5H86A

Human gcn5 bound to butyryl-coa
Total Genus 44
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
44
sequence length
167
structure length
167
Chain Sequence
b'SGIIEFHVIGNSLTPKANRRVLLWLVGLQNVFSHQLPRMPKEYIARLVFDPKHKTLALIKDGRVIGGICFRMFPTQGFTEIVFCAVTSNEQVKGYGTHLMNHLKEYHIKHNILYFLTYADEYAIGYFKKQGFSKDIKVPKSRYLGYIKDYEGATLMECELNPRIPYT'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Histone acetyltransferase KAT2A
publication title Structural basis for acyl-group discrimination by human Gcn5L2.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
total genus 44
structure length 167
sequence length 167
ec nomenclature ec 2.3.1.48: Histone acetyltransferase.
pdb deposition date 2015-12-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00583 Acetyltransf_1 Acetyltransferase (GNAT) family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.630.30 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Aminopeptidase 5h86A00
1VKCA 2J8RA 2G3AA 2PSWA 2OZUA 3R96A 1Q2YA 2B58A 3PGPA 1KUXA 3R9FA 2BSWA 1J4JA 5IB0A 3S6FA 2Y0MA 3R9EA 1P4NA 1MJAA 1RXTA 4NXYA 2PR1A 2VXKA 3IGRA 1YVKA 3H4QA 4JXRA 1Y9KA 3TFYA 4UWIA 4ORFA 2JEVA 1CM0A 2I79A 4XPLA 4IUSA 1IYKA 2ATRA 4JLYA 5EC4A 4AVCA 1Q2CA 3P2HA 4CAXA 5J8FA 4E0AA 3G8WA 4LUAA 1BO4A 2Q04A 4UWJA 3CXQA 4U9ZA 1I21A 4HKFA 4KVOE 2J8NA 5F47A 4KOSA 2AJ6A 4QUSA 2GIVA 1NSLA 1Z4EA 5H86A 3B8GA 3SXOA 4PV6A 3K9UA 3GY9A 1U6MA 5GCNA 2VEZA 2CNTA 4XNHB 2BEIA 4KOWA 2ZW7A 3JUWA 2X7BA 4MI4A 3D8PA 2ZW5A 3VWEA 1WK4A 3ZJ0A 3E0KA 2JLMA 2B3UA 2EVNA 5C82A 1CJWA 4NF1A 5F49A 3TE4A 4CAVA 3EO4A 2HV2A 1P0HA 4KZTA 4NSQA 2Q4YA 3NE7A 4KOYA 4J3GA 4MBUA 4OAEA 4H6UA 1LRZA 3R9GA 3EXNA 1L0CA 1QSTA 3W91A 3ZZIA 5CNPA 1S7KA 3F0AA 1SQHA 1Q2DA 1Y9WA 2PC1A 3DR6A 1B87A 3IWGA 2BL1A 2B4DA 2FS5A 4I49A 4XPKA 4IF5A 1Y7RA 2FSRA 4FD6A 2A4NA 4L89A 1S7NA 4RS2A 1B6BA 4DNCA 2JDDA 2ZW4A 5DWNA 4AG9A 1GHEA 5FVJA 3BJ7A 2B5GA 3BJ8A 5F48A 2OU2A 3S6KA 2R1IA 2DXQA 1NMTA 3OWCA 3QB8A 4CRYB 2ZPAA 2Q4VA 4MHDA 3TOAA 3D2PA 2PQ8A 4R9MA 3DDDA 3D3SA 2BUEA 3TTHA 3VWDA 1KZFA 1M4GA 3F8KA 3JVNA 2KCWA 2REEA 4KOTA 2FIAA 4QVTA 3N7ZA 1BOBA 4FD5A 4OADA 4R87A 1R57A 2ZW6A 2PR8A 2I00A 1N71A 2QIRA 2VBQA 5I0CA 1YK3A 4MJ8A 4YRHA 3TOBA 2B4BA 2NMTA 4R3KA 4XNHC 4PK2A 2VI7A 3P2FA 4HNWB 4L8AA 1IYLA 3GYAA 1YVOA 4KUAA 1VHSA 2VZYA 4XPDB 2OZHA 4F6AA 2REFA 3FNCA 3EFAA 3KKWA 4E2AA 3BLNA 1XF8A 2D4PA 2QMLA 3SHPA 1IB1E 5HH1A 3PP9A 2PDOA 3EC4A 4JXQA 1YX0A 4QB9A 4JJXA 4PSWA 4EVYA 2QECA 1QSMA 2WPWA 1WWZA 4CRZB 3LD2A 2FXFA 1XEBA 3FIXA 3D2MA 3R1KA 1FY7A 2GANA 4YFJA 4AVAA 2B4DB 1UFHA 3DNSA 2FE7A 2Q7BA 1S60A 2CNMA 3R95A 2F5IA 4B5PA 5JQ4A 4R57A 4KVME 1K4JA 5J8CA 4PK3A 5ISVA 4NCZA 2C27A 4KVXA 3FYNA 1I12A 1KUYA 1S5KA 5HMNA 2Z0ZA 2VQYA 2GE3A 4HNXB 2AE6A 1S7FA 3TCVA 3WR7A 1RO5A 4UBRA 4ZBGA 3PZJA 3T9YA 4R3LA 4M85A 1KUVA 4RI1A 1OZPA 4FD4A 1M44A 1Z9UA 3CXPA 2OZGA 5IV0A 4Y49B 4II9A 4CAWA 4BMHA 4AG7A 2P6GA 4ONUA 3T90A 2FCKA 3LODA 1PU9A 2RC4A 1TIQA 3UY5A 3W6SA 4E8OA 2O28A 4QC6A 3W6XA 2OH1A 4H89A 1QSNA 3S6HA 4KOXA 2R8VA 2Z10A 4GS4A 3TO7A 4XPDC 4AB7A 2HUZA 1M4IA 2ARHA 1PUAA 4UA3A 3SXNA 4MY3A 4AVBA 4KORA 1YGHA 1MJ9A 3FRMA 2P6EA 1NE9A 2ZXVA 4JWPA 1IICA 2B3VA 4KOVA 1Z4RA 1ON0A 2G3TA 3MGDA 3TT2A 4U9YA 5JPHA 4B5OA 4CS0B 4NEXA 3FXTA 3GKRA 4MY0A 4HNYB 5KTDA 2OB0A 3QAHA 4PSXA 3G3SA 2CNSA 2P0WA 2J8MA 3FBUA 2H5MA 3CXSA 4K30A 3TO6A 4B5PB 5C88A 1QSRA 2Q44A 3RYOA 2G0BA 2IL4A 2FIWA 3EY5A 4QBJA 1YLEA 2HQYA 1XE4A 3TO9A 4OLLA 5H84A 1YREA 2JDCA 5KTAA 1S3ZA 2K5TA 4H6ZA 4X5KA 5F46A 3I3GA 1V0CA 5KTCA 1MK4A 5E96A 2R98A 2P6FA 1QSOA 4M3SA 4KLWA 3S6GA 1M1DA 4KUBA 2Q0YA 2PRBA 3V8IA 2FL4A 4FD7A 1S7LA 2B5GB 1YR0A 4LX9A 2D4OA 4Y49C 4YGOA 2R7HA 4F0YA 2FT0A 3DR8A 3DSBA 3FB3A 5IX3A 5DWMA 4KOUA 4JD6A 2WPXA 1XIXA 1IIDA 3I9SA 5EBVA 4U5YA 1MJBA 2VZZA 3C26A 3F5BA 1XMTA 1I1DA 4KLVA 2Z11A 2EUIA 2CY2A 1M4DA
chains in the Genus database with same CATH superfamily
2V8HA 3D68A 5G21A 1VKCA 4NGTA 4EWTA 4OC3A 2Z3KA 2J8RA 3KZWA 2G3AA 2Q7SA 2PSWA 5AGEA 5D29A 2OZUA 4NFRA 3R96A 1Q2YA 2B58A 3IFEA 3PGPA 1KUXA 4P4EA 5ELYA 3R9FA 3TX8A 4EFDA 2BSWA 1J4JA 1JQGA 4TWEA 4ZY0A 5IB0A 3GIUA 3S6FA 3SJGA 2Y0MA 4IAVA 2J9AA 1P4NA 4MFZA 3R9EA 1MJAA 4A94A 1RXTA 4CGLA 4NXYA 2YNCC 2PR1A 2VXKA 3CDXA 5K8OA 2Z3NA 3IGRA 1YVKA 2ZEHA 3H4QA 3FMCA 1Y9KA 3NH5A 4JXRA 4UWIA 4ORFA 5LYLA 3TFYA 3FF3A 4Q36A 2JEVA 3CPAA 1CM0A 4PXDA 2C6GA 2I79A 3KI9A 4XPLA 1VIXA 2DEAA 4IUSA 4JZ0A 4B13A 4JYWA 1IYKA 3NA6A 4NGSA 4CGOA 2ATRA 4JLYA 3BI1A 2Z3OA 5EC4A 4AVCA 1Q2CA 1Z8TA 2PJ7A 3P2HA 4CAXA 2ZELA 2CTCA 5F09A 5J8FA 4E0AA 1XFOA 3G8WA 4B6ZA 4LUAA 1IOFA 2Z3PA 4A37A 1BO4A 2Q04A 2VL1A 4UWJA 4CGPA 3CXQA 4U9ZA 1I21A 3B3TA 2FVGA 1IGBA 2C6CA 4HKFA 4OC0A 2V8VA 5G22A 1TKFA 4KVOE 2AFSA 4CAFA 1LANA 2J8NA 5F47A 4MFKA 1YLOA 2IJZA 2AFMA 2AJ6A 4KOSA 1YW6A 2AFOA 2GIVA 4QUSA 1NSLA 3RAMA 1Z4EA 3PBEA 5H86A 5CPAA 3B8GA 4M6GA 2JBJA 1AYEA 4OIDA 4LQ6A 3WC5A 1Y0RA 3SXOA 4PV6A 4YU9A 3K9UA 3B35A 3GY9A 4HPSA 4R8FA 1U6MA 4R6TA 3LWUA 2PVVA 2PJ2A 3N5FA 4KS9A 4MCPA 5GCNA 1CG2A 2VEZA 2CNTA 4XNHB 2BEIA 2GREA 4B10A 4Q7AA 4KOWA 4NGRA 4UEZA 4AXVA 1IY7A 4X3RA 2AFWA 2ZW7A 3JUWA 1IOIA 2AFUA 2GU2A 2OR4A 1Z8WA 4OIWA 2X7BA 1FT7A 3ISZA 4MI4A 3RBUA 3D8PA 4DYOA 4EMEA 1ZO0A 2ZW5A 3VWEA 1WK4A 3KHXA 3IC1A 2AFXA 2PIYA 3PB7X 4IK2A 4OC1A 3ZJ0A 3E0KA 2JLMA 4MHYA 4FUUA 3IIBA 2B3UA 2EVNA 2YNEA 5C82A 3PRTA 1TKHA 1CJWA 2CF4A 4NF1A 4A2ZA 5F49A 5LRKA 3TE4A 4CAVA 3EO4A 1XRYA 1KWMA 2HV2A 1P0HA 1Y7EA 4KZTA 4NSQA 2POKA 3V7ZA 4UFXA 2O4HA 2Q4YA 3NE7A 4KOYA 1XBUA 4J3GA 3B3VA 4MBUA 2EO8A 4OAEA 4H6UA 1LRZA 3R9GA 3D7GA 3NFZA 3EXNA 1L0CA 4P4BA 1BPNA 5HVHA 1QSTA 3W91A 3ZZIA 5CNPA 1S7KA 3F0AA 1M4LA 1SQHA 2Q51A 1YW4A 2ZEEA 1Q2DA 1Y9WA 2V77A 4ZX8A 2XEJA 2PC1A 3KR4A 3DR6A 1B87A 1HDQA 3IWGA 2BL1A 1DTDA 4K3NA 1ZG7A 5JGFA 1YSJA 2B4DA 4CYNA 4NGNA 4FAIA 2FS5A 4I49A 4XPKA 3KHZA 4RUHA 4IF5A 4B12A 1OBRA 4DUKA 2AFZA 4MFLA 4PXCA 1Y7RA 2FSRA 4FD6A 2A4NA 1ZLIA 2YNDA 4OKOA 2OOTA 4L89A 2DPTA 1Z2LA 1S7NA 2HB6A 3IU1A 2RB7A 4RS2A 5LYDA 1B6BA 1HDUA 3NH4A 4UCNA 4DNCA 2JDDA 2ZW4A 5DWNA 4AG9A 1GHEA 3SI1A 4B11A 3DGVA 5FVJA 3FEEA 3KGQA 3BJ7A 3DLJA 3GB0A 2B5GA 3BJ8A 5K8NA 5F48A 2ANPA 2OU2A 1CP7A 2V8DA 3S6KA 2R1IA 7CPAA 2DXQA 1NMTA 3OWCA 3QB8A 5CBMA 3BI0A 3MN8A 4CRYB 1A2ZA 3WABA 3D67A 4MCSA 4CGNA 2ZPAA 2PJ9A 2Q4VA 4MHDA 4Z65A 1Z8XA 3TOAA 1CPSA 3D2PA 2PQ8A 4P6YA 1F2PA 3CZXA 4R9MA 3DDDA 3GLJA 3D3SA 2BUEA 3TTHA 1GYTA 3B3CA 3VWDA 1KZFA 1M4GA 3F8KA 3JVNA 3PFEA 4MXUA 4O23A 8CPAA 2KCWA 4OC2A 5LYIA 1VHEA 4CYQA 5JH9A 2REEA 2NYQA 4KOTA 5LYFA 4P44A 5K8PA 2FIAA 4QVTA 3N7ZA 1BOBA 2ZOGA 1ELMP 2Q4ZA 4P45A 4W9YA 2ZEGA 4FD5A 4OADA 5EMIA 4R87A 1R57A 2ZW6A 2PR8A 2I00A 1N71A 2QIRA 4MCRA 2VBQA 5I0CA 1YK3A 4MJ8A 3IWEA 4DJLA 2ZEOA 4YRHA 3TOBA 4C2ZA 2B4BA 2NMTA 4R3KA 4XNHC 4PK2A 3IWWA 5THWA 3H8EA 3B3SA 2VI7A 3P2FA 1LOKA 4HNWB 2WUUA 5K8MA 4L8AA 2PJ8A 1IYLA 2BO9A 3LMSA 4PPZA 3GYAA 1YVOA 4KUAA 1VGYA 1VHSA 2VZYA 4OC4A 3L2NA 1ARMA 4BBHA 4XPDB 4LQGA 2OZHA 3WC7A 5D8NA 4F6AA 4KSAA 4ZY1A 2REFA 3FNCA 3EFAA 3KKWA 4A32A 4E2AA 2JEWA 3BLNA 1XF8A 2NSMA 3PB4X 5I4MA 5HXDA 1AUGA 3V38A 2D4PA 2QMLA 3SHPA 2Z3LA 3VATA 2CIJA 1IB1E 4KSIA 2CXAA 5HH1A 2ZEPA 3PP9A 2PJ3A 2PDOA 1TXRA 2YNCA 3EC4A 4JXQA 3PBBA 5DS0A 1YX0A 4A95A 4QB9A 4JJXA 3IO1A 4P4FA 4PSWA 2QECA 4UCPA 4EVYA 1NSAA 1QSMA 5G1ZA 2BCOA 4A38A 1Q7LA 1Z8LA 3FH4A 5IB9A 2WPWA 1AMPA 2PJCA 2ZEMA 3RZAA 1WWZA 4CRZB 1LFWA 3LD2A 2PJ6A 4ZX9A 2FXFA 1XEBA 1ARLA 3BHXA 4NGPA 4CYPA 3FIXA 1F57A 3D2MA 3R1KA 1FY7A 2ZEDA 2GANA 4KSFA 3PB9X 4PXEA 3PB8X 3IU2A 4YFJA 3SJXA 4AVAA 3D66A 2B4DB 1UFHA 3DNSA 2FE7A 4GXHA 2Q7BA 1S60A 3CT9A 2CNMA 3D4UA 3R95A 1CPXA 4UF4A 1BPMA 4R7MA 2F5IA 4B5PA 3JTKA 2PJ0A 5JQ4A 1R3NA 1ZG9A 4R57A 4KVME 2PJ1A 1K4JA 2QJ8A 4FBEA 1DE4C 5J8CA 4YWYA 4UEEA 2DPSA 1XMBA 2PVWA 4PK3A 5ISVA 1XJOA 4NCZA 3FECA 2C27A 4KVXA 3VARA 2IMOA 3FYNA 1I12A 4MHZA 1KUYA 3IJ3A 3QAYA 4NJQA 1S5KA 3FJUA 4UFVA 1PCAA 5HMNA 2F7VA 2G9DA 2Z0ZA 2VQYA 5AG6A 3FEDA 2GE3A 4ONWA 4HNXB 2AE6A 1S7FA 3TCVA 3WR7A 6CPAA 1RO5A 4UBRA 2QYVA 3H8FA 4UCMA 4ZBGA 1CP6A 3PZJA 3T9YA 4R3LA 2RFHA 4ZYQA 2F8HA 3SI2A 4M85A 3I1UA 1KUVA 4RI1A 1OZPA 4FD4A 4UFWA 4C7IA 1RTQA 1M44A 1TF9A 4IHMA 1Z9UA 3CXPA 3SI0A 3D7HA 2OZGA 3JRUA 5AG4A 4Y49B 5IV0A 4II9A 3S9MA 1JWQA 4CAWA 1CX8A 4GM5A 5BWAB 3NE8A 3H5ZA 4BMHA 4AG7A 2ZEFA 4CAEA 3D7FA 2ODFA 2P6GA 4ONUA 4A33A 1X10A 4Q38A 3T90A 2FCKA 2PCUA 1LAMA 2JBKA 3LODA 3TC8A 5JM6A 1PU9A 2RC4A 1TIQA 4P4JA 3UY5A 3W6SA 4E8OA 2O28A 4F8ZA 1Z5RA 4QC6A 3W6XA 2OH1A 4H89A 2DF5A 2PJ4A 2HC9A 3A9LA 4P4DA 4MRIA 1BLLE 1QSNA 3FX6A 3S6HA 4KOXA 2R8VA 4P10A 5A27A 2Z10A 4GS4A 2PJBA 4XPDC 2C6PA 3TO7A 4AB7A 1Y0YA 3D7DA 4M6HA 5HVGA 2HUZA 2CTBA 1ZG8A 3RNZA 1M4IA 1PYTB 3SJFA 2GFQA 2ARHA 3WC6A 4ZGYB 2Z3MA 1PUAA 4MMOA 4UA3A 3RO0A 1LCPA 4MFPA 3SXNA 4F0XA 4MY3A 2PJAA 4AVBA 4CYOA 4X8IA 4CPAA 1YGHA 4KORA 1MJ9A 2EBJA 3BXMA 4X2TA 5LRJA 1ELLP 3FRMA 2P6EA 3PB6X 2ABZA 4TNUA 2EWBA 4G1PA 1NE9A 2ZXVA 4B14A 4JWPA 3PFOA 4F9VA 1IICA 2B3VA 3K2KA 4KOVA 2WYRA 2XEGA 1Z4RA 5G20A 1ON0A 2G3TA 3MGDA 4OC5A 1QMUA 3KASA 3TT2A 4WJBA 4U9YA 5JPHA 4B5OA 2ZENA 4MCQA 4NEXA 4CS0B 2PIZA 3FXTA 4MFJA 3GKRA 4MY0A 5A28A 4FWUA 3HUVA 4HNYB 5KTDA 2OB0A 3QAHA 4PQAA 4UIBA 5HVFA 2Q43A 3FVLA 3KR5A 3KL9A 3QNVA 4PSXA 2PRQA 3G3SA 3MRUA 4ZI6A 2CNSA 2EK8A 2P0WA 2J8MA 3WT4A 3FBUA 3SJEA 2H5MA 4WWVA 3CXSA 2ZOFA 4K30A 3TO6A 4B5PB 5C88A 1QSRA 3S9NA 1XOVA 2Q44A 2GLFA 5AG5A 2G0BA 2IL4A 4MHPA 2FIWA 3EY5A 3RYOA 4QBJA 1YLEA 2PE3A 2HQYA 2XEFA 2IQ6A 1XE4A 2V8GA 1EE3P 1TF8A 3TO9A 4C68A 3S9LA 4OLLA 5H84A 4F9UA 1UWYA 1YREA 5AG7A 4NGQA 1H8LA 4ZY2A 4NGMA 2JDCA 4A31A 5J1QA 5KTAA 1S3ZA 2K5TA 4H6ZA 3H8GA 2WZNA 4X5KA 5F46A 3I3GA 1V0CA 1CBXA 1F2OA 4PXBA 5KTCA 4MFQA 1MK4A 1QQ9A 4NJRA 1HEEA 5E96A 2R98A 3KQXA 4MHNA 2P6FA 1FNOA 1QSOA 1ZLHA 4M3SA 4KLWA 4P4IA 2EK9A 3S6GA 1M1DA 4KUBA 2Q0YA 2PRBA 1X12A 4OMEA 3V8IA 1IU8A 2FL4A 4FD7A 5LRGA 4C2YA 2WSAA 1S7LA 2B5GB 1YR0A 1LAPA 1VHOA 2QVPA 4LX9A 2D4OA 4RN7A 4Y49C 3GUXA 4YGOA 2R7HA 2XEIA 3B7IA 4F0YA 2FT0A 1BAVA 3PEIA 3VH9A 2C1CA 2PJ5A 3DR8A 3KQZA 3CPXA 3DSBA 3FB3A 4M6IA 2BOAA 3T8WA 5IX3A 2YGWA 5DWMA 1YQEA 4H2KA 4A30A 3B3WA 4KOUA 4C7HA 4JD6A 4BD9A 5EBVA 2GLJA 2WPXA 1XIXA 1IIDA 4CGMA 4OP4A 2O53A 3K9TA 3I9SA 3LACA 2I3CA 1MJBA 3HLPA 1R43A 3NH8A 4U5YA 2VZZA 3C26A 3F5BA 1XMTA 3ISXA 1I1DA 3IEHA 4KLVA 4R76A 2Z11A 1TKJA 4UEFA 3B2YA 4UIAA 4A39A 4C2XA 2EUIA 2CY2A 4BINA 1M4DA 1YMEA
chains in the Genus database with same CATH topology
5G21A 1VKCA 2Z3KA 2J8RA 2G3AA 5AGEA 2PSWA 2OZUA 3R96A 1Q2YA 2B58A 3PGPA 1KUXA 3R9FA 2BSWA 1J4JA 5IB0A 3S6FA 2Y0MA 4MFZA 3R9EA 1P4NA 1MJAA 1RXTA 4CGLA 4NXYA 2YNCC 2PR1A 2VXKA 2Z3NA 3IGRA 1YVKA 3H4QA 4JXRA 1Y9KA 3TFYA 4UWIA 4ORFA 4Q36A 2JEVA 1CM0A 2I79A 4XPLA 4IUSA 4B13A 1IYKA 4CGOA 2ATRA 4JLYA 5EC4A 2Z3OA 4AVCA 1Q2CA 3P2HA 4CAXA 5J8FA 4E0AA 3G8WA 4LUAA 2Z3PA 1BO4A 2Q04A 4UWJA 4CGPA 3CXQA 4U9ZA 1I21A 4HKFA 5G22A 4KVOE 4CAFA 2J8NA 5F47A 4MFKA 4KOSA 2AJ6A 4QUSA 2GIVA 1NSLA 1Z4EA 5H86A 3B8GA 3SXOA 4PV6A 3K9UA 3GY9A 1U6MA 4KS9A 5GCNA 2VEZA 2CNTA 4XNHB 2BEIA 4B10A 4KOWA 2ZW7A 3JUWA 2X7BA 4MI4A 3D8PA 1ZO0A 2ZW5A 3VWEA 1WK4A 3ZJ0A 3E0KA 2JLMA 2B3UA 2EVNA 2YNEA 5C82A 1CJWA 4NF1A 4A2ZA 5F49A 3TE4A 4CAVA 3EO4A 2HV2A 1P0HA 4KZTA 4NSQA 4UFXA 2Q4YA 3NE7A 4KOYA 4J3GA 4MBUA 4OAEA 4H6UA 1LRZA 3R9GA 3EXNA 1L0CA 1QSTA 3W91A 3ZZIA 5CNPA 1S7KA 3F0AA 1SQHA 1Q2DA 1Y9WA 2PC1A 3DR6A 1B87A 3IWGA 2BL1A 2B4DA 4CYNA 2FS5A 4I49A 4XPKA 4IF5A 4B12A 4MFLA 1Y7RA 2FSRA 4FD6A 2A4NA 2YNDA 4L89A 2DPTA 1S7NA 3IU1A 4RS2A 1B6BA 4UCNA 4DNCA 2JDDA 2ZW4A 5DWNA 4AG9A 1GHEA 4B11A 5FVJA 3BJ7A 2B5GA 3BJ8A 5F48A 2OU2A 3S6KA 2R1IA 2DXQA 1NMTA 3OWCA 3QB8A 4CRYB 4CGNA 2ZPAA 2Q4VA 4MHDA 3TOAA 3D2PA 2PQ8A 4R9MA 3DDDA 3D3SA 2BUEA 3TTHA 3VWDA 1KZFA 1M4GA 3F8KA 3JVNA 2KCWA 4CYQA 2REEA 4KOTA 2FIAA 4QVTA 3N7ZA 1BOBA 4FD5A 4OADA 4R87A 1R57A 2ZW6A 2PR8A 2I00A 1N71A 2QIRA 2VBQA 5I0CA 1YK3A 4MJ8A 3IWEA 4YRHA 3TOBA 4C2ZA 2B4BA 2NMTA 4R3KA 4XNHC 4PK2A 2VI7A 3P2FA 4HNWB 2WUUA 4L8AA 1IYLA 3GYAA 1YVOA 4KUAA 1VHSA 2VZYA 4BBHA 4XPDB 2OZHA 4F6AA 4KSAA 2REFA 3FNCA 3EFAA 3KKWA 4A32A 4E2AA 3BLNA 1XF8A 2D4PA 2QMLA 3SHPA 2Z3LA 1IB1E 2CXAA 5HH1A 3PP9A 2PDOA 3EC4A 2YNCA 4JXQA 4A95A 1YX0A 4QB9A 4JJXA 4PSWA 4EVYA 2QECA 4UCPA 1QSMA 5G1ZA 2WPWA 1WWZA 4CRZB 3LD2A 2FXFA 1XEBA 4CYPA 3FIXA 3D2MA 3R1KA 1FY7A 2GANA 4KSFA 4YFJA 3IU2A 4AVAA 2B4DB 1UFHA 3DNSA 2FE7A 2Q7BA 1S60A 2CNMA 3R95A 2F5IA 4B5PA 3JTKA 5JQ4A 4R57A 4KVME 1K4JA 5J8CA 2DPSA 4PK3A 5ISVA 4NCZA 2C27A 4KVXA 3FYNA 1I12A 1KUYA 1S5KA 4UFVA 5HMNA 2Z0ZA 2VQYA 5AG6A 2GE3A 4HNXB 2AE6A 1S7FA 3TCVA 3WR7A 1RO5A 4UBRA 4UCMA 4ZBGA 3PZJA 3T9YA 4R3LA 4M85A 1KUVA 4RI1A 1OZPA 4FD4A 4UFWA 4C7IA 1M44A 1Z9UA 3CXPA 2OZGA 5AG4A 5IV0A 4Y49B 4II9A 4CAWA 5BWAB 3H5ZA 4BMHA 4AG7A 4CAEA 2P6GA 4ONUA 4A33A 4Q38A 3T90A 2FCKA 3LODA 1PU9A 2RC4A 1TIQA 3UY5A 3W6SA 4E8OA 2O28A 4QC6A 3W6XA 2OH1A 4H89A 3A9LA 1QSNA 3S6HA 4KOXA 2R8VA 5A27A 2Z10A 4GS4A 3TO7A 4XPDC 4AB7A 2HUZA 1M4IA 2ARHA 4ZGYB 2Z3MA 1PUAA 4UA3A 4MFPA 3SXNA 4F0XA 4MY3A 4CYOA 4AVBA 1YGHA 4KORA 1MJ9A 3FRMA 2P6EA 1NE9A 2ZXVA 4B14A 4JWPA 1IICA 2B3VA 4KOVA 5G20A 1Z4RA 1ON0A 2G3TA 3MGDA 3TT2A 4U9YA 5JPHA 4B5OA 4CS0B 4NEXA 3FXTA 4MFJA 3GKRA 4MY0A 5A28A 4HNYB 5KTDA 2OB0A 3QAHA 4PSXA 3G3SA 2CNSA 2P0WA 2J8MA 3FBUA 2H5MA 3CXSA 4K30A 3TO6A 4B5PB 5C88A 1QSRA 2Q44A 3RYOA 5AG5A 2G0BA 2IL4A 2FIWA 3EY5A 4QBJA 1YLEA 2HQYA 1XE4A 3TO9A 4C68A 4OLLA 5H84A 1YREA 5AG7A 2JDCA 4A31A 5KTAA 1S3ZA 2K5TA 4H6ZA 4X5KA 5F46A 3I3GA 1V0CA 5KTCA 4MFQA 1MK4A 5E96A 2R98A 2P6FA 1QSOA 4M3SA 4KLWA 3S6GA 1M1DA 4KUBA 2Q0YA 2PRBA 3V8IA 2FL4A 4FD7A 4C2YA 2WSAA 1S7LA 2B5GB 1YR0A 4LX9A 2D4OA 4Y49C 4YGOA 2R7HA 4F0YA 2FT0A 3DR8A 3DSBA 3FB3A 5IX3A 2YGWA 5DWMA 4A30A 4KOUA 4C7HA 4JD6A 2WPXA 1XIXA 1IIDA 4CGMA 3I9SA 5EBVA 4U5YA 1MJBA 2VZZA 3C26A 3F5BA 1XMTA 1I1DA 4KLVA 2Z11A 4C2XA 2EUIA 2CY2A 1M4DA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1VKC A;  2J8R A;  2G3A A;  2PSW A;  2OZU A;  3R96 A;  1Q2Y A;  2B58 A;  3PGP A;  1KUX A;  3R9F A;  2BSW A;  1J4J A;  5IB0 A;  3S6F A;  2Y0M A;  3R9E A;  1P4N A;  1MJA A;  1RXT A;  4NXY A;  2PR1 A;  2VXK A;  3IGR A;  1YVK A;  3H4Q A;  4JXR A;  1Y9K A;  3TFY A;  4UWI A;  4ORF A;  2JEV A;  1CM0 A;  2I79 A;  4XPL A;  4IUS A;  1IYK A;  2ATR A;  4JLY A;  5EC4 A;  4AVC A;  1Q2C A;  3P2H A;  4CAX A;  5J8F A;  4E0A A;  3G8W A;  4LUA A;  1BO4 A;  2Q04 A;  4UWJ A;  3CXQ A;  4U9Z A;  1I21 A;  4HKF A;  4KVO E;  2J8N A;  5F47 A;  4KOS A;  2AJ6 A;  4QUS A;  2GIV A;  1NSL A;  1Z4E A;  5H86 A;  3B8G A;  3SXO A;  4PV6 A;  3K9U A;  3GY9 A;  1U6M A;  5GCN A;  2VEZ A;  2CNT A;  4XNH B;  2BEI A;  4KOW A;  2ZW7 A;  3JUW A;  2X7B A;  4MI4 A;  3D8P A;  2ZW5 A;  3VWE A;  1WK4 A;  3ZJ0 A;  3E0K A;  2JLM A;  2B3U A;  2EVN A;  5C82 A;  1CJW A;  4NF1 A;  5F49 A;  3TE4 A;  4CAV A;  3EO4 A;  2HV2 A;  1P0H A;  4KZT A;  4NSQ A;  2Q4Y A;  3NE7 A;  4KOY A;  4J3G A;  4MBU A;  4OAE A;  4H6U A;  1LRZ A;  3R9G A;  3EXN A;  1L0C A;  1QST A;  3W91 A;  3ZZI A;  5CNP A;  1S7K A;  3F0A A;  1SQH A;  1Q2D A;  1Y9W A;  2PC1 A;  3DR6 A;  1B87 A;  3IWG A;  2BL1 A;  2B4D A;  2FS5 A;  4I49 A;  4XPK A;  4IF5 A;  1Y7R A;  2FSR A;  4FD6 A;  2A4N A;  4L89 A;  1S7N A;  4RS2 A;  1B6B A;  4DNC A;  2JDD A;  2ZW4 A;  5DWN A;  4AG9 A;  1GHE A;  5FVJ A;  3BJ7 A;  2B5G A;  3BJ8 A;  5F48 A;  2OU2 A;  3S6K A;  2R1I A;  2DXQ A;  1NMT A;  3OWC A;  3QB8 A;  4CRY B;  2ZPA A;  2Q4V A;  4MHD A;  3TOA A;  3D2P A;  2PQ8 A;  4R9M A;  3DDD A;  3D3S A;  2BUE A;  3TTH A;  3VWD A;  1KZF A;  1M4G A;  3F8K A;  3JVN A;  2KCW A;  2REE A;  4KOT A;  2FIA A;  4QVT A;  3N7Z A;  1BOB A;  4FD5 A;  4OAD A;  4R87 A;  1R57 A;  2ZW6 A;  2PR8 A;  2I00 A;  1N71 A;  2QIR A;  2VBQ A;  5I0C A;  1YK3 A;  4MJ8 A;  4YRH A;  3TOB A;  2B4B A;  2NMT A;  4R3K A;  4XNH C;  4PK2 A;  2VI7 A;  3P2F A;  4HNW B;  4L8A A;  1IYL A;  3GYA A;  1YVO A;  4KUA A;  1VHS A;  2VZY A;  4XPD B;  2OZH A;  4F6A A;  2REF A;  3FNC A;  3EFA A;  3KKW A;  4E2A A;  3BLN A;  1XF8 A;  2D4P A;  2QML A;  3SHP A;  1IB1 E;  5HH1 A;  3PP9 A;  2PDO A;  3EC4 A;  4JXQ A;  1YX0 A;  4QB9 A;  4JJX A;  4PSW A;  4EVY A;  2QEC A;  1QSM A;  2WPW A;  1WWZ A;  4CRZ B;  3LD2 A;  2FXF A;  1XEB A;  3FIX A;  3D2M A;  3R1K A;  1FY7 A;  2GAN A;  4YFJ A;  4AVA A;  2B4D B;  1UFH A;  3DNS A;  2FE7 A;  2Q7B A;  1S60 A;  2CNM A;  3R95 A;  2F5I A;  4B5P A;  5JQ4 A;  4R57 A;  4KVM E;  1K4J A;  5J8C A;  4PK3 A;  5ISV A;  4NCZ A;  2C27 A;  4KVX A;  3FYN A;  1I12 A;  1KUY A;  1S5K A;  5HMN A;  2Z0Z A;  2VQY A;  2GE3 A;  4HNX B;  2AE6 A;  1S7F A;  3TCV A;  3WR7 A;  1RO5 A;  4UBR A;  4ZBG A;  3PZJ A;  3T9Y A;  4R3L A;  4M85 A;  1KUV A;  4RI1 A;  1OZP A;  4FD4 A;  1M44 A;  1Z9U A;  3CXP A;  2OZG A;  5IV0 A;  4Y49 B;  4II9 A;  4CAW A;  4BMH A;  4AG7 A;  2P6G A;  4ONU A;  3T90 A;  2FCK A;  3LOD A;  1PU9 A;  2RC4 A;  1TIQ A;  3UY5 A;  3W6S A;  4E8O A;  2O28 A;  4QC6 A;  3W6X A;  2OH1 A;  4H89 A;  1QSN A;  3S6H A;  4KOX A;  2R8V A;  2Z10 A;  4GS4 A;  3TO7 A;  4XPD C;  4AB7 A;  2HUZ A;  1M4I A;  2ARH A;  1PUA A;  4UA3 A;  3SXN A;  4MY3 A;  4AVB A;  4KOR A;  1YGH A;  1MJ9 A;  3FRM A;  2P6E A;  1NE9 A;  2ZXV A;  4JWP A;  1IIC A;  2B3V A;  4KOV A;  1Z4R A;  1ON0 A;  2G3T A;  3MGD A;  3TT2 A;  4U9Y A;  5JPH A;  4B5O A;  4CS0 B;  4NEX A;  3FXT A;  3GKR A;  4MY0 A;  4HNY B;  5KTD A;  2OB0 A;  3QAH A;  4PSX A;  3G3S A;  2CNS A;  2P0W A;  2J8M A;  3FBU A;  2H5M A;  3CXS A;  4K30 A;  3TO6 A;  4B5P B;  5C88 A;  1QSR A;  2Q44 A;  3RYO A;  2G0B A;  2IL4 A;  2FIW A;  3EY5 A;  4QBJ A;  1YLE A;  2HQY A;  1XE4 A;  3TO9 A;  4OLL A;  5H84 A;  1YRE A;  2JDC A;  5KTA A;  1S3Z A;  2K5T A;  4H6Z A;  4X5K A;  5F46 A;  3I3G A;  1V0C A;  5KTC A;  1MK4 A;  5E96 A;  2R98 A;  2P6F A;  1QSO A;  4M3S A;  4KLW A;  3S6G A;  1M1D A;  4KUB A;  2Q0Y A;  2PRB A;  3V8I A;  2FL4 A;  4FD7 A;  1S7L A;  2B5G B;  1YR0 A;  4LX9 A;  2D4O A;  4Y49 C;  4YGO A;  2R7H A;  4F0Y A;  2FT0 A;  3DR8 A;  3DSB A;  3FB3 A;  5IX3 A;  5DWM A;  4KOU A;  4JD6 A;  2WPX A;  1XIX A;  1IID A;  3I9S A;  5EBV A;  4U5Y A;  1MJB A;  2VZZ A;  3C26 A;  3F5B A;  1XMT A;  1I1D A;  4KLV A;  2Z11 A;  2EUI A;  2CY2 A;  1M4D A; 
#chains in the Genus database with same CATH topology
 2V8H A;  3D68 A;  5G21 A;  1VKC A;  4NGT A;  4EWT A;  4OC3 A;  2Z3K A;  2J8R A;  3KZW A;  2G3A A;  2Q7S A;  2PSW A;  5AGE A;  5D29 A;  2OZU A;  4NFR A;  3R96 A;  1Q2Y A;  2B58 A;  3IFE A;  3PGP A;  1KUX A;  4P4E A;  5ELY A;  3R9F A;  3TX8 A;  4EFD A;  2BSW A;  1J4J A;  1JQG A;  4TWE A;  4ZY0 A;  5IB0 A;  3GIU A;  3S6F A;  3SJG A;  2Y0M A;  4IAV A;  2J9A A;  1P4N A;  4MFZ A;  3R9E A;  1MJA A;  4A94 A;  1RXT A;  4CGL A;  4NXY A;  2YNC C;  2PR1 A;  2VXK A;  3CDX A;  5K8O A;  2Z3N A;  3IGR A;  1YVK A;  2ZEH A;  3H4Q A;  3FMC A;  1Y9K A;  3NH5 A;  4JXR A;  4UWI A;  4ORF A;  5LYL A;  3TFY A;  3FF3 A;  4Q36 A;  2JEV A;  3CPA A;  1CM0 A;  4PXD A;  2C6G A;  2I79 A;  3KI9 A;  4XPL A;  1VIX A;  2DEA A;  4IUS A;  4JZ0 A;  4B13 A;  4JYW A;  1IYK A;  3NA6 A;  4NGS A;  4CGO A;  2ATR A;  4JLY A;  3BI1 A;  2Z3O A;  5EC4 A;  4AVC A;  1Q2C A;  1Z8T A;  2PJ7 A;  3P2H A;  4CAX A;  2ZEL A;  2CTC A;  5F09 A;  5J8F A;  4E0A A;  1XFO A;  3G8W A;  4B6Z A;  4LUA A;  1IOF A;  2Z3P A;  4A37 A;  1BO4 A;  2Q04 A;  2VL1 A;  4UWJ A;  4CGP A;  3CXQ A;  4U9Z A;  1I21 A;  3B3T A;  2FVG A;  1IGB A;  2C6C A;  4HKF A;  4OC0 A;  2V8V A;  5G22 A;  1TKF A;  4KVO E;  2AFS A;  4CAF A;  1LAN A;  2J8N A;  5F47 A;  4MFK A;  1YLO A;  2IJZ A;  2AFM A;  2AJ6 A;  4KOS A;  1YW6 A;  2AFO A;  2GIV A;  4QUS A;  1NSL A;  3RAM A;  1Z4E A;  3PBE A;  5H86 A;  5CPA A;  3B8G A;  4M6G A;  2JBJ A;  1AYE A;  4OID A;  4LQ6 A;  3WC5 A;  1Y0R A;  3SXO A;  4PV6 A;  4YU9 A;  3K9U A;  3B35 A;  3GY9 A;  4HPS A;  4R8F A;  1U6M A;  4R6T A;  3LWU A;  2PVV A;  2PJ2 A;  3N5F A;  4KS9 A;  4MCP A;  5GCN A;  1CG2 A;  2VEZ A;  2CNT A;  4XNH B;  2BEI A;  2GRE A;  4B10 A;  4Q7A A;  4KOW A;  4NGR A;  4UEZ A;  4AXV A;  1IY7 A;  4X3R A;  2AFW A;  2ZW7 A;  3JUW A;  1IOI A;  2AFU A;  2GU2 A;  2OR4 A;  1Z8W A;  4OIW A;  2X7B A;  1FT7 A;  3ISZ A;  4MI4 A;  3RBU A;  3D8P A;  4DYO A;  4EME A;  1ZO0 A;  2ZW5 A;  3VWE A;  1WK4 A;  3KHX A;  3IC1 A;  2AFX A;  2PIY A;  3PB7 X;  4IK2 A;  4OC1 A;  3ZJ0 A;  3E0K A;  2JLM A;  4MHY A;  4FUU A;  3IIB A;  2B3U A;  2EVN A;  2YNE A;  5C82 A;  3PRT A;  1TKH A;  1CJW A;  2CF4 A;  4NF1 A;  4A2Z A;  5F49 A;  5LRK A;  3TE4 A;  4CAV A;  3EO4 A;  1XRY A;  1KWM A;  2HV2 A;  1P0H A;  1Y7E A;  4KZT A;  4NSQ A;  2POK A;  3V7Z A;  4UFX A;  2O4H A;  2Q4Y A;  3NE7 A;  4KOY A;  1XBU A;  4J3G A;  3B3V A;  4MBU A;  2EO8 A;  4OAE A;  4H6U A;  1LRZ A;  3R9G A;  3D7G A;  3NFZ A;  3EXN A;  1L0C A;  4P4B A;  1BPN A;  5HVH A;  1QST A;  3W91 A;  3ZZI A;  5CNP A;  1S7K A;  3F0A A;  1M4L A;  1SQH A;  2Q51 A;  1YW4 A;  2ZEE A;  1Q2D A;  1Y9W A;  2V77 A;  4ZX8 A;  2XEJ A;  2PC1 A;  3KR4 A;  3DR6 A;  1B87 A;  1HDQ A;  3IWG A;  2BL1 A;  1DTD A;  4K3N A;  1ZG7 A;  5JGF A;  1YSJ A;  2B4D A;  4CYN A;  4NGN A;  4FAI A;  2FS5 A;  4I49 A;  4XPK A;  3KHZ A;  4RUH A;  4IF5 A;  4B12 A;  1OBR A;  4DUK A;  2AFZ A;  4MFL A;  4PXC A;  1Y7R A;  2FSR A;  4FD6 A;  2A4N A;  1ZLI A;  2YND A;  4OKO A;  2OOT A;  4L89 A;  2DPT A;  1Z2L A;  1S7N A;  2HB6 A;  3IU1 A;  2RB7 A;  4RS2 A;  5LYD A;  1B6B A;  1HDU A;  3NH4 A;  4UCN A;  4DNC A;  2JDD A;  2ZW4 A;  5DWN A;  4AG9 A;  1GHE A;  3SI1 A;  4B11 A;  3DGV A;  5FVJ A;  3FEE A;  3KGQ A;  3BJ7 A;  3DLJ A;  3GB0 A;  2B5G A;  3BJ8 A;  5K8N A;  5F48 A;  2ANP A;  2OU2 A;  1CP7 A;  2V8D A;  3S6K A;  2R1I A;  7CPA A;  2DXQ A;  1NMT A;  3OWC A;  3QB8 A;  5CBM A;  3BI0 A;  3MN8 A;  4CRY B;  1A2Z A;  3WAB A;  3D67 A;  4MCS A;  4CGN A;  2ZPA A;  2PJ9 A;  2Q4V A;  4MHD A;  4Z65 A;  1Z8X A;  3TOA A;  1CPS A;  3D2P A;  2PQ8 A;  4P6Y A;  1F2P A;  3CZX A;  4R9M A;  3DDD A;  3GLJ A;  3D3S A;  2BUE A;  3TTH A;  1GYT A;  3B3C A;  3VWD A;  1KZF A;  1M4G A;  3F8K A;  3JVN A;  3PFE A;  4MXU A;  4O23 A;  8CPA A;  2KCW A;  4OC2 A;  5LYI A;  1VHE A;  4CYQ A;  5JH9 A;  2REE A;  2NYQ A;  4KOT A;  5LYF A;  4P44 A;  5K8P A;  2FIA A;  4QVT A;  3N7Z A;  1BOB A;  2ZOG A;  1ELM P;  2Q4Z A;  4P45 A;  4W9Y A;  2ZEG A;  4FD5 A;  4OAD A;  5EMI A;  4R87 A;  1R57 A;  2ZW6 A;  2PR8 A;  2I00 A;  1N71 A;  2QIR A;  4MCR A;  2VBQ A;  5I0C A;  1YK3 A;  4MJ8 A;  3IWE A;  4DJL A;  2ZEO A;  4YRH A;  3TOB A;  4C2Z A;  2B4B A;  2NMT A;  4R3K A;  4XNH C;  4PK2 A;  3IWW A;  5THW A;  3H8E A;  3B3S A;  2VI7 A;  3P2F A;  1LOK A;  4HNW B;  2WUU A;  5K8M A;  4L8A A;  2PJ8 A;  1IYL A;  2BO9 A;  3LMS A;  4PPZ A;  3GYA A;  1YVO A;  4KUA A;  1VGY A;  1VHS A;  2VZY A;  4OC4 A;  3L2N A;  1ARM A;  4BBH A;  4XPD B;  4LQG A;  2OZH A;  3WC7 A;  5D8N A;  4F6A A;  4KSA A;  4ZY1 A;  2REF A;  3FNC A;  3EFA A;  3KKW A;  4A32 A;  4E2A A;  2JEW A;  3BLN A;  1XF8 A;  2NSM A;  3PB4 X;  5I4M A;  5HXD A;  1AUG A;  3V38 A;  2D4P A;  2QML A;  3SHP A;  2Z3L A;  3VAT A;  2CIJ A;  1IB1 E;  4KSI A;  2CXA A;  5HH1 A;  2ZEP A;  3PP9 A;  2PJ3 A;  2PDO A;  1TXR A;  2YNC A;  3EC4 A;  4JXQ A;  3PBB A;  5DS0 A;  1YX0 A;  4A95 A;  4QB9 A;  4JJX A;  3IO1 A;  4P4F A;  4PSW A;  2QEC A;  4UCP A;  4EVY A;  1NSA A;  1QSM A;  5G1Z A;  2BCO A;  4A38 A;  1Q7L A;  1Z8L A;  3FH4 A;  5IB9 A;  2WPW A;  1AMP A;  2PJC A;  2ZEM A;  3RZA A;  1WWZ A;  4CRZ B;  1LFW A;  3LD2 A;  2PJ6 A;  4ZX9 A;  2FXF A;  1XEB A;  1ARL A;  3BHX A;  4NGP A;  4CYP A;  3FIX A;  1F57 A;  3D2M A;  3R1K A;  1FY7 A;  2ZED A;  2GAN A;  4KSF A;  3PB9 X;  4PXE A;  3PB8 X;  3IU2 A;  4YFJ A;  3SJX A;  4AVA A;  3D66 A;  2B4D B;  1UFH A;  3DNS A;  2FE7 A;  4GXH A;  2Q7B A;  1S60 A;  3CT9 A;  2CNM A;  3D4U A;  3R95 A;  1CPX A;  4UF4 A;  1BPM A;  4R7M A;  2F5I A;  4B5P A;  3JTK A;  2PJ0 A;  5JQ4 A;  1R3N A;  1ZG9 A;  4R57 A;  4KVM E;  2PJ1 A;  1K4J A;  2QJ8 A;  4FBE A;  1DE4 C;  5J8C A;  4YWY A;  4UEE A;  2DPS A;  1XMB A;  2PVW A;  4PK3 A;  5ISV A;  1XJO A;  4NCZ A;  3FEC A;  2C27 A;  4KVX A;  3VAR A;  2IMO A;  3FYN A;  1I12 A;  4MHZ A;  1KUY A;  3IJ3 A;  3QAY A;  4NJQ A;  1S5K A;  3FJU A;  4UFV A;  1PCA A;  5HMN A;  2F7V A;  2G9D A;  2Z0Z A;  2VQY A;  5AG6 A;  3FED A;  2GE3 A;  4ONW A;  4HNX B;  2AE6 A;  1S7F A;  3TCV A;  3WR7 A;  6CPA A;  1RO5 A;  4UBR A;  2QYV A;  3H8F A;  4UCM A;  4ZBG A;  1CP6 A;  3PZJ A;  3T9Y A;  4R3L A;  2RFH A;  4ZYQ A;  2F8H A;  3SI2 A;  4M85 A;  3I1U A;  1KUV A;  4RI1 A;  1OZP A;  4FD4 A;  4UFW A;  4C7I A;  1RTQ A;  1M44 A;  1TF9 A;  4IHM A;  1Z9U A;  3CXP A;  3SI0 A;  3D7H A;  2OZG A;  3JRU A;  5AG4 A;  4Y49 B;  5IV0 A;  4II9 A;  3S9M A;  1JWQ A;  4CAW A;  1CX8 A;  4GM5 A;  5BWA B;  3NE8 A;  3H5Z A;  4BMH A;  4AG7 A;  2ZEF A;  4CAE A;  3D7F A;  2ODF A;  2P6G A;  4ONU A;  4A33 A;  1X10 A;  4Q38 A;  3T90 A;  2FCK A;  2PCU A;  1LAM A;  2JBK A;  3LOD A;  3TC8 A;  5JM6 A;  1PU9 A;  2RC4 A;  1TIQ A;  4P4J A;  3UY5 A;  3W6S A;  4E8O A;  2O28 A;  4F8Z A;  1Z5R A;  4QC6 A;  3W6X A;  2OH1 A;  4H89 A;  2DF5 A;  2PJ4 A;  2HC9 A;  3A9L A;  4P4D A;  4MRI A;  1BLL E;  1QSN A;  3FX6 A;  3S6H A;  4KOX A;  2R8V A;  4P10 A;  5A27 A;  2Z10 A;  4GS4 A;  2PJB A;  4XPD C;  2C6P A;  3TO7 A;  4AB7 A;  1Y0Y A;  3D7D A;  4M6H A;  5HVG A;  2HUZ A;  2CTB A;  1ZG8 A;  3RNZ A;  1M4I A;  1PYT B;  3SJF A;  2GFQ A;  2ARH A;  3WC6 A;  4ZGY B;  2Z3M A;  1PUA A;  4MMO A;  4UA3 A;  3RO0 A;  1LCP A;  4MFP A;  3SXN A;  4F0X A;  4MY3 A;  2PJA A;  4AVB A;  4CYO A;  4X8I A;  4CPA A;  1YGH A;  4KOR A;  1MJ9 A;  2EBJ A;  3BXM A;  4X2T A;  5LRJ A;  1ELL P;  3FRM A;  2P6E A;  3PB6 X;  2ABZ A;  4TNU A;  2EWB A;  4G1P A;  1NE9 A;  2ZXV A;  4B14 A;  4JWP A;  3PFO A;  4F9V A;  1IIC A;  2B3V A;  3K2K A;  4KOV A;  2WYR A;  2XEG A;  1Z4R A;  5G20 A;  1ON0 A;  2G3T A;  3MGD A;  4OC5 A;  1QMU A;  3KAS A;  3TT2 A;  4WJB A;  4U9Y A;  5JPH A;  4B5O A;  2ZEN A;  4MCQ A;  4NEX A;  4CS0 B;  2PIZ A;  3FXT A;  4MFJ A;  3GKR A;  4MY0 A;  5A28 A;  4FWU A;  3HUV A;  4HNY B;  5KTD A;  2OB0 A;  3QAH A;  4PQA A;  4UIB A;  5HVF A;  2Q43 A;  3FVL A;  3KR5 A;  3KL9 A;  3QNV A;  4PSX A;  2PRQ A;  3G3S A;  3MRU A;  4ZI6 A;  2CNS A;  2EK8 A;  2P0W A;  2J8M A;  3WT4 A;  3FBU A;  3SJE A;  2H5M A;  4WWV A;  3CXS A;  2ZOF A;  4K30 A;  3TO6 A;  4B5P B;  5C88 A;  1QSR A;  3S9N A;  1XOV A;  2Q44 A;  2GLF A;  5AG5 A;  2G0B A;  2IL4 A;  4MHP A;  2FIW A;  3EY5 A;  3RYO A;  4QBJ A;  1YLE A;  2PE3 A;  2HQY A;  2XEF A;  2IQ6 A;  1XE4 A;  2V8G A;  1EE3 P;  1TF8 A;  3TO9 A;  4C68 A;  3S9L A;  4OLL A;  5H84 A;  4F9U A;  1UWY A;  1YRE A;  5AG7 A;  4NGQ A;  1H8L A;  4ZY2 A;  4NGM A;  2JDC A;  4A31 A;  5J1Q A;  5KTA A;  1S3Z A;  2K5T A;  4H6Z A;  3H8G A;  2WZN A;  4X5K A;  5F46 A;  3I3G A;  1V0C A;  1CBX A;  1F2O A;  4PXB A;  5KTC A;  4MFQ A;  1MK4 A;  1QQ9 A;  4NJR A;  1HEE A;  5E96 A;  2R98 A;  3KQX A;  4MHN A;  2P6F A;  1FNO A;  1QSO A;  1ZLH A;  4M3S A;  4KLW A;  4P4I A;  2EK9 A;  3S6G A;  1M1D A;  4KUB A;  2Q0Y A;  2PRB A;  1X12 A;  4OME A;  3V8I A;  1IU8 A;  2FL4 A;  4FD7 A;  5LRG A;  4C2Y A;  2WSA A;  1S7L A;  2B5G B;  1YR0 A;  1LAP A;  1VHO A;  2QVP A;  4LX9 A;  2D4O A;  4RN7 A;  4Y49 C;  3GUX A;  4YGO A;  2R7H A;  2XEI A;  3B7I A;  4F0Y A;  2FT0 A;  1BAV A;  3PEI A;  3VH9 A;  2C1C A;  2PJ5 A;  3DR8 A;  3KQZ A;  3CPX A;  3DSB A;  3FB3 A;  4M6I A;  2BOA A;  3T8W A;  5IX3 A;  2YGW A;  5DWM A;  1YQE A;  4H2K A;  4A30 A;  3B3W A;  4KOU A;  4C7H A;  4JD6 A;  4BD9 A;  5EBV A;  2GLJ A;  2WPX A;  1XIX A;  1IID A;  4CGM A;  4OP4 A;  2O53 A;  3K9T A;  3I9S A;  3LAC A;  2I3C A;  1MJB A;  3HLP A;  1R43 A;  3NH8 A;  4U5Y A;  2VZZ A;  3C26 A;  3F5B A;  1XMT A;  3ISX A;  1I1D A;  3IEH A;  4KLV A;  4R76 A;  2Z11 A;  1TKJ A;  4UEF A;  3B2Y A;  4UIA A;  4A39 A;  4C2X A;  2EUI A;  2CY2 A;  4BIN A;  1M4D A;  1YME A; 
#chains in the Genus database with same CATH homology
 5G21 A;  1VKC A;  2Z3K A;  2J8R A;  2G3A A;  5AGE A;  2PSW A;  2OZU A;  3R96 A;  1Q2Y A;  2B58 A;  3PGP A;  1KUX A;  3R9F A;  2BSW A;  1J4J A;  5IB0 A;  3S6F A;  2Y0M A;  4MFZ A;  3R9E A;  1P4N A;  1MJA A;  1RXT A;  4CGL A;  4NXY A;  2YNC C;  2PR1 A;  2VXK A;  2Z3N A;  3IGR A;  1YVK A;  3H4Q A;  4JXR A;  1Y9K A;  3TFY A;  4UWI A;  4ORF A;  4Q36 A;  2JEV A;  1CM0 A;  2I79 A;  4XPL A;  4IUS A;  4B13 A;  1IYK A;  4CGO A;  2ATR A;  4JLY A;  5EC4 A;  2Z3O A;  4AVC A;  1Q2C A;  3P2H A;  4CAX A;  5J8F A;  4E0A A;  3G8W A;  4LUA A;  2Z3P A;  1BO4 A;  2Q04 A;  4UWJ A;  4CGP A;  3CXQ A;  4U9Z A;  1I21 A;  4HKF A;  5G22 A;  4KVO E;  4CAF A;  2J8N A;  5F47 A;  4MFK A;  4KOS A;  2AJ6 A;  4QUS A;  2GIV A;  1NSL A;  1Z4E A;  5H86 A;  3B8G A;  3SXO A;  4PV6 A;  3K9U A;  3GY9 A;  1U6M A;  4KS9 A;  5GCN A;  2VEZ A;  2CNT A;  4XNH B;  2BEI A;  4B10 A;  4KOW A;  2ZW7 A;  3JUW A;  2X7B A;  4MI4 A;  3D8P A;  1ZO0 A;  2ZW5 A;  3VWE A;  1WK4 A;  3ZJ0 A;  3E0K A;  2JLM A;  2B3U A;  2EVN A;  2YNE A;  5C82 A;  1CJW A;  4NF1 A;  4A2Z A;  5F49 A;  3TE4 A;  4CAV A;  3EO4 A;  2HV2 A;  1P0H A;  4KZT A;  4NSQ A;  4UFX A;  2Q4Y A;  3NE7 A;  4KOY A;  4J3G A;  4MBU A;  4OAE A;  4H6U A;  1LRZ A;  3R9G A;  3EXN A;  1L0C A;  1QST A;  3W91 A;  3ZZI A;  5CNP A;  1S7K A;  3F0A A;  1SQH A;  1Q2D A;  1Y9W A;  2PC1 A;  3DR6 A;  1B87 A;  3IWG A;  2BL1 A;  2B4D A;  4CYN A;  2FS5 A;  4I49 A;  4XPK A;  4IF5 A;  4B12 A;  4MFL A;  1Y7R A;  2FSR A;  4FD6 A;  2A4N A;  2YND A;  4L89 A;  2DPT A;  1S7N A;  3IU1 A;  4RS2 A;  1B6B A;  4UCN A;  4DNC A;  2JDD A;  2ZW4 A;  5DWN A;  4AG9 A;  1GHE A;  4B11 A;  5FVJ A;  3BJ7 A;  2B5G A;  3BJ8 A;  5F48 A;  2OU2 A;  3S6K A;  2R1I A;  2DXQ A;  1NMT A;  3OWC A;  3QB8 A;  4CRY B;  4CGN A;  2ZPA A;  2Q4V A;  4MHD A;  3TOA A;  3D2P A;  2PQ8 A;  4R9M A;  3DDD A;  3D3S A;  2BUE A;  3TTH A;  3VWD A;  1KZF A;  1M4G A;  3F8K A;  3JVN A;  2KCW A;  4CYQ A;  2REE A;  4KOT A;  2FIA A;  4QVT A;  3N7Z A;  1BOB A;  4FD5 A;  4OAD A;  4R87 A;  1R57 A;  2ZW6 A;  2PR8 A;  2I00 A;  1N71 A;  2QIR A;  2VBQ A;  5I0C A;  1YK3 A;  4MJ8 A;  3IWE A;  4YRH A;  3TOB A;  4C2Z A;  2B4B A;  2NMT A;  4R3K A;  4XNH C;  4PK2 A;  2VI7 A;  3P2F A;  4HNW B;  2WUU A;  4L8A A;  1IYL A;  3GYA A;  1YVO A;  4KUA A;  1VHS A;  2VZY A;  4BBH A;  4XPD B;  2OZH A;  4F6A A;  4KSA A;  2REF A;  3FNC A;  3EFA A;  3KKW A;  4A32 A;  4E2A A;  3BLN A;  1XF8 A;  2D4P A;  2QML A;  3SHP A;  2Z3L A;  1IB1 E;  2CXA A;  5HH1 A;  3PP9 A;  2PDO A;  3EC4 A;  2YNC A;  4JXQ A;  4A95 A;  1YX0 A;  4QB9 A;  4JJX A;  4PSW A;  4EVY A;  2QEC A;  4UCP A;  1QSM A;  5G1Z A;  2WPW A;  1WWZ A;  4CRZ B;  3LD2 A;  2FXF A;  1XEB A;  4CYP A;  3FIX A;  3D2M A;  3R1K A;  1FY7 A;  2GAN A;  4KSF A;  4YFJ A;  3IU2 A;  4AVA A;  2B4D B;  1UFH A;  3DNS A;  2FE7 A;  2Q7B A;  1S60 A;  2CNM A;  3R95 A;  2F5I A;  4B5P A;  3JTK A;  5JQ4 A;  4R57 A;  4KVM E;  1K4J A;  5J8C A;  2DPS A;  4PK3 A;  5ISV A;  4NCZ A;  2C27 A;  4KVX A;  3FYN A;  1I12 A;  1KUY A;  1S5K A;  4UFV A;  5HMN A;  2Z0Z A;  2VQY A;  5AG6 A;  2GE3 A;  4HNX B;  2AE6 A;  1S7F A;  3TCV A;  3WR7 A;  1RO5 A;  4UBR A;  4UCM A;  4ZBG A;  3PZJ A;  3T9Y A;  4R3L A;  4M85 A;  1KUV A;  4RI1 A;  1OZP A;  4FD4 A;  4UFW A;  4C7I A;  1M44 A;  1Z9U A;  3CXP A;  2OZG A;  5AG4 A;  5IV0 A;  4Y49 B;  4II9 A;  4CAW A;  5BWA B;  3H5Z A;  4BMH A;  4AG7 A;  4CAE A;  2P6G A;  4ONU A;  4A33 A;  4Q38 A;  3T90 A;  2FCK A;  3LOD A;  1PU9 A;  2RC4 A;  1TIQ A;  3UY5 A;  3W6S A;  4E8O A;  2O28 A;  4QC6 A;  3W6X A;  2OH1 A;  4H89 A;  3A9L A;  1QSN A;  3S6H A;  4KOX A;  2R8V A;  5A27 A;  2Z10 A;  4GS4 A;  3TO7 A;  4XPD C;  4AB7 A;  2HUZ A;  1M4I A;  2ARH A;  4ZGY B;  2Z3M A;  1PUA A;  4UA3 A;  4MFP A;  3SXN A;  4F0X A;  4MY3 A;  4CYO A;  4AVB A;  1YGH A;  4KOR A;  1MJ9 A;  3FRM A;  2P6E A;  1NE9 A;  2ZXV A;  4B14 A;  4JWP A;  1IIC A;  2B3V A;  4KOV A;  5G20 A;  1Z4R A;  1ON0 A;  2G3T A;  3MGD A;  3TT2 A;  4U9Y A;  5JPH A;  4B5O A;  4CS0 B;  4NEX A;  3FXT A;  4MFJ A;  3GKR A;  4MY0 A;  5A28 A;  4HNY B;  5KTD A;  2OB0 A;  3QAH A;  4PSX A;  3G3S A;  2CNS A;  2P0W A;  2J8M A;  3FBU A;  2H5M A;  3CXS A;  4K30 A;  3TO6 A;  4B5P B;  5C88 A;  1QSR A;  2Q44 A;  3RYO A;  5AG5 A;  2G0B A;  2IL4 A;  2FIW A;  3EY5 A;  4QBJ A;  1YLE A;  2HQY A;  1XE4 A;  3TO9 A;  4C68 A;  4OLL A;  5H84 A;  1YRE A;  5AG7 A;  2JDC A;  4A31 A;  5KTA A;  1S3Z A;  2K5T A;  4H6Z A;  4X5K A;  5F46 A;  3I3G A;  1V0C A;  5KTC A;  4MFQ A;  1MK4 A;  5E96 A;  2R98 A;  2P6F A;  1QSO A;  4M3S A;  4KLW A;  3S6G A;  1M1D A;  4KUB A;  2Q0Y A;  2PRB A;  3V8I A;  2FL4 A;  4FD7 A;  4C2Y A;  2WSA A;  1S7L A;  2B5G B;  1YR0 A;  4LX9 A;  2D4O A;  4Y49 C;  4YGO A;  2R7H A;  4F0Y A;  2FT0 A;  3DR8 A;  3DSB A;  3FB3 A;  5IX3 A;  2YGW A;  5DWM A;  4A30 A;  4KOU A;  4C7H A;  4JD6 A;  2WPX A;  1XIX A;  1IID A;  4CGM A;  3I9S A;  5EBV A;  4U5Y A;  1MJB A;  2VZZ A;  3C26 A;  3F5B A;  1XMT A;  1I1D A;  4KLV A;  2Z11 A;  4C2X A;  2EUI A;  2CY2 A;  1M4D A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...