3SI2A

Structure of glycosylated murine glutaminyl cyclase in presence of the inhibitor pq50 (pdbd150)
Total Genus 104
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
104
sequence length
327
structure length
322
Chain Sequence
AWTQEKNHHQPAHLNSSSLQQVAEGTSISEMWQNDLRPLLIERYPGSPGSYSARQHIMQRIQRLQAEWVVEVDTFLSRTPYGYRSFSNIISTLNPEAKRHLVLACHYDSKYFPRWDSRVFVGATDSAVPCAMMLELARALDKKLHSLKDPDLSLQLIFFDGEEAFHHWSPQDSLYGSRHLAQKMASSPHPPGSRGTNQLDGMDLLVLLDLIGAANPTFPNFFPKTTRWFNRLQAIEKELYELGLLKDHSLERKYFQNFGYGNIIQDDHIPFLRKGVPVLHLIASPFPEVWHTMDDNEENLHASTIDNLNKIIQVFVLEYLHL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Glutaminyl-peptide cyclotransferase
publication title Structures of Glycosylated Mammalian Glutaminyl Cyclases Reveal Conformational Variability near the Active Center.
pubmed doi rcsb
source organism Mus musculus
molecule tags Transferase/transferase inhibitor
total genus 104
structure length 322
sequence length 327
ec nomenclature ec 2.3.2.5: Glutaminyl-peptide cyclotransferase.
pdb deposition date 2011-06-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF04389 Peptidase_M28 Peptidase family M28
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.630.10 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Zn peptidases 3si2A00
3NH8A 4FAIA 5K8MA 4PQAA 3PEIA 3CPXA 3D4UA 1CG2A 2WYRA 1R43A 4NGTA 4NFRA 3MN8A 3GB0A 4NGQA 2ZEGA 2AFSA 5LRKA 3HLPA 1AYEA 1CPXA 1LCPA 4NGSA 3B35A 2ZEDA 1VHEA 1QMUA 4Z65A 1LAPA 4EWTA 4WJBA 3SI2A 3WABA 3B3CA 1HDUA 4OKOA 4R6TA 1DTDA 2PJCA 3N5FA 3KHZA 4NGNA 3NA6A 5HVHA 5DS0A 2PJ4A 1CPSA 1ZLHA 2PJ8A 4P4EA 4ZY1A 1VIXA 5CBMA 4YU9A 5LRGA 3FJUA 4P10A 1VHOA 4UIBA 4YWYA 4DYOA 2ZEMA 4DUKA 4F9VA 3RBUA 2GLFA 2AFOA 4IAVA 3KR5A 2XEIA 4P4BA 3H8GA 2RB7A 4MCRA 1BLLE 1F2PA 2PE3A 4P44A 3TX8A 1M4LA 3SI0A 3TC8A 5K8PA 1XFOA 5CPAA 3PFEA 2QJ8A 3KASA 5D8NA 2OR4A 2RFHA 2GU2A 2ZEPA 4FBEA 2F8HA 3SJXA 4P4IA 2PJBA 2PJAA 2GREA 4UEEA 1OBRA 3CPAA 4OMEA 1PYTB 1ELLP 4MHNA 2BOAA 1Z2LA 3IJ3A 1ZG8A 3PB8X 3PRTA 8CPAA 5JGFA 2PJ5A 2ABZA 3LWUA 4F8ZA 3SJEA 2BO9A 4MRIA 2XEJA 4PXEA 4BD9A 3JRUA 5JM6A 3KGQA 4OC4A 2C6CA 1YMEA 4NJQA 3WC6A 7CPAA 2IJZA 2O4HA 3IO1A 2CIJA 2DEAA 1ARLA 4EFDA 2C6PA 1PCAA 4ZY2A 3KZWA 6CPAA 4A39A 1BPMA 3K9TA 4PXCA 3BI1A 3GUXA 3KQZA 3D7HA 5HVFA 4MCPA 4PXDA 1IY7A 2ANPA 4PPZA 4K3NA 3WT4A 3PB7X 2PJ7A 4R8FA 3PFOA 4NGRA 4OC1A 1ELMP 4WWVA 2ZEOA 1RTQA 2JEWA 4KSIA 3SJGA 2AFZA 1YLOA 3L2NA 4B6ZA 2EK8A 2JBJA 4F9UA 3IEHA 2QVPA 4ZX9A 2Q43A 3KR4A 2PJ9A 4TWEA 2XEFA 3D7DA 2PCUA 3BHXA 2ZENA 2PJ0A 4RUHA 2PJ1A 3H8FA 4MHPA 4O23A 1CP6A 1TKFA 3PB9X 1BPNA 1YW4A 1R3NA 1ZLIA 1CP7A 1Q7LA 4UF4A 4ZI6A 2ZEFA 3CT9A 4P4DA 1Z8LA 1Y0RA 1IGBA 3VATA 3D67A 5I4MA 1TF8A 3BI0A 3IC1A 3H8EA 4MMOA 3B3TA 3KI9A 4FWUA 5HVGA 3KHXA 4PXBA 2JBKA 4OC3A 5D29A 2QYVA 2I3CA 1YW6A 2PIYA 4ZY0A 1CX8A 1ZG7A 4MCQA 3FECA 3FEDA 3D68A 3FF3A 4UIAA 4OC2A 4R7MA 3T8WA 2CTCA 5LYLA 3D7FA 1XBUA 3DLJA 4P4FA 1H8LA 2AFXA 3S9LA 1TF9A 2ZOGA 3IIBA 2AFUA 4OP4A 2CF4A 3V7ZA 3V38A 5LYIA 2G9DA 2NSMA 2V8GA 3KQXA 4LQGA 4P4JA 1F2OA 3B3WA 4X8IA 3WC7A 4TNUA 1Y0YA 4MHYA 3IFEA 4NGMA 2XEGA 2HB6A 1LFWA 3DGVA 4EMEA 4OIWA 4GM5A 5K8NA 3FEEA 5IB9A 3IWWA 5K8OA 2Q4ZA 1ARMA 3KL9A 2VL1A 3PBEA 1XJOA 2Q51A 4FUUA 1UWYA 5J1QA 2J9AA 3S9MA 1HEEA 2C1CA 2BCOA 3B2YA 3RZAA 2EWBA 1VGYA 2OOTA 1XRYA 1TKJA 3NFZA 3FVLA 1F57A 2AFMA 4P45A 3MRUA 4OC5A 3FX6A 5ELYA 5F09A 1LANA 4A38A 4IK2A 3WC5A 4ZYQA 1JQGA 4NJRA 5LYDA 1EE3P 1Z5RA 3K2KA 3FH4A 4W9YA 1Y7EA 4UEZA 5JH9A 5LYFA 2V8HA 2PJ2A 3ISZA 4MCSA 1KWMA 4P6YA 1LAMA 3RAMA 3NH5A 4A94A 1FT7A 2WZNA 2POKA 3PBBA 3VARA 1CBXA 2CTBA 1XMBA 3NH4A 3B3SA 1DE4C 2PJ3A 4JZ0A 1AMPA 1TKHA 2AFWA 1FNOA 2V77A 3ISXA 3PB6X 4UEFA 2F7VA 1HDQA 2PVWA 4OC0A 3BXMA 4JYWA 4OIDA 2PJ6A 2PRQA 4G1PA 3CDXA 3I1UA 3B7IA 4MHZA 3D66A 2PIZA 3GLJA 4NGPA 2ZOFA 2ZEEA 3B3VA 2IMOA 2IQ6A 3D7GA 4CPAA 4X2TA 3FMCA 1LOKA 4A37A 4R76A 4X3RA 3PB4X 4AXVA 3SI1A 3HUVA 1QQ9A 1NSAA 3SJFA 3LMSA 5LRJA 5HXDA 2C6GA 2O53A 2HC9A 3VH9A 1ZG9A 4Q7AA 2PVVA 2EK9A 2ZEHA 4H2KA 4MXUA 3QNVA 2ZELA 4IHMA 4ONWA 4ZX8A 2GLJA 4DJLA 5THWA 2FVGA 3S9NA 1TXRA 1GYTA 2V8DA 2NYQA 1YSJA 1BAVA 2V8VA
chains in the Genus database with same CATH superfamily
3NH8A 4FAIA 5G1ZA 2Q7SA 4CRYB 4PQAA 3PEIA 5K8MA 3CPXA 1X10A 3D4UA 1CG2A 5EMIA 2WYRA 1R43A 3TO7A 1VKCA 4NFRA 4NGTA 3TO6A 3MN8A 3GB0A 4NGQA 1MJAA 5J8FA 2ZEGA 2AFSA 2R98A 5LRKA 1ON0A 4FD7A 1BO4A 4JWPA 3HLPA 1AYEA 1CPXA 1KUVA 1I1DA 1LCPA 2CNMA 4NGSA 3B35A 2ZEDA 2CY2A 1VHEA 2CNSA 4AVAA 1QMUA 4C68A 4Z65A 1BOBA 2B4DB 4UFXA 1LAPA 4EWTA 3D2MA 4UWIA 4CAVA 4WJBA 1NSLA 3SI2A 5AG6A 3TCVA 3WABA 1Z9UA 2Z3KA 4A31A 3B3CA 1HDUA 4OKOA 4R6TA 1DTDA 2PJCA 3N5FA 2Z3MA 2OZHA 3KHZA 2K5TA 4NGNA 4JD6A 3I3GA 4CGMA 3NA6A 3EXNA 5DS0A 5HVHA 1GHEA 2PJ4A 4JLYA 3TTHA 2FCKA 1CPSA 2G3AA 4UFWA 2B4BA 1ZLHA 2PJ8A 4P4EA 4ZY1A 2R8VA 1VIXA 5CBMA 4IF5A 2FE7A 4YU9A 2NMTA 2YNCC 4C2ZA 4L89A 1FY7A 1I21A 3P2FA 2B5GA 5DWMA 5FVJA 3EFAA 3FJUA 5LRGA 4AVBA 4P10A 3W6XA 1VHOA 4UIBA 4YWYA 1Z8WA 2Z3NA 4KVXA 2HV2A 4DYOA 2ZEMA 5IB0A 4XNHC 4CS0B 4MBUA 4DUKA 4F9VA 3RBUA 1YVOA 2GLFA 2KCWA 2AFOA 3TT2A 4IAVA 3KR5A 1XEBA 2XEIA 4P4BA 2OB0A 3H8GA 1QSMA 2RB7A 3VWDA 4K30A 4KLWA 4MCRA 3GKRA 2D4PA 1BLLE 1F2PA 2I00A 2PE3A 3H5ZA 2ATRA 4RS2A 5H84A 1Y7RA 4P44A 4CGNA 4KLVA 3IWGA 4JXRA 3TX8A 1M4LA 1RO5A 1WWZA 3SI0A 1X12A 4M85A 5KTCA 2A4NA 3EC4A 3TC8A 5K8PA 1XFOA 1S60A 4BMHA 2PR8A 5CPAA 3OWCA 3PFEA 2QJ8A 3KASA 5A27A 1VHSA 5D8NA 2OR4A 2RFHA 4FD5A 2GU2A 1S7KA 2ZEPA 4FBEA 2F8HA 4ZGYB 4A32A 5BWAB 3SJXA 5G21A 3RNZA 4AG7A 4BBHA 3GYAA 4F6AA 1A2ZA 2P6EA 4UCPA 4B13A 4P4IA 2PJBA 2PJAA 2YNEA 2GREA 4UEEA 2R1IA 1OBRA 4HPSA 2OU2A 1M4DA 3CPAA 4KSFA 4CGOA 4OMEA 1PYTB 4M6IA 1ELLP 4XPLA 4MHNA 3GIUA 2BOAA 5AG5A 2Z3LA 1P4NA 1Z2LA 3IJ3A 1M1DA 1ZG8A 3N7ZA 3PB8X 4BINA 1CJWA 1IICA 3LD2A 3PRTA 8CPAA 5JGFA 5I0CA 1S3ZA 3W91A 2WSAA 2PJ5A 3FB3A 2ABZA 2PDOA 3BLNA 3LWUA 3SHPA 4F8ZA 5HMNA 4MY0A 3SJEA 2BO9A 4MRIA 2REEA 2XEJA 4PXEA 5F48A 3CZXA 3T9YA 1M4GA 4CYOA 4BD9A 4XNHB 2B58A 4QB9A 1L0CA 1B87A 4CGPA 1M4IA 4KZTA 3JRUA 2VZYA 4UWJA 5JM6A 3KGQA 4OC4A 2C6CA 2CNTA 3IU2A 3TOAA 4OADA 4KUBA 5G20A 1YMEA 3I9SA 4XPDC 5ISVA 4Y49C 4GS4A 3B8GA 4NJQA 3FNCA 2PSWA 4H6ZA 3R96A 3WC6A 7CPAA 2IJZA 2O4HA 3F8KA 3IO1A 5AG7A 2VQYA 2CIJA 2DEAA 3QAHA 1ARLA 3G3SA 3FRMA 2AE6A 4KS9A 4EFDA 3BJ8A 3QB8A 3LODA 1S7NA 2C6PA 4FD4A 4F0XA 1PCAA 4ZY2A 3RO0A 1Q2DA 1TIQA 3KZWA 4A39A 4B12A 2I79A 2OH1A 4KOUA 6CPAA 1BPMA 3K9TA 4PXCA 5JPHA 2EO8A 3BI1A 3GUXA 3KQZA 4HNXB 4R87A 4UBRA 4C2XA 3D7HA 4B10A 4XPKA 4R3LA 5HVFA 4KVOE 1MK4A 2BEIA 1YR0A 3F0AA 4MCPA 4A30A 4PXDA 1IY7A 2F5IA 5AGEA 4C2YA 1B6BA 2ANPA 5AG4A 4PPZA 3DR8A 3V8IA 2Y0MA 3D8PA 4K3NA 3WT4A 3PB7X 2PJ7A 2Z0ZA 4NXYA 4R8FA 4FD6A 1P0HA 4CYQA 2VI7A 1XE4A 1PUAA 1QSOA 2REFA 3PFOA 4GXHA 3DNSA 4NGRA 4OC1A 1ELMP 4PSWA 4WWVA 2CXAA 2J8RA 2ZEOA 4M6HA 1RTQA 2JEWA 3BJ7A 4KSIA 4KSAA 1RXTA 3SJGA 2RC4A 1MJ9A 2AFZA 1QSNA 4IUSA 1YLOA 3L2NA 4B6ZA 2EK8A 2JBJA 4L8AA 3PP9A 4F9UA 3IEHA 2Q44A 2QVPA 2YGWA 1N71A 2P6FA 4ZX9A 2Q43A 3KR4A 2G3TA 2PJ9A 4TWEA 2XEFA 3D7DA 2PCUA 3BHXA 3JVNA 2EBJA 2PC1A 3D3SA 2FSRA 4ZBGA 3G8WA 2ZENA 4XPDB 2PJ0A 2C27A 4Y49B 2GE3A 4RUHA 4NCZA 2IL4A 2PJ1A 3H8FA 4MHPA 4O23A 1CP6A 1TKFA 2Q0YA 3TFYA 3PB9X 1BPNA 1YW4A 1R3NA 5A28A 1ZLIA 4Q38A 3C26A 4OLLA 4YRHA 1CP7A 3WR7A 1Q7LA 2WUUA 2ZXVA 1SQHA 4UF4A 5EBVA 3H4QA 4ZI6A 4JJXA 4R3KA 2ZEFA 5JQ4A 3S6HA 3CT9A 4MFPA 4UA3A 4HKFA 2FIAA 4P4DA 4PK2A 3ZJ0A 2JEVA 4B11A 1Z8LA 1Y0RA 1IGBA 4X5KA 3VATA 1Q2CA 4NSQA 3D67A 5I4MA 5KTAA 4B14A 1TF8A 3BI0A 5F49A 2ARHA 3IC1A 4LUAA 4NEXA 3H8EA 3R95A 4A33A 4MMOA 2JLMA 3FIXA 5C88A 1Y9KA 3B3TA 3NE8A 4U9ZA 3T90A 1ZO0A 3E0KA 2FIWA 3KI9A 2Z10A 4FWUA 2H5MA 4QVTA 4YFJA 3S6FA 3FBUA 5HVGA 3KHXA 4E0AA 4PXBA 2JBKA 4H6UA 4OC3A 5D29A 2QYVA 2I3CA 2DPSA 2EUIA 3EO4A 4PSXA 3F5BA 1YW6A 2PIYA 4B5PA 4ZY0A 2HQYA 2FXFA 1CX8A 1ZG7A 2EVNA 4KUAA 4MCQA 4II9A 3FECA 3K9UA 3FEDA 5G22A 3D68A 3FF3A 4UIAA 3S6KA 4OC2A 4R7MA 3T8WA 2Z11A 2CTCA 2ZW4A 4HNWB 1XMTA 1JWQA 4EVYA 5J8CA 4U9YA 5LYLA 3LACA 1YGHA 2DF5A 3D7FA 3GY9A 2ZW6A 3TO9A 3CXSA 3CXQA 1XBUA 4E8OA 3DLJA 2DXQA 2YNCA 2J8NA 4P4FA 1H8LA 4UCNA 3FYNA 4H89A 2AFXA 3ZZIA 3FXTA 3IU1A 3S9LA 4ONUA 4M3SA 2O28A 4CAEA 4MHDA 3S6GA 4F0YA 3CXPA 1TF9A 2ZOGA 3IIBA 2AFUA 4OP4A 1XIXA 2CF4A 3V7ZA 1YVKA 3V38A 1LRZA 1Z8XA 2G9DA 2NSMA 5LYIA 2OZGA 3SXNA 2PRBA 2V8GA 3KQXA 2B3UA 5F46A 2J8MA 4LQGA 4P4JA 5DWNA 1Z8TA 1F2OA 3B3WA 4X8IA 3WC7A 4TNUA 1Y0YA 2OZUA 4MHYA 1CM0A 3DDDA 3IFEA 3R9GA 4MFQA 1Y9WA 2XEGA 4NGMA 2HB6A 2QMLA 1LFWA 1U6MA 3DGVA 3QAYA 4CAWA 5CNPA 4OIWA 5E96A 4GM5A 4CAFA 4EMEA 1S7LA 4RN7A 3FEEA 5K8NA 5IB9A 1K4JA 2JDDA 3IWWA 4KORA 5K8OA 2Q4ZA 1ARMA 3KL9A 5IX3A 4A2ZA 2Q04A 2VL1A 3PBEA 4R57A 4AG9A 1XJOA 2P0WA 2Q51A 4QC6A 4FUUA 1IB1E 1UWYA 4LQ6A 4U5YA 2GFQA 5J1QA 2J9AA 4J3GA 2BSWA 2QECA 4KOVA 1S5KA 2B4DA 1IIDA 1HEEA 1WK4A 2PQ8A 2Q4VA 4MFJA 3S9MA 4CRZB 4E2AA 2C1CA 2BCOA 2GIVA 3B2YA 2ODFA 3RZAA 2EWBA 1VGYA 2FS5A 4QBJA 4UCMA 2OOTA 1XRYA 1TKJA 4MJ8A 4ORFA 2BL1A 5EC4A 4AVCA 1YK3A 3FVLA 3NFZA 1F57A 2AFMA 4KOWA 4KOSA 4P45A 3MRUA 4CAXA 4OC5A 2VEZA 3FX6A 5ELYA 1Z4EA 3P2HA 1LANA 5F09A 2VBQA 4A38A 4IK2A 3WC5A 4ZYQA 1IOFA 1JQGA 1YX0A 4NJRA 5LYDA 3A9LA 2B5GB 1EE3P 3KKWA 1NMTA 1XOVA 1Z5RA 3K2KA 1MJBA 3FH4A 3EY5A 4W9YA 2HUZA 2G0BA 1Y7EA 4MFKA 2VZZA 4UEZA 5JH9A 5LYFA 2FT0A 5GCNA 2V8HA 1QSTA 2GANA 2JDCA 4M6GA 2PJ2A 4KOYA 3ISZA 4R9MA 5F47A 4MCSA 4UFVA 1KWMA 4KOXA 5IV0A 2Z3OA 3JUWA 4JXQA 2FL4A 4P6YA 4PV6A 3SXOA 4YGOA 1LAMA 2AJ6A 4C7HA 3RAMA 3NH5A 4A94A 2PR1A 1FT7A 2WZNA 1QSRA 2POKA 5HH1A 4A95A 3PBBA 3VARA 1V0CA 4CYPA 1CBXA 2CTBA 1XMBA 2ZW5A 3NH4A 3B3SA 4CGLA 1DE4C 2PJ3A 4JZ0A 3W6SA 3PGPA 2WPXA 1AMPA 1TKHA 2AFWA 1FNOA 2ZW7A 2YNDA 4MI4A 1OZPA 1M44A 1IYLA 2V77A 4KVME 3ISXA 3PB6X 4UEFA 2F7VA 1HDQA 2PVWA 4OAEA 3BXMA 4OC0A 3TOBA 2BUEA 4JYWA 4MFZA 3PZJA 4OIDA 2PJ6A 4B5OA 1KUXA 4DNCA 2PRQA 4G1PA 3CDXA 3I1UA 3B7IA 3MGDA 4CYNA 2Q7BA 4MHZA 3D66A 3NE7A 2PIZA 3IGRA 3GLJA 1IU8A 1IOIA 4NGPA 2ZOFA 4B5PB 2ZEEA 2QIRA 3B3VA 1AUGA 2IMOA 1S7FA 2IQ6A 3D7GA 1YLEA 4CPAA 2X7BA 3R9FA 4X2TA 1UFHA 5H86A 3FMCA 3UY5A 1IYKA 3DSBA 4MFLA 1LOKA 4RI1A 2Q4YA 3TE4A 4A37A 4R76A 1PU9A 4X3RA 2R7HA 3R9EA 3PB4X 3RYOA 4AXVA 2Z3PA 3SI1A 1KZFA 3HUVA 1QQ9A 4KOTA 1NSAA 4LX9A 3IWEA 4AB7A 4PK3A 3LMSA 3SJFA 5LRJA 5HXDA 2C6GA 2O53A 5KTDA 2WPWA 3JTKA 2HC9A 2VXKA 3R1KA 4I49A 4QUSA 1ZG9A 4Q7AA 3VH9A 2PVVA 2EK9A 2ZEHA 4MY3A 3VWEA 2DPTA 4H2KA 1XF8A 4MXUA 4NF1A 2P6GA 3QNVA 2ZELA 4IHMA 4ONWA 3DR6A 4ZX8A 4C7IA 1R57A 1KUYA 1I12A 2GLJA 2B3VA 1YREA 5THWA 4DJLA 1J4JA 2FVGA 3S9NA 1TXRA 1YQEA 2ZPAA 1GYTA 2V8DA 3D2PA 2D4OA 2NYQA 1Q2YA 1YSJA 1NE9A 4HNYB 1BAVA 4Q36A 2V8VA 1Z4RA 5C82A
chains in the Genus database with same CATH topology
3NH8A 4FAIA 5K8MA 4PQAA 3PEIA 3CPXA 3D4UA 1CG2A 2WYRA 1R43A 4NGTA 4NFRA 3MN8A 3GB0A 4NGQA 2ZEGA 2AFSA 5LRKA 3HLPA 1AYEA 1CPXA 1LCPA 4NGSA 3B35A 2ZEDA 1VHEA 1QMUA 4Z65A 1LAPA 4EWTA 4WJBA 3SI2A 3WABA 3B3CA 1HDUA 4OKOA 4R6TA 1DTDA 2PJCA 3N5FA 3KHZA 4NGNA 3NA6A 5HVHA 5DS0A 2PJ4A 1CPSA 1ZLHA 2PJ8A 4P4EA 4ZY1A 1VIXA 5CBMA 4YU9A 5LRGA 3FJUA 4P10A 1VHOA 4UIBA 4YWYA 4DYOA 2ZEMA 4DUKA 4F9VA 3RBUA 2GLFA 2AFOA 4IAVA 3KR5A 2XEIA 4P4BA 3H8GA 2RB7A 4MCRA 1BLLE 1F2PA 2PE3A 4P44A 3TX8A 1M4LA 3SI0A 3TC8A 5K8PA 1XFOA 5CPAA 3PFEA 2QJ8A 3KASA 5D8NA 2OR4A 2RFHA 2GU2A 2ZEPA 4FBEA 2F8HA 3SJXA 4P4IA 2PJBA 2PJAA 2GREA 4UEEA 1OBRA 3CPAA 4OMEA 1PYTB 1ELLP 4MHNA 2BOAA 1Z2LA 3IJ3A 1ZG8A 3PB8X 3PRTA 8CPAA 5JGFA 2PJ5A 2ABZA 3LWUA 4F8ZA 3SJEA 2BO9A 4MRIA 2XEJA 4PXEA 4BD9A 3JRUA 5JM6A 3KGQA 4OC4A 2C6CA 1YMEA 4NJQA 3WC6A 7CPAA 2IJZA 2O4HA 3IO1A 2CIJA 2DEAA 1ARLA 4EFDA 2C6PA 1PCAA 4ZY2A 3KZWA 6CPAA 4A39A 1BPMA 3K9TA 4PXCA 3BI1A 3GUXA 3KQZA 3D7HA 5HVFA 4MCPA 4PXDA 1IY7A 2ANPA 4PPZA 4K3NA 3WT4A 3PB7X 2PJ7A 4R8FA 3PFOA 4NGRA 4OC1A 1ELMP 4WWVA 2ZEOA 1RTQA 2JEWA 4KSIA 3SJGA 2AFZA 1YLOA 3L2NA 4B6ZA 2EK8A 2JBJA 4F9UA 3IEHA 2QVPA 4ZX9A 2Q43A 3KR4A 2PJ9A 4TWEA 2XEFA 3D7DA 2PCUA 3BHXA 2ZENA 2PJ0A 4RUHA 2PJ1A 3H8FA 4MHPA 4O23A 1CP6A 1TKFA 3PB9X 1BPNA 1YW4A 1R3NA 1ZLIA 1CP7A 1Q7LA 4UF4A 4ZI6A 2ZEFA 3CT9A 4P4DA 1Z8LA 1Y0RA 1IGBA 3VATA 3D67A 5I4MA 1TF8A 3BI0A 3IC1A 3H8EA 4MMOA 3B3TA 3KI9A 4FWUA 5HVGA 3KHXA 4PXBA 2JBKA 4OC3A 5D29A 2QYVA 2I3CA 1YW6A 2PIYA 4ZY0A 1CX8A 1ZG7A 4MCQA 3FECA 3FEDA 3D68A 3FF3A 4UIAA 4OC2A 4R7MA 3T8WA 2CTCA 5LYLA 3D7FA 1XBUA 3DLJA 4P4FA 1H8LA 2AFXA 3S9LA 1TF9A 2ZOGA 3IIBA 2AFUA 4OP4A 2CF4A 3V7ZA 3V38A 5LYIA 2G9DA 2NSMA 2V8GA 3KQXA 4LQGA 4P4JA 1F2OA 3B3WA 4X8IA 3WC7A 4TNUA 1Y0YA 4MHYA 3IFEA 4NGMA 2XEGA 2HB6A 1LFWA 3DGVA 4EMEA 4OIWA 4GM5A 5K8NA 3FEEA 5IB9A 3IWWA 5K8OA 2Q4ZA 1ARMA 3KL9A 2VL1A 3PBEA 1XJOA 2Q51A 4FUUA 1UWYA 5J1QA 2J9AA 3S9MA 1HEEA 2C1CA 2BCOA 3B2YA 3RZAA 2EWBA 1VGYA 2OOTA 1XRYA 1TKJA 3NFZA 3FVLA 1F57A 2AFMA 4P45A 3MRUA 4OC5A 3FX6A 5ELYA 5F09A 1LANA 4A38A 4IK2A 3WC5A 4ZYQA 1JQGA 4NJRA 5LYDA 1EE3P 1Z5RA 3K2KA 3FH4A 4W9YA 1Y7EA 4UEZA 5JH9A 5LYFA 2V8HA 2PJ2A 3ISZA 4MCSA 1KWMA 4P6YA 1LAMA 3RAMA 3NH5A 4A94A 1FT7A 2WZNA 2POKA 3PBBA 3VARA 1CBXA 2CTBA 1XMBA 3NH4A 3B3SA 1DE4C 2PJ3A 4JZ0A 1AMPA 1TKHA 2AFWA 1FNOA 2V77A 3ISXA 3PB6X 4UEFA 2F7VA 1HDQA 2PVWA 4OC0A 3BXMA 4JYWA 4OIDA 2PJ6A 2PRQA 4G1PA 3CDXA 3I1UA 3B7IA 4MHZA 3D66A 2PIZA 3GLJA 4NGPA 2ZOFA 2ZEEA 3B3VA 2IMOA 2IQ6A 3D7GA 4CPAA 4X2TA 3FMCA 1LOKA 4A37A 4R76A 4X3RA 3PB4X 4AXVA 3SI1A 3HUVA 1QQ9A 1NSAA 3SJFA 3LMSA 5LRJA 5HXDA 2C6GA 2O53A 2HC9A 3VH9A 1ZG9A 4Q7AA 2PVVA 2EK9A 2ZEHA 4H2KA 4MXUA 3QNVA 2ZELA 4IHMA 4ONWA 4ZX8A 2GLJA 4DJLA 5THWA 2FVGA 3S9NA 1TXRA 1GYTA 2V8DA 2NYQA 1YSJA 1BAVA 2V8VA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3NH8 A;  4FAI A;  5K8M A;  4PQA A;  3PEI A;  3CPX A;  3D4U A;  1CG2 A;  2WYR A;  1R43 A;  4NGT A;  4NFR A;  3MN8 A;  3GB0 A;  4NGQ A;  2ZEG A;  2AFS A;  5LRK A;  3HLP A;  1AYE A;  1CPX A;  1LCP A;  4NGS A;  3B35 A;  2ZED A;  1VHE A;  1QMU A;  4Z65 A;  1LAP A;  4EWT A;  4WJB A;  3SI2 A;  3WAB A;  3B3C A;  1HDU A;  4OKO A;  4R6T A;  1DTD A;  2PJC A;  3N5F A;  3KHZ A;  4NGN A;  3NA6 A;  5HVH A;  5DS0 A;  2PJ4 A;  1CPS A;  1ZLH A;  2PJ8 A;  4P4E A;  4ZY1 A;  1VIX A;  5CBM A;  4YU9 A;  5LRG A;  3FJU A;  4P10 A;  1VHO A;  4UIB A;  4YWY A;  4DYO A;  2ZEM A;  4DUK A;  4F9V A;  3RBU A;  2GLF A;  2AFO A;  4IAV A;  3KR5 A;  2XEI A;  4P4B A;  3H8G A;  2RB7 A;  4MCR A;  1BLL E;  1F2P A;  2PE3 A;  4P44 A;  3TX8 A;  1M4L A;  3SI0 A;  3TC8 A;  5K8P A;  1XFO A;  5CPA A;  3PFE A;  2QJ8 A;  3KAS A;  5D8N A;  2OR4 A;  2RFH A;  2GU2 A;  2ZEP A;  4FBE A;  2F8H A;  3SJX A;  4P4I A;  2PJB A;  2PJA A;  2GRE A;  4UEE A;  1OBR A;  3CPA A;  4OME A;  1PYT B;  1ELL P;  4MHN A;  2BOA A;  1Z2L A;  3IJ3 A;  1ZG8 A;  3PB8 X;  3PRT A;  8CPA A;  5JGF A;  2PJ5 A;  2ABZ A;  3LWU A;  4F8Z A;  3SJE A;  2BO9 A;  4MRI A;  2XEJ A;  4PXE A;  4BD9 A;  3JRU A;  5JM6 A;  3KGQ A;  4OC4 A;  2C6C A;  1YME A;  4NJQ A;  3WC6 A;  7CPA A;  2IJZ A;  2O4H A;  3IO1 A;  2CIJ A;  2DEA A;  1ARL A;  4EFD A;  2C6P A;  1PCA A;  4ZY2 A;  3KZW A;  6CPA A;  4A39 A;  1BPM A;  3K9T A;  4PXC A;  3BI1 A;  3GUX A;  3KQZ A;  3D7H A;  5HVF A;  4MCP A;  4PXD A;  1IY7 A;  2ANP A;  4PPZ A;  4K3N A;  3WT4 A;  3PB7 X;  2PJ7 A;  4R8F A;  3PFO A;  4NGR A;  4OC1 A;  1ELM P;  4WWV A;  2ZEO A;  1RTQ A;  2JEW A;  4KSI A;  3SJG A;  2AFZ A;  1YLO A;  3L2N A;  4B6Z A;  2EK8 A;  2JBJ A;  4F9U A;  3IEH A;  2QVP A;  4ZX9 A;  2Q43 A;  3KR4 A;  2PJ9 A;  4TWE A;  2XEF A;  3D7D A;  2PCU A;  3BHX A;  2ZEN A;  2PJ0 A;  4RUH A;  2PJ1 A;  3H8F A;  4MHP A;  4O23 A;  1CP6 A;  1TKF A;  3PB9 X;  1BPN A;  1YW4 A;  1R3N A;  1ZLI A;  1CP7 A;  1Q7L A;  4UF4 A;  4ZI6 A;  2ZEF A;  3CT9 A;  4P4D A;  1Z8L A;  1Y0R A;  1IGB A;  3VAT A;  3D67 A;  5I4M A;  1TF8 A;  3BI0 A;  3IC1 A;  3H8E A;  4MMO A;  3B3T A;  3KI9 A;  4FWU A;  5HVG A;  3KHX A;  4PXB A;  2JBK A;  4OC3 A;  5D29 A;  2QYV A;  2I3C A;  1YW6 A;  2PIY A;  4ZY0 A;  1CX8 A;  1ZG7 A;  4MCQ A;  3FEC A;  3FED A;  3D68 A;  3FF3 A;  4UIA A;  4OC2 A;  4R7M A;  3T8W A;  2CTC A;  5LYL A;  3D7F A;  1XBU A;  3DLJ A;  4P4F A;  1H8L A;  2AFX A;  3S9L A;  1TF9 A;  2ZOG A;  3IIB A;  2AFU A;  4OP4 A;  2CF4 A;  3V7Z A;  3V38 A;  5LYI A;  2G9D A;  2NSM A;  2V8G A;  3KQX A;  4LQG A;  4P4J A;  1F2O A;  3B3W A;  4X8I A;  3WC7 A;  4TNU A;  1Y0Y A;  4MHY A;  3IFE A;  4NGM A;  2XEG A;  2HB6 A;  1LFW A;  3DGV A;  4EME A;  4OIW A;  4GM5 A;  5K8N A;  3FEE A;  5IB9 A;  3IWW A;  5K8O A;  2Q4Z A;  1ARM A;  3KL9 A;  2VL1 A;  3PBE A;  1XJO A;  2Q51 A;  4FUU A;  1UWY A;  5J1Q A;  2J9A A;  3S9M A;  1HEE A;  2C1C A;  2BCO A;  3B2Y A;  3RZA A;  2EWB A;  1VGY A;  2OOT A;  1XRY A;  1TKJ A;  3NFZ A;  3FVL A;  1F57 A;  2AFM A;  4P45 A;  3MRU A;  4OC5 A;  3FX6 A;  5ELY A;  5F09 A;  1LAN A;  4A38 A;  4IK2 A;  3WC5 A;  4ZYQ A;  1JQG A;  4NJR A;  5LYD A;  1EE3 P;  1Z5R A;  3K2K A;  3FH4 A;  4W9Y A;  1Y7E A;  4UEZ A;  5JH9 A;  5LYF A;  2V8H A;  2PJ2 A;  3ISZ A;  4MCS A;  1KWM A;  4P6Y A;  1LAM A;  3RAM A;  3NH5 A;  4A94 A;  1FT7 A;  2WZN A;  2POK A;  3PBB A;  3VAR A;  1CBX A;  2CTB A;  1XMB A;  3NH4 A;  3B3S A;  1DE4 C;  2PJ3 A;  4JZ0 A;  1AMP A;  1TKH A;  2AFW A;  1FNO A;  2V77 A;  3ISX A;  3PB6 X;  4UEF A;  2F7V A;  1HDQ A;  2PVW A;  4OC0 A;  3BXM A;  4JYW A;  4OID A;  2PJ6 A;  2PRQ A;  4G1P A;  3CDX A;  3I1U A;  3B7I A;  4MHZ A;  3D66 A;  2PIZ A;  3GLJ A;  4NGP A;  2ZOF A;  2ZEE A;  3B3V A;  2IMO A;  2IQ6 A;  3D7G A;  4CPA A;  4X2T A;  3FMC A;  1LOK A;  4A37 A;  4R76 A;  4X3R A;  3PB4 X;  4AXV A;  3SI1 A;  3HUV A;  1QQ9 A;  1NSA A;  3SJF A;  3LMS A;  5LRJ A;  5HXD A;  2C6G A;  2O53 A;  2HC9 A;  3VH9 A;  1ZG9 A;  4Q7A A;  2PVV A;  2EK9 A;  2ZEH A;  4H2K A;  4MXU A;  3QNV A;  2ZEL A;  4IHM A;  4ONW A;  4ZX8 A;  2GLJ A;  4DJL A;  5THW A;  2FVG A;  3S9N A;  1TXR A;  1GYT A;  2V8D A;  2NYQ A;  1YSJ A;  1BAV A;  2V8V A; 
#chains in the Genus database with same CATH topology
 3NH8 A;  4FAI A;  5G1Z A;  2Q7S A;  4CRY B;  4PQA A;  3PEI A;  5K8M A;  3CPX A;  1X10 A;  3D4U A;  1CG2 A;  5EMI A;  2WYR A;  1R43 A;  3TO7 A;  1VKC A;  4NFR A;  4NGT A;  3TO6 A;  3MN8 A;  3GB0 A;  4NGQ A;  1MJA A;  5J8F A;  2ZEG A;  2AFS A;  2R98 A;  5LRK A;  1ON0 A;  4FD7 A;  1BO4 A;  4JWP A;  3HLP A;  1AYE A;  1CPX A;  1KUV A;  1I1D A;  1LCP A;  2CNM A;  4NGS A;  3B35 A;  2ZED A;  2CY2 A;  1VHE A;  2CNS A;  4AVA A;  1QMU A;  4C68 A;  4Z65 A;  1BOB A;  2B4D B;  4UFX A;  1LAP A;  4EWT A;  3D2M A;  4UWI A;  4CAV A;  4WJB A;  1NSL A;  3SI2 A;  5AG6 A;  3TCV A;  3WAB A;  1Z9U A;  2Z3K A;  4A31 A;  3B3C A;  1HDU A;  4OKO A;  4R6T A;  1DTD A;  2PJC A;  3N5F A;  2Z3M A;  2OZH A;  3KHZ A;  2K5T A;  4NGN A;  4JD6 A;  3I3G A;  4CGM A;  3NA6 A;  3EXN A;  5DS0 A;  5HVH A;  1GHE A;  2PJ4 A;  4JLY A;  3TTH A;  2FCK A;  1CPS A;  2G3A A;  4UFW A;  2B4B A;  1ZLH A;  2PJ8 A;  4P4E A;  4ZY1 A;  2R8V A;  1VIX A;  5CBM A;  4IF5 A;  2FE7 A;  4YU9 A;  2NMT A;  2YNC C;  4C2Z A;  4L89 A;  1FY7 A;  1I21 A;  3P2F A;  2B5G A;  5DWM A;  5FVJ A;  3EFA A;  3FJU A;  5LRG A;  4AVB A;  4P10 A;  3W6X A;  1VHO A;  4UIB A;  4YWY A;  1Z8W A;  2Z3N A;  4KVX A;  2HV2 A;  4DYO A;  2ZEM A;  5IB0 A;  4XNH C;  4CS0 B;  4MBU A;  4DUK A;  4F9V A;  3RBU A;  1YVO A;  2GLF A;  2KCW A;  2AFO A;  3TT2 A;  4IAV A;  3KR5 A;  1XEB A;  2XEI A;  4P4B A;  2OB0 A;  3H8G A;  1QSM A;  2RB7 A;  3VWD A;  4K30 A;  4KLW A;  4MCR A;  3GKR A;  2D4P A;  1BLL E;  1F2P A;  2I00 A;  2PE3 A;  3H5Z A;  2ATR A;  4RS2 A;  5H84 A;  1Y7R A;  4P44 A;  4CGN A;  4KLV A;  3IWG A;  4JXR A;  3TX8 A;  1M4L A;  1RO5 A;  1WWZ A;  3SI0 A;  1X12 A;  4M85 A;  5KTC A;  2A4N A;  3EC4 A;  3TC8 A;  5K8P A;  1XFO A;  1S60 A;  4BMH A;  2PR8 A;  5CPA A;  3OWC A;  3PFE A;  2QJ8 A;  3KAS A;  5A27 A;  1VHS A;  5D8N A;  2OR4 A;  2RFH A;  4FD5 A;  2GU2 A;  1S7K A;  2ZEP A;  4FBE A;  2F8H A;  4ZGY B;  4A32 A;  5BWA B;  3SJX A;  5G21 A;  3RNZ A;  4AG7 A;  4BBH A;  3GYA A;  4F6A A;  1A2Z A;  2P6E A;  4UCP A;  4B13 A;  4P4I A;  2PJB A;  2PJA A;  2YNE A;  2GRE A;  4UEE A;  2R1I A;  1OBR A;  4HPS A;  2OU2 A;  1M4D A;  3CPA A;  4KSF A;  4CGO A;  4OME A;  1PYT B;  4M6I A;  1ELL P;  4XPL A;  4MHN A;  3GIU A;  2BOA A;  5AG5 A;  2Z3L A;  1P4N A;  1Z2L A;  3IJ3 A;  1M1D A;  1ZG8 A;  3N7Z A;  3PB8 X;  4BIN A;  1CJW A;  1IIC A;  3LD2 A;  3PRT A;  8CPA A;  5JGF A;  5I0C A;  1S3Z A;  3W91 A;  2WSA A;  2PJ5 A;  3FB3 A;  2ABZ A;  2PDO A;  3BLN A;  3LWU A;  3SHP A;  4F8Z A;  5HMN A;  4MY0 A;  3SJE A;  2BO9 A;  4MRI A;  2REE A;  2XEJ A;  4PXE A;  5F48 A;  3CZX A;  3T9Y A;  1M4G A;  4CYO A;  4BD9 A;  4XNH B;  2B58 A;  4QB9 A;  1L0C A;  1B87 A;  4CGP A;  1M4I A;  4KZT A;  3JRU A;  2VZY A;  4UWJ A;  5JM6 A;  3KGQ A;  4OC4 A;  2C6C A;  2CNT A;  3IU2 A;  3TOA A;  4OAD A;  4KUB A;  5G20 A;  1YME A;  3I9S A;  4XPD C;  5ISV A;  4Y49 C;  4GS4 A;  3B8G A;  4NJQ A;  3FNC A;  2PSW A;  4H6Z A;  3R96 A;  3WC6 A;  7CPA A;  2IJZ A;  2O4H A;  3F8K A;  3IO1 A;  5AG7 A;  2VQY A;  2CIJ A;  2DEA A;  3QAH A;  1ARL A;  3G3S A;  3FRM A;  2AE6 A;  4KS9 A;  4EFD A;  3BJ8 A;  3QB8 A;  3LOD A;  1S7N A;  2C6P A;  4FD4 A;  4F0X A;  1PCA A;  4ZY2 A;  3RO0 A;  1Q2D A;  1TIQ A;  3KZW A;  4A39 A;  4B12 A;  2I79 A;  2OH1 A;  4KOU A;  6CPA A;  1BPM A;  3K9T A;  4PXC A;  5JPH A;  2EO8 A;  3BI1 A;  3GUX A;  3KQZ A;  4HNX B;  4R87 A;  4UBR A;  4C2X A;  3D7H A;  4B10 A;  4XPK A;  4R3L A;  5HVF A;  4KVO E;  1MK4 A;  2BEI A;  1YR0 A;  3F0A A;  4MCP A;  4A30 A;  4PXD A;  1IY7 A;  2F5I A;  5AGE A;  4C2Y A;  1B6B A;  2ANP A;  5AG4 A;  4PPZ A;  3DR8 A;  3V8I A;  2Y0M A;  3D8P A;  4K3N A;  3WT4 A;  3PB7 X;  2PJ7 A;  2Z0Z A;  4NXY A;  4R8F A;  4FD6 A;  1P0H A;  4CYQ A;  2VI7 A;  1XE4 A;  1PUA A;  1QSO A;  2REF A;  3PFO A;  4GXH A;  3DNS A;  4NGR A;  4OC1 A;  1ELM P;  4PSW A;  4WWV A;  2CXA A;  2J8R A;  2ZEO A;  4M6H A;  1RTQ A;  2JEW A;  3BJ7 A;  4KSI A;  4KSA A;  1RXT A;  3SJG A;  2RC4 A;  1MJ9 A;  2AFZ A;  1QSN A;  4IUS A;  1YLO A;  3L2N A;  4B6Z A;  2EK8 A;  2JBJ A;  4L8A A;  3PP9 A;  4F9U A;  3IEH A;  2Q44 A;  2QVP A;  2YGW A;  1N71 A;  2P6F A;  4ZX9 A;  2Q43 A;  3KR4 A;  2G3T A;  2PJ9 A;  4TWE A;  2XEF A;  3D7D A;  2PCU A;  3BHX A;  3JVN A;  2EBJ A;  2PC1 A;  3D3S A;  2FSR A;  4ZBG A;  3G8W A;  2ZEN A;  4XPD B;  2PJ0 A;  2C27 A;  4Y49 B;  2GE3 A;  4RUH A;  4NCZ A;  2IL4 A;  2PJ1 A;  3H8F A;  4MHP A;  4O23 A;  1CP6 A;  1TKF A;  2Q0Y A;  3TFY A;  3PB9 X;  1BPN A;  1YW4 A;  1R3N A;  5A28 A;  1ZLI A;  4Q38 A;  3C26 A;  4OLL A;  4YRH A;  1CP7 A;  3WR7 A;  1Q7L A;  2WUU A;  2ZXV A;  1SQH A;  4UF4 A;  5EBV A;  3H4Q A;  4ZI6 A;  4JJX A;  4R3K A;  2ZEF A;  5JQ4 A;  3S6H A;  3CT9 A;  4MFP A;  4UA3 A;  4HKF A;  2FIA A;  4P4D A;  4PK2 A;  3ZJ0 A;  2JEV A;  4B11 A;  1Z8L A;  1Y0R A;  1IGB A;  4X5K A;  3VAT A;  1Q2C A;  4NSQ A;  3D67 A;  5I4M A;  5KTA A;  4B14 A;  1TF8 A;  3BI0 A;  5F49 A;  2ARH A;  3IC1 A;  4LUA A;  4NEX A;  3H8E A;  3R95 A;  4A33 A;  4MMO A;  2JLM A;  3FIX A;  5C88 A;  1Y9K A;  3B3T A;  3NE8 A;  4U9Z A;  3T90 A;  1ZO0 A;  3E0K A;  2FIW A;  3KI9 A;  2Z10 A;  4FWU A;  2H5M A;  4QVT A;  4YFJ A;  3S6F A;  3FBU A;  5HVG A;  3KHX A;  4E0A A;  4PXB A;  2JBK A;  4H6U A;  4OC3 A;  5D29 A;  2QYV A;  2I3C A;  2DPS A;  2EUI A;  3EO4 A;  4PSX A;  3F5B A;  1YW6 A;  2PIY A;  4B5P A;  4ZY0 A;  2HQY A;  2FXF A;  1CX8 A;  1ZG7 A;  2EVN A;  4KUA A;  4MCQ A;  4II9 A;  3FEC A;  3K9U A;  3FED A;  5G22 A;  3D68 A;  3FF3 A;  4UIA A;  3S6K A;  4OC2 A;  4R7M A;  3T8W A;  2Z11 A;  2CTC A;  2ZW4 A;  4HNW B;  1XMT A;  1JWQ A;  4EVY A;  5J8C A;  4U9Y A;  5LYL A;  3LAC A;  1YGH A;  2DF5 A;  3D7F A;  3GY9 A;  2ZW6 A;  3TO9 A;  3CXS A;  3CXQ A;  1XBU A;  4E8O A;  3DLJ A;  2DXQ A;  2YNC A;  2J8N A;  4P4F A;  1H8L A;  4UCN A;  3FYN A;  4H89 A;  2AFX A;  3ZZI A;  3FXT A;  3IU1 A;  3S9L A;  4ONU A;  4M3S A;  2O28 A;  4CAE A;  4MHD A;  3S6G A;  4F0Y A;  3CXP A;  1TF9 A;  2ZOG A;  3IIB A;  2AFU A;  4OP4 A;  1XIX A;  2CF4 A;  3V7Z A;  1YVK A;  3V38 A;  1LRZ A;  1Z8X A;  2G9D A;  2NSM A;  5LYI A;  2OZG A;  3SXN A;  2PRB A;  2V8G A;  3KQX A;  2B3U A;  5F46 A;  2J8M A;  4LQG A;  4P4J A;  5DWN A;  1Z8T A;  1F2O A;  3B3W A;  4X8I A;  3WC7 A;  4TNU A;  1Y0Y A;  2OZU A;  4MHY A;  1CM0 A;  3DDD A;  3IFE A;  3R9G A;  4MFQ A;  1Y9W A;  2XEG A;  4NGM A;  2HB6 A;  2QML A;  1LFW A;  1U6M A;  3DGV A;  3QAY A;  4CAW A;  5CNP A;  4OIW A;  5E96 A;  4GM5 A;  4CAF A;  4EME A;  1S7L A;  4RN7 A;  3FEE A;  5K8N A;  5IB9 A;  1K4J A;  2JDD A;  3IWW A;  4KOR A;  5K8O A;  2Q4Z A;  1ARM A;  3KL9 A;  5IX3 A;  4A2Z A;  2Q04 A;  2VL1 A;  3PBE A;  4R57 A;  4AG9 A;  1XJO A;  2P0W A;  2Q51 A;  4QC6 A;  4FUU A;  1IB1 E;  1UWY A;  4LQ6 A;  4U5Y A;  2GFQ A;  5J1Q A;  2J9A A;  4J3G A;  2BSW A;  2QEC A;  4KOV A;  1S5K A;  2B4D A;  1IID A;  1HEE A;  1WK4 A;  2PQ8 A;  2Q4V A;  4MFJ A;  3S9M A;  4CRZ B;  4E2A A;  2C1C A;  2BCO A;  2GIV A;  3B2Y A;  2ODF A;  3RZA A;  2EWB A;  1VGY A;  2FS5 A;  4QBJ A;  4UCM A;  2OOT A;  1XRY A;  1TKJ A;  4MJ8 A;  4ORF A;  2BL1 A;  5EC4 A;  4AVC A;  1YK3 A;  3FVL A;  3NFZ A;  1F57 A;  2AFM A;  4KOW A;  4KOS A;  4P45 A;  3MRU A;  4CAX A;  4OC5 A;  2VEZ A;  3FX6 A;  5ELY A;  1Z4E A;  3P2H A;  1LAN A;  5F09 A;  2VBQ A;  4A38 A;  4IK2 A;  3WC5 A;  4ZYQ A;  1IOF A;  1JQG A;  1YX0 A;  4NJR A;  5LYD A;  3A9L A;  2B5G B;  1EE3 P;  3KKW A;  1NMT A;  1XOV A;  1Z5R A;  3K2K A;  1MJB A;  3FH4 A;  3EY5 A;  4W9Y A;  2HUZ A;  2G0B A;  1Y7E A;  4MFK A;  2VZZ A;  4UEZ A;  5JH9 A;  5LYF A;  2FT0 A;  5GCN A;  2V8H A;  1QST A;  2GAN A;  2JDC A;  4M6G A;  2PJ2 A;  4KOY A;  3ISZ A;  4R9M A;  5F47 A;  4MCS A;  4UFV A;  1KWM A;  4KOX A;  5IV0 A;  2Z3O A;  3JUW A;  4JXQ A;  2FL4 A;  4P6Y A;  4PV6 A;  3SXO A;  4YGO A;  1LAM A;  2AJ6 A;  4C7H A;  3RAM A;  3NH5 A;  4A94 A;  2PR1 A;  1FT7 A;  2WZN A;  1QSR A;  2POK A;  5HH1 A;  4A95 A;  3PBB A;  3VAR A;  1V0C A;  4CYP A;  1CBX A;  2CTB A;  1XMB A;  2ZW5 A;  3NH4 A;  3B3S A;  4CGL A;  1DE4 C;  2PJ3 A;  4JZ0 A;  3W6S A;  3PGP A;  2WPX A;  1AMP A;  1TKH A;  2AFW A;  1FNO A;  2ZW7 A;  2YND A;  4MI4 A;  1OZP A;  1M44 A;  1IYL A;  2V77 A;  4KVM E;  3ISX A;  3PB6 X;  4UEF A;  2F7V A;  1HDQ A;  2PVW A;  4OAE A;  3BXM A;  4OC0 A;  3TOB A;  2BUE A;  4JYW A;  4MFZ A;  3PZJ A;  4OID A;  2PJ6 A;  4B5O A;  1KUX A;  4DNC A;  2PRQ A;  4G1P A;  3CDX A;  3I1U A;  3B7I A;  3MGD A;  4CYN A;  2Q7B A;  4MHZ A;  3D66 A;  3NE7 A;  2PIZ A;  3IGR A;  3GLJ A;  1IU8 A;  1IOI A;  4NGP A;  2ZOF A;  4B5P B;  2ZEE A;  2QIR A;  3B3V A;  1AUG A;  2IMO A;  1S7F A;  2IQ6 A;  3D7G A;  1YLE A;  4CPA A;  2X7B A;  3R9F A;  4X2T A;  1UFH A;  5H86 A;  3FMC A;  3UY5 A;  1IYK A;  3DSB A;  4MFL A;  1LOK A;  4RI1 A;  2Q4Y A;  3TE4 A;  4A37 A;  4R76 A;  1PU9 A;  4X3R A;  2R7H A;  3R9E A;  3PB4 X;  3RYO A;  4AXV A;  2Z3P A;  3SI1 A;  1KZF A;  3HUV A;  1QQ9 A;  4KOT A;  1NSA A;  4LX9 A;  3IWE A;  4AB7 A;  4PK3 A;  3LMS A;  3SJF A;  5LRJ A;  5HXD A;  2C6G A;  2O53 A;  5KTD A;  2WPW A;  3JTK A;  2HC9 A;  2VXK A;  3R1K A;  4I49 A;  4QUS A;  1ZG9 A;  4Q7A A;  3VH9 A;  2PVV A;  2EK9 A;  2ZEH A;  4MY3 A;  3VWE A;  2DPT A;  4H2K A;  1XF8 A;  4MXU A;  4NF1 A;  2P6G A;  3QNV A;  2ZEL A;  4IHM A;  4ONW A;  3DR6 A;  4ZX8 A;  4C7I A;  1R57 A;  1KUY A;  1I12 A;  2GLJ A;  2B3V A;  1YRE A;  5THW A;  4DJL A;  1J4J A;  2FVG A;  3S9N A;  1TXR A;  1YQE A;  2ZPA A;  1GYT A;  2V8D A;  3D2P A;  2D4O A;  2NYQ A;  1Q2Y A;  1YSJ A;  1NE9 A;  4HNY B;  1BAV A;  4Q36 A;  2V8V A;  1Z4R A;  5C82 A; 
#chains in the Genus database with same CATH homology
 3NH8 A;  4FAI A;  5K8M A;  4PQA A;  3PEI A;  3CPX A;  3D4U A;  1CG2 A;  2WYR A;  1R43 A;  4NGT A;  4NFR A;  3MN8 A;  3GB0 A;  4NGQ A;  2ZEG A;  2AFS A;  5LRK A;  3HLP A;  1AYE A;  1CPX A;  1LCP A;  4NGS A;  3B35 A;  2ZED A;  1VHE A;  1QMU A;  4Z65 A;  1LAP A;  4EWT A;  4WJB A;  3SI2 A;  3WAB A;  3B3C A;  1HDU A;  4OKO A;  4R6T A;  1DTD A;  2PJC A;  3N5F A;  3KHZ A;  4NGN A;  3NA6 A;  5HVH A;  5DS0 A;  2PJ4 A;  1CPS A;  1ZLH A;  2PJ8 A;  4P4E A;  4ZY1 A;  1VIX A;  5CBM A;  4YU9 A;  5LRG A;  3FJU A;  4P10 A;  1VHO A;  4UIB A;  4YWY A;  4DYO A;  2ZEM A;  4DUK A;  4F9V A;  3RBU A;  2GLF A;  2AFO A;  4IAV A;  3KR5 A;  2XEI A;  4P4B A;  3H8G A;  2RB7 A;  4MCR A;  1BLL E;  1F2P A;  2PE3 A;  4P44 A;  3TX8 A;  1M4L A;  3SI0 A;  3TC8 A;  5K8P A;  1XFO A;  5CPA A;  3PFE A;  2QJ8 A;  3KAS A;  5D8N A;  2OR4 A;  2RFH A;  2GU2 A;  2ZEP A;  4FBE A;  2F8H A;  3SJX A;  4P4I A;  2PJB A;  2PJA A;  2GRE A;  4UEE A;  1OBR A;  3CPA A;  4OME A;  1PYT B;  1ELL P;  4MHN A;  2BOA A;  1Z2L A;  3IJ3 A;  1ZG8 A;  3PB8 X;  3PRT A;  8CPA A;  5JGF A;  2PJ5 A;  2ABZ A;  3LWU A;  4F8Z A;  3SJE A;  2BO9 A;  4MRI A;  2XEJ A;  4PXE A;  4BD9 A;  3JRU A;  5JM6 A;  3KGQ A;  4OC4 A;  2C6C A;  1YME A;  4NJQ A;  3WC6 A;  7CPA A;  2IJZ A;  2O4H A;  3IO1 A;  2CIJ A;  2DEA A;  1ARL A;  4EFD A;  2C6P A;  1PCA A;  4ZY2 A;  3KZW A;  6CPA A;  4A39 A;  1BPM A;  3K9T A;  4PXC A;  3BI1 A;  3GUX A;  3KQZ A;  3D7H A;  5HVF A;  4MCP A;  4PXD A;  1IY7 A;  2ANP A;  4PPZ A;  4K3N A;  3WT4 A;  3PB7 X;  2PJ7 A;  4R8F A;  3PFO A;  4NGR A;  4OC1 A;  1ELM P;  4WWV A;  2ZEO A;  1RTQ A;  2JEW A;  4KSI A;  3SJG A;  2AFZ A;  1YLO A;  3L2N A;  4B6Z A;  2EK8 A;  2JBJ A;  4F9U A;  3IEH A;  2QVP A;  4ZX9 A;  2Q43 A;  3KR4 A;  2PJ9 A;  4TWE A;  2XEF A;  3D7D A;  2PCU A;  3BHX A;  2ZEN A;  2PJ0 A;  4RUH A;  2PJ1 A;  3H8F A;  4MHP A;  4O23 A;  1CP6 A;  1TKF A;  3PB9 X;  1BPN A;  1YW4 A;  1R3N A;  1ZLI A;  1CP7 A;  1Q7L A;  4UF4 A;  4ZI6 A;  2ZEF A;  3CT9 A;  4P4D A;  1Z8L A;  1Y0R A;  1IGB A;  3VAT A;  3D67 A;  5I4M A;  1TF8 A;  3BI0 A;  3IC1 A;  3H8E A;  4MMO A;  3B3T A;  3KI9 A;  4FWU A;  5HVG A;  3KHX A;  4PXB A;  2JBK A;  4OC3 A;  5D29 A;  2QYV A;  2I3C A;  1YW6 A;  2PIY A;  4ZY0 A;  1CX8 A;  1ZG7 A;  4MCQ A;  3FEC A;  3FED A;  3D68 A;  3FF3 A;  4UIA A;  4OC2 A;  4R7M A;  3T8W A;  2CTC A;  5LYL A;  3D7F A;  1XBU A;  3DLJ A;  4P4F A;  1H8L A;  2AFX A;  3S9L A;  1TF9 A;  2ZOG A;  3IIB A;  2AFU A;  4OP4 A;  2CF4 A;  3V7Z A;  3V38 A;  5LYI A;  2G9D A;  2NSM A;  2V8G A;  3KQX A;  4LQG A;  4P4J A;  1F2O A;  3B3W A;  4X8I A;  3WC7 A;  4TNU A;  1Y0Y A;  4MHY A;  3IFE A;  4NGM A;  2XEG A;  2HB6 A;  1LFW A;  3DGV A;  4EME A;  4OIW A;  4GM5 A;  5K8N A;  3FEE A;  5IB9 A;  3IWW A;  5K8O A;  2Q4Z A;  1ARM A;  3KL9 A;  2VL1 A;  3PBE A;  1XJO A;  2Q51 A;  4FUU A;  1UWY A;  5J1Q A;  2J9A A;  3S9M A;  1HEE A;  2C1C A;  2BCO A;  3B2Y A;  3RZA A;  2EWB A;  1VGY A;  2OOT A;  1XRY A;  1TKJ A;  3NFZ A;  3FVL A;  1F57 A;  2AFM A;  4P45 A;  3MRU A;  4OC5 A;  3FX6 A;  5ELY A;  5F09 A;  1LAN A;  4A38 A;  4IK2 A;  3WC5 A;  4ZYQ A;  1JQG A;  4NJR A;  5LYD A;  1EE3 P;  1Z5R A;  3K2K A;  3FH4 A;  4W9Y A;  1Y7E A;  4UEZ A;  5JH9 A;  5LYF A;  2V8H A;  2PJ2 A;  3ISZ A;  4MCS A;  1KWM A;  4P6Y A;  1LAM A;  3RAM A;  3NH5 A;  4A94 A;  1FT7 A;  2WZN A;  2POK A;  3PBB A;  3VAR A;  1CBX A;  2CTB A;  1XMB A;  3NH4 A;  3B3S A;  1DE4 C;  2PJ3 A;  4JZ0 A;  1AMP A;  1TKH A;  2AFW A;  1FNO A;  2V77 A;  3ISX A;  3PB6 X;  4UEF A;  2F7V A;  1HDQ A;  2PVW A;  4OC0 A;  3BXM A;  4JYW A;  4OID A;  2PJ6 A;  2PRQ A;  4G1P A;  3CDX A;  3I1U A;  3B7I A;  4MHZ A;  3D66 A;  2PIZ A;  3GLJ A;  4NGP A;  2ZOF A;  2ZEE A;  3B3V A;  2IMO A;  2IQ6 A;  3D7G A;  4CPA A;  4X2T A;  3FMC A;  1LOK A;  4A37 A;  4R76 A;  4X3R A;  3PB4 X;  4AXV A;  3SI1 A;  3HUV A;  1QQ9 A;  1NSA A;  3SJF A;  3LMS A;  5LRJ A;  5HXD A;  2C6G A;  2O53 A;  2HC9 A;  3VH9 A;  1ZG9 A;  4Q7A A;  2PVV A;  2EK9 A;  2ZEH A;  4H2K A;  4MXU A;  3QNV A;  2ZEL A;  4IHM A;  4ONW A;  4ZX8 A;  2GLJ A;  4DJL A;  5THW A;  2FVG A;  3S9N A;  1TXR A;  1GYT A;  2V8D A;  2NYQ A;  1YSJ A;  1BAV A;  2V8V A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...