3SI2A

Structure of glycosylated murine glutaminyl cyclase in presence of the inhibitor pq50 (pdbd150)
Total Genus 104
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
104
sequence length
327
structure length
322
Chain Sequence
AWTQEKNHHQPAHLNSSSLQQVAEGTSISEMWQNDLRPLLIERYPGSPGSYSARQHIMQRIQRLQAEWVVEVDTFLSRTPYGYRSFSNIISTLNPEAKRHLVLACHYDSKYFPRWDSRVFVGATDSAVPCAMMLELARALDKKLHSLKDPDLSLQLIFFDGEEAFHHWSPQDSLYGSRHLAQKMASSPHPPGSRGTNQLDGMDLLVLLDLIGAANPTFPNFFPKTTRWFNRLQAIEKELYELGLLKDHSLERKYFQNFGYGNIIQDDHIPFLRKGVPVLHLIASPFPEVWHTMDDNEENLHASTIDNLNKIIQVFVLEYLHL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase/transferase inhibitor
molecule keywords Glutaminyl-peptide cyclotransferase
publication title Structures of Glycosylated Mammalian Glutaminyl Cyclases Reveal Conformational Variability near the Active Center.
pubmed doi rcsb
source organism Mus musculus
total genus 104
structure length 322
sequence length 327
ec nomenclature ec 2.3.2.5: Glutaminyl-peptide cyclotransferase.
pdb deposition date 2011-06-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF04389 Peptidase_M28 Peptidase family M28
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.630.10 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Zn peptidases 3si2A00
1VIXA 4KSIA 3NFZA 4NGPA 5THWA 4A94A 1YW4A 3PBBA 4UEZA 1EE3P 2XEFA 1F57A 2J9AA 3PEIA 3B3WA 1H8LA 4PXBA 2Q43A 3FECA 3D7DA 5JH9A 2IJZA 4X8IA 5LYDA 1CBXA 3FX6A 1TXRA 3LWUA 4OKOA 3WT4A 2F7VA 3B35A 1YW6A 2ZOGA 5HVGA 5HVHA 4MRIA 1IY7A 3B3TA 1PYTB 3CT9A 4NGTA 3L2NA 1VGYA 3S9LA 2V8DA 1BLLE 3JRUA 5CBMA 2PIZA 2ZEFA 3PB8X 5IB9A 5K8PA 5F09A 5LRJA 1FT7A 4LQGA 3FF3A 1M4LA 4MCRA 1FNOA 1Z8LA 4F9UA 4ZY0A 4ZI6A 4TNUA 3NA6A 4PXCA 4P4JA 2QVPA 1QMUA 3H8EA 1HDQA 4OP4A 3PB4X 3PRTA 3D66A 1XMBA 4R8FA 5D8NA 4NJQA 1F2PA 4IHMA 5CPAA 2PJ8A 3S9NA 3CPAA 3IC1A 4CPAA 4JZ0A 4F9VA 1Z5RA 4P6YA 2XEIA 2Q51A 5K8MA 4G1PA 4WWVA 3IWWA 1LANA 3KHZA 4MXUA 5JGFA 4UIAA 4X2TA 2I3CA 2CIJA 6CPAA 2CTBA 1CG2A 4YU9A 2IQ6A 4DUKA 3B2YA 7CPAA 4JYWA 4ZX8A 4MHYA 3KI9A 3HLPA 4Q7AA 3N5FA 2O53A 3NH5A 1TKHA 5JM6A 1CPXA 3FH4A 4OC4A 2AFXA 2ZENA 3VH9A 2PCUA 2QYVA 4ZY1A 2ZOFA 2AFUA 2Q4ZA 5LRKA 3KR4A 4MMOA 5LYFA 4FUUA 1ARMA 4NGQA 1RTQA 3WC7A 4P4IA 2BOAA 2CTCA 2F8HA 2XEJA 2ZEGA 4OC0A 3IEHA 3KHXA 4P44A 2PJAA 1TF9A 1ZG9A 2ZEMA 4EWTA 3RZAA 1BAVA 1ZG7A 4MHPA 2XEGA 2ANPA 3FEDA 4F8ZA 3D7GA 2G9DA 3PFOA 2AFMA 4MCQA 1UWYA 2NYQA 4P10A 2PVWA 2GLJA 2QJ8A 4FBEA 5J1QA 4R7MA 1BPMA 3BI0A 4A38A 4NGRA 3K9TA 4UEEA 1IGBA 2PJ0A 3KR5A 2O4HA 3PFEA 4K3NA 1F2OA 1TKFA 3NH4A 1VHEA 2PJ6A 1LAPA 3FMCA 4PXEA 2HC9A 3B3VA 4OIDA 4A37A 3BI1A 3IJ3A 4MHZA 2ZEOA 2ZEEA 3SJGA 3H8FA 3VARA 1XRYA 4H2KA 1ARLA 4P45A 4PPZA 4P4DA 1LAMA 1LFWA 2PVVA 4ZYQA 4NGSA 2AFZA 3B3CA 4PXDA 1YMEA 1NSAA 1XBUA 3KASA 4MCSA 4EFDA 4NGMA 3BXMA 1ELMP 1JQGA 2EK8A 1CP7A 3V7ZA 3NH8A 2C6GA 4ONWA 2HB6A 3TX8A 3WABA 3B7IA 3ISZA 1KWMA 4A39A 4MHNA 1ZG8A 4FWUA 3SJEA 4B6ZA 4P4EA 4O23A 5DS0A 2V8VA 4MCPA 3MN8A 3KZWA 3LMSA 3FJUA 2PJ4A 3D7FA 4FAIA 3SI2A 1DTDA 4EMEA 2EK9A 1ZLIA 3CPXA 4DYOA 1VHOA 2WYRA 3K2KA 1Y0RA 2PJ1A 3KQXA 2GU2A 3PBEA 5LYIA 3IFEA 2RFHA 3D67A 3CDXA 3SJXA 4R76A 1R3NA 1ELLP 3DGVA 4OC5A 2RB7A 1AYEA 2BCOA 2V8HA 1YSJA 2PJ3A 2ZELA 3ISXA 3RBUA 3HUVA 4OC2A 2FVGA 3D7HA 2C1CA 3FEEA 3VATA 1Q7LA 1OBRA 1XJOA 2PJBA 3V38A 4GM5A 2ZEPA 2PE3A 3B3SA 4NFRA 2OOTA 2POKA 1CPSA 2NSMA 4WJBA 3SI1A 1XFOA 1HDUA 1LCPA 5LRGA 2WZNA 2PIYA 3KGQA 5HXDA 3PB7X 4W9YA 2JBKA 2V8GA 2AFSA 2ZEHA 8CPAA 1TKJA 2PJ9A 4AXVA 2GLFA 2AFWA 2PJ2A 3SJFA 5K8NA 4IAVA 4BD9A 4P4BA 2VL1A 2EWBA 3GLJA 1Y7EA 5K8OA 4UEFA 4R6TA 1BPNA 2GREA 3SI0A 4OC1A 3H8GA 1HEEA 1Y0YA 5ELYA 3IIBA 3PB9X 1AMPA 1YLOA 4IK2A 1TF8A 4OC3A 4X3RA 3IO1A 1PCAA 3KQZA 4RUHA 1ZLHA 3I1UA 2IMOA 3WC6A 3WC5A 4NGNA 2C6CA 4UF4A 3D68A 4UIBA 4TWEA 2BO9A 4ZX9A 4OIWA 5HVFA 1DE4C 3S9MA 4DJLA 2JBJA 3MRUA 3D4UA 1R43A 1Z2LA 2PJCA 1CX8A 5D29A 3QNVA 1CP6A 4PQAA 2C6PA 2OR4A 2PRQA 2PJ5A 2V77A 4NJRA 4Z65A 3FVLA 2ZEDA 2ABZA 3BHXA 2CF4A 4ZY2A 3GUXA 4OMEA 1QQ9A 4YWYA 2JEWA 3TC8A 1LOKA 5I4MA 3DLJA 3PB6X 2AFOA 3RAMA 2DEAA 3KL9A 1GYTA 4P4FA 3GB0A 3T8WA 5LYLA 2PJ7A
chains in the Genus database with same CATH superfamily
2ZW7A 1FY7A 1MK4A 1VIXA 4KSIA 4R57A 2CNTA 2I79A 1X12A 1YQEA 2DPTA 3CZXA 3I9SA 3NFZA 4NGPA 4QC6A 3PZJA 1QSTA 1Z8WA 3R9GA 3R1KA 5THWA 4B5OA 4CAFA 4A94A 3GKRA 2JEVA 1YW4A 2FCKA 3GYAA 3PBBA 4UEZA 4UWJA 1NSLA 1EE3P 4KVOE 2VQYA 2XEFA 4H6ZA 1F57A 5F49A 5F46A 2OZGA 2PR1A 2J9AA 3PEIA 3B3WA 1IU8A 2K5TA 3C26A 4KORA 1IICA 1H8LA 2DPSA 2Q04A 3A9LA 4PXBA 4CGOA 4JLYA 2Q43A 3FECA 3D7DA 3F0AA 5JH9A 2IJZA 4X8IA 5LYDA 5F48A 1CBXA 3CXSA 2GANA 3FX6A 2B3UA 4HNXB 1TXRA 5EC4A 3LWUA 4OKOA 4MI4A 1Z8TA 3WT4A 4A32A 1QSMA 2F7VA 5A27A 2X7BA 3B35A 1YW6A 2ZOGA 3CXPA 4AG9A 2FXFA 4RN7A 2WUUA 4KUAA 1WWZA 4FD7A 5HVGA 4MRIA 5HVHA 2F5IA 4IF5A 1IY7A 3B3TA 1PYTB 1PU9A 5IV0A 3CT9A 4NGTA 3L2NA 1VGYA 4GXHA 3S9LA 3P2HA 4B12A 2V8DA 3JVNA 5AG6A 1BLLE 3H4QA 3JRUA 2ZPAA 4AVBA 2NMTA 2PIZA 2ZEFA 5CBMA 3PB8X 2BSWA 2DF5A 1IIDA 4B5PB 1Q2CA 5IB9A 5KTAA 5K8PA 4OAEA 3D2MA 4UWIA 2BUEA 5I0CA 5F09A 5LRJA 2EBJA 1FT7A 3IWGA 2REEA 4LQGA 3FF3A 3BLNA 1M4LA 2EVNA 2JDDA 1FNOA 4MFJA 1Z8LA 2O28A 2QIRA 4MCRA 4F9UA 4ZY0A 4MJ8A 4ZI6A 2JLMA 3WR7A 3MGDA 1YREA 1S7LA 4MY0A 4TNUA 4F0YA 4UFVA 2HUZA 3NA6A 4KUBA 3PGPA 4PXCA 2R98A 1YX0A 4P4JA 2QVPA 1J4JA 4UA3A 1QMUA 2B4DB 2YNDA 3H8EA 4PSWA 1HDQA 4OP4A 3DDDA 4MY3A 3PB4X 3PRTA 3D66A 2Z3LA 4NEXA 2YNEA 4KOTA 1XMBA 4LQ6A 4R8FA 2FIAA 4NJQA 5D8NA 4CAEA 5G20A 1F2PA 3OWCA 5FVJA 2PRBA 2EUIA 1Z4RA 2J8RA 1M4GA 4IHMA 2PJ8A 5CPAA 3S9NA 3CPAA 3IC1A 4H6UA 4UFXA 4CPAA 4JZ0A 1Q2YA 1QSOA 4F9VA 2ZW4A 3QAHA 1QSRA 4KLWA 4M6GA 3S6HA 3VWDA 4YFJA 1M1DA 1Z5RA 2OZUA 2REFA 2Q4VA 5DWMA 1XIXA 3R9EA 4B13A 4P6YA 1KUYA 1S5KA 2FL4A 2XEIA 5E96A 2Q51A 1ON0A 5K8MA 4G1PA 2FS5A 4WWVA 3IWWA 1LRZA 5H84A 1LANA 3KHZA 4MXUA 4HKFA 5JGFA 4UIAA 3SHPA 2Z10A 4X2TA 2I3CA 2CIJA 4JWPA 2WSAA 3TO7A 4FD6A 4I49A 6CPAA 1S7KA 2CTBA 3I3GA 1CG2A 2VZYA 1KUVA 4YGOA 4YU9A 4A2ZA 4DNCA 1Z9UA 5IB0A 2IQ6A 1IOIA 4CYOA 4UFWA 1XF8A 4AVAA 4C7HA 4DUKA 2GIVA 5KTDA 3B2YA 4NXYA 1Y9KA 2PR8A 2ZW6A 4LUAA 4JYWA 2P6FA 3UY5A 7CPAA 4ZX8A 3PP9A 3B8GA 1M4IA 2A4NA 4MHYA 4KOSA 2Z3OA 2RC4A 1SQHA 4U9YA 4XPDB 1L0CA 1S7FA 3KI9A 4B5PA 3HLPA 4Q7AA 3N5FA 2O53A 3FYNA 1YVKA 3NH5A 1TKHA 4UCNA 3RYOA 5JM6A 1GHEA 1CPXA 3FH4A 4E8OA 4OC4A 2AFXA 3IU1A 3TOAA 2ZENA 2G3TA 3VH9A 4QVTA 4QB9A 2PCUA 2QYVA 2JDCA 4J3GA 4ZY1A 2ZOFA 2AFUA 4Y49C 2HQYA 2Q4ZA 5LRKA 3KR4A 4C68A 4MMOA 4CGNA 5C88A 4HNYB 5LYFA 4FUUA 1AUGA 2B4DA 4PSXA 1ARMA 4NGQA 1RTQA 3WC7A 4KVXA 5HH1A 4P4IA 3TCVA 2BOAA 2CTCA 3P2FA 2F8HA 2GFQA 3LODA 2XEJA 2ZEGA 5J8FA 2G3AA 2OB0A 4FD5A 3ZZIA 4CYPA 3LACA 4OC0A 3IEHA 3DR6A 1Y9WA 2H5MA 3KHXA 4P44A 4F0XA 2PJAA 4RI1A 1TF9A 1ZG9A 2ZEMA 4EWTA 3GY9A 3RZAA 4MFQA 1BAVA 1ZG7A 4RS2A 3JUWA 4MHPA 2XEGA 4E0AA 2ANPA 2B58A 3FEDA 4M6IA 1CJWA 2WPWA 4F8ZA 3D7GA 2G9DA 3PFOA 2AFMA 2Z11A 4MCQA 1M4DA 1UWYA 2NYQA 5DWNA 3VWEA 3TE4A 2QMLA 3NE8A 4P10A 2PVWA 4MHDA 4E2AA 2GLJA 2QJ8A 2FIWA 3W6SA 4CRZB 4R7MA 2G0BA 4FBEA 5J1QA 2B3VA 1BPMA 3BI0A 4IUSA 2ZXVA 4KVME 4A38A 3H5ZA 4MFPA 4NGRA 3K9TA 3BJ8A 4UEEA 1IGBA 2QECA 3NE7A 2ODFA 2PJ0A 3KR5A 1IOFA 5BWAB 4KOXA 1PUAA 3TO9A 2O4HA 2PSWA 3PFEA 4K3NA 1F2OA 1TKFA 2IL4A 3EY5A 3NH4A 1VHEA 2PJ6A 3QAYA 3T90A 4NCZA 1LAPA 2WPXA 3FMCA 5G1ZA 4PXEA 2HC9A 4CS0B 4B11A 3QB8A 1RO5A 3B3VA 3TO6A 2DXQA 4H89A 4OIDA 4R9MA 4A37A 3S6GA 3JTKA 4NF1A 2ATRA 3BI1A 5H86A 3IJ3A 4LX9A 4KOYA 1YVOA 4XPLA 3GIUA 1P0HA 4MHZA 4YRHA 2ZEOA 2ZEEA 1I12A 2Z3NA 3SJGA 3H8FA 4U9ZA 3VARA 4XNHC 1Z4EA 1XRYA 4OADA 4H2KA 1ARLA 4P45A 2VZZA 4HPSA 4PPZA 4P4DA 1LAMA 1LFWA 2PVVA 1V0CA 4MFZA 4ZYQA 1MJBA 4KSAA 2R1IA 4NGSA 5AG5A 4M3SA 2AFZA 1BOBA 3B3CA 4PXDA 1YMEA 3FIXA 2Z3MA 1NSAA 1XBUA 4AVCA 3KASA 1XE4A 2I00A 1TIQA 2P0WA 4MCSA 4EFDA 1WK4A 1R57A 4NGMA 4CAXA 3BXMA 1ELMP 1JQGA 1OZPA 2EK8A 1CP7A 3V7ZA 3NH8A 2C6GA 2OZHA 2Q4YA 5EBVA 4QUSA 2OU2A 3IGRA 4L89A 4ONWA 4CGMA 5CNPA 4KOUA 1Q2DA 2HB6A 3TX8A 3WABA 3B7IA 4M85A 5JQ4A 3S6FA 2Z0ZA 4UCPA 2ARHA 3ISZA 1KZFA 1KWMA 4A39A 4MHNA 1XEBA 2Q0YA 1ZG8A 4FWUA 1U6MA 5GCNA 2CNMA 3SJEA 4B6ZA 4ORFA 4P4EA 3IU2A 4O23A 4NSQA 5DS0A 2V8VA 1S60A 1NMTA 4MCPA 2PC1A 3MN8A 3S6KA 2R8VA 3KZWA 3LMSA 3FJUA 2PJ4A 3D7FA 4C2YA 1B6BA 3TT2A 1YGHA 2R7HA 4B14A 2FSRA 4FAIA 4K30A 2PDOA 3SI2A 5C82A 4II9A 1DTDA 1ZO0A 2YNCA 3DNSA 4EMEA 4CYQA 2EK9A 1ZLIA 3CPXA 4L8AA 2B5GB 4DYOA 1VHOA 2KCWA 3FBUA 2WYRA 1VKCA 3K2KA 1Y0RA 4M6HA 1Z8XA 2PJ1A 1K4JA 2AE6A 3N7ZA 3KQXA 2GU2A 3PBEA 5LYIA 3IFEA 3EXNA 4KOWA 1S7NA 2RFHA 3D67A 4A31A 3CDXA 3SJXA 4R76A 1R3NA 1ELLP 3DGVA 2C27A 4C7IA 1RXTA 4OC5A 2Q7SA 2RB7A 4MBUA 1AYEA 4MFLA 4A95A 2BCOA 2V8HA 4ONUA 4CGPA 1YSJA 2PJ3A 2FE7A 2ZELA 4CYNA 1VHSA 3ISXA 2P6GA 3D3SA 3HUVA 4JJXA 4OC2A 4U5YA 3RBUA 4C2ZA 1A2ZA 3FXTA 3G3SA 2FVGA 3D7HA 2C1CA 3FEEA 3LD2A 3VATA 3ZJ0A 3F5BA 1Q7LA 1OBRA 1XJOA 2PJBA 2J8MA 4X5KA 1X10A 3V38A 4HNWB 1P4NA 3G8WA 2ZEPA 4GM5A 2PE3A 2YNCC 1Y7RA 4ZBGA 1IB1E 2VI7A 3B3SA 4NFRA 4R3LA 2OOTA 2POKA 4C2XA 3E0KA 1CPSA 1S3ZA 4Y49B 3TOBA 2NSMA 4KS9A 3EO4A 4WJBA 4AB7A 3SI1A 1XFOA 1HDUA 2Z3KA 1LCPA 3SXNA 4BINA 3T9YA 4CGLA 3TFYA 5LRGA 2WZNA 2PIYA 4KOVA 3KGQA 5HXDA 3PB7X 4W9YA 2D4PA 2JBKA 1IYLA 2CXAA 2V8GA 2AFSA 3K9UA 1XMTA 2ZEHA 4CRYB 8CPAA 1TKJA 4BBHA 3R96A 2PJ9A 2VXKA 2Y0MA 4AXVA 2GLFA 2AFWA 4CAVA 2ZW5A 4PK2A 2PJ2A 3SJFA 5K8NA 2D4OA 2Q7BA 3V8IA 4IAVA 3FRMA 4GS4A 1IYKA 5AGEA 3DR8A 1YLEA 5ISVA 4BD9A 4P4BA 5HMNA 2B4BA 2VL1A 2EWBA 3GLJA 1Y7EA 1I1DA 3RO0A 5K8OA 2VBQA 4UEFA 3KKWA 4UBRA 4JD6A 4PK3A 4KZTA 4R6TA 1BPNA 2GREA 3SI0A 4OC1A 4BMHA 4XPKA 5G21A 1MJAA 2P6EA 3H8GA 2HV2A 4OLLA 1YR0A 5AG7A 4A30A 4Q36A 1HEEA 4KSFA 1Y0YA 2B5GA 5ELYA 1UFHA 3IIBA 3PB9X 1AMPA 1YLOA 4AG7A 4UCMA 3SXOA 5A28A 1M44A 4KLVA 4IK2A 3F8KA 1B87A 1TF8A 1XOVA 4R3KA 4OC3A 4X3RA 2YGWA 3RNZA 4A33A 4FD4A 3IO1A 1KUXA 1PCAA 2CNSA 2BEIA 2Z3PA 1ZLHA 2BL1A 3KQZA 4RUHA 3I1UA 2FT0A 4XPDC 2IMOA 4R87A 3WC6A 3WC5A 1I21A 4NGNA 2C6CA 4UF4A 3D68A 4UIBA 3D8PA 4TWEA 2BO9A 4JXRA 4ZX9A 4OIWA 5HVFA 5J8CA 1DE4C 1NE9A 3S9MA 2JBJA 3MRUA 3IWEA 3D4UA 4DJLA 5AG4A 5JPHA 1R43A 1Z2LA 2OH1A 2PJCA 1MJ9A 1BO4A 4JXQA 1CX8A 1JWQA 5D29A 5EMIA 3W6XA 3QNVA 3BJ7A 4EVYA 1CP6A 3D2PA 4ZGYB 2J8NA 4PQAA 3R95A 3EFAA 4CAWA 2C6PA 2OR4A 2PRQA 4PV6A 4QBJA 1CM0A 2PJ5A 2V77A 2Q44A 1YK3A 4NJRA 4B10A 4Z65A 5IX3A 3FB3A 4XNHB 3FVLA 4Q38A 1QSNA 2CY2A 1N71A 4F6AA 2ZEDA 2ABZA 3BHXA 2CF4A 4ZY2A 3GUXA 3R9FA 4OMEA 1QQ9A 2GE3A 2JEWA 4YWYA 3TC8A 1LOKA 3FNCA 5I4MA 3W91A 3DLJA 3PB6X 2AFOA 3RAMA 2DEAA 3KL9A 4MFKA 3DSBA 5F47A 3CXQA 3TTHA 3EC4A 1GYTA 4P4FA 5G22A 3GB0A 2AJ6A 2VEZA 3T8WA 2PQ8A 5KTCA 2EO8A 5LYLA 2PJ7A
chains in the Genus database with same CATH topology
1VIXA 4KSIA 3NFZA 4NGPA 5THWA 4A94A 1YW4A 3PBBA 4UEZA 1EE3P 2XEFA 1F57A 2J9AA 3PEIA 3B3WA 1H8LA 4PXBA 2Q43A 3FECA 3D7DA 5JH9A 2IJZA 4X8IA 5LYDA 1CBXA 3FX6A 1TXRA 3LWUA 4OKOA 3WT4A 2F7VA 3B35A 1YW6A 2ZOGA 5HVGA 5HVHA 4MRIA 1IY7A 3B3TA 1PYTB 3CT9A 4NGTA 3L2NA 1VGYA 3S9LA 2V8DA 1BLLE 3JRUA 5CBMA 2PIZA 2ZEFA 3PB8X 5IB9A 5K8PA 5F09A 5LRJA 1FT7A 4LQGA 3FF3A 1M4LA 4MCRA 1FNOA 1Z8LA 4F9UA 4ZY0A 4ZI6A 4TNUA 3NA6A 4PXCA 4P4JA 2QVPA 1QMUA 3H8EA 1HDQA 4OP4A 3PB4X 3PRTA 3D66A 1XMBA 4R8FA 5D8NA 4NJQA 1F2PA 4IHMA 5CPAA 2PJ8A 3S9NA 3CPAA 3IC1A 4CPAA 4JZ0A 4F9VA 1Z5RA 4P6YA 2XEIA 2Q51A 5K8MA 4G1PA 4WWVA 3IWWA 1LANA 3KHZA 4MXUA 5JGFA 4UIAA 4X2TA 2I3CA 2CIJA 6CPAA 2CTBA 1CG2A 4YU9A 2IQ6A 4DUKA 3B2YA 7CPAA 4JYWA 4ZX8A 4MHYA 3KI9A 3HLPA 4Q7AA 3N5FA 2O53A 3NH5A 1TKHA 5JM6A 1CPXA 3FH4A 4OC4A 2AFXA 2ZENA 3VH9A 2PCUA 2QYVA 4ZY1A 2ZOFA 2AFUA 2Q4ZA 5LRKA 3KR4A 4MMOA 5LYFA 4FUUA 1ARMA 4NGQA 1RTQA 3WC7A 4P4IA 2BOAA 2CTCA 2F8HA 2XEJA 2ZEGA 4OC0A 3IEHA 3KHXA 4P44A 2PJAA 1TF9A 1ZG9A 2ZEMA 4EWTA 3RZAA 1BAVA 1ZG7A 4MHPA 2XEGA 2ANPA 3FEDA 4F8ZA 3D7GA 2G9DA 3PFOA 2AFMA 4MCQA 1UWYA 2NYQA 4P10A 2PVWA 2GLJA 2QJ8A 4FBEA 5J1QA 4R7MA 1BPMA 3BI0A 4A38A 4NGRA 3K9TA 4UEEA 1IGBA 2PJ0A 3KR5A 2O4HA 3PFEA 4K3NA 1F2OA 1TKFA 3NH4A 1VHEA 2PJ6A 1LAPA 3FMCA 4PXEA 2HC9A 3B3VA 4OIDA 4A37A 3BI1A 3IJ3A 4MHZA 2ZEOA 2ZEEA 3SJGA 3H8FA 3VARA 1XRYA 4H2KA 1ARLA 4P45A 4PPZA 4P4DA 1LAMA 1LFWA 2PVVA 4ZYQA 4NGSA 2AFZA 3B3CA 4PXDA 1YMEA 1NSAA 1XBUA 3KASA 4MCSA 4EFDA 4NGMA 3BXMA 1ELMP 1JQGA 2EK8A 1CP7A 3V7ZA 3NH8A 2C6GA 4ONWA 2HB6A 3TX8A 3WABA 3B7IA 3ISZA 1KWMA 4A39A 4MHNA 1ZG8A 4FWUA 3SJEA 4B6ZA 4P4EA 4O23A 5DS0A 2V8VA 4MCPA 3MN8A 3KZWA 3LMSA 3FJUA 2PJ4A 3D7FA 4FAIA 3SI2A 1DTDA 4EMEA 2EK9A 1ZLIA 3CPXA 4DYOA 1VHOA 2WYRA 3K2KA 1Y0RA 2PJ1A 3KQXA 2GU2A 3PBEA 5LYIA 3IFEA 2RFHA 3D67A 3CDXA 3SJXA 4R76A 1R3NA 1ELLP 3DGVA 4OC5A 2RB7A 1AYEA 2BCOA 2V8HA 1YSJA 2PJ3A 2ZELA 3ISXA 3RBUA 3HUVA 4OC2A 2FVGA 3D7HA 2C1CA 3FEEA 3VATA 1Q7LA 1OBRA 1XJOA 2PJBA 3V38A 4GM5A 2ZEPA 2PE3A 3B3SA 4NFRA 2OOTA 2POKA 1CPSA 2NSMA 4WJBA 3SI1A 1XFOA 1HDUA 1LCPA 5LRGA 2WZNA 2PIYA 3KGQA 5HXDA 3PB7X 4W9YA 2JBKA 2V8GA 2AFSA 2ZEHA 8CPAA 1TKJA 2PJ9A 4AXVA 2GLFA 2AFWA 2PJ2A 3SJFA 5K8NA 4IAVA 4BD9A 4P4BA 2VL1A 2EWBA 3GLJA 1Y7EA 5K8OA 4UEFA 4R6TA 1BPNA 2GREA 3SI0A 4OC1A 3H8GA 1HEEA 1Y0YA 5ELYA 3IIBA 3PB9X 1AMPA 1YLOA 4IK2A 1TF8A 4OC3A 4X3RA 3IO1A 1PCAA 3KQZA 4RUHA 1ZLHA 3I1UA 2IMOA 3WC6A 3WC5A 4NGNA 2C6CA 4UF4A 3D68A 4UIBA 4TWEA 2BO9A 4ZX9A 4OIWA 5HVFA 1DE4C 3S9MA 4DJLA 2JBJA 3MRUA 3D4UA 1R43A 1Z2LA 2PJCA 1CX8A 5D29A 3QNVA 1CP6A 4PQAA 2C6PA 2OR4A 2PRQA 2PJ5A 2V77A 4NJRA 4Z65A 3FVLA 2ZEDA 2ABZA 3BHXA 2CF4A 4ZY2A 3GUXA 4OMEA 1QQ9A 4YWYA 2JEWA 3TC8A 1LOKA 5I4MA 3DLJA 3PB6X 2AFOA 3RAMA 2DEAA 3KL9A 1GYTA 4P4FA 3GB0A 3T8WA 5LYLA 2PJ7A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1VIX A;  4KSI A;  3NFZ A;  4NGP A;  5THW A;  4A94 A;  1YW4 A;  3PBB A;  4UEZ A;  1EE3 P;  2XEF A;  1F57 A;  2J9A A;  3PEI A;  3B3W A;  1H8L A;  4PXB A;  2Q43 A;  3FEC A;  3D7D A;  5JH9 A;  2IJZ A;  4X8I A;  5LYD A;  1CBX A;  3FX6 A;  1TXR A;  3LWU A;  4OKO A;  3WT4 A;  2F7V A;  3B35 A;  1YW6 A;  2ZOG A;  5HVG A;  5HVH A;  4MRI A;  1IY7 A;  3B3T A;  1PYT B;  3CT9 A;  4NGT A;  3L2N A;  1VGY A;  3S9L A;  2V8D A;  1BLL E;  3JRU A;  5CBM A;  2PIZ A;  2ZEF A;  3PB8 X;  5IB9 A;  5K8P A;  5F09 A;  5LRJ A;  1FT7 A;  4LQG A;  3FF3 A;  1M4L A;  4MCR A;  1FNO A;  1Z8L A;  4F9U A;  4ZY0 A;  4ZI6 A;  4TNU A;  3NA6 A;  4PXC A;  4P4J A;  2QVP A;  1QMU A;  3H8E A;  1HDQ A;  4OP4 A;  3PB4 X;  3PRT A;  3D66 A;  1XMB A;  4R8F A;  5D8N A;  4NJQ A;  1F2P A;  4IHM A;  5CPA A;  2PJ8 A;  3S9N A;  3CPA A;  3IC1 A;  4CPA A;  4JZ0 A;  4F9V A;  1Z5R A;  4P6Y A;  2XEI A;  2Q51 A;  5K8M A;  4G1P A;  4WWV A;  3IWW A;  1LAN A;  3KHZ A;  4MXU A;  5JGF A;  4UIA A;  4X2T A;  2I3C A;  2CIJ A;  6CPA A;  2CTB A;  1CG2 A;  4YU9 A;  2IQ6 A;  4DUK A;  3B2Y A;  7CPA A;  4JYW A;  4ZX8 A;  4MHY A;  3KI9 A;  3HLP A;  4Q7A A;  3N5F A;  2O53 A;  3NH5 A;  1TKH A;  5JM6 A;  1CPX A;  3FH4 A;  4OC4 A;  2AFX A;  2ZEN A;  3VH9 A;  2PCU A;  2QYV A;  4ZY1 A;  2ZOF A;  2AFU A;  2Q4Z A;  5LRK A;  3KR4 A;  4MMO A;  5LYF A;  4FUU A;  1ARM A;  4NGQ A;  1RTQ A;  3WC7 A;  4P4I A;  2BOA A;  2CTC A;  2F8H A;  2XEJ A;  2ZEG A;  4OC0 A;  3IEH A;  3KHX A;  4P44 A;  2PJA A;  1TF9 A;  1ZG9 A;  2ZEM A;  4EWT A;  3RZA A;  1BAV A;  1ZG7 A;  4MHP A;  2XEG A;  2ANP A;  3FED A;  4F8Z A;  3D7G A;  2G9D A;  3PFO A;  2AFM A;  4MCQ A;  1UWY A;  2NYQ A;  4P10 A;  2PVW A;  2GLJ A;  2QJ8 A;  4FBE A;  5J1Q A;  4R7M A;  1BPM A;  3BI0 A;  4A38 A;  4NGR A;  3K9T A;  4UEE A;  1IGB A;  2PJ0 A;  3KR5 A;  2O4H A;  3PFE A;  4K3N A;  1F2O A;  1TKF A;  3NH4 A;  1VHE A;  2PJ6 A;  1LAP A;  3FMC A;  4PXE A;  2HC9 A;  3B3V A;  4OID A;  4A37 A;  3BI1 A;  3IJ3 A;  4MHZ A;  2ZEO A;  2ZEE A;  3SJG A;  3H8F A;  3VAR A;  1XRY A;  4H2K A;  1ARL A;  4P45 A;  4PPZ A;  4P4D A;  1LAM A;  1LFW A;  2PVV A;  4ZYQ A;  4NGS A;  2AFZ A;  3B3C A;  4PXD A;  1YME A;  1NSA A;  1XBU A;  3KAS A;  4MCS A;  4EFD A;  4NGM A;  3BXM A;  1ELM P;  1JQG A;  2EK8 A;  1CP7 A;  3V7Z A;  3NH8 A;  2C6G A;  4ONW A;  2HB6 A;  3TX8 A;  3WAB A;  3B7I A;  3ISZ A;  1KWM A;  4A39 A;  4MHN A;  1ZG8 A;  4FWU A;  3SJE A;  4B6Z A;  4P4E A;  4O23 A;  5DS0 A;  2V8V A;  4MCP A;  3MN8 A;  3KZW A;  3LMS A;  3FJU A;  2PJ4 A;  3D7F A;  4FAI A;  3SI2 A;  1DTD A;  4EME A;  2EK9 A;  1ZLI A;  3CPX A;  4DYO A;  1VHO A;  2WYR A;  3K2K A;  1Y0R A;  2PJ1 A;  3KQX A;  2GU2 A;  3PBE A;  5LYI A;  3IFE A;  2RFH A;  3D67 A;  3CDX A;  3SJX A;  4R76 A;  1R3N A;  1ELL P;  3DGV A;  4OC5 A;  2RB7 A;  1AYE A;  2BCO A;  2V8H A;  1YSJ A;  2PJ3 A;  2ZEL A;  3ISX A;  3RBU A;  3HUV A;  4OC2 A;  2FVG A;  3D7H A;  2C1C A;  3FEE A;  3VAT A;  1Q7L A;  1OBR A;  1XJO A;  2PJB A;  3V38 A;  4GM5 A;  2ZEP A;  2PE3 A;  3B3S A;  4NFR A;  2OOT A;  2POK A;  1CPS A;  2NSM A;  4WJB A;  3SI1 A;  1XFO A;  1HDU A;  1LCP A;  5LRG A;  2WZN A;  2PIY A;  3KGQ A;  5HXD A;  3PB7 X;  4W9Y A;  2JBK A;  2V8G A;  2AFS A;  2ZEH A;  8CPA A;  1TKJ A;  2PJ9 A;  4AXV A;  2GLF A;  2AFW A;  2PJ2 A;  3SJF A;  5K8N A;  4IAV A;  4BD9 A;  4P4B A;  2VL1 A;  2EWB A;  3GLJ A;  1Y7E A;  5K8O A;  4UEF A;  4R6T A;  1BPN A;  2GRE A;  3SI0 A;  4OC1 A;  3H8G A;  1HEE A;  1Y0Y A;  5ELY A;  3IIB A;  3PB9 X;  1AMP A;  1YLO A;  4IK2 A;  1TF8 A;  4OC3 A;  4X3R A;  3IO1 A;  1PCA A;  3KQZ A;  4RUH A;  1ZLH A;  3I1U A;  2IMO A;  3WC6 A;  3WC5 A;  4NGN A;  2C6C A;  4UF4 A;  3D68 A;  4UIB A;  4TWE A;  2BO9 A;  4ZX9 A;  4OIW A;  5HVF A;  1DE4 C;  3S9M A;  4DJL A;  2JBJ A;  3MRU A;  3D4U A;  1R43 A;  1Z2L A;  2PJC A;  1CX8 A;  5D29 A;  3QNV A;  1CP6 A;  4PQA A;  2C6P A;  2OR4 A;  2PRQ A;  2PJ5 A;  2V77 A;  4NJR A;  4Z65 A;  3FVL A;  2ZED A;  2ABZ A;  3BHX A;  2CF4 A;  4ZY2 A;  3GUX A;  4OME A;  1QQ9 A;  4YWY A;  2JEW A;  3TC8 A;  1LOK A;  5I4M A;  3DLJ A;  3PB6 X;  2AFO A;  3RAM A;  2DEA A;  3KL9 A;  1GYT A;  4P4F A;  3GB0 A;  3T8W A;  5LYL A;  2PJ7 A; 
#chains in the Genus database with same CATH topology
 2ZW7 A;  1FY7 A;  1MK4 A;  1VIX A;  4KSI A;  4R57 A;  2CNT A;  2I79 A;  1X12 A;  1YQE A;  2DPT A;  3CZX A;  3I9S A;  3NFZ A;  4NGP A;  4QC6 A;  3PZJ A;  1QST A;  1Z8W A;  3R9G A;  3R1K A;  5THW A;  4B5O A;  4CAF A;  4A94 A;  3GKR A;  2JEV A;  1YW4 A;  2FCK A;  3GYA A;  3PBB A;  4UEZ A;  4UWJ A;  1NSL A;  1EE3 P;  4KVO E;  2VQY A;  2XEF A;  4H6Z A;  1F57 A;  5F49 A;  5F46 A;  2OZG A;  2PR1 A;  2J9A A;  3PEI A;  3B3W A;  1IU8 A;  2K5T A;  3C26 A;  4KOR A;  1IIC A;  1H8L A;  2DPS A;  2Q04 A;  3A9L A;  4PXB A;  4CGO A;  4JLY A;  2Q43 A;  3FEC A;  3D7D A;  3F0A A;  5JH9 A;  2IJZ A;  4X8I A;  5LYD A;  5F48 A;  1CBX A;  3CXS A;  2GAN A;  3FX6 A;  2B3U A;  4HNX B;  1TXR A;  5EC4 A;  3LWU A;  4OKO A;  4MI4 A;  1Z8T A;  3WT4 A;  4A32 A;  1QSM A;  2F7V A;  5A27 A;  2X7B A;  3B35 A;  1YW6 A;  2ZOG A;  3CXP A;  4AG9 A;  2FXF A;  4RN7 A;  2WUU A;  4KUA A;  1WWZ A;  4FD7 A;  5HVG A;  4MRI A;  5HVH A;  2F5I A;  4IF5 A;  1IY7 A;  3B3T A;  1PYT B;  1PU9 A;  5IV0 A;  3CT9 A;  4NGT A;  3L2N A;  1VGY A;  4GXH A;  3S9L A;  3P2H A;  4B12 A;  2V8D A;  3JVN A;  5AG6 A;  1BLL E;  3H4Q A;  3JRU A;  2ZPA A;  4AVB A;  2NMT A;  2PIZ A;  2ZEF A;  5CBM A;  3PB8 X;  2BSW A;  2DF5 A;  1IID A;  4B5P B;  1Q2C A;  5IB9 A;  5KTA A;  5K8P A;  4OAE A;  3D2M A;  4UWI A;  2BUE A;  5I0C A;  5F09 A;  5LRJ A;  2EBJ A;  1FT7 A;  3IWG A;  2REE A;  4LQG A;  3FF3 A;  3BLN A;  1M4L A;  2EVN A;  2JDD A;  1FNO A;  4MFJ A;  1Z8L A;  2O28 A;  2QIR A;  4MCR A;  4F9U A;  4ZY0 A;  4MJ8 A;  4ZI6 A;  2JLM A;  3WR7 A;  3MGD A;  1YRE A;  1S7L A;  4MY0 A;  4TNU A;  4F0Y A;  4UFV A;  2HUZ A;  3NA6 A;  4KUB A;  3PGP A;  4PXC A;  2R98 A;  1YX0 A;  4P4J A;  2QVP A;  1J4J A;  4UA3 A;  1QMU A;  2B4D B;  2YND A;  3H8E A;  4PSW A;  1HDQ A;  4OP4 A;  3DDD A;  4MY3 A;  3PB4 X;  3PRT A;  3D66 A;  2Z3L A;  4NEX A;  2YNE A;  4KOT A;  1XMB A;  4LQ6 A;  4R8F A;  2FIA A;  4NJQ A;  5D8N A;  4CAE A;  5G20 A;  1F2P A;  3OWC A;  5FVJ A;  2PRB A;  2EUI A;  1Z4R A;  2J8R A;  1M4G A;  4IHM A;  2PJ8 A;  5CPA A;  3S9N A;  3CPA A;  3IC1 A;  4H6U A;  4UFX A;  4CPA A;  4JZ0 A;  1Q2Y A;  1QSO A;  4F9V A;  2ZW4 A;  3QAH A;  1QSR A;  4KLW A;  4M6G A;  3S6H A;  3VWD A;  4YFJ A;  1M1D A;  1Z5R A;  2OZU A;  2REF A;  2Q4V A;  5DWM A;  1XIX A;  3R9E A;  4B13 A;  4P6Y A;  1KUY A;  1S5K A;  2FL4 A;  2XEI A;  5E96 A;  2Q51 A;  1ON0 A;  5K8M A;  4G1P A;  2FS5 A;  4WWV A;  3IWW A;  1LRZ A;  5H84 A;  1LAN A;  3KHZ A;  4MXU A;  4HKF A;  5JGF A;  4UIA A;  3SHP A;  2Z10 A;  4X2T A;  2I3C A;  2CIJ A;  4JWP A;  2WSA A;  3TO7 A;  4FD6 A;  4I49 A;  6CPA A;  1S7K A;  2CTB A;  3I3G A;  1CG2 A;  2VZY A;  1KUV A;  4YGO A;  4YU9 A;  4A2Z A;  4DNC A;  1Z9U A;  5IB0 A;  2IQ6 A;  1IOI A;  4CYO A;  4UFW A;  1XF8 A;  4AVA A;  4C7H A;  4DUK A;  2GIV A;  5KTD A;  3B2Y A;  4NXY A;  1Y9K A;  2PR8 A;  2ZW6 A;  4LUA A;  4JYW A;  2P6F A;  3UY5 A;  7CPA A;  4ZX8 A;  3PP9 A;  3B8G A;  1M4I A;  2A4N A;  4MHY A;  4KOS A;  2Z3O A;  2RC4 A;  1SQH A;  4U9Y A;  4XPD B;  1L0C A;  1S7F A;  3KI9 A;  4B5P A;  3HLP A;  4Q7A A;  3N5F A;  2O53 A;  3FYN A;  1YVK A;  3NH5 A;  1TKH A;  4UCN A;  3RYO A;  5JM6 A;  1GHE A;  1CPX A;  3FH4 A;  4E8O A;  4OC4 A;  2AFX A;  3IU1 A;  3TOA A;  2ZEN A;  2G3T A;  3VH9 A;  4QVT A;  4QB9 A;  2PCU A;  2QYV A;  2JDC A;  4J3G A;  4ZY1 A;  2ZOF A;  2AFU A;  4Y49 C;  2HQY A;  2Q4Z A;  5LRK A;  3KR4 A;  4C68 A;  4MMO A;  4CGN A;  5C88 A;  4HNY B;  5LYF A;  4FUU A;  1AUG A;  2B4D A;  4PSX A;  1ARM A;  4NGQ A;  1RTQ A;  3WC7 A;  4KVX A;  5HH1 A;  4P4I A;  3TCV A;  2BOA A;  2CTC A;  3P2F A;  2F8H A;  2GFQ A;  3LOD A;  2XEJ A;  2ZEG A;  5J8F A;  2G3A A;  2OB0 A;  4FD5 A;  3ZZI A;  4CYP A;  3LAC A;  4OC0 A;  3IEH A;  3DR6 A;  1Y9W A;  2H5M A;  3KHX A;  4P44 A;  4F0X A;  2PJA A;  4RI1 A;  1TF9 A;  1ZG9 A;  2ZEM A;  4EWT A;  3GY9 A;  3RZA A;  4MFQ A;  1BAV A;  1ZG7 A;  4RS2 A;  3JUW A;  4MHP A;  2XEG A;  4E0A A;  2ANP A;  2B58 A;  3FED A;  4M6I A;  1CJW A;  2WPW A;  4F8Z A;  3D7G A;  2G9D A;  3PFO A;  2AFM A;  2Z11 A;  4MCQ A;  1M4D A;  1UWY A;  2NYQ A;  5DWN A;  3VWE A;  3TE4 A;  2QML A;  3NE8 A;  4P10 A;  2PVW A;  4MHD A;  4E2A A;  2GLJ A;  2QJ8 A;  2FIW A;  3W6S A;  4CRZ B;  4R7M A;  2G0B A;  4FBE A;  5J1Q A;  2B3V A;  1BPM A;  3BI0 A;  4IUS A;  2ZXV A;  4KVM E;  4A38 A;  3H5Z A;  4MFP A;  4NGR A;  3K9T A;  3BJ8 A;  4UEE A;  1IGB A;  2QEC A;  3NE7 A;  2ODF A;  2PJ0 A;  3KR5 A;  1IOF A;  5BWA B;  4KOX A;  1PUA A;  3TO9 A;  2O4H A;  2PSW A;  3PFE A;  4K3N A;  1F2O A;  1TKF A;  2IL4 A;  3EY5 A;  3NH4 A;  1VHE A;  2PJ6 A;  3QAY A;  3T90 A;  4NCZ A;  1LAP A;  2WPX A;  3FMC A;  5G1Z A;  4PXE A;  2HC9 A;  4CS0 B;  4B11 A;  3QB8 A;  1RO5 A;  3B3V A;  3TO6 A;  2DXQ A;  4H89 A;  4OID A;  4R9M A;  4A37 A;  3S6G A;  3JTK A;  4NF1 A;  2ATR A;  3BI1 A;  5H86 A;  3IJ3 A;  4LX9 A;  4KOY A;  1YVO A;  4XPL A;  3GIU A;  1P0H A;  4MHZ A;  4YRH A;  2ZEO A;  2ZEE A;  1I12 A;  2Z3N A;  3SJG A;  3H8F A;  4U9Z A;  3VAR A;  4XNH C;  1Z4E A;  1XRY A;  4OAD A;  4H2K A;  1ARL A;  4P45 A;  2VZZ A;  4HPS A;  4PPZ A;  4P4D A;  1LAM A;  1LFW A;  2PVV A;  1V0C A;  4MFZ A;  4ZYQ A;  1MJB A;  4KSA A;  2R1I A;  4NGS A;  5AG5 A;  4M3S A;  2AFZ A;  1BOB A;  3B3C A;  4PXD A;  1YME A;  3FIX A;  2Z3M A;  1NSA A;  1XBU A;  4AVC A;  3KAS A;  1XE4 A;  2I00 A;  1TIQ A;  2P0W A;  4MCS A;  4EFD A;  1WK4 A;  1R57 A;  4NGM A;  4CAX A;  3BXM A;  1ELM P;  1JQG A;  1OZP A;  2EK8 A;  1CP7 A;  3V7Z A;  3NH8 A;  2C6G A;  2OZH A;  2Q4Y A;  5EBV A;  4QUS A;  2OU2 A;  3IGR A;  4L89 A;  4ONW A;  4CGM A;  5CNP A;  4KOU A;  1Q2D A;  2HB6 A;  3TX8 A;  3WAB A;  3B7I A;  4M85 A;  5JQ4 A;  3S6F A;  2Z0Z A;  4UCP A;  2ARH A;  3ISZ A;  1KZF A;  1KWM A;  4A39 A;  4MHN A;  1XEB A;  2Q0Y A;  1ZG8 A;  4FWU A;  1U6M A;  5GCN A;  2CNM A;  3SJE A;  4B6Z A;  4ORF A;  4P4E A;  3IU2 A;  4O23 A;  4NSQ A;  5DS0 A;  2V8V A;  1S60 A;  1NMT A;  4MCP A;  2PC1 A;  3MN8 A;  3S6K A;  2R8V A;  3KZW A;  3LMS A;  3FJU A;  2PJ4 A;  3D7F A;  4C2Y A;  1B6B A;  3TT2 A;  1YGH A;  2R7H A;  4B14 A;  2FSR A;  4FAI A;  4K30 A;  2PDO A;  3SI2 A;  5C82 A;  4II9 A;  1DTD A;  1ZO0 A;  2YNC A;  3DNS A;  4EME A;  4CYQ A;  2EK9 A;  1ZLI A;  3CPX A;  4L8A A;  2B5G B;  4DYO A;  1VHO A;  2KCW A;  3FBU A;  2WYR A;  1VKC A;  3K2K A;  1Y0R A;  4M6H A;  1Z8X A;  2PJ1 A;  1K4J A;  2AE6 A;  3N7Z A;  3KQX A;  2GU2 A;  3PBE A;  5LYI A;  3IFE A;  3EXN A;  4KOW A;  1S7N A;  2RFH A;  3D67 A;  4A31 A;  3CDX A;  3SJX A;  4R76 A;  1R3N A;  1ELL P;  3DGV A;  2C27 A;  4C7I A;  1RXT A;  4OC5 A;  2Q7S A;  2RB7 A;  4MBU A;  1AYE A;  4MFL A;  4A95 A;  2BCO A;  2V8H A;  4ONU A;  4CGP A;  1YSJ A;  2PJ3 A;  2FE7 A;  2ZEL A;  4CYN A;  1VHS A;  3ISX A;  2P6G A;  3D3S A;  3HUV A;  4JJX A;  4OC2 A;  4U5Y A;  3RBU A;  4C2Z A;  1A2Z A;  3FXT A;  3G3S A;  2FVG A;  3D7H A;  2C1C A;  3FEE A;  3LD2 A;  3VAT A;  3ZJ0 A;  3F5B A;  1Q7L A;  1OBR A;  1XJO A;  2PJB A;  2J8M A;  4X5K A;  1X10 A;  3V38 A;  4HNW B;  1P4N A;  3G8W A;  2ZEP A;  4GM5 A;  2PE3 A;  2YNC C;  1Y7R A;  4ZBG A;  1IB1 E;  2VI7 A;  3B3S A;  4NFR A;  4R3L A;  2OOT A;  2POK A;  4C2X A;  3E0K A;  1CPS A;  1S3Z A;  4Y49 B;  3TOB A;  2NSM A;  4KS9 A;  3EO4 A;  4WJB A;  4AB7 A;  3SI1 A;  1XFO A;  1HDU A;  2Z3K A;  1LCP A;  3SXN A;  4BIN A;  3T9Y A;  4CGL A;  3TFY A;  5LRG A;  2WZN A;  2PIY A;  4KOV A;  3KGQ A;  5HXD A;  3PB7 X;  4W9Y A;  2D4P A;  2JBK A;  1IYL A;  2CXA A;  2V8G A;  2AFS A;  3K9U A;  1XMT A;  2ZEH A;  4CRY B;  8CPA A;  1TKJ A;  4BBH A;  3R96 A;  2PJ9 A;  2VXK A;  2Y0M A;  4AXV A;  2GLF A;  2AFW A;  4CAV A;  2ZW5 A;  4PK2 A;  2PJ2 A;  3SJF A;  5K8N A;  2D4O A;  2Q7B A;  3V8I A;  4IAV A;  3FRM A;  4GS4 A;  1IYK A;  5AGE A;  3DR8 A;  1YLE A;  5ISV A;  4BD9 A;  4P4B A;  5HMN A;  2B4B A;  2VL1 A;  2EWB A;  3GLJ A;  1Y7E A;  1I1D A;  3RO0 A;  5K8O A;  2VBQ A;  4UEF A;  3KKW A;  4UBR A;  4JD6 A;  4PK3 A;  4KZT A;  4R6T A;  1BPN A;  2GRE A;  3SI0 A;  4OC1 A;  4BMH A;  4XPK A;  5G21 A;  1MJA A;  2P6E A;  3H8G A;  2HV2 A;  4OLL A;  1YR0 A;  5AG7 A;  4A30 A;  4Q36 A;  1HEE A;  4KSF A;  1Y0Y A;  2B5G A;  5ELY A;  1UFH A;  3IIB A;  3PB9 X;  1AMP A;  1YLO A;  4AG7 A;  4UCM A;  3SXO A;  5A28 A;  1M44 A;  4KLV A;  4IK2 A;  3F8K A;  1B87 A;  1TF8 A;  1XOV A;  4R3K A;  4OC3 A;  4X3R A;  2YGW A;  3RNZ A;  4A33 A;  4FD4 A;  3IO1 A;  1KUX A;  1PCA A;  2CNS A;  2BEI A;  2Z3P A;  1ZLH A;  2BL1 A;  3KQZ A;  4RUH A;  3I1U A;  2FT0 A;  4XPD C;  2IMO A;  4R87 A;  3WC6 A;  3WC5 A;  1I21 A;  4NGN A;  2C6C A;  4UF4 A;  3D68 A;  4UIB A;  3D8P A;  4TWE A;  2BO9 A;  4JXR A;  4ZX9 A;  4OIW A;  5HVF A;  5J8C A;  1DE4 C;  1NE9 A;  3S9M A;  2JBJ A;  3MRU A;  3IWE A;  3D4U A;  4DJL A;  5AG4 A;  5JPH A;  1R43 A;  1Z2L A;  2OH1 A;  2PJC A;  1MJ9 A;  1BO4 A;  4JXQ A;  1CX8 A;  1JWQ A;  5D29 A;  5EMI A;  3W6X A;  3QNV A;  3BJ7 A;  4EVY A;  1CP6 A;  3D2P A;  4ZGY B;  2J8N A;  4PQA A;  3R95 A;  3EFA A;  4CAW A;  2C6P A;  2OR4 A;  2PRQ A;  4PV6 A;  4QBJ A;  1CM0 A;  2PJ5 A;  2V77 A;  2Q44 A;  1YK3 A;  4NJR A;  4B10 A;  4Z65 A;  5IX3 A;  3FB3 A;  4XNH B;  3FVL A;  4Q38 A;  1QSN A;  2CY2 A;  1N71 A;  4F6A A;  2ZED A;  2ABZ A;  3BHX A;  2CF4 A;  4ZY2 A;  3GUX A;  3R9F A;  4OME A;  1QQ9 A;  2GE3 A;  2JEW A;  4YWY A;  3TC8 A;  1LOK A;  3FNC A;  5I4M A;  3W91 A;  3DLJ A;  3PB6 X;  2AFO A;  3RAM A;  2DEA A;  3KL9 A;  4MFK A;  3DSB A;  5F47 A;  3CXQ A;  3TTH A;  3EC4 A;  1GYT A;  4P4F A;  5G22 A;  3GB0 A;  2AJ6 A;  2VEZ A;  3T8W A;  2PQ8 A;  5KTC A;  2EO8 A;  5LYL A;  2PJ7 A; 
#chains in the Genus database with same CATH homology
 1VIX A;  4KSI A;  3NFZ A;  4NGP A;  5THW A;  4A94 A;  1YW4 A;  3PBB A;  4UEZ A;  1EE3 P;  2XEF A;  1F57 A;  2J9A A;  3PEI A;  3B3W A;  1H8L A;  4PXB A;  2Q43 A;  3FEC A;  3D7D A;  5JH9 A;  2IJZ A;  4X8I A;  5LYD A;  1CBX A;  3FX6 A;  1TXR A;  3LWU A;  4OKO A;  3WT4 A;  2F7V A;  3B35 A;  1YW6 A;  2ZOG A;  5HVG A;  5HVH A;  4MRI A;  1IY7 A;  3B3T A;  1PYT B;  3CT9 A;  4NGT A;  3L2N A;  1VGY A;  3S9L A;  2V8D A;  1BLL E;  3JRU A;  5CBM A;  2PIZ A;  2ZEF A;  3PB8 X;  5IB9 A;  5K8P A;  5F09 A;  5LRJ A;  1FT7 A;  4LQG A;  3FF3 A;  1M4L A;  4MCR A;  1FNO A;  1Z8L A;  4F9U A;  4ZY0 A;  4ZI6 A;  4TNU A;  3NA6 A;  4PXC A;  4P4J A;  2QVP A;  1QMU A;  3H8E A;  1HDQ A;  4OP4 A;  3PB4 X;  3PRT A;  3D66 A;  1XMB A;  4R8F A;  5D8N A;  4NJQ A;  1F2P A;  4IHM A;  5CPA A;  2PJ8 A;  3S9N A;  3CPA A;  3IC1 A;  4CPA A;  4JZ0 A;  4F9V A;  1Z5R A;  4P6Y A;  2XEI A;  2Q51 A;  5K8M A;  4G1P A;  4WWV A;  3IWW A;  1LAN A;  3KHZ A;  4MXU A;  5JGF A;  4UIA A;  4X2T A;  2I3C A;  2CIJ A;  6CPA A;  2CTB A;  1CG2 A;  4YU9 A;  2IQ6 A;  4DUK A;  3B2Y A;  7CPA A;  4JYW A;  4ZX8 A;  4MHY A;  3KI9 A;  3HLP A;  4Q7A A;  3N5F A;  2O53 A;  3NH5 A;  1TKH A;  5JM6 A;  1CPX A;  3FH4 A;  4OC4 A;  2AFX A;  2ZEN A;  3VH9 A;  2PCU A;  2QYV A;  4ZY1 A;  2ZOF A;  2AFU A;  2Q4Z A;  5LRK A;  3KR4 A;  4MMO A;  5LYF A;  4FUU A;  1ARM A;  4NGQ A;  1RTQ A;  3WC7 A;  4P4I A;  2BOA A;  2CTC A;  2F8H A;  2XEJ A;  2ZEG A;  4OC0 A;  3IEH A;  3KHX A;  4P44 A;  2PJA A;  1TF9 A;  1ZG9 A;  2ZEM A;  4EWT A;  3RZA A;  1BAV A;  1ZG7 A;  4MHP A;  2XEG A;  2ANP A;  3FED A;  4F8Z A;  3D7G A;  2G9D A;  3PFO A;  2AFM A;  4MCQ A;  1UWY A;  2NYQ A;  4P10 A;  2PVW A;  2GLJ A;  2QJ8 A;  4FBE A;  5J1Q A;  4R7M A;  1BPM A;  3BI0 A;  4A38 A;  4NGR A;  3K9T A;  4UEE A;  1IGB A;  2PJ0 A;  3KR5 A;  2O4H A;  3PFE A;  4K3N A;  1F2O A;  1TKF A;  3NH4 A;  1VHE A;  2PJ6 A;  1LAP A;  3FMC A;  4PXE A;  2HC9 A;  3B3V A;  4OID A;  4A37 A;  3BI1 A;  3IJ3 A;  4MHZ A;  2ZEO A;  2ZEE A;  3SJG A;  3H8F A;  3VAR A;  1XRY A;  4H2K A;  1ARL A;  4P45 A;  4PPZ A;  4P4D A;  1LAM A;  1LFW A;  2PVV A;  4ZYQ A;  4NGS A;  2AFZ A;  3B3C A;  4PXD A;  1YME A;  1NSA A;  1XBU A;  3KAS A;  4MCS A;  4EFD A;  4NGM A;  3BXM A;  1ELM P;  1JQG A;  2EK8 A;  1CP7 A;  3V7Z A;  3NH8 A;  2C6G A;  4ONW A;  2HB6 A;  3TX8 A;  3WAB A;  3B7I A;  3ISZ A;  1KWM A;  4A39 A;  4MHN A;  1ZG8 A;  4FWU A;  3SJE A;  4B6Z A;  4P4E A;  4O23 A;  5DS0 A;  2V8V A;  4MCP A;  3MN8 A;  3KZW A;  3LMS A;  3FJU A;  2PJ4 A;  3D7F A;  4FAI A;  3SI2 A;  1DTD A;  4EME A;  2EK9 A;  1ZLI A;  3CPX A;  4DYO A;  1VHO A;  2WYR A;  3K2K A;  1Y0R A;  2PJ1 A;  3KQX A;  2GU2 A;  3PBE A;  5LYI A;  3IFE A;  2RFH A;  3D67 A;  3CDX A;  3SJX A;  4R76 A;  1R3N A;  1ELL P;  3DGV A;  4OC5 A;  2RB7 A;  1AYE A;  2BCO A;  2V8H A;  1YSJ A;  2PJ3 A;  2ZEL A;  3ISX A;  3RBU A;  3HUV A;  4OC2 A;  2FVG A;  3D7H A;  2C1C A;  3FEE A;  3VAT A;  1Q7L A;  1OBR A;  1XJO A;  2PJB A;  3V38 A;  4GM5 A;  2ZEP A;  2PE3 A;  3B3S A;  4NFR A;  2OOT A;  2POK A;  1CPS A;  2NSM A;  4WJB A;  3SI1 A;  1XFO A;  1HDU A;  1LCP A;  5LRG A;  2WZN A;  2PIY A;  3KGQ A;  5HXD A;  3PB7 X;  4W9Y A;  2JBK A;  2V8G A;  2AFS A;  2ZEH A;  8CPA A;  1TKJ A;  2PJ9 A;  4AXV A;  2GLF A;  2AFW A;  2PJ2 A;  3SJF A;  5K8N A;  4IAV A;  4BD9 A;  4P4B A;  2VL1 A;  2EWB A;  3GLJ A;  1Y7E A;  5K8O A;  4UEF A;  4R6T A;  1BPN A;  2GRE A;  3SI0 A;  4OC1 A;  3H8G A;  1HEE A;  1Y0Y A;  5ELY A;  3IIB A;  3PB9 X;  1AMP A;  1YLO A;  4IK2 A;  1TF8 A;  4OC3 A;  4X3R A;  3IO1 A;  1PCA A;  3KQZ A;  4RUH A;  1ZLH A;  3I1U A;  2IMO A;  3WC6 A;  3WC5 A;  4NGN A;  2C6C A;  4UF4 A;  3D68 A;  4UIB A;  4TWE A;  2BO9 A;  4ZX9 A;  4OIW A;  5HVF A;  1DE4 C;  3S9M A;  4DJL A;  2JBJ A;  3MRU A;  3D4U A;  1R43 A;  1Z2L A;  2PJC A;  1CX8 A;  5D29 A;  3QNV A;  1CP6 A;  4PQA A;  2C6P A;  2OR4 A;  2PRQ A;  2PJ5 A;  2V77 A;  4NJR A;  4Z65 A;  3FVL A;  2ZED A;  2ABZ A;  3BHX A;  2CF4 A;  4ZY2 A;  3GUX A;  4OME A;  1QQ9 A;  4YWY A;  2JEW A;  3TC8 A;  1LOK A;  5I4M A;  3DLJ A;  3PB6 X;  2AFO A;  3RAM A;  2DEA A;  3KL9 A;  1GYT A;  4P4F A;  3GB0 A;  3T8W A;  5LYL A;  2PJ7 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...