2A4NA

Crystal structure of aminoglycoside 6'-n-acetyltransferase complexed with coenzyme a
Total Genus 47
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
47
sequence length
180
structure length
180
Chain Sequence
MIISEFDRNNPVLKDQLSDLLRLTWPEEYGDSSAEEVEEMMNPERIAVAAVDQDELVGFIGAIPQYGITGWELHPLVVESSRRKNQIGTRLVNYLEKEVASRGGITIYLGTDDLDHGTTLSQTDLYEHTFDKVASIQNLREHPYEFYEKLGYKIVGVLPNANGWDKPDIWMAKTIIPRPD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structures of aminoglycoside acetyltransferase AAC(6')-Ii in a novel crystal form: structural and normal-mode analyses.
pubmed doi rcsb
source organism Enterococcus faecium
molecule tags Transferase
molecule keywords aac(6')-Ii
total genus 47
structure length 180
sequence length 180
chains with identical sequence B
ec nomenclature ec 2.3.1.82: Aminoglycoside 6'-N-acetyltransferase.
pdb deposition date 2005-06-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00583 Acetyltransf_1 Acetyltransferase (GNAT) family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.630.30 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Aminopeptidase 2a4nA00
4XPDB 5F49A 4NCZA 5C82A 2GANA 1Q2CA 2C27A 1M4IA 1FY7A 3S6HA 4ORFA 5EBVA 2PR8A 3EC4A 2F5IA 2G3AA 5H84A 2BL1A 4KOVA 1MJ9A 4FD5A 4Y49C 3DSBA 4M85A 3GYAA 4ZBGA 4AVAA 1M44A 4AG9A 3ZJ0A 2NMTA 5E96A 3TOBA 3LODA 3ZZIA 2ZPAA 3TO6A 1XMTA 2B58A 4KUAA 4E2AA 2R8VA 4JLYA 2B5GB 1Z4EA 4PSXA 4KVXA 1YVOA 1QSMA 3GKRA 3E0KA 3PZJA 3H4QA 2D4OA 2VBQA 3DR8A 4RI1A 4JXQA 1CM0A 1YGHA 4B5OA 2QECA 2FL4A 2ZW7A 1KZFA 2ZW4A 2VXKA 3DDDA 2OZGA 1K4JA 3FRMA 1MK4A 3EFAA 1MJBA 2PR1A 4CRYB 1WK4A 3FNCA 4HNWB 5I0CA 3WR7A 1L0CA 4NF1A 5J8CA 2GE3A 2G3TA 1V0CA 2I00A 3P2HA 2Q0YA 3RYOA 1N71A 3KKWA 1Z9UA 2P6GA 4XPLA 3UY5A 4MY0A 4FD4A 1IICA 3R9FA 2B3UA 2HQYA 2PRBA 4PSWA 2ATRA 3FIXA 4KVOE 1NSLA 2RC4A 3F8KA 4NXYA 4CAVA 3BLNA 3IGRA 4UBRA 3PGPA 2Z10A 4KOXA 4OADA 4KOSA 4KLWA 4II9A 4R3KA 4PV6A 4B5PA 2AJ6A 1BO4A 2B3VA 2ARHA 1KUXA 2Q4YA 3R9EA 3FB3A 2WPWA 2OH1A 3D3SA 4H6ZA 1KUVA 4IUSA 1S5KA 3I3GA 1CJWA 2Y0MA 3D2PA 4UWJA 3V8IA 4JD6A 4F0YA 4R3LA 2WPXA 5HH1A 1VKCA 1RO5A 4AVCA 1YK3A 4B5PB 3S6KA 2FXFA 4XNHC 1S60A 1R57A 4YFJA 4F6AA 3W6SA 2Q4VA 4YRHA 4YGOA 1M4DA 2P6FA 3LD2A 4XNHB 2CNMA 4LUAA 1XIXA 3D2MA 4CAXA 1P4NA 1TIQA 4QC6A 4PK2A 2O28A 2FSRA 3F5BA 4U5YA 2IL4A 5KTCA 1NE9A 1NMTA 4XPDC 3SXNA 2B4BA 5HMNA 2HUZA 3IWGA 5IV0A 1Z4RA 4KOTA 4H6UA 1GHEA 2JLMA 2OZUA 4PK3A 2OB0A 2VZYA 3SHPA 3SXOA 3BJ7A 1LRZA 5KTDA 1XE4A 2H5MA 2A4NA 5DWMA 2J8NA 3VWDA 4MHDA 4J3GA 3B8GA 1S7LA 3TTHA 2Z0ZA 1MJAA 2REEA 3GY9A 1QSOA 2FIWA 2JDCA 1P0HA 4KUBA 4OLLA 3FYNA 3S6FA 1VHSA 1PUAA 1PU9A 2FT0A 4JXRA 5ISVA 4U9YA 3R96A 2Q7BA 4ONUA 4MY3A 3K9UA 3VWEA 1U6MA 5J8FA 4FD6A 3JUWA 4KOUA 3NE7A 3QB8A 2ZW6A 1YLEA 4NEXA 2VI7A 4JWPA 4IF5A 4GS4A 5F48A 2P6EA 3PP9A 1M1DA 4HKFA 1Y9WA 1B87A 2QMLA 3TCVA 4L8AA 3TE4A 1YR0A 2Q44A 4QVTA 2PC1A 2R7HA 4QB9A 1I1DA 4R9MA 1Y9KA 4KZTA 5FVJA 4FD7A 2HV2A 3W6XA 1Q2YA 4KLVA 2G0BA 1Y7RA 2FE7A 5DWNA 4X5KA 4R57A 4KVME 2D4PA 2VEZA 4I49A 4UA3A 1IIDA 3W91A 5C88A 5F46A 4L89A 1I21A 5F47A 1OZPA 2JDDA 5H86A 1I12A 3TFYA 4M3SA 2AE6A 3TOAA 4E0AA 2JEVA 2EVNA 2GIVA 2X7BA 2Q04A 4E8OA 4AB7A 2B4DA 3T90A 1J4JA 2B5GA 1QSTA 4MJ8A 3FXTA 2FS5A 3JVNA 1KUYA 3QAHA 4DNCA 4MBUA 2CNTA 3CXSA 4K30A 2VQYA 2REFA 1IYLA 3TO9A 5JQ4A 1S7KA 2CY2A 2ZXVA 3EXNA 3BJ8A 2I79A 4XPKA 1XF8A 2J8RA 3G3SA 1Q2DA 1XEBA 1BOBA 5GCNA 2ZW5A 3DR6A 3TO7A 4LX9A 4UWIA 3G8WA 1RXTA 2BUEA 4R87A 1QSNA 2EUIA 2OU2A 2KCWA 4EVYA 1YX0A 4AVBA 5JPHA 1WWZA 2BEIA 2PQ8A 3D8PA 2R98A 4AG7A 4NSQA 3R1KA 1S3ZA 4HNXB 3N7ZA 3CXQA 1YVKA 3R9GA 2DXQA 2FIAA 4CAWA 2PDOA 4Y49B 3T9YA 3S6GA 1QSRA 4BMHA 4KOWA 5IX3A 4OAEA 4U9ZA 2J8MA 2VZZA 4H89A 5IB0A 2QIRA 2R1IA 4JJXA 1B6BA 4CS0B 3R95A 2CNSA 3CXPA 3MGDA 3F0AA 1S7NA 2BSWA 4MI4A 2PSWA 1M4GA 2P0WA 2Z11A 4KORA 2B4DB 4QBJA 1ON0A 1IYKA 4QUSA 3TT2A 3I9SA 5EC4A 3OWCA 2OZHA 5KTAA 4RS2A 1UFHA 3DNSA 3EY5A 3FBUA 5CNPA 4HNYB 1YREA 1IB1E 3C26A 2K5TA 2FCKA 1SQHA 3EO4A 3P2FA 1S7FA 4KOYA 4CRZB
chains in the Genus database with same CATH superfamily
2ABZA 2PJBA 4NGRA 2Q4ZA 4C2YA 4XPDB 3FECA 5F49A 4NCZA 1LAPA 2GANA 5C82A 1Q2CA 2YNEA 2C27A 1M4IA 1FY7A 3IFEA 3S6HA 2Q51A 3FMCA 2PR8A 4ORFA 3EC4A 5EBVA 1XBUA 2F5IA 2G3AA 3FX6A 4BBHA 4MCRA 3KL9A 5H84A 4MFPA 2BL1A 4KOVA 1MJ9A 4FD5A 4ZX9A 4Y49C 3DSBA 4M85A 3GYAA 4CAFA 4ZBGA 3B3VA 2Z3NA 4AVAA 3GB0A 1M44A 5LRGA 4AG9A 4EFDA 2PIZA 3ZJ0A 3KHZA 2NMTA 5E96A 3PEIA 3TOBA 3LODA 1BAVA 4F9UA 2ZEEA 3H5ZA 1FNOA 1Y0YA 2ZPAA 3ZZIA 3TO6A 1XMTA 2B58A 4FWUA 4KUAA 1Y0RA 4C68A 1VHOA 3HLPA 3IJ3A 2ZOGA 4E2AA 2R8VA 1LCPA 2PJ2A 4FUUA 4JLYA 2B5GB 1Z4EA 5LYDA 4Z65A 5AG6A 4PSXA 4KVXA 3RAMA 1YVOA 2PJ9A 2Z3MA 1QSMA 3GKRA 1Z8LA 4UEZA 3JTKA 2ZEOA 3E0KA 1Z8TA 4BD9A 3PZJA 4A33A 1XOVA 2YNCC 3PBBA 3H4QA 1IY7A 2D4OA 4CGNA 2VBQA 2J9AA 2ZENA 2C6CA 3DR8A 4RI1A 4JXQA 3PFEA 4RN7A 2IJZA 1CM0A 3NH5A 5LRJA 4CGLA 1Z5RA 2GLJA 1CX8A 1YGHA 3IC1A 4B5OA 3BI1A 2QECA 1AMPA 2FL4A 2ZW7A 2BOAA 3IIBA 4P4JA 1KZFA 2ZW4A 2VXKA 5EMIA 4F9VA 3DDDA 2JEWA 2OZGA 1K4JA 3CDXA 4OIWA 2EK9A 3FRMA 5LYFA 2PJ3A 1F2OA 1BPNA 1MK4A 3EFAA 2I3CA 1MJBA 3BI0A 2PR1A 4KS9A 4CRYB 5A28A 3V7ZA 1WK4A 5G22A 3FNCA 4HNWB 4MFJA 1AUGA 1CPXA 4X8IA 4P45A 3B3TA 5I0CA 4MCSA 2RB7A 4YU9A 4FBEA 3FF3A 4CYOA 3A9LA 4CRZB 3DGVA 3WR7A 5I4MA 2DPTA 1L0CA 4KSFA 4MFQA 4NF1A 5J8CA 2GE3A 2V8DA 1HEEA 3H8EA 4UFWA 2G3TA 4NGSA 4OC5A 1V0CA 2I00A 3P2HA 2Q0YA 4CYNA 1CPSA 1PCAA 3RYOA 1N71A 3KKWA 3WABA 1YW6A 5LYLA 5BWAB 1Z9UA 4M6HA 2C6GA 2P6GA 4XPLA 3UY5A 4MY0A 4ZX8A 1OBRA 4FD4A 1ELLP 1IICA 5D8NA 4G1PA 4MHZA 3R9FA 3VH9A 2B3UA 2HQYA 1XRYA 3KI9A 2O4HA 4JYWA 2PRBA 3H8GA 4PSWA 2AFOA 2ZEMA 4IHMA 2ATRA 2WZNA 3FIXA 4KVOE 4R76A 5ELYA 2PJAA 1NSLA 4BINA 2RC4A 3F8KA 4NXYA 1X12A 1DE4C 2AFXA 4CAVA 3BLNA 2G9DA 3TX8A 3IGRA 1ZG8A 4UBRA 5G21A 3PGPA 2Z10A 4KOXA 2XEGA 4OADA 3B7IA 4KOSA 2PJ0A 4KLWA 3CT9A 4II9A 1X10A 3N5FA 4R3KA 1HDQA 1KWMA 1CBXA 4PV6A 1BPMA 4B5PA 2AJ6A 5K8NA 2ZEPA 1BO4A 3SJEA 4MXUA 1TF8A 4A30A 2B3VA 2ARHA 1YW4A 1KUXA 2Q4YA 4H2KA 3B2YA 2RFHA 2POKA 2YNCA 4GM5A 3R9EA 4UFVA 2ZEGA 3FB3A 2WPWA 2EBJA 1DTDA 2OH1A 4P4EA 1Z8XA 3D3SA 2NYQA 4H6ZA 3TC8A 1KUVA 5JGFA 4IUSA 4MFZA 1S5KA 4K3NA 4P4FA 3I3GA 1CJWA 4OC0A 2Z3KA 1CP6A 2JBJA 4F0XA 2Y0MA 3B3SA 5IB9A 3D2PA 2PVWA 4UWJA 3V8IA 4JD6A 4CYQA 4F0YA 5CPAA 4R3LA 2WPXA 4PPZA 1VKCA 5HH1A 4PXDA 1RO5A 3PB9X 4A37A 4AVCA 1YK3A 2Z3PA 3S6KA 2FXFA 2IMOA 4P4BA 4B5PB 4TWEA 4XNHC 3KGQA 3LWUA 4MFKA 1S60A 1R57A 2XEIA 4YFJA 1TKJA 4F6AA 4TNUA 3W6SA 4FAIA 2Q4VA 3LMSA 4YRHA 1F57A 2V77A 1M4DA 4YGOA 3IO1A 3KR4A 2P6FA 3LD2A 2PCUA 2HB6A 2O53A 5G1ZA 4O23A 4XNHB 1LAMA 4ZY1A 3IWWA 4A38A 2CNMA 4X3RA 2C6PA 1H8LA 3B3CA 4LUAA 1XIXA 3D2MA 4P6YA 4CAXA 3FH4A 5G20A 1P4NA 4CGMA 1TIQA 4P44A 1YQEA 4QC6A 4PK2A 4RUHA 2O28A 4B6ZA 2FSRA 3F5BA 3RZAA 3IU2A 4U5YA 2IL4A 5KTCA 3WC7A 1NE9A 1NMTA 1NSAA 4UCNA 4C2XA 2ODFA 3K9TA 4UEEA 3KQXA 2DEAA 4XPDC 2ZELA 4C2ZA 1EE3P 3SXNA 1LOKA 2B4BA 4OMEA 5HMNA 3NH8A 3PRTA 4IAVA 2AFSA 5HVGA 2HUZA 2V8GA 3S9MA 3IWGA 5IV0A 1Z4RA 4Q36A 5AGEA 4F8ZA 2BCOA 4KOTA 3D7HA 1GHEA 2JLMA 4H6UA 4B13A 2AFMA 2OZUA 1F2PA 4PK3A 2OB0A 3BXMA 2VZYA 3SHPA 1VHEA 3SXOA 3BJ7A 1LRZA 5KTDA 1XE4A 2H5MA 2A4NA 2QYVA 5DWMA 5F09A 2J8NA 2PJ4A 3VWDA 4MHDA 1GYTA 4J3GA 3B8GA 1S7LA 3SI0A 1FT7A 3JRUA 2Z0ZA 3TTHA 1MJAA 2WYRA 2REEA 4B11A 3GY9A 3NA6A 2ZEDA 1QSOA 3NFZA 2FIWA 2JDCA 1P0HA 4PXBA 3D7GA 3KZWA 4M6IA 4KUBA 4HPSA 4OLLA 3S9LA 3FYNA 3S6FA 1VHSA 1PUAA 1PU9A 4C7HA 2FT0A 4JXRA 3D68A 3GUXA 5ISVA 4EMEA 3NH4A 4U9YA 3R96A 4AXVA 4OC1A 2Q7BA 4ONUA 4MY3A 3K9UA 3VWEA 4CGPA 1U6MA 5J8FA 4DYOA 2XEFA 3SJXA 4FD6A 2ZEHA 3JUWA 4KOUA 3NE7A 2Z3LA 1AYEA 2F7VA 2ZW6A 3QB8A 2Q43A 4R8FA 1YLEA 2PRQA 2WSAA 4NEXA 2VI7A 4JWPA 4IF5A 4GS4A 5F48A 2P6EA 3PP9A 4MHPA 4C7IA 3MRUA 4WJBA 3PB7X 4PXCA 1M1DA 5AG4A 4HKFA 1Y9WA 1B87A 3B35A 3FVLA 2QMLA 3TCVA 5K8PA 4WWVA 4B12A 4A94A 4L8AA 3IU1A 1YR0A 2PE3A 2Q44A 3TE4A 4QVTA 2PC1A 2R7HA 1HDUA 3PB8X 4QB9A 2CF4A 1XFOA 3S9NA 4NJQA 1I1DA 4NFRA 4JZ0A 3D7DA 3PFOA 1Q7LA 2PJ5A 4R9MA 1YSJA 4OC4A 5AG5A 3K2KA 5JM6A 1Y9KA 1LFWA 4KZTA 2JBKA 5FVJA 2GU2A 4FD7A 2HV2A 6CPAA 1IU8A 3W6XA 1Q2YA 4KLVA 4MHNA 2G0BA 1TXRA 1Y7RA 2FE7A 4NGTA 4UF4A 1ARMA 4OIDA 4OC2A 5DWNA 5D29A 1Y7EA 3BHXA 4LQ6A 1ZLHA 4X5KA 3VATA 4R57A 4KVME 2D4PA 2VEZA 4I49A 4B10A 4UA3A 1IIDA 1JQGA 3W91A 2CTBA 5C88A 2PIYA 5J1QA 5F46A 4LQGA 1YMEA 4L89A 2GFQA 1I21A 5F47A 1OZPA 1XMBA 2JDDA 1TKHA 5H86A 1I12A 5HVFA 3TFYA 7CPAA 4M3SA 2IQ6A 3PB4X 2AE6A 3FEEA 4X2TA 4MHYA 3CPAA 3TOAA 4E0AA 4ZGYB 8CPAA 5HXDA 2JEVA 2AFUA 2EVNA 2GIVA 2X7BA 2XEJA 3VARA 2Q04A 4A31A 3GLJA 1QMUA 4E8OA 4AB7A 2OOTA 4NGPA 2B4DA 3T90A 1J4JA 4A32A 3QAYA 2B5GA 1QSTA 4MJ8A 3DLJA 4PQAA 4UFXA 3FXTA 2FS5A 3JVNA 2PJ1A 5LYIA 4ZY0A 1ZG7A 3HUVA 1KUYA 3PBEA 3QAHA 4MBUA 4DNCA 2CNTA 3CXSA 3RO0A 2DPSA 4K30A 2VQYA 2REFA 3KR5A 1LANA 2CXAA 1IYLA 4R7MA 5AG7A 3TO9A 5JQ4A 1S7KA 1Z8WA 2CY2A 2ZXVA 3CPXA 3KASA 4MCQA 4W9YA 1ARLA 3EXNA 3BJ8A 2I79A 4XPKA 1XF8A 2J8RA 3G3SA 3WC6A 5K8MA 1Q2DA 1VGYA 1XEBA 2YNDA 3FEDA 4ONWA 1BOBA 1TKFA 5GCNA 2ZW5A 1ZG9A 4CPAA 1ELMP 3DR6A 3D67A 2OR4A 4LX9A 3TO7A 4DJLA 1CG2A 4UWIA 1IOIA 1R3NA 2ZEFA 3LACA 4ZY2A 3G8WA 4CAEA 1CP7A 5CBMA 4CGOA 1PYTB 1RXTA 3RNZA 1BLLE 2BUEA 4M6GA 3SI2A 3SJFA 3ISZA 4R87A 4MFLA 1QSNA 2EUIA 4MMOA 3SI1A 2OU2A 3IEHA 3NE8A 1RTQA 2PJ8A 2PJ7A 2KCWA 2FVGA 4EVYA 3WC5A 1YX0A 4AVBA 5JPHA 4UCPA 4A2ZA 1WWZA 2BEIA 2PQ8A 2WUUA 2NSMA 4NGNA 2V8HA 5HVHA 3D8PA 2ANPA 2R98A 4NGQA 3D4UA 4AG7A 4B14A 4NSQA 4ZYQA 4CYPA 3R1KA 1S3ZA 4HNXB 4ZI6A 3N7ZA 3QNVA 2HC9A 1XJOA 2QJ8A 1YLOA 3CXQA 1YVKA 4DUKA 3R9GA 2DXQA 2FIAA 2AFZA 2PDOA 4CAWA 2C1CA 4Y49B 4R6TA 3T9YA 3S6GA 1QSRA 4BMHA 4UEFA 4Q7AA 4KOWA 4MCPA 4OAEA 4EWTA 4IK2A 5IX3A 4U9ZA 2J8MA 2ZOFA 3FJUA 4A95A 2CIJA 5K8OA 2VZZA 4H89A 5IB0A 3B3WA 4YWYA 1Z2LA 2PJ6A 2PVVA 4OKOA 3I1UA 2V8VA 1JWQA 4UCMA 4KSIA 4NGMA 3H8FA 2YGWA 3T8WA 2QIRA 2R1IA 1IGBA 3D66A 3D7FA 4JJXA 4A39A 1B6BA 3IWEA 4CS0B 1R43A 3R95A 2VL1A 4Q38A 3RBUA 2CNSA 3CXPA 3CZXA 3MGDA 4MRIA 4PXEA 3V38A 3F0AA 3SJGA 1QQ9A 2AFWA 1S7NA 2EO8A 2BSWA 2BO9A 2PSWA 1M4GA 3PB6X 4MI4A 2DF5A 2P0WA 1A2ZA 1VIXA 2Z11A 3WT4A 4KORA 4P4DA 3MN8A 2B4DB 4QBJA 1ON0A 1IYKA 2EK8A 2EWBA 2F8HA 5A27A 4QUSA 2CTCA 3ISXA 5DS0A 3GIUA 4UIAA 3TT2A 5LRKA 3I9SA 5EC4A 3OWCA 2OZHA 5KTAA 1ZO0A 4RS2A 4KSAA 1UWYA 3KHXA 4UIBA 1UFHA 3DNSA 3EY5A 3FBUA 5CNPA 4HNYB 1YREA 1ZLIA 1IB1E 3C26A 4GXHA 2K5TA 3KQZA 4NJRA 2Z3OA 2FCKA 1IOFA 1SQHA 3EO4A 3P2FA 5THWA 2GREA 2PJCA 3L2NA 1TF9A 4P4IA 4OP4A 1S7FA 4KOYA 1M4LA 4P10A 2QVPA 4OC3A 5JH9A 2Q7SA 2GLFA
chains in the Genus database with same CATH topology
4C2YA 4XPDB 5F49A 4NCZA 5C82A 2GANA 1Q2CA 2YNEA 2C27A 1M4IA 1FY7A 3S6HA 4ORFA 5EBVA 2PR8A 3EC4A 2F5IA 2G3AA 4BBHA 5H84A 4MFPA 2BL1A 4KOVA 1MJ9A 4FD5A 4Y49C 3DSBA 4M85A 3GYAA 4CAFA 4ZBGA 4AVAA 2Z3NA 1M44A 4AG9A 3ZJ0A 2NMTA 5E96A 3TOBA 3LODA 3H5ZA 3ZZIA 2ZPAA 3TO6A 1XMTA 2B58A 4KUAA 4C68A 4E2AA 2R8VA 4JLYA 2B5GB 1Z4EA 5AG6A 4PSXA 4KVXA 1YVOA 2Z3MA 1QSMA 3GKRA 3JTKA 3E0KA 3PZJA 4A33A 2YNCC 3H4QA 2D4OA 4CGNA 2VBQA 3DR8A 4RI1A 4JXQA 1CM0A 4CGLA 1YGHA 4B5OA 2QECA 2FL4A 2ZW7A 1KZFA 2ZW4A 2VXKA 3DDDA 2OZGA 1K4JA 3FRMA 1MK4A 3EFAA 1MJBA 2PR1A 4KS9A 4CRYB 5A28A 1WK4A 5G22A 3FNCA 4HNWB 4MFJA 5I0CA 4CYOA 3A9LA 3WR7A 2DPTA 1L0CA 4KSFA 4MFQA 4NF1A 5J8CA 2GE3A 4UFWA 2G3TA 1V0CA 2I00A 3P2HA 2Q0YA 4CYNA 3RYOA 1N71A 3KKWA 5BWAB 1Z9UA 2P6GA 4XPLA 3UY5A 4MY0A 4FD4A 1IICA 3R9FA 2B3UA 2HQYA 2PRBA 4PSWA 2ATRA 3FIXA 4KVOE 1NSLA 2RC4A 3F8KA 4NXYA 4CAVA 3BLNA 3IGRA 4UBRA 5G21A 3PGPA 2Z10A 4KOXA 4OADA 4KOSA 4KLWA 4II9A 4R3KA 4PV6A 4B5PA 2AJ6A 1BO4A 4A30A 2B3VA 2ARHA 1KUXA 2Q4YA 2YNCA 3R9EA 4UFVA 3FB3A 2WPWA 2OH1A 3D3SA 4H6ZA 1KUVA 4IUSA 4MFZA 1S5KA 3I3GA 1CJWA 2Z3KA 4F0XA 2Y0MA 3D2PA 4UWJA 3V8IA 4JD6A 4CYQA 4F0YA 4R3LA 2WPXA 5HH1A 1VKCA 1RO5A 4AVCA 1YK3A 2Z3PA 3S6KA 2FXFA 4B5PB 4XNHC 4MFKA 1S60A 1R57A 4YFJA 4F6AA 3W6SA 2Q4VA 4YRHA 4YGOA 1M4DA 2P6FA 3LD2A 5G1ZA 4XNHB 2CNMA 4LUAA 1XIXA 3D2MA 4CAXA 5G20A 1P4NA 4CGMA 1TIQA 4QC6A 4PK2A 2O28A 2FSRA 3F5BA 3IU2A 4U5YA 2IL4A 5KTCA 1NE9A 1NMTA 4UCNA 4C2XA 4XPDC 4C2ZA 3SXNA 2B4BA 5HMNA 2HUZA 3IWGA 5IV0A 1Z4RA 4Q36A 5AGEA 4KOTA 4H6UA 1GHEA 2JLMA 4B13A 2OZUA 4PK3A 2OB0A 2VZYA 3SHPA 3SXOA 3BJ7A 1LRZA 5KTDA 1XE4A 2H5MA 2A4NA 5DWMA 2J8NA 3VWDA 4MHDA 4J3GA 3B8GA 1S7LA 3TTHA 2Z0ZA 1MJAA 2REEA 4B11A 3GY9A 1QSOA 2FIWA 2JDCA 1P0HA 4KUBA 4OLLA 3FYNA 3S6FA 1VHSA 1PUAA 1PU9A 4C7HA 2FT0A 4JXRA 5ISVA 4U9YA 3R96A 2Q7BA 4ONUA 4MY3A 3K9UA 3VWEA 4CGPA 1U6MA 5J8FA 4FD6A 3JUWA 4KOUA 3NE7A 2Z3LA 3QB8A 2ZW6A 1YLEA 2WSAA 4NEXA 2VI7A 4JWPA 4IF5A 4GS4A 5F48A 2P6EA 3PP9A 4C7IA 1M1DA 5AG4A 4HKFA 1Y9WA 1B87A 2QMLA 3TCVA 4B12A 4L8AA 3IU1A 1YR0A 2Q44A 3TE4A 4QVTA 2PC1A 2R7HA 4QB9A 1I1DA 4R9MA 5AG5A 1Y9KA 4KZTA 5FVJA 4FD7A 2HV2A 3W6XA 1Q2YA 4KLVA 2G0BA 1Y7RA 2FE7A 5DWNA 4X5KA 4R57A 4KVME 2D4PA 2VEZA 4I49A 4B10A 4UA3A 1IIDA 3W91A 5C88A 5F46A 4L89A 1I21A 5F47A 1OZPA 2JDDA 5H86A 1I12A 3TFYA 4M3SA 2AE6A 3TOAA 4E0AA 4ZGYB 2JEVA 2EVNA 2GIVA 2X7BA 4A31A 2Q04A 4E8OA 4AB7A 2B4DA 3T90A 1J4JA 4A32A 2B5GA 1QSTA 4MJ8A 4UFXA 3FXTA 2FS5A 3JVNA 1KUYA 3QAHA 4DNCA 4MBUA 2CNTA 3CXSA 2DPSA 4K30A 2VQYA 2REFA 2CXAA 1IYLA 5AG7A 3TO9A 5JQ4A 1S7KA 2CY2A 2ZXVA 3EXNA 3BJ8A 2I79A 4XPKA 1XF8A 2J8RA 3G3SA 1Q2DA 1XEBA 2YNDA 1BOBA 5GCNA 2ZW5A 3DR6A 3TO7A 4LX9A 4UWIA 3G8WA 4CAEA 4CGOA 1RXTA 2BUEA 4R87A 4MFLA 1QSNA 2EUIA 2OU2A 2KCWA 4EVYA 1YX0A 4AVBA 5JPHA 4UCPA 4A2ZA 1WWZA 2BEIA 2PQ8A 2WUUA 3D8PA 2R98A 4AG7A 4B14A 4NSQA 4CYPA 3R1KA 1S3ZA 4HNXB 3N7ZA 3CXQA 1YVKA 3R9GA 2DXQA 2FIAA 4CAWA 2PDOA 4Y49B 3T9YA 3S6GA 1QSRA 4BMHA 4KOWA 5IX3A 4OAEA 4U9ZA 2J8MA 4A95A 2VZZA 4H89A 5IB0A 4UCMA 2YGWA 2QIRA 2R1IA 4JJXA 1B6BA 3IWEA 4CS0B 3R95A 4Q38A 2CNSA 3CXPA 3MGDA 3F0AA 1S7NA 2BSWA 2PSWA 1M4GA 4MI4A 2P0WA 2Z11A 4KORA 2B4DB 4QBJA 1ON0A 1IYKA 5A27A 4QUSA 3TT2A 3I9SA 5EC4A 3OWCA 2OZHA 5KTAA 1ZO0A 4RS2A 4KSAA 1UFHA 3DNSA 3EY5A 3FBUA 5CNPA 4HNYB 1YREA 1IB1E 3C26A 2K5TA 2Z3OA 2FCKA 1SQHA 3EO4A 3P2FA 1S7FA 4KOYA 4CRZB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4XPD B;  5F49 A;  4NCZ A;  5C82 A;  2GAN A;  1Q2C A;  2C27 A;  1M4I A;  1FY7 A;  3S6H A;  4ORF A;  5EBV A;  2PR8 A;  3EC4 A;  2F5I A;  2G3A A;  5H84 A;  2BL1 A;  4KOV A;  1MJ9 A;  4FD5 A;  4Y49 C;  3DSB A;  4M85 A;  3GYA A;  4ZBG A;  4AVA A;  1M44 A;  4AG9 A;  3ZJ0 A;  2NMT A;  5E96 A;  3TOB A;  3LOD A;  3ZZI A;  2ZPA A;  3TO6 A;  1XMT A;  2B58 A;  4KUA A;  4E2A A;  2R8V A;  4JLY A;  2B5G B;  1Z4E A;  4PSX A;  4KVX A;  1YVO A;  1QSM A;  3GKR A;  3E0K A;  3PZJ A;  3H4Q A;  2D4O A;  2VBQ A;  3DR8 A;  4RI1 A;  4JXQ A;  1CM0 A;  1YGH A;  4B5O A;  2QEC A;  2FL4 A;  2ZW7 A;  1KZF A;  2ZW4 A;  2VXK A;  3DDD A;  2OZG A;  1K4J A;  3FRM A;  1MK4 A;  3EFA A;  1MJB A;  2PR1 A;  4CRY B;  1WK4 A;  3FNC A;  4HNW B;  5I0C A;  3WR7 A;  1L0C A;  4NF1 A;  5J8C A;  2GE3 A;  2G3T A;  1V0C A;  2I00 A;  3P2H A;  2Q0Y A;  3RYO A;  1N71 A;  3KKW A;  1Z9U A;  2P6G A;  4XPL A;  3UY5 A;  4MY0 A;  4FD4 A;  1IIC A;  3R9F A;  2B3U A;  2HQY A;  2PRB A;  4PSW A;  2ATR A;  3FIX A;  4KVO E;  1NSL A;  2RC4 A;  3F8K A;  4NXY A;  4CAV A;  3BLN A;  3IGR A;  4UBR A;  3PGP A;  2Z10 A;  4KOX A;  4OAD A;  4KOS A;  4KLW A;  4II9 A;  4R3K A;  4PV6 A;  4B5P A;  2AJ6 A;  1BO4 A;  2B3V A;  2ARH A;  1KUX A;  2Q4Y A;  3R9E A;  3FB3 A;  2WPW A;  2OH1 A;  3D3S A;  4H6Z A;  1KUV A;  4IUS A;  1S5K A;  3I3G A;  1CJW A;  2Y0M A;  3D2P A;  4UWJ A;  3V8I A;  4JD6 A;  4F0Y A;  4R3L A;  2WPX A;  5HH1 A;  1VKC A;  1RO5 A;  4AVC A;  1YK3 A;  4B5P B;  3S6K A;  2FXF A;  4XNH C;  1S60 A;  1R57 A;  4YFJ A;  4F6A A;  3W6S A;  2Q4V A;  4YRH A;  4YGO A;  1M4D A;  2P6F A;  3LD2 A;  4XNH B;  2CNM A;  4LUA A;  1XIX A;  3D2M A;  4CAX A;  1P4N A;  1TIQ A;  4QC6 A;  4PK2 A;  2O28 A;  2FSR A;  3F5B A;  4U5Y A;  2IL4 A;  5KTC A;  1NE9 A;  1NMT A;  4XPD C;  3SXN A;  2B4B A;  5HMN A;  2HUZ A;  3IWG A;  5IV0 A;  1Z4R A;  4KOT A;  4H6U A;  1GHE A;  2JLM A;  2OZU A;  4PK3 A;  2OB0 A;  2VZY A;  3SHP A;  3SXO A;  3BJ7 A;  1LRZ A;  5KTD A;  1XE4 A;  2H5M A;  2A4N A;  5DWM A;  2J8N A;  3VWD A;  4MHD A;  4J3G A;  3B8G A;  1S7L A;  3TTH A;  2Z0Z A;  1MJA A;  2REE A;  3GY9 A;  1QSO A;  2FIW A;  2JDC A;  1P0H A;  4KUB A;  4OLL A;  3FYN A;  3S6F A;  1VHS A;  1PUA A;  1PU9 A;  2FT0 A;  4JXR A;  5ISV A;  4U9Y A;  3R96 A;  2Q7B A;  4ONU A;  4MY3 A;  3K9U A;  3VWE A;  1U6M A;  5J8F A;  4FD6 A;  3JUW A;  4KOU A;  3NE7 A;  3QB8 A;  2ZW6 A;  1YLE A;  4NEX A;  2VI7 A;  4JWP A;  4IF5 A;  4GS4 A;  5F48 A;  2P6E A;  3PP9 A;  1M1D A;  4HKF A;  1Y9W A;  1B87 A;  2QML A;  3TCV A;  4L8A A;  3TE4 A;  1YR0 A;  2Q44 A;  4QVT A;  2PC1 A;  2R7H A;  4QB9 A;  1I1D A;  4R9M A;  1Y9K A;  4KZT A;  5FVJ A;  4FD7 A;  2HV2 A;  3W6X A;  1Q2Y A;  4KLV A;  2G0B A;  1Y7R A;  2FE7 A;  5DWN A;  4X5K A;  4R57 A;  4KVM E;  2D4P A;  2VEZ A;  4I49 A;  4UA3 A;  1IID A;  3W91 A;  5C88 A;  5F46 A;  4L89 A;  1I21 A;  5F47 A;  1OZP A;  2JDD A;  5H86 A;  1I12 A;  3TFY A;  4M3S A;  2AE6 A;  3TOA A;  4E0A A;  2JEV A;  2EVN A;  2GIV A;  2X7B A;  2Q04 A;  4E8O A;  4AB7 A;  2B4D A;  3T90 A;  1J4J A;  2B5G A;  1QST A;  4MJ8 A;  3FXT A;  2FS5 A;  3JVN A;  1KUY A;  3QAH A;  4DNC A;  4MBU A;  2CNT A;  3CXS A;  4K30 A;  2VQY A;  2REF A;  1IYL A;  3TO9 A;  5JQ4 A;  1S7K A;  2CY2 A;  2ZXV A;  3EXN A;  3BJ8 A;  2I79 A;  4XPK A;  1XF8 A;  2J8R A;  3G3S A;  1Q2D A;  1XEB A;  1BOB A;  5GCN A;  2ZW5 A;  3DR6 A;  3TO7 A;  4LX9 A;  4UWI A;  3G8W A;  1RXT A;  2BUE A;  4R87 A;  1QSN A;  2EUI A;  2OU2 A;  2KCW A;  4EVY A;  1YX0 A;  4AVB A;  5JPH A;  1WWZ A;  2BEI A;  2PQ8 A;  3D8P A;  2R98 A;  4AG7 A;  4NSQ A;  3R1K A;  1S3Z A;  4HNX B;  3N7Z A;  3CXQ A;  1YVK A;  3R9G A;  2DXQ A;  2FIA A;  4CAW A;  2PDO A;  4Y49 B;  3T9Y A;  3S6G A;  1QSR A;  4BMH A;  4KOW A;  5IX3 A;  4OAE A;  4U9Z A;  2J8M A;  2VZZ A;  4H89 A;  5IB0 A;  2QIR A;  2R1I A;  4JJX A;  1B6B A;  4CS0 B;  3R95 A;  2CNS A;  3CXP A;  3MGD A;  3F0A A;  1S7N A;  2BSW A;  4MI4 A;  2PSW A;  1M4G A;  2P0W A;  2Z11 A;  4KOR A;  2B4D B;  4QBJ A;  1ON0 A;  1IYK A;  4QUS A;  3TT2 A;  3I9S A;  5EC4 A;  3OWC A;  2OZH A;  5KTA A;  4RS2 A;  1UFH A;  3DNS A;  3EY5 A;  3FBU A;  5CNP A;  4HNY B;  1YRE A;  1IB1 E;  3C26 A;  2K5T A;  2FCK A;  1SQH A;  3EO4 A;  3P2F A;  1S7F A;  4KOY A;  4CRZ B; 
#chains in the Genus database with same CATH topology
 2ABZ A;  2PJB A;  4NGR A;  2Q4Z A;  4C2Y A;  4XPD B;  3FEC A;  5F49 A;  4NCZ A;  1LAP A;  2GAN A;  5C82 A;  1Q2C A;  2YNE A;  2C27 A;  1M4I A;  1FY7 A;  3IFE A;  3S6H A;  2Q51 A;  3FMC A;  2PR8 A;  4ORF A;  3EC4 A;  5EBV A;  1XBU A;  2F5I A;  2G3A A;  3FX6 A;  4BBH A;  4MCR A;  3KL9 A;  5H84 A;  4MFP A;  2BL1 A;  4KOV A;  1MJ9 A;  4FD5 A;  4ZX9 A;  4Y49 C;  3DSB A;  4M85 A;  3GYA A;  4CAF A;  4ZBG A;  3B3V A;  2Z3N A;  4AVA A;  3GB0 A;  1M44 A;  5LRG A;  4AG9 A;  4EFD A;  2PIZ A;  3ZJ0 A;  3KHZ A;  2NMT A;  5E96 A;  3PEI A;  3TOB A;  3LOD A;  1BAV A;  4F9U A;  2ZEE A;  3H5Z A;  1FNO A;  1Y0Y A;  2ZPA A;  3ZZI A;  3TO6 A;  1XMT A;  2B58 A;  4FWU A;  4KUA A;  1Y0R A;  4C68 A;  1VHO A;  3HLP A;  3IJ3 A;  2ZOG A;  4E2A A;  2R8V A;  1LCP A;  2PJ2 A;  4FUU A;  4JLY A;  2B5G B;  1Z4E A;  5LYD A;  4Z65 A;  5AG6 A;  4PSX A;  4KVX A;  3RAM A;  1YVO A;  2PJ9 A;  2Z3M A;  1QSM A;  3GKR A;  1Z8L A;  4UEZ A;  3JTK A;  2ZEO A;  3E0K A;  1Z8T A;  4BD9 A;  3PZJ A;  4A33 A;  1XOV A;  2YNC C;  3PBB A;  3H4Q A;  1IY7 A;  2D4O A;  4CGN A;  2VBQ A;  2J9A A;  2ZEN A;  2C6C A;  3DR8 A;  4RI1 A;  4JXQ A;  3PFE A;  4RN7 A;  2IJZ A;  1CM0 A;  3NH5 A;  5LRJ A;  4CGL A;  1Z5R A;  2GLJ A;  1CX8 A;  1YGH A;  3IC1 A;  4B5O A;  3BI1 A;  2QEC A;  1AMP A;  2FL4 A;  2ZW7 A;  2BOA A;  3IIB A;  4P4J A;  1KZF A;  2ZW4 A;  2VXK A;  5EMI A;  4F9V A;  3DDD A;  2JEW A;  2OZG A;  1K4J A;  3CDX A;  4OIW A;  2EK9 A;  3FRM A;  5LYF A;  2PJ3 A;  1F2O A;  1BPN A;  1MK4 A;  3EFA A;  2I3C A;  1MJB A;  3BI0 A;  2PR1 A;  4KS9 A;  4CRY B;  5A28 A;  3V7Z A;  1WK4 A;  5G22 A;  3FNC A;  4HNW B;  4MFJ A;  1AUG A;  1CPX A;  4X8I A;  4P45 A;  3B3T A;  5I0C A;  4MCS A;  2RB7 A;  4YU9 A;  4FBE A;  3FF3 A;  4CYO A;  3A9L A;  4CRZ B;  3DGV A;  3WR7 A;  5I4M A;  2DPT A;  1L0C A;  4KSF A;  4MFQ A;  4NF1 A;  5J8C A;  2GE3 A;  2V8D A;  1HEE A;  3H8E A;  4UFW A;  2G3T A;  4NGS A;  4OC5 A;  1V0C A;  2I00 A;  3P2H A;  2Q0Y A;  4CYN A;  1CPS A;  1PCA A;  3RYO A;  1N71 A;  3KKW A;  3WAB A;  1YW6 A;  5LYL A;  5BWA B;  1Z9U A;  4M6H A;  2C6G A;  2P6G A;  4XPL A;  3UY5 A;  4MY0 A;  4ZX8 A;  1OBR A;  4FD4 A;  1ELL P;  1IIC A;  5D8N A;  4G1P A;  4MHZ A;  3R9F A;  3VH9 A;  2B3U A;  2HQY A;  1XRY A;  3KI9 A;  2O4H A;  4JYW A;  2PRB A;  3H8G A;  4PSW A;  2AFO A;  2ZEM A;  4IHM A;  2ATR A;  2WZN A;  3FIX A;  4KVO E;  4R76 A;  5ELY A;  2PJA A;  1NSL A;  4BIN A;  2RC4 A;  3F8K A;  4NXY A;  1X12 A;  1DE4 C;  2AFX A;  4CAV A;  3BLN A;  2G9D A;  3TX8 A;  3IGR A;  1ZG8 A;  4UBR A;  5G21 A;  3PGP A;  2Z10 A;  4KOX A;  2XEG A;  4OAD A;  3B7I A;  4KOS A;  2PJ0 A;  4KLW A;  3CT9 A;  4II9 A;  1X10 A;  3N5F A;  4R3K A;  1HDQ A;  1KWM A;  1CBX A;  4PV6 A;  1BPM A;  4B5P A;  2AJ6 A;  5K8N A;  2ZEP A;  1BO4 A;  3SJE A;  4MXU A;  1TF8 A;  4A30 A;  2B3V A;  2ARH A;  1YW4 A;  1KUX A;  2Q4Y A;  4H2K A;  3B2Y A;  2RFH A;  2POK A;  2YNC A;  4GM5 A;  3R9E A;  4UFV A;  2ZEG A;  3FB3 A;  2WPW A;  2EBJ A;  1DTD A;  2OH1 A;  4P4E A;  1Z8X A;  3D3S A;  2NYQ A;  4H6Z A;  3TC8 A;  1KUV A;  5JGF A;  4IUS A;  4MFZ A;  1S5K A;  4K3N A;  4P4F A;  3I3G A;  1CJW A;  4OC0 A;  2Z3K A;  1CP6 A;  2JBJ A;  4F0X A;  2Y0M A;  3B3S A;  5IB9 A;  3D2P A;  2PVW A;  4UWJ A;  3V8I A;  4JD6 A;  4CYQ A;  4F0Y A;  5CPA A;  4R3L A;  2WPX A;  4PPZ A;  1VKC A;  5HH1 A;  4PXD A;  1RO5 A;  3PB9 X;  4A37 A;  4AVC A;  1YK3 A;  2Z3P A;  3S6K A;  2FXF A;  2IMO A;  4P4B A;  4B5P B;  4TWE A;  4XNH C;  3KGQ A;  3LWU A;  4MFK A;  1S60 A;  1R57 A;  2XEI A;  4YFJ A;  1TKJ A;  4F6A A;  4TNU A;  3W6S A;  4FAI A;  2Q4V A;  3LMS A;  4YRH A;  1F57 A;  2V77 A;  1M4D A;  4YGO A;  3IO1 A;  3KR4 A;  2P6F A;  3LD2 A;  2PCU A;  2HB6 A;  2O53 A;  5G1Z A;  4O23 A;  4XNH B;  1LAM A;  4ZY1 A;  3IWW A;  4A38 A;  2CNM A;  4X3R A;  2C6P A;  1H8L A;  3B3C A;  4LUA A;  1XIX A;  3D2M A;  4P6Y A;  4CAX A;  3FH4 A;  5G20 A;  1P4N A;  4CGM A;  1TIQ A;  4P44 A;  1YQE A;  4QC6 A;  4PK2 A;  4RUH A;  2O28 A;  4B6Z A;  2FSR A;  3F5B A;  3RZA A;  3IU2 A;  4U5Y A;  2IL4 A;  5KTC A;  3WC7 A;  1NE9 A;  1NMT A;  1NSA A;  4UCN A;  4C2X A;  2ODF A;  3K9T A;  4UEE A;  3KQX A;  2DEA A;  4XPD C;  2ZEL A;  4C2Z A;  1EE3 P;  3SXN A;  1LOK A;  2B4B A;  4OME A;  5HMN A;  3NH8 A;  3PRT A;  4IAV A;  2AFS A;  5HVG A;  2HUZ A;  2V8G A;  3S9M A;  3IWG A;  5IV0 A;  1Z4R A;  4Q36 A;  5AGE A;  4F8Z A;  2BCO A;  4KOT A;  3D7H A;  1GHE A;  2JLM A;  4H6U A;  4B13 A;  2AFM A;  2OZU A;  1F2P A;  4PK3 A;  2OB0 A;  3BXM A;  2VZY A;  3SHP A;  1VHE A;  3SXO A;  3BJ7 A;  1LRZ A;  5KTD A;  1XE4 A;  2H5M A;  2A4N A;  2QYV A;  5DWM A;  5F09 A;  2J8N A;  2PJ4 A;  3VWD A;  4MHD A;  1GYT A;  4J3G A;  3B8G A;  1S7L A;  3SI0 A;  1FT7 A;  3JRU A;  2Z0Z A;  3TTH A;  1MJA A;  2WYR A;  2REE A;  4B11 A;  3GY9 A;  3NA6 A;  2ZED A;  1QSO A;  3NFZ A;  2FIW A;  2JDC A;  1P0H A;  4PXB A;  3D7G A;  3KZW A;  4M6I A;  4KUB A;  4HPS A;  4OLL A;  3S9L A;  3FYN A;  3S6F A;  1VHS A;  1PUA A;  1PU9 A;  4C7H A;  2FT0 A;  4JXR A;  3D68 A;  3GUX A;  5ISV A;  4EME A;  3NH4 A;  4U9Y A;  3R96 A;  4AXV A;  4OC1 A;  2Q7B A;  4ONU A;  4MY3 A;  3K9U A;  3VWE A;  4CGP A;  1U6M A;  5J8F A;  4DYO A;  2XEF A;  3SJX A;  4FD6 A;  2ZEH A;  3JUW A;  4KOU A;  3NE7 A;  2Z3L A;  1AYE A;  2F7V A;  2ZW6 A;  3QB8 A;  2Q43 A;  4R8F A;  1YLE A;  2PRQ A;  2WSA A;  4NEX A;  2VI7 A;  4JWP A;  4IF5 A;  4GS4 A;  5F48 A;  2P6E A;  3PP9 A;  4MHP A;  4C7I A;  3MRU A;  4WJB A;  3PB7 X;  4PXC A;  1M1D A;  5AG4 A;  4HKF A;  1Y9W A;  1B87 A;  3B35 A;  3FVL A;  2QML A;  3TCV A;  5K8P A;  4WWV A;  4B12 A;  4A94 A;  4L8A A;  3IU1 A;  1YR0 A;  2PE3 A;  2Q44 A;  3TE4 A;  4QVT A;  2PC1 A;  2R7H A;  1HDU A;  3PB8 X;  4QB9 A;  2CF4 A;  1XFO A;  3S9N A;  4NJQ A;  1I1D A;  4NFR A;  4JZ0 A;  3D7D A;  3PFO A;  1Q7L A;  2PJ5 A;  4R9M A;  1YSJ A;  4OC4 A;  5AG5 A;  3K2K A;  5JM6 A;  1Y9K A;  1LFW A;  4KZT A;  2JBK A;  5FVJ A;  2GU2 A;  4FD7 A;  2HV2 A;  6CPA A;  1IU8 A;  3W6X A;  1Q2Y A;  4KLV A;  4MHN A;  2G0B A;  1TXR A;  1Y7R A;  2FE7 A;  4NGT A;  4UF4 A;  1ARM A;  4OID A;  4OC2 A;  5DWN A;  5D29 A;  1Y7E A;  3BHX A;  4LQ6 A;  1ZLH A;  4X5K A;  3VAT A;  4R57 A;  4KVM E;  2D4P A;  2VEZ A;  4I49 A;  4B10 A;  4UA3 A;  1IID A;  1JQG A;  3W91 A;  2CTB A;  5C88 A;  2PIY A;  5J1Q A;  5F46 A;  4LQG A;  1YME A;  4L89 A;  2GFQ A;  1I21 A;  5F47 A;  1OZP A;  1XMB A;  2JDD A;  1TKH A;  5H86 A;  1I12 A;  5HVF A;  3TFY A;  7CPA A;  4M3S A;  2IQ6 A;  3PB4 X;  2AE6 A;  3FEE A;  4X2T A;  4MHY A;  3CPA A;  3TOA A;  4E0A A;  4ZGY B;  8CPA A;  5HXD A;  2JEV A;  2AFU A;  2EVN A;  2GIV A;  2X7B A;  2XEJ A;  3VAR A;  2Q04 A;  4A31 A;  3GLJ A;  1QMU A;  4E8O A;  4AB7 A;  2OOT A;  4NGP A;  2B4D A;  3T90 A;  1J4J A;  4A32 A;  3QAY A;  2B5G A;  1QST A;  4MJ8 A;  3DLJ A;  4PQA A;  4UFX A;  3FXT A;  2FS5 A;  3JVN A;  2PJ1 A;  5LYI A;  4ZY0 A;  1ZG7 A;  3HUV A;  1KUY A;  3PBE A;  3QAH A;  4MBU A;  4DNC A;  2CNT A;  3CXS A;  3RO0 A;  2DPS A;  4K30 A;  2VQY A;  2REF A;  3KR5 A;  1LAN A;  2CXA A;  1IYL A;  4R7M A;  5AG7 A;  3TO9 A;  5JQ4 A;  1S7K A;  1Z8W A;  2CY2 A;  2ZXV A;  3CPX A;  3KAS A;  4MCQ A;  4W9Y A;  1ARL A;  3EXN A;  3BJ8 A;  2I79 A;  4XPK A;  1XF8 A;  2J8R A;  3G3S A;  3WC6 A;  5K8M A;  1Q2D A;  1VGY A;  1XEB A;  2YND A;  3FED A;  4ONW A;  1BOB A;  1TKF A;  5GCN A;  2ZW5 A;  1ZG9 A;  4CPA A;  1ELM P;  3DR6 A;  3D67 A;  2OR4 A;  4LX9 A;  3TO7 A;  4DJL A;  1CG2 A;  4UWI A;  1IOI A;  1R3N A;  2ZEF A;  3LAC A;  4ZY2 A;  3G8W A;  4CAE A;  1CP7 A;  5CBM A;  4CGO A;  1PYT B;  1RXT A;  3RNZ A;  1BLL E;  2BUE A;  4M6G A;  3SI2 A;  3SJF A;  3ISZ A;  4R87 A;  4MFL A;  1QSN A;  2EUI A;  4MMO A;  3SI1 A;  2OU2 A;  3IEH A;  3NE8 A;  1RTQ A;  2PJ8 A;  2PJ7 A;  2KCW A;  2FVG A;  4EVY A;  3WC5 A;  1YX0 A;  4AVB A;  5JPH A;  4UCP A;  4A2Z A;  1WWZ A;  2BEI A;  2PQ8 A;  2WUU A;  2NSM A;  4NGN A;  2V8H A;  5HVH A;  3D8P A;  2ANP A;  2R98 A;  4NGQ A;  3D4U A;  4AG7 A;  4B14 A;  4NSQ A;  4ZYQ A;  4CYP A;  3R1K A;  1S3Z A;  4HNX B;  4ZI6 A;  3N7Z A;  3QNV A;  2HC9 A;  1XJO A;  2QJ8 A;  1YLO A;  3CXQ A;  1YVK A;  4DUK A;  3R9G A;  2DXQ A;  2FIA A;  2AFZ A;  2PDO A;  4CAW A;  2C1C A;  4Y49 B;  4R6T A;  3T9Y A;  3S6G A;  1QSR A;  4BMH A;  4UEF A;  4Q7A A;  4KOW A;  4MCP A;  4OAE A;  4EWT A;  4IK2 A;  5IX3 A;  4U9Z A;  2J8M A;  2ZOF A;  3FJU A;  4A95 A;  2CIJ A;  5K8O A;  2VZZ A;  4H89 A;  5IB0 A;  3B3W A;  4YWY A;  1Z2L A;  2PJ6 A;  2PVV A;  4OKO A;  3I1U A;  2V8V A;  1JWQ A;  4UCM A;  4KSI A;  4NGM A;  3H8F A;  2YGW A;  3T8W A;  2QIR A;  2R1I A;  1IGB A;  3D66 A;  3D7F A;  4JJX A;  4A39 A;  1B6B A;  3IWE A;  4CS0 B;  1R43 A;  3R95 A;  2VL1 A;  4Q38 A;  3RBU A;  2CNS A;  3CXP A;  3CZX A;  3MGD A;  4MRI A;  4PXE A;  3V38 A;  3F0A A;  3SJG A;  1QQ9 A;  2AFW A;  1S7N A;  2EO8 A;  2BSW A;  2BO9 A;  2PSW A;  1M4G A;  3PB6 X;  4MI4 A;  2DF5 A;  2P0W A;  1A2Z A;  1VIX A;  2Z11 A;  3WT4 A;  4KOR A;  4P4D A;  3MN8 A;  2B4D B;  4QBJ A;  1ON0 A;  1IYK A;  2EK8 A;  2EWB A;  2F8H A;  5A27 A;  4QUS A;  2CTC A;  3ISX A;  5DS0 A;  3GIU A;  4UIA A;  3TT2 A;  5LRK A;  3I9S A;  5EC4 A;  3OWC A;  2OZH A;  5KTA A;  1ZO0 A;  4RS2 A;  4KSA A;  1UWY A;  3KHX A;  4UIB A;  1UFH A;  3DNS A;  3EY5 A;  3FBU A;  5CNP A;  4HNY B;  1YRE A;  1ZLI A;  1IB1 E;  3C26 A;  4GXH A;  2K5T A;  3KQZ A;  4NJR A;  2Z3O A;  2FCK A;  1IOF A;  1SQH A;  3EO4 A;  3P2F A;  5THW A;  2GRE A;  2PJC A;  3L2N A;  1TF9 A;  4P4I A;  4OP4 A;  1S7F A;  4KOY A;  1M4L A;  4P10 A;  2QVP A;  4OC3 A;  5JH9 A;  2Q7S A;  2GLF A; 
#chains in the Genus database with same CATH homology
 4C2Y A;  4XPD B;  5F49 A;  4NCZ A;  5C82 A;  2GAN A;  1Q2C A;  2YNE A;  2C27 A;  1M4I A;  1FY7 A;  3S6H A;  4ORF A;  5EBV A;  2PR8 A;  3EC4 A;  2F5I A;  2G3A A;  4BBH A;  5H84 A;  4MFP A;  2BL1 A;  4KOV A;  1MJ9 A;  4FD5 A;  4Y49 C;  3DSB A;  4M85 A;  3GYA A;  4CAF A;  4ZBG A;  4AVA A;  2Z3N A;  1M44 A;  4AG9 A;  3ZJ0 A;  2NMT A;  5E96 A;  3TOB A;  3LOD A;  3H5Z A;  3ZZI A;  2ZPA A;  3TO6 A;  1XMT A;  2B58 A;  4KUA A;  4C68 A;  4E2A A;  2R8V A;  4JLY A;  2B5G B;  1Z4E A;  5AG6 A;  4PSX A;  4KVX A;  1YVO A;  2Z3M A;  1QSM A;  3GKR A;  3JTK A;  3E0K A;  3PZJ A;  4A33 A;  2YNC C;  3H4Q A;  2D4O A;  4CGN A;  2VBQ A;  3DR8 A;  4RI1 A;  4JXQ A;  1CM0 A;  4CGL A;  1YGH A;  4B5O A;  2QEC A;  2FL4 A;  2ZW7 A;  1KZF A;  2ZW4 A;  2VXK A;  3DDD A;  2OZG A;  1K4J A;  3FRM A;  1MK4 A;  3EFA A;  1MJB A;  2PR1 A;  4KS9 A;  4CRY B;  5A28 A;  1WK4 A;  5G22 A;  3FNC A;  4HNW B;  4MFJ A;  5I0C A;  4CYO A;  3A9L A;  3WR7 A;  2DPT A;  1L0C A;  4KSF A;  4MFQ A;  4NF1 A;  5J8C A;  2GE3 A;  4UFW A;  2G3T A;  1V0C A;  2I00 A;  3P2H A;  2Q0Y A;  4CYN A;  3RYO A;  1N71 A;  3KKW A;  5BWA B;  1Z9U A;  2P6G A;  4XPL A;  3UY5 A;  4MY0 A;  4FD4 A;  1IIC A;  3R9F A;  2B3U A;  2HQY A;  2PRB A;  4PSW A;  2ATR A;  3FIX A;  4KVO E;  1NSL A;  2RC4 A;  3F8K A;  4NXY A;  4CAV A;  3BLN A;  3IGR A;  4UBR A;  5G21 A;  3PGP A;  2Z10 A;  4KOX A;  4OAD A;  4KOS A;  4KLW A;  4II9 A;  4R3K A;  4PV6 A;  4B5P A;  2AJ6 A;  1BO4 A;  4A30 A;  2B3V A;  2ARH A;  1KUX A;  2Q4Y A;  2YNC A;  3R9E A;  4UFV A;  3FB3 A;  2WPW A;  2OH1 A;  3D3S A;  4H6Z A;  1KUV A;  4IUS A;  4MFZ A;  1S5K A;  3I3G A;  1CJW A;  2Z3K A;  4F0X A;  2Y0M A;  3D2P A;  4UWJ A;  3V8I A;  4JD6 A;  4CYQ A;  4F0Y A;  4R3L A;  2WPX A;  5HH1 A;  1VKC A;  1RO5 A;  4AVC A;  1YK3 A;  2Z3P A;  3S6K A;  2FXF A;  4B5P B;  4XNH C;  4MFK A;  1S60 A;  1R57 A;  4YFJ A;  4F6A A;  3W6S A;  2Q4V A;  4YRH A;  4YGO A;  1M4D A;  2P6F A;  3LD2 A;  5G1Z A;  4XNH B;  2CNM A;  4LUA A;  1XIX A;  3D2M A;  4CAX A;  5G20 A;  1P4N A;  4CGM A;  1TIQ A;  4QC6 A;  4PK2 A;  2O28 A;  2FSR A;  3F5B A;  3IU2 A;  4U5Y A;  2IL4 A;  5KTC A;  1NE9 A;  1NMT A;  4UCN A;  4C2X A;  4XPD C;  4C2Z A;  3SXN A;  2B4B A;  5HMN A;  2HUZ A;  3IWG A;  5IV0 A;  1Z4R A;  4Q36 A;  5AGE A;  4KOT A;  4H6U A;  1GHE A;  2JLM A;  4B13 A;  2OZU A;  4PK3 A;  2OB0 A;  2VZY A;  3SHP A;  3SXO A;  3BJ7 A;  1LRZ A;  5KTD A;  1XE4 A;  2H5M A;  2A4N A;  5DWM A;  2J8N A;  3VWD A;  4MHD A;  4J3G A;  3B8G A;  1S7L A;  3TTH A;  2Z0Z A;  1MJA A;  2REE A;  4B11 A;  3GY9 A;  1QSO A;  2FIW A;  2JDC A;  1P0H A;  4KUB A;  4OLL A;  3FYN A;  3S6F A;  1VHS A;  1PUA A;  1PU9 A;  4C7H A;  2FT0 A;  4JXR A;  5ISV A;  4U9Y A;  3R96 A;  2Q7B A;  4ONU A;  4MY3 A;  3K9U A;  3VWE A;  4CGP A;  1U6M A;  5J8F A;  4FD6 A;  3JUW A;  4KOU A;  3NE7 A;  2Z3L A;  3QB8 A;  2ZW6 A;  1YLE A;  2WSA A;  4NEX A;  2VI7 A;  4JWP A;  4IF5 A;  4GS4 A;  5F48 A;  2P6E A;  3PP9 A;  4C7I A;  1M1D A;  5AG4 A;  4HKF A;  1Y9W A;  1B87 A;  2QML A;  3TCV A;  4B12 A;  4L8A A;  3IU1 A;  1YR0 A;  2Q44 A;  3TE4 A;  4QVT A;  2PC1 A;  2R7H A;  4QB9 A;  1I1D A;  4R9M A;  5AG5 A;  1Y9K A;  4KZT A;  5FVJ A;  4FD7 A;  2HV2 A;  3W6X A;  1Q2Y A;  4KLV A;  2G0B A;  1Y7R A;  2FE7 A;  5DWN A;  4X5K A;  4R57 A;  4KVM E;  2D4P A;  2VEZ A;  4I49 A;  4B10 A;  4UA3 A;  1IID A;  3W91 A;  5C88 A;  5F46 A;  4L89 A;  1I21 A;  5F47 A;  1OZP A;  2JDD A;  5H86 A;  1I12 A;  3TFY A;  4M3S A;  2AE6 A;  3TOA A;  4E0A A;  4ZGY B;  2JEV A;  2EVN A;  2GIV A;  2X7B A;  4A31 A;  2Q04 A;  4E8O A;  4AB7 A;  2B4D A;  3T90 A;  1J4J A;  4A32 A;  2B5G A;  1QST A;  4MJ8 A;  4UFX A;  3FXT A;  2FS5 A;  3JVN A;  1KUY A;  3QAH A;  4DNC A;  4MBU A;  2CNT A;  3CXS A;  2DPS A;  4K30 A;  2VQY A;  2REF A;  2CXA A;  1IYL A;  5AG7 A;  3TO9 A;  5JQ4 A;  1S7K A;  2CY2 A;  2ZXV A;  3EXN A;  3BJ8 A;  2I79 A;  4XPK A;  1XF8 A;  2J8R A;  3G3S A;  1Q2D A;  1XEB A;  2YND A;  1BOB A;  5GCN A;  2ZW5 A;  3DR6 A;  3TO7 A;  4LX9 A;  4UWI A;  3G8W A;  4CAE A;  4CGO A;  1RXT A;  2BUE A;  4R87 A;  4MFL A;  1QSN A;  2EUI A;  2OU2 A;  2KCW A;  4EVY A;  1YX0 A;  4AVB A;  5JPH A;  4UCP A;  4A2Z A;  1WWZ A;  2BEI A;  2PQ8 A;  2WUU A;  3D8P A;  2R98 A;  4AG7 A;  4B14 A;  4NSQ A;  4CYP A;  3R1K A;  1S3Z A;  4HNX B;  3N7Z A;  3CXQ A;  1YVK A;  3R9G A;  2DXQ A;  2FIA A;  4CAW A;  2PDO A;  4Y49 B;  3T9Y A;  3S6G A;  1QSR A;  4BMH A;  4KOW A;  5IX3 A;  4OAE A;  4U9Z A;  2J8M A;  4A95 A;  2VZZ A;  4H89 A;  5IB0 A;  4UCM A;  2YGW A;  2QIR A;  2R1I A;  4JJX A;  1B6B A;  3IWE A;  4CS0 B;  3R95 A;  4Q38 A;  2CNS A;  3CXP A;  3MGD A;  3F0A A;  1S7N A;  2BSW A;  2PSW A;  1M4G A;  4MI4 A;  2P0W A;  2Z11 A;  4KOR A;  2B4D B;  4QBJ A;  1ON0 A;  1IYK A;  5A27 A;  4QUS A;  3TT2 A;  3I9S A;  5EC4 A;  3OWC A;  2OZH A;  5KTA A;  1ZO0 A;  4RS2 A;  4KSA A;  1UFH A;  3DNS A;  3EY5 A;  3FBU A;  5CNP A;  4HNY B;  1YRE A;  1IB1 E;  3C26 A;  2K5T A;  2Z3O A;  2FCK A;  1SQH A;  3EO4 A;  3P2F A;  1S7F A;  4KOY A;  4CRZ B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...