2A4NA

Crystal structure of aminoglycoside 6'-n-acetyltransferase complexed with coenzyme a
Total Genus 47
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
47
sequence length
180
structure length
180
Chain Sequence
MIISEFDRNNPVLKDQLSDLLRLTWPEEYGDSSAEEVEEMMNPERIAVAAVDQDELVGFIGAIPQYGITGWELHPLVVESSRRKNQIGTRLVNYLEKEVASRGGITIYLGTDDLDHGTTLSQTDLYEHTFDKVASIQNLREHPYEFYEKLGYKIVGVLPNANGWDKPDIWMAKTIIPRPD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords aac(6')-Ii
publication title Structures of aminoglycoside acetyltransferase AAC(6')-Ii in a novel crystal form: structural and normal-mode analyses.
pubmed doi rcsb
source organism Enterococcus faecium
molecule tags Transferase
total genus 47
structure length 180
sequence length 180
chains with identical sequence B
ec nomenclature ec 2.3.1.82: Aminoglycoside 6'-N-acetyltransferase.
pdb deposition date 2005-06-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00583 Acetyltransf_1 Acetyltransferase (GNAT) family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.630.30 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Aminopeptidase 2a4nA00
5HH1A 2A4NA 1KUYA 4NCZA 3DR8A 5DWNA 2K5TA 2CY2A 5JQ4A 1NE9A 5J8CA 4AG9A 4LX9A 3LD2A 2VXKA 3ZZIA 3W91A 4U9YA 3DSBA 4U9ZA 3SXNA 3DNSA 4JXRA 2OB0A 4X5KA 5F49A 4II9A 3QB8A 3KKWA 4B5OA 5J8FA 1MJAA 2KCWA 4R9MA 2O28A 1B6BA 4KORA 4U5YA 3D2MA 2P6EA 3H4QA 1IICA 4ZBGA 2VZYA 5IV0A 2PC1A 4KOWA 2FE7A 4IUSA 2D4PA 3BLNA 2I00A 2OU2A 4AG7A 4FD6A 1PUAA 3P2FA 4YFJA 3K9UA 2WPXA 4KOSA 5JPHA 5C82A 3F8KA 2Q4VA 2PR1A 1MJBA 1NSLA 3QAHA 1WK4A 4CRZB 4AVBA 3B8GA 3NE7A 2P6FA 2OH1A 2B5GB 3IWGA 2Z11A 2OZUA 4KUAA 1M4IA 1YREA 1N71A 2B4DB 3S6KA 2CNTA 4L89A 2F5IA 3GY9A 4ORFA 4E2AA 5IX3A 2R1IA 2B5GA 1XIXA 5H84A 1S7FA 4ONUA 2B4BA 4JJXA 2B4DA 4XPKA 3CXSA 3FXTA 4KVXA 3G8WA 3JUWA 3S6GA 4JXQA 3TO7A 2VZZA 1IB1E 2OZHA 2PSWA 4R87A 4Y49C 1LRZA 1S7KA 3JVNA 3T9YA 2FXFA 2R8VA 2Q0YA 2AE6A 4CAXA 3C26A 5KTDA 5IB0A 4KZTA 4HNXB 2FS5A 2J8RA 4FD7A 3FRMA 2QIRA 1WWZA 1I1DA 3PZJA 4KLWA 5DWMA 1YR0A 3S6HA 2P6GA 1M4GA 4HNYB 3T90A 2VI7A 2NMTA 4AVAA 4KOTA 1S3ZA 2HV2A 1VHSA 4CRYB 4AB7A 3FBUA 2Z10A 4R3LA 5H86A 4UBRA 4DNCA 2B3UA 5EBVA 1IIDA 5KTAA 2HQYA 3BJ7A 1KZFA 4UWJA 1YGHA 4B5PB 4M3SA 3SXOA 3GYAA 2ARHA 2ZW4A 2PDOA 4KVME 1OZPA 5KTCA 2EVNA 4OAEA 1XF8A 3TOBA 4KLVA 1J4JA 3VWEA 4B5PA 1RXTA 1Z4EA 4QBJA 1UFHA 3D8PA 1CJWA 1PU9A 1I12A 4OLLA 1Q2CA 1Y9KA 2J8MA 3FIXA 2OZGA 3EC4A 4MJ8A 2FSRA 3D2PA 3E0KA 2D4OA 2ZPAA 4HKFA 1Z9UA 3R1KA 2Q7BA 3I9SA 2ZW6A 3PGPA 1KUXA 4R57A 2VQYA 2ZXVA 2VEZA 1BO4A 4I49A 3R9FA 2H5MA 2RC4A 3W6XA 1V0CA 3F0AA 2WPWA 2J8NA 3F5BA 4E8OA 5GCNA 3TE4A 3D3SA 3DDDA 4HNWB 4UWIA 3GKRA 2C27A 5I0CA 1YVKA 4QB9A 2FT0A 4FD5A 3CXPA 3DR6A 2G3AA 4MI4A 2AJ6A 4NEXA 1B87A 4KOYA 1YLEA 4FD4A 1Y9WA 1YVOA 4K30A 3IGRA 2VBQA 1VKCA 1L0CA 2ZW5A 4CS0B 4NF1A 4PK3A 1Y7RA 1IYKA 3WR7A 2FL4A 1U6MA 1KUVA 1P0HA 4PSWA 2JDDA 4Y49B 2CNSA 1M4DA 1S5KA 1IYLA 1YX0A 3EFAA 4JLYA 2Z0ZA 4KUBA 4J3GA 4EVYA 2FCKA 4QC6A 2GIVA 4H89A 1CM0A 2ATRA 3EXNA 3G3SA 1GHEA 1I21A 3N7ZA 3FYNA 2ZW7A 4MY3A 1NMTA 4UA3A 3S6FA 1S7LA 3TO9A 4E0AA 4RI1A 1Z4RA 3TT2A 2BUEA 1TIQA 4OADA 5FVJA 2Y0MA 2Q04A 4XPDC 3TFYA 2G0BA 2B58A 4JWPA 2R98A 4KOVA 1BOBA 4MBUA 4RS2A 1SQHA 4R3KA 3R95A 2PRBA 1YK3A 4GS4A 2Q44A 2R7HA 2JEVA 4YRHA 4XPDB 3MGDA 2BEIA 5HMNA 4F0YA 1XEBA 2REFA 4H6ZA 2JLMA 4IF5A 2PR8A 1R57A 3TCVA 1S60A 2G3TA 4XPLA 5C88A 3TTHA 5ISVA 4BMHA 3VWDA 1MJ9A 1M44A 4YGOA 3CXQA 2P0WA 2B3VA 3OWCA 4QVTA 3R9GA 3TOAA 4L8AA 3V8IA 4QUSA 2JDCA 3RYOA 3P2HA 3TO6A 1QSRA 4MHDA 5EC4A 1XE4A 1ON0A 3BJ8A 4PV6A 3FNCA 3FB3A 3LODA 4F6AA 2BSWA 5CNPA 1Q2DA 3R9EA 1MK4A 2CNMA 4NSQA 4PSXA 3W6SA 3ZJ0A 4CAVA 2DXQA 2I79A 4XNHC 3SHPA 4AVCA 2QECA 4H6UA 1S7NA 4PK2A 3EY5A 1FY7A 2PQ8A 2FIAA 2Q4YA 3R96A 1Q2YA 1K4JA 4XNHB 4KVOE 4NXYA 5F48A 2REEA 1QSTA 2X7BA 3I3GA 1QSMA 4M85A 5F46A 3UY5A 1RO5A 2GE3A 2GANA 5E96A 2QMLA 2IL4A 5F47A 4CAWA 1XMTA 3PP9A 2BL1A 4KOUA 4LUAA 4KOXA 2EUIA 1P4NA 4JD6A 4MY0A 1M1DA 3EO4A 2FIWA 2HUZA 1QSOA 1QSNA
chains in the Genus database with same CATH superfamily
5HH1A 2A4NA 4UFWA 1KUYA 1VHEA 3NH5A 4R6TA 4Q7AA 4NCZA 1BLLE 1VIXA 4KSIA 5HVHA 2PJBA 2IMOA 2YNEA 3DR8A 2PE3A 3PRTA 5DWNA 2K5TA 4NGTA 4EWTA 2CY2A 3B3TA 5JQ4A 4UFVA 5LRJA 1NE9A 4Z65A 3KQXA 2ODFA 5J8CA 1IGBA 4PXBA 1X12A 4AG9A 3FEEA 3IU2A 2NSMA 3KGQA 4LX9A 3LD2A 1QQ9A 2VXKA 3KQZA 1QMUA 5CBMA 3ZZIA 3W91A 2PJ5A 3I1UA 3H8EA 3FECA 4U9YA 2PJ2A 4EFDA 3DSBA 4F0XA 4U9ZA 3SXNA 1DE4C 3DNSA 4JXRA 4DJLA 5BWAB 2OB0A 4X5KA 3VH9A 4A32A 4MMOA 5F49A 2PJ6A 1UWYA 4II9A 5G22A 2PJ9A 1Q7LA 4F9VA 4NJQA 3QB8A 3KKWA 4MCQA 4P4DA 4ZY0A 4B5OA 5J8FA 4IK2A 1MJAA 3ISXA 2KCWA 2ZEEA 4R9MA 3GB0A 2O28A 1B6BA 2WSAA 2ZOFA 4KORA 4B6ZA 4U5YA 3D2MA 2P6EA 2FVGA 3H4QA 1IICA 2C1CA 2NYQA 4ZBGA 2VZYA 4OIDA 5IV0A 2PC1A 4KOWA 2FE7A 2O53A 4HPSA 4IUSA 2PJ1A 2PJAA 1TKHA 4M6GA 4RUHA 1LAPA 2D4PA 4UEEA 3S9NA 3BLNA 2I00A 4CAFA 1HDQA 2XEIA 2ZEOA 4X3RA 2OU2A 3B3WA 1Y0YA 4AG7A 4FD6A 1PUAA 3P2FA 2GLFA 1RTQA 1AUGA 4YFJA 3K9UA 2WPXA 4KOSA 5JPHA 2BOAA 2PIZA 3F8KA 5C82A 2Q4VA 4A94A 2PR1A 1MJBA 4CYOA 3DLJA 4YU9A 1NSLA 3QAHA 5G1ZA 1WK4A 2F7VA 4CRZB 2PJ7A 4AVBA 4TWEA 1Y7EA 4B10A 3B8GA 3NE7A 2P6FA 2OH1A 4NGNA 3SI1A 2B5GB 3MRUA 3IJ3A 3IWGA 4OP4A 4BBHA 3CPXA 2Z11A 2OZUA 1M4LA 3DGVA 4KUAA 5HVGA 1M4IA 5CPAA 1YREA 1N71A 1XBUA 2B4DB 4MHNA 3IWEA 3S6KA 2CNTA 4M6HA 3NA6A 1FNOA 4L89A 2EK9A 2F5IA 2OR4A 3PB4X 3GY9A 4ORFA 4E2AA 5IX3A 4MFLA 2R1IA 2B5GA 2DEAA 1XIXA 5H84A 1NSAA 1S7FA 4ONUA 2B4BA 5IB9A 5AG4A 1ZLHA 4JJXA 2ZENA 4A95A 4IAVA 2JBJA 3D68A 4BINA 2B4DA 3IWWA 4XPKA 3CXSA 5DS0A 3FXTA 2Q7SA 4KVXA 3TC8A 3RZAA 3G8WA 3JUWA 3KR5A 4JXQA 3S6GA 3SJXA 3TO7A 2VZZA 2Q4ZA 1IB1E 2OZHA 4UFXA 3WC5A 2PSWA 5LRGA 4R87A 4FBEA 4Y49C 2YNCC 4A31A 5JM6A 1CPXA 4C2YA 1LRZA 2HB6A 2V8HA 3RBUA 1S7KA 3JVNA 1Y0RA 4ZI6A 5F09A 3D7FA 3BI1A 4NFRA 4PXDA 3T9YA 4R76A 2FXFA 2R8VA 2Q0YA 2AE6A 3K9TA 3C26A 2CTBA 4CAXA 4KZTA 5EMIA 4HNXB 5IB0A 2FS5A 4B12A 2YNDA 2J8RA 4FD7A 3FRMA 3JRUA 2QIRA 1CP7A 1WWZA 3CPAA 1I1DA 3PZJA 4KLWA 1AYEA 1BPMA 5DWMA 2C6GA 1YR0A 3S6HA 2P6GA 1M4GA 3H8GA 4HNYB 3T90A 2VI7A 2Z3MA 2NMTA 4AVAA 2ZEHA 1S3ZA 4KOTA 3IFEA 3NH4A 2HV2A 2AFUA 1VHSA 1XJOA 4AB7A 4CRYB 3FBUA 4P4IA 4A2ZA 2Z10A 3L2NA 4CGOA 4R3LA 5H86A 4UBRA 3D4UA 4DNCA 1GYTA 2B3UA 1LANA 3KR4A 5EBVA 1IIDA 4NGSA 3VARA 5KTAA 2Z3KA 2HQYA 3BJ7A 1ZG8A 1KZFA 4UWJA 2ZOGA 3A9LA 1YGHA 3KI9A 4B5PB 4M3SA 4MFJA 4H2KA 3FEDA 2CIJA 3SXOA 2GFQA 3JTKA 2YGWA 3GYAA 2ARHA 2ZW4A 2PDOA 5KTDA 1H8LA 4ZY2A 4KVME 2EWBA 3H8FA 4OC4A 1IOFA 3CZXA 1XRYA 1OZPA 5KTCA 3SJGA 2EVNA 4OAEA 2Z3PA 2ZEPA 1XF8A 3TOBA 4MFQA 4KLVA 4ZGYB 3LWUA 2PJ0A 1J4JA 4ZY1A 1KWMA 3V7ZA 3VWEA 4B5PA 2RFHA 4OC1A 1RXTA 1Z4EA 4QBJA 1UFHA 4CGNA 2V8VA 4B14A 3D8PA 4NGMA 1CJWA 1PU9A 1I12A 4OLLA 7CPAA 2J8MA 1Q2CA 1Y9KA 2AFOA 2RB7A 3FIXA 4UCMA 4P4JA 4ZX8A 2OZGA 3EC4A 4MJ8A 3KHXA 2FSRA 3D2PA 3B35A 2AFSA 3E0KA 1Z5RA 2D4OA 2V77A 2J9AA 2ZPAA 4HKFA 5JH9A 4B11A 4LQGA 4MHPA 1Z9UA 1ZLIA 1ZO0A 3R1KA 2Q7BA 3I9SA 3D7HA 3GLJA 2ZEFA 3GIUA 2ZW6A 3PGPA 4UIAA 3PB6X 4M6IA 1KUXA 2PJ4A 2VQYA 3HLPA 4Q38A 3KZWA 2Z3NA 3BHXA 4R57A 1A2ZA 2OOTA 4BD9A 5I4MA 1XMBA 2ZXVA 1PCAA 3WC6A 2VEZA 3D67A 1BO4A 4I49A 5J1QA 4Q36A 3R9FA 3TX8A 5AG5A 2H5MA 2EO8A 4CYNA 2DF5A 2RC4A 1IY7A 3W6XA 1V0CA 5LYFA 2JEWA 3B2YA 1F2OA 3FF3A 2GU2A 3F0AA 3IC1A 3WC7A 2WPWA 4OC5A 2J8NA 3F5BA 1CPSA 5THWA 3WT4A 4E8OA 5GCNA 3TE4A 3SJFA 5D29A 1YW6A 4WJBA 4CAEA 1HDUA 3D3SA 3NFZA 2CXAA 3DDDA 3S9MA 8CPAA 4HNWB 4UWIA 1TKJA 3GKRA 4C68A 4GXHA 4A39A 2AFXA 2C27A 3CT9A 4P6YA 5I0CA 3S9LA 3KHZA 1YVKA 4X2TA 4QB9A 2QVPA 2FT0A 2Q51A 4FD5A 1ARMA 1Z8TA 4UIBA 3CXPA 4CGLA 2BCOA 3DR6A 4OKOA 2G3AA 4MI4A 2C6PA 5JGFA 2AJ6A 4NEXA 1Z8LA 1IU8A 4B13A 1XFOA 1YLOA 1B87A 2ABZA 4KOYA 4CGPA 1JWQA 1YLEA 4FD4A 5AG7A 5LRKA 1CG2A 1Y9WA 1YVOA 4K30A 4NGPA 5K8MA 3GUXA 2VBQA 3IGRA 2O4HA 1VKCA 2XEGA 1L0CA 2ZW5A 4CS0B 4K3NA 4NF1A 4PK3A 4DYOA 1PYTB 3PFEA 4MFZA 4RN7A 4WWVA 3SI2A 1Y7RA 1IYKA 1Z8WA 3HUVA 1CP6A 4OMEA 3WR7A 1EE3P 2ANPA 3H5ZA 3N5FA 2Z3OA 4ZYQA 4CGMA 2FL4A 1U6MA 1KUVA 1P0HA 4PSWA 2PRQA 2I3CA 3BXMA 2HC9A 2JDDA 4UCPA 4MCSA 4Y49B 5K8PA 2WYRA 2CNSA 4X8IA 3ISZA 3QAYA 1M4DA 1DTDA 2VL1A 1S5KA 1IYLA 1OBRA 1YMEA 3B7IA 4FWUA 1YX0A 2Q43A 4MFKA 3EFAA 1IOIA 4JLYA 5K8OA 2XEFA 2Z0ZA 4KUBA 2ZEDA 4J3GA 3SI0A 2PVWA 2ZELA 2FCKA 4EMEA 4EVYA 1Z8XA 4YWYA 2PJ8A 4QC6A 5K8NA 3BI0A 2PVVA 2GIVA 1TF9A 1CM0A 2ATRA 3B3SA 4H89A 4A33A 3EXNA 4P10A 5D8NA 4CYPA 3IU1A 2WZNA 2YNCA 3G3SA 3KASA 1ELMP 1GHEA 4P4EA 1I21A 3N7ZA 3FJUA 3FYNA 2ZW7A 4MY3A 4CYQA 1NMTA 3PB8X 2V8GA 4UA3A 4PPZA 3S6FA 4JYWA 1AMPA 2F8HA 2ZEGA 3RNZA 1S7LA 2JBKA 3TO9A 4E0AA 4ZX9A 1FT7A 4RI1A 2POKA 3FX6A 1Z4RA 3TT2A 1CX8A 4TNUA 2BUEA 1TIQA 4MHZA 4OADA 5FVJA 1LFWA 2Y0MA 2Q04A 1VHOA 3MN8A 4XPDC 1BAVA 2G0BA 3RO0A 3VATA 3TFYA 2B58A 4JWPA 2R98A 4KOVA 4MCPA 2AFMA 2AFZA 5AGEA 5HVFA 3PBEA 1BOBA 1JQGA 4MBUA 2G9DA 2V8DA 4RS2A 1ZG7A 1SQHA 4R3KA 2ZEMA 3R95A 2PRBA 3LACA 4W9YA 5A28A 3NE8A 1XOVA 1YK3A 2Q44A 2R7HA 4GM5A 4GS4A 2JEVA 4YRHA 4XPDB 3MGDA 2BEIA 2EBJA 5HMNA 3LMSA 4PXCA 3V38A 1XEBA 2REFA 4H6ZA 4F0YA 5A27A 5LYLA 1VGYA 3B3CA 2JLMA 4IF5A 4LQ6A 4NGQA 2PR8A 1R57A 1X10A 4A37A 2QJ8A 3TCVA 1S60A 4AXVA 4NGRA 2G3TA 4XPLA 3D66A 5G21A 5C88A 3PEIA 2GLJA 3TTHA 2QYVA 1F57A 5ISVA 3PBBA 4BMHA 3VWDA 1MJ9A 3NH8A 1M44A 4YGOA 3CXQA 2P0WA 1TKFA 5ELYA 4OC3A 2B3VA 4FUUA 3OWCA 4QVTA 2DPSA 4PQAA 3R9GA 3TOAA 4UF4A 1ARLA 4L8AA 3V8IA 4QUSA 4FAIA 1BPNA 1LCPA 2JDCA 4R7MA 3RYOA 4KS9A 3P2HA 3TO6A 4KSFA 1ZG9A 1QSRA 3B3VA 4MHDA 4MXUA 5EC4A 3SJEA 1XE4A 2DPTA 5G20A 3PFOA 4KSAA 1ON0A 4A30A 3BJ8A 4PV6A 3FNCA 4F9UA 1LOKA 2EK8A 4P4BA 2AFWA 4OC0A 3FB3A 4C7IA 3LODA 4A38A 2BSWA 4F6AA 5CNPA 1Q2DA 3R9EA 1MK4A 2CNMA 2PJ3A 4NSQA 4PSXA 2XEJA 4C2XA 4ONWA 4PXEA 1LAMA 3W6SA 6CPAA 3ZJ0A 1YQEA 4CAVA 1TF8A 4C2ZA 2DXQA 1R3NA 2I79A 3FVLA 4R8FA 4XNHC 1F2PA 3SHPA 4MCRA 1HEEA 4P45A 1ELLP 3D7DA 1YW4A 4AVCA 1CBXA 4CPAA 3RAMA 4IHMA 2QECA 4MHYA 4H6UA 1S7NA 4PK2A 3EY5A 3FH4A 1FY7A 2PQ8A 3WABA 3IO1A 2FIAA 3PB9X 5HXDA 2Q4YA 4MFPA 5LYDA 4C7HA 3K2KA 3KL9A 4JZ0A 3R96A 1Q2YA 4F8ZA 2PCUA 1K4JA 4DUKA 4XNHB 4KVOE 4NXYA 4O23A 5F48A 2REEA 1QSTA 2X7BA 3I3GA 4NJRA 4MRIA 1QSMA 3IIBA 4OIWA 4M85A 2Z3LA 4UCNA 5F46A 2WUUA 3UY5A 1RO5A 2GE3A 1TXRA 2IQ6A 3FMCA 2IJZA 5AG6A 2CTCA 4P44A 2GANA 5LYIA 5E96A 2C6CA 2QMLA 2IL4A 2PJCA 1YSJA 5F47A 4UEZA 2BO9A 2PIYA 1XMTA 3PB7X 2BL1A 2CF4A 1R43A 2GREA 3PP9A 4CAWA 3T8WA 1Z2LA 4KOUA 4LUAA 3D7GA 3IEHA 4KOXA 2EUIA 1P4NA 4JD6A 4UEFA 3QNVA 4MY0A 4OC2A 3CDXA 1M1DA 3EO4A 2FIWA 2HUZA 4P4FA 4G1PA 1QSOA 1QSNA
chains in the Genus database with same CATH topology
5HH1A 2A4NA 4UFWA 1KUYA 4NCZA 2YNEA 3DR8A 5DWNA 2K5TA 2CY2A 5JQ4A 4UFVA 1NE9A 5J8CA 4AG9A 3IU2A 4LX9A 3LD2A 2VXKA 3ZZIA 3W91A 4U9YA 4F0XA 3DSBA 4U9ZA 3SXNA 3DNSA 4JXRA 5BWAB 2OB0A 4X5KA 4A32A 5F49A 4II9A 5G22A 3QB8A 3KKWA 4B5OA 5J8FA 1MJAA 2KCWA 4R9MA 2O28A 1B6BA 2WSAA 4KORA 4U5YA 3D2MA 2P6EA 3H4QA 1IICA 4ZBGA 2VZYA 5IV0A 2PC1A 4KOWA 2FE7A 4IUSA 2D4PA 3BLNA 2I00A 4CAFA 2OU2A 4AG7A 4FD6A 1PUAA 3P2FA 4YFJA 3K9UA 2WPXA 4KOSA 5JPHA 5C82A 3F8KA 2Q4VA 4CYOA 2PR1A 1MJBA 1NSLA 3QAHA 5G1ZA 1WK4A 4CRZB 4AVBA 4B10A 3B8GA 3NE7A 2P6FA 2OH1A 2B5GB 3IWGA 4BBHA 2Z11A 2OZUA 4KUAA 1M4IA 1YREA 1N71A 2B4DB 3IWEA 3S6KA 2CNTA 4L89A 2F5IA 3GY9A 4ORFA 4E2AA 5IX3A 4MFLA 2R1IA 2B5GA 1XIXA 5H84A 1S7FA 4ONUA 2B4BA 5AG4A 4JJXA 4A95A 2B4DA 4XPKA 3CXSA 3FXTA 4KVXA 3G8WA 3JUWA 3S6GA 4JXQA 3TO7A 2VZZA 1IB1E 2OZHA 4UFXA 2PSWA 4R87A 4Y49C 2YNCC 4A31A 4C2YA 1LRZA 1S7KA 3JVNA 3T9YA 2FXFA 2R8VA 2Q0YA 2AE6A 4CAXA 3C26A 5KTDA 5IB0A 4KZTA 4HNXB 2FS5A 4B12A 2YNDA 2J8RA 4FD7A 3FRMA 2QIRA 1WWZA 1I1DA 3PZJA 4KLWA 5DWMA 1YR0A 3S6HA 2P6GA 1M4GA 4HNYB 3T90A 2VI7A 2Z3MA 2NMTA 4AVAA 4KOTA 1S3ZA 2HV2A 1VHSA 4CRYB 4AB7A 3FBUA 4A2ZA 2Z10A 4CGOA 4R3LA 5H86A 4UBRA 4DNCA 2B3UA 5EBVA 1IIDA 5KTAA 2Z3KA 2HQYA 3BJ7A 1KZFA 4UWJA 3A9LA 1YGHA 4B5PB 4M3SA 4MFJA 3SXOA 3JTKA 2YGWA 3GYAA 2ARHA 2ZW4A 2PDOA 4KVME 1OZPA 5KTCA 2EVNA 4OAEA 2Z3PA 1XF8A 3TOBA 4MFQA 4KLVA 4ZGYB 1J4JA 3VWEA 4B5PA 1RXTA 1Z4EA 4QBJA 1UFHA 4CGNA 4B14A 3D8PA 1CJWA 1PU9A 1I12A 4OLLA 1Q2CA 1Y9KA 2J8MA 3FIXA 4UCMA 2OZGA 3EC4A 4MJ8A 2FSRA 3D2PA 3E0KA 2D4OA 2ZPAA 4HKFA 4B11A 1Z9UA 1ZO0A 3R1KA 2Q7BA 3I9SA 2ZW6A 3PGPA 1KUXA 4R57A 2VQYA 4Q38A 2Z3NA 2ZXVA 2VEZA 1BO4A 4I49A 4Q36A 3R9FA 5AG5A 2H5MA 4CYNA 2RC4A 3W6XA 1V0CA 3F0AA 2WPWA 2J8NA 3F5BA 4E8OA 5GCNA 3TE4A 4CAEA 3D3SA 2CXAA 3DDDA 4HNWB 4UWIA 3GKRA 4C68A 2C27A 5I0CA 1YVKA 4QB9A 2FT0A 4FD5A 3CXPA 4CGLA 3DR6A 2G3AA 4MI4A 2AJ6A 4NEXA 4B13A 4CGPA 1B87A 4KOYA 1YLEA 4FD4A 5AG7A 1Y9WA 1YVOA 4K30A 3IGRA 2VBQA 1VKCA 1L0CA 2ZW5A 4CS0B 4NF1A 4PK3A 4MFZA 1Y7RA 1IYKA 3WR7A 3H5ZA 2Z3OA 4CGMA 2FL4A 1U6MA 1KUVA 1P0HA 4PSWA 2JDDA 4UCPA 4Y49B 2CNSA 1M4DA 1S5KA 1IYLA 1YX0A 4MFKA 3EFAA 4JLYA 2Z0ZA 4KUBA 4J3GA 4EVYA 2FCKA 4QC6A 2GIVA 4H89A 1CM0A 2ATRA 4A33A 3EXNA 4CYPA 3IU1A 2YNCA 3G3SA 1GHEA 1I21A 3N7ZA 3FYNA 2ZW7A 4MY3A 4CYQA 1NMTA 4UA3A 3S6FA 1S7LA 3TO9A 4E0AA 4RI1A 1Z4RA 3TT2A 2BUEA 1TIQA 4OADA 5FVJA 2Y0MA 2Q04A 4XPDC 3TFYA 2G0BA 2B58A 4JWPA 2R98A 4KOVA 5AGEA 1BOBA 4MBUA 4RS2A 1SQHA 4R3KA 3R95A 2PRBA 5A28A 1YK3A 4GS4A 2Q44A 2R7HA 2JEVA 4YRHA 4XPDB 3MGDA 2BEIA 5HMNA 4F0YA 1XEBA 2REFA 4H6ZA 5A27A 2JLMA 4IF5A 2PR8A 1R57A 3TCVA 1S60A 2G3TA 4XPLA 5G21A 5C88A 3TTHA 5ISVA 4BMHA 3VWDA 1MJ9A 1M44A 4YGOA 3CXQA 2P0WA 2B3VA 3OWCA 4QVTA 2DPSA 3R9GA 3TOAA 4L8AA 3V8IA 4QUSA 2JDCA 3RYOA 4KS9A 3P2HA 3TO6A 4KSFA 1QSRA 4MHDA 5EC4A 1XE4A 2DPTA 5G20A 4KSAA 4A30A 1ON0A 3BJ8A 4PV6A 3FNCA 3FB3A 4C7IA 3LODA 4F6AA 2BSWA 5CNPA 1Q2DA 3R9EA 1MK4A 2CNMA 4NSQA 4PSXA 4C2XA 3W6SA 3ZJ0A 4CAVA 4C2ZA 2DXQA 2I79A 4XNHC 3SHPA 4AVCA 2QECA 4H6UA 1S7NA 4PK2A 3EY5A 1FY7A 2PQ8A 2FIAA 2Q4YA 4MFPA 4C7HA 3R96A 1Q2YA 1K4JA 4XNHB 4KVOE 4NXYA 5F48A 2REEA 1QSTA 2X7BA 3I3GA 1QSMA 4M85A 2Z3LA 4UCNA 5F46A 2WUUA 3UY5A 1RO5A 2GE3A 5AG6A 2GANA 5E96A 2QMLA 2IL4A 5F47A 4CAWA 1XMTA 3PP9A 2BL1A 4KOUA 4LUAA 4KOXA 2EUIA 1P4NA 4JD6A 4MY0A 1M1DA 3EO4A 2FIWA 2HUZA 1QSOA 1QSNA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5HH1 A;  2A4N A;  1KUY A;  4NCZ A;  3DR8 A;  5DWN A;  2K5T A;  2CY2 A;  5JQ4 A;  1NE9 A;  5J8C A;  4AG9 A;  4LX9 A;  3LD2 A;  2VXK A;  3ZZI A;  3W91 A;  4U9Y A;  3DSB A;  4U9Z A;  3SXN A;  3DNS A;  4JXR A;  2OB0 A;  4X5K A;  5F49 A;  4II9 A;  3QB8 A;  3KKW A;  4B5O A;  5J8F A;  1MJA A;  2KCW A;  4R9M A;  2O28 A;  1B6B A;  4KOR A;  4U5Y A;  3D2M A;  2P6E A;  3H4Q A;  1IIC A;  4ZBG A;  2VZY A;  5IV0 A;  2PC1 A;  4KOW A;  2FE7 A;  4IUS A;  2D4P A;  3BLN A;  2I00 A;  2OU2 A;  4AG7 A;  4FD6 A;  1PUA A;  3P2F A;  4YFJ A;  3K9U A;  2WPX A;  4KOS A;  5JPH A;  5C82 A;  3F8K A;  2Q4V A;  2PR1 A;  1MJB A;  1NSL A;  3QAH A;  1WK4 A;  4CRZ B;  4AVB A;  3B8G A;  3NE7 A;  2P6F A;  2OH1 A;  2B5G B;  3IWG A;  2Z11 A;  2OZU A;  4KUA A;  1M4I A;  1YRE A;  1N71 A;  2B4D B;  3S6K A;  2CNT A;  4L89 A;  2F5I A;  3GY9 A;  4ORF A;  4E2A A;  5IX3 A;  2R1I A;  2B5G A;  1XIX A;  5H84 A;  1S7F A;  4ONU A;  2B4B A;  4JJX A;  2B4D A;  4XPK A;  3CXS A;  3FXT A;  4KVX A;  3G8W A;  3JUW A;  3S6G A;  4JXQ A;  3TO7 A;  2VZZ A;  1IB1 E;  2OZH A;  2PSW A;  4R87 A;  4Y49 C;  1LRZ A;  1S7K A;  3JVN A;  3T9Y A;  2FXF A;  2R8V A;  2Q0Y A;  2AE6 A;  4CAX A;  3C26 A;  5KTD A;  5IB0 A;  4KZT A;  4HNX B;  2FS5 A;  2J8R A;  4FD7 A;  3FRM A;  2QIR A;  1WWZ A;  1I1D A;  3PZJ A;  4KLW A;  5DWM A;  1YR0 A;  3S6H A;  2P6G A;  1M4G A;  4HNY B;  3T90 A;  2VI7 A;  2NMT A;  4AVA A;  4KOT A;  1S3Z A;  2HV2 A;  1VHS A;  4CRY B;  4AB7 A;  3FBU A;  2Z10 A;  4R3L A;  5H86 A;  4UBR A;  4DNC A;  2B3U A;  5EBV A;  1IID A;  5KTA A;  2HQY A;  3BJ7 A;  1KZF A;  4UWJ A;  1YGH A;  4B5P B;  4M3S A;  3SXO A;  3GYA A;  2ARH A;  2ZW4 A;  2PDO A;  4KVM E;  1OZP A;  5KTC A;  2EVN A;  4OAE A;  1XF8 A;  3TOB A;  4KLV A;  1J4J A;  3VWE A;  4B5P A;  1RXT A;  1Z4E A;  4QBJ A;  1UFH A;  3D8P A;  1CJW A;  1PU9 A;  1I12 A;  4OLL A;  1Q2C A;  1Y9K A;  2J8M A;  3FIX A;  2OZG A;  3EC4 A;  4MJ8 A;  2FSR A;  3D2P A;  3E0K A;  2D4O A;  2ZPA A;  4HKF A;  1Z9U A;  3R1K A;  2Q7B A;  3I9S A;  2ZW6 A;  3PGP A;  1KUX A;  4R57 A;  2VQY A;  2ZXV A;  2VEZ A;  1BO4 A;  4I49 A;  3R9F A;  2H5M A;  2RC4 A;  3W6X A;  1V0C A;  3F0A A;  2WPW A;  2J8N A;  3F5B A;  4E8O A;  5GCN A;  3TE4 A;  3D3S A;  3DDD A;  4HNW B;  4UWI A;  3GKR A;  2C27 A;  5I0C A;  1YVK A;  4QB9 A;  2FT0 A;  4FD5 A;  3CXP A;  3DR6 A;  2G3A A;  4MI4 A;  2AJ6 A;  4NEX A;  1B87 A;  4KOY A;  1YLE A;  4FD4 A;  1Y9W A;  1YVO A;  4K30 A;  3IGR A;  2VBQ A;  1VKC A;  1L0C A;  2ZW5 A;  4CS0 B;  4NF1 A;  4PK3 A;  1Y7R A;  1IYK A;  3WR7 A;  2FL4 A;  1U6M A;  1KUV A;  1P0H A;  4PSW A;  2JDD A;  4Y49 B;  2CNS A;  1M4D A;  1S5K A;  1IYL A;  1YX0 A;  3EFA A;  4JLY A;  2Z0Z A;  4KUB A;  4J3G A;  4EVY A;  2FCK A;  4QC6 A;  2GIV A;  4H89 A;  1CM0 A;  2ATR A;  3EXN A;  3G3S A;  1GHE A;  1I21 A;  3N7Z A;  3FYN A;  2ZW7 A;  4MY3 A;  1NMT A;  4UA3 A;  3S6F A;  1S7L A;  3TO9 A;  4E0A A;  4RI1 A;  1Z4R A;  3TT2 A;  2BUE A;  1TIQ A;  4OAD A;  5FVJ A;  2Y0M A;  2Q04 A;  4XPD C;  3TFY A;  2G0B A;  2B58 A;  4JWP A;  2R98 A;  4KOV A;  1BOB A;  4MBU A;  4RS2 A;  1SQH A;  4R3K A;  3R95 A;  2PRB A;  1YK3 A;  4GS4 A;  2Q44 A;  2R7H A;  2JEV A;  4YRH A;  4XPD B;  3MGD A;  2BEI A;  5HMN A;  4F0Y A;  1XEB A;  2REF A;  4H6Z A;  2JLM A;  4IF5 A;  2PR8 A;  1R57 A;  3TCV A;  1S60 A;  2G3T A;  4XPL A;  5C88 A;  3TTH A;  5ISV A;  4BMH A;  3VWD A;  1MJ9 A;  1M44 A;  4YGO A;  3CXQ A;  2P0W A;  2B3V A;  3OWC A;  4QVT A;  3R9G A;  3TOA A;  4L8A A;  3V8I A;  4QUS A;  2JDC A;  3RYO A;  3P2H A;  3TO6 A;  1QSR A;  4MHD A;  5EC4 A;  1XE4 A;  1ON0 A;  3BJ8 A;  4PV6 A;  3FNC A;  3FB3 A;  3LOD A;  4F6A A;  2BSW A;  5CNP A;  1Q2D A;  3R9E A;  1MK4 A;  2CNM A;  4NSQ A;  4PSX A;  3W6S A;  3ZJ0 A;  4CAV A;  2DXQ A;  2I79 A;  4XNH C;  3SHP A;  4AVC A;  2QEC A;  4H6U A;  1S7N A;  4PK2 A;  3EY5 A;  1FY7 A;  2PQ8 A;  2FIA A;  2Q4Y A;  3R96 A;  1Q2Y A;  1K4J A;  4XNH B;  4KVO E;  4NXY A;  5F48 A;  2REE A;  1QST A;  2X7B A;  3I3G A;  1QSM A;  4M85 A;  5F46 A;  3UY5 A;  1RO5 A;  2GE3 A;  2GAN A;  5E96 A;  2QML A;  2IL4 A;  5F47 A;  4CAW A;  1XMT A;  3PP9 A;  2BL1 A;  4KOU A;  4LUA A;  4KOX A;  2EUI A;  1P4N A;  4JD6 A;  4MY0 A;  1M1D A;  3EO4 A;  2FIW A;  2HUZ A;  1QSO A;  1QSN A; 
#chains in the Genus database with same CATH topology
 5HH1 A;  2A4N A;  4UFW A;  1KUY A;  1VHE A;  3NH5 A;  4R6T A;  4Q7A A;  4NCZ A;  1BLL E;  1VIX A;  4KSI A;  5HVH A;  2PJB A;  2IMO A;  2YNE A;  3DR8 A;  2PE3 A;  3PRT A;  5DWN A;  2K5T A;  4NGT A;  4EWT A;  2CY2 A;  3B3T A;  5JQ4 A;  4UFV A;  5LRJ A;  1NE9 A;  4Z65 A;  3KQX A;  2ODF A;  5J8C A;  1IGB A;  4PXB A;  1X12 A;  4AG9 A;  3FEE A;  3IU2 A;  2NSM A;  3KGQ A;  4LX9 A;  3LD2 A;  1QQ9 A;  2VXK A;  3KQZ A;  1QMU A;  5CBM A;  3ZZI A;  3W91 A;  2PJ5 A;  3I1U A;  3H8E A;  3FEC A;  4U9Y A;  2PJ2 A;  4EFD A;  3DSB A;  4F0X A;  4U9Z A;  3SXN A;  1DE4 C;  3DNS A;  4JXR A;  4DJL A;  5BWA B;  2OB0 A;  4X5K A;  3VH9 A;  4A32 A;  4MMO A;  5F49 A;  2PJ6 A;  1UWY A;  4II9 A;  5G22 A;  2PJ9 A;  1Q7L A;  4F9V A;  4NJQ A;  3QB8 A;  3KKW A;  4MCQ A;  4P4D A;  4ZY0 A;  4B5O A;  5J8F A;  4IK2 A;  1MJA A;  3ISX A;  2KCW A;  2ZEE A;  4R9M A;  3GB0 A;  2O28 A;  1B6B A;  2WSA A;  2ZOF A;  4KOR A;  4B6Z A;  4U5Y A;  3D2M A;  2P6E A;  2FVG A;  3H4Q A;  1IIC A;  2C1C A;  2NYQ A;  4ZBG A;  2VZY A;  4OID A;  5IV0 A;  2PC1 A;  4KOW A;  2FE7 A;  2O53 A;  4HPS A;  4IUS A;  2PJ1 A;  2PJA A;  1TKH A;  4M6G A;  4RUH A;  1LAP A;  2D4P A;  4UEE A;  3S9N A;  3BLN A;  2I00 A;  4CAF A;  1HDQ A;  2XEI A;  2ZEO A;  4X3R A;  2OU2 A;  3B3W A;  1Y0Y A;  4AG7 A;  4FD6 A;  1PUA A;  3P2F A;  2GLF A;  1RTQ A;  1AUG A;  4YFJ A;  3K9U A;  2WPX A;  4KOS A;  5JPH A;  2BOA A;  2PIZ A;  3F8K A;  5C82 A;  2Q4V A;  4A94 A;  2PR1 A;  1MJB A;  4CYO A;  3DLJ A;  4YU9 A;  1NSL A;  3QAH A;  5G1Z A;  1WK4 A;  2F7V A;  4CRZ B;  2PJ7 A;  4AVB A;  4TWE A;  1Y7E A;  4B10 A;  3B8G A;  3NE7 A;  2P6F A;  2OH1 A;  4NGN A;  3SI1 A;  2B5G B;  3MRU A;  3IJ3 A;  3IWG A;  4OP4 A;  4BBH A;  3CPX A;  2Z11 A;  2OZU A;  1M4L A;  3DGV A;  4KUA A;  5HVG A;  1M4I A;  5CPA A;  1YRE A;  1N71 A;  1XBU A;  2B4D B;  4MHN A;  3IWE A;  3S6K A;  2CNT A;  4M6H A;  3NA6 A;  1FNO A;  4L89 A;  2EK9 A;  2F5I A;  2OR4 A;  3PB4 X;  3GY9 A;  4ORF A;  4E2A A;  5IX3 A;  4MFL A;  2R1I A;  2B5G A;  2DEA A;  1XIX A;  5H84 A;  1NSA A;  1S7F A;  4ONU A;  2B4B A;  5IB9 A;  5AG4 A;  1ZLH A;  4JJX A;  2ZEN A;  4A95 A;  4IAV A;  2JBJ A;  3D68 A;  4BIN A;  2B4D A;  3IWW A;  4XPK A;  3CXS A;  5DS0 A;  3FXT A;  2Q7S A;  4KVX A;  3TC8 A;  3RZA A;  3G8W A;  3JUW A;  3KR5 A;  4JXQ A;  3S6G A;  3SJX A;  3TO7 A;  2VZZ A;  2Q4Z A;  1IB1 E;  2OZH A;  4UFX A;  3WC5 A;  2PSW A;  5LRG A;  4R87 A;  4FBE A;  4Y49 C;  2YNC C;  4A31 A;  5JM6 A;  1CPX A;  4C2Y A;  1LRZ A;  2HB6 A;  2V8H A;  3RBU A;  1S7K A;  3JVN A;  1Y0R A;  4ZI6 A;  5F09 A;  3D7F A;  3BI1 A;  4NFR A;  4PXD A;  3T9Y A;  4R76 A;  2FXF A;  2R8V A;  2Q0Y A;  2AE6 A;  3K9T A;  3C26 A;  2CTB A;  4CAX A;  4KZT A;  5EMI A;  4HNX B;  5IB0 A;  2FS5 A;  4B12 A;  2YND A;  2J8R A;  4FD7 A;  3FRM A;  3JRU A;  2QIR A;  1CP7 A;  1WWZ A;  3CPA A;  1I1D A;  3PZJ A;  4KLW A;  1AYE A;  1BPM A;  5DWM A;  2C6G A;  1YR0 A;  3S6H A;  2P6G A;  1M4G A;  3H8G A;  4HNY B;  3T90 A;  2VI7 A;  2Z3M A;  2NMT A;  4AVA A;  2ZEH A;  1S3Z A;  4KOT A;  3IFE A;  3NH4 A;  2HV2 A;  2AFU A;  1VHS A;  1XJO A;  4AB7 A;  4CRY B;  3FBU A;  4P4I A;  4A2Z A;  2Z10 A;  3L2N A;  4CGO A;  4R3L A;  5H86 A;  4UBR A;  3D4U A;  4DNC A;  1GYT A;  2B3U A;  1LAN A;  3KR4 A;  5EBV A;  1IID A;  4NGS A;  3VAR A;  5KTA A;  2Z3K A;  2HQY A;  3BJ7 A;  1ZG8 A;  1KZF A;  4UWJ A;  2ZOG A;  3A9L A;  1YGH A;  3KI9 A;  4B5P B;  4M3S A;  4MFJ A;  4H2K A;  3FED A;  2CIJ A;  3SXO A;  2GFQ A;  3JTK A;  2YGW A;  3GYA A;  2ARH A;  2ZW4 A;  2PDO A;  5KTD A;  1H8L A;  4ZY2 A;  4KVM E;  2EWB A;  3H8F A;  4OC4 A;  1IOF A;  3CZX A;  1XRY A;  1OZP A;  5KTC A;  3SJG A;  2EVN A;  4OAE A;  2Z3P A;  2ZEP A;  1XF8 A;  3TOB A;  4MFQ A;  4KLV A;  4ZGY B;  3LWU A;  2PJ0 A;  1J4J A;  4ZY1 A;  1KWM A;  3V7Z A;  3VWE A;  4B5P A;  2RFH A;  4OC1 A;  1RXT A;  1Z4E A;  4QBJ A;  1UFH A;  4CGN A;  2V8V A;  4B14 A;  3D8P A;  4NGM A;  1CJW A;  1PU9 A;  1I12 A;  4OLL A;  7CPA A;  2J8M A;  1Q2C A;  1Y9K A;  2AFO A;  2RB7 A;  3FIX A;  4UCM A;  4P4J A;  4ZX8 A;  2OZG A;  3EC4 A;  4MJ8 A;  3KHX A;  2FSR A;  3D2P A;  3B35 A;  2AFS A;  3E0K A;  1Z5R A;  2D4O A;  2V77 A;  2J9A A;  2ZPA A;  4HKF A;  5JH9 A;  4B11 A;  4LQG A;  4MHP A;  1Z9U A;  1ZLI A;  1ZO0 A;  3R1K A;  2Q7B A;  3I9S A;  3D7H A;  3GLJ A;  2ZEF A;  3GIU A;  2ZW6 A;  3PGP A;  4UIA A;  3PB6 X;  4M6I A;  1KUX A;  2PJ4 A;  2VQY A;  3HLP A;  4Q38 A;  3KZW A;  2Z3N A;  3BHX A;  4R57 A;  1A2Z A;  2OOT A;  4BD9 A;  5I4M A;  1XMB A;  2ZXV A;  1PCA A;  3WC6 A;  2VEZ A;  3D67 A;  1BO4 A;  4I49 A;  5J1Q A;  4Q36 A;  3R9F A;  3TX8 A;  5AG5 A;  2H5M A;  2EO8 A;  4CYN A;  2DF5 A;  2RC4 A;  1IY7 A;  3W6X A;  1V0C A;  5LYF A;  2JEW A;  3B2Y A;  1F2O A;  3FF3 A;  2GU2 A;  3F0A A;  3IC1 A;  3WC7 A;  2WPW A;  4OC5 A;  2J8N A;  3F5B A;  1CPS A;  5THW A;  3WT4 A;  4E8O A;  5GCN A;  3TE4 A;  3SJF A;  5D29 A;  1YW6 A;  4WJB A;  4CAE A;  1HDU A;  3D3S A;  3NFZ A;  2CXA A;  3DDD A;  3S9M A;  8CPA A;  4HNW B;  4UWI A;  1TKJ A;  3GKR A;  4C68 A;  4GXH A;  4A39 A;  2AFX A;  2C27 A;  3CT9 A;  4P6Y A;  5I0C A;  3S9L A;  3KHZ A;  1YVK A;  4X2T A;  4QB9 A;  2QVP A;  2FT0 A;  2Q51 A;  4FD5 A;  1ARM A;  1Z8T A;  4UIB A;  3CXP A;  4CGL A;  2BCO A;  3DR6 A;  4OKO A;  2G3A A;  4MI4 A;  2C6P A;  5JGF A;  2AJ6 A;  4NEX A;  1Z8L A;  1IU8 A;  4B13 A;  1XFO A;  1YLO A;  1B87 A;  2ABZ A;  4KOY A;  4CGP A;  1JWQ A;  1YLE A;  4FD4 A;  5AG7 A;  5LRK A;  1CG2 A;  1Y9W A;  1YVO A;  4K30 A;  4NGP A;  5K8M A;  3GUX A;  2VBQ A;  3IGR A;  2O4H A;  1VKC A;  2XEG A;  1L0C A;  2ZW5 A;  4CS0 B;  4K3N A;  4NF1 A;  4PK3 A;  4DYO A;  1PYT B;  3PFE A;  4MFZ A;  4RN7 A;  4WWV A;  3SI2 A;  1Y7R A;  1IYK A;  1Z8W A;  3HUV A;  1CP6 A;  4OME A;  3WR7 A;  1EE3 P;  2ANP A;  3H5Z A;  3N5F A;  2Z3O A;  4ZYQ A;  4CGM A;  2FL4 A;  1U6M A;  1KUV A;  1P0H A;  4PSW A;  2PRQ A;  2I3C A;  3BXM A;  2HC9 A;  2JDD A;  4UCP A;  4MCS A;  4Y49 B;  5K8P A;  2WYR A;  2CNS A;  4X8I A;  3ISZ A;  3QAY A;  1M4D A;  1DTD A;  2VL1 A;  1S5K A;  1IYL A;  1OBR A;  1YME A;  3B7I A;  4FWU A;  1YX0 A;  2Q43 A;  4MFK A;  3EFA A;  1IOI A;  4JLY A;  5K8O A;  2XEF A;  2Z0Z A;  4KUB A;  2ZED A;  4J3G A;  3SI0 A;  2PVW A;  2ZEL A;  2FCK A;  4EME A;  4EVY A;  1Z8X A;  4YWY A;  2PJ8 A;  4QC6 A;  5K8N A;  3BI0 A;  2PVV A;  2GIV A;  1TF9 A;  1CM0 A;  2ATR A;  3B3S A;  4H89 A;  4A33 A;  3EXN A;  4P10 A;  5D8N A;  4CYP A;  3IU1 A;  2WZN A;  2YNC A;  3G3S A;  3KAS A;  1ELM P;  1GHE A;  4P4E A;  1I21 A;  3N7Z A;  3FJU A;  3FYN A;  2ZW7 A;  4MY3 A;  4CYQ A;  1NMT A;  3PB8 X;  2V8G A;  4UA3 A;  4PPZ A;  3S6F A;  4JYW A;  1AMP A;  2F8H A;  2ZEG A;  3RNZ A;  1S7L A;  2JBK A;  3TO9 A;  4E0A A;  4ZX9 A;  1FT7 A;  4RI1 A;  2POK A;  3FX6 A;  1Z4R A;  3TT2 A;  1CX8 A;  4TNU A;  2BUE A;  1TIQ A;  4MHZ A;  4OAD A;  5FVJ A;  1LFW A;  2Y0M A;  2Q04 A;  1VHO A;  3MN8 A;  4XPD C;  1BAV A;  2G0B A;  3RO0 A;  3VAT A;  3TFY A;  2B58 A;  4JWP A;  2R98 A;  4KOV A;  4MCP A;  2AFM A;  2AFZ A;  5AGE A;  5HVF A;  3PBE A;  1BOB A;  1JQG A;  4MBU A;  2G9D A;  2V8D A;  4RS2 A;  1ZG7 A;  1SQH A;  4R3K A;  2ZEM A;  3R95 A;  2PRB A;  3LAC A;  4W9Y A;  5A28 A;  3NE8 A;  1XOV A;  1YK3 A;  2Q44 A;  2R7H A;  4GM5 A;  4GS4 A;  2JEV A;  4YRH A;  4XPD B;  3MGD A;  2BEI A;  2EBJ A;  5HMN A;  3LMS A;  4PXC A;  3V38 A;  1XEB A;  2REF A;  4H6Z A;  4F0Y A;  5A27 A;  5LYL A;  1VGY A;  3B3C A;  2JLM A;  4IF5 A;  4LQ6 A;  4NGQ A;  2PR8 A;  1R57 A;  1X10 A;  4A37 A;  2QJ8 A;  3TCV A;  1S60 A;  4AXV A;  4NGR A;  2G3T A;  4XPL A;  3D66 A;  5G21 A;  5C88 A;  3PEI A;  2GLJ A;  3TTH A;  2QYV A;  1F57 A;  5ISV A;  3PBB A;  4BMH A;  3VWD A;  1MJ9 A;  3NH8 A;  1M44 A;  4YGO A;  3CXQ A;  2P0W A;  1TKF A;  5ELY A;  4OC3 A;  2B3V A;  4FUU A;  3OWC A;  4QVT A;  2DPS A;  4PQA A;  3R9G A;  3TOA A;  4UF4 A;  1ARL A;  4L8A A;  3V8I A;  4QUS A;  4FAI A;  1BPN A;  1LCP A;  2JDC A;  4R7M A;  3RYO A;  4KS9 A;  3P2H A;  3TO6 A;  4KSF A;  1ZG9 A;  1QSR A;  3B3V A;  4MHD A;  4MXU A;  5EC4 A;  3SJE A;  1XE4 A;  2DPT A;  5G20 A;  3PFO A;  4KSA A;  1ON0 A;  4A30 A;  3BJ8 A;  4PV6 A;  3FNC A;  4F9U A;  1LOK A;  2EK8 A;  4P4B A;  2AFW A;  4OC0 A;  3FB3 A;  4C7I A;  3LOD A;  4A38 A;  2BSW A;  4F6A A;  5CNP A;  1Q2D A;  3R9E A;  1MK4 A;  2CNM A;  2PJ3 A;  4NSQ A;  4PSX A;  2XEJ A;  4C2X A;  4ONW A;  4PXE A;  1LAM A;  3W6S A;  6CPA A;  3ZJ0 A;  1YQE A;  4CAV A;  1TF8 A;  4C2Z A;  2DXQ A;  1R3N A;  2I79 A;  3FVL A;  4R8F A;  4XNH C;  1F2P A;  3SHP A;  4MCR A;  1HEE A;  4P45 A;  1ELL P;  3D7D A;  1YW4 A;  4AVC A;  1CBX A;  4CPA A;  3RAM A;  4IHM A;  2QEC A;  4MHY A;  4H6U A;  1S7N A;  4PK2 A;  3EY5 A;  3FH4 A;  1FY7 A;  2PQ8 A;  3WAB A;  3IO1 A;  2FIA A;  3PB9 X;  5HXD A;  2Q4Y A;  4MFP A;  5LYD A;  4C7H A;  3K2K A;  3KL9 A;  4JZ0 A;  3R96 A;  1Q2Y A;  4F8Z A;  2PCU A;  1K4J A;  4DUK A;  4XNH B;  4KVO E;  4NXY A;  4O23 A;  5F48 A;  2REE A;  1QST A;  2X7B A;  3I3G A;  4NJR A;  4MRI A;  1QSM A;  3IIB A;  4OIW A;  4M85 A;  2Z3L A;  4UCN A;  5F46 A;  2WUU A;  3UY5 A;  1RO5 A;  2GE3 A;  1TXR A;  2IQ6 A;  3FMC A;  2IJZ A;  5AG6 A;  2CTC A;  4P44 A;  2GAN A;  5LYI A;  5E96 A;  2C6C A;  2QML A;  2IL4 A;  2PJC A;  1YSJ A;  5F47 A;  4UEZ A;  2BO9 A;  2PIY A;  1XMT A;  3PB7 X;  2BL1 A;  2CF4 A;  1R43 A;  2GRE A;  3PP9 A;  4CAW A;  3T8W A;  1Z2L A;  4KOU A;  4LUA A;  3D7G A;  3IEH A;  4KOX A;  2EUI A;  1P4N A;  4JD6 A;  4UEF A;  3QNV A;  4MY0 A;  4OC2 A;  3CDX A;  1M1D A;  3EO4 A;  2FIW A;  2HUZ A;  4P4F A;  4G1P A;  1QSO A;  1QSN A; 
#chains in the Genus database with same CATH homology
 5HH1 A;  2A4N A;  4UFW A;  1KUY A;  4NCZ A;  2YNE A;  3DR8 A;  5DWN A;  2K5T A;  2CY2 A;  5JQ4 A;  4UFV A;  1NE9 A;  5J8C A;  4AG9 A;  3IU2 A;  4LX9 A;  3LD2 A;  2VXK A;  3ZZI A;  3W91 A;  4U9Y A;  4F0X A;  3DSB A;  4U9Z A;  3SXN A;  3DNS A;  4JXR A;  5BWA B;  2OB0 A;  4X5K A;  4A32 A;  5F49 A;  4II9 A;  5G22 A;  3QB8 A;  3KKW A;  4B5O A;  5J8F A;  1MJA A;  2KCW A;  4R9M A;  2O28 A;  1B6B A;  2WSA A;  4KOR A;  4U5Y A;  3D2M A;  2P6E A;  3H4Q A;  1IIC A;  4ZBG A;  2VZY A;  5IV0 A;  2PC1 A;  4KOW A;  2FE7 A;  4IUS A;  2D4P A;  3BLN A;  2I00 A;  4CAF A;  2OU2 A;  4AG7 A;  4FD6 A;  1PUA A;  3P2F A;  4YFJ A;  3K9U A;  2WPX A;  4KOS A;  5JPH A;  5C82 A;  3F8K A;  2Q4V A;  4CYO A;  2PR1 A;  1MJB A;  1NSL A;  3QAH A;  5G1Z A;  1WK4 A;  4CRZ B;  4AVB A;  4B10 A;  3B8G A;  3NE7 A;  2P6F A;  2OH1 A;  2B5G B;  3IWG A;  4BBH A;  2Z11 A;  2OZU A;  4KUA A;  1M4I A;  1YRE A;  1N71 A;  2B4D B;  3IWE A;  3S6K A;  2CNT A;  4L89 A;  2F5I A;  3GY9 A;  4ORF A;  4E2A A;  5IX3 A;  4MFL A;  2R1I A;  2B5G A;  1XIX A;  5H84 A;  1S7F A;  4ONU A;  2B4B A;  5AG4 A;  4JJX A;  4A95 A;  2B4D A;  4XPK A;  3CXS A;  3FXT A;  4KVX A;  3G8W A;  3JUW A;  3S6G A;  4JXQ A;  3TO7 A;  2VZZ A;  1IB1 E;  2OZH A;  4UFX A;  2PSW A;  4R87 A;  4Y49 C;  2YNC C;  4A31 A;  4C2Y A;  1LRZ A;  1S7K A;  3JVN A;  3T9Y A;  2FXF A;  2R8V A;  2Q0Y A;  2AE6 A;  4CAX A;  3C26 A;  5KTD A;  5IB0 A;  4KZT A;  4HNX B;  2FS5 A;  4B12 A;  2YND A;  2J8R A;  4FD7 A;  3FRM A;  2QIR A;  1WWZ A;  1I1D A;  3PZJ A;  4KLW A;  5DWM A;  1YR0 A;  3S6H A;  2P6G A;  1M4G A;  4HNY B;  3T90 A;  2VI7 A;  2Z3M A;  2NMT A;  4AVA A;  4KOT A;  1S3Z A;  2HV2 A;  1VHS A;  4CRY B;  4AB7 A;  3FBU A;  4A2Z A;  2Z10 A;  4CGO A;  4R3L A;  5H86 A;  4UBR A;  4DNC A;  2B3U A;  5EBV A;  1IID A;  5KTA A;  2Z3K A;  2HQY A;  3BJ7 A;  1KZF A;  4UWJ A;  3A9L A;  1YGH A;  4B5P B;  4M3S A;  4MFJ A;  3SXO A;  3JTK A;  2YGW A;  3GYA A;  2ARH A;  2ZW4 A;  2PDO A;  4KVM E;  1OZP A;  5KTC A;  2EVN A;  4OAE A;  2Z3P A;  1XF8 A;  3TOB A;  4MFQ A;  4KLV A;  4ZGY B;  1J4J A;  3VWE A;  4B5P A;  1RXT A;  1Z4E A;  4QBJ A;  1UFH A;  4CGN A;  4B14 A;  3D8P A;  1CJW A;  1PU9 A;  1I12 A;  4OLL A;  1Q2C A;  1Y9K A;  2J8M A;  3FIX A;  4UCM A;  2OZG A;  3EC4 A;  4MJ8 A;  2FSR A;  3D2P A;  3E0K A;  2D4O A;  2ZPA A;  4HKF A;  4B11 A;  1Z9U A;  1ZO0 A;  3R1K A;  2Q7B A;  3I9S A;  2ZW6 A;  3PGP A;  1KUX A;  4R57 A;  2VQY A;  4Q38 A;  2Z3N A;  2ZXV A;  2VEZ A;  1BO4 A;  4I49 A;  4Q36 A;  3R9F A;  5AG5 A;  2H5M A;  4CYN A;  2RC4 A;  3W6X A;  1V0C A;  3F0A A;  2WPW A;  2J8N A;  3F5B A;  4E8O A;  5GCN A;  3TE4 A;  4CAE A;  3D3S A;  2CXA A;  3DDD A;  4HNW B;  4UWI A;  3GKR A;  4C68 A;  2C27 A;  5I0C A;  1YVK A;  4QB9 A;  2FT0 A;  4FD5 A;  3CXP A;  4CGL A;  3DR6 A;  2G3A A;  4MI4 A;  2AJ6 A;  4NEX A;  4B13 A;  4CGP A;  1B87 A;  4KOY A;  1YLE A;  4FD4 A;  5AG7 A;  1Y9W A;  1YVO A;  4K30 A;  3IGR A;  2VBQ A;  1VKC A;  1L0C A;  2ZW5 A;  4CS0 B;  4NF1 A;  4PK3 A;  4MFZ A;  1Y7R A;  1IYK A;  3WR7 A;  3H5Z A;  2Z3O A;  4CGM A;  2FL4 A;  1U6M A;  1KUV A;  1P0H A;  4PSW A;  2JDD A;  4UCP A;  4Y49 B;  2CNS A;  1M4D A;  1S5K A;  1IYL A;  1YX0 A;  4MFK A;  3EFA A;  4JLY A;  2Z0Z A;  4KUB A;  4J3G A;  4EVY A;  2FCK A;  4QC6 A;  2GIV A;  4H89 A;  1CM0 A;  2ATR A;  4A33 A;  3EXN A;  4CYP A;  3IU1 A;  2YNC A;  3G3S A;  1GHE A;  1I21 A;  3N7Z A;  3FYN A;  2ZW7 A;  4MY3 A;  4CYQ A;  1NMT A;  4UA3 A;  3S6F A;  1S7L A;  3TO9 A;  4E0A A;  4RI1 A;  1Z4R A;  3TT2 A;  2BUE A;  1TIQ A;  4OAD A;  5FVJ A;  2Y0M A;  2Q04 A;  4XPD C;  3TFY A;  2G0B A;  2B58 A;  4JWP A;  2R98 A;  4KOV A;  5AGE A;  1BOB A;  4MBU A;  4RS2 A;  1SQH A;  4R3K A;  3R95 A;  2PRB A;  5A28 A;  1YK3 A;  4GS4 A;  2Q44 A;  2R7H A;  2JEV A;  4YRH A;  4XPD B;  3MGD A;  2BEI A;  5HMN A;  4F0Y A;  1XEB A;  2REF A;  4H6Z A;  5A27 A;  2JLM A;  4IF5 A;  2PR8 A;  1R57 A;  3TCV A;  1S60 A;  2G3T A;  4XPL A;  5G21 A;  5C88 A;  3TTH A;  5ISV A;  4BMH A;  3VWD A;  1MJ9 A;  1M44 A;  4YGO A;  3CXQ A;  2P0W A;  2B3V A;  3OWC A;  4QVT A;  2DPS A;  3R9G A;  3TOA A;  4L8A A;  3V8I A;  4QUS A;  2JDC A;  3RYO A;  4KS9 A;  3P2H A;  3TO6 A;  4KSF A;  1QSR A;  4MHD A;  5EC4 A;  1XE4 A;  2DPT A;  5G20 A;  4KSA A;  4A30 A;  1ON0 A;  3BJ8 A;  4PV6 A;  3FNC A;  3FB3 A;  4C7I A;  3LOD A;  4F6A A;  2BSW A;  5CNP A;  1Q2D A;  3R9E A;  1MK4 A;  2CNM A;  4NSQ A;  4PSX A;  4C2X A;  3W6S A;  3ZJ0 A;  4CAV A;  4C2Z A;  2DXQ A;  2I79 A;  4XNH C;  3SHP A;  4AVC A;  2QEC A;  4H6U A;  1S7N A;  4PK2 A;  3EY5 A;  1FY7 A;  2PQ8 A;  2FIA A;  2Q4Y A;  4MFP A;  4C7H A;  3R96 A;  1Q2Y A;  1K4J A;  4XNH B;  4KVO E;  4NXY A;  5F48 A;  2REE A;  1QST A;  2X7B A;  3I3G A;  1QSM A;  4M85 A;  2Z3L A;  4UCN A;  5F46 A;  2WUU A;  3UY5 A;  1RO5 A;  2GE3 A;  5AG6 A;  2GAN A;  5E96 A;  2QML A;  2IL4 A;  5F47 A;  4CAW A;  1XMT A;  3PP9 A;  2BL1 A;  4KOU A;  4LUA A;  4KOX A;  2EUI A;  1P4N A;  4JD6 A;  4MY0 A;  1M1D A;  3EO4 A;  2FIW A;  2HUZ A;  1QSO A;  1QSN A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...