2A4NA

Crystal structure of aminoglycoside 6'-n-acetyltransferase complexed with coenzyme a
Total Genus 47
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
47
sequence length
180
structure length
180
Chain Sequence
MIISEFDRNNPVLKDQLSDLLRLTWPEEYGDSSAEEVEEMMNPERIAVAAVDQDELVGFIGAIPQYGITGWELHPLVVESSRRKNQIGTRLVNYLEKEVASRGGITIYLGTDDLDHGTTLSQTDLYEHTFDKVASIQNLREHPYEFYEKLGYKIVGVLPNANGWDKPDIWMAKTIIPRPD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords aac(6')-Ii
publication title Structures of aminoglycoside acetyltransferase AAC(6')-Ii in a novel crystal form: structural and normal-mode analyses.
pubmed doi rcsb
source organism Enterococcus faecium
molecule tags Transferase
total genus 47
structure length 180
sequence length 180
chains with identical sequence B
ec nomenclature ec 2.3.1.82: Aminoglycoside 6'-N-acetyltransferase.
pdb deposition date 2005-06-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00583 Acetyltransf_1 Acetyltransferase (GNAT) family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.630.30 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Aminopeptidase 2a4nA00
1MJ9A 3S6FA 2VBQA 3KKWA 4RS2A 4KVXA 1XMTA 5JQ4A 5IX3A 3D2MA 3DR6A 3P2FA 1XEBA 4X5KA 3IWGA 1Q2YA 5E96A 4UWIA 1L0CA 3BLNA 4CAWA 2KCWA 3LD2A 5KTDA 1YVOA 1KUVA 4Y49C 4PSXA 4KUAA 1UFHA 1Y9KA 1I21A 1YX0A 1QSNA 2PR8A 2HQYA 4PSWA 2Q4VA 3D3SA 2FE7A 2JEVA 4PK2A 2R98A 3K9UA 2FIAA 4FD4A 2DXQA 4KOWA 5IV0A 2ZW7A 1OZPA 3W6XA 4KVME 4HKFA 2REEA 1WWZA 3ZJ0A 1S7FA 3R9FA 2CNTA 4MHDA 2B3UA 2BL1A 2ZW4A 1NMTA 2RC4A 1Z9UA 2JLMA 2CY2A 3R9EA 1BOBA 4R3KA 5GCNA 3D8PA 2OB0A 2B5GA 4PK3A 1M1DA 1FY7A 1R57A 3I9SA 4H89A 5EC4A 4AG9A 3DNSA 4JXRA 2Q4YA 2OZHA 2H5MA 4OLLA 3TTHA 1V0CA 2B4BA 3VWDA 3JUWA 4R9MA 2QECA 4LUAA 4QC6A 1VKCA 5IB0A 2ZPAA 2VEZA 2G3AA 3EO4A 1RO5A 1IYLA 4XPLA 2ATRA 4J3GA 4R57A 3TO7A 4AB7A 4QBJA 1Y7RA 1KUYA 2BSWA 4ONUA 3P2HA 4NXYA 4E8OA 1S7KA 2PC1A 2JDCA 2VI7A 4HNXB 4HNYB 3SHPA 1K4JA 4M85A 3EC4A 3FNCA 3R95A 4L8AA 1YGHA 3H4QA 1MJAA 3G8WA 3DDDA 3SXNA 4DNCA 4U9ZA 2GANA 4KUBA 1KUXA 1S60A 4LX9A 5EBVA 3S6HA 3T90A 4NEXA 2Q7BA 1M4GA 2VXKA 2A4NA 4FD7A 2Z11A 4F0YA 3TE4A 2GE3A 3W6SA 4XNHB 4KORA 4PV6A 1YK3A 3TO6A 3BJ7A 4KOYA 3FRMA 1PU9A 1LRZA 2JDDA 1J4JA 5F49A 2IL4A 1XE4A 3CXPA 1IB1E 1I12A 4AVAA 3F0AA 4CS0B 4JXQA 3TCVA 1XF8A 3NE7A 4KOVA 4K30A 2P0WA 2J8RA 3T9YA 2B5GB 2ZW5A 3TO9A 1Y9WA 2B4DA 2PSWA 1P0HA 2FT0A 1Z4RA 3B8GA 2P6FA 3QAHA 3JVNA 5ISVA 1ON0A 3S6GA 1S3ZA 2GIVA 3CXQA 3FXTA 1KZFA 2R8VA 2R7HA 3C26A 3CXSA 2OH1A 1B87A 1Q2CA 1CM0A 4OADA 4YFJA 2FS5A 2ZXVA 2WPWA 2FL4A 1N71A 4UBRA 3PZJA 3OWCA 2AJ6A 4QUSA 4XPDB 1RXTA 1MJBA 1I1DA 5H84A 4B5PA 5C82A 3BJ8A 5JPHA 1IYKA 2P6GA 4JLYA 5J8CA 2FXFA 4I49A 1GHEA 2FCKA 2Z0ZA 1IICA 2Q44A 3RYOA 5HH1A 4CAVA 3TT2A 2EUIA 4Y49B 1M4DA 3W91A 2VQYA 5FVJA 2REFA 1VHSA 3FIXA 2PRBA 3S6KA 4ZBGA 2ZW6A 2I00A 3DSBA 2QIRA 5CNPA 1WK4A 2X7BA 1QSTA 2QMLA 1B6BA 3N7ZA 2Q04A 3TOBA 4NCZA 4R3LA 3FB3A 2BUEA 2CNSA 4BMHA 2HUZA 4KLVA 3FBUA 4CAXA 2B4DB 4QB9A 4RI1A 1YLEA 2J8MA 3MGDA 4II9A 4H6UA 4UA3A 4B5OA 4FD5A 2BEIA 3I3GA 2WPXA 2PDOA 2AE6A 4IF5A 2K5TA 4EVYA 3EFAA 2O28A 2Z10A 4QVTA 3PGPA 3VWEA 4OAEA 1Z4EA 3R9GA 2Y0MA 1QSRA 3WR7A 1S5KA 1SQHA 4NF1A 4U5YA 4B5PB 3R96A 1BO4A 2FIWA 3E0KA 2B58A 5F46A 2G3TA 1P4NA 4KLWA 3F5BA 2J8NA 4MY0A 4MY3A 1S7NA 5J8FA 1NE9A 3F8KA 2Q0YA 3D2PA 5F48A 4R87A 1XIXA 4E2AA 2ARHA 4UWJA 5DWNA 3FYNA 1TIQA 4XNHC 4L89A 2OZUA 1PUAA 2P6EA 4JD6A 2CNMA 1Q2DA 1YVKA 4KOSA 4H6ZA 1S7LA 3DR8A 4XPKA 1M44A 3EY5A 1YREA 4NSQA 3ZZIA 4JJXA 4AG7A 4IUSA 4KOXA 3V8IA 1IIDA 3LODA 5H86A 5F47A 2D4PA 4YGOA 3GYAA 5DWMA 4KOTA 4AVBA 4CRZB 4KZTA 4CRYB 4KOUA 2FSRA 3TFYA 5C88A 2OZGA 3GY9A 4U9YA 3IGRA 5I0CA 4AVCA 4E0AA 1QSOA 1CJWA 1NSLA 4M3SA 3G3SA 2I79A 3GKRA 2PR1A 3TOAA 4MI4A 2PQ8A 4KVOE 4MBUA 1QSMA 2EVNA 2B3VA 2G0BA 4MJ8A 4ORFA 2NMTA 4F6AA 4JWPA 4FD6A 1M4IA 2OU2A 2VZYA 3UY5A 4HNWB 3PP9A 1U6MA 2C27A 5HMNA 2D4OA 1YR0A 3QB8A 3R1KA 2F5IA 4XPDC 4GS4A 2HV2A 4YRHA 1MK4A 5KTCA 3SXOA 3EXNA 2VZZA 2R1IA 5KTAA
chains in the Genus database with same CATH superfamily
2YNCC 1MJ9A 3S6FA 2VBQA 3KKWA 3KASA 4RS2A 2PJ0A 4UIBA 4KVXA 1XMTA 5LYIA 3V7ZA 5JQ4A 5IX3A 3D2MA 3DR6A 4OP4A 1PYTB 2PJ4A 1GYTA 8CPAA 3MRUA 3P2FA 4C7HA 1XEBA 4R8FA 4X5KA 2PJAA 3IWGA 3LACA 3IU2A 5LRGA 1Q2YA 4EWTA 4P45A 3B2YA 3IO1A 4UWIA 5E96A 1L0CA 3BLNA 1R43A 1Z8LA 4CYOA 4P44A 4M6HA 3SJXA 4CAWA 2KCWA 3LD2A 1LAPA 5KTDA 1DE4C 3IU1A 1YVOA 1KUVA 2O53A 1Y0YA 2EWBA 2GREA 3I1UA 4Y49C 1Z5RA 2V8VA 3NFZA 4BBHA 4PSXA 4KUAA 4C2YA 1UFHA 4UFXA 4C68A 1Y9KA 2C1CA 4CAFA 1I21A 1YX0A 1QSNA 2PR8A 2HQYA 2QJ8A 4PSWA 3WC6A 2ZEDA 4A38A 2C6CA 2Q4VA 3D3SA 4OKOA 4M6GA 3PB6X 4JYWA 4RN7A 2FE7A 4OC4A 2BOAA 3FX6A 1PCAA 5AG6A 4YWYA 1TXRA 2JEVA 2PJCA 2ZOGA 3D7GA 1F2PA 1TKJA 2HC9A 4PK2A 2VL1A 2R98A 2XEIA 3PB8X 2OOTA 3K9UA 2FIAA 4NJQA 1YW6A 4PXBA 4B6ZA 3KHXA 4NFRA 4FD4A 2DXQA 3LWUA 4KOWA 5IV0A 4TNUA 4X3RA 3CPXA 2NYQA 2ZW7A 1OZPA 2RFHA 4KVME 3W6XA 1TF9A 4A39A 4HKFA 2REEA 1QMUA 1WWZA 3ZJ0A 2AFWA 1YLOA 3FEDA 1S7FA 4P4JA 3R9FA 2CNTA 1LCPA 4A2ZA 4IHMA 2B3UA 2BL1A 2ZW4A 4MHDA 5D8NA 1NMTA 2RC4A 2ZEMA 1Z9UA 3S9LA 2JLMA 2CTBA 2CY2A 3S9NA 4Q7AA 4MXUA 2PIZA 3R9EA 4CGMA 1BOBA 4B12A 4R3KA 5GCNA 3RO0A 2V77A 1LANA 5K8OA 3GUXA 3D8PA 2I3CA 5HVHA 1XRYA 2OB0A 3CZXA 1BPNA 2B5GA 5JM6A 4PK3A 1CP7A 1M1DA 3D68A 3KI9A 4ZYQA 1EE3P 4O23A 3BHXA 1FY7A 2EO8A 1IOFA 1R57A 3BI0A 3I9SA 3B3CA 4H89A 4MCRA 5EC4A 4ZY1A 4AG9A 3DNSA 4JXRA 1ARMA 1TKHA 4B13A 4CYPA 2Q4YA 2OZHA 3HLPA 2H5MA 2Q43A 4KSIA 1CG2A 4OLLA 4OC3A 3TTHA 1V0CA 4MHNA 2B4BA 3VWDA 3JUWA 2AFUA 4R9MA 2QECA 2CIJA 4LUAA 3SI2A 3PEIA 4F9VA 1JQGA 2AFXA 3RBUA 4P4FA 4QC6A 1VKCA 3ISXA 5IB0A 3GB0A 2ZPAA 2VEZA 2AFSA 2G3AA 2RB7A 3EO4A 3GLJA 1RO5A 2PJ6A 2AFOA 5G20A 1IYLA 4XPLA 2ATRA 3TC8A 3PFOA 4NGQA 1DTDA 4J3GA 4R57A 4PPZA 4UCMA 3TO7A 4AB7A 3T8WA 4QBJA 1Y7RA 1KUYA 2WUUA 4A30A 2BSWA 2BO9A 4ONUA 5AG7A 3P2HA 4NXYA 2Z3KA 2EK9A 1Y0RA 2WZNA 2YGWA 4E8OA 1S7KA 5JH9A 2PC1A 2JDCA 2VI7A 4HNXB 2PJ8A 2Z3LA 3CPAA 4HNYB 3SHPA 1K4JA 4F9UA 3D7FA 2ANPA 2ODFA 4M85A 2ABZA 1NSAA 3EC4A 3FNCA 3PB9X 4L8AA 3R95A 1YGHA 4X8IA 4NGPA 2PJ9A 2YNCA 4DJLA 3H4QA 4KSAA 4IK2A 1MJAA 4Q36A 5A27A 1ZG7A 4CAEA 2CXAA 3G8WA 3DDDA 3SXNA 4DNCA 4U9ZA 2GANA 5F09A 4KUBA 4NGTA 1F57A 1KUXA 1S60A 1XFOA 4GM5A 1X10A 4A32A 4OIWA 4LX9A 5EBVA 3S6HA 4P4DA 3T90A 3HUVA 2V8DA 1AUGA 5G22A 3SI1A 4NEXA 2Q7BA 1XMBA 1BLLE 4MFKA 2XEJA 1M4GA 2VXKA 2A4NA 4FD7A 4P4BA 7CPAA 2Z11A 4M6IA 4F0YA 3TE4A 2GE3A 1YSJA 2V8HA 4UEZA 4NGNA 4MHZA 4CGPA 2POKA 4XNHB 3KQZA 3W6SA 4KORA 4PV6A 1YK3A 4HPSA 1FT7A 3TO6A 3BJ7A 3N5FA 4KOYA 1HDUA 3FRMA 1PU9A 1LRZA 3B7IA 2JDDA 4ZX8A 3NH5A 3KQXA 1J4JA 1BAVA 5F49A 2DPSA 2IL4A 4MFJA 3IC1A 2IQ6A 5THWA 1XE4A 3GIUA 3CXPA 1IB1E 3H8FA 3H5ZA 1I12A 4AVAA 1XJOA 3F0AA 4CS0B 4JXQA 4OMEA 4A31A 3TCVA 1XF8A 3NE7A 4KOVA 4K30A 2JBKA 2J8RA 2P0WA 3T9YA 2B5GB 2ZW5A 4NGSA 3TO9A 4B10A 2YNEA 4AXVA 4CYQA 1Y9WA 2B4DA 2PSWA 3H8EA 1M4LA 3CT9A 4CGNA 1P0HA 2FT0A 1Z4RA 3B8GA 2P6FA 3QAHA 1ZLHA 3JVNA 5I4MA 5ISVA 1LFWA 2ZEFA 1ZLIA 2DEAA 3D66A 4UEEA 2ZEEA 1ON0A 3S6GA 3WC5A 1S3ZA 2PJ7A 2GIVA 3CXQA 4W9YA 1LOKA 3H8GA 2PJ5A 3FXTA 5EMIA 4EMEA 1KZFA 2R8VA 2R7HA 4OC0A 2ZEOA 3C26A 3CDXA 2Z3OA 3CXSA 2OH1A 4C7IA 4OC5A 3IWWA 3PBBA 3V38A 3PRTA 1HDQA 1VGYA 3KL9A 1B87A 3FVLA 1Q2CA 1CM0A 1X12A 4MRIA 4OADA 3RNZA 4ZY0A 4YFJA 2NSMA 2ZXVA 3VARA 2WPWA 3IIBA 2FL4A 3KGQA 1Z8XA 4GXHA 1N71A 3S9MA 1A2ZA 1IOIA 4UBRA 2CTCA 2AJ6A 3OWCA 3PZJA 4QUSA 1LAMA 4XPDB 4P10A 4F0XA 1Z8TA 2Q4ZA 1RXTA 4MCSA 1MJBA 1I1DA 3B3TA 1FNOA 3D67A 3FECA 4MMOA 5H84A 4B5PA 5A28A 5C82A 2PRQA 3BJ8A 5JPHA 3SJFA 1CX8A 4BD9A 1IYKA 3A9LA 5DS0A 3FJUA 1BPMA 4UEFA 4LQGA 4RUHA 4ZGYB 2F8HA 5K8MA 2P6GA 4JLYA 5J8CA 2EBJA 2FXFA 2XEGA 4R76A 4UCPA 4I49A 1VHOA 3NH8A 4WWVA 4MFPA 1GHEA 3QNVA 2FCKA 4NGMA 2Z0ZA 1IICA 2Q44A 3RYOA 5HH1A 4CAVA 3TT2A 2EUIA 5D29A 2IMOA 4Y49B 1ARLA 1M4DA 3W91A 2VQYA 5FVJA 1ZG9A 2REFA 1VHSA 2GU2A 2PJ2A 3BI1A 4NGRA 3DLJA 3FIXA 3D7HA 1CPSA 2PRBA 3FF3A 3K2KA 3S6KA 4ZBGA 4H2KA 2ZW6A 2I00A 3DSBA 3IJ3A 2QIRA 3ISZA 2WSAA 5CNPA 3VATA 2JBJA 3NE8A 4K3NA 2PJ1A 1WK4A 4MHPA 2X7BA 1QSTA 2GFQA 2QMLA 3FH4A 5G21A 3B3WA 4B11A 1B6BA 3N7ZA 4Z65A 5HVGA 2Z3NA 3PB7X 2Q04A 3TOBA 3WABA 4NCZA 4R3LA 5LYFA 4CYNA 1RTQA 5K8PA 3FB3A 2BUEA 1ZG8A 3WC7A 2CNSA 4BMHA 4MFLA 2HUZA 2YNDA 3K9TA 4P6YA 4KLVA 3FBUA 4CAXA 4JZ0A 2B4DB 4QB9A 1YMEA 4RI1A 3LMSA 4DUKA 4C2XA 1YLEA 4KS9A 2J8MA 3FEEA 3MGDA 5CBMA 4H6UA 4UA3A 4II9A 4B5OA 4FD5A 1TF8A 2BEIA 3I3GA 1Z2LA 4KSFA 1OBRA 4R7MA 2WPXA 2PDOA 1F2OA 2PJ3A 2PVWA 3NH4A 1JWQA 4P4EA 5ELYA 2AE6A 4IF5A 1YQEA 2EK8A 1AYEA 2K5TA 4EVYA 3EFAA 4UCNA 3IEHA 2O28A 2QYVA 4MFZA 2Q51A 2Z10A 4QVTA 5J1QA 3TX8A 3QAYA 4MCQA 4UFWA 1VHEA 3PGPA 4ZY2A 3VWEA 1ELLP 1Z4EA 4OAEA 2QVPA 3R9GA 4OIDA 4ZI6A 2Y0MA 1R3NA 1QSRA 3B3SA 3WR7A 4NJRA 3D7DA 1SQHA 1S5KA 2HB6A 4NF1A 2O4HA 3NA6A 2F7VA 4U5YA 2AFZA 4B5PB 3D4UA 2PCUA 1BO4A 3R96A 5BWAB 2FIWA 2GLFA 3E0KA 2B58A 5F46A 2G3TA 1P4NA 4KLWA 4G1PA 3F5BA 4X2TA 5AGEA 2J8NA 3JTKA 1CBXA 2Z3MA 3PFEA 1ELMP 4MY0A 5AG5A 4A94A 3PB4X 4MY3A 1S7NA 2DPTA 2C6PA 5LYDA 1Z8WA 5J8FA 1VIXA 3IWEA 1NE9A 3F8KA 2AFMA 2G9DA 2ZENA 3B35A 4BINA 2Q0YA 1QQ9A 2Q7SA 3D2PA 4MFQA 5AG4A 5F48A 4A95A 4R87A 1XIXA 4FBEA 4OC2A 2ARHA 2ZELA 3RAMA 4E2AA 3KZWA 6CPAA 4P4IA 4UWJA 5DWNA 1TKFA 3FYNA 2ZEGA 3KHZA 4FWUA 5LRJA 5LYLA 2DF5A 2PJBA 1TIQA 1Y7EA 4FUUA 1Q7LA 4XNHC 2C6GA 4L89A 2OZUA 1PUAA 2V8GA 2P6EA 1UWYA 4JD6A 2CNMA 3L2NA 1Q2DA 1YVKA 1CP6A 2FVGA 3IFEA 4H6ZA 4KOSA 1HEEA 1S7LA 3DR8A 4XPKA 4C2ZA 1M44A 4UFVA 3EY5A 3KR5A 1YREA 3PBEA 4MCPA 4NSQA 4Q38A 3ZZIA 3JRUA 4JJXA 2VZZA 4AG7A 2JEWA 4IUSA 4KOXA 3V8IA 4PXEA 1H8LA 1IIDA 1XOVA 3LODA 5H86A 2PVVA 5F47A 2D4PA 3VH9A 4PXCA 4YGOA 4A33A 3WT4A 2ZOFA 3GYAA 5DWMA 2BCOA 4KOTA 4ZX9A 4CPAA 3RZAA 4AVBA 4CRZB 4KZTA 1YW4A 4CRYB 4KOUA 4R6TA 5CPAA 2FSRA 3TFYA 5C88A 2OZGA 1XBUA 3GY9A 2OR4A 4U9YA 4DYOA 3IGRA 5I0CA 5IB9A 2IJZA 1CPXA 2Z3PA 3SJEA 4AVCA 4LQ6A 4E0AA 4CGLA 1ZO0A 3SJGA 1QSOA 1CJWA 1NSLA 4M3SA 3G3SA 4B14A 2I79A 2J9AA 1IU8A 3GKRA 2PR1A 3TOAA 2ZEPA 4MI4A 2PQ8A 4KVOE 4WJBA 3FMCA 4OC1A 5HVFA 4MBUA 1QSMA 2ZEHA 2EVNA 2PE3A 4UF4A 5LRKA 3DGVA 4FAIA 2XEFA 5HXDA 1IGBA 2CF4A 3BXMA 4PXDA 2B3VA 4A37A 5JGFA 1IY7A 1AMPA 2G0BA 4MJ8A 4ORFA 2NMTA 4F6AA 4JWPA 3B3VA 4FD6A 4TWEA 4YU9A 1KWMA 1M4IA 2OU2A 2VZYA 4UIAA 5G1ZA 3UY5A 2GLJA 4HNWB 3SI0A 4EFDA 2PIYA 3PP9A 1U6MA 2C27A 5HMNA 2D4OA 3KR4A 5K8NA 1YR0A 3QB8A 4MHYA 3R1KA 2F5IA 4XPDC 4F8ZA 4ONWA 4GS4A 2HV2A 4YRHA 4PQAA 4CGOA 1MK4A 5KTCA 3SXOA 3MN8A 4IAVA 3EXNA 2WYRA 2FS5A 2R1IA 5KTAA
chains in the Genus database with same CATH topology
2YNCC 1MJ9A 3S6FA 2VBQA 3KKWA 4RS2A 4KVXA 1XMTA 5JQ4A 5IX3A 3D2MA 3DR6A 3P2FA 4C7HA 1XEBA 4X5KA 3IWGA 3IU2A 1Q2YA 5E96A 4UWIA 1L0CA 3BLNA 4CYOA 4CAWA 2KCWA 3LD2A 5KTDA 3IU1A 1YVOA 1KUVA 4Y49C 4BBHA 4PSXA 4KUAA 4C2YA 1UFHA 4UFXA 4C68A 1Y9KA 4CAFA 1I21A 1YX0A 1QSNA 2PR8A 2HQYA 4PSWA 2Q4VA 3D3SA 2FE7A 5AG6A 2JEVA 4PK2A 2R98A 3K9UA 2FIAA 4FD4A 2DXQA 4KOWA 5IV0A 2ZW7A 1OZPA 3W6XA 4KVME 4HKFA 2REEA 1WWZA 3ZJ0A 1S7FA 3R9FA 2CNTA 4A2ZA 4MHDA 2B3UA 2BL1A 2ZW4A 1NMTA 2RC4A 1Z9UA 2JLMA 2CY2A 3R9EA 4CGMA 1BOBA 4B12A 4R3KA 5GCNA 3D8PA 2OB0A 2B5GA 4PK3A 1M1DA 1FY7A 1R57A 3I9SA 4H89A 5EC4A 4AG9A 3DNSA 4JXRA 4B13A 4CYPA 2Q4YA 2OZHA 2H5MA 4OLLA 3TTHA 1V0CA 2B4BA 3VWDA 3JUWA 4R9MA 2QECA 4LUAA 4QC6A 1VKCA 5IB0A 2ZPAA 2VEZA 2G3AA 3EO4A 1RO5A 5G20A 1IYLA 4XPLA 2ATRA 4J3GA 4R57A 4UCMA 3TO7A 4AB7A 4QBJA 1Y7RA 1KUYA 2WUUA 4A30A 2BSWA 4ONUA 5AG7A 3P2HA 4NXYA 2Z3KA 2YGWA 4E8OA 1S7KA 2PC1A 2JDCA 2VI7A 4HNXB 2Z3LA 4HNYB 3SHPA 1K4JA 4M85A 3EC4A 3FNCA 3R95A 4L8AA 1YGHA 2YNCA 3H4QA 4KSAA 1MJAA 4Q36A 5A27A 4CAEA 2CXAA 3G8WA 3DDDA 3SXNA 4DNCA 4U9ZA 2GANA 4KUBA 1KUXA 1S60A 4A32A 4LX9A 5EBVA 3S6HA 3T90A 5G22A 4NEXA 2Q7BA 4MFKA 1M4GA 2VXKA 2A4NA 4FD7A 2Z11A 4F0YA 3TE4A 2GE3A 4CGPA 3W6SA 4XNHB 4KORA 4PV6A 1YK3A 3TO6A 3BJ7A 4KOYA 3FRMA 1PU9A 1LRZA 2JDDA 1J4JA 5F49A 2DPSA 2IL4A 4MFJA 1XE4A 3CXPA 1IB1E 3H5ZA 1I12A 4AVAA 3F0AA 4CS0B 4JXQA 4A31A 3TCVA 1XF8A 3NE7A 4KOVA 4K30A 2P0WA 2J8RA 3T9YA 2B5GB 2ZW5A 3TO9A 4B10A 2YNEA 4CYQA 1Y9WA 2B4DA 2PSWA 4CGNA 1P0HA 2FT0A 1Z4RA 3B8GA 2P6FA 3QAHA 3JVNA 5ISVA 1ON0A 3S6GA 1S3ZA 2GIVA 3CXQA 3FXTA 1KZFA 2R8VA 2R7HA 3C26A 2Z3OA 3CXSA 2OH1A 4C7IA 1B87A 1Q2CA 1CM0A 4OADA 4YFJA 2FS5A 2ZXVA 2WPWA 2FL4A 1N71A 4UBRA 3PZJA 3OWCA 2AJ6A 4QUSA 4XPDB 4F0XA 1RXTA 1MJBA 1I1DA 5H84A 4B5PA 5C82A 5A28A 3BJ8A 5JPHA 1IYKA 3A9LA 4ZGYB 2P6GA 4JLYA 5J8CA 2FXFA 4UCPA 4I49A 4MFPA 1GHEA 2FCKA 2Z0ZA 1IICA 2Q44A 3RYOA 5HH1A 4CAVA 3TT2A 2EUIA 4Y49B 1M4DA 3W91A 2VQYA 5FVJA 2REFA 1VHSA 3FIXA 2PRBA 3S6KA 4ZBGA 2ZW6A 2I00A 3DSBA 2QIRA 2WSAA 5CNPA 1WK4A 2X7BA 1QSTA 4B11A 2QMLA 5G21A 1B6BA 3N7ZA 2Z3NA 2Q04A 3TOBA 4NCZA 4R3LA 4CYNA 3FB3A 2BUEA 2CNSA 4BMHA 4MFLA 2HUZA 2YNDA 4KLVA 3FBUA 4CAXA 2B4DB 4QB9A 4RI1A 4C2XA 1YLEA 4KS9A 2J8MA 3MGDA 4II9A 4H6UA 4UA3A 4B5OA 4FD5A 2BEIA 3I3GA 4KSFA 2WPXA 2PDOA 2AE6A 4IF5A 2K5TA 4EVYA 3EFAA 4UCNA 2O28A 4MFZA 2Z10A 4QVTA 4UFWA 3PGPA 3VWEA 4OAEA 1Z4EA 3R9GA 2Y0MA 1QSRA 3WR7A 1S5KA 1SQHA 4NF1A 4U5YA 4B5PB 3R96A 1BO4A 5BWAB 2FIWA 3E0KA 2B58A 5F46A 2G3TA 1P4NA 4KLWA 3F5BA 5AGEA 2J8NA 3JTKA 2Z3MA 4MY0A 5AG5A 4MY3A 1S7NA 2DPTA 5J8FA 3IWEA 1NE9A 3F8KA 5AG4A 2Q0YA 3D2PA 4MFQA 5F48A 4A95A 4R87A 1XIXA 4E2AA 2ARHA 4UWJA 5DWNA 3FYNA 1TIQA 4XNHC 4L89A 2OZUA 1PUAA 2P6EA 4JD6A 2CNMA 1Q2DA 1YVKA 4KOSA 4H6ZA 1S7LA 3DR8A 4XPKA 4C2ZA 1M44A 4UFVA 3EY5A 1YREA 4NSQA 4Q38A 3ZZIA 4JJXA 4AG7A 4IUSA 4KOXA 3V8IA 1IIDA 3LODA 5H86A 5F47A 2D4PA 4YGOA 4A33A 3GYAA 5DWMA 4KOTA 4AVBA 4CRZB 4KZTA 4CRYB 4KOUA 2FSRA 3TFYA 5C88A 2OZGA 3GY9A 4U9YA 3IGRA 5I0CA 2Z3PA 4AVCA 4E0AA 4CGLA 1ZO0A 4B14A 1QSOA 1CJWA 1NSLA 4M3SA 3G3SA 2I79A 3GKRA 2PR1A 3TOAA 4MI4A 2PQ8A 4KVOE 4MBUA 1QSMA 2EVNA 2B3VA 2G0BA 4MJ8A 4ORFA 2NMTA 4F6AA 4JWPA 4FD6A 5G1ZA 1M4IA 2OU2A 2VZYA 3UY5A 4HNWB 3PP9A 1U6MA 2C27A 5HMNA 2D4OA 1YR0A 3QB8A 3R1KA 2F5IA 4XPDC 4GS4A 2HV2A 4YRHA 4CGOA 1MK4A 5KTCA 3SXOA 3EXNA 2VZZA 2R1IA 5KTAA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1MJ9 A;  3S6F A;  2VBQ A;  3KKW A;  4RS2 A;  4KVX A;  1XMT A;  5JQ4 A;  5IX3 A;  3D2M A;  3DR6 A;  3P2F A;  1XEB A;  4X5K A;  3IWG A;  1Q2Y A;  5E96 A;  4UWI A;  1L0C A;  3BLN A;  4CAW A;  2KCW A;  3LD2 A;  5KTD A;  1YVO A;  1KUV A;  4Y49 C;  4PSX A;  4KUA A;  1UFH A;  1Y9K A;  1I21 A;  1YX0 A;  1QSN A;  2PR8 A;  2HQY A;  4PSW A;  2Q4V A;  3D3S A;  2FE7 A;  2JEV A;  4PK2 A;  2R98 A;  3K9U A;  2FIA A;  4FD4 A;  2DXQ A;  4KOW A;  5IV0 A;  2ZW7 A;  1OZP A;  3W6X A;  4KVM E;  4HKF A;  2REE A;  1WWZ A;  3ZJ0 A;  1S7F A;  3R9F A;  2CNT A;  4MHD A;  2B3U A;  2BL1 A;  2ZW4 A;  1NMT A;  2RC4 A;  1Z9U A;  2JLM A;  2CY2 A;  3R9E A;  1BOB A;  4R3K A;  5GCN A;  3D8P A;  2OB0 A;  2B5G A;  4PK3 A;  1M1D A;  1FY7 A;  1R57 A;  3I9S A;  4H89 A;  5EC4 A;  4AG9 A;  3DNS A;  4JXR A;  2Q4Y A;  2OZH A;  2H5M A;  4OLL A;  3TTH A;  1V0C A;  2B4B A;  3VWD A;  3JUW A;  4R9M A;  2QEC A;  4LUA A;  4QC6 A;  1VKC A;  5IB0 A;  2ZPA A;  2VEZ A;  2G3A A;  3EO4 A;  1RO5 A;  1IYL A;  4XPL A;  2ATR A;  4J3G A;  4R57 A;  3TO7 A;  4AB7 A;  4QBJ A;  1Y7R A;  1KUY A;  2BSW A;  4ONU A;  3P2H A;  4NXY A;  4E8O A;  1S7K A;  2PC1 A;  2JDC A;  2VI7 A;  4HNX B;  4HNY B;  3SHP A;  1K4J A;  4M85 A;  3EC4 A;  3FNC A;  3R95 A;  4L8A A;  1YGH A;  3H4Q A;  1MJA A;  3G8W A;  3DDD A;  3SXN A;  4DNC A;  4U9Z A;  2GAN A;  4KUB A;  1KUX A;  1S60 A;  4LX9 A;  5EBV A;  3S6H A;  3T90 A;  4NEX A;  2Q7B A;  1M4G A;  2VXK A;  2A4N A;  4FD7 A;  2Z11 A;  4F0Y A;  3TE4 A;  2GE3 A;  3W6S A;  4XNH B;  4KOR A;  4PV6 A;  1YK3 A;  3TO6 A;  3BJ7 A;  4KOY A;  3FRM A;  1PU9 A;  1LRZ A;  2JDD A;  1J4J A;  5F49 A;  2IL4 A;  1XE4 A;  3CXP A;  1IB1 E;  1I12 A;  4AVA A;  3F0A A;  4CS0 B;  4JXQ A;  3TCV A;  1XF8 A;  3NE7 A;  4KOV A;  4K30 A;  2P0W A;  2J8R A;  3T9Y A;  2B5G B;  2ZW5 A;  3TO9 A;  1Y9W A;  2B4D A;  2PSW A;  1P0H A;  2FT0 A;  1Z4R A;  3B8G A;  2P6F A;  3QAH A;  3JVN A;  5ISV A;  1ON0 A;  3S6G A;  1S3Z A;  2GIV A;  3CXQ A;  3FXT A;  1KZF A;  2R8V A;  2R7H A;  3C26 A;  3CXS A;  2OH1 A;  1B87 A;  1Q2C A;  1CM0 A;  4OAD A;  4YFJ A;  2FS5 A;  2ZXV A;  2WPW A;  2FL4 A;  1N71 A;  4UBR A;  3PZJ A;  3OWC A;  2AJ6 A;  4QUS A;  4XPD B;  1RXT A;  1MJB A;  1I1D A;  5H84 A;  4B5P A;  5C82 A;  3BJ8 A;  5JPH A;  1IYK A;  2P6G A;  4JLY A;  5J8C A;  2FXF A;  4I49 A;  1GHE A;  2FCK A;  2Z0Z A;  1IIC A;  2Q44 A;  3RYO A;  5HH1 A;  4CAV A;  3TT2 A;  2EUI A;  4Y49 B;  1M4D A;  3W91 A;  2VQY A;  5FVJ A;  2REF A;  1VHS A;  3FIX A;  2PRB A;  3S6K A;  4ZBG A;  2ZW6 A;  2I00 A;  3DSB A;  2QIR A;  5CNP A;  1WK4 A;  2X7B A;  1QST A;  2QML A;  1B6B A;  3N7Z A;  2Q04 A;  3TOB A;  4NCZ A;  4R3L A;  3FB3 A;  2BUE A;  2CNS A;  4BMH A;  2HUZ A;  4KLV A;  3FBU A;  4CAX A;  2B4D B;  4QB9 A;  4RI1 A;  1YLE A;  2J8M A;  3MGD A;  4II9 A;  4H6U A;  4UA3 A;  4B5O A;  4FD5 A;  2BEI A;  3I3G A;  2WPX A;  2PDO A;  2AE6 A;  4IF5 A;  2K5T A;  4EVY A;  3EFA A;  2O28 A;  2Z10 A;  4QVT A;  3PGP A;  3VWE A;  4OAE A;  1Z4E A;  3R9G A;  2Y0M A;  1QSR A;  3WR7 A;  1S5K A;  1SQH A;  4NF1 A;  4U5Y A;  4B5P B;  3R96 A;  1BO4 A;  2FIW A;  3E0K A;  2B58 A;  5F46 A;  2G3T A;  1P4N A;  4KLW A;  3F5B A;  2J8N A;  4MY0 A;  4MY3 A;  1S7N A;  5J8F A;  1NE9 A;  3F8K A;  2Q0Y A;  3D2P A;  5F48 A;  4R87 A;  1XIX A;  4E2A A;  2ARH A;  4UWJ A;  5DWN A;  3FYN A;  1TIQ A;  4XNH C;  4L89 A;  2OZU A;  1PUA A;  2P6E A;  4JD6 A;  2CNM A;  1Q2D A;  1YVK A;  4KOS A;  4H6Z A;  1S7L A;  3DR8 A;  4XPK A;  1M44 A;  3EY5 A;  1YRE A;  4NSQ A;  3ZZI A;  4JJX A;  4AG7 A;  4IUS A;  4KOX A;  3V8I A;  1IID A;  3LOD A;  5H86 A;  5F47 A;  2D4P A;  4YGO A;  3GYA A;  5DWM A;  4KOT A;  4AVB A;  4CRZ B;  4KZT A;  4CRY B;  4KOU A;  2FSR A;  3TFY A;  5C88 A;  2OZG A;  3GY9 A;  4U9Y A;  3IGR A;  5I0C A;  4AVC A;  4E0A A;  1QSO A;  1CJW A;  1NSL A;  4M3S A;  3G3S A;  2I79 A;  3GKR A;  2PR1 A;  3TOA A;  4MI4 A;  2PQ8 A;  4KVO E;  4MBU A;  1QSM A;  2EVN A;  2B3V A;  2G0B A;  4MJ8 A;  4ORF A;  2NMT A;  4F6A A;  4JWP A;  4FD6 A;  1M4I A;  2OU2 A;  2VZY A;  3UY5 A;  4HNW B;  3PP9 A;  1U6M A;  2C27 A;  5HMN A;  2D4O A;  1YR0 A;  3QB8 A;  3R1K A;  2F5I A;  4XPD C;  4GS4 A;  2HV2 A;  4YRH A;  1MK4 A;  5KTC A;  3SXO A;  3EXN A;  2VZZ A;  2R1I A;  5KTA A; 
#chains in the Genus database with same CATH topology
 2YNC C;  1MJ9 A;  3S6F A;  2VBQ A;  3KKW A;  3KAS A;  4RS2 A;  2PJ0 A;  4UIB A;  4KVX A;  1XMT A;  5LYI A;  3V7Z A;  5JQ4 A;  5IX3 A;  3D2M A;  3DR6 A;  4OP4 A;  1PYT B;  2PJ4 A;  1GYT A;  8CPA A;  3MRU A;  3P2F A;  4C7H A;  1XEB A;  4R8F A;  4X5K A;  2PJA A;  3IWG A;  3LAC A;  3IU2 A;  5LRG A;  1Q2Y A;  4EWT A;  4P45 A;  3B2Y A;  3IO1 A;  4UWI A;  5E96 A;  1L0C A;  3BLN A;  1R43 A;  1Z8L A;  4CYO A;  4P44 A;  4M6H A;  3SJX A;  4CAW A;  2KCW A;  3LD2 A;  1LAP A;  5KTD A;  1DE4 C;  3IU1 A;  1YVO A;  1KUV A;  2O53 A;  1Y0Y A;  2EWB A;  2GRE A;  3I1U A;  4Y49 C;  1Z5R A;  2V8V A;  3NFZ A;  4BBH A;  4PSX A;  4KUA A;  4C2Y A;  1UFH A;  4UFX A;  4C68 A;  1Y9K A;  2C1C A;  4CAF A;  1I21 A;  1YX0 A;  1QSN A;  2PR8 A;  2HQY A;  2QJ8 A;  4PSW A;  3WC6 A;  2ZED A;  4A38 A;  2C6C A;  2Q4V A;  3D3S A;  4OKO A;  4M6G A;  3PB6 X;  4JYW A;  4RN7 A;  2FE7 A;  4OC4 A;  2BOA A;  3FX6 A;  1PCA A;  5AG6 A;  4YWY A;  1TXR A;  2JEV A;  2PJC A;  2ZOG A;  3D7G A;  1F2P A;  1TKJ A;  2HC9 A;  4PK2 A;  2VL1 A;  2R98 A;  2XEI A;  3PB8 X;  2OOT A;  3K9U A;  2FIA A;  4NJQ A;  1YW6 A;  4PXB A;  4B6Z A;  3KHX A;  4NFR A;  4FD4 A;  2DXQ A;  3LWU A;  4KOW A;  5IV0 A;  4TNU A;  4X3R A;  3CPX A;  2NYQ A;  2ZW7 A;  1OZP A;  2RFH A;  4KVM E;  3W6X A;  1TF9 A;  4A39 A;  4HKF A;  2REE A;  1QMU A;  1WWZ A;  3ZJ0 A;  2AFW A;  1YLO A;  3FED A;  1S7F A;  4P4J A;  3R9F A;  2CNT A;  1LCP A;  4A2Z A;  4IHM A;  2B3U A;  2BL1 A;  2ZW4 A;  4MHD A;  5D8N A;  1NMT A;  2RC4 A;  2ZEM A;  1Z9U A;  3S9L A;  2JLM A;  2CTB A;  2CY2 A;  3S9N A;  4Q7A A;  4MXU A;  2PIZ A;  3R9E A;  4CGM A;  1BOB A;  4B12 A;  4R3K A;  5GCN A;  3RO0 A;  2V77 A;  1LAN A;  5K8O A;  3GUX A;  3D8P A;  2I3C A;  5HVH A;  1XRY A;  2OB0 A;  3CZX A;  1BPN A;  2B5G A;  5JM6 A;  4PK3 A;  1CP7 A;  1M1D A;  3D68 A;  3KI9 A;  4ZYQ A;  1EE3 P;  4O23 A;  3BHX A;  1FY7 A;  2EO8 A;  1IOF A;  1R57 A;  3BI0 A;  3I9S A;  3B3C A;  4H89 A;  4MCR A;  5EC4 A;  4ZY1 A;  4AG9 A;  3DNS A;  4JXR A;  1ARM A;  1TKH A;  4B13 A;  4CYP A;  2Q4Y A;  2OZH A;  3HLP A;  2H5M A;  2Q43 A;  4KSI A;  1CG2 A;  4OLL A;  4OC3 A;  3TTH A;  1V0C A;  4MHN A;  2B4B A;  3VWD A;  3JUW A;  2AFU A;  4R9M A;  2QEC A;  2CIJ A;  4LUA A;  3SI2 A;  3PEI A;  4F9V A;  1JQG A;  2AFX A;  3RBU A;  4P4F A;  4QC6 A;  1VKC A;  3ISX A;  5IB0 A;  3GB0 A;  2ZPA A;  2VEZ A;  2AFS A;  2G3A A;  2RB7 A;  3EO4 A;  3GLJ A;  1RO5 A;  2PJ6 A;  2AFO A;  5G20 A;  1IYL A;  4XPL A;  2ATR A;  3TC8 A;  3PFO A;  4NGQ A;  1DTD A;  4J3G A;  4R57 A;  4PPZ A;  4UCM A;  3TO7 A;  4AB7 A;  3T8W A;  4QBJ A;  1Y7R A;  1KUY A;  2WUU A;  4A30 A;  2BSW A;  2BO9 A;  4ONU A;  5AG7 A;  3P2H A;  4NXY A;  2Z3K A;  2EK9 A;  1Y0R A;  2WZN A;  2YGW A;  4E8O A;  1S7K A;  5JH9 A;  2PC1 A;  2JDC A;  2VI7 A;  4HNX B;  2PJ8 A;  2Z3L A;  3CPA A;  4HNY B;  3SHP A;  1K4J A;  4F9U A;  3D7F A;  2ANP A;  2ODF A;  4M85 A;  2ABZ A;  1NSA A;  3EC4 A;  3FNC A;  3PB9 X;  4L8A A;  3R95 A;  1YGH A;  4X8I A;  4NGP A;  2PJ9 A;  2YNC A;  4DJL A;  3H4Q A;  4KSA A;  4IK2 A;  1MJA A;  4Q36 A;  5A27 A;  1ZG7 A;  4CAE A;  2CXA A;  3G8W A;  3DDD A;  3SXN A;  4DNC A;  4U9Z A;  2GAN A;  5F09 A;  4KUB A;  4NGT A;  1F57 A;  1KUX A;  1S60 A;  1XFO A;  4GM5 A;  1X10 A;  4A32 A;  4OIW A;  4LX9 A;  5EBV A;  3S6H A;  4P4D A;  3T90 A;  3HUV A;  2V8D A;  1AUG A;  5G22 A;  3SI1 A;  4NEX A;  2Q7B A;  1XMB A;  1BLL E;  4MFK A;  2XEJ A;  1M4G A;  2VXK A;  2A4N A;  4FD7 A;  4P4B A;  7CPA A;  2Z11 A;  4M6I A;  4F0Y A;  3TE4 A;  2GE3 A;  1YSJ A;  2V8H A;  4UEZ A;  4NGN A;  4MHZ A;  4CGP A;  2POK A;  4XNH B;  3KQZ A;  3W6S A;  4KOR A;  4PV6 A;  1YK3 A;  4HPS A;  1FT7 A;  3TO6 A;  3BJ7 A;  3N5F A;  4KOY A;  1HDU A;  3FRM A;  1PU9 A;  1LRZ A;  3B7I A;  2JDD A;  4ZX8 A;  3NH5 A;  3KQX A;  1J4J A;  1BAV A;  5F49 A;  2DPS A;  2IL4 A;  4MFJ A;  3IC1 A;  2IQ6 A;  5THW A;  1XE4 A;  3GIU A;  3CXP A;  1IB1 E;  3H8F A;  3H5Z A;  1I12 A;  4AVA A;  1XJO A;  3F0A A;  4CS0 B;  4JXQ A;  4OME A;  4A31 A;  3TCV A;  1XF8 A;  3NE7 A;  4KOV A;  4K30 A;  2JBK A;  2J8R A;  2P0W A;  3T9Y A;  2B5G B;  2ZW5 A;  4NGS A;  3TO9 A;  4B10 A;  2YNE A;  4AXV A;  4CYQ A;  1Y9W A;  2B4D A;  2PSW A;  3H8E A;  1M4L A;  3CT9 A;  4CGN A;  1P0H A;  2FT0 A;  1Z4R A;  3B8G A;  2P6F A;  3QAH A;  1ZLH A;  3JVN A;  5I4M A;  5ISV A;  1LFW A;  2ZEF A;  1ZLI A;  2DEA A;  3D66 A;  4UEE A;  2ZEE A;  1ON0 A;  3S6G A;  3WC5 A;  1S3Z A;  2PJ7 A;  2GIV A;  3CXQ A;  4W9Y A;  1LOK A;  3H8G A;  2PJ5 A;  3FXT A;  5EMI A;  4EME A;  1KZF A;  2R8V A;  2R7H A;  4OC0 A;  2ZEO A;  3C26 A;  3CDX A;  2Z3O A;  3CXS A;  2OH1 A;  4C7I A;  4OC5 A;  3IWW A;  3PBB A;  3V38 A;  3PRT A;  1HDQ A;  1VGY A;  3KL9 A;  1B87 A;  3FVL A;  1Q2C A;  1CM0 A;  1X12 A;  4MRI A;  4OAD A;  3RNZ A;  4ZY0 A;  4YFJ A;  2NSM A;  2ZXV A;  3VAR A;  2WPW A;  3IIB A;  2FL4 A;  3KGQ A;  1Z8X A;  4GXH A;  1N71 A;  3S9M A;  1A2Z A;  1IOI A;  4UBR A;  2CTC A;  2AJ6 A;  3OWC A;  3PZJ A;  4QUS A;  1LAM A;  4XPD B;  4P10 A;  4F0X A;  1Z8T A;  2Q4Z A;  1RXT A;  4MCS A;  1MJB A;  1I1D A;  3B3T A;  1FNO A;  3D67 A;  3FEC A;  4MMO A;  5H84 A;  4B5P A;  5A28 A;  5C82 A;  2PRQ A;  3BJ8 A;  5JPH A;  3SJF A;  1CX8 A;  4BD9 A;  1IYK A;  3A9L A;  5DS0 A;  3FJU A;  1BPM A;  4UEF A;  4LQG A;  4RUH A;  4ZGY B;  2F8H A;  5K8M A;  2P6G A;  4JLY A;  5J8C A;  2EBJ A;  2FXF A;  2XEG A;  4R76 A;  4UCP A;  4I49 A;  1VHO A;  3NH8 A;  4WWV A;  4MFP A;  1GHE A;  3QNV A;  2FCK A;  4NGM A;  2Z0Z A;  1IIC A;  2Q44 A;  3RYO A;  5HH1 A;  4CAV A;  3TT2 A;  2EUI A;  5D29 A;  2IMO A;  4Y49 B;  1ARL A;  1M4D A;  3W91 A;  2VQY A;  5FVJ A;  1ZG9 A;  2REF A;  1VHS A;  2GU2 A;  2PJ2 A;  3BI1 A;  4NGR A;  3DLJ A;  3FIX A;  3D7H A;  1CPS A;  2PRB A;  3FF3 A;  3K2K A;  3S6K A;  4ZBG A;  4H2K A;  2ZW6 A;  2I00 A;  3DSB A;  3IJ3 A;  2QIR A;  3ISZ A;  2WSA A;  5CNP A;  3VAT A;  2JBJ A;  3NE8 A;  4K3N A;  2PJ1 A;  1WK4 A;  4MHP A;  2X7B A;  1QST A;  2GFQ A;  2QML A;  3FH4 A;  5G21 A;  3B3W A;  4B11 A;  1B6B A;  3N7Z A;  4Z65 A;  5HVG A;  2Z3N A;  3PB7 X;  2Q04 A;  3TOB A;  3WAB A;  4NCZ A;  4R3L A;  5LYF A;  4CYN A;  1RTQ A;  5K8P A;  3FB3 A;  2BUE A;  1ZG8 A;  3WC7 A;  2CNS A;  4BMH A;  4MFL A;  2HUZ A;  2YND A;  3K9T A;  4P6Y A;  4KLV A;  3FBU A;  4CAX A;  4JZ0 A;  2B4D B;  4QB9 A;  1YME A;  4RI1 A;  3LMS A;  4DUK A;  4C2X A;  1YLE A;  4KS9 A;  2J8M A;  3FEE A;  3MGD A;  5CBM A;  4H6U A;  4UA3 A;  4II9 A;  4B5O A;  4FD5 A;  1TF8 A;  2BEI A;  3I3G A;  1Z2L A;  4KSF A;  1OBR A;  4R7M A;  2WPX A;  2PDO A;  1F2O A;  2PJ3 A;  2PVW A;  3NH4 A;  1JWQ A;  4P4E A;  5ELY A;  2AE6 A;  4IF5 A;  1YQE A;  2EK8 A;  1AYE A;  2K5T A;  4EVY A;  3EFA A;  4UCN A;  3IEH A;  2O28 A;  2QYV A;  4MFZ A;  2Q51 A;  2Z10 A;  4QVT A;  5J1Q A;  3TX8 A;  3QAY A;  4MCQ A;  4UFW A;  1VHE A;  3PGP A;  4ZY2 A;  3VWE A;  1ELL P;  1Z4E A;  4OAE A;  2QVP A;  3R9G A;  4OID A;  4ZI6 A;  2Y0M A;  1R3N A;  1QSR A;  3B3S A;  3WR7 A;  4NJR A;  3D7D A;  1SQH A;  1S5K A;  2HB6 A;  4NF1 A;  2O4H A;  3NA6 A;  2F7V A;  4U5Y A;  2AFZ A;  4B5P B;  3D4U A;  2PCU A;  1BO4 A;  3R96 A;  5BWA B;  2FIW A;  2GLF A;  3E0K A;  2B58 A;  5F46 A;  2G3T A;  1P4N A;  4KLW A;  4G1P A;  3F5B A;  4X2T A;  5AGE A;  2J8N A;  3JTK A;  1CBX A;  2Z3M A;  3PFE A;  1ELM P;  4MY0 A;  5AG5 A;  4A94 A;  3PB4 X;  4MY3 A;  1S7N A;  2DPT A;  2C6P A;  5LYD A;  1Z8W A;  5J8F A;  1VIX A;  3IWE A;  1NE9 A;  3F8K A;  2AFM A;  2G9D A;  2ZEN A;  3B35 A;  4BIN A;  2Q0Y A;  1QQ9 A;  2Q7S A;  3D2P A;  4MFQ A;  5AG4 A;  5F48 A;  4A95 A;  4R87 A;  1XIX A;  4FBE A;  4OC2 A;  2ARH A;  2ZEL A;  3RAM A;  4E2A A;  3KZW A;  6CPA A;  4P4I A;  4UWJ A;  5DWN A;  1TKF A;  3FYN A;  2ZEG A;  3KHZ A;  4FWU A;  5LRJ A;  5LYL A;  2DF5 A;  2PJB A;  1TIQ A;  1Y7E A;  4FUU A;  1Q7L A;  4XNH C;  2C6G A;  4L89 A;  2OZU A;  1PUA A;  2V8G A;  2P6E A;  1UWY A;  4JD6 A;  2CNM A;  3L2N A;  1Q2D A;  1YVK A;  1CP6 A;  2FVG A;  3IFE A;  4H6Z A;  4KOS A;  1HEE A;  1S7L A;  3DR8 A;  4XPK A;  4C2Z A;  1M44 A;  4UFV A;  3EY5 A;  3KR5 A;  1YRE A;  3PBE A;  4MCP A;  4NSQ A;  4Q38 A;  3ZZI A;  3JRU A;  4JJX A;  2VZZ A;  4AG7 A;  2JEW A;  4IUS A;  4KOX A;  3V8I A;  4PXE A;  1H8L A;  1IID A;  1XOV A;  3LOD A;  5H86 A;  2PVV A;  5F47 A;  2D4P A;  3VH9 A;  4PXC A;  4YGO A;  4A33 A;  3WT4 A;  2ZOF A;  3GYA A;  5DWM A;  2BCO A;  4KOT A;  4ZX9 A;  4CPA A;  3RZA A;  4AVB A;  4CRZ B;  4KZT A;  1YW4 A;  4CRY B;  4KOU A;  4R6T A;  5CPA A;  2FSR A;  3TFY A;  5C88 A;  2OZG A;  1XBU A;  3GY9 A;  2OR4 A;  4U9Y A;  4DYO A;  3IGR A;  5I0C A;  5IB9 A;  2IJZ A;  1CPX A;  2Z3P A;  3SJE A;  4AVC A;  4LQ6 A;  4E0A A;  4CGL A;  1ZO0 A;  3SJG A;  1QSO A;  1CJW A;  1NSL A;  4M3S A;  3G3S A;  4B14 A;  2I79 A;  2J9A A;  1IU8 A;  3GKR A;  2PR1 A;  3TOA A;  2ZEP A;  4MI4 A;  2PQ8 A;  4KVO E;  4WJB A;  3FMC A;  4OC1 A;  5HVF A;  4MBU A;  1QSM A;  2ZEH A;  2EVN A;  2PE3 A;  4UF4 A;  5LRK A;  3DGV A;  4FAI A;  2XEF A;  5HXD A;  1IGB A;  2CF4 A;  3BXM A;  4PXD A;  2B3V A;  4A37 A;  5JGF A;  1IY7 A;  1AMP A;  2G0B A;  4MJ8 A;  4ORF A;  2NMT A;  4F6A A;  4JWP A;  3B3V A;  4FD6 A;  4TWE A;  4YU9 A;  1KWM A;  1M4I A;  2OU2 A;  2VZY A;  4UIA A;  5G1Z A;  3UY5 A;  2GLJ A;  4HNW B;  3SI0 A;  4EFD A;  2PIY A;  3PP9 A;  1U6M A;  2C27 A;  5HMN A;  2D4O A;  3KR4 A;  5K8N A;  1YR0 A;  3QB8 A;  4MHY A;  3R1K A;  2F5I A;  4XPD C;  4F8Z A;  4ONW A;  4GS4 A;  2HV2 A;  4YRH A;  4PQA A;  4CGO A;  1MK4 A;  5KTC A;  3SXO A;  3MN8 A;  4IAV A;  3EXN A;  2WYR A;  2FS5 A;  2R1I A;  5KTA A; 
#chains in the Genus database with same CATH homology
 2YNC C;  1MJ9 A;  3S6F A;  2VBQ A;  3KKW A;  4RS2 A;  4KVX A;  1XMT A;  5JQ4 A;  5IX3 A;  3D2M A;  3DR6 A;  3P2F A;  4C7H A;  1XEB A;  4X5K A;  3IWG A;  3IU2 A;  1Q2Y A;  5E96 A;  4UWI A;  1L0C A;  3BLN A;  4CYO A;  4CAW A;  2KCW A;  3LD2 A;  5KTD A;  3IU1 A;  1YVO A;  1KUV A;  4Y49 C;  4BBH A;  4PSX A;  4KUA A;  4C2Y A;  1UFH A;  4UFX A;  4C68 A;  1Y9K A;  4CAF A;  1I21 A;  1YX0 A;  1QSN A;  2PR8 A;  2HQY A;  4PSW A;  2Q4V A;  3D3S A;  2FE7 A;  5AG6 A;  2JEV A;  4PK2 A;  2R98 A;  3K9U A;  2FIA A;  4FD4 A;  2DXQ A;  4KOW A;  5IV0 A;  2ZW7 A;  1OZP A;  3W6X A;  4KVM E;  4HKF A;  2REE A;  1WWZ A;  3ZJ0 A;  1S7F A;  3R9F A;  2CNT A;  4A2Z A;  4MHD A;  2B3U A;  2BL1 A;  2ZW4 A;  1NMT A;  2RC4 A;  1Z9U A;  2JLM A;  2CY2 A;  3R9E A;  4CGM A;  1BOB A;  4B12 A;  4R3K A;  5GCN A;  3D8P A;  2OB0 A;  2B5G A;  4PK3 A;  1M1D A;  1FY7 A;  1R57 A;  3I9S A;  4H89 A;  5EC4 A;  4AG9 A;  3DNS A;  4JXR A;  4B13 A;  4CYP A;  2Q4Y A;  2OZH A;  2H5M A;  4OLL A;  3TTH A;  1V0C A;  2B4B A;  3VWD A;  3JUW A;  4R9M A;  2QEC A;  4LUA A;  4QC6 A;  1VKC A;  5IB0 A;  2ZPA A;  2VEZ A;  2G3A A;  3EO4 A;  1RO5 A;  5G20 A;  1IYL A;  4XPL A;  2ATR A;  4J3G A;  4R57 A;  4UCM A;  3TO7 A;  4AB7 A;  4QBJ A;  1Y7R A;  1KUY A;  2WUU A;  4A30 A;  2BSW A;  4ONU A;  5AG7 A;  3P2H A;  4NXY A;  2Z3K A;  2YGW A;  4E8O A;  1S7K A;  2PC1 A;  2JDC A;  2VI7 A;  4HNX B;  2Z3L A;  4HNY B;  3SHP A;  1K4J A;  4M85 A;  3EC4 A;  3FNC A;  3R95 A;  4L8A A;  1YGH A;  2YNC A;  3H4Q A;  4KSA A;  1MJA A;  4Q36 A;  5A27 A;  4CAE A;  2CXA A;  3G8W A;  3DDD A;  3SXN A;  4DNC A;  4U9Z A;  2GAN A;  4KUB A;  1KUX A;  1S60 A;  4A32 A;  4LX9 A;  5EBV A;  3S6H A;  3T90 A;  5G22 A;  4NEX A;  2Q7B A;  4MFK A;  1M4G A;  2VXK A;  2A4N A;  4FD7 A;  2Z11 A;  4F0Y A;  3TE4 A;  2GE3 A;  4CGP A;  3W6S A;  4XNH B;  4KOR A;  4PV6 A;  1YK3 A;  3TO6 A;  3BJ7 A;  4KOY A;  3FRM A;  1PU9 A;  1LRZ A;  2JDD A;  1J4J A;  5F49 A;  2DPS A;  2IL4 A;  4MFJ A;  1XE4 A;  3CXP A;  1IB1 E;  3H5Z A;  1I12 A;  4AVA A;  3F0A A;  4CS0 B;  4JXQ A;  4A31 A;  3TCV A;  1XF8 A;  3NE7 A;  4KOV A;  4K30 A;  2P0W A;  2J8R A;  3T9Y A;  2B5G B;  2ZW5 A;  3TO9 A;  4B10 A;  2YNE A;  4CYQ A;  1Y9W A;  2B4D A;  2PSW A;  4CGN A;  1P0H A;  2FT0 A;  1Z4R A;  3B8G A;  2P6F A;  3QAH A;  3JVN A;  5ISV A;  1ON0 A;  3S6G A;  1S3Z A;  2GIV A;  3CXQ A;  3FXT A;  1KZF A;  2R8V A;  2R7H A;  3C26 A;  2Z3O A;  3CXS A;  2OH1 A;  4C7I A;  1B87 A;  1Q2C A;  1CM0 A;  4OAD A;  4YFJ A;  2FS5 A;  2ZXV A;  2WPW A;  2FL4 A;  1N71 A;  4UBR A;  3PZJ A;  3OWC A;  2AJ6 A;  4QUS A;  4XPD B;  4F0X A;  1RXT A;  1MJB A;  1I1D A;  5H84 A;  4B5P A;  5C82 A;  5A28 A;  3BJ8 A;  5JPH A;  1IYK A;  3A9L A;  4ZGY B;  2P6G A;  4JLY A;  5J8C A;  2FXF A;  4UCP A;  4I49 A;  4MFP A;  1GHE A;  2FCK A;  2Z0Z A;  1IIC A;  2Q44 A;  3RYO A;  5HH1 A;  4CAV A;  3TT2 A;  2EUI A;  4Y49 B;  1M4D A;  3W91 A;  2VQY A;  5FVJ A;  2REF A;  1VHS A;  3FIX A;  2PRB A;  3S6K A;  4ZBG A;  2ZW6 A;  2I00 A;  3DSB A;  2QIR A;  2WSA A;  5CNP A;  1WK4 A;  2X7B A;  1QST A;  4B11 A;  2QML A;  5G21 A;  1B6B A;  3N7Z A;  2Z3N A;  2Q04 A;  3TOB A;  4NCZ A;  4R3L A;  4CYN A;  3FB3 A;  2BUE A;  2CNS A;  4BMH A;  4MFL A;  2HUZ A;  2YND A;  4KLV A;  3FBU A;  4CAX A;  2B4D B;  4QB9 A;  4RI1 A;  4C2X A;  1YLE A;  4KS9 A;  2J8M A;  3MGD A;  4II9 A;  4H6U A;  4UA3 A;  4B5O A;  4FD5 A;  2BEI A;  3I3G A;  4KSF A;  2WPX A;  2PDO A;  2AE6 A;  4IF5 A;  2K5T A;  4EVY A;  3EFA A;  4UCN A;  2O28 A;  4MFZ A;  2Z10 A;  4QVT A;  4UFW A;  3PGP A;  3VWE A;  4OAE A;  1Z4E A;  3R9G A;  2Y0M A;  1QSR A;  3WR7 A;  1S5K A;  1SQH A;  4NF1 A;  4U5Y A;  4B5P B;  3R96 A;  1BO4 A;  5BWA B;  2FIW A;  3E0K A;  2B58 A;  5F46 A;  2G3T A;  1P4N A;  4KLW A;  3F5B A;  5AGE A;  2J8N A;  3JTK A;  2Z3M A;  4MY0 A;  5AG5 A;  4MY3 A;  1S7N A;  2DPT A;  5J8F A;  3IWE A;  1NE9 A;  3F8K A;  5AG4 A;  2Q0Y A;  3D2P A;  4MFQ A;  5F48 A;  4A95 A;  4R87 A;  1XIX A;  4E2A A;  2ARH A;  4UWJ A;  5DWN A;  3FYN A;  1TIQ A;  4XNH C;  4L89 A;  2OZU A;  1PUA A;  2P6E A;  4JD6 A;  2CNM A;  1Q2D A;  1YVK A;  4KOS A;  4H6Z A;  1S7L A;  3DR8 A;  4XPK A;  4C2Z A;  1M44 A;  4UFV A;  3EY5 A;  1YRE A;  4NSQ A;  4Q38 A;  3ZZI A;  4JJX A;  4AG7 A;  4IUS A;  4KOX A;  3V8I A;  1IID A;  3LOD A;  5H86 A;  5F47 A;  2D4P A;  4YGO A;  4A33 A;  3GYA A;  5DWM A;  4KOT A;  4AVB A;  4CRZ B;  4KZT A;  4CRY B;  4KOU A;  2FSR A;  3TFY A;  5C88 A;  2OZG A;  3GY9 A;  4U9Y A;  3IGR A;  5I0C A;  2Z3P A;  4AVC A;  4E0A A;  4CGL A;  1ZO0 A;  4B14 A;  1QSO A;  1CJW A;  1NSL A;  4M3S A;  3G3S A;  2I79 A;  3GKR A;  2PR1 A;  3TOA A;  4MI4 A;  2PQ8 A;  4KVO E;  4MBU A;  1QSM A;  2EVN A;  2B3V A;  2G0B A;  4MJ8 A;  4ORF A;  2NMT A;  4F6A A;  4JWP A;  4FD6 A;  5G1Z A;  1M4I A;  2OU2 A;  2VZY A;  3UY5 A;  4HNW B;  3PP9 A;  1U6M A;  2C27 A;  5HMN A;  2D4O A;  1YR0 A;  3QB8 A;  3R1K A;  2F5I A;  4XPD C;  4GS4 A;  2HV2 A;  4YRH A;  4CGO A;  1MK4 A;  5KTC A;  3SXO A;  3EXN A;  2VZZ A;  2R1I A;  5KTA A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...