2A4NA

Crystal structure of aminoglycoside 6'-n-acetyltransferase complexed with coenzyme a
Total Genus 47
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
47
sequence length
180
structure length
180
Chain Sequence
b'MIISEFDRNNPVLKDQLSDLLRLTWPEEYGDSSAEEVEEMMNPERIAVAAVDQDELVGFIGAIPQYGITGWELHPLVVESSRRKNQIGTRLVNYLEKEVASRGGITIYLGTDDLDHGTTLSQTDLYEHTFDKVASIQNLREHPYEFYEKLGYKIVGVLPNANGWDKPDIWMAKTIIPRPD'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords aac(6')-Ii
publication title Structures of aminoglycoside acetyltransferase AAC(6')-Ii in a novel crystal form: structural and normal-mode analyses.
pubmed doi rcsb
source organism Enterococcus faecium
molecule tags Transferase
total genus 47
structure length 180
sequence length 180
chains with identical sequence B
ec nomenclature ec 2.3.1.82: Aminoglycoside 6'-N-acetyltransferase.
pdb deposition date 2005-06-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00583 Acetyltransf_1 Acetyltransferase (GNAT) family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.630.30 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Aminopeptidase 2a4nA00
1Z4EA 4YGOA 5DWNA 3I3GA 4QB9A 4AB7A 4CAVA 5HH1A 4F6AA 2AJ6A 4RS2A 2GE3A 4AG7A 4CRZB 1XMTA 5HMNA 1YREA 4IUSA 4KUAA 3ZJ0A 3S6HA 1NSLA 4KOUA 3GYAA 2G3TA 4L89A 3PGPA 3EY5A 3R96A 2G3AA 4R3KA 2WPWA 2B4BA 2VBQA 4DNCA 1XEBA 3DSBA 3G3SA 4R9MA 4LUAA 2VXKA 1YK3A 4EVYA 2ZW7A 4XNHC 1J4JA 4XNHB 3JUWA 5J8CA 1P0HA 3TFYA 3BJ7A 4UBRA 2FT0A 3BLNA 1P4NA 4ZBGA 1S5KA 4UA3A 3TO6A 5IV0A 2RC4A 1N71A 3TTHA 4B5OA 2OZUA 1RXTA 2FXFA 4U9YA 4KVME 3KKWA 2FL4A 4QBJA 4FD4A 3CXPA 2VI7A 3QB8A 4JWPA 3DR6A 4XPDC 4XPDB 1PU9A 4YFJA 4HNXB 2A4NA 1TIQA 1Q2YA 2R8VA 3EFAA 4CRYB 1QSMA 3EO4A 4FD5A 4MY0A 2R1IA 1XE4A 1M4IA 4H6UA 2DXQA 3IGRA 3T9YA 4KOWA 3E0KA 4PK2A 2OZHA 4KUBA 1U6MA 1SQHA 2FE7A 2D4OA 2VEZA 2IL4A 4AVAA 4KOSA 4FD6A 2B3VA 5J8FA 4MJ8A 4XPLA 5JQ4A 3GKRA 1MJBA 1K4JA 1Y9KA 4KORA 5H84A 4K30A 3S6GA 1KUXA 3F8KA 2OH1A 1WWZA 2CNMA 2Q4YA 2B5GA 1XF8A 2FSRA 3LODA 1Y7RA 4KZTA 2Q7BA 3LD2A 2B5GB 5DWMA 2H5MA 2ZPAA 2P0WA 3CXSA 1LRZA 2PC1A 2BL1A 4JJXA 2FS5A 1WK4A 1IIDA 2CNTA 1M1DA 3I9SA 2PQ8A 3DR8A 2ATRA 3WR7A 2O28A 5KTAA 2QMLA 3K9UA 2HQYA 1IYKA 2AE6A 3TCVA 2I79A 5IX3A 3TOBA 3FRMA 2J8MA 4HNYB 1MJAA 4L8AA 3TOAA 2PR1A 1NMTA 2B3UA 2ZW4A 4I49A 1B6BA 5F49A 5EBVA 1I1DA 4E2AA 1BOBA 4KVXA 3NE7A 5FVJA 3OWCA 5JPHA 1V0CA 3S6KA 1Q2DA 1S60A 1Z4RA 2OB0A 4R3LA 4QUSA 2B58A 1I12A 4KOYA 3EXNA 2Z11A 1QSTA 3R9GA 1IICA 2R7HA 4AVBA 2GIVA 2EVNA 2Y0MA 1L0CA 2QECA 4H89A 3F5BA 3VWEA 1KZFA 1QSRA 2FIAA 3BJ8A 2JEVA 3RYOA 4Y49C 4R87A 4Y49B 2Z10A 2PRBA 3T90A 4CS0B 2EUIA 3UY5A 1FY7A 4YRHA 2FIWA 2VZYA 3PZJA 2REFA 4B5PA 4NXYA 4ORFA 4HKFA 4B5PB 4MI4A 5ISVA 3D8PA 4QVTA 2R98A 2C27A 1R57A 2K5TA 1MK4A 1YVKA 3FIXA 3FB3A 3PP9A 4E8OA 3D2MA 2VZZA 1S7NA 4KLVA 1S7KA 2WPXA 1M44A 1YR0A 4M3SA 4RI1A 5F48A 1M4GA 2PSWA 2BEIA 4KOTA 2Q0YA 3DDDA 2JDCA 4MHDA 1S3ZA 2I00A 4PSWA 5EC4A 5GCNA 3R95A 4U5YA 2CNSA 3W6XA 4PSXA 4KOVA 5C82A 1YX0A 4J3GA 2PDOA 2QIRA 4PV6A 4NCZA 4JLYA 2X7BA 3IWGA 4II9A 1VKCA 4X5KA 4HNWB 4QC6A 1CM0A 1S7FA 1YGHA 3FYNA 3F0AA 1OZPA 4ONUA 1M4DA 4UWJA 4AVCA 4OLLA 1Y9WA 2J8NA 3R9EA 1UFHA 3TE4A 2KCWA 4NEXA 3FXTA 5E96A 4CAXA 4KVOE 2OZGA 2D4PA 3TO7A 1XIXA 1IYLA 1YVOA 3VWDA 5KTDA 5F46A 1NE9A 3GY9A 5IB0A 3P2HA 3TO9A 3ZZIA 3S6FA 4PK3A 1BO4A 3SHPA 1S7LA 1KUYA 4KLWA 1Q2CA 2ZW6A 2GANA 2JDDA 5I0CA 3JVNA 3CXQA 1YLEA 3P2FA 4H6ZA 2B4DA 4GS4A 5KTCA 5C88A 2B4DB 4NF1A 3H4QA 3DNSA 3W6SA 1QSOA 3SXNA 1RO5A 3W91A 3B8GA 2P6FA 4MBUA 2ZXVA 4F0YA 1I21A 4E0AA 1Z9UA 3D2PA 2P6EA 3TT2A 2P6GA 2HV2A 1ON0A 3D3SA 5F47A 2OU2A 1KUVA 3N7ZA 3R1KA 2J8RA 4FD7A 4NSQA 5CNPA 4XPKA 2VQYA 3QAHA 2ZW5A 4OAEA 3MGDA 3C26A 2Q4VA 2PR8A 1MJ9A 4M85A 3FBUA 4UWIA 2FCKA 4CAWA 2JLMA 3G8WA 2Q04A 1VHSA 4U9ZA 1QSNA 2CY2A 3FNCA 3EC4A 2REEA 2Q44A 4R57A 2NMTA 4JXRA 4LX9A 4OADA 4AG9A 4KOXA 1PUAA 2G0BA 1GHEA 2BUEA 4BMHA 4IF5A 4JXQA 1CJWA 2F5IA 4MY3A 1IB1E 3V8IA 3R9FA 2BSWA 2Z0ZA 3SXOA 1B87A 4JD6A 5H86A 2HUZA 2ARHA
chains in the Genus database with same CATH superfamily
1Z4EA 5A27A 4YGOA 1AMPA 5DWNA 1CP7A 3I3GA 4QB9A 2YNDA 4AB7A 4CAVA 2WSAA 4Q36A 5HH1A 4F6AA 3D7FA 2PJ7A 1BAVA 2C6GA 3LWUA 2AJ6A 4RS2A 3B3CA 2PJBA 5IB9A 2GE3A 2J9AA 4AG7A 4CRZB 2QYVA 1XMTA 5HMNA 1YREA 4IUSA 4KUAA 5ELYA 3GLJA 3ZJ0A 2WZNA 2Z3NA 3S6HA 1ELMP 2PJ1A 2PJ6A 4C2ZA 2F7VA 1NSLA 2C6CA 4KOUA 3GYAA 1CBXA 1CG2A 2QJ8A 4TNUA 2G3TA 3FEDA 1VIXA 4MFZA 3WC5A 4L89A 3PGPA 3RAMA 3BI1A 4AXVA 4CGNA 2V8DA 3EY5A 3R96A 2G3AA 1ZG9A 4R3KA 1XFOA 2WPWA 2POKA 2DPSA 3FMCA 2B4BA 2VBQA 3PFEA 1R3NA 4DNCA 1XEBA 3DSBA 3G3SA 4K3NA 4R9MA 4LUAA 2VXKA 1YK3A 4EVYA 2ZW7A 4XNHC 1YW6A 2VL1A 3GUXA 1ARLA 1J4JA 4XNHB 2GFQA 2Z3KA 3JUWA 1P0HA 5J8CA 4A31A 3TFYA 3BJ7A 4UBRA 2Z3OA 2FT0A 3D7HA 3S9MA 4ZY0A 1LOKA 3BLNA 2AFMA 1P4NA 4ZBGA 3NE8A 1S5KA 4UA3A 1YW4A 3TO6A 5IV0A 4Q38A 2NYQA 2RC4A 1N71A 4IK2A 3TTHA 4B5OA 3FX6A 1KWMA 4P4BA 2OZUA 2PIZA 1RXTA 2FXFA 3KZWA 1JWQA 4KVME 4U9YA 3KKWA 5HVFA 1LAMA 5JGFA 2YNCC 2FL4A 2OR4A 4CYPA 3B3VA 2O53A 4FD4A 4QBJA 1LCPA 7CPAA 3CXPA 2VI7A 3QB8A 6CPAA 4JWPA 3D66A 5LRJA 4UIBA 5BWAB 1TKFA 3B3WA 2Z3PA 2PJ2A 3DR6A 4UFXA 2PJ3A 4B10A 4XPDC 2XEJA 4O23A 4XPDB 1PU9A 3RZAA 4YFJA 1CX8A 1Z2LA 5JM6A 2IMOA 3V38A 4HNXB 2A4NA 4NJQA 4UCPA 3CT9A 4LQ6A 3MRUA 1TIQA 3DLJA 1Q2YA 5K8OA 4GXHA 2R8VA 2CTBA 3NH4A 3EFAA 4CRYB 1QSMA 3EO4A 1NSAA 4FD5A 1Z8XA 4MY0A 5LYFA 3BI0A 2R1IA 1XE4A 1M4IA 4H6UA 3JRUA 3VATA 3WC6A 1QQ9A 4ZY1A 2DXQA 3IGRA 3T9YA 4KOWA 2PJ8A 3E0KA 4PK2A 2JEWA 2OZHA 3PBBA 3LACA 4PXEA 4RUHA 1XOVA 1IGBA 4KUBA 1U6MA 4CYQA 5THWA 4MFQA 2HB6A 1JQGA 3IC1A 3H5ZA 4ZI6A 3KL9A 4UFWA 2PVVA 4ZX8A 1SQHA 2FE7A 2D4OA 4BD9A 2VEZA 3FH4A 3PB6X 2IL4A 2PJCA 4AVAA 1BPNA 5F09A 4KOSA 4FD6A 2AFOA 3KQZA 5LYIA 3MN8A 2B3VA 3RBUA 5J8FA 4FWUA 2I3CA 3NH8A 4MJ8A 4XPLA 5JQ4A 3GKRA 4C68A 1Z8WA 1MJBA 3A9LA 3N5FA 2JBJA 2G9DA 4MFKA 2V8HA 1K4JA 1Y9KA 2Q43A 2RB7A 4M6GA 4CAEA 4KORA 4C7IA 5H84A 4K30A 3S6GA 1KUXA 2ZEOA 3IU2A 1VGYA 1TKHA 4F0XA 4OC4A 1LFWA 2OH1A 3F8KA 5G21A 4C2YA 1WWZA 2CNMA 1XMBA 2Q4YA 2B5GA 1YSJA 1XF8A 2FSRA 3FVLA 5EMIA 2CXAA 3IFEA 3LODA 1Y7RA 3H8GA 4KZTA 2Q7BA 3LD2A 2B5GB 1FNOA 1QMUA 4NGPA 4WWVA 2H5MA 5DWMA 2ZPAA 4NGQA 1YLOA 2P0WA 2ZELA 3CXSA 4FUUA 1LRZA 4CYOA 2PC1A 1VHOA 2BL1A 4JJXA 2FS5A 4MFLA 1PCAA 2ZEPA 1ZLIA 4LQGA 3IU1A 1WK4A 2AFZA 4B13A 1IIDA 2F8HA 2CNTA 5AG5A 1M1DA 3I9SA 4EWTA 2PQ8A 3D7DA 2ATRA 3DR8A 3WR7A 2O28A 5KTAA 2WYRA 2QMLA 3K9UA 2DF5A 8CPAA 2HQYA 3SJGA 1IYKA 2ZENA 2AE6A 3TCVA 2I79A 5IX3A 1HEEA 4EFDA 3TOBA 3FRMA 4ZX9A 2BOAA 1X10A 3NA6A 3KR4A 2J8MA 4HNYB 4MHYA 1MJAA 2HC9A 2ZOFA 4UEZA 4L8AA 2PCUA 1XRYA 3TOAA 2PR1A 3HLPA 4CGLA 3TX8A 3PFOA 1NMTA 1Y0RA 3IWWA 3SJEA 2B3UA 4ZYQA 2ZW4A 4I49A 1B6BA 5F49A 4KS9A 1GYTA 1I1DA 5EBVA 4E2AA 4EMEA 1BOBA 3CPXA 4KVXA 3BHXA 3NE7A 1FT7A 5FVJA 3OWCA 5JPHA 5GCNA 3KHXA 3ISZA 5J1QA 4F9VA 1V0CA 3S6KA 1Q2DA 3SI1A 3VH9A 1S60A 1Z4RA 2OB0A 4R3LA 4CYNA 3B3SA 4QUSA 4OC1A 2B58A 1CPSA 1I12A 4KOYA 3EXNA 1AUGA 4DUKA 2Z11A 5HVGA 4A32A 1QSTA 2Q51A 2DEAA 1XBUA 3R9GA 2PE3A 1M4LA 3H8EA 3HUVA 3IO1A 1IICA 4A30A 2R7HA 3IWEA 4AVBA 2GIVA 2EVNA 1F2OA 2Y0MA 1L0CA 2QECA 2EBJA 4H89A 1Y7EA 3F5BA 4A37A 4GM5A 3VWEA 1KZFA 1QSRA 2FIAA 3BJ8A 4OC0A 2DPTA 2JEVA 3RYOA 2Z3MA 3D67A 5D8NA 4Y49C 4R87A 4CGMA 3PB8X 4Y49B 2Z10A 3WT4A 4PQAA 4UIAA 3CZXA 3RO0A 2PRBA 3B3TA 4P6YA 3T90A 4CS0B 2EUIA 3UY5A 1FY7A 3FJUA 4YRHA 2GLJA 1IU8A 2FIWA 2VZYA 2AFSA 2ZEHA 2REFA 2Q4ZA 3K2KA 3PB9X 3PZJA 4JYWA 4UEEA 4WJBA 3WABA 4B5PA 4NXYA 4ORFA 4A39A 2EO8A 3KQXA 4HKFA 4B5PB 4BINA 4NGMA 4MI4A 5ISVA 3D8PA 4MHPA 4QVTA 4CGPA 2R98A 4UCNA 2C27A 3PBEA 1R57A 1Z8TA 2K5TA 2XEGA 5A28A 2ABZA 1MK4A 2IJZA 2ZOGA 4OIDA 1YVKA 2V8GA 2WUUA 4KSFA 1ZO0A 3FB3A 3FIXA 4OC2A 3S9LA 3PP9A 4R76A 4E8OA 2AFXA 2XEFA 4KSIA 3CPAA 4X3RA 3B35A 3D2MA 2VZZA 3SI0A 1S7NA 3I1UA 3B7IA 4KLVA 1S7KA 1ZLHA 2WPXA 3FEEA 4NGSA 4P4DA 1M44A 3JTKA 4NGTA 2Q7SA 4A95A 3KASA 3KGQA 1YR0A 4M3SA 4RI1A 5F48A 1M4GA 1LANA 3KI9A 2PSWA 4F8ZA 3BXMA 2BEIA 2GREA 2Q0YA 3DDDA 2JDCA 4KOTA 1S3ZA 2I00A 4MHDA 4PSWA 4R6TA 4X8IA 2ZEDA 5EC4A 4MXUA 4U5YA 4YWYA 3R95A 4PXCA 2C1CA 5CPAA 4C2XA 3S9NA 2CNSA 3D68A 3W6XA 4PSXA 4UFVA 1TF9A 2PVWA 4KOVA 5C82A 1YX0A 4CGOA 4J3GA 2EK9A 2GLFA 2PDOA 4IAVA 4CAFA 2ZEFA 2CF4A 2QIRA 3PRTA 4RN7A 1CPXA 2EK8A 4IHMA 4P4JA 4OIWA 4PV6A 4Z65A 4B6ZA 4NCZA 4JLYA 2X7BA 3IWGA 3WC7A 4MCRA 4B14A 4P44A 4II9A 1VKCA 4X5KA 4HNWB 4QC6A 4OMEA 5HVHA 1BPMA 1CM0A 1S7FA 1YGHA 5K8NA 3FYNA 3F0AA 1OZPA 4Q7AA 4ONUA 4A94A 1M4DA 3PB4X 3D4UA 4UWJA 4AVCA 4OLLA 1TF8A 3TC8A 1Y9WA 3QAYA 3PEIA 2PJAA 5I4MA 3L2NA 2J8NA 3R9EA 1UFHA 3TE4A 2KCWA 4NEXA 5G20A 3FXTA 5E96A 4TWEA 1PYTB 3DGVA 4KVOE 4CAXA 1CP6A 5CBMA 4MMOA 3SI2A 3T8WA 4M6HA 5LYDA 1TKJA 2OZGA 2D4PA 1F2PA 2V8VA 4A38A 3TO7A 4DJLA 4F9UA 1XIXA 1IYLA 1YVOA 3VWDA 5KTDA 5F46A 1IOIA 1NE9A 3D7GA 3QNVA 1YQEA 3GY9A 5IB0A 4P4EA 4NJRA 3P2HA 4X2TA 3TO9A 5JH9A 3ZZIA 1DTDA 5K8MA 2JBKA 2PJ0A 4OKOA 4P10A 4PK3A 3S6FA 1BO4A 2PIYA 4DYOA 2BO9A 3H8FA 1ZG8A 5LRGA 4MHNA 3SHPA 4UCMA 3IJ3A 4MFPA 3SJXA 1S7LA 4R8FA 1KUYA 4KLWA 4P4FA 1Q2CA 2ZW6A 2YNEA 4PXBA 4UF4A 2GANA 4ZY2A 2ODFA 2PRQA 2JDDA 5I0CA 3JVNA 3CXQA 4MCPA 4A2ZA 5AG4A 4NFRA 4NGRA 1YLEA 4UEFA 3P2FA 4H6ZA 1BLLE 5AG7A 4H2KA 2B4DA 4GS4A 2PJ9A 2OOTA 5KTCA 5C88A 4B12A 2B4DB 4NF1A 2XEIA 2ZEMA 3PB7X 3RNZA 2AFWA 3VARA 3H4QA 3DNSA 3W6SA 1QSOA 5AGEA 4PPZA 5D29A 1RO5A 3SXNA 3W91A 3B8GA 2P6FA 4MBUA 2ZXVA 4FAIA 4F0YA 4PXDA 2C6PA 1F57A 1I21A 4M6IA 4E0AA 1Z9UA 2ZEGA 1YMEA 3D2PA 4W9YA 2QVPA 2P6EA 3TT2A 2P6GA 2HV2A 1ON0A 1RTQA 3D3SA 5F47A 1HDUA 4HPSA 2OU2A 1KUVA 3N7ZA 2YNCA 2CTCA 4MCSA 4FBEA 3R1KA 1A2ZA 1TXRA 2J8RA 4FD7A 3ISXA 4YU9A 4NSQA 1DE4C 3GB0A 5CNPA 1H8LA 1IY7A 2ZEEA 2PJ5A 3V7ZA 4XPKA 2VQYA 3QAHA 1XJOA 2ZW5A 4OAEA 3B2YA 2PJ4A 4KSAA 1ARMA 4ONWA 3MGDA 2Z3LA 4MFJA 2CIJA 1Z8LA 3C26A 1VHEA 2Q4VA 2O4HA 2PR8A 1MJ9A 1IOFA 2FVGA 4JZ0A 2NSMA 4M85A 3FBUA 4UWIA 2FCKA 5HXDA 5AG6A 4CAWA 1LAPA 2GU2A 4OP4A 1ELLP 4OC3A 4P45A 2V77A 2JLMA 1HDQA 1ZG7A 3G8WA 2Q04A 5DS0A 1VHSA 2ANPA 3CDXA 4U9ZA 1QSNA 1X12A 2CY2A 3FNCA 5LRKA 3K9TA 4A33A 3EC4A 5G1ZA 2REEA 3NH5A 2Q44A 4MRIA 2YGWA 4R57A 2NMTA 4JXRA 1EE3P 3GIUA 4LX9A 3FF3A 3IIBA 5LYLA 1Z5RA 2AFUA 4C7HA 3FECA 3KHZA 3IEHA 4OADA 4AG9A 5K8PA 4KOXA 5G22A 1PUAA 4P4IA 1R43A 2BCOA 3LMSA 1OBRA 4NGNA 1AYEA 2G0BA 1Y0YA 1GHEA 2BUEA 4CPAA 4OC5A 4BMHA 2RFHA 3KR5A 2EWBA 4IF5A 4MHZA 3NFZA 4JXQA 1CJWA 2F5IA 4MY3A 4B11A 4MCQA 1IB1E 4G1PA 3V8IA 4ZGYB 3R9FA 1Q7LA 2BSWA 2Z0ZA 3SXOA 1B87A 4JD6A 2IQ6A 5H86A 3SJFA 1UWYA 4BBHA 4R7MA 2HUZA 2ARHA
chains in the Genus database with same CATH topology
1Z4EA 5A27A 4YGOA 5DWNA 3I3GA 4QB9A 2YNDA 4AB7A 4CAVA 2WSAA 4Q36A 5HH1A 4F6AA 2AJ6A 4RS2A 2GE3A 4AG7A 4CRZB 1XMTA 5HMNA 1YREA 4IUSA 4KUAA 3ZJ0A 3S6HA 2Z3NA 4C2ZA 1NSLA 4KOUA 3GYAA 2G3TA 4MFZA 4L89A 3PGPA 4CGNA 3EY5A 3R96A 2G3AA 4R3KA 2WPWA 2DPSA 2B4BA 2VBQA 4DNCA 1XEBA 3DSBA 3G3SA 4R9MA 4LUAA 2VXKA 1YK3A 4EVYA 2ZW7A 4XNHC 1J4JA 4XNHB 2Z3KA 3JUWA 5J8CA 1P0HA 4A31A 3TFYA 3BJ7A 4UBRA 2Z3OA 2FT0A 3BLNA 1P4NA 4ZBGA 1S5KA 4UA3A 3TO6A 5IV0A 4Q38A 2RC4A 1N71A 3TTHA 4B5OA 2OZUA 1RXTA 2FXFA 4U9YA 4KVME 3KKWA 2YNCC 2FL4A 4CYPA 4QBJA 4FD4A 3CXPA 2VI7A 3QB8A 4JWPA 5BWAB 2Z3PA 3DR6A 4UFXA 4B10A 4XPDC 4XPDB 1PU9A 4YFJA 4HNXB 2A4NA 4UCPA 1TIQA 1Q2YA 2R8VA 3EFAA 4CRYB 1QSMA 3EO4A 4FD5A 4MY0A 2R1IA 1XE4A 1M4IA 4H6UA 2DXQA 3IGRA 3T9YA 4KOWA 3E0KA 4PK2A 2OZHA 4KUBA 1U6MA 4CYQA 4MFQA 3H5ZA 4UFWA 1SQHA 2FE7A 2D4OA 2VEZA 2IL4A 4AVAA 4KOSA 4FD6A 2B3VA 5J8FA 4MJ8A 4XPLA 5JQ4A 3GKRA 4C68A 1MJBA 3A9LA 4MFKA 1K4JA 1Y9KA 4CAEA 4KORA 4C7IA 5H84A 4K30A 3S6GA 1KUXA 3IU2A 4F0XA 3F8KA 2OH1A 5G21A 4C2YA 1WWZA 2CNMA 2Q4YA 2B5GA 1XF8A 2FSRA 2CXAA 3LODA 1Y7RA 4KZTA 2Q7BA 3LD2A 2B5GB 5DWMA 2H5MA 2ZPAA 4CYOA 2P0WA 3CXSA 1LRZA 2PC1A 2BL1A 4JJXA 2FS5A 4MFLA 4B13A 3IU1A 1WK4A 1IIDA 2CNTA 5AG5A 1M1DA 3I9SA 2PQ8A 3DR8A 2ATRA 3WR7A 2O28A 5KTAA 2QMLA 3K9UA 2HQYA 1IYKA 2AE6A 3TCVA 2I79A 5IX3A 3TOBA 3FRMA 2J8MA 4HNYB 1MJAA 4L8AA 3TOAA 2PR1A 4CGLA 1NMTA 2B3UA 2ZW4A 4I49A 1B6BA 5F49A 4KS9A 1I1DA 5EBVA 4E2AA 1BOBA 4KVXA 3NE7A 5FVJA 3OWCA 5JPHA 1V0CA 3S6KA 1Q2DA 1S60A 1Z4RA 2OB0A 4R3LA 4CYNA 4QUSA 2B58A 1I12A 4KOYA 3EXNA 2Z11A 4A32A 1QSTA 3R9GA 1IICA 4A30A 3IWEA 2R7HA 4AVBA 2GIVA 2EVNA 2Y0MA 1L0CA 2QECA 4H89A 3F5BA 3VWEA 1KZFA 1QSRA 2FIAA 3BJ8A 2DPTA 2JEVA 3RYOA 2Z3MA 4Y49C 4R87A 4CGMA 4Y49B 2Z10A 2PRBA 3T90A 4CS0B 2EUIA 3UY5A 1FY7A 4YRHA 2FIWA 2VZYA 3PZJA 2REFA 4B5PA 4NXYA 4ORFA 4HKFA 4B5PB 4MI4A 5ISVA 3D8PA 4QVTA 4CGPA 2R98A 4UCNA 2C27A 1R57A 2K5TA 5A28A 1MK4A 1YVKA 4KSFA 2WUUA 1ZO0A 3FB3A 3FIXA 3PP9A 4E8OA 3D2MA 2VZZA 1S7NA 4KLVA 1S7KA 2WPXA 1M44A 3JTKA 4A95A 1YR0A 4M3SA 4RI1A 5F48A 1M4GA 2PSWA 2BEIA 4KOTA 2Q0YA 3DDDA 2JDCA 4MHDA 1S3ZA 2I00A 4PSWA 5EC4A 5GCNA 3R95A 4U5YA 4C2XA 2CNSA 3W6XA 4PSXA 4UFVA 4KOVA 5C82A 1YX0A 4CGOA 4J3GA 2PDOA 4CAFA 2QIRA 4PV6A 4NCZA 4JLYA 2X7BA 3IWGA 4B14A 4II9A 1VKCA 4X5KA 4HNWB 4QC6A 1CM0A 1S7FA 1YGHA 3FYNA 3F0AA 1OZPA 4ONUA 1M4DA 4UWJA 4AVCA 4OLLA 1Y9WA 2J8NA 3R9EA 1UFHA 3TE4A 2KCWA 4NEXA 5G20A 3FXTA 5E96A 4CAXA 4KVOE 2OZGA 2D4PA 3TO7A 1XIXA 1IYLA 1YVOA 3VWDA 5KTDA 5F46A 1NE9A 3GY9A 5IB0A 3P2HA 3TO9A 3ZZIA 3S6FA 4PK3A 1BO4A 3SHPA 4UCMA 4MFPA 1S7LA 1KUYA 4KLWA 1Q2CA 2ZW6A 2YNEA 2GANA 2JDDA 5I0CA 3JVNA 3CXQA 4A2ZA 5AG4A 1YLEA 3P2FA 4H6ZA 5AG7A 2B4DA 4GS4A 5KTCA 5C88A 4B12A 2B4DB 4NF1A 3H4QA 3DNSA 3W6SA 1QSOA 5AGEA 3SXNA 1RO5A 3W91A 3B8GA 2P6FA 4MBUA 2ZXVA 4F0YA 1I21A 4E0AA 1Z9UA 3D2PA 2P6EA 3TT2A 2P6GA 2HV2A 1ON0A 3D3SA 5F47A 2OU2A 1KUVA 3N7ZA 2YNCA 3R1KA 2J8RA 4FD7A 4NSQA 5CNPA 4XPKA 2VQYA 3QAHA 2ZW5A 4OAEA 4KSAA 3MGDA 2Z3LA 4MFJA 3C26A 2Q4VA 2PR8A 1MJ9A 4M85A 3FBUA 4UWIA 2FCKA 5AG6A 4CAWA 2JLMA 3G8WA 2Q04A 1VHSA 4U9ZA 1QSNA 2CY2A 3FNCA 4A33A 3EC4A 5G1ZA 2REEA 2Q44A 2YGWA 4R57A 2NMTA 4JXRA 4LX9A 4C7HA 4OADA 4AG9A 4KOXA 5G22A 1PUAA 2G0BA 1GHEA 2BUEA 4BMHA 4IF5A 4JXQA 1CJWA 2F5IA 4MY3A 4B11A 1IB1E 3V8IA 4ZGYB 3R9FA 2BSWA 2Z0ZA 3SXOA 1B87A 4JD6A 5H86A 4BBHA 2HUZA 2ARHA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1Z4E A;  4YGO A;  5DWN A;  3I3G A;  4QB9 A;  4AB7 A;  4CAV A;  5HH1 A;  4F6A A;  2AJ6 A;  4RS2 A;  2GE3 A;  4AG7 A;  4CRZ B;  1XMT A;  5HMN A;  1YRE A;  4IUS A;  4KUA A;  3ZJ0 A;  3S6H A;  1NSL A;  4KOU A;  3GYA A;  2G3T A;  4L89 A;  3PGP A;  3EY5 A;  3R96 A;  2G3A A;  4R3K A;  2WPW A;  2B4B A;  2VBQ A;  4DNC A;  1XEB A;  3DSB A;  3G3S A;  4R9M A;  4LUA A;  2VXK A;  1YK3 A;  4EVY A;  2ZW7 A;  4XNH C;  1J4J A;  4XNH B;  3JUW A;  5J8C A;  1P0H A;  3TFY A;  3BJ7 A;  4UBR A;  2FT0 A;  3BLN A;  1P4N A;  4ZBG A;  1S5K A;  4UA3 A;  3TO6 A;  5IV0 A;  2RC4 A;  1N71 A;  3TTH A;  4B5O A;  2OZU A;  1RXT A;  2FXF A;  4U9Y A;  4KVM E;  3KKW A;  2FL4 A;  4QBJ A;  4FD4 A;  3CXP A;  2VI7 A;  3QB8 A;  4JWP A;  3DR6 A;  4XPD C;  4XPD B;  1PU9 A;  4YFJ A;  4HNX B;  2A4N A;  1TIQ A;  1Q2Y A;  2R8V A;  3EFA A;  4CRY B;  1QSM A;  3EO4 A;  4FD5 A;  4MY0 A;  2R1I A;  1XE4 A;  1M4I A;  4H6U A;  2DXQ A;  3IGR A;  3T9Y A;  4KOW A;  3E0K A;  4PK2 A;  2OZH A;  4KUB A;  1U6M A;  1SQH A;  2FE7 A;  2D4O A;  2VEZ A;  2IL4 A;  4AVA A;  4KOS A;  4FD6 A;  2B3V A;  5J8F A;  4MJ8 A;  4XPL A;  5JQ4 A;  3GKR A;  1MJB A;  1K4J A;  1Y9K A;  4KOR A;  5H84 A;  4K30 A;  3S6G A;  1KUX A;  3F8K A;  2OH1 A;  1WWZ A;  2CNM A;  2Q4Y A;  2B5G A;  1XF8 A;  2FSR A;  3LOD A;  1Y7R A;  4KZT A;  2Q7B A;  3LD2 A;  2B5G B;  5DWM A;  2H5M A;  2ZPA A;  2P0W A;  3CXS A;  1LRZ A;  2PC1 A;  2BL1 A;  4JJX A;  2FS5 A;  1WK4 A;  1IID A;  2CNT A;  1M1D A;  3I9S A;  2PQ8 A;  3DR8 A;  2ATR A;  3WR7 A;  2O28 A;  5KTA A;  2QML A;  3K9U A;  2HQY A;  1IYK A;  2AE6 A;  3TCV A;  2I79 A;  5IX3 A;  3TOB A;  3FRM A;  2J8M A;  4HNY B;  1MJA A;  4L8A A;  3TOA A;  2PR1 A;  1NMT A;  2B3U A;  2ZW4 A;  4I49 A;  1B6B A;  5F49 A;  5EBV A;  1I1D A;  4E2A A;  1BOB A;  4KVX A;  3NE7 A;  5FVJ A;  3OWC A;  5JPH A;  1V0C A;  3S6K A;  1Q2D A;  1S60 A;  1Z4R A;  2OB0 A;  4R3L A;  4QUS A;  2B58 A;  1I12 A;  4KOY A;  3EXN A;  2Z11 A;  1QST A;  3R9G A;  1IIC A;  2R7H A;  4AVB A;  2GIV A;  2EVN A;  2Y0M A;  1L0C A;  2QEC A;  4H89 A;  3F5B A;  3VWE A;  1KZF A;  1QSR A;  2FIA A;  3BJ8 A;  2JEV A;  3RYO A;  4Y49 C;  4R87 A;  4Y49 B;  2Z10 A;  2PRB A;  3T90 A;  4CS0 B;  2EUI A;  3UY5 A;  1FY7 A;  4YRH A;  2FIW A;  2VZY A;  3PZJ A;  2REF A;  4B5P A;  4NXY A;  4ORF A;  4HKF A;  4B5P B;  4MI4 A;  5ISV A;  3D8P A;  4QVT A;  2R98 A;  2C27 A;  1R57 A;  2K5T A;  1MK4 A;  1YVK A;  3FIX A;  3FB3 A;  3PP9 A;  4E8O A;  3D2M A;  2VZZ A;  1S7N A;  4KLV A;  1S7K A;  2WPX A;  1M44 A;  1YR0 A;  4M3S A;  4RI1 A;  5F48 A;  1M4G A;  2PSW A;  2BEI A;  4KOT A;  2Q0Y A;  3DDD A;  2JDC A;  4MHD A;  1S3Z A;  2I00 A;  4PSW A;  5EC4 A;  5GCN A;  3R95 A;  4U5Y A;  2CNS A;  3W6X A;  4PSX A;  4KOV A;  5C82 A;  1YX0 A;  4J3G A;  2PDO A;  2QIR A;  4PV6 A;  4NCZ A;  4JLY A;  2X7B A;  3IWG A;  4II9 A;  1VKC A;  4X5K A;  4HNW B;  4QC6 A;  1CM0 A;  1S7F A;  1YGH A;  3FYN A;  3F0A A;  1OZP A;  4ONU A;  1M4D A;  4UWJ A;  4AVC A;  4OLL A;  1Y9W A;  2J8N A;  3R9E A;  1UFH A;  3TE4 A;  2KCW A;  4NEX A;  3FXT A;  5E96 A;  4CAX A;  4KVO E;  2OZG A;  2D4P A;  3TO7 A;  1XIX A;  1IYL A;  1YVO A;  3VWD A;  5KTD A;  5F46 A;  1NE9 A;  3GY9 A;  5IB0 A;  3P2H A;  3TO9 A;  3ZZI A;  3S6F A;  4PK3 A;  1BO4 A;  3SHP A;  1S7L A;  1KUY A;  4KLW A;  1Q2C A;  2ZW6 A;  2GAN A;  2JDD A;  5I0C A;  3JVN A;  3CXQ A;  1YLE A;  3P2F A;  4H6Z A;  2B4D A;  4GS4 A;  5KTC A;  5C88 A;  2B4D B;  4NF1 A;  3H4Q A;  3DNS A;  3W6S A;  1QSO A;  3SXN A;  1RO5 A;  3W91 A;  3B8G A;  2P6F A;  4MBU A;  2ZXV A;  4F0Y A;  1I21 A;  4E0A A;  1Z9U A;  3D2P A;  2P6E A;  3TT2 A;  2P6G A;  2HV2 A;  1ON0 A;  3D3S A;  5F47 A;  2OU2 A;  1KUV A;  3N7Z A;  3R1K A;  2J8R A;  4FD7 A;  4NSQ A;  5CNP A;  4XPK A;  2VQY A;  3QAH A;  2ZW5 A;  4OAE A;  3MGD A;  3C26 A;  2Q4V A;  2PR8 A;  1MJ9 A;  4M85 A;  3FBU A;  4UWI A;  2FCK A;  4CAW A;  2JLM A;  3G8W A;  2Q04 A;  1VHS A;  4U9Z A;  1QSN A;  2CY2 A;  3FNC A;  3EC4 A;  2REE A;  2Q44 A;  4R57 A;  2NMT A;  4JXR A;  4LX9 A;  4OAD A;  4AG9 A;  4KOX A;  1PUA A;  2G0B A;  1GHE A;  2BUE A;  4BMH A;  4IF5 A;  4JXQ A;  1CJW A;  2F5I A;  4MY3 A;  1IB1 E;  3V8I A;  3R9F A;  2BSW A;  2Z0Z A;  3SXO A;  1B87 A;  4JD6 A;  5H86 A;  2HUZ A;  2ARH A; 
#chains in the Genus database with same CATH topology
 1Z4E A;  5A27 A;  4YGO A;  1AMP A;  5DWN A;  1CP7 A;  3I3G A;  4QB9 A;  2YND A;  4AB7 A;  4CAV A;  2WSA A;  4Q36 A;  5HH1 A;  4F6A A;  3D7F A;  2PJ7 A;  1BAV A;  2C6G A;  3LWU A;  2AJ6 A;  4RS2 A;  3B3C A;  2PJB A;  5IB9 A;  2GE3 A;  2J9A A;  4AG7 A;  4CRZ B;  2QYV A;  1XMT A;  5HMN A;  1YRE A;  4IUS A;  4KUA A;  5ELY A;  3GLJ A;  3ZJ0 A;  2WZN A;  2Z3N A;  3S6H A;  1ELM P;  2PJ1 A;  2PJ6 A;  4C2Z A;  2F7V A;  1NSL A;  2C6C A;  4KOU A;  3GYA A;  1CBX A;  1CG2 A;  2QJ8 A;  4TNU A;  2G3T A;  3FED A;  1VIX A;  4MFZ A;  3WC5 A;  4L89 A;  3PGP A;  3RAM A;  3BI1 A;  4AXV A;  4CGN A;  2V8D A;  3EY5 A;  3R96 A;  2G3A A;  1ZG9 A;  4R3K A;  1XFO A;  2WPW A;  2POK A;  2DPS A;  3FMC A;  2B4B A;  2VBQ A;  3PFE A;  1R3N A;  4DNC A;  1XEB A;  3DSB A;  3G3S A;  4K3N A;  4R9M A;  4LUA A;  2VXK A;  1YK3 A;  4EVY A;  2ZW7 A;  4XNH C;  1YW6 A;  2VL1 A;  3GUX A;  1ARL A;  1J4J A;  4XNH B;  2GFQ A;  2Z3K A;  3JUW A;  1P0H A;  5J8C A;  4A31 A;  3TFY A;  3BJ7 A;  4UBR A;  2Z3O A;  2FT0 A;  3D7H A;  3S9M A;  4ZY0 A;  1LOK A;  3BLN A;  2AFM A;  1P4N A;  4ZBG A;  3NE8 A;  1S5K A;  4UA3 A;  1YW4 A;  3TO6 A;  5IV0 A;  4Q38 A;  2NYQ A;  2RC4 A;  1N71 A;  4IK2 A;  3TTH A;  4B5O A;  3FX6 A;  1KWM A;  4P4B A;  2OZU A;  2PIZ A;  1RXT A;  2FXF A;  3KZW A;  1JWQ A;  4KVM E;  4U9Y A;  3KKW A;  5HVF A;  1LAM A;  5JGF A;  2YNC C;  2FL4 A;  2OR4 A;  4CYP A;  3B3V A;  2O53 A;  4FD4 A;  4QBJ A;  1LCP A;  7CPA A;  3CXP A;  2VI7 A;  3QB8 A;  6CPA A;  4JWP A;  3D66 A;  5LRJ A;  4UIB A;  5BWA B;  1TKF A;  3B3W A;  2Z3P A;  2PJ2 A;  3DR6 A;  4UFX A;  2PJ3 A;  4B10 A;  4XPD C;  2XEJ A;  4O23 A;  4XPD B;  1PU9 A;  3RZA A;  4YFJ A;  1CX8 A;  1Z2L A;  5JM6 A;  2IMO A;  3V38 A;  4HNX B;  2A4N A;  4NJQ A;  4UCP A;  3CT9 A;  4LQ6 A;  3MRU A;  1TIQ A;  3DLJ A;  1Q2Y A;  5K8O A;  4GXH A;  2R8V A;  2CTB A;  3NH4 A;  3EFA A;  4CRY B;  1QSM A;  3EO4 A;  1NSA A;  4FD5 A;  1Z8X A;  4MY0 A;  5LYF A;  3BI0 A;  2R1I A;  1XE4 A;  1M4I A;  4H6U A;  3JRU A;  3VAT A;  3WC6 A;  1QQ9 A;  4ZY1 A;  2DXQ A;  3IGR A;  3T9Y A;  4KOW A;  2PJ8 A;  3E0K A;  4PK2 A;  2JEW A;  2OZH A;  3PBB A;  3LAC A;  4PXE A;  4RUH A;  1XOV A;  1IGB A;  4KUB A;  1U6M A;  4CYQ A;  5THW A;  4MFQ A;  2HB6 A;  1JQG A;  3IC1 A;  3H5Z A;  4ZI6 A;  3KL9 A;  4UFW A;  2PVV A;  4ZX8 A;  1SQH A;  2FE7 A;  2D4O A;  4BD9 A;  2VEZ A;  3FH4 A;  3PB6 X;  2IL4 A;  2PJC A;  4AVA A;  1BPN A;  5F09 A;  4KOS A;  4FD6 A;  2AFO A;  3KQZ A;  5LYI A;  3MN8 A;  2B3V A;  3RBU A;  5J8F A;  4FWU A;  2I3C A;  3NH8 A;  4MJ8 A;  4XPL A;  5JQ4 A;  3GKR A;  4C68 A;  1Z8W A;  1MJB A;  3A9L A;  3N5F A;  2JBJ A;  2G9D A;  4MFK A;  2V8H A;  1K4J A;  1Y9K A;  2Q43 A;  2RB7 A;  4M6G A;  4CAE A;  4KOR A;  4C7I A;  5H84 A;  4K30 A;  3S6G A;  1KUX A;  2ZEO A;  3IU2 A;  1VGY A;  1TKH A;  4F0X A;  4OC4 A;  1LFW A;  2OH1 A;  3F8K A;  5G21 A;  4C2Y A;  1WWZ A;  2CNM A;  1XMB A;  2Q4Y A;  2B5G A;  1YSJ A;  1XF8 A;  2FSR A;  3FVL A;  5EMI A;  2CXA A;  3IFE A;  3LOD A;  1Y7R A;  3H8G A;  4KZT A;  2Q7B A;  3LD2 A;  2B5G B;  1FNO A;  1QMU A;  4NGP A;  4WWV A;  2H5M A;  5DWM A;  2ZPA A;  4NGQ A;  1YLO A;  2P0W A;  2ZEL A;  3CXS A;  4FUU A;  1LRZ A;  4CYO A;  2PC1 A;  1VHO A;  2BL1 A;  4JJX A;  2FS5 A;  4MFL A;  1PCA A;  2ZEP A;  1ZLI A;  4LQG A;  3IU1 A;  1WK4 A;  2AFZ A;  4B13 A;  1IID A;  2F8H A;  2CNT A;  5AG5 A;  1M1D A;  3I9S A;  4EWT A;  2PQ8 A;  3D7D A;  2ATR A;  3DR8 A;  3WR7 A;  2O28 A;  5KTA A;  2WYR A;  2QML A;  3K9U A;  2DF5 A;  8CPA A;  2HQY A;  3SJG A;  1IYK A;  2ZEN A;  2AE6 A;  3TCV A;  2I79 A;  5IX3 A;  1HEE A;  4EFD A;  3TOB A;  3FRM A;  4ZX9 A;  2BOA A;  1X10 A;  3NA6 A;  3KR4 A;  2J8M A;  4HNY B;  4MHY A;  1MJA A;  2HC9 A;  2ZOF A;  4UEZ A;  4L8A A;  2PCU A;  1XRY A;  3TOA A;  2PR1 A;  3HLP A;  4CGL A;  3TX8 A;  3PFO A;  1NMT A;  1Y0R A;  3IWW A;  3SJE A;  2B3U A;  4ZYQ A;  2ZW4 A;  4I49 A;  1B6B A;  5F49 A;  4KS9 A;  1GYT A;  1I1D A;  5EBV A;  4E2A A;  4EME A;  1BOB A;  3CPX A;  4KVX A;  3BHX A;  3NE7 A;  1FT7 A;  5FVJ A;  3OWC A;  5JPH A;  5GCN A;  3KHX A;  3ISZ A;  5J1Q A;  4F9V A;  1V0C A;  3S6K A;  1Q2D A;  3SI1 A;  3VH9 A;  1S60 A;  1Z4R A;  2OB0 A;  4R3L A;  4CYN A;  3B3S A;  4QUS A;  4OC1 A;  2B58 A;  1CPS A;  1I12 A;  4KOY A;  3EXN A;  1AUG A;  4DUK A;  2Z11 A;  5HVG A;  4A32 A;  1QST A;  2Q51 A;  2DEA A;  1XBU A;  3R9G A;  2PE3 A;  1M4L A;  3H8E A;  3HUV A;  3IO1 A;  1IIC A;  4A30 A;  2R7H A;  3IWE A;  4AVB A;  2GIV A;  2EVN A;  1F2O A;  2Y0M A;  1L0C A;  2QEC A;  2EBJ A;  4H89 A;  1Y7E A;  3F5B A;  4A37 A;  4GM5 A;  3VWE A;  1KZF A;  1QSR A;  2FIA A;  3BJ8 A;  4OC0 A;  2DPT A;  2JEV A;  3RYO A;  2Z3M A;  3D67 A;  5D8N A;  4Y49 C;  4R87 A;  4CGM A;  3PB8 X;  4Y49 B;  2Z10 A;  3WT4 A;  4PQA A;  4UIA A;  3CZX A;  3RO0 A;  2PRB A;  3B3T A;  4P6Y A;  3T90 A;  4CS0 B;  2EUI A;  3UY5 A;  1FY7 A;  3FJU A;  4YRH A;  2GLJ A;  1IU8 A;  2FIW A;  2VZY A;  2AFS A;  2ZEH A;  2REF A;  2Q4Z A;  3K2K A;  3PB9 X;  3PZJ A;  4JYW A;  4UEE A;  4WJB A;  3WAB A;  4B5P A;  4NXY A;  4ORF A;  4A39 A;  2EO8 A;  3KQX A;  4HKF A;  4B5P B;  4BIN A;  4NGM A;  4MI4 A;  5ISV A;  3D8P A;  4MHP A;  4QVT A;  4CGP A;  2R98 A;  4UCN A;  2C27 A;  3PBE A;  1R57 A;  1Z8T A;  2K5T A;  2XEG A;  5A28 A;  2ABZ A;  1MK4 A;  2IJZ A;  2ZOG A;  4OID A;  1YVK A;  2V8G A;  2WUU A;  4KSF A;  1ZO0 A;  3FB3 A;  3FIX A;  4OC2 A;  3S9L A;  3PP9 A;  4R76 A;  4E8O A;  2AFX A;  2XEF A;  4KSI A;  3CPA A;  4X3R A;  3B35 A;  3D2M A;  2VZZ A;  3SI0 A;  1S7N A;  3I1U A;  3B7I A;  4KLV A;  1S7K A;  1ZLH A;  2WPX A;  3FEE A;  4NGS A;  4P4D A;  1M44 A;  3JTK A;  4NGT A;  2Q7S A;  4A95 A;  3KAS A;  3KGQ A;  1YR0 A;  4M3S A;  4RI1 A;  5F48 A;  1M4G A;  1LAN A;  3KI9 A;  2PSW A;  4F8Z A;  3BXM A;  2BEI A;  2GRE A;  2Q0Y A;  3DDD A;  2JDC A;  4KOT A;  1S3Z A;  2I00 A;  4MHD A;  4PSW A;  4R6T A;  4X8I A;  2ZED A;  5EC4 A;  4MXU A;  4U5Y A;  4YWY A;  3R95 A;  4PXC A;  2C1C A;  5CPA A;  4C2X A;  3S9N A;  2CNS A;  3D68 A;  3W6X A;  4PSX A;  4UFV A;  1TF9 A;  2PVW A;  4KOV A;  5C82 A;  1YX0 A;  4CGO A;  4J3G A;  2EK9 A;  2GLF A;  2PDO A;  4IAV A;  4CAF A;  2ZEF A;  2CF4 A;  2QIR A;  3PRT A;  4RN7 A;  1CPX A;  2EK8 A;  4IHM A;  4P4J A;  4OIW A;  4PV6 A;  4Z65 A;  4B6Z A;  4NCZ A;  4JLY A;  2X7B A;  3IWG A;  3WC7 A;  4MCR A;  4B14 A;  4P44 A;  4II9 A;  1VKC A;  4X5K A;  4HNW B;  4QC6 A;  4OME A;  5HVH A;  1BPM A;  1CM0 A;  1S7F A;  1YGH A;  5K8N A;  3FYN A;  3F0A A;  1OZP A;  4Q7A A;  4ONU A;  4A94 A;  1M4D A;  3PB4 X;  3D4U A;  4UWJ A;  4AVC A;  4OLL A;  1TF8 A;  3TC8 A;  1Y9W A;  3QAY A;  3PEI A;  2PJA A;  5I4M A;  3L2N A;  2J8N A;  3R9E A;  1UFH A;  3TE4 A;  2KCW A;  4NEX A;  5G20 A;  3FXT A;  5E96 A;  4TWE A;  1PYT B;  3DGV A;  4KVO E;  4CAX A;  1CP6 A;  5CBM A;  4MMO A;  3SI2 A;  3T8W A;  4M6H A;  5LYD A;  1TKJ A;  2OZG A;  2D4P A;  1F2P A;  2V8V A;  4A38 A;  3TO7 A;  4DJL A;  4F9U A;  1XIX A;  1IYL A;  1YVO A;  3VWD A;  5KTD A;  5F46 A;  1IOI A;  1NE9 A;  3D7G A;  3QNV A;  1YQE A;  3GY9 A;  5IB0 A;  4P4E A;  4NJR A;  3P2H A;  4X2T A;  3TO9 A;  5JH9 A;  3ZZI A;  1DTD A;  5K8M A;  2JBK A;  2PJ0 A;  4OKO A;  4P10 A;  4PK3 A;  3S6F A;  1BO4 A;  2PIY A;  4DYO A;  2BO9 A;  3H8F A;  1ZG8 A;  5LRG A;  4MHN A;  3SHP A;  4UCM A;  3IJ3 A;  4MFP A;  3SJX A;  1S7L A;  4R8F A;  1KUY A;  4KLW A;  4P4F A;  1Q2C A;  2ZW6 A;  2YNE A;  4PXB A;  4UF4 A;  2GAN A;  4ZY2 A;  2ODF A;  2PRQ A;  2JDD A;  5I0C A;  3JVN A;  3CXQ A;  4MCP A;  4A2Z A;  5AG4 A;  4NFR A;  4NGR A;  1YLE A;  4UEF A;  3P2F A;  4H6Z A;  1BLL E;  5AG7 A;  4H2K A;  2B4D A;  4GS4 A;  2PJ9 A;  2OOT A;  5KTC A;  5C88 A;  4B12 A;  2B4D B;  4NF1 A;  2XEI A;  2ZEM A;  3PB7 X;  3RNZ A;  2AFW A;  3VAR A;  3H4Q A;  3DNS A;  3W6S A;  1QSO A;  5AGE A;  4PPZ A;  5D29 A;  1RO5 A;  3SXN A;  3W91 A;  3B8G A;  2P6F A;  4MBU A;  2ZXV A;  4FAI A;  4F0Y A;  4PXD A;  2C6P A;  1F57 A;  1I21 A;  4M6I A;  4E0A A;  1Z9U A;  2ZEG A;  1YME A;  3D2P A;  4W9Y A;  2QVP A;  2P6E A;  3TT2 A;  2P6G A;  2HV2 A;  1ON0 A;  1RTQ A;  3D3S A;  5F47 A;  1HDU A;  4HPS A;  2OU2 A;  1KUV A;  3N7Z A;  2YNC A;  2CTC A;  4MCS A;  4FBE A;  3R1K A;  1A2Z A;  1TXR A;  2J8R A;  4FD7 A;  3ISX A;  4YU9 A;  4NSQ A;  1DE4 C;  3GB0 A;  5CNP A;  1H8L A;  1IY7 A;  2ZEE A;  2PJ5 A;  3V7Z A;  4XPK A;  2VQY A;  3QAH A;  1XJO A;  2ZW5 A;  4OAE A;  3B2Y A;  2PJ4 A;  4KSA A;  1ARM A;  4ONW A;  3MGD A;  2Z3L A;  4MFJ A;  2CIJ A;  1Z8L A;  3C26 A;  1VHE A;  2Q4V A;  2O4H A;  2PR8 A;  1MJ9 A;  1IOF A;  2FVG A;  4JZ0 A;  2NSM A;  4M85 A;  3FBU A;  4UWI A;  2FCK A;  5HXD A;  5AG6 A;  4CAW A;  1LAP A;  2GU2 A;  4OP4 A;  1ELL P;  4OC3 A;  4P45 A;  2V77 A;  2JLM A;  1HDQ A;  1ZG7 A;  3G8W A;  2Q04 A;  5DS0 A;  1VHS A;  2ANP A;  3CDX A;  4U9Z A;  1QSN A;  1X12 A;  2CY2 A;  3FNC A;  5LRK A;  3K9T A;  4A33 A;  3EC4 A;  5G1Z A;  2REE A;  3NH5 A;  2Q44 A;  4MRI A;  2YGW A;  4R57 A;  2NMT A;  4JXR A;  1EE3 P;  3GIU A;  4LX9 A;  3FF3 A;  3IIB A;  5LYL A;  1Z5R A;  2AFU A;  4C7H A;  3FEC A;  3KHZ A;  3IEH A;  4OAD A;  4AG9 A;  5K8P A;  4KOX A;  5G22 A;  1PUA A;  4P4I A;  1R43 A;  2BCO A;  3LMS A;  1OBR A;  4NGN A;  1AYE A;  2G0B A;  1Y0Y A;  1GHE A;  2BUE A;  4CPA A;  4OC5 A;  4BMH A;  2RFH A;  3KR5 A;  2EWB A;  4IF5 A;  4MHZ A;  3NFZ A;  4JXQ A;  1CJW A;  2F5I A;  4MY3 A;  4B11 A;  4MCQ A;  1IB1 E;  4G1P A;  3V8I A;  4ZGY B;  3R9F A;  1Q7L A;  2BSW A;  2Z0Z A;  3SXO A;  1B87 A;  4JD6 A;  2IQ6 A;  5H86 A;  3SJF A;  1UWY A;  4BBH A;  4R7M A;  2HUZ A;  2ARH A; 
#chains in the Genus database with same CATH homology
 1Z4E A;  5A27 A;  4YGO A;  5DWN A;  3I3G A;  4QB9 A;  2YND A;  4AB7 A;  4CAV A;  2WSA A;  4Q36 A;  5HH1 A;  4F6A A;  2AJ6 A;  4RS2 A;  2GE3 A;  4AG7 A;  4CRZ B;  1XMT A;  5HMN A;  1YRE A;  4IUS A;  4KUA A;  3ZJ0 A;  3S6H A;  2Z3N A;  4C2Z A;  1NSL A;  4KOU A;  3GYA A;  2G3T A;  4MFZ A;  4L89 A;  3PGP A;  4CGN A;  3EY5 A;  3R96 A;  2G3A A;  4R3K A;  2WPW A;  2DPS A;  2B4B A;  2VBQ A;  4DNC A;  1XEB A;  3DSB A;  3G3S A;  4R9M A;  4LUA A;  2VXK A;  1YK3 A;  4EVY A;  2ZW7 A;  4XNH C;  1J4J A;  4XNH B;  2Z3K A;  3JUW A;  5J8C A;  1P0H A;  4A31 A;  3TFY A;  3BJ7 A;  4UBR A;  2Z3O A;  2FT0 A;  3BLN A;  1P4N A;  4ZBG A;  1S5K A;  4UA3 A;  3TO6 A;  5IV0 A;  4Q38 A;  2RC4 A;  1N71 A;  3TTH A;  4B5O A;  2OZU A;  1RXT A;  2FXF A;  4U9Y A;  4KVM E;  3KKW A;  2YNC C;  2FL4 A;  4CYP A;  4QBJ A;  4FD4 A;  3CXP A;  2VI7 A;  3QB8 A;  4JWP A;  5BWA B;  2Z3P A;  3DR6 A;  4UFX A;  4B10 A;  4XPD C;  4XPD B;  1PU9 A;  4YFJ A;  4HNX B;  2A4N A;  4UCP A;  1TIQ A;  1Q2Y A;  2R8V A;  3EFA A;  4CRY B;  1QSM A;  3EO4 A;  4FD5 A;  4MY0 A;  2R1I A;  1XE4 A;  1M4I A;  4H6U A;  2DXQ A;  3IGR A;  3T9Y A;  4KOW A;  3E0K A;  4PK2 A;  2OZH A;  4KUB A;  1U6M A;  4CYQ A;  4MFQ A;  3H5Z A;  4UFW A;  1SQH A;  2FE7 A;  2D4O A;  2VEZ A;  2IL4 A;  4AVA A;  4KOS A;  4FD6 A;  2B3V A;  5J8F A;  4MJ8 A;  4XPL A;  5JQ4 A;  3GKR A;  4C68 A;  1MJB A;  3A9L A;  4MFK A;  1K4J A;  1Y9K A;  4CAE A;  4KOR A;  4C7I A;  5H84 A;  4K30 A;  3S6G A;  1KUX A;  3IU2 A;  4F0X A;  3F8K A;  2OH1 A;  5G21 A;  4C2Y A;  1WWZ A;  2CNM A;  2Q4Y A;  2B5G A;  1XF8 A;  2FSR A;  2CXA A;  3LOD A;  1Y7R A;  4KZT A;  2Q7B A;  3LD2 A;  2B5G B;  5DWM A;  2H5M A;  2ZPA A;  4CYO A;  2P0W A;  3CXS A;  1LRZ A;  2PC1 A;  2BL1 A;  4JJX A;  2FS5 A;  4MFL A;  4B13 A;  3IU1 A;  1WK4 A;  1IID A;  2CNT A;  5AG5 A;  1M1D A;  3I9S A;  2PQ8 A;  3DR8 A;  2ATR A;  3WR7 A;  2O28 A;  5KTA A;  2QML A;  3K9U A;  2HQY A;  1IYK A;  2AE6 A;  3TCV A;  2I79 A;  5IX3 A;  3TOB A;  3FRM A;  2J8M A;  4HNY B;  1MJA A;  4L8A A;  3TOA A;  2PR1 A;  4CGL A;  1NMT A;  2B3U A;  2ZW4 A;  4I49 A;  1B6B A;  5F49 A;  4KS9 A;  1I1D A;  5EBV A;  4E2A A;  1BOB A;  4KVX A;  3NE7 A;  5FVJ A;  3OWC A;  5JPH A;  1V0C A;  3S6K A;  1Q2D A;  1S60 A;  1Z4R A;  2OB0 A;  4R3L A;  4CYN A;  4QUS A;  2B58 A;  1I12 A;  4KOY A;  3EXN A;  2Z11 A;  4A32 A;  1QST A;  3R9G A;  1IIC A;  4A30 A;  3IWE A;  2R7H A;  4AVB A;  2GIV A;  2EVN A;  2Y0M A;  1L0C A;  2QEC A;  4H89 A;  3F5B A;  3VWE A;  1KZF A;  1QSR A;  2FIA A;  3BJ8 A;  2DPT A;  2JEV A;  3RYO A;  2Z3M A;  4Y49 C;  4R87 A;  4CGM A;  4Y49 B;  2Z10 A;  2PRB A;  3T90 A;  4CS0 B;  2EUI A;  3UY5 A;  1FY7 A;  4YRH A;  2FIW A;  2VZY A;  3PZJ A;  2REF A;  4B5P A;  4NXY A;  4ORF A;  4HKF A;  4B5P B;  4MI4 A;  5ISV A;  3D8P A;  4QVT A;  4CGP A;  2R98 A;  4UCN A;  2C27 A;  1R57 A;  2K5T A;  5A28 A;  1MK4 A;  1YVK A;  4KSF A;  2WUU A;  1ZO0 A;  3FB3 A;  3FIX A;  3PP9 A;  4E8O A;  3D2M A;  2VZZ A;  1S7N A;  4KLV A;  1S7K A;  2WPX A;  1M44 A;  3JTK A;  4A95 A;  1YR0 A;  4M3S A;  4RI1 A;  5F48 A;  1M4G A;  2PSW A;  2BEI A;  4KOT A;  2Q0Y A;  3DDD A;  2JDC A;  4MHD A;  1S3Z A;  2I00 A;  4PSW A;  5EC4 A;  5GCN A;  3R95 A;  4U5Y A;  4C2X A;  2CNS A;  3W6X A;  4PSX A;  4UFV A;  4KOV A;  5C82 A;  1YX0 A;  4CGO A;  4J3G A;  2PDO A;  4CAF A;  2QIR A;  4PV6 A;  4NCZ A;  4JLY A;  2X7B A;  3IWG A;  4B14 A;  4II9 A;  1VKC A;  4X5K A;  4HNW B;  4QC6 A;  1CM0 A;  1S7F A;  1YGH A;  3FYN A;  3F0A A;  1OZP A;  4ONU A;  1M4D A;  4UWJ A;  4AVC A;  4OLL A;  1Y9W A;  2J8N A;  3R9E A;  1UFH A;  3TE4 A;  2KCW A;  4NEX A;  5G20 A;  3FXT A;  5E96 A;  4CAX A;  4KVO E;  2OZG A;  2D4P A;  3TO7 A;  1XIX A;  1IYL A;  1YVO A;  3VWD A;  5KTD A;  5F46 A;  1NE9 A;  3GY9 A;  5IB0 A;  3P2H A;  3TO9 A;  3ZZI A;  3S6F A;  4PK3 A;  1BO4 A;  3SHP A;  4UCM A;  4MFP A;  1S7L A;  1KUY A;  4KLW A;  1Q2C A;  2ZW6 A;  2YNE A;  2GAN A;  2JDD A;  5I0C A;  3JVN A;  3CXQ A;  4A2Z A;  5AG4 A;  1YLE A;  3P2F A;  4H6Z A;  5AG7 A;  2B4D A;  4GS4 A;  5KTC A;  5C88 A;  4B12 A;  2B4D B;  4NF1 A;  3H4Q A;  3DNS A;  3W6S A;  1QSO A;  5AGE A;  3SXN A;  1RO5 A;  3W91 A;  3B8G A;  2P6F A;  4MBU A;  2ZXV A;  4F0Y A;  1I21 A;  4E0A A;  1Z9U A;  3D2P A;  2P6E A;  3TT2 A;  2P6G A;  2HV2 A;  1ON0 A;  3D3S A;  5F47 A;  2OU2 A;  1KUV A;  3N7Z A;  2YNC A;  3R1K A;  2J8R A;  4FD7 A;  4NSQ A;  5CNP A;  4XPK A;  2VQY A;  3QAH A;  2ZW5 A;  4OAE A;  4KSA A;  3MGD A;  2Z3L A;  4MFJ A;  3C26 A;  2Q4V A;  2PR8 A;  1MJ9 A;  4M85 A;  3FBU A;  4UWI A;  2FCK A;  5AG6 A;  4CAW A;  2JLM A;  3G8W A;  2Q04 A;  1VHS A;  4U9Z A;  1QSN A;  2CY2 A;  3FNC A;  4A33 A;  3EC4 A;  5G1Z A;  2REE A;  2Q44 A;  2YGW A;  4R57 A;  2NMT A;  4JXR A;  4LX9 A;  4C7H A;  4OAD A;  4AG9 A;  4KOX A;  5G22 A;  1PUA A;  2G0B A;  1GHE A;  2BUE A;  4BMH A;  4IF5 A;  4JXQ A;  1CJW A;  2F5I A;  4MY3 A;  4B11 A;  1IB1 E;  3V8I A;  4ZGY B;  3R9F A;  2BSW A;  2Z0Z A;  3SXO A;  1B87 A;  4JD6 A;  5H86 A;  4BBH A;  2HUZ A;  2ARH A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...