5H86A

Human gcn5 bound to butyryl-coa
Total Genus 44
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
44
sequence length
167
structure length
167
Chain Sequence
SGIIEFHVIGNSLTPKANRRVLLWLVGLQNVFSHQLPRMPKEYIARLVFDPKHKTLALIKDGRVIGGICFRMFPTQGFTEIVFCAVTSNEQVKGYGTHLMNHLKEYHIKHNILYFLTYADEYAIGYFKKQGFSKDIKVPKSRYLGYIKDYEGATLMECELNPRIPYT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Histone acetyltransferase KAT2A
publication title Structural basis for acyl-group discrimination by human Gcn5L2.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
total genus 44
structure length 167
sequence length 167
ec nomenclature ec 2.3.1.48: Histone acetyltransferase.
pdb deposition date 2015-12-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00583 Acetyltransf_1 Acetyltransferase (GNAT) family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.630.30 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Aminopeptidase 5h86A00
2HUZA 1QSNA 1UFHA 2EUIA 4QBJA 5JPHA 4KOSA 2BEIA 3F5BA 1IYLA 4KZTA 2ARHA 1S7LA 1BOBA 4HNXB 4FD6A 4H6UA 5DWMA 4OADA 3QB8A 4R3LA 1BO4A 4R9MA 3DDDA 1Q2DA 3G3SA 4JD6A 2B3VA 4HNYB 2ZPAA 4KUBA 4YGOA 3IWGA 2CY2A 1XE4A 4LUAA 3TO7A 2NMTA 2PR8A 2QMLA 5HMNA 3IGRA 4Y49C 3DSBA 1Q2YA 4RS2A 5J8FA 2X7BA 1WWZA 1M1DA 1XMTA 4DNCA 1VKCA 3E0KA 4H6ZA 4KVME 4GS4A 4OLLA 3QAHA 4QC6A 2FL4A 2KCWA 4NSQA 2IL4A 2OU2A 4F6AA 2J8RA 2VZYA 2A4NA 4B5OA 2VQYA 4BMHA 3MGDA 1IYKA 4J3GA 4NXYA 4E0AA 2OZHA 1QSRA 1S3ZA 4JXRA 2HQYA 3I3GA 5GCNA 2FIWA 4PV6A 2K5TA 1S60A 1GHEA 2Q4YA 1YLEA 4JWPA 2DXQA 5KTCA 3DR6A 1NMTA 2H5MA 2PC1A 4U9YA 4L89A 4KOTA 3VWEA 4MBUA 4CS0B 3CXSA 4XPDC 1N71A 4KUAA 4KORA 2G3AA 3R1KA 5C88A 4L8AA 3N7ZA 5I0CA 2ZW4A 3D2PA 2Q0YA 3SHPA 3D2MA 3CXQA 2OZGA 2REEA 1Z4EA 2Z0ZA 1M4GA 1QSTA 1I12A 1S7KA 5IB0A 3FRMA 1XEBA 2I79A 4ONUA 3WR7A 2GANA 2Z10A 4MY0A 4UWIA 3TCVA 1KZFA 5F48A 4MI4A 4U9ZA 2ZXVA 3TO9A 5J8CA 4AG7A 5KTAA 2ATRA 2VI7A 3R9FA 3TT2A 1S7NA 4AVCA 3TE4A 4R87A 4FD4A 2B3UA 2OB0A 4KLWA 3PZJA 2FSRA 2BL1A 5FVJA 1ON0A 4II9A 1K4JA 4X5KA 5ISVA 1MK4A 3S6KA 2B58A 3EY5A 1IIDA 3H4QA 3PGPA 4F0YA 4CRYB 4QB9A 4U5YA 3T9YA 1RXTA 5DWNA 3TOBA 4NEXA 5F47A 4KOYA 2VXKA 2FIAA 1YR0A 3BJ7A 2B4BA 3ZJ0A 2FS5A 2PR1A 2JLMA 3DNSA 3TTHA 5C82A 3W6XA 2Z11A 3FB3A 3S6FA 3S6GA 2PQ8A 3FXTA 4ORFA 5HH1A 4XNHB 2P6FA 1B87A 3ZZIA 3BJ8A 3R96A 1P4NA 2VZZA 1VHSA 3B8GA 1V0CA 4M85A 3EC4A 3SXOA 4YFJA 4PK2A 4AVAA 2J8NA 3LODA 4ZBGA 1WK4A 2JDDA 1Y9WA 2FT0A 2BSWA 1SQHA 4KOXA 4UBRA 2R98A 3CXPA 3FNCA 2Q7BA 1XIXA 2OZUA 3P2FA 4KOWA 4KOUA 2WPXA 1S7FA 2BUEA 3JUWA 1PUAA 2JEVA 2G0BA 3GKRA 3K9UA 3R9EA 1Z9UA 4PK3A 2ZW6A 3DR8A 4YRHA 2JDCA 4PSXA 5H86A 2ZW7A 4JXQA 5KTDA 2QIRA 4QVTA 1B6BA 1Q2CA 3VWDA 3F0AA 4NCZA 1MJBA 1M4IA 3D3SA 4UA3A 1S5KA 2D4OA 3RYOA 4MHDA 2Y0MA 5F46A 3EO4A 4OAEA 2FE7A 1MJ9A 1KUXA 4E2AA 4R57A 2C27A 2R7HA 2CNMA 4CAWA 2D4PA 2J8MA 3P2HA 4E8OA 2Q04A 1KUYA 2RC4A 1MJAA 3C26A 5EBVA 2VBQA 4XPLA 3OWCA 1Y7RA 1XF8A 2P6GA 4I49A 2O28A 2GIVA 2HV2A 3PP9A 1RO5A 2FXFA 4AVBA 3S6HA 1QSMA 3T90A 4QUSA 1IB1E 2AJ6A 1I1DA 4Y49B 2Q44A 3G8WA 5E96A 1CJWA 2PDOA 4LX9A 1U6MA 1OZPA 4CAVA 3FBUA 3BLNA 5EC4A 1J4JA 3V8IA 1YREA 4MJ8A 4M3SA 4B5PB 2P0WA 2B5GB 2B4DB 2FCKA 3I9SA 3JVNA 2VEZA 2ZW5A 2R1IA 1FY7A 3GY9A 5IX3A 3W91A 4UWJA 4JJXA 3EXNA 2CNSA 1PU9A 2EVNA 2CNTA 2REFA 3FIXA 4K30A 1NSLA 4JLYA 2PRBA 3KKWA 5IV0A 3W6SA 2R8VA 4AG9A 4B5PA 1YGHA 1YVOA 2B5GA 2B4DA 4XNHC 4IUSA 3UY5A 1L0CA 4KLVA 1Z4RA 4KVXA 2G3TA 1IICA 2F5IA 4KOVA 1M44A 5JQ4A 3TOAA 1YX0A 1QSOA 2WPWA 4XPKA 2P6EA 4XPDB 4PSWA 4FD7A 3NE7A 2OH1A 1NE9A 4MY3A 4NF1A 3GYAA 1R57A 1YK3A 4EVYA 3TFYA 3R95A 4R3KA 4IF5A 5H84A 1KUVA 3FYNA 4CRZB 1Y9KA 4H89A 1M4DA 1TIQA 1P0HA 5CNPA 3F8KA 3SXNA 1I21A 1LRZA 2PSWA 2I00A 4CAXA 4HKFA 2AE6A 3LD2A 2Q4VA 1CM0A 3R9GA 4RI1A 4HNWB 2GE3A 3TO6A 4AB7A 4KVOE 5F49A 4FD5A 1YVKA 3EFAA 2QECA 3D8PA
chains in the Genus database with same CATH superfamily
2HUZA 1QSNA 1UFHA 2EUIA 3WC5A 4R7MA 3SI1A 4QBJA 2Q51A 4KOSA 4CYNA 5JPHA 3PBEA 2BEIA 3F5BA 1IYLA 4KZTA 3JRUA 2ARHA 1S7LA 1BOBA 2IMOA 2PJ1A 4HNXB 4FD6A 4NGQA 4H6UA 2CIJA 2PJ5A 5DWMA 3LWUA 4CGOA 1ELLP 1VHOA 4OADA 2HC9A 3QB8A 4A33A 2CTCA 5F09A 4R3LA 1BO4A 2AFWA 3HUVA 4MRIA 4MXUA 4R9MA 4UEEA 3IWEA 4A2ZA 3DDDA 2V8DA 1Q2DA 3H5ZA 3NH4A 4OIWA 3QNVA 3G3SA 1LAPA 4JD6A 2B3VA 4HNYB 2ZOGA 2ZPAA 4IK2A 2C1CA 4KUBA 3SJFA 4YGOA 1ELMP 2AFZA 3IWGA 2CY2A 4TNUA 2RFHA 1XE4A 1Z8LA 4LUAA 3TO7A 4B6ZA 2PVWA 3KHZA 4KS9A 3KZWA 2NMTA 2PR8A 2QMLA 1ZLHA 5HMNA 1BPMA 4F0XA 3IGRA 4Y49C 1LANA 3DSBA 1Q2YA 5AG6A 4RS2A 3FEEA 3NA6A 2AFXA 3HLPA 5J8FA 4FWUA 2X7BA 1WWZA 1F2OA 1M1DA 4MFJA 1XMTA 4DNCA 3KR4A 1VKCA 1IOFA 3PB8X 3S9NA 2YGWA 5AG5A 3E0KA 4FUUA 4H6ZA 3KL9A 3SI0A 4OC5A 2XEFA 4KVME 1F57A 4GS4A 4OLLA 4ZY2A 1ZG7A 3QAHA 1EE3P 4QC6A 4CPAA 2FL4A 2KCWA 4NSQA 2IL4A 4NGMA 2OU2A 4MCSA 3ISXA 1FT7A 4O23A 4X8IA 4F6AA 2J8RA 2VZYA 5IB9A 2A4NA 4UFXA 2C6GA 3H8GA 4B5OA 2VQYA 2ZELA 4TWEA 1Y0RA 1CPSA 4BMHA 1TKJA 3MGDA 1IYKA 4J3GA 4NXYA 4E0AA 2DPSA 2OZHA 1QSRA 1S3ZA 4JXRA 3DGVA 3PB7X 2HQYA 5HXDA 3I3GA 4PXDA 5GCNA 1GYTA 2BOAA 1BPNA 2FIWA 4PV6A 2K5TA 1S60A 1GHEA 2Q4YA 4JZ0A 4MHNA 4CYQA 3FECA 2Q43A 1YLEA 2EK9A 2ZEPA 2AFUA 4JWPA 2DXQA 5KTCA 3DR6A 2ZEGA 1NMTA 1Z8WA 4B12A 2H5MA 2PC1A 3D7DA 3K9TA 1RTQA 1LOKA 4KSAA 4U9YA 4OC1A 4L89A 4KOTA 4BINA 3NH8A 4PQAA 4MBUA 3VWEA 4CS0B 4M6HA 3LMSA 2CXAA 3CXSA 5A28A 1QQ9A 2ZEDA 4CAEA 4UCMA 3ISZA 3CPXA 4XPDC 2OOTA 1N71A 1BAVA 4KUAA 3SJGA 4KORA 2AFOA 1X10A 4PXEA 2ODFA 2G3AA 1XOVA 1LFWA 4H2KA 3R1KA 3GIUA 5C88A 1JQGA 4L8AA 3N7ZA 3FJUA 5I0CA 3KASA 2ZW4A 3D2PA 4ONWA 2Q0YA 1CP6A 4CAFA 3SHPA 3D2MA 2AFSA 2Z3KA 3CXQA 2OZGA 3KR5A 3PB6X 3WC7A 3IIBA 2REEA 1Z4EA 1Y0YA 3TC8A 2O4HA 2Z0ZA 1M4GA 1QSTA 1I12A 5K8PA 1S7KA 5IB0A 3FRMA 4ZGYB 2PE3A 1XEBA 2I79A 4MFQA 3FMCA 4ONUA 1Z2LA 1VGYA 2G9DA 3D4UA 2GANA 3WR7A 2Z10A 4MY0A 4ZI6A 6CPAA 2GREA 2Q7SA 4UWIA 4EFDA 2OR4A 4UIAA 3TCVA 4A31A 2WZNA 1KZFA 4LQGA 4YU9A 1CP7A 5F48A 4MI4A 4U9ZA 2ZXVA 1H8LA 3TO9A 2JBJA 2V8GA 5J8CA 4AG7A 3B7IA 4C7IA 5KTAA 2ATRA 2VI7A 5BWAB 3R9FA 3TT2A 4Q7AA 1S7NA 1YQEA 4AVCA 3TE4A 5LYDA 5CPAA 1LAMA 4R87A 4FD4A 4NGRA 2B3UA 4OC2A 3CDXA 3RBUA 2OB0A 4F8ZA 2PJ0A 4KLWA 3PZJA 4UFWA 2Z3MA 2EO8A 2C6PA 2FSRA 2BL1A 2YNEA 3DLJA 5FVJA 5K8OA 1XFOA 4C2YA 2ZEHA 4A37A 3CZXA 1ON0A 4II9A 1K4JA 4X5KA 2WYRA 5JGFA 5ISVA 3CT9A 3K2KA 3KQZA 4F9VA 1MK4A 2PJ6A 4M6GA 3S6KA 2B58A 1ZLIA 2Z3NA 3EY5A 1IIDA 4W9YA 3H4QA 2PJ8A 4ZY0A 3PGPA 2QJ8A 3FVLA 4F0YA 3GUXA 4C2XA 2QVPA 4CRYB 4QB9A 1ZG9A 4JYWA 2IQ6A 4MMOA 3BHXA 4U5YA 1CG2A 3T9YA 3IFEA 4F9UA 1RXTA 5DWNA 3H8FA 3TOBA 2PIZA 4YWYA 4NEXA 5F47A 4MHYA 5J1QA 4CGNA 5AG7A 4KOYA 2VXKA 4Q38A 5LYLA 2FIAA 4Q36A 1YR0A 2RB7A 4MFKA 2PCUA 2EK8A 3BJ7A 2B4BA 3T8WA 1BLLE 5LRGA 3ZJ0A 1AMPA 4BBHA 1M4LA 2FS5A 2PR1A 1ZG8A 3QAYA 4OMEA 1XBUA 2JLMA 3DNSA 5AGEA 3SI2A 4LQ6A 8CPAA 4P44A 3RAMA 1IOIA 3D66A 4CYOA 3TTHA 2NYQA 5C82A 4RUHA 1CBXA 3KQXA 5ELYA 4MHPA 3PBBA 2Z11A 3FB3A 4UEFA 3W6XA 4C7HA 4EWTA 3RNZA 1HDQA 4P4JA 4P6YA 3CPAA 3S6FA 1OBRA 2AFMA 3S6GA 4DJLA 2PQ8A 3FXTA 4ORFA 5HH1A 4XNHB 3WABA 2P6FA 1B87A 3GLJA 3BJ8A 4P4FA 5EMIA 3VH9A 3ZZIA 4A94A 4B10A 1UWYA 3R96A 1P4NA 2VZZA 3TX8A 4PXBA 4ZX8A 2PRQA 5CBMA 1LCPA 4K3NA 2F8HA 4P4IA 1VHSA 3B8GA 1YMEA 1V0CA 3D7FA 4P4DA 4M85A 3EC4A 3SXOA 1QMUA 2PJCA 3L2NA 3FH4A 1ARLA 2XEGA 4YFJA 1DE4C 4GM5A 4PK2A 4AVAA 2J8NA 5LRJA 3LODA 3S9LA 4ZBGA 1WK4A 2JDDA 1HDUA 1Y9WA 3KHXA 2FT0A 4P10A 4B13A 2BSWA 5LYIA 1SQHA 4KOXA 4UBRA 2R98A 4FBEA 3CXPA 2V8VA 2PJ3A 3FNCA 1XIXA 3PB4X 2Q7BA 2OZUA 2YNCA 4DUKA 1A2ZA 2CTBA 3P2FA 4KOWA 4CGPA 4KOUA 3JTKA 3D68A 4MCPA 2WPXA 1S7FA 2BUEA 4R76A 4CGMA 5A27A 2PJBA 2PVVA 1PUAA 3JUWA 5HVHA 3IEHA 2JEVA 2G0BA 2PJ2A 2ANPA 2F7VA 5K8NA 3WC6A 2IJZA 3GKRA 3K9UA 3PRTA 2NSMA 1Z9UA 3IO1A 4PK3A 5G20A 3R9EA 2ZW6A 3DR8A 4WJBA 4YRHA 5DS0A 4P4EA 2JDCA 4OP4A 4PSXA 5H86A 2ZW7A 4JXQA 5KTDA 2QIRA 4CYPA 3BI1A 4QVTA 1B6BA 1Z8TA 4IHMA 1Q2CA 2Z3PA 3B3WA 3VWDA 1Z5RA 3F0AA 3KI9A 1TXRA 4WWVA 2FVGA 4NCZA 1MJBA 1Z8XA 1M4IA 3B2YA 2BCOA 4NGSA 4X2TA 3D3SA 3FF3A 4P45A 1VIXA 4UA3A 1S5KA 4B14A 2D4OA 4AXVA 4P4BA 3RYOA 2WUUA 4A38A 1R3NA 4MHDA 2Y0MA 4B11A 5F46A 3EO4A 4UEZA 4OAEA 1TF8A 1YLOA 2FE7A 1MJ9A 3WT4A 5JM6A 1ZO0A 1KUXA 1AUGA 4R57A 4E2AA 2C27A 2ZEOA 2R7HA 4MCRA 3PEIA 2CNMA 3B3SA 4A32A 4CAWA 2D4PA 2GFQA 2J8MA 1XRYA 3P2HA 3FEDA 3B3TA 1IU8A 2ZENA 4E8OA 2Q04A 4HPSA 1KUYA 2PIYA 2RC4A 1TKFA 3MRUA 2XEIA 3RO0A 4FAIA 1YW4A 3IWWA 1MJAA 3C26A 1Y7EA 2VBQA 4OKOA 2Z3LA 4XPLA 5EBVA 3OWCA 1Y7RA 4R8FA 4CGLA 1XF8A 2P6GA 4I49A 4DYOA 4UCNA 2O28A 5G1ZA 3H8EA 2GIVA 4MFZA 2HV2A 2V8HA 1JWQA 3PFOA 3PP9A 4Z65A 1HEEA 1RO5A 2FXFA 4AVBA 3S6HA 1QSMA 2POKA 3T90A 5I4MA 4QUSA 1IB1E 2AJ6A 5HVGA 1I1DA 1YSJA 4Y49B 4NGPA 2Q44A 3G8WA 5E96A 3SJXA 1CJWA 2PDOA 4KSFA 1CPXA 4LX9A 1U6MA 1OZPA 2BO9A 4CAVA 1NSAA 3FBUA 2J9AA 3BLNA 1J4JA 5EC4A 3V8IA 4MHZA 1YREA 3NH5A 4MJ8A 1PCAA 1IGBA 3BI0A 4M3SA 4B5PB 1R43A 2P0WA 4R6TA 2B5GB 2B4DB 5JH9A 2FCKA 1FNOA 1ARMA 1XMBA 2YNDA 3I9SA 3JVNA 2ABZA 4G1PA 2VEZA 1Q7LA 3IC1A 4ZY1A 5AG4A 2ZW5A 2R1IA 1FY7A 3B3VA 4PXCA 1YW6A 2PJAA 3GY9A 4EMEA 5IX3A 5G22A 4UWJA 3W91A 4A39A 4JJXA 4NJRA 7CPAA 3EXNA 2CF4A 2CNSA 1PU9A 3PFEA 3KGQA 2EVNA 4UCPA 1TF9A 2CNTA 2REFA 3FIXA 4NGNA 3V38A 4K30A 1NSLA 4PPZA 3NE8A 4JLYA 2PRBA 3KKWA 5IV0A 3W6SA 2R8VA 4AG9A 4B5PA 3D7HA 4C2ZA 1YGHA 1YVOA 2B5GA 2B4DA 2I3CA 4OC4A 4XNHC 4IUSA 5HVFA 3BXMA 3UY5A 4A30A 2YNCC 2GLJA 4BD9A 3NFZA 4OIDA 4MFPA 5LYFA 1VHEA 1XJOA 2DPTA 1L0CA 5THWA 2O53A 4KSIA 4KLVA 1DTDA 3VARA 1Z4RA 2DEAA 4KVXA 3B35A 4MCQA 2DF5A 2G3TA 4GXHA 1IICA 2F5IA 3SJEA 2JEWA 2GLFA 4KOVA 4UIBA 1M44A 2ZEEA 4M6IA 4ZYQA 2ZEMA 1PYTB 5JQ4A 3TOAA 3N5FA 2HB6A 1YX0A 1QSOA 3RZAA 2WPWA 4XPKA 2P6EA 3MN8A 4UFVA 4PSWA 4XPDB 4FD7A 3NE7A 2QYVA 3IU2A 3PB9X 2OH1A 2GU2A 1NE9A 3D67A 2EWBA 2Q4ZA 4NFRA 2WSAA 4MY3A 3S9MA 2VL1A 4NF1A 3GYAA 1R57A 1YK3A 2EBJA 4EVYA 4OC3A 2V77A 3R95A 3TFYA 4MFLA 1KWMA 4R3KA 4IF5A 5H84A 4C68A 2ZOFA 5D8NA 1KUVA 3FYNA 4CRZB 3V7ZA 1TKHA 1Y9KA 5G21A 4H89A 1M4DA 1TIQA 1P0HA 4X3RA 3F8KA 5CNPA 3SXNA 1I21A 1CX8A 3D7GA 1LRZA 2PJ7A 4ZX9A 2PSWA 2I00A 3GB0A 3I1UA 3IU1A 3LACA 4HKFA 4CAXA 2Z3OA 4NGTA 2AE6A 3B3CA 4OC0A 3LD2A 2Q4VA 5D29A 2XEJA 4UF4A 1CM0A 3R9GA 1AYEA 1F2PA 4IAVA 4RI1A 2JBKA 4HNWB 5K8MA 5LRKA 1IY7A 2GE3A 3A9LA 3TO6A 1X12A 4AB7A 3FX6A 4KVOE 3VATA 2PJ4A 4RN7A 5F49A 4FD5A 4A95A 4NJQA 1YVKA 2PJ9A 3EFAA 2QECA 3D8PA 2ZEFA 2C6CA 3IJ3A
chains in the Genus database with same CATH topology
2HUZA 1QSNA 1UFHA 2EUIA 4QBJA 5JPHA 4KOSA 4CYNA 2BEIA 3F5BA 1IYLA 4KZTA 2ARHA 1S7LA 1BOBA 4HNXB 4FD6A 4H6UA 5DWMA 4CGOA 4OADA 4A33A 3QB8A 4R3LA 1BO4A 4R9MA 4A2ZA 3IWEA 3DDDA 1Q2DA 3H5ZA 3G3SA 4JD6A 2B3VA 4HNYB 2ZPAA 4KUBA 4YGOA 3IWGA 2CY2A 1XE4A 4LUAA 3TO7A 4KS9A 2NMTA 2PR8A 2QMLA 5HMNA 4F0XA 3IGRA 4Y49C 3DSBA 1Q2YA 5AG6A 4RS2A 5J8FA 2X7BA 1WWZA 1M1DA 4MFJA 1XMTA 4DNCA 1VKCA 2YGWA 5AG5A 3E0KA 4H6ZA 4KVME 4GS4A 4OLLA 3QAHA 4QC6A 2FL4A 2KCWA 4NSQA 2IL4A 2OU2A 4F6AA 2J8RA 2VZYA 2A4NA 4UFXA 4B5OA 2VQYA 4BMHA 3MGDA 1IYKA 4J3GA 4NXYA 4E0AA 2DPSA 2OZHA 1QSRA 1S3ZA 4JXRA 2HQYA 3I3GA 5GCNA 2FIWA 4PV6A 2K5TA 1S60A 1GHEA 2Q4YA 4CYQA 1YLEA 4JWPA 2DXQA 5KTCA 3DR6A 1NMTA 4B12A 2H5MA 2PC1A 4KSAA 4U9YA 4L89A 4KOTA 3VWEA 4MBUA 4CS0B 2CXAA 3CXSA 5A28A 4CAEA 4UCMA 4XPDC 1N71A 4KUAA 4KORA 2G3AA 3R1KA 5C88A 4L8AA 3N7ZA 5I0CA 2ZW4A 3D2PA 2Q0YA 4CAFA 3SHPA 3D2MA 2Z3KA 3CXQA 2OZGA 2REEA 1Z4EA 2Z0ZA 1M4GA 1QSTA 1I12A 1S7KA 5IB0A 3FRMA 4ZGYB 1XEBA 2I79A 4MFQA 4ONUA 3WR7A 2GANA 2Z10A 4MY0A 4UWIA 3TCVA 4A31A 1KZFA 5F48A 4MI4A 4U9ZA 2ZXVA 3TO9A 5J8CA 4AG7A 4C7IA 5KTAA 2ATRA 2VI7A 5BWAB 3R9FA 3TT2A 1S7NA 4AVCA 3TE4A 4R87A 4FD4A 2B3UA 2OB0A 4KLWA 3PZJA 4UFWA 2Z3MA 2FSRA 2BL1A 2YNEA 5FVJA 4C2YA 1ON0A 4II9A 1K4JA 4X5KA 5ISVA 1MK4A 3S6KA 2B58A 2Z3NA 3EY5A 1IIDA 3H4QA 3PGPA 4F0YA 4C2XA 4CRYB 4QB9A 4U5YA 3T9YA 1RXTA 5DWNA 3TOBA 4NEXA 5F47A 4CGNA 5AG7A 4KOYA 2VXKA 4Q38A 2FIAA 4Q36A 1YR0A 4MFKA 3BJ7A 2B4BA 3ZJ0A 4BBHA 2FS5A 2PR1A 5AGEA 2JLMA 3DNSA 4CYOA 3TTHA 5C82A 3W6XA 2Z11A 3FB3A 4C7HA 3S6FA 3S6GA 2PQ8A 3FXTA 4ORFA 5HH1A 4XNHB 2P6FA 1B87A 3ZZIA 3BJ8A 4B10A 3R96A 1P4NA 2VZZA 1VHSA 3B8GA 1V0CA 4M85A 3EC4A 3SXOA 4YFJA 4PK2A 4AVAA 2J8NA 3LODA 4ZBGA 1WK4A 2JDDA 1Y9WA 2FT0A 4B13A 2BSWA 1SQHA 4KOXA 4UBRA 2R98A 3CXPA 3FNCA 2Q7BA 1XIXA 2OZUA 2YNCA 3P2FA 4KOWA 4CGPA 4KOUA 3JTKA 2WPXA 1S7FA 2BUEA 4CGMA 5A27A 3JUWA 1PUAA 2JEVA 2G0BA 3GKRA 3K9UA 5G20A 3R9EA 1Z9UA 4PK3A 2ZW6A 3DR8A 4YRHA 2JDCA 4PSXA 5H86A 2ZW7A 4JXQA 5KTDA 2QIRA 4CYPA 4QVTA 1B6BA 1Q2CA 2Z3PA 3VWDA 3F0AA 4NCZA 1MJBA 1M4IA 3D3SA 4UA3A 1S5KA 4B14A 2D4OA 3RYOA 2WUUA 4MHDA 2Y0MA 4B11A 5F46A 3EO4A 4OAEA 2FE7A 1MJ9A 1ZO0A 1KUXA 4E2AA 4R57A 2C27A 2R7HA 2CNMA 4A32A 4CAWA 2D4PA 2J8MA 3P2HA 4E8OA 2Q04A 1KUYA 2RC4A 1MJAA 3C26A 5EBVA 2VBQA 2Z3LA 4XPLA 3OWCA 1Y7RA 4CGLA 1XF8A 2P6GA 4I49A 4UCNA 2O28A 5G1ZA 2GIVA 4MFZA 2HV2A 3PP9A 1RO5A 2FXFA 4AVBA 3S6HA 1QSMA 3T90A 4QUSA 1IB1E 2AJ6A 1I1DA 4Y49B 2Q44A 3G8WA 5E96A 1CJWA 2PDOA 4KSFA 4LX9A 1U6MA 1OZPA 4CAVA 3FBUA 3BLNA 5EC4A 1J4JA 3V8IA 1YREA 4MJ8A 4M3SA 4B5PB 2P0WA 2B5GB 2B4DB 2FCKA 2YNDA 3I9SA 3JVNA 2VEZA 5AG4A 2ZW5A 2R1IA 1FY7A 3GY9A 5IX3A 5G22A 4UWJA 3W91A 4JJXA 3EXNA 2CNSA 1PU9A 2EVNA 4UCPA 2CNTA 2REFA 3FIXA 4K30A 1NSLA 4JLYA 2PRBA 3KKWA 5IV0A 3W6SA 2R8VA 4AG9A 4B5PA 4C2ZA 1YGHA 1YVOA 2B5GA 2B4DA 4XNHC 4IUSA 3UY5A 4A30A 2YNCC 4MFPA 2DPTA 1L0CA 4KLVA 1Z4RA 4KVXA 2G3TA 1IICA 2F5IA 4KOVA 1M44A 5JQ4A 3TOAA 1YX0A 1QSOA 2WPWA 4XPKA 2P6EA 4UFVA 4XPDB 4PSWA 4FD7A 3NE7A 3IU2A 2OH1A 1NE9A 2WSAA 4MY3A 4NF1A 3GYAA 1R57A 1YK3A 4EVYA 3TFYA 3R95A 4MFLA 4R3KA 4IF5A 5H84A 4C68A 1KUVA 3FYNA 4CRZB 5G21A 1Y9KA 4H89A 1M4DA 1TIQA 1P0HA 5CNPA 3F8KA 3SXNA 1I21A 1LRZA 2PSWA 2I00A 4CAXA 3IU1A 4HKFA 2Z3OA 2AE6A 3LD2A 2Q4VA 1CM0A 3R9GA 4RI1A 4HNWB 2GE3A 3A9LA 3TO6A 4AB7A 4KVOE 4A95A 5F49A 4FD5A 1YVKA 3EFAA 2QECA 3D8PA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2HUZ A;  1QSN A;  1UFH A;  2EUI A;  4QBJ A;  5JPH A;  4KOS A;  2BEI A;  3F5B A;  1IYL A;  4KZT A;  2ARH A;  1S7L A;  1BOB A;  4HNX B;  4FD6 A;  4H6U A;  5DWM A;  4OAD A;  3QB8 A;  4R3L A;  1BO4 A;  4R9M A;  3DDD A;  1Q2D A;  3G3S A;  4JD6 A;  2B3V A;  4HNY B;  2ZPA A;  4KUB A;  4YGO A;  3IWG A;  2CY2 A;  1XE4 A;  4LUA A;  3TO7 A;  2NMT A;  2PR8 A;  2QML A;  5HMN A;  3IGR A;  4Y49 C;  3DSB A;  1Q2Y A;  4RS2 A;  5J8F A;  2X7B A;  1WWZ A;  1M1D A;  1XMT A;  4DNC A;  1VKC A;  3E0K A;  4H6Z A;  4KVM E;  4GS4 A;  4OLL A;  3QAH A;  4QC6 A;  2FL4 A;  2KCW A;  4NSQ A;  2IL4 A;  2OU2 A;  4F6A A;  2J8R A;  2VZY A;  2A4N A;  4B5O A;  2VQY A;  4BMH A;  3MGD A;  1IYK A;  4J3G A;  4NXY A;  4E0A A;  2OZH A;  1QSR A;  1S3Z A;  4JXR A;  2HQY A;  3I3G A;  5GCN A;  2FIW A;  4PV6 A;  2K5T A;  1S60 A;  1GHE A;  2Q4Y A;  1YLE A;  4JWP A;  2DXQ A;  5KTC A;  3DR6 A;  1NMT A;  2H5M A;  2PC1 A;  4U9Y A;  4L89 A;  4KOT A;  3VWE A;  4MBU A;  4CS0 B;  3CXS A;  4XPD C;  1N71 A;  4KUA A;  4KOR A;  2G3A A;  3R1K A;  5C88 A;  4L8A A;  3N7Z A;  5I0C A;  2ZW4 A;  3D2P A;  2Q0Y A;  3SHP A;  3D2M A;  3CXQ A;  2OZG A;  2REE A;  1Z4E A;  2Z0Z A;  1M4G A;  1QST A;  1I12 A;  1S7K A;  5IB0 A;  3FRM A;  1XEB A;  2I79 A;  4ONU A;  3WR7 A;  2GAN A;  2Z10 A;  4MY0 A;  4UWI A;  3TCV A;  1KZF A;  5F48 A;  4MI4 A;  4U9Z A;  2ZXV A;  3TO9 A;  5J8C A;  4AG7 A;  5KTA A;  2ATR A;  2VI7 A;  3R9F A;  3TT2 A;  1S7N A;  4AVC A;  3TE4 A;  4R87 A;  4FD4 A;  2B3U A;  2OB0 A;  4KLW A;  3PZJ A;  2FSR A;  2BL1 A;  5FVJ A;  1ON0 A;  4II9 A;  1K4J A;  4X5K A;  5ISV A;  1MK4 A;  3S6K A;  2B58 A;  3EY5 A;  1IID A;  3H4Q A;  3PGP A;  4F0Y A;  4CRY B;  4QB9 A;  4U5Y A;  3T9Y A;  1RXT A;  5DWN A;  3TOB A;  4NEX A;  5F47 A;  4KOY A;  2VXK A;  2FIA A;  1YR0 A;  3BJ7 A;  2B4B A;  3ZJ0 A;  2FS5 A;  2PR1 A;  2JLM A;  3DNS A;  3TTH A;  5C82 A;  3W6X A;  2Z11 A;  3FB3 A;  3S6F A;  3S6G A;  2PQ8 A;  3FXT A;  4ORF A;  5HH1 A;  4XNH B;  2P6F A;  1B87 A;  3ZZI A;  3BJ8 A;  3R96 A;  1P4N A;  2VZZ A;  1VHS A;  3B8G A;  1V0C A;  4M85 A;  3EC4 A;  3SXO A;  4YFJ A;  4PK2 A;  4AVA A;  2J8N A;  3LOD A;  4ZBG A;  1WK4 A;  2JDD A;  1Y9W A;  2FT0 A;  2BSW A;  1SQH A;  4KOX A;  4UBR A;  2R98 A;  3CXP A;  3FNC A;  2Q7B A;  1XIX A;  2OZU A;  3P2F A;  4KOW A;  4KOU A;  2WPX A;  1S7F A;  2BUE A;  3JUW A;  1PUA A;  2JEV A;  2G0B A;  3GKR A;  3K9U A;  3R9E A;  1Z9U A;  4PK3 A;  2ZW6 A;  3DR8 A;  4YRH A;  2JDC A;  4PSX A;  5H86 A;  2ZW7 A;  4JXQ A;  5KTD A;  2QIR A;  4QVT A;  1B6B A;  1Q2C A;  3VWD A;  3F0A A;  4NCZ A;  1MJB A;  1M4I A;  3D3S A;  4UA3 A;  1S5K A;  2D4O A;  3RYO A;  4MHD A;  2Y0M A;  5F46 A;  3EO4 A;  4OAE A;  2FE7 A;  1MJ9 A;  1KUX A;  4E2A A;  4R57 A;  2C27 A;  2R7H A;  2CNM A;  4CAW A;  2D4P A;  2J8M A;  3P2H A;  4E8O A;  2Q04 A;  1KUY A;  2RC4 A;  1MJA A;  3C26 A;  5EBV A;  2VBQ A;  4XPL A;  3OWC A;  1Y7R A;  1XF8 A;  2P6G A;  4I49 A;  2O28 A;  2GIV A;  2HV2 A;  3PP9 A;  1RO5 A;  2FXF A;  4AVB A;  3S6H A;  1QSM A;  3T90 A;  4QUS A;  1IB1 E;  2AJ6 A;  1I1D A;  4Y49 B;  2Q44 A;  3G8W A;  5E96 A;  1CJW A;  2PDO A;  4LX9 A;  1U6M A;  1OZP A;  4CAV A;  3FBU A;  3BLN A;  5EC4 A;  1J4J A;  3V8I A;  1YRE A;  4MJ8 A;  4M3S A;  4B5P B;  2P0W A;  2B5G B;  2B4D B;  2FCK A;  3I9S A;  3JVN A;  2VEZ A;  2ZW5 A;  2R1I A;  1FY7 A;  3GY9 A;  5IX3 A;  3W91 A;  4UWJ A;  4JJX A;  3EXN A;  2CNS A;  1PU9 A;  2EVN A;  2CNT A;  2REF A;  3FIX A;  4K30 A;  1NSL A;  4JLY A;  2PRB A;  3KKW A;  5IV0 A;  3W6S A;  2R8V A;  4AG9 A;  4B5P A;  1YGH A;  1YVO A;  2B5G A;  2B4D A;  4XNH C;  4IUS A;  3UY5 A;  1L0C A;  4KLV A;  1Z4R A;  4KVX A;  2G3T A;  1IIC A;  2F5I A;  4KOV A;  1M44 A;  5JQ4 A;  3TOA A;  1YX0 A;  1QSO A;  2WPW A;  4XPK A;  2P6E A;  4XPD B;  4PSW A;  4FD7 A;  3NE7 A;  2OH1 A;  1NE9 A;  4MY3 A;  4NF1 A;  3GYA A;  1R57 A;  1YK3 A;  4EVY A;  3TFY A;  3R95 A;  4R3K A;  4IF5 A;  5H84 A;  1KUV A;  3FYN A;  4CRZ B;  1Y9K A;  4H89 A;  1M4D A;  1TIQ A;  1P0H A;  5CNP A;  3F8K A;  3SXN A;  1I21 A;  1LRZ A;  2PSW A;  2I00 A;  4CAX A;  4HKF A;  2AE6 A;  3LD2 A;  2Q4V A;  1CM0 A;  3R9G A;  4RI1 A;  4HNW B;  2GE3 A;  3TO6 A;  4AB7 A;  4KVO E;  5F49 A;  4FD5 A;  1YVK A;  3EFA A;  2QEC A;  3D8P A; 
#chains in the Genus database with same CATH topology
 2HUZ A;  1QSN A;  1UFH A;  2EUI A;  3WC5 A;  4R7M A;  3SI1 A;  4QBJ A;  2Q51 A;  4KOS A;  4CYN A;  5JPH A;  3PBE A;  2BEI A;  3F5B A;  1IYL A;  4KZT A;  3JRU A;  2ARH A;  1S7L A;  1BOB A;  2IMO A;  2PJ1 A;  4HNX B;  4FD6 A;  4NGQ A;  4H6U A;  2CIJ A;  2PJ5 A;  5DWM A;  3LWU A;  4CGO A;  1ELL P;  1VHO A;  4OAD A;  2HC9 A;  3QB8 A;  4A33 A;  2CTC A;  5F09 A;  4R3L A;  1BO4 A;  2AFW A;  3HUV A;  4MRI A;  4MXU A;  4R9M A;  4UEE A;  3IWE A;  4A2Z A;  3DDD A;  2V8D A;  1Q2D A;  3H5Z A;  3NH4 A;  4OIW A;  3QNV A;  3G3S A;  1LAP A;  4JD6 A;  2B3V A;  4HNY B;  2ZOG A;  2ZPA A;  4IK2 A;  2C1C A;  4KUB A;  3SJF A;  4YGO A;  1ELM P;  2AFZ A;  3IWG A;  2CY2 A;  4TNU A;  2RFH A;  1XE4 A;  1Z8L A;  4LUA A;  3TO7 A;  4B6Z A;  2PVW A;  3KHZ A;  4KS9 A;  3KZW A;  2NMT A;  2PR8 A;  2QML A;  1ZLH A;  5HMN A;  1BPM A;  4F0X A;  3IGR A;  4Y49 C;  1LAN A;  3DSB A;  1Q2Y A;  5AG6 A;  4RS2 A;  3FEE A;  3NA6 A;  2AFX A;  3HLP A;  5J8F A;  4FWU A;  2X7B A;  1WWZ A;  1F2O A;  1M1D A;  4MFJ A;  1XMT A;  4DNC A;  3KR4 A;  1VKC A;  1IOF A;  3PB8 X;  3S9N A;  2YGW A;  5AG5 A;  3E0K A;  4FUU A;  4H6Z A;  3KL9 A;  3SI0 A;  4OC5 A;  2XEF A;  4KVM E;  1F57 A;  4GS4 A;  4OLL A;  4ZY2 A;  1ZG7 A;  3QAH A;  1EE3 P;  4QC6 A;  4CPA A;  2FL4 A;  2KCW A;  4NSQ A;  2IL4 A;  4NGM A;  2OU2 A;  4MCS A;  3ISX A;  1FT7 A;  4O23 A;  4X8I A;  4F6A A;  2J8R A;  2VZY A;  5IB9 A;  2A4N A;  4UFX A;  2C6G A;  3H8G A;  4B5O A;  2VQY A;  2ZEL A;  4TWE A;  1Y0R A;  1CPS A;  4BMH A;  1TKJ A;  3MGD A;  1IYK A;  4J3G A;  4NXY A;  4E0A A;  2DPS A;  2OZH A;  1QSR A;  1S3Z A;  4JXR A;  3DGV A;  3PB7 X;  2HQY A;  5HXD A;  3I3G A;  4PXD A;  5GCN A;  1GYT A;  2BOA A;  1BPN A;  2FIW A;  4PV6 A;  2K5T A;  1S60 A;  1GHE A;  2Q4Y A;  4JZ0 A;  4MHN A;  4CYQ A;  3FEC A;  2Q43 A;  1YLE A;  2EK9 A;  2ZEP A;  2AFU A;  4JWP A;  2DXQ A;  5KTC A;  3DR6 A;  2ZEG A;  1NMT A;  1Z8W A;  4B12 A;  2H5M A;  2PC1 A;  3D7D A;  3K9T A;  1RTQ A;  1LOK A;  4KSA A;  4U9Y A;  4OC1 A;  4L89 A;  4KOT A;  4BIN A;  3NH8 A;  4PQA A;  4MBU A;  3VWE A;  4CS0 B;  4M6H A;  3LMS A;  2CXA A;  3CXS A;  5A28 A;  1QQ9 A;  2ZED A;  4CAE A;  4UCM A;  3ISZ A;  3CPX A;  4XPD C;  2OOT A;  1N71 A;  1BAV A;  4KUA A;  3SJG A;  4KOR A;  2AFO A;  1X10 A;  4PXE A;  2ODF A;  2G3A A;  1XOV A;  1LFW A;  4H2K A;  3R1K A;  3GIU A;  5C88 A;  1JQG A;  4L8A A;  3N7Z A;  3FJU A;  5I0C A;  3KAS A;  2ZW4 A;  3D2P A;  4ONW A;  2Q0Y A;  1CP6 A;  4CAF A;  3SHP A;  3D2M A;  2AFS A;  2Z3K A;  3CXQ A;  2OZG A;  3KR5 A;  3PB6 X;  3WC7 A;  3IIB A;  2REE A;  1Z4E A;  1Y0Y A;  3TC8 A;  2O4H A;  2Z0Z A;  1M4G A;  1QST A;  1I12 A;  5K8P A;  1S7K A;  5IB0 A;  3FRM A;  4ZGY B;  2PE3 A;  1XEB A;  2I79 A;  4MFQ A;  3FMC A;  4ONU A;  1Z2L A;  1VGY A;  2G9D A;  3D4U A;  2GAN A;  3WR7 A;  2Z10 A;  4MY0 A;  4ZI6 A;  6CPA A;  2GRE A;  2Q7S A;  4UWI A;  4EFD A;  2OR4 A;  4UIA A;  3TCV A;  4A31 A;  2WZN A;  1KZF A;  4LQG A;  4YU9 A;  1CP7 A;  5F48 A;  4MI4 A;  4U9Z A;  2ZXV A;  1H8L A;  3TO9 A;  2JBJ A;  2V8G A;  5J8C A;  4AG7 A;  3B7I A;  4C7I A;  5KTA A;  2ATR A;  2VI7 A;  5BWA B;  3R9F A;  3TT2 A;  4Q7A A;  1S7N A;  1YQE A;  4AVC A;  3TE4 A;  5LYD A;  5CPA A;  1LAM A;  4R87 A;  4FD4 A;  4NGR A;  2B3U A;  4OC2 A;  3CDX A;  3RBU A;  2OB0 A;  4F8Z A;  2PJ0 A;  4KLW A;  3PZJ A;  4UFW A;  2Z3M A;  2EO8 A;  2C6P A;  2FSR A;  2BL1 A;  2YNE A;  3DLJ A;  5FVJ A;  5K8O A;  1XFO A;  4C2Y A;  2ZEH A;  4A37 A;  3CZX A;  1ON0 A;  4II9 A;  1K4J A;  4X5K A;  2WYR A;  5JGF A;  5ISV A;  3CT9 A;  3K2K A;  3KQZ A;  4F9V A;  1MK4 A;  2PJ6 A;  4M6G A;  3S6K A;  2B58 A;  1ZLI A;  2Z3N A;  3EY5 A;  1IID A;  4W9Y A;  3H4Q A;  2PJ8 A;  4ZY0 A;  3PGP A;  2QJ8 A;  3FVL A;  4F0Y A;  3GUX A;  4C2X A;  2QVP A;  4CRY B;  4QB9 A;  1ZG9 A;  4JYW A;  2IQ6 A;  4MMO A;  3BHX A;  4U5Y A;  1CG2 A;  3T9Y A;  3IFE A;  4F9U A;  1RXT A;  5DWN A;  3H8F A;  3TOB A;  2PIZ A;  4YWY A;  4NEX A;  5F47 A;  4MHY A;  5J1Q A;  4CGN A;  5AG7 A;  4KOY A;  2VXK A;  4Q38 A;  5LYL A;  2FIA A;  4Q36 A;  1YR0 A;  2RB7 A;  4MFK A;  2PCU A;  2EK8 A;  3BJ7 A;  2B4B A;  3T8W A;  1BLL E;  5LRG A;  3ZJ0 A;  1AMP A;  4BBH A;  1M4L A;  2FS5 A;  2PR1 A;  1ZG8 A;  3QAY A;  4OME A;  1XBU A;  2JLM A;  3DNS A;  5AGE A;  3SI2 A;  4LQ6 A;  8CPA A;  4P44 A;  3RAM A;  1IOI A;  3D66 A;  4CYO A;  3TTH A;  2NYQ A;  5C82 A;  4RUH A;  1CBX A;  3KQX A;  5ELY A;  4MHP A;  3PBB A;  2Z11 A;  3FB3 A;  4UEF A;  3W6X A;  4C7H A;  4EWT A;  3RNZ A;  1HDQ A;  4P4J A;  4P6Y A;  3CPA A;  3S6F A;  1OBR A;  2AFM A;  3S6G A;  4DJL A;  2PQ8 A;  3FXT A;  4ORF A;  5HH1 A;  4XNH B;  3WAB A;  2P6F A;  1B87 A;  3GLJ A;  3BJ8 A;  4P4F A;  5EMI A;  3VH9 A;  3ZZI A;  4A94 A;  4B10 A;  1UWY A;  3R96 A;  1P4N A;  2VZZ A;  3TX8 A;  4PXB A;  4ZX8 A;  2PRQ A;  5CBM A;  1LCP A;  4K3N A;  2F8H A;  4P4I A;  1VHS A;  3B8G A;  1YME A;  1V0C A;  3D7F A;  4P4D A;  4M85 A;  3EC4 A;  3SXO A;  1QMU A;  2PJC A;  3L2N A;  3FH4 A;  1ARL A;  2XEG A;  4YFJ A;  1DE4 C;  4GM5 A;  4PK2 A;  4AVA A;  2J8N A;  5LRJ A;  3LOD A;  3S9L A;  4ZBG A;  1WK4 A;  2JDD A;  1HDU A;  1Y9W A;  3KHX A;  2FT0 A;  4P10 A;  4B13 A;  2BSW A;  5LYI A;  1SQH A;  4KOX A;  4UBR A;  2R98 A;  4FBE A;  3CXP A;  2V8V A;  2PJ3 A;  3FNC A;  1XIX A;  3PB4 X;  2Q7B A;  2OZU A;  2YNC A;  4DUK A;  1A2Z A;  2CTB A;  3P2F A;  4KOW A;  4CGP A;  4KOU A;  3JTK A;  3D68 A;  4MCP A;  2WPX A;  1S7F A;  2BUE A;  4R76 A;  4CGM A;  5A27 A;  2PJB A;  2PVV A;  1PUA A;  3JUW A;  5HVH A;  3IEH A;  2JEV A;  2G0B A;  2PJ2 A;  2ANP A;  2F7V A;  5K8N A;  3WC6 A;  2IJZ A;  3GKR A;  3K9U A;  3PRT A;  2NSM A;  1Z9U A;  3IO1 A;  4PK3 A;  5G20 A;  3R9E A;  2ZW6 A;  3DR8 A;  4WJB A;  4YRH A;  5DS0 A;  4P4E A;  2JDC A;  4OP4 A;  4PSX A;  5H86 A;  2ZW7 A;  4JXQ A;  5KTD A;  2QIR A;  4CYP A;  3BI1 A;  4QVT A;  1B6B A;  1Z8T A;  4IHM A;  1Q2C A;  2Z3P A;  3B3W A;  3VWD A;  1Z5R A;  3F0A A;  3KI9 A;  1TXR A;  4WWV A;  2FVG A;  4NCZ A;  1MJB A;  1Z8X A;  1M4I A;  3B2Y A;  2BCO A;  4NGS A;  4X2T A;  3D3S A;  3FF3 A;  4P45 A;  1VIX A;  4UA3 A;  1S5K A;  4B14 A;  2D4O A;  4AXV A;  4P4B A;  3RYO A;  2WUU A;  4A38 A;  1R3N A;  4MHD A;  2Y0M A;  4B11 A;  5F46 A;  3EO4 A;  4UEZ A;  4OAE A;  1TF8 A;  1YLO A;  2FE7 A;  1MJ9 A;  3WT4 A;  5JM6 A;  1ZO0 A;  1KUX A;  1AUG A;  4R57 A;  4E2A A;  2C27 A;  2ZEO A;  2R7H A;  4MCR A;  3PEI A;  2CNM A;  3B3S A;  4A32 A;  4CAW A;  2D4P A;  2GFQ A;  2J8M A;  1XRY A;  3P2H A;  3FED A;  3B3T A;  1IU8 A;  2ZEN A;  4E8O A;  2Q04 A;  4HPS A;  1KUY A;  2PIY A;  2RC4 A;  1TKF A;  3MRU A;  2XEI A;  3RO0 A;  4FAI A;  1YW4 A;  3IWW A;  1MJA A;  3C26 A;  1Y7E A;  2VBQ A;  4OKO A;  2Z3L A;  4XPL A;  5EBV A;  3OWC A;  1Y7R A;  4R8F A;  4CGL A;  1XF8 A;  2P6G A;  4I49 A;  4DYO A;  4UCN A;  2O28 A;  5G1Z A;  3H8E A;  2GIV A;  4MFZ A;  2HV2 A;  2V8H A;  1JWQ A;  3PFO A;  3PP9 A;  4Z65 A;  1HEE A;  1RO5 A;  2FXF A;  4AVB A;  3S6H A;  1QSM A;  2POK A;  3T90 A;  5I4M A;  4QUS A;  1IB1 E;  2AJ6 A;  5HVG A;  1I1D A;  1YSJ A;  4Y49 B;  4NGP A;  2Q44 A;  3G8W A;  5E96 A;  3SJX A;  1CJW A;  2PDO A;  4KSF A;  1CPX A;  4LX9 A;  1U6M A;  1OZP A;  2BO9 A;  4CAV A;  1NSA A;  3FBU A;  2J9A A;  3BLN A;  1J4J A;  5EC4 A;  3V8I A;  4MHZ A;  1YRE A;  3NH5 A;  4MJ8 A;  1PCA A;  1IGB A;  3BI0 A;  4M3S A;  4B5P B;  1R43 A;  2P0W A;  4R6T A;  2B5G B;  2B4D B;  5JH9 A;  2FCK A;  1FNO A;  1ARM A;  1XMB A;  2YND A;  3I9S A;  3JVN A;  2ABZ A;  4G1P A;  2VEZ A;  1Q7L A;  3IC1 A;  4ZY1 A;  5AG4 A;  2ZW5 A;  2R1I A;  1FY7 A;  3B3V A;  4PXC A;  1YW6 A;  2PJA A;  3GY9 A;  4EME A;  5IX3 A;  5G22 A;  4UWJ A;  3W91 A;  4A39 A;  4JJX A;  4NJR A;  7CPA A;  3EXN A;  2CF4 A;  2CNS A;  1PU9 A;  3PFE A;  3KGQ A;  2EVN A;  4UCP A;  1TF9 A;  2CNT A;  2REF A;  3FIX A;  4NGN A;  3V38 A;  4K30 A;  1NSL A;  4PPZ A;  3NE8 A;  4JLY A;  2PRB A;  3KKW A;  5IV0 A;  3W6S A;  2R8V A;  4AG9 A;  4B5P A;  3D7H A;  4C2Z A;  1YGH A;  1YVO A;  2B5G A;  2B4D A;  2I3C A;  4OC4 A;  4XNH C;  4IUS A;  5HVF A;  3BXM A;  3UY5 A;  4A30 A;  2YNC C;  2GLJ A;  4BD9 A;  3NFZ A;  4OID A;  4MFP A;  5LYF A;  1VHE A;  1XJO A;  2DPT A;  1L0C A;  5THW A;  2O53 A;  4KSI A;  4KLV A;  1DTD A;  3VAR A;  1Z4R A;  2DEA A;  4KVX A;  3B35 A;  4MCQ A;  2DF5 A;  2G3T A;  4GXH A;  1IIC A;  2F5I A;  3SJE A;  2JEW A;  2GLF A;  4KOV A;  4UIB A;  1M44 A;  2ZEE A;  4M6I A;  4ZYQ A;  2ZEM A;  1PYT B;  5JQ4 A;  3TOA A;  3N5F A;  2HB6 A;  1YX0 A;  1QSO A;  3RZA A;  2WPW A;  4XPK A;  2P6E A;  3MN8 A;  4UFV A;  4PSW A;  4XPD B;  4FD7 A;  3NE7 A;  2QYV A;  3IU2 A;  3PB9 X;  2OH1 A;  2GU2 A;  1NE9 A;  3D67 A;  2EWB A;  2Q4Z A;  4NFR A;  2WSA A;  4MY3 A;  3S9M A;  2VL1 A;  4NF1 A;  3GYA A;  1R57 A;  1YK3 A;  2EBJ A;  4EVY A;  4OC3 A;  2V77 A;  3R95 A;  3TFY A;  4MFL A;  1KWM A;  4R3K A;  4IF5 A;  5H84 A;  4C68 A;  2ZOF A;  5D8N A;  1KUV A;  3FYN A;  4CRZ B;  3V7Z A;  1TKH A;  1Y9K A;  5G21 A;  4H89 A;  1M4D A;  1TIQ A;  1P0H A;  4X3R A;  3F8K A;  5CNP A;  3SXN A;  1I21 A;  1CX8 A;  3D7G A;  1LRZ A;  2PJ7 A;  4ZX9 A;  2PSW A;  2I00 A;  3GB0 A;  3I1U A;  3IU1 A;  3LAC A;  4HKF A;  4CAX A;  2Z3O A;  4NGT A;  2AE6 A;  3B3C A;  4OC0 A;  3LD2 A;  2Q4V A;  5D29 A;  2XEJ A;  4UF4 A;  1CM0 A;  3R9G A;  1AYE A;  1F2P A;  4IAV A;  4RI1 A;  2JBK A;  4HNW B;  5K8M A;  5LRK A;  1IY7 A;  2GE3 A;  3A9L A;  3TO6 A;  1X12 A;  4AB7 A;  3FX6 A;  4KVO E;  3VAT A;  2PJ4 A;  4RN7 A;  5F49 A;  4FD5 A;  4A95 A;  4NJQ A;  1YVK A;  2PJ9 A;  3EFA A;  2QEC A;  3D8P A;  2ZEF A;  2C6C A;  3IJ3 A; 
#chains in the Genus database with same CATH homology
 2HUZ A;  1QSN A;  1UFH A;  2EUI A;  4QBJ A;  5JPH A;  4KOS A;  4CYN A;  2BEI A;  3F5B A;  1IYL A;  4KZT A;  2ARH A;  1S7L A;  1BOB A;  4HNX B;  4FD6 A;  4H6U A;  5DWM A;  4CGO A;  4OAD A;  4A33 A;  3QB8 A;  4R3L A;  1BO4 A;  4R9M A;  4A2Z A;  3IWE A;  3DDD A;  1Q2D A;  3H5Z A;  3G3S A;  4JD6 A;  2B3V A;  4HNY B;  2ZPA A;  4KUB A;  4YGO A;  3IWG A;  2CY2 A;  1XE4 A;  4LUA A;  3TO7 A;  4KS9 A;  2NMT A;  2PR8 A;  2QML A;  5HMN A;  4F0X A;  3IGR A;  4Y49 C;  3DSB A;  1Q2Y A;  5AG6 A;  4RS2 A;  5J8F A;  2X7B A;  1WWZ A;  1M1D A;  4MFJ A;  1XMT A;  4DNC A;  1VKC A;  2YGW A;  5AG5 A;  3E0K A;  4H6Z A;  4KVM E;  4GS4 A;  4OLL A;  3QAH A;  4QC6 A;  2FL4 A;  2KCW A;  4NSQ A;  2IL4 A;  2OU2 A;  4F6A A;  2J8R A;  2VZY A;  2A4N A;  4UFX A;  4B5O A;  2VQY A;  4BMH A;  3MGD A;  1IYK A;  4J3G A;  4NXY A;  4E0A A;  2DPS A;  2OZH A;  1QSR A;  1S3Z A;  4JXR A;  2HQY A;  3I3G A;  5GCN A;  2FIW A;  4PV6 A;  2K5T A;  1S60 A;  1GHE A;  2Q4Y A;  4CYQ A;  1YLE A;  4JWP A;  2DXQ A;  5KTC A;  3DR6 A;  1NMT A;  4B12 A;  2H5M A;  2PC1 A;  4KSA A;  4U9Y A;  4L89 A;  4KOT A;  3VWE A;  4MBU A;  4CS0 B;  2CXA A;  3CXS A;  5A28 A;  4CAE A;  4UCM A;  4XPD C;  1N71 A;  4KUA A;  4KOR A;  2G3A A;  3R1K A;  5C88 A;  4L8A A;  3N7Z A;  5I0C A;  2ZW4 A;  3D2P A;  2Q0Y A;  4CAF A;  3SHP A;  3D2M A;  2Z3K A;  3CXQ A;  2OZG A;  2REE A;  1Z4E A;  2Z0Z A;  1M4G A;  1QST A;  1I12 A;  1S7K A;  5IB0 A;  3FRM A;  4ZGY B;  1XEB A;  2I79 A;  4MFQ A;  4ONU A;  3WR7 A;  2GAN A;  2Z10 A;  4MY0 A;  4UWI A;  3TCV A;  4A31 A;  1KZF A;  5F48 A;  4MI4 A;  4U9Z A;  2ZXV A;  3TO9 A;  5J8C A;  4AG7 A;  4C7I A;  5KTA A;  2ATR A;  2VI7 A;  5BWA B;  3R9F A;  3TT2 A;  1S7N A;  4AVC A;  3TE4 A;  4R87 A;  4FD4 A;  2B3U A;  2OB0 A;  4KLW A;  3PZJ A;  4UFW A;  2Z3M A;  2FSR A;  2BL1 A;  2YNE A;  5FVJ A;  4C2Y A;  1ON0 A;  4II9 A;  1K4J A;  4X5K A;  5ISV A;  1MK4 A;  3S6K A;  2B58 A;  2Z3N A;  3EY5 A;  1IID A;  3H4Q A;  3PGP A;  4F0Y A;  4C2X A;  4CRY B;  4QB9 A;  4U5Y A;  3T9Y A;  1RXT A;  5DWN A;  3TOB A;  4NEX A;  5F47 A;  4CGN A;  5AG7 A;  4KOY A;  2VXK A;  4Q38 A;  2FIA A;  4Q36 A;  1YR0 A;  4MFK A;  3BJ7 A;  2B4B A;  3ZJ0 A;  4BBH A;  2FS5 A;  2PR1 A;  5AGE A;  2JLM A;  3DNS A;  4CYO A;  3TTH A;  5C82 A;  3W6X A;  2Z11 A;  3FB3 A;  4C7H A;  3S6F A;  3S6G A;  2PQ8 A;  3FXT A;  4ORF A;  5HH1 A;  4XNH B;  2P6F A;  1B87 A;  3ZZI A;  3BJ8 A;  4B10 A;  3R96 A;  1P4N A;  2VZZ A;  1VHS A;  3B8G A;  1V0C A;  4M85 A;  3EC4 A;  3SXO A;  4YFJ A;  4PK2 A;  4AVA A;  2J8N A;  3LOD A;  4ZBG A;  1WK4 A;  2JDD A;  1Y9W A;  2FT0 A;  4B13 A;  2BSW A;  1SQH A;  4KOX A;  4UBR A;  2R98 A;  3CXP A;  3FNC A;  2Q7B A;  1XIX A;  2OZU A;  2YNC A;  3P2F A;  4KOW A;  4CGP A;  4KOU A;  3JTK A;  2WPX A;  1S7F A;  2BUE A;  4CGM A;  5A27 A;  3JUW A;  1PUA A;  2JEV A;  2G0B A;  3GKR A;  3K9U A;  5G20 A;  3R9E A;  1Z9U A;  4PK3 A;  2ZW6 A;  3DR8 A;  4YRH A;  2JDC A;  4PSX A;  5H86 A;  2ZW7 A;  4JXQ A;  5KTD A;  2QIR A;  4CYP A;  4QVT A;  1B6B A;  1Q2C A;  2Z3P A;  3VWD A;  3F0A A;  4NCZ A;  1MJB A;  1M4I A;  3D3S A;  4UA3 A;  1S5K A;  4B14 A;  2D4O A;  3RYO A;  2WUU A;  4MHD A;  2Y0M A;  4B11 A;  5F46 A;  3EO4 A;  4OAE A;  2FE7 A;  1MJ9 A;  1ZO0 A;  1KUX A;  4E2A A;  4R57 A;  2C27 A;  2R7H A;  2CNM A;  4A32 A;  4CAW A;  2D4P A;  2J8M A;  3P2H A;  4E8O A;  2Q04 A;  1KUY A;  2RC4 A;  1MJA A;  3C26 A;  5EBV A;  2VBQ A;  2Z3L A;  4XPL A;  3OWC A;  1Y7R A;  4CGL A;  1XF8 A;  2P6G A;  4I49 A;  4UCN A;  2O28 A;  5G1Z A;  2GIV A;  4MFZ A;  2HV2 A;  3PP9 A;  1RO5 A;  2FXF A;  4AVB A;  3S6H A;  1QSM A;  3T90 A;  4QUS A;  1IB1 E;  2AJ6 A;  1I1D A;  4Y49 B;  2Q44 A;  3G8W A;  5E96 A;  1CJW A;  2PDO A;  4KSF A;  4LX9 A;  1U6M A;  1OZP A;  4CAV A;  3FBU A;  3BLN A;  5EC4 A;  1J4J A;  3V8I A;  1YRE A;  4MJ8 A;  4M3S A;  4B5P B;  2P0W A;  2B5G B;  2B4D B;  2FCK A;  2YND A;  3I9S A;  3JVN A;  2VEZ A;  5AG4 A;  2ZW5 A;  2R1I A;  1FY7 A;  3GY9 A;  5IX3 A;  5G22 A;  4UWJ A;  3W91 A;  4JJX A;  3EXN A;  2CNS A;  1PU9 A;  2EVN A;  4UCP A;  2CNT A;  2REF A;  3FIX A;  4K30 A;  1NSL A;  4JLY A;  2PRB A;  3KKW A;  5IV0 A;  3W6S A;  2R8V A;  4AG9 A;  4B5P A;  4C2Z A;  1YGH A;  1YVO A;  2B5G A;  2B4D A;  4XNH C;  4IUS A;  3UY5 A;  4A30 A;  2YNC C;  4MFP A;  2DPT A;  1L0C A;  4KLV A;  1Z4R A;  4KVX A;  2G3T A;  1IIC A;  2F5I A;  4KOV A;  1M44 A;  5JQ4 A;  3TOA A;  1YX0 A;  1QSO A;  2WPW A;  4XPK A;  2P6E A;  4UFV A;  4XPD B;  4PSW A;  4FD7 A;  3NE7 A;  3IU2 A;  2OH1 A;  1NE9 A;  2WSA A;  4MY3 A;  4NF1 A;  3GYA A;  1R57 A;  1YK3 A;  4EVY A;  3TFY A;  3R95 A;  4MFL A;  4R3K A;  4IF5 A;  5H84 A;  4C68 A;  1KUV A;  3FYN A;  4CRZ B;  5G21 A;  1Y9K A;  4H89 A;  1M4D A;  1TIQ A;  1P0H A;  5CNP A;  3F8K A;  3SXN A;  1I21 A;  1LRZ A;  2PSW A;  2I00 A;  4CAX A;  3IU1 A;  4HKF A;  2Z3O A;  2AE6 A;  3LD2 A;  2Q4V A;  1CM0 A;  3R9G A;  4RI1 A;  4HNW B;  2GE3 A;  3A9L A;  3TO6 A;  4AB7 A;  4KVO E;  4A95 A;  5F49 A;  4FD5 A;  1YVK A;  3EFA A;  2QEC A;  3D8P A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...