA 2R7HA 1RXTA 4NGTA 4A33A 4C7IA 1IIDA 3DSBA 2FIAA 2GE3A 2Q4YA 2V8DA 3KR5A 2FS5A 4UFVA 4II9A 2K5TA 2PR1A 1FNOA 3P2FA 1PUAA 1N71A 5HVGA 2VZYA 2CNSA 4DJLA 2Q0YA 2G3TA 3NE7A 4M6HA 3RZAA 1SQHA 4OC4A 3QAHA 3WC5A 4PK3A 1ELMP 1S60A 4JXRA 3ZZIA 1LAPA 1OZPA 3PRTA 2QMLA 3QNVA 4KOSA 4U5YA 4KOWA 5EMIA 1CPXA 4YWYA 5LYDA 7CPAA 1ZLHA 3D67A 2J8MA 4UEZA 4CGOA 1Y0YA 4P4IA 3IWWA 1Z8WA 4ZGYB 1DE4C 2ZEHA 3E0KA 4F0YA 3B3WA 2IQ6A 4R9MA 4NGNA 1M44A 2Z3OA 3UY5A 4X5KA 1CJWA 2BO9A 4UCNA 4UFWA 2OR4A 1LRZA 4X2TA 5F47A 2P6EA 3B35A 5K8MA 3FEDA 2IL4A 1XF8A 2C27A 4CAEA 1ZG7A 3H8EA 4P44A 2FSRA 1FT7A
chains in the Genus database with same CATH topology
4Z65A 2EK8A 3PFOA 3NH4A 4OMEA 2XEGA 4UIAA 2QYVA 4NGPA 4PXDA 3PEIA 2O4HA 2PJ6A 4FAIA 1ZG9A 2GLFA 3KQZA 2NYQA 3KZWA 4AXVA 5K8NA 1H8LA 3H8GA 2XEFA 3KI9A 2I3CA 4OIWA 2PCUA 3B7IA 2GREA 2PVWA 1Z2LA 5DS0A 3IFEA 3FMCA 1PYTB 1QQ9A 5HXDA 2CIJA 2PJ1A 4TNUA 2ZEOA 2AFZA 2XEJA 3B3VA 4UEFA 3S9LA 1R43A 4OC3A 5CBMA 4IK2A 3NH5A 1CP7A 4H2KA 4R8FA 1Y0RA 1AMPA 2G9DA 2PJ9A 5LYLA 4P45A 1VIXA 3DLJA 4ZYQA 2F8HA 3PB4X 1Z8LA 1BAVA 2J9AA 1TF9A 3SJGA 1AYEA 2EK9A 4NJQA 1Q7LA 2ZELA 2EWBA 4W9YA 2PJ5A 3D68A 4JZ0A 4OC5A 1NSAA 1XBUA 2V8HA 1XRYA 2IMOA 5LRJA 5LYIA 5J1QA 2NSMA 3NFZA 3WC7A 1YLOA 3D7FA 4EFDA 1F2OA 3K9TA 2AFUA 1LOKA 1TKHA 4MMOA 2WZNA 2FVGA 1PCAA 2ZEMA 2ZEDA 4DYOA 3FECA 1CPSA 2OOTA 2PRQA 3NH8A 4PPZA 5THWA 4JYWA 4G1PA 4MHZA 1IGBA 4KSIA 4ZX8A 1XFOA 2PJBA 3KL9A 3SI0A 3PBBA 2CF4A 3RAMA 1IY7A 4UF4A 2ZENA 1TF8A 4GM5A 5JH9A 2PJ2A 1F2PA 1TKJA 3SJEA 3ISXA 5IB9A 4A39A 4F9UA 4ZY0A 4R76A 4PQAA 4IHMA 1GYTA 4OP4A 4TWEA 3T8WA 3VARA 4ZI6A 1OBRA 4ONWA 3IJ3A 3KR4A 3KHZA 2JBKA 1VGYA 1Y7EA 3DGVA 2PJCA 4NJRA 2AFMA 4CPAA 5D8NA 3GUXA 5K8PA 2CTBA 2Q43A 2ZEPA 4MHYA 2IJZA 3WABA 2JEWA 1BPNA 2VL1A 4FBEA 4ZY1A 3TC8A 2QJ8A 4NGMA 5F09A 1ZLIA 3MN8A 1BPMA 1XMBA 4P4EA 2BCOA 4X8IA 8CPAA 3D7DA 4PXCA 5CPAA 3IEHA 3ISZA 2PJAA 4A37A 3JRUA 5LRGA 4P4FA 3RBUA 2PIYA 3WC6A 4Q7AA 4LQGA 3BHXA 4OC0A 2V8VA 4NFRA 1TKFA 4OIDA 3D7GA 2PJ3A 4NGRA 2Q4ZA 4MHNA 4DUKA 3NA6A 5D29A 4IAVA 2V77A 4OC2A 1LANA 3S9NA 3SI2A 2PJ7A 3PB8X 2ABZA 5LYFA 2V8GA 2HC9A 2C1CA 1ZG8A 1ARMA 4MCRA 2PE3A 1YW6A 3PB9X 2AFSA 4MCPA 3D7HA 4R7MA 1VHEA 3SJFA 2BOAA 1QMUA 4P4DA 2O53A 3B3CA 2AFXA 4MCSA 2AFOA 2GU2A 1VHOA 3CT9A 3FJUA 4ZX9A 2WYRA 1RTQA 1ARLA 4YU9A 1LCPA 4MRIA 2RB7A 4WJBA 1UWYA 3FH4A 4EWTA 3LWUA 1LAMA 1Z5RA 1ELLP 3KHXA 3V38A 2AFWA 5LRKA 3IIBA 3K2KA 2ZOFA 6CPAA 1HEEA 2Q51A 2PJ8A 3VH9A 4B6ZA 3KASA 3L2NA 4P4BA 2ZOGA 1YSJA 2JBJA 3V7ZA 5K8OA 4FWUA 1CG2A 3H8FA 4A38A 4PXBA 4O23A 3IC1A 5JM6A 4K3NA 1TXRA 3LMSA 2POKA 1HDUA 2DEAA 4F9VA 3VATA 4UEEA 2XEIA 3D4UA 3TX8A 1CBXA 1LFWA 1YW4A 1M4LA 1R3NA 3BI1A 3HUVA 5ELYA 3CDXA 4BD9A 2PJ0A 4MHPA 3B3TA 4NGSA 4NGQA 1JQGA 1KWMA 4WWVA 2PJ4A 4RUHA 3N5FA 2ZEGA 4P4JA 3MRUA 3BI0A 2GLJA 3B3SA 4MXUA 4X3RA 2ANPA 3IO1A 4EMEA 2PVVA 4F8ZA 2CTCA 3FEEA 3SI1A 1HDQA 4ZY2A 3WT4A 3PFEA 5I4MA 2ZEFA 1CX8A 3GLJA 2C6PA 3SJXA 3CPAA 3FX6A 1YMEA 3PBEA 1BLLE 1EE3P 3FVLA 3FF3A 2RFHA 3GB0A 2F7VA 2HB6A 5HVFA 2C6GA 1XJOA 3BXMA 3D66A 4OC1A 1CP6A 4R6TA 4MCQA 1DTDA 4UIBA 3HLPA 3KGQA 3CPXA 2C6CA 4A94A 5JGFA 1F57A 3I1UA 4OKOA 3B2YA 3KQXA 2QVPA 4P10A 3S9MA 2ZEEA 2PIZA 4PXEA 3PB7X 4P6YA 5HVHA 3PB6X 4FUUA 4NGTA 3KR5A 2V8DA 1FNOA 5HVGA 4DJLA 3RZAA 3WC5A 4OC4A 1ELMP 3QNVA 1LAPA 3PRTA 4YWYA 1CPXA 5LYDA 7CPAA 1ZLHA 3D67A 4UEZA 1Y0YA 4P4IA 3IWWA 1DE4C 2ZEHA 3B3WA 2IQ6A 4NGNA 2BO9A 2OR4A 4X2TA 3B35A 5K8MA 3FEDA 1ZG7A 3H8EA 4P44A 1FT7A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4Z65 A;  2EK8 A;  3PFO A;  3NH4 A;  4OME A;  2XEG A;  4UIA A;  2QYV A;  4NGP A;  4PXD A;  3PEI A;  2O4H A;  2PJ6 A;  4FAI A;  1ZG9 A;  2GLF A;  3KQZ A;  2NYQ A;  3KZW A;  4AXV A;  5K8N A;  1H8L A;  3H8G A;  2XEF A;  3KI9 A;  2I3C A;  4OIW A;  2PCU A;  3B7I A;  2GRE A;  2PVW A;  1Z2L A;  5DS0 A;  3IFE A;  3FMC A;  1PYT B;  1QQ9 A;  5HXD A;  2CIJ A;  2PJ1 A;  4TNU A;  2ZEO A;  2AFZ A;  2XEJ A;  3B3V A;  4UEF A;  3S9L A;  1R43 A;  4OC3 A;  5CBM A;  4IK2 A;  3NH5 A;  1CP7 A;  4H2K A;  4R8F A;  1Y0R A;  1AMP A;  2G9D A;  2PJ9 A;  5LYL A;  4P45 A;  1VIX A;  3DLJ A;  4ZYQ A;  2F8H A;  3PB4 X;  1Z8L A;  1BAV A;  2J9A A;  1TF9 A;  3SJG A;  1AYE A;  2EK9 A;  4NJQ A;  1Q7L A;  2ZEL A;  2EWB A;  4W9Y A;  2PJ5 A;  3D68 A;  4JZ0 A;  4OC5 A;  1NSA A;  1XBU A;  2V8H A;  1XRY A;  2IMO A;  5LRJ A;  5LYI A;  5J1Q A;  2NSM A;  3NFZ A;  3WC7 A;  1YLO A;  3D7F A;  4EFD A;  1F2O A;  3K9T A;  2AFU A;  1LOK A;  1TKH A;  4MMO A;  2WZN A;  2FVG A;  1PCA A;  2ZEM A;  2ZED A;  4DYO A;  3FEC A;  1CPS A;  2OOT A;  2PRQ A;  3NH8 A;  4PPZ A;  5THW A;  4JYW A;  4G1P A;  4MHZ A;  1IGB A;  4KSI A;  4ZX8 A;  1XFO A;  2PJB A;  3KL9 A;  3SI0 A;  3PBB A;  2CF4 A;  3RAM A;  1IY7 A;  4UF4 A;  2ZEN A;  1TF8 A;  4GM5 A;  5JH9 A;  2PJ2 A;  1F2P A;  1TKJ A;  3SJE A;  3ISX A;  5IB9 A;  4A39 A;  4F9U A;  4ZY0 A;  4R76 A;  4PQA A;  4IHM A;  1GYT A;  4OP4 A;  4TWE A;  3T8W A;  3VAR A;  4ZI6 A;  1OBR A;  4ONW A;  3IJ3 A;  3KR4 A;  3KHZ A;  2JBK A;  1VGY A;  1Y7E A;  3DGV A;  2PJC A;  4NJR A;  2AFM A;  4CPA A;  5D8N A;  3GUX A;  5K8P A;  2CTB A;  2Q43 A;  2ZEP A;  4MHY A;  2IJZ A;  3WAB A;  2JEW A;  1BPN A;  2VL1 A;  4FBE A;  4ZY1 A;  3TC8 A;  2QJ8 A;  4NGM A;  5F09 A;  1ZLI A;  3MN8 A;  1BPM A;  1XMB A;  4P4E A;  2BCO A;  4X8I A;  8CPA A;  3D7D A;  4PXC A;  5CPA A;  3IEH A;  3ISZ A;  2PJA A;  4A37 A;  3JRU A;  5LRG A;  4P4F A;  3RBU A;  2PIY A;  3WC6 A;  4Q7A A;  4LQG A;  3BHX A;  4OC0 A;  2V8V A;  4NFR A;  1TKF A;  4OID A;  3D7G A;  2PJ3 A;  4NGR A;  2Q4Z A;  4MHN A;  4DUK A;  3NA6 A;  5D29 A;  4IAV A;  2V77 A;  4OC2 A;  1LAN A;  3S9N A;  3SI2 A;  2PJ7 A;  3PB8 X;  2ABZ A;  5LYF A;  2V8G A;  2HC9 A;  2C1C A;  1ZG8 A;  1ARM A;  4MCR A;  2PE3 A;  1YW6 A;  3PB9 X;  2AFS A;  4MCP A;  3D7H A;  4R7M A;  1VHE A;  3SJF A;  2BOA A;  1QMU A;  4P4D A;  2O53 A;  3B3C A;  2AFX A;  4MCS A;  2AFO A;  2GU2 A;  1VHO A;  3CT9 A;  3FJU A;  4ZX9 A;  2WYR A;  1RTQ A;  1ARL A;  4YU9 A;  1LCP A;  4MRI A;  2RB7 A;  4WJB A;  1UWY A;  3FH4 A;  4EWT A;  3LWU A;  1LAM A;  1Z5R A;  1ELL P;  3KHX A;  3V38 A;  2AFW A;  5LRK A;  3IIB A;  3K2K A;  2ZOF A;  6CPA A;  1HEE A;  2Q51 A;  2PJ8 A;  3VH9 A;  4B6Z A;  3KAS A;  3L2N A;  4P4B A;  2ZOG A;  1YSJ A;  2JBJ A;  3V7Z A;  5K8O A;  4FWU A;  1CG2 A;  3H8F A;  4A38 A;  4PXB A;  4O23 A;  3IC1 A;  5JM6 A;  4K3N A;  1TXR A;  3LMS A;  2POK A;  1HDU A;  2DEA A;  4F9V A;  3VAT A;  4UEE A;  2XEI A;  3D4U A;  3TX8 A;  1CBX A;  1LFW A;  1YW4 A;  1M4L A;  1R3N A;  3BI1 A;  3HUV A;  5ELY A;  3CDX A;  4BD9 A;  2PJ0 A;  4MHP A;  3B3T A;  4NGS A;  4NGQ A;  1JQG A;  1KWM A;  4WWV A;  2PJ4 A;  4RUH A;  3N5F A;  2ZEG A;  4P4J A;  3MRU A;  3BI0 A;  2GLJ A;  3B3S A;  4MXU A;  4X3R A;  2ANP A;  3IO1 A;  4EME A;  2PVV A;  4F8Z A;  2CTC A;  3FEE A;  3SI1 A;  1HDQ A;  4ZY2 A;  3WT4 A;  3PFE A;  5I4M A;  2ZEF A;  1CX8 A;  3GLJ A;  2C6P A;  3SJX A;  3CPA A;  3FX6 A;  1YME A;  3PBE A;  1BLL E;  1EE3 P;  3FVL A;  3FF3 A;  2RFH A;  3GB0 A;  2F7V A;  2HB6 A;  5HVF A;  2C6G A;  1XJO A;  3BXM A;  3D66 A;  4OC1 A;  1CP6 A;  4R6T A;  4MCQ A;  1DTD A;  4UIB A;  3HLP A;  3KGQ A;  3CPX A;  2C6C A;  4A94 A;  5JGF A;  1F57 A;  3I1U A;  4OKO A;  3B2Y A;  3KQX A;  2QVP A;  4P10 A;  3S9M A;  2ZEE A;  2PIZ A;  4PXE A;  3PB7 X;  4P6Y A;  5HVH A;  3PB6 X;  4FUU A;  4NGT A;  3KR5 A;  2V8D A;  1FNO A;  5HVG A;  4DJL A;  3RZA A;  3WC5 A;  4OC4 A;  1ELM P;  3QNV A;  1LAP A;  3PRT A;  4YWY A;  1CPX A;  5LYD A;  7CPA A;  1ZLH A;  3D67 A;  4UEZ A;  1Y0Y A;  4P4I A;  3IWW A;  1DE4 C;  2ZEH A;  3B3W A;  2IQ6 A;  4NGN A;  2BO9 A;  2OR4 A;  4X2T A;  3B35 A;  5K8M A;  3FED A;  1ZG7 A;  3H8E A;  4P44 A;  1FT7 A; 
#chains in the Genus database with same CATH topology
 2JLM A;  4Z65 A;  2EK8 A;  1YRE A;  2F5I A;  3PFO A;  3NH4 A;  1YR0 A;  4MFJ A;  4OME A;  2XEG A;  2EBJ A;  4UIA A;  4U9Z A;  4L8A A;  1Y9K A;  2QYV A;  1I21 A;  3K9U A;  3S6K A;  3SXN A;  2Q7B A;  1YQE A;  4NGP A;  5GCN A;  4PXD A;  4HPS A;  3PEI A;  5JQ4 A;  1Z8X A;  4MFL A;  2O4H A;  4NSQ A;  5H84 A;  2B58 A;  2PJ6 A;  5C82 A;  4FAI A;  4M6G A;  1QSN A;  1ZG9 A;  2GLF A;  4Y49 C;  1K4J A;  1S3Z A;  3KQZ A;  2NYQ A;  3KZW A;  4AXV A;  5K8N A;  2WSA A;  2ARH A;  5EC4 A;  1VKC A;  1H8L A;  1YX0 A;  2BL1 A;  1IIC A;  2XEF A;  3H8G A;  3KI9 A;  4AVA A;  2HUZ A;  1Z9U A;  2I3C A;  4KZT A;  4OIW A;  4OLL A;  2PCU A;  4H6Z A;  4LQ6 A;  3B7I A;  2GRE A;  2PVW A;  2YGW A;  1Z2L A;  4KS9 A;  5DS0 A;  2YNE A;  3IFE A;  1BOB A;  3FBU A;  4GS4 A;  3FMC A;  3R9E A;  1PYT B;  5F49 A;  1QQ9 A;  4B5P B;  5HXD A;  2CIJ A;  2PJ1 A;  4TNU A;  2ZEO A;  1IYK A;  4CYP A;  2AFZ A;  2XEJ A;  3B3V A;  3NE8 A;  4UEF A;  3S9L A;  3TOA A;  2VBQ A;  1R43 A;  4OC3 A;  5CBM A;  4IK2 A;  3LD2 A;  1CP7 A;  3NH5 A;  4Q38 A;  2B3V A;  2FCK A;  4H2K A;  4R8F A;  3TOB A;  3DDD A;  1P0H A;  1IOF A;  2B5G B;  4B14 A;  1Y0R A;  1AMP A;  3DR6 A;  4EVY A;  2G9D A;  2PJ9 A;  3I9S A;  5LYL A;  2FXF A;  4P45 A;  3R9G A;  1VIX A;  4E2A A;  3DLJ A;  2VXK A;  3EXN A;  4ZYQ A;  3IU2 A;  2F8H A;  3PB4 X;  1Z8L A;  1BAV A;  2J9A A;  4B12 A;  5FVJ A;  1TF9 A;  3SJG A;  3ZJ0 A;  4I49 A;  3CXS A;  3DR8 A;  1AYE A;  4KOY A;  4H6U A;  1Q2C A;  4LUA A;  4R3L A;  1Y7R A;  1AUG A;  2EK9 A;  3DNS A;  4NJQ A;  1Q7L A;  2DF5 A;  2ZEL A;  2EWB A;  4W9Y A;  1QSM A;  2PJ5 A;  3D68 A;  4JZ0 A;  3QAY A;  4CGN A;  4OC5 A;  1NSA A;  1XBU A;  2V8H A;  1P4N A;  3GIU A;  1XRY A;  2IMO A;  3FNC A;  5LRJ A;  5LYI A;  5J1Q A;  3TCV A;  2NSM A;  5G20 A;  4NXY A;  2RC4 A;  4OAE A;  5J8F A;  3NFZ A;  3WC7 A;  1YLO A;  4M6I A;  2WUU A;  3D7F A;  2R1I A;  2PRB A;  4EFD A;  4XPK A;  2H5M A;  2P0W A;  3D3S A;  1F2O A;  3K9T A;  4K30 A;  2AFU A;  1LOK A;  1TKH A;  2QIR A;  1IU8 A;  2YNC C;  2WZN A;  4FD4 A;  4MMO A;  4XNH B;  2FVG A;  2OU2 A;  1PCA A;  2ZEM A;  3RO0 A;  2ZED A;  3TE4 A;  4KOV A;  5AG4 A;  4DYO A;  3MGD A;  5DWM A;  3FEC A;  1CPS A;  2VZZ A;  2OOT A;  2PRQ A;  2ZW4 A;  3NH8 A;  3H4Q A;  2CNT A;  4PPZ A;  5THW A;  3GYA A;  2WPW A;  4JYW A;  4G1P A;  3TO9 A;  4AVC A;  4MHZ A;  1IGB A;  4KSI A;  1TIQ A;  4YRH A;  3IGR A;  1XFO A;  1Z4R A;  4ZX8 A;  2PJB A;  3GY9 A;  3I3G A;  3D2P A;  1FY7 A;  1YVK A;  5IV0 A;  3KL9 A;  2B4D A;  3SI0 A;  3PBB A;  2ZW6 A;  1QST A;  2I79 A;  4QC6 A;  4A31 A;  2CF4 A;  4QB9 A;  3EFA A;  3RAM A;  2Z11 A;  1IY7 A;  4UF4 A;  1M4D A;  5JPH A;  2ZEN A;  3RNZ A;  4KLW A;  4UCP A;  1TF8 A;  4GM5 A;  4CGL A;  5JH9 A;  2PJ2 A;  1F2P A;  1KUX A;  1TKJ A;  3P2H A;  4XPL A;  5KTD A;  3SJE A;  3ISX A;  5IB9 A;  1R57 A;  5LRG A;  4A39 A;  1QSR A;  4F9U A;  4ZY0 A;  5KTC A;  2OZH A;  4R76 A;  4KOT A;  1I12 A;  2B5G A;  1PU9 A;  4IHM A;  4PQA A;  3TO6 A;  1IYL A;  1GYT A;  4FD6 A;  4M3S A;  2GFQ A;  4MI4 A;  2HQY A;  4OP4 A;  1I1D A;  2BUE A;  3FB3 A;  4HNX B;  4R3K A;  4TWE A;  3RYO A;  3T8W A;  3VAR A;  3N7Z A;  4ZI6 A;  3TFY A;  1NMT A;  2Q04 A;  3EY5 A;  1OBR A;  4ONW A;  3IJ3 A;  3KR4 A;  4QVT A;  3IWG A;  3CZX A;  3VWE A;  3KHZ A;  2JBK A;  1VGY A;  1M4I A;  1QSO A;  1Y7E A;  1NSL A;  4MFZ A;  4CRZ B;  2ZW7 A;  2PJC A;  2Z3K A;  3DGV A;  4ZBG A;  4NJR A;  2AFM A;  2ATR A;  5IB0 A;  3FYN A;  4CPA A;  3FIX A;  5AG5 A;  3GUX A;  5D8N A;  2CTB A;  2Q43 A;  2ZEP A;  5K8P A;  2CNM A;  4MHY A;  2IJZ A;  3WAB A;  4JWP A;  2JEW A;  2Z3M A;  2JDC A;  5A28 A;  5KTA A;  1BPN A;  2VL1 A;  4FBE A;  4ZY1 A;  1U6M A;  4HNY B;  2Z10 A;  2FIW A;  5BWA B;  4ORF A;  3TC8 A;  1X12 A;  2QJ8 A;  4OAD A;  3SHP A;  2J8N A;  4NGM A;  4BBH A;  5F09 A;  1M4G A;  1ZLI A;  5G1Z A;  3MN8 A;  1BPM A;  2ODF A;  4QBJ A;  1WWZ A;  4MFK A;  1XMB A;  1KUV A;  1VHS A;  4P4E A;  2BCO A;  4X8I A;  8CPA A;  4B13 A;  4UWJ A;  1MK4 A;  3D7D A;  1XMT A;  4PXC A;  2VEZ A;  5CPA A;  2BEI A;  3IEH A;  3ISZ A;  2PJA A;  4A37 A;  3JRU A;  4PSW A;  4P4F A;  5AG7 A;  2CY2 A;  2PIY A;  2PSW A;  3D8P A;  4FD7 A;  4Q7A A;  4LQG A;  1MJ9 A;  3BHX A;  4OC0 A;  4CAF A;  4J3G A;  1XIX A;  4PV6 A;  2O28 A;  4HKF A;  2PDO A;  2V8V A;  4F0X A;  5ISV A;  4NFR A;  1TKF A;  2ZXV A;  3D7G A;  4OID A;  5DWN A;  1JWQ A;  4JLY A;  2PJ3 A;  4NGR A;  2OH1 A;  2Q4Z A;  2Z3P A;  4XNH C;  3BLN A;  4MHN A;  2WPX A;  4DUK A;  3JTK A;  3NA6 A;  1RO5 A;  4C2Z A;  5D29 A;  2P6G A;  4IAV A;  2G0B A;  4CS0 B;  2NMT A;  2EO8 A;  4E8O A;  1S7L A;  2V77 A;  4OC2 A;  1CM0 A;  1KZF A;  2EVN A;  3S6F A;  3W6X A;  1LAN A;  3KKW A;  3S9N A;  4JJX A;  3SI2 A;  4NEX A;  2Q44 A;  3FRM A;  2PJ7 A;  5HH1 A;  3PB8 X;  2ABZ A;  5LYF A;  2V8G A;  4IUS A;  4JXQ A;  2GIV A;  2J8R A;  4M85 A;  2HC9 A;  4BD9 A;  3R1K A;  3R96 A;  2C1C A;  2FL4 A;  3C26 A;  4YFJ A;  2REF A;  1B6B A;  1ZG8 A;  4UA3 A;  3VWD A;  1ARM A;  3JVN A;  4MCR A;  4B5P A;  3TO7 A;  2PE3 A;  1YW6 A;  3PB9 X;  2AFS A;  4MCP A;  3D7H A;  2G3A A;  4R7M A;  1KUY A;  1VHE A;  2YND A;  3SJF A;  4CGP A;  3CXQ A;  2BOA A;  1QMU A;  2GAN A;  1YVO A;  4P4D A;  2O53 A;  3B3C A;  2AFX A;  2FT0 A;  4UBR A;  4MCS A;  3F5B A;  2PQ8 A;  5F46 A;  2AFO A;  2GU2 A;  4CAV A;  1VHO A;  3CT9 A;  4XPD C;  2VQY A;  3BJ8 A;  4KOR A;  2Z0Z A;  4B11 A;  3FJU A;  4CAW A;  4ZX9 A;  2WYR A;  3TT2 A;  4Q36 A;  2OB0 A;  4C2X A;  1RTQ A;  2PR8 A;  3JUW A;  5AGE A;  5I0C A;  1ARL A;  4YU9 A;  4R57 A;  1LCP A;  5E96 A;  4MRI A;  5CNP A;  4PK2 A;  2B3U A;  1J4J A;  2RB7 A;  4WJB A;  1UWY A;  1UFH A;  3FH4 A;  4F6A A;  4GXH A;  4RI1 A;  4U9Y A;  4UCM A;  4EWT A;  1B87 A;  3LWU A;  5A27 A;  1LAM A;  1Z5R A;  1ELL P;  4C2Y A;  4A95 A;  4A2Z A;  3EC4 A;  3V8I A;  3KHX A;  3FXT A;  4NF1 A;  1XEB A;  3V38 A;  4PSX A;  2AFW A;  5LRK A;  3IIB A;  3S6H A;  3T9Y A;  3K2K A;  4H89 A;  3TTH A;  2ZOF A;  6CPA A;  2Z3L A;  3LAC A;  4MBU A;  4L89 A;  2B4D B;  1IB1 E;  1BO4 A;  1HEE A;  4KUA A;  2HV2 A;  2Q51 A;  2PJ8 A;  2I00 A;  3VH9 A;  4KOU A;  4A32 A;  4B6Z A;  2YNC A;  3KAS A;  3L2N A;  2R98 A;  4KSF A;  4P4B A;  2ZOG A;  1YSJ A;  2JBJ A;  2PC1 A;  3V7Z A;  4FWU A;  3CXP A;  5K8O A;  1ON0 A;  4C7H A;  1YK3 A;  1CG2 A;  4FD5 A;  3R9F A;  3H8F A;  4A38 A;  2KCW A;  1Z8T A;  5IX3 A;  1L0C A;  4PXB A;  4O23 A;  3IC1 A;  2R8V A;  4AG7 A;  4AB7 A;  5JM6 A;  3SXO A;  1XOV A;  1Z4E A;  4K3N A;  3BJ7 A;  1XE4 A;  1TXR A;  3LMS A;  2POK A;  4MY0 A;  1HDU A;  2DEA A;  4KVO E;  3R95 A;  2A4N A;  3VAT A;  4MY3 A;  4F9V A;  1YGH A;  3OWC A;  4UEE A;  2XEI A;  3PZJ A;  3WR7 A;  4BIN A;  3D4U A;  3G8W A;  3TX8 A;  4QUS A;  1CBX A;  1LFW A;  1YW4 A;  1A2Z A;  1M4L A;  4DNC A;  2BSW A;  1R3N A;  3BI1 A;  3HUV A;  5ELY A;  2B4B A;  3CDX A;  3W91 A;  3WC6 A;  2PJ0 A;  3D2M A;  4MHP A;  3B3T A;  4R87 A;  3F0A A;  4NGQ A;  4NGS A;  1JQG A;  1KWM A;  4WWV A;  2PJ4 A;  5HMN A;  4RUH A;  4MHD A;  3N5F A;  3IU1 A;  2ZEG A;  4P4J A;  2JDD A;  2Z3N A;  1S7F A;  1MJA A;  3MRU A;  4KLV A;  2DXQ A;  1X10 A;  3BI0 A;  2GLJ A;  2ZPA A;  3B3S A;  4MXU A;  4X3R A;  2ANP A;  2QEC A;  3IO1 A;  3A9L A;  3QB8 A;  2PVV A;  4NCZ A;  2DPT A;  4EME A;  2REE A;  4F8Z A;  4MFQ A;  2EUI A;  2CTC A;  4ONU A;  4BMH A;  3FEE A;  4CAX A;  3SI1 A;  1YLE A;  5F48 A;  1HDQ A;  4YGO A;  4E0A A;  5H86 A;  3IWE A;  4ZY2 A;  3PFE A;  3WT4 A;  5C88 A;  5I4M A;  2ZEF A;  1CX8 A;  2Y0M A;  3GLJ A;  2OZG A;  2C6P A;  4XPD B;  3SJX A;  3CPA A;  3FX6 A;  1IOI A;  2OZU A;  4B5O A;  1YME A;  4RN7 A;  3GKR A;  4KVM E;  2D4P A;  4MFP A;  2JEV A;  3S6G A;  3PP9 A;  3W6S A;  3PBE A;  1BLL E;  1V0C A;  1Q2D A;  1EE3 P;  4CGM A;  3FVL A;  5G21 A;  4HNW B;  4C68 A;  3G3S A;  1S7K A;  4UWI A;  2ZW5 A;  4B10 A;  5AG6 A;  5J8C A;  4AG9 A;  3FF3 A;  2RFH A;  3GB0 A;  4Y49 B;  2F7V A;  2VI7 A;  4CRY B;  2HB6 A;  3PGP A;  1M1D A;  5HVF A;  1MJB A;  2C6G A;  1XJO A;  3BXM A;  3D66 A;  3EO4 A;  2P6F A;  1Q2Y A;  4OC1 A;  1S5K A;  5EBV A;  3H5Z A;  1CP6 A;  4KUB A;  4R6T A;  4UFX A;  5G22 A;  4MJ8 A;  1NE9 A;  4MCQ A;  3F8K A;  1DTD A;  4A30 A;  4UIB A;  4LX9 A;  1S7N A;  3HLP A;  4IF5 A;  4KOX A;  3KGQ A;  2Q4V A;  4CYN A;  2AJ6 A;  3CPX A;  2C6C A;  3B8G A;  4A94 A;  1Y9W A;  5JGF A;  2AE6 A;  1WK4 A;  4JD6 A;  4RS2 A;  1F57 A;  2D4O A;  3I1U A;  4KSA A;  3B2Y A;  4OKO A;  3KQX A;  2QVP A;  4P10 A;  3RBU A;  2X7B A;  2FE7 A;  4KVX A;  3S9M A;  4CYO A;  2ZEE A;  2PIZ A;  4CYQ A;  2CXA A;  4PXE A;  2Q7S A;  4AVB A;  3PB7 X;  4P6Y A;  1GHE A;  5HVH A;  3PB6 X;  3LOD A;  4FUU A;  3T90 A;  1ZO0 A;  2DPS A;  2R7H A;  1RXT A;  4NGT A;  4A33 A;  4C7I A;  1IID A;  3DSB A;  2FIA A;  2GE3 A;  2Q4Y A;  2V8D A;  3KR5 A;  2FS5 A;  4UFV A;  4II9 A;  2K5T A;  2PR1 A;  1FNO A;  3P2F A;  1PUA A;  1N71 A;  5HVG A;  2VZY A;  2CNS A;  4DJL A;  2Q0Y A;  2G3T A;  3NE7 A;  4M6H A;  3RZA A;  1SQH A;  4OC4 A;  3QAH A;  3WC5 A;  4PK3 A;  1ELM P;  1S60 A;  4JXR A;  3ZZI A;  1LAP A;  1OZP A;  3PRT A;  2QML A;  3QNV A;  4KOS A;  4U5Y A;  4KOW A;  5EMI A;  1CPX A;  4YWY A;  5LYD A;  7CPA A;  1ZLH A;  3D67 A;  2J8M A;  4UEZ A;  4CGO A;  1Y0Y A;  4P4I A;  3IWW A;  1Z8W A;  4ZGY B;  1DE4 C;  2ZEH A;  3E0K A;  4F0Y A;  3B3W A;  2IQ6 A;  4R9M A;  4NGN A;  1M44 A;  2Z3O A;  3UY5 A;  4X5K A;  1CJW A;  2BO9 A;  4UCN A;  4UFW A;  2OR4 A;  1LRZ A;  4X2T A;  5F47 A;  2P6E A;  3B35 A;  5K8M A;  3FED A;  2IL4 A;  1XF8 A;  2C27 A;  4CAE A;  1ZG7 A;  3H8E A;  4P44 A;  2FSR A;  1FT7 A; 
#chains in the Genus database with same CATH homology
 4Z65 A;  2EK8 A;  3PFO A;  3NH4 A;  4OME A;  2XEG A;  4UIA A;  2QYV A;  4NGP A;  4PXD A;  3PEI A;  2O4H A;  2PJ6 A;  4FAI A;  1ZG9 A;  2GLF A;  3KQZ A;  2NYQ A;  3KZW A;  4AXV A;  5K8N A;  1H8L A;  3H8G A;  2XEF A;  3KI9 A;  2I3C A;  4OIW A;  2PCU A;  3B7I A;  2GRE A;  2PVW A;  1Z2L A;  5DS0 A;  3IFE A;  3FMC A;  1PYT B;  1QQ9 A;  5HXD A;  2CIJ A;  2PJ1 A;  4TNU A;  2ZEO A;  2AFZ A;  2XEJ A;  3B3V A;  4UEF A;  3S9L A;  1R43 A;  4OC3 A;  5CBM A;  4IK2 A;  3NH5 A;  1CP7 A;  4H2K A;  4R8F A;  1Y0R A;  1AMP A;  2G9D A;  2PJ9 A;  5LYL A;  4P45 A;  1VIX A;  3DLJ A;  4ZYQ A;  2F8H A;  3PB4 X;  1Z8L A;  1BAV A;  2J9A A;  1TF9 A;  3SJG A;  1AYE A;  2EK9 A;  4NJQ A;  1Q7L A;  2ZEL A;  2EWB A;  4W9Y A;  2PJ5 A;  3D68 A;  4JZ0 A;  4OC5 A;  1NSA A;  1XBU A;  2V8H A;  1XRY A;  2IMO A;  5LRJ A;  5LYI A;  5J1Q A;  2NSM A;  3NFZ A;  3WC7 A;  1YLO A;  3D7F A;  4EFD A;  1F2O A;  3K9T A;  2AFU A;  1LOK A;  1TKH A;  4MMO A;  2WZN A;  2FVG A;  1PCA A;  2ZEM A;  2ZED A;  4DYO A;  3FEC A;  1CPS A;  2OOT A;  2PRQ A;  3NH8 A;  4PPZ A;  5THW A;  4JYW A;  4G1P A;  4MHZ A;  1IGB A;  4KSI A;  4ZX8 A;  1XFO A;  2PJB A;  3KL9 A;  3SI0 A;  3PBB A;  2CF4 A;  3RAM A;  1IY7 A;  4UF4 A;  2ZEN A;  1TF8 A;  4GM5 A;  5JH9 A;  2PJ2 A;  1F2P A;  1TKJ A;  3SJE A;  3ISX A;  5IB9 A;  4A39 A;  4F9U A;  4ZY0 A;  4R76 A;  4PQA A;  4IHM A;  1GYT A;  4OP4 A;  4TWE A;  3T8W A;  3VAR A;  4ZI6 A;  1OBR A;  4ONW A;  3IJ3 A;  3KR4 A;  3KHZ A;  2JBK A;  1VGY A;  1Y7E A;  3DGV A;  2PJC A;  4NJR A;  2AFM A;  4CPA A;  5D8N A;  3GUX A;  5K8P A;  2CTB A;  2Q43 A;  2ZEP A;  4MHY A;  2IJZ A;  3WAB A;  2JEW A;  1BPN A;  2VL1 A;  4FBE A;  4ZY1 A;  3TC8 A;  2QJ8 A;  4NGM A;  5F09 A;  1ZLI A;  3MN8 A;  1BPM A;  1XMB A;  4P4E A;  2BCO A;  4X8I A;  8CPA A;  3D7D A;  4PXC A;  5CPA A;  3IEH A;  3ISZ A;  2PJA A;  4A37 A;  3JRU A;  5LRG A;  4P4F A;  3RBU A;  2PIY A;  3WC6 A;  4Q7A A;  4LQG A;  3BHX A;  4OC0 A;  2V8V A;  4NFR A;  1TKF A;  4OID A;  3D7G A;  2PJ3 A;  4NGR A;  2Q4Z A;  4MHN A;  4DUK A;  3NA6 A;  5D29 A;  4IAV A;  2V77 A;  4OC2 A;  1LAN A;  3S9N A;  3SI2 A;  2PJ7 A;  3PB8 X;  2ABZ A;  5LYF A;  2V8G A;  2HC9 A;  2C1C A;  1ZG8 A;  1ARM A;  4MCR A;  2PE3 A;  1YW6 A;  3PB9 X;  2AFS A;  4MCP A;  3D7H A;  4R7M A;  1VHE A;  3SJF A;  2BOA A;  1QMU A;  4P4D A;  2O53 A;  3B3C A;  2AFX A;  4MCS A;  2AFO A;  2GU2 A;  1VHO A;  3CT9 A;  3FJU A;  4ZX9 A;  2WYR A;  1RTQ A;  1ARL A;  4YU9 A;  1LCP A;  4MRI A;  2RB7 A;  4WJB A;  1UWY A;  3FH4 A;  4EWT A;  3LWU A;  1LAM A;  1Z5R A;  1ELL P;  3KHX A;  3V38 A;  2AFW A;  5LRK A;  3IIB A;  3K2K A;  2ZOF A;  6CPA A;  1HEE A;  2Q51 A;  2PJ8 A;  3VH9 A;  4B6Z A;  3KAS A;  3L2N A;  4P4B A;  2ZOG A;  1YSJ A;  2JBJ A;  3V7Z A;  5K8O A;  4FWU A;  1CG2 A;  3H8F A;  4A38 A;  4PXB A;  4O23 A;  3IC1 A;  5JM6 A;  4K3N A;  1TXR A;  3LMS A;  2POK A;  1HDU A;  2DEA A;  4F9V A;  3VAT A;  4UEE A;  2XEI A;  3D4U A;  3TX8 A;  1CBX A;  1LFW A;  1YW4 A;  1M4L A;  1R3N A;  3BI1 A;  3HUV A;  5ELY A;  3CDX A;  4BD9 A;  2PJ0 A;  4MHP A;  3B3T A;  4NGS A;  4NGQ A;  1JQG A;  1KWM A;  4WWV A;  2PJ4 A;  4RUH A;  3N5F A;  2ZEG A;  4P4J A;  3MRU A;  3BI0 A;  2GLJ A;  3B3S A;  4MXU A;  4X3R A;  2ANP A;  3IO1 A;  4EME A;  2PVV A;  4F8Z A;  2CTC A;  3FEE A;  3SI1 A;  1HDQ A;  4ZY2 A;  3WT4 A;  3PFE A;  5I4M A;  2ZEF A;  1CX8 A;  3GLJ A;  2C6P A;  3SJX A;  3CPA A;  3FX6 A;  1YME A;  3PBE A;  1BLL E;  1EE3 P;  3FVL A;  3FF3 A;  2RFH A;  3GB0 A;  2F7V A;  2HB6 A;  5HVF A;  2C6G A;  1XJO A;  3BXM A;  3D66 A;  4OC1 A;  1CP6 A;  4R6T A;  4MCQ A;  1DTD A;  4UIB A;  3HLP A;  3KGQ A;  3CPX A;  2C6C A;  4A94 A;  5JGF A;  1F57 A;  3I1U A;  4OKO A;  3B2Y A;  3KQX A;  2QVP A;  4P10 A;  3S9M A;  2ZEE A;  2PIZ A;  4PXE A;  3PB7 X;  4P6Y A;  5HVH A;  3PB6 X;  4FUU A;  4NGT A;  3KR5 A;  2V8D A;  1FNO A;  5HVG A;  4DJL A;  3RZA A;  3WC5 A;  4OC4 A;  1ELM P;  3QNV A;  1LAP A;  3PRT A;  4YWY A;  1CPX A;  5LYD A;  7CPA A;  1ZLH A;  3D67 A;  4UEZ A;  1Y0Y A;  4P4I A;  3IWW A;  1DE4 C;  2ZEH A;  3B3W A;  2IQ6 A;  4NGN A;  2BO9 A;  2OR4 A;  4X2T A;  3B35 A;  5K8M A;  3FED A;  1ZG7 A;  3H8E A;  4P44 A;  1FT7 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...