2A4NA

Crystal structure of aminoglycoside 6'-n-acetyltransferase complexed with coenzyme a
Total Genus 47
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
47
sequence length
180
structure length
180
Chain Sequence
MIISEFDRNNPVLKDQLSDLLRLTWPEEYGDSSAEEVEEMMNPERIAVAAVDQDELVGFIGAIPQYGITGWELHPLVVESSRRKNQIGTRLVNYLEKEVASRGGITIYLGTDDLDHGTTLSQTDLYEHTFDKVASIQNLREHPYEFYEKLGYKIVGVLPNANGWDKPDIWMAKTIIPRPD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords aac(6')-Ii
publication title Structures of aminoglycoside acetyltransferase AAC(6')-Ii in a novel crystal form: structural and normal-mode analyses.
pubmed doi rcsb
source organism Enterococcus faecium
total genus 47
structure length 180
sequence length 180
chains with identical sequence B
ec nomenclature ec 2.3.1.82: Aminoglycoside 6'-N-acetyltransferase.
pdb deposition date 2005-06-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00583 Acetyltransf_1 Acetyltransferase (GNAT) family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.630.30 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Aminopeptidase 2a4nA00
2CNMA 4KUAA 2B58A 4AVBA 4KVOE 1Z9UA 2P6FA 2R1IA 4B5PA 4NCZA 3W6SA 4JD6A 3DNSA 4KOWA 4AB7A 5KTDA 3V8IA 4NEXA 3R95A 4PSXA 4RS2A 4E0AA 2X7BA 3BJ7A 2OZHA 3QAHA 2ZXVA 4M3SA 1I12A 4PK2A 4KOXA 4KOTA 3B8GA 1XE4A 3EC4A 1U6MA 1Z4EA 3FNCA 2PC1A 4XPKA 3W6XA 4R9MA 1YK3A 2ZW4A 4FD5A 2R7HA 1WWZA 4R57A 3P2HA 1NSLA 1S7NA 3I3GA 5IX3A 2J8NA 3LD2A 3MGDA 3S6KA 4AVCA 5HH1A 3PZJA 2P6GA 3BLNA 1S60A 4EVYA 2GIVA 2D4OA 4KUBA 1NE9A 1GHEA 5ISVA 1B6BA 5GCNA 4NXYA 2P6EA 1YVOA 2ATRA 5F49A 3E0KA 4KORA 5H84A 1I1DA 3RYOA 4MJ8A 2C27A 3D3SA 1XIXA 2AJ6A 2B3VA 1K4JA 1S7FA 4XNHB 1QSMA 1FY7A 2PDOA 3F5BA 2FL4A 5FVJA 2EVNA 1J4JA 2I79A 1BO4A 2DXQA 4MI4A 5C88A 1Y9WA 1IB1E 3DSBA 4HKFA 1YR0A 2HV2A 4QC6A 2B5GB 3GKRA 2GANA 1YX0A 2BSWA 3TO9A 1IYKA 1N71A 3C26A 3NE7A 3ZZIA 4CRZB 4KZTA 4YFJA 1SQHA 4R87A 3W91A 2BEIA 1IYLA 2H5MA 4U9YA 3EFAA 4K30A 2B4DA 1S7LA 4E8OA 2Z0ZA 1Q2CA 2D4PA 1R57A 3CXPA 5HMNA 3P2FA 4KLWA 3D2MA 1CJWA 4E2AA 3TE4A 2ZPAA 2HQYA 3G3SA 4OLLA 5F47A 2FCKA 2Q0YA 4II9A 4KOYA 1L0CA 3SHPA 4JJXA 4OAEA 4UA3A 3KKWA 2PSWA 2JEVA 3D8PA 5H86A 1P0HA 3S6HA 4UBRA 2P0WA 1QSRA 4PK3A 3F0AA 2BL1A 3PP9A 4J3GA 2IL4A 3ZJ0A 3EXNA 1CM0A 3EO4A 2PQ8A 4PV6A 1YVKA 3R9FA 3TO7A 5KTCA 1RXTA 1Y7RA 2F5IA 2Y0MA 1UFHA 1KUYA 4QB9A 1M4IA 4GS4A 4U5YA 2BUEA 1MJAA 2KCWA 1B87A 3BJ8A 2EUIA 2OZUA 1V0CA 1Q2DA 4B5OA 1OZPA 2Q7BA 4U9ZA 4H89A 3DR6A 4QBJA 4QVTA 5EC4A 4BMHA 3QB8A 3TTHA 4NF1A 2JDDA 2OU2A 1YGHA 1Q2YA 4MHDA 3T90A 1Z4RA 2Z11A 2FS5A 1WK4A 4H6UA 1M44A 2B3UA 1VHSA 3JVNA 3VWDA 4L8AA 4B5PB 4F6AA 5CNPA 2ZW6A 4QUSA 4CS0B 2VXKA 1MK4A 4MBUA 3UY5A 2ZW7A 1P4NA 5IB0A 3CXQA 2QMLA 2PR1A 5J8CA 2B4BA 4KOSA 1M1DA 4IF5A 3SXNA 1YREA 4KOVA 4Y49B 1S7KA 1S5KA 5I0CA 1LRZA 5JPHA 2RC4A 2FIAA 3PGPA 1IICA 5IV0A 1VKCA 3S6FA 1QSOA 1QSTA 1KUVA 4ORFA 1RO5A 4AG9A 5J8FA 3FXTA 4ZBGA 1M4DA 2PRBA 2Q4VA 1MJBA 4XNHC 3TT2A 4R3LA 4UWIA 1XMTA 3IWGA 4MY3A 4M85A 2OH1A 1QSNA 4KOUA 4X5KA 2CNSA 2PR8A 2G3AA 2G3TA 1ON0A 4F0YA 2I00A 3GY9A 3JUWA 5DWNA 3TCVA 5E96A 3K9UA 4YGOA 3F8KA 1MJ9A 4XPDC 4JLYA 4ONUA 5F48A 5KTAA 4H6ZA 3DDDA 3CXSA 1PUAA 1I21A 2OZGA 3SXOA 3T9YA 1PU9A 4KLVA 2Q04A 2FT0A 3S6GA 4DNCA 4HNXB 4JXQA 1TIQA 2K5TA 2VQYA 1XF8A 5F46A 2B4DB 2Z10A 3R1KA 2G0BA 4LX9A 2FXFA 2B5GA 4OADA 1IIDA 2GE3A 3TOAA 2CNTA 2VZYA 2JDCA 3FIXA 1S3ZA 2CY2A 2FIWA 3OWCA 2ZW5A 2HUZA 4FD7A 2VBQA 2REFA 3R96A 4FD6A 3H4QA 4R3KA 4AVAA 3LODA 3R9EA 1XEBA 2R8VA 2VZZA 5EBVA 2OB0A 1YLEA 2R98A 3WR7A 3EY5A 4YRHA 4MY0A 4I49A 3D2PA 2VI7A 2ARHA 5JQ4A 4UWJA 2A4NA 4NSQA 3TO6A 3G8WA 3FYNA 3IGRA 2J8RA 4CAVA 2O28A 3DR8A 4IUSA 4L89A 3R9GA 5C82A 4FD4A 2NMTA 4KVME 2WPWA 3FRMA 4KVXA 4AG7A 4CRYB 2WPXA 1M4GA 4LUAA 4RI1A 4PSWA 4XPDB 4JXRA 1Y9KA 3TOBA 3N7ZA 1KZFA 3VWEA 3TFYA 1NMTA 2JLMA 4HNWB 5DWMA 1BOBA 4HNYB 4CAXA 2J8MA 2AE6A 3FBUA 2Q4YA 3FB3A 2QIRA 4JWPA 2Q44A 2FSRA 3GYAA 4CAWA 2FE7A 2REEA 3I9SA 4Y49C 2VEZA 1KUXA 4XPLA 2QECA
chains in the Genus database with same CATH superfamily
2CNMA 4NGSA 4A33A 4K3NA 4KUAA 2B58A 2CXAA 3ISZA 3PFOA 5HVFA 4AVBA 1ARLA 4KVOE 2YGWA 2EK8A 2DPTA 1Z9UA 2ODFA 5JH9A 2GLJA 2P6FA 2IJZA 2AFZA 4G1PA 5AGEA 2AFXA 2R1IA 2VL1A 4B5PA 4NCZA 3W6SA 4JD6A 3DNSA 4KOWA 4AB7A 5KTDA 3V8IA 2PIYA 4NEXA 3R95A 4PSXA 3SI0A 2C6CA 4NGQA 4RS2A 4E0AA 2X7BA 3CPAA 4ZY1A 2G9DA 3BJ7A 2OZHA 3QAHA 4P4FA 4NGRA 4R76A 4C2YA 1RTQA 2ZXVA 4M3SA 3RAMA 1BLLE 1I12A 2F8HA 4PK2A 4KOXA 4KOTA 3B8GA 1XBUA 1XE4A 3K2KA 5LRKA 3EC4A 1U6MA 4MFKA 1Z4EA 3FNCA 3B3CA 1Z2LA 2PC1A 5K8MA 3BXMA 4C7IA 4XPKA 3W6XA 4Q7AA 1TKJA 2XEJA 3D7FA 4R9MA 1TXRA 1YK3A 2YNCC 1HDUA 2ZW4A 3MN8A 4FD5A 2R7HA 2QVPA 1WWZA 1CPSA 1BPMA 2PJ5A 4R57A 3P2HA 5D29A 1NSLA 3SI1A 1S7NA 2PJCA 3B7IA 3I3GA 4FUUA 5IX3A 2J8NA 3LD2A 4P4JA 2V8DA 3MGDA 4OKOA 3S6KA 3V7ZA 4AVCA 3B3TA 2ZEOA 3PZJA 5HH1A 2CIJA 4ZGYB 1ELMP 1KWMA 2P6GA 3BLNA 4CYNA 3FEEA 3NH5A 2IMOA 2ZEDA 1AMPA 1S60A 4EVYA 2GIVA 3HLPA 2RB7A 4DUKA 7CPAA 2D4OA 3B3VA 4MHZA 4A32A 4KUBA 2Q51A 1QQ9A 1NE9A 2O53A 1GHEA 5ISVA 1B6BA 2ZOFA 2CTCA 4JYWA 4NXYA 2P6EA 5GCNA 1Z8LA 1YVOA 2V8HA 4UCPA 3D7DA 3LWUA 2ATRA 3BHXA 4PXDA 5F49A 3E0KA 4KORA 5H84A 1I1DA 3RYOA 4C7HA 4MJ8A 2C27A 3PB7X 2EBJA 3D3SA 2BO9A 1XIXA 2AJ6A 2B3VA 2YNCA 3NFZA 1K4JA 1F2OA 1S7FA 4XNHB 2BCOA 1QSMA 1FY7A 1ARMA 2PDOA 2PJ6A 1ZG9A 2QYVA 2V8GA 3F5BA 2FL4A 2NSMA 3KHZA 5FVJA 2JBJA 1LFWA 1J4JA 2EVNA 2I79A 1BO4A 2DXQA 4MI4A 5C88A 3NH8A 4CPAA 3IWWA 5K8OA 1VHOA 4MFLA 1Y9WA 1IB1E 3DSBA 3NH4A 4A37A 5IB9A 1Z8TA 2HB6A 3RNZA 4HKFA 1YR0A 2HV2A 4QC6A 1H8LA 1LAMA 2Z3MA 1CBXA 2B5GB 3MRUA 3WC7A 4ZI6A 3GKRA 2GANA 4MCRA 4ZY0A 4OIDA 1YX0A 2BSWA 3TO9A 4KSAA 2ABZA 1IYKA 4P45A 1M4LA 4B6ZA 1N71A 3C26A 3NE7A 4X3RA 2ZEEA 3IJ3A 4MFJA 3K9TA 4NGNA 3D4UA 3TC8A 3ZZIA 1LOKA 3FVLA 4CRZB 4KZTA 4YFJA 4C2XA 1SQHA 4R87A 3W91A 2BEIA 1IYLA 2H5MA 4U9YA 4UFVA 2NYQA 4RN7A 3EFAA 4A30A 4K30A 2B4DA 3CZXA 1S7LA 1XRYA 4CYPA 4E8OA 2Z0ZA 4EMEA 1Q2CA 1JQGA 2D4PA 1R57A 2PJBA 3CXPA 3I1UA 3P2FA 5HMNA 1VGYA 1XJOA 4KLWA 3D2MA 3FMCA 4MHNA 3H8GA 1CJWA 2PJ2A 4P6YA 3SJFA 2ZPAA 4E2AA 3TE4A 2XEGA 3S9LA 2HQYA 3IO1A 1Z8XA 3G3SA 4OLLA 2EWBA 2FCKA 4GM5A 2Q0YA 3KL9A 5F47A 4B13A 4II9A 5LYIA 4X2TA 4KOYA 3CT9A 4O23A 1F57A 1Q7LA 1IGBA 1L0CA 2PJ0A 2Z3KA 2PJ9A 3NE8A 4OP4A 5THWA 4CGLA 4UFXA 4M6GA 1EE3P 3D67A 3SHPA 4JJXA 4MFPA 4MHYA 4X8IA 4OAEA 2V77A 4UA3A 4ZX8A 4DJLA 3KKWA 4F8ZA 2PSWA 2JEVA 4WJBA 3D8PA 5H86A 2PIZA 1P0HA 1ZG7A 2WYRA 3S6HA 4UBRA 2ZENA 2P0WA 5F09A 3PBEA 1QSRA 4PK3A 3F0AA 2BL1A 1AYEA 4ZX9A 3PP9A 4J3GA 4PXCA 5D8NA 2IL4A 2CF4A 4OC1A 3ZJ0A 2F7VA 3EXNA 1CM0A 2Q4ZA 3EO4A 1XFOA 2PQ8A 4TWEA 4PV6A 4BINA 1YVKA 3QAYA 3R9FA 5LRJA 3TO7A 5KTCA 1RXTA 1Y7RA 2F5IA 3NA6A 2Y0MA 1UFHA 3KZWA 3PRTA 1KUYA 4QB9A 3PB9X 1M4IA 4GS4A 4U5YA 2FVGA 1YSJA 4UEFA 3BI0A 3ISXA 2BUEA 1MJAA 3B2YA 2KCWA 3IIBA 1B87A 3BJ8A 2EUIA 2Z3OA 3IEHA 2OZUA 4MRIA 1V0CA 4KS9A 4A38A 1Q2DA 2PVVA 1CP7A 4UEEA 4B5OA 1OZPA 2Q7BA 4U9ZA 4H89A 4KSIA 3DR6A 4UCMA 1F2PA 4QBJA 4QVTA 3VATA 1OBRA 2AFSA 2C6PA 3FECA 4NJQA 3QB8A 5EC4A 3TTHA 4A94A 4NF1A 2JDDA 5G20A 2OU2A 1PCAA 1ZLHA 5BWAB 1YGHA 1Q2YA 4F0XA 1R43A 1VHEA 5HVHA 5LYFA 5LYLA 4MHDA 4W9YA 3B35A 3T90A 2DPSA 1Z4RA 2Z11A 4P4IA 2FS5A 3PB6X 1WK4A 5ELYA 4H6UA 3SJEA 1M44A 2B3UA 1VHSA 1YQEA 2OR4A 3JVNA 3VWDA 4FBEA 1CG2A 1FT7A 4L8AA 4B5PB 1X10A 4OIWA 4F6AA 4IAVA 4MCSA 2DF5A 8CPAA 5CNPA 2ZW6A 4QUSA 4EFDA 1CP6A 4CS0B 3KGQA 4PXBA 4MHPA 4M6HA 4R7MA 2VXKA 1MK4A 4MFQA 5AG5A 1TF9A 2AFUA 4MBUA 2PE3A 2ZW7A 3UY5A 1P4NA 2PJAA 4LQ6A 4LQGA 3KHXA 4NGTA 5IB0A 3CXQA 2QMLA 2PR1A 5J8CA 2WSAA 4CGMA 4Z65A 1JWQA 2B4BA 4MMOA 3FEDA 1X12A 2PCUA 4KOSA 3TX8A 3HUVA 5HVGA 3B3SA 1M1DA 1A2ZA 4IF5A 4R8FA 2ZEMA 3SXNA 1YREA 1YW4A 1ZLIA 3DLJA 3H5ZA 2XEFA 4KOVA 2GU2A 4A39A 2JBKA 2BOAA 2JEWA 1S7KA 4Y49B 1S5KA 3V38A 5I0CA 5HXDA 1LRZA 3LACA 4ONWA 3RZAA 5JPHA 1ZG8A 2RC4A 3N5FA 4C2ZA 2YNDA 2FIAA 1BPNA 2EO8A 3PGPA 5AG4A 4NGMA 2POKA 4FAIA 2PVWA 1IICA 5IV0A 4UIAA 1VKCA 5JGFA 3WABA 5JM6A 3RBUA 4CAFA 3IFEA 3S6FA 5LYDA 1QSOA 4NGPA 1TKFA 1QSTA 5J1QA 3S9MA 1KUVA 4ORFA 1RO5A 4MCPA 4OC2A 4AG9A 4CGPA 1IY7A 3PB4X 5J8FA 3FXTA 4NFRA 4ZBGA 3PBBA 3WT4A 4A95A 1M4DA 3S9NA 2DEAA 2PRBA 3WC6A 2Q4VA 1MJBA 3H8EA 4XNHC 1Z5RA 3TT2A 1XMBA 4R3LA 4UWIA 5CBMA 1XMTA 3D68A 3IWGA 4MY3A 4M85A 2OH1A 1R3NA 1QSNA 4KOUA 4PXEA 4BBHA 4A2ZA 2QJ8A 4OMEA 4X5KA 2CNSA 1QMUA 2O4HA 2PR8A 2G3AA 1PYTB 2G3TA 4R6TA 3IWEA 3KASA 3GIUA 1ON0A 4KSFA 3FF3A 2C6GA 3H8FA 2PJ4A 4F0YA 1BAVA 2I00A 5LRGA 3GY9A 3JUWA 5DWNA 3JRUA 3TCVA 4B12A 5E96A 4CAEA 3K9UA 1HEEA 3F8KA 4YGOA 4CGNA 1MJ9A 3GLJA 4XPDC 2PJ3A 4OC0A 3GUXA 4JLYA 4P10A 4ONUA 4A31A 1IOIA 5F48A 1CX8A 4UCNA 4ZYQA 4H6ZA 3KI9A 3DDDA 5KTAA 1TF8A 2GLFA 3CXSA 1NSAA 4DYOA 2OOTA 1FNOA 1PUAA 1I21A 2OZGA 4UFWA 1AUGA 3SXOA 3T9YA 1PU9A 3PEIA 3FX6A 4KLVA 2Q04A 3SI2A 2Q7SA 2FT0A 2J9AA 4IK2A 3S6GA 4HNXB 4BMHA 5AG7A 4JXQA 4DNCA 3KR5A 4TNUA 1TIQA 2K5TA 4YWYA 2VQYA 3FH4A 1XF8A 3PFEA 2IQ6A 1YMEA 1LCPA 2CTBA 1IU8A 3VARA 4B14A 1DE4C 5F46A 2B4DB 2Z3PA 2C1CA 2Z10A 3DGVA 2G0BA 3R1KA 3PB8X 1LAPA 3CDXA 2Z3LA 4LX9A 4P4DA 4P4BA 1Y0RA 5K8NA 4UIBA 1GYTA 2FXFA 2B5GA 4MFZA 2AFMA 4RUHA 2ANPA 2ZEPA 4OADA 4PQAA 1IOFA 1TKHA 3SJXA 3IU1A 2YNEA 1IIDA 2GE3A 3VH9A 4CGOA 5G21A 2XEIA 3TOAA 2CNTA 4GXHA 3SJGA 2VZYA 1UWYA 2JDCA 4IHMA 3FIXA 4PPZA 1S3ZA 2CY2A 2FIWA 3OWCA 2ZW5A 2HUZA 3KQXA 5DS0A 4FD7A 2VBQA 1CPXA 4WWVA 2REFA 5I4MA 5G22A 3R96A 3B3WA 3D7GA 4FD6A 3H4QA 4R3KA 4AVAA 3LODA 3R9EA 4OC5A 4EWTA 1Y0YA 1XEBA 2PRQA 4B10A 1HDQA 2R8VA 1YW6A 2VZZA 5AG6A 5EBVA 5CPAA 5EMIA 3GB0A 1YLOA 2AFWA 2OB0A 1YLEA 4P4EA 2R98A 3WR7A 3WC5A 3EY5A 4YRHA 2V8VA 4MY0A 2ZELA 4H2KA 4JZ0A 1Z8WA 4I49A 4MCQA 4C68A 5A28A 3D2PA 2VI7A 2PJ1A 2ARHA 5K8PA 5JQ4A 2ZEFA 4UWJA 2A4NA 1VIXA 4NJRA 3RO0A 4MXUA 1ELLP 4NSQA 4B11A 3T8WA 3TO6A 2Z3NA 3L2NA 2ZEGA 3G8WA 4OC3A 1XOVA 3D66A 2RFHA 4F9VA 3FYNA 3IGRA 4OC4A 2J8RA 4YU9A 3D7HA 4BD9A 2O28A 4CAVA 3DR8A 4IUSA 4L89A 3R9GA 3FJUA 4CYQA 4F9UA 5C82A 3BI1A 2I3CA 4FD4A 4HPSA 2NMTA 4KVME 2WPWA 4Q36A 3FRMA 4M6IA 4KVXA 2GFQA 2WZNA 3IC1A 4UF4A 4AG7A 4CRYB 5G1ZA 3IU2A 2WPXA 1M4GA 1Y7EA 4LUAA 4RI1A 4PSWA 4XPDB 4JXRA 3JTKA 1Y9KA 3TOBA 3N7ZA 1KZFA 3VWEA 3TFYA 1DTDA 2GREA 1NMTA 2JLMA 2ZEHA 3KR4A 3LMSA 4HNWB 5DWMA 3CPXA 1BOBA 4HNYB 6CPAA 4CAXA 2EK9A 2J8MA 2AE6A 3FBUA 2Q4YA 3FB3A 2PJ8A 2QIRA 3A9LA 4CYOA 2HC9A 1ZO0A 2PJ7A 1LANA 4JWPA 4ZY2A 4FWUA 2Q44A 2FSRA 2ZOGA 3GYAA 4CAWA 2FE7A 4AXVA 2REEA 4Q38A 2WUUA 3I9SA 3QNVA 4UEZA 5A27A 2AFOA 3KQZA 4Y49C 2VEZA 1KUXA 4XPLA 2Q43A 4P44A 2QECA
chains in the Genus database with same CATH topology
2CNMA 4A33A 4KUAA 2B58A 2CXAA 4AVBA 4KVOE 2YGWA 2DPTA 1Z9UA 2P6FA 5AGEA 2R1IA 4B5PA 4NCZA 3W6SA 4JD6A 3DNSA 4KOWA 4AB7A 5KTDA 3V8IA 4NEXA 3R95A 4PSXA 4RS2A 4E0AA 2X7BA 3BJ7A 2OZHA 3QAHA 4C2YA 2ZXVA 4M3SA 1I12A 4PK2A 4KOXA 4KOTA 3B8GA 1XE4A 3EC4A 1U6MA 4MFKA 1Z4EA 3FNCA 2PC1A 4C7IA 4XPKA 3W6XA 4R9MA 1YK3A 2YNCC 2ZW4A 4FD5A 2R7HA 1WWZA 4R57A 3P2HA 1NSLA 1S7NA 3I3GA 5IX3A 2J8NA 3LD2A 3MGDA 3S6KA 4AVCA 5HH1A 3PZJA 4ZGYB 2P6GA 3BLNA 4CYNA 1S60A 4EVYA 2GIVA 2D4OA 4A32A 4KUBA 1NE9A 1GHEA 5ISVA 1B6BA 5GCNA 4NXYA 2P6EA 1YVOA 4UCPA 2ATRA 5F49A 3E0KA 4KORA 5H84A 1I1DA 3RYOA 4C7HA 4MJ8A 2C27A 3D3SA 1XIXA 2AJ6A 2B3VA 2YNCA 1K4JA 1S7FA 4XNHB 1QSMA 1FY7A 2PDOA 3F5BA 2FL4A 5FVJA 2EVNA 1J4JA 2I79A 1BO4A 2DXQA 4MI4A 5C88A 4MFLA 1Y9WA 1IB1E 3DSBA 4HKFA 1YR0A 2HV2A 4QC6A 2Z3MA 2B5GB 3GKRA 2GANA 1YX0A 2BSWA 3TO9A 4KSAA 1IYKA 1N71A 3C26A 3NE7A 4MFJA 3ZZIA 4CRZB 4KZTA 4YFJA 4C2XA 1SQHA 4R87A 3W91A 2BEIA 1IYLA 2H5MA 4U9YA 4UFVA 3EFAA 4A30A 4K30A 2B4DA 1S7LA 4CYPA 4E8OA 2Z0ZA 1Q2CA 2D4PA 1R57A 3CXPA 5HMNA 3P2FA 4KLWA 3D2MA 1CJWA 4E2AA 3TE4A 2ZPAA 2HQYA 3G3SA 4OLLA 5F47A 2FCKA 4B13A 2Q0YA 4II9A 4KOYA 1L0CA 2Z3KA 4CGLA 4UFXA 3SHPA 4JJXA 4MFPA 4OAEA 4UA3A 3KKWA 2PSWA 2JEVA 3D8PA 5H86A 1P0HA 3S6HA 4UBRA 2P0WA 1QSRA 4PK3A 3F0AA 2BL1A 3PP9A 4J3GA 2IL4A 3ZJ0A 3EXNA 1CM0A 3EO4A 2PQ8A 4PV6A 1YVKA 3R9FA 3TO7A 5KTCA 1RXTA 1Y7RA 2F5IA 2Y0MA 1UFHA 1KUYA 4QB9A 1M4IA 4GS4A 4U5YA 2BUEA 1MJAA 2KCWA 1B87A 3BJ8A 2EUIA 2Z3OA 2OZUA 1V0CA 4KS9A 1Q2DA 4B5OA 1OZPA 2Q7BA 4U9ZA 4H89A 3DR6A 4UCMA 4QBJA 4QVTA 5EC4A 4A31A 4BMHA 3QB8A 3TTHA 4NF1A 2JDDA 5G20A 2OU2A 5BWAB 1YGHA 1Q2YA 4F0XA 4MHDA 3T90A 2DPSA 1Z4RA 2Z11A 2FS5A 1WK4A 4H6UA 1M44A 2B3UA 1VHSA 3JVNA 3VWDA 4L8AA 4B5PB 4F6AA 5CNPA 2ZW6A 4QUSA 4CS0B 2VXKA 1MK4A 4MFQA 5AG5A 4MBUA 3UY5A 2ZW7A 1P4NA 5IB0A 3CXQA 2QMLA 2PR1A 5J8CA 2WSAA 4CGMA 2B4BA 4KOSA 1M1DA 4IF5A 3SXNA 1YREA 3H5ZA 4KOVA 4Y49B 1S7KA 1S5KA 5I0CA 1LRZA 5JPHA 2RC4A 4C2ZA 2YNDA 2FIAA 3PGPA 5AG4A 1IICA 5IV0A 1VKCA 4CAFA 3S6FA 1QSOA 1QSTA 1KUVA 4ORFA 1RO5A 4AG9A 5J8FA 4CGPA 3FXTA 4ZBGA 4A95A 1M4DA 2PRBA 2Q4VA 1MJBA 4XNHC 3TT2A 4R3LA 4UWIA 1XMTA 3IWGA 4MY3A 4M85A 2OH1A 1QSNA 4KOUA 4BBHA 4A2ZA 4X5KA 2CNSA 2PR8A 2G3AA 2G3TA 3IWEA 1ON0A 4KSFA 4F0YA 2I00A 3GY9A 3JUWA 5DWNA 3TCVA 4B12A 5E96A 4CAEA 3K9UA 4YGOA 3F8KA 4CGNA 1MJ9A 4XPDC 4JLYA 4ONUA 5F48A 4UCNA 5KTAA 4H6ZA 3DDDA 3CXSA 1PUAA 1I21A 2OZGA 4UFWA 3SXOA 3T9YA 1PU9A 4KLVA 2Q04A 2FT0A 3S6GA 4DNCA 4HNXB 5AG7A 4JXQA 1TIQA 2K5TA 2VQYA 1XF8A 4B14A 5F46A 2B4DB 2Z3PA 2Z10A 3R1KA 2G0BA 2Z3LA 4LX9A 2FXFA 2B5GA 4MFZA 4OADA 3IU1A 2YNEA 1IIDA 2GE3A 4CGOA 5G21A 3TOAA 2CNTA 2VZYA 2JDCA 3FIXA 1S3ZA 2CY2A 2FIWA 3OWCA 2ZW5A 2HUZA 4FD7A 2VBQA 2REFA 5G22A 3R96A 4FD6A 3H4QA 4R3KA 4AVAA 3LODA 3R9EA 1XEBA 2R8VA 2VZZA 5AG6A 5EBVA 2OB0A 1YLEA 2R98A 3WR7A 3EY5A 4YRHA 4MY0A 4I49A 4C68A 5A28A 3D2PA 2VI7A 2ARHA 5JQ4A 4UWJA 2A4NA 4NSQA 4B11A 3TO6A 2Z3NA 3G8WA 3FYNA 3IGRA 2J8RA 4CAVA 4CYQA 2O28A 3DR8A 4IUSA 4L89A 3R9GA 5C82A 4FD4A 2NMTA 4KVME 2WPWA 4Q36A 3FRMA 4KVXA 4AG7A 4CRYB 5G1ZA 3IU2A 2WPXA 1M4GA 4LUAA 4RI1A 4PSWA 4XPDB 4JXRA 3JTKA 1Y9KA 3TOBA 3N7ZA 1KZFA 3VWEA 3TFYA 1NMTA 2JLMA 4HNWB 5DWMA 1BOBA 4HNYB 4CAXA 2J8MA 2AE6A 3FBUA 2Q4YA 3FB3A 2QIRA 3A9LA 4CYOA 1ZO0A 4JWPA 2Q44A 2FSRA 3GYAA 4CAWA 2FE7A 2REEA 4Q38A 2WUUA 3I9SA 5A27A 4Y49C 2VEZA 1KUXA 4XPLA 4B10A 2QECA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2CNM A;  4KUA A;  2B58 A;  4AVB A;  4KVO E;  1Z9U A;  2P6F A;  2R1I A;  4B5P A;  4NCZ A;  3W6S A;  4JD6 A;  3DNS A;  4KOW A;  4AB7 A;  5KTD A;  3V8I A;  4NEX A;  3R95 A;  4PSX A;  4RS2 A;  4E0A A;  2X7B A;  3BJ7 A;  2OZH A;  3QAH A;  2ZXV A;  4M3S A;  1I12 A;  4PK2 A;  4KOX A;  4KOT A;  3B8G A;  1XE4 A;  3EC4 A;  1U6M A;  1Z4E A;  3FNC A;  2PC1 A;  4XPK A;  3W6X A;  4R9M A;  1YK3 A;  2ZW4 A;  4FD5 A;  2R7H A;  1WWZ A;  4R57 A;  3P2H A;  1NSL A;  1S7N A;  3I3G A;  5IX3 A;  2J8N A;  3LD2 A;  3MGD A;  3S6K A;  4AVC A;  5HH1 A;  3PZJ A;  2P6G A;  3BLN A;  1S60 A;  4EVY A;  2GIV A;  2D4O A;  4KUB A;  1NE9 A;  1GHE A;  5ISV A;  1B6B A;  5GCN A;  4NXY A;  2P6E A;  1YVO A;  2ATR A;  5F49 A;  3E0K A;  4KOR A;  5H84 A;  1I1D A;  3RYO A;  4MJ8 A;  2C27 A;  3D3S A;  1XIX A;  2AJ6 A;  2B3V A;  1K4J A;  1S7F A;  4XNH B;  1QSM A;  1FY7 A;  2PDO A;  3F5B A;  2FL4 A;  5FVJ A;  2EVN A;  1J4J A;  2I79 A;  1BO4 A;  2DXQ A;  4MI4 A;  5C88 A;  1Y9W A;  1IB1 E;  3DSB A;  4HKF A;  1YR0 A;  2HV2 A;  4QC6 A;  2B5G B;  3GKR A;  2GAN A;  1YX0 A;  2BSW A;  3TO9 A;  1IYK A;  1N71 A;  3C26 A;  3NE7 A;  3ZZI A;  4CRZ B;  4KZT A;  4YFJ A;  1SQH A;  4R87 A;  3W91 A;  2BEI A;  1IYL A;  2H5M A;  4U9Y A;  3EFA A;  4K30 A;  2B4D A;  1S7L A;  4E8O A;  2Z0Z A;  1Q2C A;  2D4P A;  1R57 A;  3CXP A;  5HMN A;  3P2F A;  4KLW A;  3D2M A;  1CJW A;  4E2A A;  3TE4 A;  2ZPA A;  2HQY A;  3G3S A;  4OLL A;  5F47 A;  2FCK A;  2Q0Y A;  4II9 A;  4KOY A;  1L0C A;  3SHP A;  4JJX A;  4OAE A;  4UA3 A;  3KKW A;  2PSW A;  2JEV A;  3D8P A;  5H86 A;  1P0H A;  3S6H A;  4UBR A;  2P0W A;  1QSR A;  4PK3 A;  3F0A A;  2BL1 A;  3PP9 A;  4J3G A;  2IL4 A;  3ZJ0 A;  3EXN A;  1CM0 A;  3EO4 A;  2PQ8 A;  4PV6 A;  1YVK A;  3R9F A;  3TO7 A;  5KTC A;  1RXT A;  1Y7R A;  2F5I A;  2Y0M A;  1UFH A;  1KUY A;  4QB9 A;  1M4I A;  4GS4 A;  4U5Y A;  2BUE A;  1MJA A;  2KCW A;  1B87 A;  3BJ8 A;  2EUI A;  2OZU A;  1V0C A;  1Q2D A;  4B5O A;  1OZP A;  2Q7B A;  4U9Z A;  4H89 A;  3DR6 A;  4QBJ A;  4QVT A;  5EC4 A;  4BMH A;  3QB8 A;  3TTH A;  4NF1 A;  2JDD A;  2OU2 A;  1YGH A;  1Q2Y A;  4MHD A;  3T90 A;  1Z4R A;  2Z11 A;  2FS5 A;  1WK4 A;  4H6U A;  1M44 A;  2B3U A;  1VHS A;  3JVN A;  3VWD A;  4L8A A;  4B5P B;  4F6A A;  5CNP A;  2ZW6 A;  4QUS A;  4CS0 B;  2VXK A;  1MK4 A;  4MBU A;  3UY5 A;  2ZW7 A;  1P4N A;  5IB0 A;  3CXQ A;  2QML A;  2PR1 A;  5J8C A;  2B4B A;  4KOS A;  1M1D A;  4IF5 A;  3SXN A;  1YRE A;  4KOV A;  4Y49 B;  1S7K A;  1S5K A;  5I0C A;  1LRZ A;  5JPH A;  2RC4 A;  2FIA A;  3PGP A;  1IIC A;  5IV0 A;  1VKC A;  3S6F A;  1QSO A;  1QST A;  1KUV A;  4ORF A;  1RO5 A;  4AG9 A;  5J8F A;  3FXT A;  4ZBG A;  1M4D A;  2PRB A;  2Q4V A;  1MJB A;  4XNH C;  3TT2 A;  4R3L A;  4UWI A;  1XMT A;  3IWG A;  4MY3 A;  4M85 A;  2OH1 A;  1QSN A;  4KOU A;  4X5K A;  2CNS A;  2PR8 A;  2G3A A;  2G3T A;  1ON0 A;  4F0Y A;  2I00 A;  3GY9 A;  3JUW A;  5DWN A;  3TCV A;  5E96 A;  3K9U A;  4YGO A;  3F8K A;  1MJ9 A;  4XPD C;  4JLY A;  4ONU A;  5F48 A;  5KTA A;  4H6Z A;  3DDD A;  3CXS A;  1PUA A;  1I21 A;  2OZG A;  3SXO A;  3T9Y A;  1PU9 A;  4KLV A;  2Q04 A;  2FT0 A;  3S6G A;  4DNC A;  4HNX B;  4JXQ A;  1TIQ A;  2K5T A;  2VQY A;  1XF8 A;  5F46 A;  2B4D B;  2Z10 A;  3R1K A;  2G0B A;  4LX9 A;  2FXF A;  2B5G A;  4OAD A;  1IID A;  2GE3 A;  3TOA A;  2CNT A;  2VZY A;  2JDC A;  3FIX A;  1S3Z A;  2CY2 A;  2FIW A;  3OWC A;  2ZW5 A;  2HUZ A;  4FD7 A;  2VBQ A;  2REF A;  3R96 A;  4FD6 A;  3H4Q A;  4R3K A;  4AVA A;  3LOD A;  3R9E A;  1XEB A;  2R8V A;  2VZZ A;  5EBV A;  2OB0 A;  1YLE A;  2R98 A;  3WR7 A;  3EY5 A;  4YRH A;  4MY0 A;  4I49 A;  3D2P A;  2VI7 A;  2ARH A;  5JQ4 A;  4UWJ A;  2A4N A;  4NSQ A;  3TO6 A;  3G8W A;  3FYN A;  3IGR A;  2J8R A;  4CAV A;  2O28 A;  3DR8 A;  4IUS A;  4L89 A;  3R9G A;  5C82 A;  4FD4 A;  2NMT A;  4KVM E;  2WPW A;  3FRM A;  4KVX A;  4AG7 A;  4CRY B;  2WPX A;  1M4G A;  4LUA A;  4RI1 A;  4PSW A;  4XPD B;  4JXR A;  1Y9K A;  3TOB A;  3N7Z A;  1KZF A;  3VWE A;  3TFY A;  1NMT A;  2JLM A;  4HNW B;  5DWM A;  1BOB A;  4HNY B;  4CAX A;  2J8M A;  2AE6 A;  3FBU A;  2Q4Y A;  3FB3 A;  2QIR A;  4JWP A;  2Q44 A;  2FSR A;  3GYA A;  4CAW A;  2FE7 A;  2REE A;  3I9S A;  4Y49 C;  2VEZ A;  1KUX A;  4XPL A;  2QEC A; 
#chains in the Genus database with same CATH topology
 2CNM A;  4NGS A;  4A33 A;  4K3N A;  4KUA A;  2B58 A;  2CXA A;  3ISZ A;  3PFO A;  5HVF A;  4AVB A;  1ARL A;  4KVO E;  2YGW A;  2EK8 A;  2DPT A;  1Z9U A;  2ODF A;  5JH9 A;  2GLJ A;  2P6F A;  2IJZ A;  2AFZ A;  4G1P A;  5AGE A;  2AFX A;  2R1I A;  2VL1 A;  4B5P A;  4NCZ A;  3W6S A;  4JD6 A;  3DNS A;  4KOW A;  4AB7 A;  5KTD A;  3V8I A;  2PIY A;  4NEX A;  3R95 A;  4PSX A;  3SI0 A;  2C6C A;  4NGQ A;  4RS2 A;  4E0A A;  2X7B A;  3CPA A;  4ZY1 A;  2G9D A;  3BJ7 A;  2OZH A;  3QAH A;  4P4F A;  4NGR A;  4R76 A;  4C2Y A;  1RTQ A;  2ZXV A;  4M3S A;  3RAM A;  1BLL E;  1I12 A;  2F8H A;  4PK2 A;  4KOX A;  4KOT A;  3B8G A;  1XBU A;  1XE4 A;  3K2K A;  5LRK A;  3EC4 A;  1U6M A;  4MFK A;  1Z4E A;  3FNC A;  3B3C A;  1Z2L A;  2PC1 A;  5K8M A;  3BXM A;  4C7I A;  4XPK A;  3W6X A;  4Q7A A;  1TKJ A;  2XEJ A;  3D7F A;  4R9M A;  1TXR A;  1YK3 A;  2YNC C;  1HDU A;  2ZW4 A;  3MN8 A;  4FD5 A;  2R7H A;  2QVP A;  1WWZ A;  1CPS A;  1BPM A;  2PJ5 A;  4R57 A;  3P2H A;  5D29 A;  1NSL A;  3SI1 A;  1S7N A;  2PJC A;  3B7I A;  3I3G A;  4FUU A;  5IX3 A;  2J8N A;  3LD2 A;  4P4J A;  2V8D A;  3MGD A;  4OKO A;  3S6K A;  3V7Z A;  4AVC A;  3B3T A;  2ZEO A;  3PZJ A;  5HH1 A;  2CIJ A;  4ZGY B;  1ELM P;  1KWM A;  2P6G A;  3BLN A;  4CYN A;  3FEE A;  3NH5 A;  2IMO A;  2ZED A;  1AMP A;  1S60 A;  4EVY A;  2GIV A;  3HLP A;  2RB7 A;  4DUK A;  7CPA A;  2D4O A;  3B3V A;  4MHZ A;  4A32 A;  4KUB A;  2Q51 A;  1QQ9 A;  1NE9 A;  2O53 A;  1GHE A;  5ISV A;  1B6B A;  2ZOF A;  2CTC A;  4JYW A;  4NXY A;  2P6E A;  5GCN A;  1Z8L A;  1YVO A;  2V8H A;  4UCP A;  3D7D A;  3LWU A;  2ATR A;  3BHX A;  4PXD A;  5F49 A;  3E0K A;  4KOR A;  5H84 A;  1I1D A;  3RYO A;  4C7H A;  4MJ8 A;  2C27 A;  3PB7 X;  2EBJ A;  3D3S A;  2BO9 A;  1XIX A;  2AJ6 A;  2B3V A;  2YNC A;  3NFZ A;  1K4J A;  1F2O A;  1S7F A;  4XNH B;  2BCO A;  1QSM A;  1FY7 A;  1ARM A;  2PDO A;  2PJ6 A;  1ZG9 A;  2QYV A;  2V8G A;  3F5B A;  2FL4 A;  2NSM A;  3KHZ A;  5FVJ A;  2JBJ A;  1LFW A;  1J4J A;  2EVN A;  2I79 A;  1BO4 A;  2DXQ A;  4MI4 A;  5C88 A;  3NH8 A;  4CPA A;  3IWW A;  5K8O A;  1VHO A;  4MFL A;  1Y9W A;  1IB1 E;  3DSB A;  3NH4 A;  4A37 A;  5IB9 A;  1Z8T A;  2HB6 A;  3RNZ A;  4HKF A;  1YR0 A;  2HV2 A;  4QC6 A;  1H8L A;  1LAM A;  2Z3M A;  1CBX A;  2B5G B;  3MRU A;  3WC7 A;  4ZI6 A;  3GKR A;  2GAN A;  4MCR A;  4ZY0 A;  4OID A;  1YX0 A;  2BSW A;  3TO9 A;  4KSA A;  2ABZ A;  1IYK A;  4P45 A;  1M4L A;  4B6Z A;  1N71 A;  3C26 A;  3NE7 A;  4X3R A;  2ZEE A;  3IJ3 A;  4MFJ A;  3K9T A;  4NGN A;  3D4U A;  3TC8 A;  3ZZI A;  1LOK A;  3FVL A;  4CRZ B;  4KZT A;  4YFJ A;  4C2X A;  1SQH A;  4R87 A;  3W91 A;  2BEI A;  1IYL A;  2H5M A;  4U9Y A;  4UFV A;  2NYQ A;  4RN7 A;  3EFA A;  4A30 A;  4K30 A;  2B4D A;  3CZX A;  1S7L A;  1XRY A;  4CYP A;  4E8O A;  2Z0Z A;  4EME A;  1Q2C A;  1JQG A;  2D4P A;  1R57 A;  2PJB A;  3CXP A;  3I1U A;  3P2F A;  5HMN A;  1VGY A;  1XJO A;  4KLW A;  3D2M A;  3FMC A;  4MHN A;  3H8G A;  1CJW A;  2PJ2 A;  4P6Y A;  3SJF A;  2ZPA A;  4E2A A;  3TE4 A;  2XEG A;  3S9L A;  2HQY A;  3IO1 A;  1Z8X A;  3G3S A;  4OLL A;  2EWB A;  2FCK A;  4GM5 A;  2Q0Y A;  3KL9 A;  5F47 A;  4B13 A;  4II9 A;  5LYI A;  4X2T A;  4KOY A;  3CT9 A;  4O23 A;  1F57 A;  1Q7L A;  1IGB A;  1L0C A;  2PJ0 A;  2Z3K A;  2PJ9 A;  3NE8 A;  4OP4 A;  5THW A;  4CGL A;  4UFX A;  4M6G A;  1EE3 P;  3D67 A;  3SHP A;  4JJX A;  4MFP A;  4MHY A;  4X8I A;  4OAE A;  2V77 A;  4UA3 A;  4ZX8 A;  4DJL A;  3KKW A;  4F8Z A;  2PSW A;  2JEV A;  4WJB A;  3D8P A;  5H86 A;  2PIZ A;  1P0H A;  1ZG7 A;  2WYR A;  3S6H A;  4UBR A;  2ZEN A;  2P0W A;  5F09 A;  3PBE A;  1QSR A;  4PK3 A;  3F0A A;  2BL1 A;  1AYE A;  4ZX9 A;  3PP9 A;  4J3G A;  4PXC A;  5D8N A;  2IL4 A;  2CF4 A;  4OC1 A;  3ZJ0 A;  2F7V A;  3EXN A;  1CM0 A;  2Q4Z A;  3EO4 A;  1XFO A;  2PQ8 A;  4TWE A;  4PV6 A;  4BIN A;  1YVK A;  3QAY A;  3R9F A;  5LRJ A;  3TO7 A;  5KTC A;  1RXT A;  1Y7R A;  2F5I A;  3NA6 A;  2Y0M A;  1UFH A;  3KZW A;  3PRT A;  1KUY A;  4QB9 A;  3PB9 X;  1M4I A;  4GS4 A;  4U5Y A;  2FVG A;  1YSJ A;  4UEF A;  3BI0 A;  3ISX A;  2BUE A;  1MJA A;  3B2Y A;  2KCW A;  3IIB A;  1B87 A;  3BJ8 A;  2EUI A;  2Z3O A;  3IEH A;  2OZU A;  4MRI A;  1V0C A;  4KS9 A;  4A38 A;  1Q2D A;  2PVV A;  1CP7 A;  4UEE A;  4B5O A;  1OZP A;  2Q7B A;  4U9Z A;  4H89 A;  4KSI A;  3DR6 A;  4UCM A;  1F2P A;  4QBJ A;  4QVT A;  3VAT A;  1OBR A;  2AFS A;  2C6P A;  3FEC A;  4NJQ A;  3QB8 A;  5EC4 A;  3TTH A;  4A94 A;  4NF1 A;  2JDD A;  5G20 A;  2OU2 A;  1PCA A;  1ZLH A;  5BWA B;  1YGH A;  1Q2Y A;  4F0X A;  1R43 A;  1VHE A;  5HVH A;  5LYF A;  5LYL A;  4MHD A;  4W9Y A;  3B35 A;  3T90 A;  2DPS A;  1Z4R A;  2Z11 A;  4P4I A;  2FS5 A;  3PB6 X;  1WK4 A;  5ELY A;  4H6U A;  3SJE A;  1M44 A;  2B3U A;  1VHS A;  1YQE A;  2OR4 A;  3JVN A;  3VWD A;  4FBE A;  1CG2 A;  1FT7 A;  4L8A A;  4B5P B;  1X10 A;  4OIW A;  4F6A A;  4IAV A;  4MCS A;  2DF5 A;  8CPA A;  5CNP A;  2ZW6 A;  4QUS A;  4EFD A;  1CP6 A;  4CS0 B;  3KGQ A;  4PXB A;  4MHP A;  4M6H A;  4R7M A;  2VXK A;  1MK4 A;  4MFQ A;  5AG5 A;  1TF9 A;  2AFU A;  4MBU A;  2PE3 A;  2ZW7 A;  3UY5 A;  1P4N A;  2PJA A;  4LQ6 A;  4LQG A;  3KHX A;  4NGT A;  5IB0 A;  3CXQ A;  2QML A;  2PR1 A;  5J8C A;  2WSA A;  4CGM A;  4Z65 A;  1JWQ A;  2B4B A;  4MMO A;  3FED A;  1X12 A;  2PCU A;  4KOS A;  3TX8 A;  3HUV A;  5HVG A;  3B3S A;  1M1D A;  1A2Z A;  4IF5 A;  4R8F A;  2ZEM A;  3SXN A;  1YRE A;  1YW4 A;  1ZLI A;  3DLJ A;  3H5Z A;  2XEF A;  4KOV A;  2GU2 A;  4A39 A;  2JBK A;  2BOA A;  2JEW A;  1S7K A;  4Y49 B;  1S5K A;  3V38 A;  5I0C A;  5HXD A;  1LRZ A;  3LAC A;  4ONW A;  3RZA A;  5JPH A;  1ZG8 A;  2RC4 A;  3N5F A;  4C2Z A;  2YND A;  2FIA A;  1BPN A;  2EO8 A;  3PGP A;  5AG4 A;  4NGM A;  2POK A;  4FAI A;  2PVW A;  1IIC A;  5IV0 A;  4UIA A;  1VKC A;  5JGF A;  3WAB A;  5JM6 A;  3RBU A;  4CAF A;  3IFE A;  3S6F A;  5LYD A;  1QSO A;  4NGP A;  1TKF A;  1QST A;  5J1Q A;  3S9M A;  1KUV A;  4ORF A;  1RO5 A;  4MCP A;  4OC2 A;  4AG9 A;  4CGP A;  1IY7 A;  3PB4 X;  5J8F A;  3FXT A;  4NFR A;  4ZBG A;  3PBB A;  3WT4 A;  4A95 A;  1M4D A;  3S9N A;  2DEA A;  2PRB A;  3WC6 A;  2Q4V A;  1MJB A;  3H8E A;  4XNH C;  1Z5R A;  3TT2 A;  1XMB A;  4R3L A;  4UWI A;  5CBM A;  1XMT A;  3D68 A;  3IWG A;  4MY3 A;  4M85 A;  2OH1 A;  1R3N A;  1QSN A;  4KOU A;  4PXE A;  4BBH A;  4A2Z A;  2QJ8 A;  4OME A;  4X5K A;  2CNS A;  1QMU A;  2O4H A;  2PR8 A;  2G3A A;  1PYT B;  2G3T A;  4R6T A;  3IWE A;  3KAS A;  3GIU A;  1ON0 A;  4KSF A;  3FF3 A;  2C6G A;  3H8F A;  2PJ4 A;  4F0Y A;  1BAV A;  2I00 A;  5LRG A;  3GY9 A;  3JUW A;  5DWN A;  3JRU A;  3TCV A;  4B12 A;  5E96 A;  4CAE A;  3K9U A;  1HEE A;  3F8K A;  4YGO A;  4CGN A;  1MJ9 A;  3GLJ A;  4XPD C;  2PJ3 A;  4OC0 A;  3GUX A;  4JLY A;  4P10 A;  4ONU A;  4A31 A;  1IOI A;  5F48 A;  1CX8 A;  4UCN A;  4ZYQ A;  4H6Z A;  3KI9 A;  3DDD A;  5KTA A;  1TF8 A;  2GLF A;  3CXS A;  1NSA A;  4DYO A;  2OOT A;  1FNO A;  1PUA A;  1I21 A;  2OZG A;  4UFW A;  1AUG A;  3SXO A;  3T9Y A;  1PU9 A;  3PEI A;  3FX6 A;  4KLV A;  2Q04 A;  3SI2 A;  2Q7S A;  2FT0 A;  2J9A A;  4IK2 A;  3S6G A;  4HNX B;  4BMH A;  5AG7 A;  4JXQ A;  4DNC A;  3KR5 A;  4TNU A;  1TIQ A;  2K5T A;  4YWY A;  2VQY A;  3FH4 A;  1XF8 A;  3PFE A;  2IQ6 A;  1YME A;  1LCP A;  2CTB A;  1IU8 A;  3VAR A;  4B14 A;  1DE4 C;  5F46 A;  2B4D B;  2Z3P A;  2C1C A;  2Z10 A;  3DGV A;  2G0B A;  3R1K A;  3PB8 X;  1LAP A;  3CDX A;  2Z3L A;  4LX9 A;  4P4D A;  4P4B A;  1Y0R A;  5K8N A;  4UIB A;  1GYT A;  2FXF A;  2B5G A;  4MFZ A;  2AFM A;  4RUH A;  2ANP A;  2ZEP A;  4OAD A;  4PQA A;  1IOF A;  1TKH A;  3SJX A;  3IU1 A;  2YNE A;  1IID A;  2GE3 A;  3VH9 A;  4CGO A;  5G21 A;  2XEI A;  3TOA A;  2CNT A;  4GXH A;  3SJG A;  2VZY A;  1UWY A;  2JDC A;  4IHM A;  3FIX A;  4PPZ A;  1S3Z A;  2CY2 A;  2FIW A;  3OWC A;  2ZW5 A;  2HUZ A;  3KQX A;  5DS0 A;  4FD7 A;  2VBQ A;  1CPX A;  4WWV A;  2REF A;  5I4M A;  5G22 A;  3R96 A;  3B3W A;  3D7G A;  4FD6 A;  3H4Q A;  4R3K A;  4AVA A;  3LOD A;  3R9E A;  4OC5 A;  4EWT A;  1Y0Y A;  1XEB A;  2PRQ A;  4B10 A;  1HDQ A;  2R8V A;  1YW6 A;  2VZZ A;  5AG6 A;  5EBV A;  5CPA A;  5EMI A;  3GB0 A;  1YLO A;  2AFW A;  2OB0 A;  1YLE A;  4P4E A;  2R98 A;  3WR7 A;  3WC5 A;  3EY5 A;  4YRH A;  2V8V A;  4MY0 A;  2ZEL A;  4H2K A;  4JZ0 A;  1Z8W A;  4I49 A;  4MCQ A;  4C68 A;  5A28 A;  3D2P A;  2VI7 A;  2PJ1 A;  2ARH A;  5K8P A;  5JQ4 A;  2ZEF A;  4UWJ A;  2A4N A;  1VIX A;  4NJR A;  3RO0 A;  4MXU A;  1ELL P;  4NSQ A;  4B11 A;  3T8W A;  3TO6 A;  2Z3N A;  3L2N A;  2ZEG A;  3G8W A;  4OC3 A;  1XOV A;  3D66 A;  2RFH A;  4F9V A;  3FYN A;  3IGR A;  4OC4 A;  2J8R A;  4YU9 A;  3D7H A;  4BD9 A;  2O28 A;  4CAV A;  3DR8 A;  4IUS A;  4L89 A;  3R9G A;  3FJU A;  4CYQ A;  4F9U A;  5C82 A;  3BI1 A;  2I3C A;  4FD4 A;  4HPS A;  2NMT A;  4KVM E;  2WPW A;  4Q36 A;  3FRM A;  4M6I A;  4KVX A;  2GFQ A;  2WZN A;  3IC1 A;  4UF4 A;  4AG7 A;  4CRY B;  5G1Z A;  3IU2 A;  2WPX A;  1M4G A;  1Y7E A;  4LUA A;  4RI1 A;  4PSW A;  4XPD B;  4JXR A;  3JTK A;  1Y9K A;  3TOB A;  3N7Z A;  1KZF A;  3VWE A;  3TFY A;  1DTD A;  2GRE A;  1NMT A;  2JLM A;  2ZEH A;  3KR4 A;  3LMS A;  4HNW B;  5DWM A;  3CPX A;  1BOB A;  4HNY B;  6CPA A;  4CAX A;  2EK9 A;  2J8M A;  2AE6 A;  3FBU A;  2Q4Y A;  3FB3 A;  2PJ8 A;  2QIR A;  3A9L A;  4CYO A;  2HC9 A;  1ZO0 A;  2PJ7 A;  1LAN A;  4JWP A;  4ZY2 A;  4FWU A;  2Q44 A;  2FSR A;  2ZOG A;  3GYA A;  4CAW A;  2FE7 A;  4AXV A;  2REE A;  4Q38 A;  2WUU A;  3I9S A;  3QNV A;  4UEZ A;  5A27 A;  2AFO A;  3KQZ A;  4Y49 C;  2VEZ A;  1KUX A;  4XPL A;  2Q43 A;  4P44 A;  2QEC A; 
#chains in the Genus database with same CATH homology
 2CNM A;  4A33 A;  4KUA A;  2B58 A;  2CXA A;  4AVB A;  4KVO E;  2YGW A;  2DPT A;  1Z9U A;  2P6F A;  5AGE A;  2R1I A;  4B5P A;  4NCZ A;  3W6S A;  4JD6 A;  3DNS A;  4KOW A;  4AB7 A;  5KTD A;  3V8I A;  4NEX A;  3R95 A;  4PSX A;  4RS2 A;  4E0A A;  2X7B A;  3BJ7 A;  2OZH A;  3QAH A;  4C2Y A;  2ZXV A;  4M3S A;  1I12 A;  4PK2 A;  4KOX A;  4KOT A;  3B8G A;  1XE4 A;  3EC4 A;  1U6M A;  4MFK A;  1Z4E A;  3FNC A;  2PC1 A;  4C7I A;  4XPK A;  3W6X A;  4R9M A;  1YK3 A;  2YNC C;  2ZW4 A;  4FD5 A;  2R7H A;  1WWZ A;  4R57 A;  3P2H A;  1NSL A;  1S7N A;  3I3G A;  5IX3 A;  2J8N A;  3LD2 A;  3MGD A;  3S6K A;  4AVC A;  5HH1 A;  3PZJ A;  4ZGY B;  2P6G A;  3BLN A;  4CYN A;  1S60 A;  4EVY A;  2GIV A;  2D4O A;  4A32 A;  4KUB A;  1NE9 A;  1GHE A;  5ISV A;  1B6B A;  5GCN A;  4NXY A;  2P6E A;  1YVO A;  4UCP A;  2ATR A;  5F49 A;  3E0K A;  4KOR A;  5H84 A;  1I1D A;  3RYO A;  4C7H A;  4MJ8 A;  2C27 A;  3D3S A;  1XIX A;  2AJ6 A;  2B3V A;  2YNC A;  1K4J A;  1S7F A;  4XNH B;  1QSM A;  1FY7 A;  2PDO A;  3F5B A;  2FL4 A;  5FVJ A;  2EVN A;  1J4J A;  2I79 A;  1BO4 A;  2DXQ A;  4MI4 A;  5C88 A;  4MFL A;  1Y9W A;  1IB1 E;  3DSB A;  4HKF A;  1YR0 A;  2HV2 A;  4QC6 A;  2Z3M A;  2B5G B;  3GKR A;  2GAN A;  1YX0 A;  2BSW A;  3TO9 A;  4KSA A;  1IYK A;  1N71 A;  3C26 A;  3NE7 A;  4MFJ A;  3ZZI A;  4CRZ B;  4KZT A;  4YFJ A;  4C2X A;  1SQH A;  4R87 A;  3W91 A;  2BEI A;  1IYL A;  2H5M A;  4U9Y A;  4UFV A;  3EFA A;  4A30 A;  4K30 A;  2B4D A;  1S7L A;  4CYP A;  4E8O A;  2Z0Z A;  1Q2C A;  2D4P A;  1R57 A;  3CXP A;  5HMN A;  3P2F A;  4KLW A;  3D2M A;  1CJW A;  4E2A A;  3TE4 A;  2ZPA A;  2HQY A;  3G3S A;  4OLL A;  5F47 A;  2FCK A;  4B13 A;  2Q0Y A;  4II9 A;  4KOY A;  1L0C A;  2Z3K A;  4CGL A;  4UFX A;  3SHP A;  4JJX A;  4MFP A;  4OAE A;  4UA3 A;  3KKW A;  2PSW A;  2JEV A;  3D8P A;  5H86 A;  1P0H A;  3S6H A;  4UBR A;  2P0W A;  1QSR A;  4PK3 A;  3F0A A;  2BL1 A;  3PP9 A;  4J3G A;  2IL4 A;  3ZJ0 A;  3EXN A;  1CM0 A;  3EO4 A;  2PQ8 A;  4PV6 A;  1YVK A;  3R9F A;  3TO7 A;  5KTC A;  1RXT A;  1Y7R A;  2F5I A;  2Y0M A;  1UFH A;  1KUY A;  4QB9 A;  1M4I A;  4GS4 A;  4U5Y A;  2BUE A;  1MJA A;  2KCW A;  1B87 A;  3BJ8 A;  2EUI A;  2Z3O A;  2OZU A;  1V0C A;  4KS9 A;  1Q2D A;  4B5O A;  1OZP A;  2Q7B A;  4U9Z A;  4H89 A;  3DR6 A;  4UCM A;  4QBJ A;  4QVT A;  5EC4 A;  4A31 A;  4BMH A;  3QB8 A;  3TTH A;  4NF1 A;  2JDD A;  5G20 A;  2OU2 A;  5BWA B;  1YGH A;  1Q2Y A;  4F0X A;  4MHD A;  3T90 A;  2DPS A;  1Z4R A;  2Z11 A;  2FS5 A;  1WK4 A;  4H6U A;  1M44 A;  2B3U A;  1VHS A;  3JVN A;  3VWD A;  4L8A A;  4B5P B;  4F6A A;  5CNP A;  2ZW6 A;  4QUS A;  4CS0 B;  2VXK A;  1MK4 A;  4MFQ A;  5AG5 A;  4MBU A;  3UY5 A;  2ZW7 A;  1P4N A;  5IB0 A;  3CXQ A;  2QML A;  2PR1 A;  5J8C A;  2WSA A;  4CGM A;  2B4B A;  4KOS A;  1M1D A;  4IF5 A;  3SXN A;  1YRE A;  3H5Z A;  4KOV A;  4Y49 B;  1S7K A;  1S5K A;  5I0C A;  1LRZ A;  5JPH A;  2RC4 A;  4C2Z A;  2YND A;  2FIA A;  3PGP A;  5AG4 A;  1IIC A;  5IV0 A;  1VKC A;  4CAF A;  3S6F A;  1QSO A;  1QST A;  1KUV A;  4ORF A;  1RO5 A;  4AG9 A;  5J8F A;  4CGP A;  3FXT A;  4ZBG A;  4A95 A;  1M4D A;  2PRB A;  2Q4V A;  1MJB A;  4XNH C;  3TT2 A;  4R3L A;  4UWI A;  1XMT A;  3IWG A;  4MY3 A;  4M85 A;  2OH1 A;  1QSN A;  4KOU A;  4BBH A;  4A2Z A;  4X5K A;  2CNS A;  2PR8 A;  2G3A A;  2G3T A;  3IWE A;  1ON0 A;  4KSF A;  4F0Y A;  2I00 A;  3GY9 A;  3JUW A;  5DWN A;  3TCV A;  4B12 A;  5E96 A;  4CAE A;  3K9U A;  4YGO A;  3F8K A;  4CGN A;  1MJ9 A;  4XPD C;  4JLY A;  4ONU A;  5F48 A;  4UCN A;  5KTA A;  4H6Z A;  3DDD A;  3CXS A;  1PUA A;  1I21 A;  2OZG A;  4UFW A;  3SXO A;  3T9Y A;  1PU9 A;  4KLV A;  2Q04 A;  2FT0 A;  3S6G A;  4DNC A;  4HNX B;  5AG7 A;  4JXQ A;  1TIQ A;  2K5T A;  2VQY A;  1XF8 A;  4B14 A;  5F46 A;  2B4D B;  2Z3P A;  2Z10 A;  3R1K A;  2G0B A;  2Z3L A;  4LX9 A;  2FXF A;  2B5G A;  4MFZ A;  4OAD A;  3IU1 A;  2YNE A;  1IID A;  2GE3 A;  4CGO A;  5G21 A;  3TOA A;  2CNT A;  2VZY A;  2JDC A;  3FIX A;  1S3Z A;  2CY2 A;  2FIW A;  3OWC A;  2ZW5 A;  2HUZ A;  4FD7 A;  2VBQ A;  2REF A;  5G22 A;  3R96 A;  4FD6 A;  3H4Q A;  4R3K A;  4AVA A;  3LOD A;  3R9E A;  1XEB A;  2R8V A;  2VZZ A;  5AG6 A;  5EBV A;  2OB0 A;  1YLE A;  2R98 A;  3WR7 A;  3EY5 A;  4YRH A;  4MY0 A;  4I49 A;  4C68 A;  5A28 A;  3D2P A;  2VI7 A;  2ARH A;  5JQ4 A;  4UWJ A;  2A4N A;  4NSQ A;  4B11 A;  3TO6 A;  2Z3N A;  3G8W A;  3FYN A;  3IGR A;  2J8R A;  4CAV A;  4CYQ A;  2O28 A;  3DR8 A;  4IUS A;  4L89 A;  3R9G A;  5C82 A;  4FD4 A;  2NMT A;  4KVM E;  2WPW A;  4Q36 A;  3FRM A;  4KVX A;  4AG7 A;  4CRY B;  5G1Z A;  3IU2 A;  2WPX A;  1M4G A;  4LUA A;  4RI1 A;  4PSW A;  4XPD B;  4JXR A;  3JTK A;  1Y9K A;  3TOB A;  3N7Z A;  1KZF A;  3VWE A;  3TFY A;  1NMT A;  2JLM A;  4HNW B;  5DWM A;  1BOB A;  4HNY B;  4CAX A;  2J8M A;  2AE6 A;  3FBU A;  2Q4Y A;  3FB3 A;  2QIR A;  3A9L A;  4CYO A;  1ZO0 A;  4JWP A;  2Q44 A;  2FSR A;  3GYA A;  4CAW A;  2FE7 A;  2REE A;  4Q38 A;  2WUU A;  3I9S A;  5A27 A;  4Y49 C;  2VEZ A;  1KUX A;  4XPL A;  4B10 A;  2QEC A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...