5H86A

Human gcn5 bound to butyryl-coa
Total Genus 44
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
44
sequence length
167
structure length
167
Chain Sequence
SGIIEFHVIGNSLTPKANRRVLLWLVGLQNVFSHQLPRMPKEYIARLVFDPKHKTLALIKDGRVIGGICFRMFPTQGFTEIVFCAVTSNEQVKGYGTHLMNHLKEYHIKHNILYFLTYADEYAIGYFKKQGFSKDIKVPKSRYLGYIKDYEGATLMECELNPRIPYT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords Histone acetyltransferase KAT2A
publication title Structural basis for acyl-group discrimination by human Gcn5L2.
pubmed doi rcsb
source organism Homo sapiens
total genus 44
structure length 167
sequence length 167
ec nomenclature ec 2.3.1.48: Histone acetyltransferase.
pdb deposition date 2015-12-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00583 Acetyltransf_1 Acetyltransferase (GNAT) family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.630.30 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Aminopeptidase 5h86A00
2FL4A 2O28A 3QB8A 4B5PA 1XEBA 1V0CA 3EXNA 4QC6A 3F5BA 4XPLA 1RO5A 4NEXA 2G3TA 4BMHA 3D3SA 2AJ6A 2R7HA 3LODA 5F49A 4PV6A 4AG9A 4KOTA 4OADA 4OAEA 3R9EA 1IB1E 3GY9A 2JDDA 1XF8A 2BEIA 5EBVA 2NMTA 5DWMA 1M4IA 3FB3A 2Z11A 2J8MA 4KVOE 3W91A 4KORA 4M3SA 3P2FA 4MI4A 4YGOA 4QB9A 5E96A 4YFJA 1YX0A 4AVAA 2B3VA 2X7BA 2P6FA 2ZPAA 5IV0A 5HH1A 4NCZA 4E0AA 2Z0ZA 4CAWA 3OWCA 4KOWA 4NXYA 4H89A 3FNCA 1TIQA 3E0KA 2PC1A 4AVCA 3ZZIA 2QECA 1NSLA 4H6UA 2Q44A 5F47A 4MHDA 3R1KA 3S6HA 4KUAA 3TOBA 4IUSA 3IGRA 3R95A 1I21A 1I1DA 1YR0A 3DR6A 4KLWA 5F48A 3PGPA 3UY5A 3TO9A 2K5TA 1P4NA 3SHPA 2F5IA 2OZGA 4KVME 4KZTA 2FE7A 1Z4RA 5KTCA 1XE4A 3FYNA 3VWEA 2FIWA 1OZPA 1S5KA 4XNHB 3R9GA 2RC4A 4GS4A 4DNCA 2PR1A 1U6MA 2R1IA 3PP9A 2CNTA 3MGDA 4CAXA 5C82A 4FD5A 3W6SA 4Y49B 4ORFA 3TTHA 2ZXVA 3B8GA 1CM0A 4IF5A 4B5PB 4M85A 1XIXA 2QMLA 2HQYA 3EC4A 4I49A 2J8RA 1M4DA 1BOBA 4XPDC 5JPHA 3BLNA 4HNXB 3W6XA 3P2HA 4K30A 1QSNA 1GHEA 3D2MA 4JLYA 4PSXA 2I00A 3G8WA 3KKWA 4KOXA 3R9FA 3DDDA 1XMTA 5I0CA 4FD7A 4L89A 3EFAA 2KCWA 2ZW5A 4LX9A 2P6GA 1S7LA 3EO4A 2FXFA 3TE4A 3FXTA 4MY3A 4XNHC 2GANA 4UWJA 4F6AA 1MJAA 3V8IA 2JEVA 4MBUA 3BJ7A 4HNYB 2JDCA 1UFHA 1B6BA 1YVKA 2FCKA 3EY5A 4Y49C 3TO6A 2P6EA 2D4OA 2VZZA 4U5YA 4NF1A 1YK3A 2B4BA 1QSTA 3TOAA 4JXQA 3I3GA 5FVJA 2CNMA 3F8KA 2PDOA 5C88A 4KVXA 4KOYA 1Z4EA 1WK4A 4KOUA 2ZW7A 1P0HA 1M4GA 1YGHA 3FBUA 2HV2A 2R98A 2OU2A 2J8NA 1J4JA 1SQHA 2G0BA 4OLLA 5CNPA 4FD4A 2B5GB 1B87A 4AVBA 2VXKA 2B4DB 1KUYA 2JLMA 2WPXA 1FY7A 5DWNA 3LD2A 5J8CA 1VKCA 1NMTA 2B5GA 3SXOA 4MY0A 5J8FA 4R87A 2B4DA 2IL4A 1IICA 1ON0A 1LRZA 3N7ZA 4F0YA 3WR7A 5IX3A 4R3KA 1Q2YA 4RI1A 2Y0MA 1IYLA 3CXPA 3S6KA 1S60A 3TFYA 1YVOA 2OZHA 4U9ZA 1Q2CA 1S7FA 4EVYA 3T9YA 2GIVA 5F46A 2EVNA 3D2PA 2VBQA 2VQYA 4JXRA 3VWDA 4JWPA 1I12A 5EC4A 4PSWA 3DR8A 3DSBA 2VI7A 3C26A 4CRZB 3K9UA 1N71A 2PRBA 2Z10A 1BO4A 2FS5A 1VHSA 3JVNA 4UA3A 4MJ8A 5H84A 1M1DA 2VEZA 4B5OA 5IB0A 3S6FA 4HKFA 3H4QA 1QSRA 3F0AA 1YLEA 4H6ZA 2OB0A 1WWZA 4KLVA 1Z9UA 1QSOA 2VZYA 2ZW4A 3T90A 2GE3A 1Y9WA 2FIAA 4CRYB 4ONUA 3SXNA 4CS0B 1S7KA 1MJ9A 4XPKA 5KTDA 1KUVA 4QVTA 4HNWB 4PK2A 1S7NA 2REEA 2AE6A 1MJBA 4AB7A 4PK3A 4U9YA 1PU9A 1S3ZA 4R57A 3QAHA 4UBRA 4FD6A 3NE7A 3BJ8A 2ATRA 4KOSA 2C27A 4E8OA 2REFA 4KOVA 2CY2A 5GCNA 3G3SA 1L0CA 3DNSA 2Q04A 4QUSA 1KUXA 4R3LA 3TCVA 2OZUA 2Q7BA 2QIRA 1RXTA 3RYOA 5JQ4A 2P0WA 1QSMA 1R57A 1PUAA 3TT2A 3FIXA 4II9A 4YRHA 2PQ8A 2R8VA 1KZFA 5ISVA 2FSRA 1IIDA 4NSQA 4CAVA 1Q2DA 3S6GA 5H86A 2FT0A 2DXQA 4L8AA 2CNSA 4QBJA 2Q4VA 3R96A 2I79A 1MK4A 2HUZA 4KUBA 2B3UA 4XPDB 2BSWA 3FRMA 2ARHA 2Q0YA 4ZBGA 2D4PA 3IWGA 1IYKA 3GYAA 2PR8A 4E2AA 3I9SA 4LUAA 1M44A 2PSWA 3TO7A 4AG7A 4J3GA 3ZJ0A 1NE9A 2ZW6A 4JJXA 3JUWA 3CXSA 3CXQA 1Y9KA 4RS2A 5KTAA 2EUIA 3GKRA 2G3AA 2B58A 2WPWA 3PZJA 1K4JA 2BL1A 4JD6A 1CJWA 2OH1A 1YREA 2H5MA 4R9MA 3D8PA 5HMNA 4X5KA 2BUEA 2A4NA 1Y7RA 2Q4YA 4UWIA
chains in the Genus database with same CATH superfamily
2YNDA 2FL4A 2O28A 3QB8A 4B5PA 3D68A 1XEBA 2QJ8A 1V0CA 4PPZA 5DS0A 1FT7A 3EXNA 4QC6A 3H8GA 3F5BA 4A38A 2PJ8A 4IHMA 4ZX9A 3HUVA 3B3CA 3VARA 4WWVA 4XPLA 4A37A 1RO5A 4NEXA 2G3TA 4UF4A 2Z3MA 4BMHA 4ZX8A 3D3SA 2AJ6A 2R7HA 3LODA 3KL9A 3IU2A 2ZEFA 5F49A 3D67A 4PV6A 4YWYA 5HVGA 4AG9A 4KOTA 4OADA 4OAEA 3R9EA 1IB1E 1LOKA 2BCOA 2ZEDA 3B35A 2JDDA 1XF8A 3GY9A 4BINA 1HEEA 1YW6A 3D7GA 2BEIA 4CGOA 1A2ZA 5EBVA 2NMTA 3NE8A 5DWMA 1M4IA 2Z3PA 7CPAA 4FUUA 1XMBA 4NJRA 3FB3A 2Z11A 3KHXA 4P10A 4MCSA 4X2TA 2J8MA 4KVOE 3W91A 4KORA 5CPAA 1Q7LA 4A2ZA 4CGPA 1ZO0A 4M3SA 3P2FA 4MI4A 2DF5A 3CDXA 1R3NA 4YGOA 4CAFA 2GLJA 4QB9A 5E96A 4YFJA 4MFLA 4NGMA 3TX8A 1YX0A 2PRQA 4AVAA 2B3VA 4KS9A 2X7BA 1ARLA 2P6FA 2PJ2A 2ZPAA 4MRIA 5IV0A 3FX6A 4OC2A 2CF4A 5HH1A 4NCZA 4E0AA 2Z0ZA 3NFZA 4Q38A 4CAWA 5G20A 3OWCA 4KOWA 4MFZA 4WJBA 2ZEPA 4MHYA 2ODFA 4NXYA 3VH9A 4H89A 3FNCA 3BI0A 1TIQA 3E0KA 2PC1A 4AVCA 3S9LA 2AFWA 4UIAA 3ZZIA 2PJCA 5AG6A 2PE3A 1DTDA 2QECA 3K2KA 2C6PA 2AFOA 4LQ6A 3DLJA 3T8WA 1NSLA 4H6UA 4NGQA 2Q44A 4NGSA 5F09A 4PQAA 4UEZA 4MHDA 4UFXA 1AUGA 5F47A 5I4MA 3R1KA 3S6HA 4KUAA 3TOBA 4IUSA 4MHPA 3IGRA 5CBMA 3R95A 1I21A 1I1DA 1YR0A 2Z3LA 3DR6A 3H8FA 4KLWA 4OKOA 5F48A 1NSAA 3PGPA 4OC1A 2BO9A 3UY5A 2Z3KA 3SJXA 1ZG7A 3TO9A 2K5TA 1P4NA 3SHPA 1LCPA 2F5IA 4OIWA 2OZGA 4KVME 1AMPA 4KZTA 1IOFA 1BPMA 1Z4RA 2FE7A 3ISXA 5KTCA 2XEJA 1XE4A 4CYOA 1Y0RA 3FYNA 2F8HA 3VWEA 2FIWA 2YNCA 1ZLHA 2ZELA 1OZPA 1S5KA 2XEGA 2QVPA 3D4UA 3SJFA 4XNHB 1AYEA 3R9GA 2RC4A 3CPAA 4OMEA 4GS4A 4DNCA 4CAEA 3NA6A 2PR1A 3KQXA 1TF9A 1U6MA 2R1IA 4MCQA 3WC6A 3B3VA 4NGTA 1HDUA 3PP9A 2CNTA 3NH4A 3MGDA 1F57A 1M4LA 4LQGA 4CAXA 3JRUA 5C82A 4FD5A 2AFUA 2CIJA 3B3TA 3KI9A 4ORFA 4X3RA 4Y49B 3W6SA 4C7HA 3TTHA 4G1PA 4P45A 4F9VA 4PXEA 2FVGA 2ZXVA 3B8GA 1CM0A 4IF5A 4B5PB 2QYVA 2JBKA 4M85A 1BPNA 1Z8XA 3I1UA 2ZEMA 1XIXA 2QMLA 2HQYA 3EC4A 4I49A 1ZLIA 4IAVA 4OC4A 4ZI6A 2J8RA 1M4DA 1IY7A 1BOBA 4XPDC 1Z5RA 3BLNA 5JPHA 4HNXB 3W6XA 3P2HA 2PJ5A 4K30A 2IMOA 1QSNA 1DE4C 1GHEA 4KSFA 3D2MA 4JLYA 4PSXA 5G1ZA 1XFOA 2I00A 2DPTA 3G8WA 3KKWA 4KOXA 4YU9A 2WUUA 3B7IA 3DDDA 3L2NA 5LYDA 3R9FA 4B10A 3KHZA 1XMTA 2C6GA 4Q7AA 2OOTA 4C7IA 4FAIA 4FD7A 5I0CA 1ZG9A 3MRUA 3IWWA 4L89A 4CYNA 3EFAA 3PBBA 2WZNA 2KCWA 3K9TA 2O4HA 2ZEGA 2ZW5A 3A9LA 2I3CA 4LX9A 5AG7A 2P6GA 3IC1A 1S7LA 3EO4A 1YMEA 2FXFA 4RN7A 1IOIA 1PCAA 3RAMA 3TE4A 2PCUA 1CX8A 1Z8WA 4UCPA 3FXTA 3FEEA 4MY3A 4XNHC 2GANA 4UWJA 5JGFA 3IU1A 2CTBA 4P4JA 4F6AA 1MJAA 1FNOA 1Z2LA 3V8IA 2JEVA 4MBUA 4B6ZA 4CGNA 3BJ7A 4HNYB 1ELLP 2CXAA 2JDCA 1UFHA 1B6BA 1YVKA 2PJ3A 2FCKA 4A94A 3EY5A 4Y49C 3TO6A 2BOAA 2HC9A 2P6EA 1Z8LA 2D4OA 2VZZA 3SI0A 4A95A 3WT4A 4U5YA 2IJZA 2JEWA 2V77A 1KWMA 1YK3A 4NF1A 4X8IA 1Z8TA 2B4BA 3IFEA 3JTKA 4DUKA 1LAPA 1QSTA 3TC8A 3TOAA 5LRKA 4JXQA 2YGWA 5D8NA 1CP7A 1CPXA 3I3GA 5FVJA 2CNMA 2PJ6A 2ZEOA 3F8KA 2PDOA 1BAVA 5C88A 4KVXA 3QAYA 3D7FA 4KOYA 3PB9X 2Z3OA 1Z4EA 4OIDA 1WK4A 4KOUA 2ZW7A 1P0HA 5AG5A 1M4GA 1YGHA 4UEEA 3FBUA 3WC7A 5JH9A 2V8HA 2HV2A 2R98A 4EFDA 2PVWA 2OR4A 3HLPA 3PB7X 4ZY0A 2OU2A 1LFWA 2J8NA 2GREA 1J4JA 1QMUA 1SQHA 2AFMA 2G0BA 3RO0A 2GU2A 4TNUA 3GLJA 2ZEHA 4FD4A 4OLLA 2B5GB 1YLOA 5CNPA 4EWTA 1B87A 2V8DA 3D7HA 5K8PA 4AVBA 2VXKA 2JBJA 3KGQA 2B4DB 4C2YA 3GB0A 3B3WA 1KUYA 2CTCA 2JLMA 2WPXA 4MCPA 3GUXA 4MXUA 4P4DA 1XRYA 1FY7A 3D7DA 5DWNA 3LD2A 3LWUA 3IWEA 1F2OA 4MMOA 1VKCA 1NMTA 2V8GA 5J8CA 2B5GA 4GM5A 3B2YA 4EMEA 5A28A 3PFOA 4UFWA 4MY0A 3SXOA 4B12A 5J8FA 4R87A 4CGLA 5K8MA 2B4DA 2IL4A 3FJUA 5THWA 3RBUA 4R7MA 4CYQA 2VL1A 3FEDA 1BLLE 1IICA 2C6CA 2G9DA 1ON0A 3FECA 3PBEA 4UFVA 1LRZA 4O23A 3N7ZA 4F0YA 3WR7A 5IX3A 4R3KA 1Q2YA 3PB6X 4MCRA 2ANPA 4NGNA 4RI1A 2Y0MA 5K8OA 1IYLA 5LRGA 5LYLA 3CXPA 3ISZA 1S60A 3S6KA 2PJ4A 3TFYA 1YVOA 4R6TA 2OZHA 2HB6A 2PIYA 4U9ZA 4CYPA 1Q2CA 3CT9A 1VHEA 1S7FA 2EK8A 3CPXA 3FH4A 3B3SA 4EVYA 4UEFA 3RZAA 1HDQA 1UWYA 1ARMA 3T9YA 2GIVA 3KR5A 4M6GA 4F8ZA 3CZXA 5F46A 2EVNA 4DJLA 3BHXA 3D2PA 3IO1A 5IB9A 3V7ZA 2VBQA 1EE3P 1Y7EA 3KR4A 2VQYA 4JXRA 3VWDA 5BWAB 4TWEA 4JWPA 4JZ0A 3D66A 4JYWA 2ZENA 1ELMP 1I12A 3QNVA 5EC4A 2XEIA 4PSWA 2YNCC 3DR8A 3DGVA 4K3NA 4MFQA 3DSBA 2O53A 2VI7A 1TKFA 3C26A 2WSAA 4B14A 4CRZB 3H5ZA 2YNEA 4P4FA 3K9UA 2ZOFA 1N71A 4MHZA 5EMIA 2PRBA 2Z10A 1BO4A 2FS5A 1JQGA 1VHSA 3NH8A 3JVNA 1CBXA 2AFZA 3N5FA 4UA3A 1OBRA 3BI1A 4MJ8A 1YW4A 5H84A 4PXBA 4A30A 1M1DA 2PJ7A 2VEZA 4B5OA 5IB0A 3S6FA 4HKFA 4CGMA 3H4QA 1QSRA 3F0AA 1YLEA 2Z3NA 2AFXA 4H6ZA 4F0XA 3FMCA 2OB0A 1WWZA 3KQZA 2Q7SA 4KLVA 5JM6A 1Z9UA 1QSOA 2VZYA 2ZW4A 3T90A 3IJ3A 4R8FA 2GE3A 1Y9WA 2DPSA 2FIAA 2GFQA 4CRYB 2PJ0A 4ONUA 4C68A 4P4BA 3SXNA 4CS0B 1S7KA 1MJ9A 4R76A 3WC5A 5LYFA 4XPKA 1Y0YA 2NYQA 5AG4A 5KTDA 4P6YA 4KSAA 3H8EA 4NJQA 2ZEEA 2ZOGA 1KUVA 1TKHA 4QVTA 4HNWB 4PK2A 4C2XA 1PYTB 4ZYQA 1S7NA 3MN8A 2PJBA 4CPAA 2REEA 2AE6A 4DYOA 1MJBA 3FVLA 4AB7A 4ZGYB 3S9NA 4PK3A 4PXCA 8CPAA 5G21A 1GYTA 3PB4X 4U9YA 4UIBA 1PU9A 4MFKA 1S3ZA 5AGEA 4R57A 3QAHA 4HPSA 4UBRA 4FD6A 5K8NA 3NE7A 3RNZA 3BJ8A 2PJ1A 6CPAA 5A27A 4MHNA 2ATRA 2C1CA 4KOSA 2C27A 4E8OA 4B11A 2REFA 4KOVA 2CY2A 5GCNA 3G3SA 4OP4A 1L0CA 3DNSA 2Q04A 4QUSA 1KUXA 2POKA 5G22A 4Z65A 2ABZA 4R3LA 3TCVA 2OZUA 3LMSA 2Q7BA 5HVHA 3SI2A 2QIRA 4OC5A 4UCNA 1IGBA 3BXMA 1RXTA 4P4EA 1H8LA 2DEAA 1TXRA 4UCMA 3RYOA 2P0WA 5JQ4A 1QSMA 1LAMA 2Q43A 4W9YA 4M6HA 3LACA 4IK2A 1R57A 3KZWA 4FBEA 1PUAA 4P44A 3TT2A 5D29A 2PVVA 3FIXA 4II9A 4YRHA 1XOVA 1IU8A 4ONWA 3SJGA 1YSJA 2PQ8A 1KZFA 2R8VA 2XEFA 3KASA 4MFJA 4OC3A 3WABA 5ISVA 3IEHA 2FSRA 1R43A 1IIDA 4NSQA 3V38A 3PRTA 2EBJA 3SI1A 4CAVA 2NSMA 2Q4ZA 1Q2DA 3GIUA 3S6GA 5H86A 4A33A 2FT0A 3PFEA 1CG2A 2DXQA 2Q51A 4L8AA 1LANA 4A39A 4ZY2A 3VATA 2CNSA 2RB7A 1VIXA 2RFHA 4NGPA 4QBJA 2Q4VA 3R96A 1VHOA 2I79A 3FF3A 4C2ZA 1MK4A 2HUZA 1X12A 4F9UA 4KUBA 2B3UA 2PIZA 4XPDB 2J9AA 2BSWA 4NFRA 4PXDA 4Q36A 3FRMA 2ARHA 2Q0YA 4A31A 2EWBA 4BD9A 4NGRA 4OC0A 1XJOA 3PB8X 4ZBGA 2D4PA 1YQEA 4KSIA 4P4IA 4A32A 3IWGA 1IYKA 3GYAA 1VGYA 3IIBA 2PR8A 4E2AA 3I9SA 4LUAA 5LYIA 1M44A 3PEIA 2PSWA 1TF8A 1X10A 3TO7A 4AG7A 4J3GA 3ZJ0A 3NH5A 1NE9A 2ZW6A 5LRJA 2EO8A 4JJXA 3SJEA 5J1QA 2PJAA 3JUWA 3CXSA 3CXQA 1XBUA 1ZG8A 1Y9KA 1JWQA 4RS2A 5KTAA 2EUIA 2IQ6A 4RUHA 3GKRA 2G3AA 2B58A 2WPWA 3PZJA 1K4JA 4GXHA 5HVFA 4BBHA 2PJ9A 2F7VA 2BL1A 4JD6A 1CJWA 1F2PA 2OH1A 1YREA 2H5MA 4H2KA 4M6IA 4R9MA 4B13A 3D8PA 3S9MA 5HMNA 4X5KA 2EK9A 1TKJA 2BUEA 2WYRA 5ELYA 2A4NA 4AXVA 4ZY1A 1CP6A 1Y7RA 4FWUA 2Q4YA 2V8VA 4UWIA 1RTQA 5HXDA 2GLFA 2AFSA 1QQ9A 4MFPA 1CPSA
chains in the Genus database with same CATH topology
2YNDA 2FL4A 2O28A 3QB8A 4B5PA 1XEBA 1V0CA 3EXNA 4QC6A 3F5BA 4XPLA 1RO5A 4NEXA 2G3TA 2Z3MA 4BMHA 3D3SA 2AJ6A 2R7HA 3LODA 3IU2A 5F49A 4PV6A 4AG9A 4KOTA 4OADA 4OAEA 3R9EA 1IB1E 3GY9A 2JDDA 1XF8A 2BEIA 4CGOA 5EBVA 2NMTA 5DWMA 1M4IA 2Z3PA 3FB3A 2Z11A 2J8MA 4KVOE 3W91A 4KORA 4A2ZA 4CGPA 1ZO0A 4M3SA 3P2FA 4MI4A 4YGOA 4CAFA 4QB9A 5E96A 4YFJA 4MFLA 1YX0A 4AVAA 2B3VA 4KS9A 2X7BA 2P6FA 2ZPAA 5IV0A 5HH1A 4NCZA 4E0AA 2Z0ZA 4Q38A 4CAWA 5G20A 3OWCA 4KOWA 4MFZA 4NXYA 4H89A 3FNCA 1TIQA 3E0KA 2PC1A 4AVCA 3ZZIA 5AG6A 2QECA 1NSLA 4H6UA 2Q44A 5F47A 4MHDA 4UFXA 3R1KA 3S6HA 4KUAA 3TOBA 4IUSA 3IGRA 3R95A 1I21A 1I1DA 1YR0A 2Z3LA 3DR6A 4KLWA 5F48A 3PGPA 3UY5A 2Z3KA 3TO9A 2K5TA 1P4NA 3SHPA 2F5IA 2OZGA 4KVME 4KZTA 2FE7A 1Z4RA 5KTCA 4CYOA 1XE4A 3FYNA 3VWEA 2FIWA 2YNCA 1OZPA 1S5KA 4XNHB 3R9GA 2RC4A 4GS4A 4DNCA 4CAEA 2PR1A 1U6MA 2R1IA 3PP9A 2CNTA 3MGDA 4CAXA 5C82A 4FD5A 3W6SA 4Y49B 4ORFA 4C7HA 3TTHA 2ZXVA 3B8GA 1CM0A 4IF5A 4B5PB 4M85A 1XIXA 2QMLA 2HQYA 3EC4A 4I49A 2J8RA 1M4DA 1BOBA 4XPDC 5JPHA 3BLNA 4HNXB 3W6XA 3P2HA 4K30A 1QSNA 1GHEA 4KSFA 3D2MA 4JLYA 4PSXA 5G1ZA 2I00A 2DPTA 3G8WA 3KKWA 4KOXA 2WUUA 3DDDA 3R9FA 4B10A 4C7IA 1XMTA 5I0CA 4FD7A 4L89A 4CYNA 3EFAA 2KCWA 2ZW5A 3A9LA 4LX9A 5AG7A 2P6GA 1S7LA 3EO4A 2FXFA 3TE4A 4UCPA 3FXTA 4MY3A 4XNHC 2GANA 4UWJA 3IU1A 4F6AA 1MJAA 3V8IA 2JEVA 4MBUA 4CGNA 3BJ7A 4HNYB 2CXAA 2JDCA 1UFHA 1B6BA 1YVKA 2FCKA 3EY5A 4Y49C 3TO6A 2P6EA 2D4OA 2VZZA 4A95A 4U5YA 4NF1A 1YK3A 3JTKA 2B4BA 1QSTA 3TOAA 4JXQA 2YGWA 3I3GA 5FVJA 2CNMA 3F8KA 2PDOA 5C88A 4KVXA 4KOYA 2Z3OA 1Z4EA 1WK4A 4KOUA 2ZW7A 1P0HA 5AG5A 1M4GA 1YGHA 3FBUA 2HV2A 2R98A 2OU2A 2J8NA 1J4JA 1SQHA 2G0BA 4OLLA 5CNPA 4FD4A 2B5GB 1B87A 4AVBA 2VXKA 2B4DB 4C2YA 1KUYA 2JLMA 2WPXA 1FY7A 5DWNA 3LD2A 3IWEA 5J8CA 1VKCA 1NMTA 2B5GA 5A28A 3SXOA 4UFWA 4MY0A 4B12A 5J8FA 4R87A 4CGLA 2B4DA 2IL4A 4CYQA 4UFVA 1IICA 1ON0A 1LRZA 3N7ZA 4F0YA 3WR7A 5IX3A 4R3KA 1Q2YA 4RI1A 2Y0MA 1IYLA 3CXPA 3S6KA 1S60A 3TFYA 1YVOA 2OZHA 4U9ZA 4CYPA 1Q2CA 1S7FA 4EVYA 3T9YA 2GIVA 5F46A 2EVNA 3D2PA 2VBQA 2VQYA 4JXRA 3VWDA 5BWAB 4JWPA 1I12A 5EC4A 4PSWA 2YNCC 3DR8A 4MFQA 3DSBA 2VI7A 4B14A 3C26A 2WSAA 4CRZB 3H5ZA 2YNEA 3K9UA 1N71A 2PRBA 2Z10A 1BO4A 2FS5A 1VHSA 3JVNA 4UA3A 4A30A 4MJ8A 5H84A 1M1DA 2VEZA 4B5OA 5IB0A 3S6FA 4HKFA 4CGMA 3H4QA 1QSRA 3F0AA 1YLEA 2Z3NA 4H6ZA 4F0XA 2OB0A 1WWZA 4KLVA 1Z9UA 1QSOA 2VZYA 2ZW4A 3T90A 2GE3A 1Y9WA 2DPSA 2FIAA 4CRYB 4ONUA 4C68A 3SXNA 4CS0B 1S7KA 1MJ9A 4XPKA 5AG4A 5KTDA 4KSAA 1KUVA 4QVTA 4HNWB 4PK2A 4C2XA 1S7NA 2REEA 2AE6A 1MJBA 4AB7A 4ZGYB 4PK3A 5G21A 4U9YA 1PU9A 4MFKA 1S3ZA 5AGEA 4R57A 3QAHA 4UBRA 4FD6A 3NE7A 3BJ8A 5A27A 2ATRA 4KOSA 2C27A 4E8OA 4B11A 2REFA 4KOVA 2CY2A 5GCNA 3G3SA 1L0CA 3DNSA 2Q04A 4QUSA 1KUXA 5G22A 4R3LA 3TCVA 2OZUA 2Q7BA 2QIRA 4UCNA 1RXTA 4UCMA 3RYOA 5JQ4A 2P0WA 1QSMA 1R57A 1PUAA 3TT2A 3FIXA 4II9A 4YRHA 2PQ8A 2R8VA 1KZFA 4MFJA 5ISVA 2FSRA 1IIDA 4NSQA 4CAVA 1Q2DA 3S6GA 5H86A 4A33A 2FT0A 2DXQA 4L8AA 2CNSA 4QBJA 2Q4VA 3R96A 2I79A 4C2ZA 1MK4A 2HUZA 4KUBA 2B3UA 4XPDB 2BSWA 4Q36A 3FRMA 2ARHA 2Q0YA 4A31A 4ZBGA 2D4PA 4A32A 3IWGA 1IYKA 3GYAA 2PR8A 4E2AA 3I9SA 4LUAA 1M44A 2PSWA 3TO7A 4AG7A 4J3GA 3ZJ0A 1NE9A 2ZW6A 4JJXA 3JUWA 3CXSA 3CXQA 1Y9KA 4RS2A 5KTAA 2EUIA 3GKRA 2G3AA 2B58A 2WPWA 3PZJA 1K4JA 4BBHA 2BL1A 4JD6A 1CJWA 2OH1A 1YREA 2H5MA 4R9MA 4B13A 3D8PA 5HMNA 4X5KA 2BUEA 2A4NA 1Y7RA 2Q4YA 4UWIA 4MFPA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2FL4 A;  2O28 A;  3QB8 A;  4B5P A;  1XEB A;  1V0C A;  3EXN A;  4QC6 A;  3F5B A;  4XPL A;  1RO5 A;  4NEX A;  2G3T A;  4BMH A;  3D3S A;  2AJ6 A;  2R7H A;  3LOD A;  5F49 A;  4PV6 A;  4AG9 A;  4KOT A;  4OAD A;  4OAE A;  3R9E A;  1IB1 E;  3GY9 A;  2JDD A;  1XF8 A;  2BEI A;  5EBV A;  2NMT A;  5DWM A;  1M4I A;  3FB3 A;  2Z11 A;  2J8M A;  4KVO E;  3W91 A;  4KOR A;  4M3S A;  3P2F A;  4MI4 A;  4YGO A;  4QB9 A;  5E96 A;  4YFJ A;  1YX0 A;  4AVA A;  2B3V A;  2X7B A;  2P6F A;  2ZPA A;  5IV0 A;  5HH1 A;  4NCZ A;  4E0A A;  2Z0Z A;  4CAW A;  3OWC A;  4KOW A;  4NXY A;  4H89 A;  3FNC A;  1TIQ A;  3E0K A;  2PC1 A;  4AVC A;  3ZZI A;  2QEC A;  1NSL A;  4H6U A;  2Q44 A;  5F47 A;  4MHD A;  3R1K A;  3S6H A;  4KUA A;  3TOB A;  4IUS A;  3IGR A;  3R95 A;  1I21 A;  1I1D A;  1YR0 A;  3DR6 A;  4KLW A;  5F48 A;  3PGP A;  3UY5 A;  3TO9 A;  2K5T A;  1P4N A;  3SHP A;  2F5I A;  2OZG A;  4KVM E;  4KZT A;  2FE7 A;  1Z4R A;  5KTC A;  1XE4 A;  3FYN A;  3VWE A;  2FIW A;  1OZP A;  1S5K A;  4XNH B;  3R9G A;  2RC4 A;  4GS4 A;  4DNC A;  2PR1 A;  1U6M A;  2R1I A;  3PP9 A;  2CNT A;  3MGD A;  4CAX A;  5C82 A;  4FD5 A;  3W6S A;  4Y49 B;  4ORF A;  3TTH A;  2ZXV A;  3B8G A;  1CM0 A;  4IF5 A;  4B5P B;  4M85 A;  1XIX A;  2QML A;  2HQY A;  3EC4 A;  4I49 A;  2J8R A;  1M4D A;  1BOB A;  4XPD C;  5JPH A;  3BLN A;  4HNX B;  3W6X A;  3P2H A;  4K30 A;  1QSN A;  1GHE A;  3D2M A;  4JLY A;  4PSX A;  2I00 A;  3G8W A;  3KKW A;  4KOX A;  3R9F A;  3DDD A;  1XMT A;  5I0C A;  4FD7 A;  4L89 A;  3EFA A;  2KCW A;  2ZW5 A;  4LX9 A;  2P6G A;  1S7L A;  3EO4 A;  2FXF A;  3TE4 A;  3FXT A;  4MY3 A;  4XNH C;  2GAN A;  4UWJ A;  4F6A A;  1MJA A;  3V8I A;  2JEV A;  4MBU A;  3BJ7 A;  4HNY B;  2JDC A;  1UFH A;  1B6B A;  1YVK A;  2FCK A;  3EY5 A;  4Y49 C;  3TO6 A;  2P6E A;  2D4O A;  2VZZ A;  4U5Y A;  4NF1 A;  1YK3 A;  2B4B A;  1QST A;  3TOA A;  4JXQ A;  3I3G A;  5FVJ A;  2CNM A;  3F8K A;  2PDO A;  5C88 A;  4KVX A;  4KOY A;  1Z4E A;  1WK4 A;  4KOU A;  2ZW7 A;  1P0H A;  1M4G A;  1YGH A;  3FBU A;  2HV2 A;  2R98 A;  2OU2 A;  2J8N A;  1J4J A;  1SQH A;  2G0B A;  4OLL A;  5CNP A;  4FD4 A;  2B5G B;  1B87 A;  4AVB A;  2VXK A;  2B4D B;  1KUY A;  2JLM A;  2WPX A;  1FY7 A;  5DWN A;  3LD2 A;  5J8C A;  1VKC A;  1NMT A;  2B5G A;  3SXO A;  4MY0 A;  5J8F A;  4R87 A;  2B4D A;  2IL4 A;  1IIC A;  1ON0 A;  1LRZ A;  3N7Z A;  4F0Y A;  3WR7 A;  5IX3 A;  4R3K A;  1Q2Y A;  4RI1 A;  2Y0M A;  1IYL A;  3CXP A;  3S6K A;  1S60 A;  3TFY A;  1YVO A;  2OZH A;  4U9Z A;  1Q2C A;  1S7F A;  4EVY A;  3T9Y A;  2GIV A;  5F46 A;  2EVN A;  3D2P A;  2VBQ A;  2VQY A;  4JXR A;  3VWD A;  4JWP A;  1I12 A;  5EC4 A;  4PSW A;  3DR8 A;  3DSB A;  2VI7 A;  3C26 A;  4CRZ B;  3K9U A;  1N71 A;  2PRB A;  2Z10 A;  1BO4 A;  2FS5 A;  1VHS A;  3JVN A;  4UA3 A;  4MJ8 A;  5H84 A;  1M1D A;  2VEZ A;  4B5O A;  5IB0 A;  3S6F A;  4HKF A;  3H4Q A;  1QSR A;  3F0A A;  1YLE A;  4H6Z A;  2OB0 A;  1WWZ A;  4KLV A;  1Z9U A;  1QSO A;  2VZY A;  2ZW4 A;  3T90 A;  2GE3 A;  1Y9W A;  2FIA A;  4CRY B;  4ONU A;  3SXN A;  4CS0 B;  1S7K A;  1MJ9 A;  4XPK A;  5KTD A;  1KUV A;  4QVT A;  4HNW B;  4PK2 A;  1S7N A;  2REE A;  2AE6 A;  1MJB A;  4AB7 A;  4PK3 A;  4U9Y A;  1PU9 A;  1S3Z A;  4R57 A;  3QAH A;  4UBR A;  4FD6 A;  3NE7 A;  3BJ8 A;  2ATR A;  4KOS A;  2C27 A;  4E8O A;  2REF A;  4KOV A;  2CY2 A;  5GCN A;  3G3S A;  1L0C A;  3DNS A;  2Q04 A;  4QUS A;  1KUX A;  4R3L A;  3TCV A;  2OZU A;  2Q7B A;  2QIR A;  1RXT A;  3RYO A;  5JQ4 A;  2P0W A;  1QSM A;  1R57 A;  1PUA A;  3TT2 A;  3FIX A;  4II9 A;  4YRH A;  2PQ8 A;  2R8V A;  1KZF A;  5ISV A;  2FSR A;  1IID A;  4NSQ A;  4CAV A;  1Q2D A;  3S6G A;  5H86 A;  2FT0 A;  2DXQ A;  4L8A A;  2CNS A;  4QBJ A;  2Q4V A;  3R96 A;  2I79 A;  1MK4 A;  2HUZ A;  4KUB A;  2B3U A;  4XPD B;  2BSW A;  3FRM A;  2ARH A;  2Q0Y A;  4ZBG A;  2D4P A;  3IWG A;  1IYK A;  3GYA A;  2PR8 A;  4E2A A;  3I9S A;  4LUA A;  1M44 A;  2PSW A;  3TO7 A;  4AG7 A;  4J3G A;  3ZJ0 A;  1NE9 A;  2ZW6 A;  4JJX A;  3JUW A;  3CXS A;  3CXQ A;  1Y9K A;  4RS2 A;  5KTA A;  2EUI A;  3GKR A;  2G3A A;  2B58 A;  2WPW A;  3PZJ A;  1K4J A;  2BL1 A;  4JD6 A;  1CJW A;  2OH1 A;  1YRE A;  2H5M A;  4R9M A;  3D8P A;  5HMN A;  4X5K A;  2BUE A;  2A4N A;  1Y7R A;  2Q4Y A;  4UWI A; 
#chains in the Genus database with same CATH topology
 2YND A;  2FL4 A;  2O28 A;  3QB8 A;  4B5P A;  3D68 A;  1XEB A;  2QJ8 A;  1V0C A;  4PPZ A;  5DS0 A;  1FT7 A;  3EXN A;  4QC6 A;  3H8G A;  3F5B A;  4A38 A;  2PJ8 A;  4IHM A;  4ZX9 A;  3HUV A;  3B3C A;  3VAR A;  4WWV A;  4XPL A;  4A37 A;  1RO5 A;  4NEX A;  2G3T A;  4UF4 A;  2Z3M A;  4BMH A;  4ZX8 A;  3D3S A;  2AJ6 A;  2R7H A;  3LOD A;  3KL9 A;  3IU2 A;  2ZEF A;  5F49 A;  3D67 A;  4PV6 A;  4YWY A;  5HVG A;  4AG9 A;  4KOT A;  4OAD A;  4OAE A;  3R9E A;  1IB1 E;  1LOK A;  2BCO A;  2ZED A;  3B35 A;  2JDD A;  1XF8 A;  3GY9 A;  4BIN A;  1HEE A;  1YW6 A;  3D7G A;  2BEI A;  4CGO A;  1A2Z A;  5EBV A;  2NMT A;  3NE8 A;  5DWM A;  1M4I A;  2Z3P A;  7CPA A;  4FUU A;  1XMB A;  4NJR A;  3FB3 A;  2Z11 A;  3KHX A;  4P10 A;  4MCS A;  4X2T A;  2J8M A;  4KVO E;  3W91 A;  4KOR A;  5CPA A;  1Q7L A;  4A2Z A;  4CGP A;  1ZO0 A;  4M3S A;  3P2F A;  4MI4 A;  2DF5 A;  3CDX A;  1R3N A;  4YGO A;  4CAF A;  2GLJ A;  4QB9 A;  5E96 A;  4YFJ A;  4MFL A;  4NGM A;  3TX8 A;  1YX0 A;  2PRQ A;  4AVA A;  2B3V A;  4KS9 A;  2X7B A;  1ARL A;  2P6F A;  2PJ2 A;  2ZPA A;  4MRI A;  5IV0 A;  3FX6 A;  4OC2 A;  2CF4 A;  5HH1 A;  4NCZ A;  4E0A A;  2Z0Z A;  3NFZ A;  4Q38 A;  4CAW A;  5G20 A;  3OWC A;  4KOW A;  4MFZ A;  4WJB A;  2ZEP A;  4MHY A;  2ODF A;  4NXY A;  3VH9 A;  4H89 A;  3FNC A;  3BI0 A;  1TIQ A;  3E0K A;  2PC1 A;  4AVC A;  3S9L A;  2AFW A;  4UIA A;  3ZZI A;  2PJC A;  5AG6 A;  2PE3 A;  1DTD A;  2QEC A;  3K2K A;  2C6P A;  2AFO A;  4LQ6 A;  3DLJ A;  3T8W A;  1NSL A;  4H6U A;  4NGQ A;  2Q44 A;  4NGS A;  5F09 A;  4PQA A;  4UEZ A;  4MHD A;  4UFX A;  1AUG A;  5F47 A;  5I4M A;  3R1K A;  3S6H A;  4KUA A;  3TOB A;  4IUS A;  4MHP A;  3IGR A;  5CBM A;  3R95 A;  1I21 A;  1I1D A;  1YR0 A;  2Z3L A;  3DR6 A;  3H8F A;  4KLW A;  4OKO A;  5F48 A;  1NSA A;  3PGP A;  4OC1 A;  2BO9 A;  3UY5 A;  2Z3K A;  3SJX A;  1ZG7 A;  3TO9 A;  2K5T A;  1P4N A;  3SHP A;  1LCP A;  2F5I A;  4OIW A;  2OZG A;  4KVM E;  1AMP A;  4KZT A;  1IOF A;  1BPM A;  1Z4R A;  2FE7 A;  3ISX A;  5KTC A;  2XEJ A;  1XE4 A;  4CYO A;  1Y0R A;  3FYN A;  2F8H A;  3VWE A;  2FIW A;  2YNC A;  1ZLH A;  2ZEL A;  1OZP A;  1S5K A;  2XEG A;  2QVP A;  3D4U A;  3SJF A;  4XNH B;  1AYE A;  3R9G A;  2RC4 A;  3CPA A;  4OME A;  4GS4 A;  4DNC A;  4CAE A;  3NA6 A;  2PR1 A;  3KQX A;  1TF9 A;  1U6M A;  2R1I A;  4MCQ A;  3WC6 A;  3B3V A;  4NGT A;  1HDU A;  3PP9 A;  2CNT A;  3NH4 A;  3MGD A;  1F57 A;  1M4L A;  4LQG A;  4CAX A;  3JRU A;  5C82 A;  4FD5 A;  2AFU A;  2CIJ A;  3B3T A;  3KI9 A;  4ORF A;  4X3R A;  4Y49 B;  3W6S A;  4C7H A;  3TTH A;  4G1P A;  4P45 A;  4F9V A;  4PXE A;  2FVG A;  2ZXV A;  3B8G A;  1CM0 A;  4IF5 A;  4B5P B;  2QYV A;  2JBK A;  4M85 A;  1BPN A;  1Z8X A;  3I1U A;  2ZEM A;  1XIX A;  2QML A;  2HQY A;  3EC4 A;  4I49 A;  1ZLI A;  4IAV A;  4OC4 A;  4ZI6 A;  2J8R A;  1M4D A;  1IY7 A;  1BOB A;  4XPD C;  1Z5R A;  3BLN A;  5JPH A;  4HNX B;  3W6X A;  3P2H A;  2PJ5 A;  4K30 A;  2IMO A;  1QSN A;  1DE4 C;  1GHE A;  4KSF A;  3D2M A;  4JLY A;  4PSX A;  5G1Z A;  1XFO A;  2I00 A;  2DPT A;  3G8W A;  3KKW A;  4KOX A;  4YU9 A;  2WUU A;  3B7I A;  3DDD A;  3L2N A;  5LYD A;  3R9F A;  4B10 A;  3KHZ A;  1XMT A;  2C6G A;  4Q7A A;  2OOT A;  4C7I A;  4FAI A;  4FD7 A;  5I0C A;  1ZG9 A;  3MRU A;  3IWW A;  4L89 A;  4CYN A;  3EFA A;  3PBB A;  2WZN A;  2KCW A;  3K9T A;  2O4H A;  2ZEG A;  2ZW5 A;  3A9L A;  2I3C A;  4LX9 A;  5AG7 A;  2P6G A;  3IC1 A;  1S7L A;  3EO4 A;  1YME A;  2FXF A;  4RN7 A;  1IOI A;  1PCA A;  3RAM A;  3TE4 A;  2PCU A;  1CX8 A;  1Z8W A;  4UCP A;  3FXT A;  3FEE A;  4MY3 A;  4XNH C;  2GAN A;  4UWJ A;  5JGF A;  3IU1 A;  2CTB A;  4P4J A;  4F6A A;  1MJA A;  1FNO A;  1Z2L A;  3V8I A;  2JEV A;  4MBU A;  4B6Z A;  4CGN A;  3BJ7 A;  4HNY B;  1ELL P;  2CXA A;  2JDC A;  1UFH A;  1B6B A;  1YVK A;  2PJ3 A;  2FCK A;  4A94 A;  3EY5 A;  4Y49 C;  3TO6 A;  2BOA A;  2HC9 A;  2P6E A;  1Z8L A;  2D4O A;  2VZZ A;  3SI0 A;  4A95 A;  3WT4 A;  4U5Y A;  2IJZ A;  2JEW A;  2V77 A;  1KWM A;  1YK3 A;  4NF1 A;  4X8I A;  1Z8T A;  2B4B A;  3IFE A;  3JTK A;  4DUK A;  1LAP A;  1QST A;  3TC8 A;  3TOA A;  5LRK A;  4JXQ A;  2YGW A;  5D8N A;  1CP7 A;  1CPX A;  3I3G A;  5FVJ A;  2CNM A;  2PJ6 A;  2ZEO A;  3F8K A;  2PDO A;  1BAV A;  5C88 A;  4KVX A;  3QAY A;  3D7F A;  4KOY A;  3PB9 X;  2Z3O A;  1Z4E A;  4OID A;  1WK4 A;  4KOU A;  2ZW7 A;  1P0H A;  5AG5 A;  1M4G A;  1YGH A;  4UEE A;  3FBU A;  3WC7 A;  5JH9 A;  2V8H A;  2HV2 A;  2R98 A;  4EFD A;  2PVW A;  2OR4 A;  3HLP A;  3PB7 X;  4ZY0 A;  2OU2 A;  1LFW A;  2J8N A;  2GRE A;  1J4J A;  1QMU A;  1SQH A;  2AFM A;  2G0B A;  3RO0 A;  2GU2 A;  4TNU A;  3GLJ A;  2ZEH A;  4FD4 A;  4OLL A;  2B5G B;  1YLO A;  5CNP A;  4EWT A;  1B87 A;  2V8D A;  3D7H A;  5K8P A;  4AVB A;  2VXK A;  2JBJ A;  3KGQ A;  2B4D B;  4C2Y A;  3GB0 A;  3B3W A;  1KUY A;  2CTC A;  2JLM A;  2WPX A;  4MCP A;  3GUX A;  4MXU A;  4P4D A;  1XRY A;  1FY7 A;  3D7D A;  5DWN A;  3LD2 A;  3LWU A;  3IWE A;  1F2O A;  4MMO A;  1VKC A;  1NMT A;  2V8G A;  5J8C A;  2B5G A;  4GM5 A;  3B2Y A;  4EME A;  5A28 A;  3PFO A;  4UFW A;  4MY0 A;  3SXO A;  4B12 A;  5J8F A;  4R87 A;  4CGL A;  5K8M A;  2B4D A;  2IL4 A;  3FJU A;  5THW A;  3RBU A;  4R7M A;  4CYQ A;  2VL1 A;  3FED A;  1BLL E;  1IIC A;  2C6C A;  2G9D A;  1ON0 A;  3FEC A;  3PBE A;  4UFV A;  1LRZ A;  4O23 A;  3N7Z A;  4F0Y A;  3WR7 A;  5IX3 A;  4R3K A;  1Q2Y A;  3PB6 X;  4MCR A;  2ANP A;  4NGN A;  4RI1 A;  2Y0M A;  5K8O A;  1IYL A;  5LRG A;  5LYL A;  3CXP A;  3ISZ A;  1S60 A;  3S6K A;  2PJ4 A;  3TFY A;  1YVO A;  4R6T A;  2OZH A;  2HB6 A;  2PIY A;  4U9Z A;  4CYP A;  1Q2C A;  3CT9 A;  1VHE A;  1S7F A;  2EK8 A;  3CPX A;  3FH4 A;  3B3S A;  4EVY A;  4UEF A;  3RZA A;  1HDQ A;  1UWY A;  1ARM A;  3T9Y A;  2GIV A;  3KR5 A;  4M6G A;  4F8Z A;  3CZX A;  5F46 A;  2EVN A;  4DJL A;  3BHX A;  3D2P A;  3IO1 A;  5IB9 A;  3V7Z A;  2VBQ A;  1EE3 P;  1Y7E A;  3KR4 A;  2VQY A;  4JXR A;  3VWD A;  5BWA B;  4TWE A;  4JWP A;  4JZ0 A;  3D66 A;  4JYW A;  2ZEN A;  1ELM P;  1I12 A;  3QNV A;  5EC4 A;  2XEI A;  4PSW A;  2YNC C;  3DR8 A;  3DGV A;  4K3N A;  4MFQ A;  3DSB A;  2O53 A;  2VI7 A;  1TKF A;  3C26 A;  2WSA A;  4B14 A;  4CRZ B;  3H5Z A;  2YNE A;  4P4F A;  3K9U A;  2ZOF A;  1N71 A;  4MHZ A;  5EMI A;  2PRB A;  2Z10 A;  1BO4 A;  2FS5 A;  1JQG A;  1VHS A;  3NH8 A;  3JVN A;  1CBX A;  2AFZ A;  3N5F A;  4UA3 A;  1OBR A;  3BI1 A;  4MJ8 A;  1YW4 A;  5H84 A;  4PXB A;  4A30 A;  1M1D A;  2PJ7 A;  2VEZ A;  4B5O A;  5IB0 A;  3S6F A;  4HKF A;  4CGM A;  3H4Q A;  1QSR A;  3F0A A;  1YLE A;  2Z3N A;  2AFX A;  4H6Z A;  4F0X A;  3FMC A;  2OB0 A;  1WWZ A;  3KQZ A;  2Q7S A;  4KLV A;  5JM6 A;  1Z9U A;  1QSO A;  2VZY A;  2ZW4 A;  3T90 A;  3IJ3 A;  4R8F A;  2GE3 A;  1Y9W A;  2DPS A;  2FIA A;  2GFQ A;  4CRY B;  2PJ0 A;  4ONU A;  4C68 A;  4P4B A;  3SXN A;  4CS0 B;  1S7K A;  1MJ9 A;  4R76 A;  3WC5 A;  5LYF A;  4XPK A;  1Y0Y A;  2NYQ A;  5AG4 A;  5KTD A;  4P6Y A;  4KSA A;  3H8E A;  4NJQ A;  2ZEE A;  2ZOG A;  1KUV A;  1TKH A;  4QVT A;  4HNW B;  4PK2 A;  4C2X A;  1PYT B;  4ZYQ A;  1S7N A;  3MN8 A;  2PJB A;  4CPA A;  2REE A;  2AE6 A;  4DYO A;  1MJB A;  3FVL A;  4AB7 A;  4ZGY B;  3S9N A;  4PK3 A;  4PXC A;  8CPA A;  5G21 A;  1GYT A;  3PB4 X;  4U9Y A;  4UIB A;  1PU9 A;  4MFK A;  1S3Z A;  5AGE A;  4R57 A;  3QAH A;  4HPS A;  4UBR A;  4FD6 A;  5K8N A;  3NE7 A;  3RNZ A;  3BJ8 A;  2PJ1 A;  6CPA A;  5A27 A;  4MHN A;  2ATR A;  2C1C A;  4KOS A;  2C27 A;  4E8O A;  4B11 A;  2REF A;  4KOV A;  2CY2 A;  5GCN A;  3G3S A;  4OP4 A;  1L0C A;  3DNS A;  2Q04 A;  4QUS A;  1KUX A;  2POK A;  5G22 A;  4Z65 A;  2ABZ A;  4R3L A;  3TCV A;  2OZU A;  3LMS A;  2Q7B A;  5HVH A;  3SI2 A;  2QIR A;  4OC5 A;  4UCN A;  1IGB A;  3BXM A;  1RXT A;  4P4E A;  1H8L A;  2DEA A;  1TXR A;  4UCM A;  3RYO A;  2P0W A;  5JQ4 A;  1QSM A;  1LAM A;  2Q43 A;  4W9Y A;  4M6H A;  3LAC A;  4IK2 A;  1R57 A;  3KZW A;  4FBE A;  1PUA A;  4P44 A;  3TT2 A;  5D29 A;  2PVV A;  3FIX A;  4II9 A;  4YRH A;  1XOV A;  1IU8 A;  4ONW A;  3SJG A;  1YSJ A;  2PQ8 A;  1KZF A;  2R8V A;  2XEF A;  3KAS A;  4MFJ A;  4OC3 A;  3WAB A;  5ISV A;  3IEH A;  2FSR A;  1R43 A;  1IID A;  4NSQ A;  3V38 A;  3PRT A;  2EBJ A;  3SI1 A;  4CAV A;  2NSM A;  2Q4Z A;  1Q2D A;  3GIU A;  3S6G A;  5H86 A;  4A33 A;  2FT0 A;  3PFE A;  1CG2 A;  2DXQ A;  2Q51 A;  4L8A A;  1LAN A;  4A39 A;  4ZY2 A;  3VAT A;  2CNS A;  2RB7 A;  1VIX A;  2RFH A;  4NGP A;  4QBJ A;  2Q4V A;  3R96 A;  1VHO A;  2I79 A;  3FF3 A;  4C2Z A;  1MK4 A;  2HUZ A;  1X12 A;  4F9U A;  4KUB A;  2B3U A;  2PIZ A;  4XPD B;  2J9A A;  2BSW A;  4NFR A;  4PXD A;  4Q36 A;  3FRM A;  2ARH A;  2Q0Y A;  4A31 A;  2EWB A;  4BD9 A;  4NGR A;  4OC0 A;  1XJO A;  3PB8 X;  4ZBG A;  2D4P A;  1YQE A;  4KSI A;  4P4I A;  4A32 A;  3IWG A;  1IYK A;  3GYA A;  1VGY A;  3IIB A;  2PR8 A;  4E2A A;  3I9S A;  4LUA A;  5LYI A;  1M44 A;  3PEI A;  2PSW A;  1TF8 A;  1X10 A;  3TO7 A;  4AG7 A;  4J3G A;  3ZJ0 A;  3NH5 A;  1NE9 A;  2ZW6 A;  5LRJ A;  2EO8 A;  4JJX A;  3SJE A;  5J1Q A;  2PJA A;  3JUW A;  3CXS A;  3CXQ A;  1XBU A;  1ZG8 A;  1Y9K A;  1JWQ A;  4RS2 A;  5KTA A;  2EUI A;  2IQ6 A;  4RUH A;  3GKR A;  2G3A A;  2B58 A;  2WPW A;  3PZJ A;  1K4J A;  4GXH A;  5HVF A;  4BBH A;  2PJ9 A;  2F7V A;  2BL1 A;  4JD6 A;  1CJW A;  1F2P A;  2OH1 A;  1YRE A;  2H5M A;  4H2K A;  4M6I A;  4R9M A;  4B13 A;  3D8P A;  3S9M A;  5HMN A;  4X5K A;  2EK9 A;  1TKJ A;  2BUE A;  2WYR A;  5ELY A;  2A4N A;  4AXV A;  4ZY1 A;  1CP6 A;  1Y7R A;  4FWU A;  2Q4Y A;  2V8V A;  4UWI A;  1RTQ A;  5HXD A;  2GLF A;  2AFS A;  1QQ9 A;  4MFP A;  1CPS A; 
#chains in the Genus database with same CATH homology
 2YND A;  2FL4 A;  2O28 A;  3QB8 A;  4B5P A;  1XEB A;  1V0C A;  3EXN A;  4QC6 A;  3F5B A;  4XPL A;  1RO5 A;  4NEX A;  2G3T A;  2Z3M A;  4BMH A;  3D3S A;  2AJ6 A;  2R7H A;  3LOD A;  3IU2 A;  5F49 A;  4PV6 A;  4AG9 A;  4KOT A;  4OAD A;  4OAE A;  3R9E A;  1IB1 E;  3GY9 A;  2JDD A;  1XF8 A;  2BEI A;  4CGO A;  5EBV A;  2NMT A;  5DWM A;  1M4I A;  2Z3P A;  3FB3 A;  2Z11 A;  2J8M A;  4KVO E;  3W91 A;  4KOR A;  4A2Z A;  4CGP A;  1ZO0 A;  4M3S A;  3P2F A;  4MI4 A;  4YGO A;  4CAF A;  4QB9 A;  5E96 A;  4YFJ A;  4MFL A;  1YX0 A;  4AVA A;  2B3V A;  4KS9 A;  2X7B A;  2P6F A;  2ZPA A;  5IV0 A;  5HH1 A;  4NCZ A;  4E0A A;  2Z0Z A;  4Q38 A;  4CAW A;  5G20 A;  3OWC A;  4KOW A;  4MFZ A;  4NXY A;  4H89 A;  3FNC A;  1TIQ A;  3E0K A;  2PC1 A;  4AVC A;  3ZZI A;  5AG6 A;  2QEC A;  1NSL A;  4H6U A;  2Q44 A;  5F47 A;  4MHD A;  4UFX A;  3R1K A;  3S6H A;  4KUA A;  3TOB A;  4IUS A;  3IGR A;  3R95 A;  1I21 A;  1I1D A;  1YR0 A;  2Z3L A;  3DR6 A;  4KLW A;  5F48 A;  3PGP A;  3UY5 A;  2Z3K A;  3TO9 A;  2K5T A;  1P4N A;  3SHP A;  2F5I A;  2OZG A;  4KVM E;  4KZT A;  2FE7 A;  1Z4R A;  5KTC A;  4CYO A;  1XE4 A;  3FYN A;  3VWE A;  2FIW A;  2YNC A;  1OZP A;  1S5K A;  4XNH B;  3R9G A;  2RC4 A;  4GS4 A;  4DNC A;  4CAE A;  2PR1 A;  1U6M A;  2R1I A;  3PP9 A;  2CNT A;  3MGD A;  4CAX A;  5C82 A;  4FD5 A;  3W6S A;  4Y49 B;  4ORF A;  4C7H A;  3TTH A;  2ZXV A;  3B8G A;  1CM0 A;  4IF5 A;  4B5P B;  4M85 A;  1XIX A;  2QML A;  2HQY A;  3EC4 A;  4I49 A;  2J8R A;  1M4D A;  1BOB A;  4XPD C;  5JPH A;  3BLN A;  4HNX B;  3W6X A;  3P2H A;  4K30 A;  1QSN A;  1GHE A;  4KSF A;  3D2M A;  4JLY A;  4PSX A;  5G1Z A;  2I00 A;  2DPT A;  3G8W A;  3KKW A;  4KOX A;  2WUU A;  3DDD A;  3R9F A;  4B10 A;  4C7I A;  1XMT A;  5I0C A;  4FD7 A;  4L89 A;  4CYN A;  3EFA A;  2KCW A;  2ZW5 A;  3A9L A;  4LX9 A;  5AG7 A;  2P6G A;  1S7L A;  3EO4 A;  2FXF A;  3TE4 A;  4UCP A;  3FXT A;  4MY3 A;  4XNH C;  2GAN A;  4UWJ A;  3IU1 A;  4F6A A;  1MJA A;  3V8I A;  2JEV A;  4MBU A;  4CGN A;  3BJ7 A;  4HNY B;  2CXA A;  2JDC A;  1UFH A;  1B6B A;  1YVK A;  2FCK A;  3EY5 A;  4Y49 C;  3TO6 A;  2P6E A;  2D4O A;  2VZZ A;  4A95 A;  4U5Y A;  4NF1 A;  1YK3 A;  3JTK A;  2B4B A;  1QST A;  3TOA A;  4JXQ A;  2YGW A;  3I3G A;  5FVJ A;  2CNM A;  3F8K A;  2PDO A;  5C88 A;  4KVX A;  4KOY A;  2Z3O A;  1Z4E A;  1WK4 A;  4KOU A;  2ZW7 A;  1P0H A;  5AG5 A;  1M4G A;  1YGH A;  3FBU A;  2HV2 A;  2R98 A;  2OU2 A;  2J8N A;  1J4J A;  1SQH A;  2G0B A;  4OLL A;  5CNP A;  4FD4 A;  2B5G B;  1B87 A;  4AVB A;  2VXK A;  2B4D B;  4C2Y A;  1KUY A;  2JLM A;  2WPX A;  1FY7 A;  5DWN A;  3LD2 A;  3IWE A;  5J8C A;  1VKC A;  1NMT A;  2B5G A;  5A28 A;  3SXO A;  4UFW A;  4MY0 A;  4B12 A;  5J8F A;  4R87 A;  4CGL A;  2B4D A;  2IL4 A;  4CYQ A;  4UFV A;  1IIC A;  1ON0 A;  1LRZ A;  3N7Z A;  4F0Y A;  3WR7 A;  5IX3 A;  4R3K A;  1Q2Y A;  4RI1 A;  2Y0M A;  1IYL A;  3CXP A;  3S6K A;  1S60 A;  3TFY A;  1YVO A;  2OZH A;  4U9Z A;  4CYP A;  1Q2C A;  1S7F A;  4EVY A;  3T9Y A;  2GIV A;  5F46 A;  2EVN A;  3D2P A;  2VBQ A;  2VQY A;  4JXR A;  3VWD A;  5BWA B;  4JWP A;  1I12 A;  5EC4 A;  4PSW A;  2YNC C;  3DR8 A;  4MFQ A;  3DSB A;  2VI7 A;  4B14 A;  3C26 A;  2WSA A;  4CRZ B;  3H5Z A;  2YNE A;  3K9U A;  1N71 A;  2PRB A;  2Z10 A;  1BO4 A;  2FS5 A;  1VHS A;  3JVN A;  4UA3 A;  4A30 A;  4MJ8 A;  5H84 A;  1M1D A;  2VEZ A;  4B5O A;  5IB0 A;  3S6F A;  4HKF A;  4CGM A;  3H4Q A;  1QSR A;  3F0A A;  1YLE A;  2Z3N A;  4H6Z A;  4F0X A;  2OB0 A;  1WWZ A;  4KLV A;  1Z9U A;  1QSO A;  2VZY A;  2ZW4 A;  3T90 A;  2GE3 A;  1Y9W A;  2DPS A;  2FIA A;  4CRY B;  4ONU A;  4C68 A;  3SXN A;  4CS0 B;  1S7K A;  1MJ9 A;  4XPK A;  5AG4 A;  5KTD A;  4KSA A;  1KUV A;  4QVT A;  4HNW B;  4PK2 A;  4C2X A;  1S7N A;  2REE A;  2AE6 A;  1MJB A;  4AB7 A;  4ZGY B;  4PK3 A;  5G21 A;  4U9Y A;  1PU9 A;  4MFK A;  1S3Z A;  5AGE A;  4R57 A;  3QAH A;  4UBR A;  4FD6 A;  3NE7 A;  3BJ8 A;  5A27 A;  2ATR A;  4KOS A;  2C27 A;  4E8O A;  4B11 A;  2REF A;  4KOV A;  2CY2 A;  5GCN A;  3G3S A;  1L0C A;  3DNS A;  2Q04 A;  4QUS A;  1KUX A;  5G22 A;  4R3L A;  3TCV A;  2OZU A;  2Q7B A;  2QIR A;  4UCN A;  1RXT A;  4UCM A;  3RYO A;  5JQ4 A;  2P0W A;  1QSM A;  1R57 A;  1PUA A;  3TT2 A;  3FIX A;  4II9 A;  4YRH A;  2PQ8 A;  2R8V A;  1KZF A;  4MFJ A;  5ISV A;  2FSR A;  1IID A;  4NSQ A;  4CAV A;  1Q2D A;  3S6G A;  5H86 A;  4A33 A;  2FT0 A;  2DXQ A;  4L8A A;  2CNS A;  4QBJ A;  2Q4V A;  3R96 A;  2I79 A;  4C2Z A;  1MK4 A;  2HUZ A;  4KUB A;  2B3U A;  4XPD B;  2BSW A;  4Q36 A;  3FRM A;  2ARH A;  2Q0Y A;  4A31 A;  4ZBG A;  2D4P A;  4A32 A;  3IWG A;  1IYK A;  3GYA A;  2PR8 A;  4E2A A;  3I9S A;  4LUA A;  1M44 A;  2PSW A;  3TO7 A;  4AG7 A;  4J3G A;  3ZJ0 A;  1NE9 A;  2ZW6 A;  4JJX A;  3JUW A;  3CXS A;  3CXQ A;  1Y9K A;  4RS2 A;  5KTA A;  2EUI A;  3GKR A;  2G3A A;  2B58 A;  2WPW A;  3PZJ A;  1K4J A;  4BBH A;  2BL1 A;  4JD6 A;  1CJW A;  2OH1 A;  1YRE A;  2H5M A;  4R9M A;  4B13 A;  3D8P A;  5HMN A;  4X5K A;  2BUE A;  2A4N A;  1Y7R A;  2Q4Y A;  4UWI A;  4MFP A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...