4LUAA

Crystal structure of n-acetyltransferase from staphylococcus aureus mu50
Total Genus 45
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
45
sequence length
164
structure length
156
Chain Sequence
AMIEIKTLTNNDFNEYKRLVSTVNEEFTQDSHYSQTMTDTLIHDILNKCIVFGCYENETLIATAALEQIREHKSLIKYNFVTNNDKSINSELINFIINYARQNNYESLLTSIVSNNIGAKVFYSALGFDILGFEKNAIKIGNTYFDEHWLFYDLIN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Purification, crystallization and preliminary X-ray diffraction analysis of the N-acetyltransferase SAV0826 from Staphylococcus aureus.
pubmed doi rcsb
source organism Staphylococcus aureus subsp. aureus
molecule tags Transferase
molecule keywords N-acetyltransferase
total genus 45
structure length 156
sequence length 164
ec nomenclature
pdb deposition date 2013-07-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13420 Acetyltransf_4 Acetyltransferase (GNAT) domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.630.30 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Aminopeptidase 4luaA00
3DNSA 4CAXA 3G8WA 4KOSA 2JLMA 3SXOA 3JVNA 3TT2A 5FVJA 5IX3A 4JWPA 3KKWA 4CAWA 5HH1A 5I0CA 1M4DA 2R8VA 1Z9UA 4KVME 4NXYA 4K30A 4OAEA 4E2AA 2PC1A 3FBUA 4L8AA 2P6EA 4DNCA 4CAVA 3QB8A 4HNXB 2CY2A 2R1IA 2Z11A 4UA3A 2ZW6A 4RS2A 5C82A 1YX0A 2Q4YA 1P0HA 1WWZA 2Y0MA 1IB1E 3IWGA 2R7HA 3F0AA 3RYOA 4PK2A 4QVTA 2FIWA 4OADA 1MJBA 1CM0A 3TO9A 3TO6A 3CXSA 2CNSA 1QSNA 4JLYA 4KLVA 4PV6A 3D2PA 4B5PA 5F49A 3TOBA 2FS5A 4LUAA 4JJXA 4U5YA 3W6SA 1YLEA 1V0CA 1Q2YA 4AVAA 5IV0A 1P4NA 3BJ7A 4R3KA 1FY7A 2HV2A 2B5GA 2OH1A 4F0YA 2IL4A 4BMHA 2PQ8A 1RXTA 4KLWA 3W91A 4AVBA 2GE3A 3TCVA 4M85A 5E96A 3OWCA 1Y9KA 4KOTA 3EO4A 1PUAA 2I79A 1QSMA 4JXRA 2REEA 3DR6A 4H6ZA 1IICA 2AJ6A 2JDDA 4R9MA 4XPDC 3TOAA 4KUAA 1S60A 2DXQA 5DWMA 1I12A 3P2HA 5C88A 2OB0A 2B3UA 2CNMA 2QIRA 4ZBGA 4KOXA 5DWNA 3CXPA 1KUXA 1TIQA 5EBVA 4KORA 3LODA 2EVNA 4IUSA 1R57A 1Z4EA 5IB0A 2ZXVA 2GIVA 2PR1A 3WR7A 1XEBA 3CXQA 1YK3A 4B5OA 5CNPA 3R96A 4CRZB 1XMTA 3EY5A 4QB9A 5KTCA 4AG9A 4KOUA 3SXNA 1S7FA 1Y9WA 2B58A 2AE6A 2FCKA 3JUWA 4M3SA 4JXQA 2VZZA 5J8CA 1K4JA 2ZW5A 3BJ8A 1QSOA 4QC6A 5H84A 5HMNA 3EXNA 5J8FA 3V8IA 1RO5A 3K9UA 2Z0ZA 3F8KA 3ZJ0A 4MJ8A 2Q0YA 4YGOA 1B6BA 2R98A 4OLLA 4MI4A 4II9A 3DDDA 2EUIA 4XNHC 4PSXA 2D4PA 1YVKA 1B87A 2FE7A 2BUEA 1KZFA 4GS4A 3S6HA 2PRBA 2G3AA 3R1KA 3FNCA 1MK4A 2HQYA 4Y49B 1S7NA 3FXTA 1NMTA 1OZPA 3BLNA 2B4DB 3GYAA 4CS0B 1M4IA 2FIAA 5JQ4A 1Q2CA 2ZPAA 2KCWA 4R87A 5KTAA 5KTDA 5F46A 4XPKA 1M4GA 2H5MA 3FYNA 4UWIA 3P2FA 4KZTA 2FSRA 2VXKA 1S7KA 2B5GB 2I00A 4LX9A 4MHDA 3B8GA 1BO4A 2ZW7A 3DR8A 4U9YA 3TE4A 2OZHA 1LRZA 2VEZA 3F5BA 4AB7A 2Q4VA 3GY9A 3N7ZA 1IIDA 3EFAA 3PP9A 3I3GA 4H6UA 3DSBA 3D3SA 2ARHA 4YFJA 2G3TA 1N71A 4ONUA 1UFHA 1U6MA 1Y7RA 2VI7A 4JD6A 2J8RA 4FD6A 2OZGA 4QBJA 2FL4A 3QAHA 4PK3A 5F47A 4ORFA 2JDCA 2ZW4A 1WK4A 4HNYB 2F5IA 3R95A 2FXFA 5ISVA 2Q44A 2B4DA 3PGPA 4YRHA 2VBQA 4FD5A 1XIXA 3NE7A 4NSQA 2HUZA 3GKRA 2BSWA 1YREA 1L0CA 1YR0A 1NSLA 3G3SA 2B4BA 3TFYA 2D4OA 4UWJA 2PDOA 2G0BA 4E0AA 1QSTA 1GHEA 2B3VA 3TO7A 4L89A 4F6AA 1ON0A 3LD2A 5EC4A 4KOYA 5F48A 3UY5A 4U9ZA 1S7LA 2X7BA 4XPLA 2O28A 3R9FA 1XF8A 1NE9A 2RC4A 4MY0A 2VQYA 3D8PA 1I21A 2P6GA 4RI1A 3T9YA 3MGDA 2QMLA 2J8MA 1J4JA 4PSWA 2VZYA 3FB3A 1BOBA 1S5KA 3EC4A 1PU9A 3D2MA 1VHSA 3E0KA 3R9EA 4IF5A 4KVOE 4NEXA 2P6FA 1VKCA 4KUBA 2GANA 3FIXA 3TTHA 4NF1A 3S6GA 4I49A 2WPWA 1KUYA 1I1DA 4FD4A 2P0WA 2OU2A 4FD7A 3I9SA 4XPDB 3C26A 2BL1A 4X5KA 4AVCA 3R9GA 1MJAA 2C27A 2CNTA 4Y49C 1YVOA 2Q7BA 1M44A 3VWEA 4R3LA 2Q04A 1IYKA 4XNHB 4HNWB 3S6FA 5JPHA 4HKFA 2BEIA 4KOWA 2ATRA 4KVXA 3PZJA 5H86A 1IYLA 4AG7A 1S3ZA 3H4QA 2Z10A 4R57A 2WPXA 4E8OA 2FT0A 1XE4A 3T90A 3ZZIA 4H89A 2K5TA 4KOVA 1MJ9A 4B5PB 3SHPA 2NMTA 2A4NA 3FRMA 1M1DA 4MBUA 4MY3A 2PR8A 1Q2DA 1YGHA 3S6KA 2REFA 4EVYA 1QSRA 2JEVA 1Z4RA 4J3GA 5GCNA 1SQHA 1KUVA 4CRYB 4NCZA 1CJWA 3W6XA 4UBRA 2QECA 4QUSA 2J8NA 2OZUA 2PSWA 3VWDA 3IGRA
chains in the Genus database with same CATH superfamily
3DNSA 4PXDA 5I4MA 2GFQA 2ZEHA 4CAXA 3G8WA 4Q7AA 4UCNA 1NSAA 4FWUA 4KOSA 2YNDA 1PYTB 2JLMA 4DUKA 3SXOA 3JVNA 3TT2A 2BO9A 4M6HA 3NH5A 1Z8XA 3NH4A 5FVJA 5IX3A 1CP7A 2PJ2A 4JWPA 2CTCA 3KKWA 3RAMA 3KQZA 4CAWA 5HH1A 3NE8A 5I0CA 1M4DA 2R8VA 1Z9UA 4KVME 4M6IA 4NXYA 2PJCA 4K30A 4OAEA 4E2AA 2EWBA 2Z3MA 3QAYA 2JBJA 2PC1A 4UFXA 3FBUA 4L8AA 4JZ0A 2P6EA 4GXHA 4DNCA 4CAVA 1VIXA 3QB8A 4HNXB 2ZENA 7CPAA 4BINA 2F7VA 4C2XA 4C7IA 2CY2A 2R1IA 4UFWA 2Z11A 4UA3A 1CPSA 2ZW6A 4RS2A 5C82A 4MFPA 1YX0A 2Q4YA 1P0HA 1WWZA 3L2NA 1ELLP 4PXCA 3ISZA 3IWWA 2Y0MA 2AFOA 1ZG8A 1IB1E 3IWGA 2R7HA 3F0AA 3RYOA 1LFWA 4PK2A 5AGEA 4MFKA 4QVTA 2FIWA 4MFQA 4OADA 4CAEA 1MJBA 1CM0A 1UWYA 2V8GA 5G21A 4B11A 5K8OA 4A39A 3PEIA 1F2OA 3JRUA 3TO9A 3TO6A 3CXSA 4EFDA 1ZG9A 2CNSA 5HXDA 1QSNA 3D7HA 4JLYA 4KLVA 4PV6A 3D2PA 4B5PA 1CX8A 1ARLA 5D29A 5F49A 1GYTA 4B13A 1YW4A 3TOBA 2PVVA 2FS5A 4LUAA 4JJXA 4U5YA 3W6SA 1HEEA 4CGPA 5A28A 1TXRA 3KQXA 1BAVA 2NSMA 4CGLA 1YLEA 2NYQA 3GIUA 2CXAA 3IEHA 1YMEA 4OKOA 2OOTA 1V0CA 4MCPA 4HPSA 2ZEFA 1Q2YA 3FX6A 3IU1A 4AVAA 3CPXA 3LACA 4TNUA 4P4DA 5IV0A 2AFMA 1P4NA 3BJ7A 3B7IA 4R3KA 1FY7A 4BD9A 4CGOA 4NGNA 2HV2A 3I1UA 3PBEA 4FAIA 1XBUA 4YU9A 2B5GA 2OH1A 4OC1A 4F0YA 3WC7A 5AG7A 4A33A 2IL4A 4BMHA 3IC1A 4P45A 4UEFA 2IJZA 2CTBA 2PQ8A 3CDXA 3S9NA 1RXTA 4KLWA 2Q43A 3W91A 4AVBA 2YNCC 3KGQA 5JH9A 3DLJA 2GE3A 4NGMA 3TCVA 4M85A 4IHMA 1YQEA 3B3TA 5E96A 2GLJA 3B3CA 4CGNA 3OWCA 4NGTA 1Y9KA 4KOTA 2V8HA 3EO4A 3BXMA 1PUAA 1QQ9A 2I79A 1Y0YA 1QSMA 2XEGA 4OC0A 1AYEA 5K8PA 2QYVA 2REEA 3DR6A 4JXRA 4H6ZA 1IICA 2AJ6A 2JDDA 4R9MA 4XPDC 3TOAA 4KUAA 1S60A 3CPAA 2DXQA 2ZEOA 5DWMA 3BI1A 1I12A 1H8LA 3GB0A 3P2HA 5C88A 4LQ6A 3WC5A 2OB0A 4WWVA 3V7ZA 2B3UA 2PCUA 3K2KA 4MCSA 3S9MA 4C68A 2CNMA 2QIRA 4ZBGA 4KOXA 2HC9A 3H8GA 4F8ZA 5DWNA 3CXPA 1KUXA 1TIQA 5K8MA 5LRKA 5EBVA 4KORA 3LODA 4P4IA 2EVNA 1R3NA 2DEAA 4IUSA 1R57A 1Z4EA 3GLJA 4GM5A 4ZY2A 5IB0A 2GREA 4ZGYB 2XEJA 2GIVA 2ZXVA 4A95A 2PR1A 3WR7A 4ZYQA 3HUVA 1XEBA 3CXQA 2Z3NA 5AG4A 1YK3A 4B5OA 5CNPA 2GLFA 2V77A 2ZEEA 3PB8X 3R96A 5J1QA 4CRZB 1DTDA 1XMTA 3EY5A 4NGRA 4QB9A 5KTCA 5F09A 2CIJA 4ZX9A 4AG9A 3SJEA 1Z8WA 3KHXA 4P4JA 4KOUA 4P4BA 4A32A 4C7HA 3SXNA 5ELYA 2WYRA 1S7FA 1Y9WA 4CPAA 2B58A 1IU8A 2AE6A 2FCKA 3JUWA 4M3SA 4JXQA 1YSJA 4MRIA 3VATA 4A37A 1TF8A 2Z3PA 4CGMA 1BPNA 2VZZA 5J8CA 1K4JA 2Z3OA 3PB4X 4X2TA 2PJAA 2OR4A 2ZW5A 2Z3LA 3PBBA 3BJ8A 1QSOA 3QNVA 4QC6A 5H84A 1BLLE 3EXNA 5HMNA 4UIBA 3V8IA 5J8FA 4CAFA 2PJ7A 1RO5A 4CYQA 2O53A 3K9UA 1LAPA 2Z0ZA 2ABZA 3F8KA 3ZJ0A 4MJ8A 4MMOA 4RN7A 2WSAA 3NA6A 5CPAA 2Q0YA 4UCPA 4YGOA 1B6BA 2R98A 3IFEA 3WABA 4OLLA 4PPZA 4MI4A 1XRYA 4R7MA 4II9A 4UFVA 4X8IA 3IIBA 5HVGA 3DDDA 2EUIA 4XNHC 4PSXA 2ZELA 2D4PA 1YVKA 5G22A 1B87A 2PJ0A 2FE7A 3NH8A 2POKA 2BUEA 4B14A 1X10A 4B6ZA 3SJXA 3RBUA 1KZFA 3ISXA 5AG6A 4GS4A 3FEEA 3B3VA 3S6HA 2PRBA 1ELMP 2G3AA 3R1KA 1LCPA 5THWA 3FNCA 2O4HA 4NGQA 1MK4A 1CG2A 2HQYA 4Y49B 2XEFA 4EMEA 4OMEA 3NFZA 1S7NA 4UF4A 1VHOA 3FXTA 1NMTA 4MCQA 2C6GA 2JBKA 1OZPA 3BLNA 2C6CA 1OBRA 2Q7SA 4A30A 2B4DB 3GYAA 4CS0B 2AFUA 1M4IA 1RTQA 4DYOA 4R6TA 2FIAA 5JQ4A 1Q2CA 3SI0A 4A2ZA 2ZPAA 2KCWA 3KR4A 2PIZA 3FJUA 4R87A 5KTAA 4MHYA 5KTDA 5F46A 2EBJA 2EK8A 4XPKA 1M4GA 2H5MA 4RUHA 3FYNA 4UWIA 3B3WA 3P2FA 1IGBA 1Z8TA 4KZTA 3TC8A 2AFWA 2PJ5A 3KASA 2FSRA 2VXKA 1S7KA 3PFOA 4WJBA 2B5GB 2I00A 4LX9A 4MHDA 2Q4ZA 2PVWA 2ZEPA 3B8GA 2PE3A 4LQGA 2DPTA 4MFJA 3B2YA 1DE4C 4OC2A 5HVFA 1XOVA 2PJ4A 1BO4A 2WZNA 3KHZA 2ZW7A 1XJOA 1ZLIA 4R76A 4P4EA 3PFEA 3DR8A 3D7GA 4U9YA 5IB9A 3TE4A 2OZHA 4PQAA 1LRZA 2VEZA 1BPMA 3F5BA 4AB7A 2Q4VA 3FVLA 3GY9A 3N7ZA 1IIDA 1EE3P 2IQ6A 3EFAA 3I3GA 3PP9A 4H6UA 3DSBA 3CT9A 3B3SA 3D3SA 2ARHA 4YFJA 1Z5RA 5LYIA 4MFZA 2G3TA 1N71A 4OP4A 4ONUA 5G1ZA 3T8WA 1ZO0A 4UEEA 1UFHA 4FBEA 1U6MA 2RB7A 1Y7RA 3TX8A 3RO0A 2VI7A 4JD6A 3PB6X 2J8RA 4FD6A 2OZGA 4QBJA 2FL4A 4K3NA 4NFRA 3QAHA 4CYOA 1Z8LA 6CPAA 3D68A 4PK3A 4CYPA 2JEWA 3FECA 4NJQA 5F47A 4ORFA 1R43A 2JDCA 5AG5A 1YW6A 1ARMA 2ZW4A 1VHEA 3A9LA 3KZWA 1AUGA 1WK4A 4HNYB 4UEZA 2F5IA 3R95A 4A38A 2FXFA 2YGWA 3KR5A 5ISVA 3MN8A 2Q44A 2B4DA 4OC4A 2PJ1A 3PGPA 1LOKA 5LRGA 4YRHA 2EK9A 2VBQA 4FD5A 1LANA 4OC5A 1XIXA 3K9TA 2ZOGA 3NE7A 3IWEA 4NSQA 4P10A 4PXEA 2HUZA 3GKRA 3BHXA 1IY7A 2BSWA 3PB7X 1YREA 4ZI6A 4C2ZA 1LAMA 1L0CA 3GUXA 1YR0A 1NSLA 3G3SA 1KWMA 2B4BA 3TFYA 4B12A 4MCRA 2D4OA 4MHNA 4UWJA 5JGFA 3D7FA 3IO1A 2PDOA 2G0BA 3D4UA 3H5ZA 4E0AA 2ZOFA 2HB6A 1GHEA 1QSTA 3SI1A 1YLOA 1ZG7A 1M4LA 3SJGA 2B3VA 3TO7A 4L89A 5LRJA 5D8NA 4F6AA 1ON0A 2F8HA 3LD2A 2DF5A 3SJFA 5EC4A 4KOYA 5F48A 3UY5A 2BOAA 4U9ZA 1S7LA 2PJ3A 2X7BA 4XPLA 2C6PA 2O28A 2XEIA 3R9FA 1XF8A 3VH9A 5EMIA 1NE9A 2RC4A 4MY0A 2PJBA 4Z65A 2VQYA 3D8PA 4B10A 4IK2A 1I21A 4YWYA 2P6GA 4KS9A 4RI1A 3T9YA 4OIDA 3MGDA 2QMLA 4W9YA 1TKHA 2AFSA 2J8MA 3HLPA 5K8NA 1J4JA 2I3CA 3FF3A 5DS0A 5A27A 4PSWA 2VZYA 2ZEGA 2V8DA 2VL1A 3FB3A 1BOBA 4MFLA 1CBXA 4Q38A 1S5KA 1VGYA 2Z3KA 4ZY1A 3EC4A 1PU9A 3D2MA 1X12A 4IAVA 3LWUA 3D7DA 4OC3A 1VHSA 3E0KA 3R9EA 4IF5A 4KVOE 4JYWA 4NEXA 2P6FA 4AXVA 4F0XA 5LYLA 1VKCA 4CYNA 4KUBA 1PCAA 3VARA 2GANA 3FIXA 3IJ3A 3PRTA 4NF1A 4ONWA 4Q36A 1FNOA 2PRQA 3S6GA 3TTHA 4I49A 2WPWA 1KUYA 4FUUA 5CBMA 1I1DA 1HDUA 1IOFA 2Q51A 2GU2A 3KL9A 3SI2A 4FD4A 4ZY0A 1Z2LA 3S9LA 3WC6A 1TF9A 2P0WA 2OU2A 2QJ8A 3I9SA 4FD7A 4XPDB 3V38A 3C26A 4A94A 2BL1A 4P44A 2FVGA 4X5KA 5LYDA 4AVCA 2ZEMA 4NGSA 1MJAA 3R9GA 2C27A 2CNTA 4NJRA 4Y49C 1YVOA 3WT4A 3N5FA 2Q7BA 4C2YA 2AFZA 2YNEA 4EWTA 4O23A 4TWEA 3PB9X 3KI9A 1ZLHA 3RZAA 4KSIA 1M44A 2C1CA 3VWEA 2ODFA 4R3LA 2CF4A 2Q04A 1IYKA 1TKFA 8CPAA 2PJ9A 3B35A 4XNHB 4UCMA 1Q7LA 4HNWB 4BBHA 4KSFA 3S6FA 1Y0RA 5JPHA 2ANPA 4HKFA 1JWQA 2BEIA 1CP6A 3FMCA 4KOWA 2YNCA 4R8FA 5HVHA 5LYFA 4P4FA 2ATRA 1HDQA 3RNZA 3DGVA 3H8EA 4KVXA 5G20A 1QMUA 3PZJA 5H86A 1IYLA 1CPXA 4AG7A 4DJLA 1S3ZA 3H4QA 2BCOA 4MXUA 2Z10A 1XFOA 3H8FA 4P6YA 1F2PA 4R57A 4UIAA 2QVPA 2WPXA 4NGPA 4MHZA 1XMBA 1F57A 4E8OA 3BI0A 2FT0A 3FEDA 1XE4A 2WUUA 2ZEDA 4KSAA 4A31A 3T90A 3ZZIA 4H89A 2K5TA 4KOVA 2PJ8A 1MJ9A 2V8VA 4B5PB 2DPSA 3SHPA 3LMSA 4ZX8A 1Y7EA 2NMTA 2A4NA 1AMPA 1JQGA 1A2ZA 2IMOA 3FRMA 4G1PA 1M1DA 4MBUA 4MY3A 1IOIA 1FT7A 3CZXA 2EO8A 2PR8A 1Q2DA 1YGHA 4PXBA 2PIYA 4MHPA 3S6KA 2REFA 4EVYA 2PJ6A 4F9VA 2JEVA 1QSRA 1Z4RA 2J9AA 3D66A 3JTKA 4J3GA 1SQHA 5GCNA 2RFHA 1KUVA 4CRYB 3FH4A 4NCZA 1CJWA 3W6XA 2AFXA 3IU2A 4M6GA 4UBRA 4X3RA 2QECA 4QUSA 2J8NA 5BWAB 1TKJA 2OZUA 2PSWA 4OIWA 4F9UA 3MRUA 3VWDA 3IGRA 4H2KA 3D67A 2G9DA 5JM6A
chains in the Genus database with same CATH topology
3DNSA 4CAXA 3G8WA 4UCNA 4KOSA 2YNDA 2JLMA 3SXOA 3JVNA 3TT2A 5FVJA 5IX3A 4JWPA 3KKWA 4CAWA 5HH1A 5I0CA 1M4DA 2R8VA 1Z9UA 4KVME 4NXYA 4K30A 4OAEA 4E2AA 2Z3MA 2PC1A 4UFXA 3FBUA 4L8AA 2P6EA 4DNCA 4CAVA 3QB8A 4HNXB 4C2XA 4C7IA 2CY2A 2R1IA 4UFWA 2Z11A 4UA3A 2ZW6A 4RS2A 5C82A 4MFPA 1YX0A 2Q4YA 1P0HA 1WWZA 2Y0MA 1IB1E 3IWGA 2R7HA 3F0AA 3RYOA 4PK2A 5AGEA 4MFKA 4QVTA 2FIWA 4MFQA 4OADA 4CAEA 1MJBA 1CM0A 5G21A 4B11A 3TO9A 3TO6A 3CXSA 2CNSA 1QSNA 4JLYA 4KLVA 4PV6A 3D2PA 4B5PA 5F49A 4B13A 3TOBA 2FS5A 4LUAA 4JJXA 4U5YA 3W6SA 4CGPA 5A28A 4CGLA 1YLEA 2CXAA 1V0CA 1Q2YA 3IU1A 4AVAA 5IV0A 1P4NA 3BJ7A 4R3KA 1FY7A 4CGOA 2HV2A 2B5GA 2OH1A 4F0YA 5AG7A 4A33A 2IL4A 4BMHA 2PQ8A 1RXTA 4KLWA 3W91A 4AVBA 2YNCC 2GE3A 3TCVA 4M85A 5E96A 4CGNA 3OWCA 1Y9KA 4KOTA 3EO4A 1PUAA 2I79A 1QSMA 4JXRA 2REEA 3DR6A 4H6ZA 1IICA 2AJ6A 2JDDA 4R9MA 4XPDC 3TOAA 4KUAA 1S60A 2DXQA 5DWMA 1I12A 3P2HA 5C88A 2OB0A 2B3UA 4C68A 2CNMA 2QIRA 4ZBGA 4KOXA 5DWNA 3CXPA 1KUXA 1TIQA 5EBVA 4KORA 3LODA 2EVNA 4IUSA 1R57A 1Z4EA 5IB0A 4ZGYB 2ZXVA 2GIVA 4A95A 2PR1A 3WR7A 1XEBA 3CXQA 2Z3NA 5AG4A 1YK3A 4B5OA 5CNPA 3R96A 4CRZB 1XMTA 3EY5A 4QB9A 5KTCA 4AG9A 4KOUA 4A32A 4C7HA 3SXNA 1S7FA 1Y9WA 2B58A 2AE6A 2FCKA 3JUWA 4M3SA 4JXQA 2Z3PA 4CGMA 2VZZA 5J8CA 1K4JA 2Z3OA 2ZW5A 2Z3LA 3BJ8A 1QSOA 4QC6A 5H84A 5HMNA 3EXNA 5J8FA 3V8IA 4CAFA 1RO5A 4CYQA 3K9UA 2Z0ZA 3F8KA 3ZJ0A 4MJ8A 2WSAA 2Q0YA 4UCPA 4YGOA 1B6BA 2R98A 4OLLA 4MI4A 4II9A 4UFVA 3DDDA 2EUIA 4XNHC 4PSXA 2D4PA 1YVKA 5G22A 1B87A 2FE7A 2BUEA 4B14A 1KZFA 5AG6A 4GS4A 3S6HA 2PRBA 2G3AA 3R1KA 3FNCA 1MK4A 2HQYA 4Y49B 1S7NA 3FXTA 1NMTA 1OZPA 3BLNA 4A30A 2B4DB 3GYAA 4CS0B 1M4IA 2FIAA 5JQ4A 1Q2CA 4A2ZA 2ZPAA 2KCWA 4R87A 5KTAA 5KTDA 5F46A 4XPKA 1M4GA 2H5MA 3FYNA 4UWIA 3P2FA 4KZTA 2FSRA 2VXKA 1S7KA 2B5GB 2I00A 4LX9A 4MHDA 3B8GA 2DPTA 4MFJA 1BO4A 2ZW7A 3DR8A 4U9YA 3TE4A 2OZHA 1LRZA 2VEZA 3F5BA 4AB7A 2Q4VA 3GY9A 3N7ZA 1IIDA 3EFAA 3PP9A 3I3GA 4H6UA 3DSBA 3D3SA 2ARHA 4YFJA 4MFZA 2G3TA 1N71A 4ONUA 5G1ZA 1ZO0A 1UFHA 1U6MA 1Y7RA 2VI7A 4JD6A 2J8RA 4FD6A 2OZGA 4QBJA 2FL4A 4CYOA 3QAHA 4PK3A 4CYPA 5F47A 4ORFA 2JDCA 5AG5A 2ZW4A 3A9LA 1WK4A 4HNYB 2F5IA 3R95A 2FXFA 2YGWA 5ISVA 2Q44A 2B4DA 3PGPA 4YRHA 2VBQA 4FD5A 1XIXA 3NE7A 3IWEA 4NSQA 2HUZA 3GKRA 2BSWA 1YREA 4C2ZA 1L0CA 1YR0A 1NSLA 3G3SA 2B4BA 3TFYA 4B12A 2D4OA 4UWJA 2PDOA 2G0BA 3H5ZA 4E0AA 1QSTA 1GHEA 2B3VA 3TO7A 4L89A 4F6AA 1ON0A 3LD2A 5EC4A 4KOYA 5F48A 3UY5A 4U9ZA 1S7LA 2X7BA 4XPLA 2O28A 3R9FA 1XF8A 1NE9A 2RC4A 4MY0A 2VQYA 3D8PA 4B10A 1I21A 2P6GA 4KS9A 4RI1A 3T9YA 3MGDA 2QMLA 2J8MA 1J4JA 5A27A 4PSWA 2VZYA 3FB3A 4MFLA 1BOBA 4Q38A 1S5KA 2Z3KA 3EC4A 1PU9A 3D2MA 1VHSA 3E0KA 3R9EA 4IF5A 4KVOE 4NEXA 2P6FA 4F0XA 1VKCA 4CYNA 4KUBA 2GANA 3FIXA 3TTHA 4NF1A 4Q36A 3S6GA 4I49A 2WPWA 1KUYA 1I1DA 4FD4A 2P0WA 2OU2A 4FD7A 3I9SA 4XPDB 3C26A 2BL1A 4X5KA 4AVCA 3R9GA 1MJAA 2C27A 2CNTA 4Y49C 1YVOA 4C2YA 2Q7BA 2YNEA 1M44A 3VWEA 4R3LA 2Q04A 1IYKA 4XNHB 4UCMA 4HNWB 4BBHA 4KSFA 3S6FA 5JPHA 4HKFA 2BEIA 4KOWA 2YNCA 2ATRA 4KVXA 5G20A 3PZJA 5H86A 1IYLA 4AG7A 1S3ZA 3H4QA 2Z10A 4R57A 2WPXA 4E8OA 2FT0A 1XE4A 2WUUA 4KSAA 4A31A 3T90A 3ZZIA 4H89A 2K5TA 4KOVA 1MJ9A 4B5PB 2DPSA 3SHPA 2NMTA 2A4NA 3FRMA 1M1DA 4MBUA 4MY3A 2PR8A 1Q2DA 1YGHA 3S6KA 2REFA 4EVYA 1QSRA 2JEVA 1Z4RA 4J3GA 3JTKA 5GCNA 1SQHA 1KUVA 4CRYB 4NCZA 1CJWA 3W6XA 3IU2A 4UBRA 2QECA 4QUSA 2J8NA 5BWAB 2OZUA 2PSWA 3VWDA 3IGRA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3DNS A;  4CAX A;  3G8W A;  4KOS A;  2JLM A;  3SXO A;  3JVN A;  3TT2 A;  5FVJ A;  5IX3 A;  4JWP A;  3KKW A;  4CAW A;  5HH1 A;  5I0C A;  1M4D A;  2R8V A;  1Z9U A;  4KVM E;  4NXY A;  4K30 A;  4OAE A;  4E2A A;  2PC1 A;  3FBU A;  4L8A A;  2P6E A;  4DNC A;  4CAV A;  3QB8 A;  4HNX B;  2CY2 A;  2R1I A;  2Z11 A;  4UA3 A;  2ZW6 A;  4RS2 A;  5C82 A;  1YX0 A;  2Q4Y A;  1P0H A;  1WWZ A;  2Y0M A;  1IB1 E;  3IWG A;  2R7H A;  3F0A A;  3RYO A;  4PK2 A;  4QVT A;  2FIW A;  4OAD A;  1MJB A;  1CM0 A;  3TO9 A;  3TO6 A;  3CXS A;  2CNS A;  1QSN A;  4JLY A;  4KLV A;  4PV6 A;  3D2P A;  4B5P A;  5F49 A;  3TOB A;  2FS5 A;  4LUA A;  4JJX A;  4U5Y A;  3W6S A;  1YLE A;  1V0C A;  1Q2Y A;  4AVA A;  5IV0 A;  1P4N A;  3BJ7 A;  4R3K A;  1FY7 A;  2HV2 A;  2B5G A;  2OH1 A;  4F0Y A;  2IL4 A;  4BMH A;  2PQ8 A;  1RXT A;  4KLW A;  3W91 A;  4AVB A;  2GE3 A;  3TCV A;  4M85 A;  5E96 A;  3OWC A;  1Y9K A;  4KOT A;  3EO4 A;  1PUA A;  2I79 A;  1QSM A;  4JXR A;  2REE A;  3DR6 A;  4H6Z A;  1IIC A;  2AJ6 A;  2JDD A;  4R9M A;  4XPD C;  3TOA A;  4KUA A;  1S60 A;  2DXQ A;  5DWM A;  1I12 A;  3P2H A;  5C88 A;  2OB0 A;  2B3U A;  2CNM A;  2QIR A;  4ZBG A;  4KOX A;  5DWN A;  3CXP A;  1KUX A;  1TIQ A;  5EBV A;  4KOR A;  3LOD A;  2EVN A;  4IUS A;  1R57 A;  1Z4E A;  5IB0 A;  2ZXV A;  2GIV A;  2PR1 A;  3WR7 A;  1XEB A;  3CXQ A;  1YK3 A;  4B5O A;  5CNP A;  3R96 A;  4CRZ B;  1XMT A;  3EY5 A;  4QB9 A;  5KTC A;  4AG9 A;  4KOU A;  3SXN A;  1S7F A;  1Y9W A;  2B58 A;  2AE6 A;  2FCK A;  3JUW A;  4M3S A;  4JXQ A;  2VZZ A;  5J8C A;  1K4J A;  2ZW5 A;  3BJ8 A;  1QSO A;  4QC6 A;  5H84 A;  5HMN A;  3EXN A;  5J8F A;  3V8I A;  1RO5 A;  3K9U A;  2Z0Z A;  3F8K A;  3ZJ0 A;  4MJ8 A;  2Q0Y A;  4YGO A;  1B6B A;  2R98 A;  4OLL A;  4MI4 A;  4II9 A;  3DDD A;  2EUI A;  4XNH C;  4PSX A;  2D4P A;  1YVK A;  1B87 A;  2FE7 A;  2BUE A;  1KZF A;  4GS4 A;  3S6H A;  2PRB A;  2G3A A;  3R1K A;  3FNC A;  1MK4 A;  2HQY A;  4Y49 B;  1S7N A;  3FXT A;  1NMT A;  1OZP A;  3BLN A;  2B4D B;  3GYA A;  4CS0 B;  1M4I A;  2FIA A;  5JQ4 A;  1Q2C A;  2ZPA A;  2KCW A;  4R87 A;  5KTA A;  5KTD A;  5F46 A;  4XPK A;  1M4G A;  2H5M A;  3FYN A;  4UWI A;  3P2F A;  4KZT A;  2FSR A;  2VXK A;  1S7K A;  2B5G B;  2I00 A;  4LX9 A;  4MHD A;  3B8G A;  1BO4 A;  2ZW7 A;  3DR8 A;  4U9Y A;  3TE4 A;  2OZH A;  1LRZ A;  2VEZ A;  3F5B A;  4AB7 A;  2Q4V A;  3GY9 A;  3N7Z A;  1IID A;  3EFA A;  3PP9 A;  3I3G A;  4H6U A;  3DSB A;  3D3S A;  2ARH A;  4YFJ A;  2G3T A;  1N71 A;  4ONU A;  1UFH A;  1U6M A;  1Y7R A;  2VI7 A;  4JD6 A;  2J8R A;  4FD6 A;  2OZG A;  4QBJ A;  2FL4 A;  3QAH A;  4PK3 A;  5F47 A;  4ORF A;  2JDC A;  2ZW4 A;  1WK4 A;  4HNY B;  2F5I A;  3R95 A;  2FXF A;  5ISV A;  2Q44 A;  2B4D A;  3PGP A;  4YRH A;  2VBQ A;  4FD5 A;  1XIX A;  3NE7 A;  4NSQ A;  2HUZ A;  3GKR A;  2BSW A;  1YRE A;  1L0C A;  1YR0 A;  1NSL A;  3G3S A;  2B4B A;  3TFY A;  2D4O A;  4UWJ A;  2PDO A;  2G0B A;  4E0A A;  1QST A;  1GHE A;  2B3V A;  3TO7 A;  4L89 A;  4F6A A;  1ON0 A;  3LD2 A;  5EC4 A;  4KOY A;  5F48 A;  3UY5 A;  4U9Z A;  1S7L A;  2X7B A;  4XPL A;  2O28 A;  3R9F A;  1XF8 A;  1NE9 A;  2RC4 A;  4MY0 A;  2VQY A;  3D8P A;  1I21 A;  2P6G A;  4RI1 A;  3T9Y A;  3MGD A;  2QML A;  2J8M A;  1J4J A;  4PSW A;  2VZY A;  3FB3 A;  1BOB A;  1S5K A;  3EC4 A;  1PU9 A;  3D2M A;  1VHS A;  3E0K A;  3R9E A;  4IF5 A;  4KVO E;  4NEX A;  2P6F A;  1VKC A;  4KUB A;  2GAN A;  3FIX A;  3TTH A;  4NF1 A;  3S6G A;  4I49 A;  2WPW A;  1KUY A;  1I1D A;  4FD4 A;  2P0W A;  2OU2 A;  4FD7 A;  3I9S A;  4XPD B;  3C26 A;  2BL1 A;  4X5K A;  4AVC A;  3R9G A;  1MJA A;  2C27 A;  2CNT A;  4Y49 C;  1YVO A;  2Q7B A;  1M44 A;  3VWE A;  4R3L A;  2Q04 A;  1IYK A;  4XNH B;  4HNW B;  3S6F A;  5JPH A;  4HKF A;  2BEI A;  4KOW A;  2ATR A;  4KVX A;  3PZJ A;  5H86 A;  1IYL A;  4AG7 A;  1S3Z A;  3H4Q A;  2Z10 A;  4R57 A;  2WPX A;  4E8O A;  2FT0 A;  1XE4 A;  3T90 A;  3ZZI A;  4H89 A;  2K5T A;  4KOV A;  1MJ9 A;  4B5P B;  3SHP A;  2NMT A;  2A4N A;  3FRM A;  1M1D A;  4MBU A;  4MY3 A;  2PR8 A;  1Q2D A;  1YGH A;  3S6K A;  2REF A;  4EVY A;  1QSR A;  2JEV A;  1Z4R A;  4J3G A;  5GCN A;  1SQH A;  1KUV A;  4CRY B;  4NCZ A;  1CJW A;  3W6X A;  4UBR A;  2QEC A;  4QUS A;  2J8N A;  2OZU A;  2PSW A;  3VWD A;  3IGR A; 
#chains in the Genus database with same CATH topology
 3DNS A;  4PXD A;  5I4M A;  2GFQ A;  2ZEH A;  4CAX A;  3G8W A;  4Q7A A;  4UCN A;  1NSA A;  4FWU A;  4KOS A;  2YND A;  1PYT B;  2JLM A;  4DUK A;  3SXO A;  3JVN A;  3TT2 A;  2BO9 A;  4M6H A;  3NH5 A;  1Z8X A;  3NH4 A;  5FVJ A;  5IX3 A;  1CP7 A;  2PJ2 A;  4JWP A;  2CTC A;  3KKW A;  3RAM A;  3KQZ A;  4CAW A;  5HH1 A;  3NE8 A;  5I0C A;  1M4D A;  2R8V A;  1Z9U A;  4KVM E;  4M6I A;  4NXY A;  2PJC A;  4K30 A;  4OAE A;  4E2A A;  2EWB A;  2Z3M A;  3QAY A;  2JBJ A;  2PC1 A;  4UFX A;  3FBU A;  4L8A A;  4JZ0 A;  2P6E A;  4GXH A;  4DNC A;  4CAV A;  1VIX A;  3QB8 A;  4HNX B;  2ZEN A;  7CPA A;  4BIN A;  2F7V A;  4C2X A;  4C7I A;  2CY2 A;  2R1I A;  4UFW A;  2Z11 A;  4UA3 A;  1CPS A;  2ZW6 A;  4RS2 A;  5C82 A;  4MFP A;  1YX0 A;  2Q4Y A;  1P0H A;  1WWZ A;  3L2N A;  1ELL P;  4PXC A;  3ISZ A;  3IWW A;  2Y0M A;  2AFO A;  1ZG8 A;  1IB1 E;  3IWG A;  2R7H A;  3F0A A;  3RYO A;  1LFW A;  4PK2 A;  5AGE A;  4MFK A;  4QVT A;  2FIW A;  4MFQ A;  4OAD A;  4CAE A;  1MJB A;  1CM0 A;  1UWY A;  2V8G A;  5G21 A;  4B11 A;  5K8O A;  4A39 A;  3PEI A;  1F2O A;  3JRU A;  3TO9 A;  3TO6 A;  3CXS A;  4EFD A;  1ZG9 A;  2CNS A;  5HXD A;  1QSN A;  3D7H A;  4JLY A;  4KLV A;  4PV6 A;  3D2P A;  4B5P A;  1CX8 A;  1ARL A;  5D29 A;  5F49 A;  1GYT A;  4B13 A;  1YW4 A;  3TOB A;  2PVV A;  2FS5 A;  4LUA A;  4JJX A;  4U5Y A;  3W6S A;  1HEE A;  4CGP A;  5A28 A;  1TXR A;  3KQX A;  1BAV A;  2NSM A;  4CGL A;  1YLE A;  2NYQ A;  3GIU A;  2CXA A;  3IEH A;  1YME A;  4OKO A;  2OOT A;  1V0C A;  4MCP A;  4HPS A;  2ZEF A;  1Q2Y A;  3FX6 A;  3IU1 A;  4AVA A;  3CPX A;  3LAC A;  4TNU A;  4P4D A;  5IV0 A;  2AFM A;  1P4N A;  3BJ7 A;  3B7I A;  4R3K A;  1FY7 A;  4BD9 A;  4CGO A;  4NGN A;  2HV2 A;  3I1U A;  3PBE A;  4FAI A;  1XBU A;  4YU9 A;  2B5G A;  2OH1 A;  4OC1 A;  4F0Y A;  3WC7 A;  5AG7 A;  4A33 A;  2IL4 A;  4BMH A;  3IC1 A;  4P45 A;  4UEF A;  2IJZ A;  2CTB A;  2PQ8 A;  3CDX A;  3S9N A;  1RXT A;  4KLW A;  2Q43 A;  3W91 A;  4AVB A;  2YNC C;  3KGQ A;  5JH9 A;  3DLJ A;  2GE3 A;  4NGM A;  3TCV A;  4M85 A;  4IHM A;  1YQE A;  3B3T A;  5E96 A;  2GLJ A;  3B3C A;  4CGN A;  3OWC A;  4NGT A;  1Y9K A;  4KOT A;  2V8H A;  3EO4 A;  3BXM A;  1PUA A;  1QQ9 A;  2I79 A;  1Y0Y A;  1QSM A;  2XEG A;  4OC0 A;  1AYE A;  5K8P A;  2QYV A;  2REE A;  3DR6 A;  4JXR A;  4H6Z A;  1IIC A;  2AJ6 A;  2JDD A;  4R9M A;  4XPD C;  3TOA A;  4KUA A;  1S60 A;  3CPA A;  2DXQ A;  2ZEO A;  5DWM A;  3BI1 A;  1I12 A;  1H8L A;  3GB0 A;  3P2H A;  5C88 A;  4LQ6 A;  3WC5 A;  2OB0 A;  4WWV A;  3V7Z A;  2B3U A;  2PCU A;  3K2K A;  4MCS A;  3S9M A;  4C68 A;  2CNM A;  2QIR A;  4ZBG A;  4KOX A;  2HC9 A;  3H8G A;  4F8Z A;  5DWN A;  3CXP A;  1KUX A;  1TIQ A;  5K8M A;  5LRK A;  5EBV A;  4KOR A;  3LOD A;  4P4I A;  2EVN A;  1R3N A;  2DEA A;  4IUS A;  1R57 A;  1Z4E A;  3GLJ A;  4GM5 A;  4ZY2 A;  5IB0 A;  2GRE A;  4ZGY B;  2XEJ A;  2GIV A;  2ZXV A;  4A95 A;  2PR1 A;  3WR7 A;  4ZYQ A;  3HUV A;  1XEB A;  3CXQ A;  2Z3N A;  5AG4 A;  1YK3 A;  4B5O A;  5CNP A;  2GLF A;  2V77 A;  2ZEE A;  3PB8 X;  3R96 A;  5J1Q A;  4CRZ B;  1DTD A;  1XMT A;  3EY5 A;  4NGR A;  4QB9 A;  5KTC A;  5F09 A;  2CIJ A;  4ZX9 A;  4AG9 A;  3SJE A;  1Z8W A;  3KHX A;  4P4J A;  4KOU A;  4P4B A;  4A32 A;  4C7H A;  3SXN A;  5ELY A;  2WYR A;  1S7F A;  1Y9W A;  4CPA A;  2B58 A;  1IU8 A;  2AE6 A;  2FCK A;  3JUW A;  4M3S A;  4JXQ A;  1YSJ A;  4MRI A;  3VAT A;  4A37 A;  1TF8 A;  2Z3P A;  4CGM A;  1BPN A;  2VZZ A;  5J8C A;  1K4J A;  2Z3O A;  3PB4 X;  4X2T A;  2PJA A;  2OR4 A;  2ZW5 A;  2Z3L A;  3PBB A;  3BJ8 A;  1QSO A;  3QNV A;  4QC6 A;  5H84 A;  1BLL E;  3EXN A;  5HMN A;  4UIB A;  3V8I A;  5J8F A;  4CAF A;  2PJ7 A;  1RO5 A;  4CYQ A;  2O53 A;  3K9U A;  1LAP A;  2Z0Z A;  2ABZ A;  3F8K A;  3ZJ0 A;  4MJ8 A;  4MMO A;  4RN7 A;  2WSA A;  3NA6 A;  5CPA A;  2Q0Y A;  4UCP A;  4YGO A;  1B6B A;  2R98 A;  3IFE A;  3WAB A;  4OLL A;  4PPZ A;  4MI4 A;  1XRY A;  4R7M A;  4II9 A;  4UFV A;  4X8I A;  3IIB A;  5HVG A;  3DDD A;  2EUI A;  4XNH C;  4PSX A;  2ZEL A;  2D4P A;  1YVK A;  5G22 A;  1B87 A;  2PJ0 A;  2FE7 A;  3NH8 A;  2POK A;  2BUE A;  4B14 A;  1X10 A;  4B6Z A;  3SJX A;  3RBU A;  1KZF A;  3ISX A;  5AG6 A;  4GS4 A;  3FEE A;  3B3V A;  3S6H A;  2PRB A;  1ELM P;  2G3A A;  3R1K A;  1LCP A;  5THW A;  3FNC A;  2O4H A;  4NGQ A;  1MK4 A;  1CG2 A;  2HQY A;  4Y49 B;  2XEF A;  4EME A;  4OME A;  3NFZ A;  1S7N A;  4UF4 A;  1VHO A;  3FXT A;  1NMT A;  4MCQ A;  2C6G A;  2JBK A;  1OZP A;  3BLN A;  2C6C A;  1OBR A;  2Q7S A;  4A30 A;  2B4D B;  3GYA A;  4CS0 B;  2AFU A;  1M4I A;  1RTQ A;  4DYO A;  4R6T A;  2FIA A;  5JQ4 A;  1Q2C A;  3SI0 A;  4A2Z A;  2ZPA A;  2KCW A;  3KR4 A;  2PIZ A;  3FJU A;  4R87 A;  5KTA A;  4MHY A;  5KTD A;  5F46 A;  2EBJ A;  2EK8 A;  4XPK A;  1M4G A;  2H5M A;  4RUH A;  3FYN A;  4UWI A;  3B3W A;  3P2F A;  1IGB A;  1Z8T A;  4KZT A;  3TC8 A;  2AFW A;  2PJ5 A;  3KAS A;  2FSR A;  2VXK A;  1S7K A;  3PFO A;  4WJB A;  2B5G B;  2I00 A;  4LX9 A;  4MHD A;  2Q4Z A;  2PVW A;  2ZEP A;  3B8G A;  2PE3 A;  4LQG A;  2DPT A;  4MFJ A;  3B2Y A;  1DE4 C;  4OC2 A;  5HVF A;  1XOV A;  2PJ4 A;  1BO4 A;  2WZN A;  3KHZ A;  2ZW7 A;  1XJO A;  1ZLI A;  4R76 A;  4P4E A;  3PFE A;  3DR8 A;  3D7G A;  4U9Y A;  5IB9 A;  3TE4 A;  2OZH A;  4PQA A;  1LRZ A;  2VEZ A;  1BPM A;  3F5B A;  4AB7 A;  2Q4V A;  3FVL A;  3GY9 A;  3N7Z A;  1IID A;  1EE3 P;  2IQ6 A;  3EFA A;  3I3G A;  3PP9 A;  4H6U A;  3DSB A;  3CT9 A;  3B3S A;  3D3S A;  2ARH A;  4YFJ A;  1Z5R A;  5LYI A;  4MFZ A;  2G3T A;  1N71 A;  4OP4 A;  4ONU A;  5G1Z A;  3T8W A;  1ZO0 A;  4UEE A;  1UFH A;  4FBE A;  1U6M A;  2RB7 A;  1Y7R A;  3TX8 A;  3RO0 A;  2VI7 A;  4JD6 A;  3PB6 X;  2J8R A;  4FD6 A;  2OZG A;  4QBJ A;  2FL4 A;  4K3N A;  4NFR A;  3QAH A;  4CYO A;  1Z8L A;  6CPA A;  3D68 A;  4PK3 A;  4CYP A;  2JEW A;  3FEC A;  4NJQ A;  5F47 A;  4ORF A;  1R43 A;  2JDC A;  5AG5 A;  1YW6 A;  1ARM A;  2ZW4 A;  1VHE A;  3A9L A;  3KZW A;  1AUG A;  1WK4 A;  4HNY B;  4UEZ A;  2F5I A;  3R95 A;  4A38 A;  2FXF A;  2YGW A;  3KR5 A;  5ISV A;  3MN8 A;  2Q44 A;  2B4D A;  4OC4 A;  2PJ1 A;  3PGP A;  1LOK A;  5LRG A;  4YRH A;  2EK9 A;  2VBQ A;  4FD5 A;  1LAN A;  4OC5 A;  1XIX A;  3K9T A;  2ZOG A;  3NE7 A;  3IWE A;  4NSQ A;  4P10 A;  4PXE A;  2HUZ A;  3GKR A;  3BHX A;  1IY7 A;  2BSW A;  3PB7 X;  1YRE A;  4ZI6 A;  4C2Z A;  1LAM A;  1L0C A;  3GUX A;  1YR0 A;  1NSL A;  3G3S A;  1KWM A;  2B4B A;  3TFY A;  4B12 A;  4MCR A;  2D4O A;  4MHN A;  4UWJ A;  5JGF A;  3D7F A;  3IO1 A;  2PDO A;  2G0B A;  3D4U A;  3H5Z A;  4E0A A;  2ZOF A;  2HB6 A;  1GHE A;  1QST A;  3SI1 A;  1YLO A;  1ZG7 A;  1M4L A;  3SJG A;  2B3V A;  3TO7 A;  4L89 A;  5LRJ A;  5D8N A;  4F6A A;  1ON0 A;  2F8H A;  3LD2 A;  2DF5 A;  3SJF A;  5EC4 A;  4KOY A;  5F48 A;  3UY5 A;  2BOA A;  4U9Z A;  1S7L A;  2PJ3 A;  2X7B A;  4XPL A;  2C6P A;  2O28 A;  2XEI A;  3R9F A;  1XF8 A;  3VH9 A;  5EMI A;  1NE9 A;  2RC4 A;  4MY0 A;  2PJB A;  4Z65 A;  2VQY A;  3D8P A;  4B10 A;  4IK2 A;  1I21 A;  4YWY A;  2P6G A;  4KS9 A;  4RI1 A;  3T9Y A;  4OID A;  3MGD A;  2QML A;  4W9Y A;  1TKH A;  2AFS A;  2J8M A;  3HLP A;  5K8N A;  1J4J A;  2I3C A;  3FF3 A;  5DS0 A;  5A27 A;  4PSW A;  2VZY A;  2ZEG A;  2V8D A;  2VL1 A;  3FB3 A;  1BOB A;  4MFL A;  1CBX A;  4Q38 A;  1S5K A;  1VGY A;  2Z3K A;  4ZY1 A;  3EC4 A;  1PU9 A;  3D2M A;  1X12 A;  4IAV A;  3LWU A;  3D7D A;  4OC3 A;  1VHS A;  3E0K A;  3R9E A;  4IF5 A;  4KVO E;  4JYW A;  4NEX A;  2P6F A;  4AXV A;  4F0X A;  5LYL A;  1VKC A;  4CYN A;  4KUB A;  1PCA A;  3VAR A;  2GAN A;  3FIX A;  3IJ3 A;  3PRT A;  4NF1 A;  4ONW A;  4Q36 A;  1FNO A;  2PRQ A;  3S6G A;  3TTH A;  4I49 A;  2WPW A;  1KUY A;  4FUU A;  5CBM A;  1I1D A;  1HDU A;  1IOF A;  2Q51 A;  2GU2 A;  3KL9 A;  3SI2 A;  4FD4 A;  4ZY0 A;  1Z2L A;  3S9L A;  3WC6 A;  1TF9 A;  2P0W A;  2OU2 A;  2QJ8 A;  3I9S A;  4FD7 A;  4XPD B;  3V38 A;  3C26 A;  4A94 A;  2BL1 A;  4P44 A;  2FVG A;  4X5K A;  5LYD A;  4AVC A;  2ZEM A;  4NGS A;  1MJA A;  3R9G A;  2C27 A;  2CNT A;  4NJR A;  4Y49 C;  1YVO A;  3WT4 A;  3N5F A;  2Q7B A;  4C2Y A;  2AFZ A;  2YNE A;  4EWT A;  4O23 A;  4TWE A;  3PB9 X;  3KI9 A;  1ZLH A;  3RZA A;  4KSI A;  1M44 A;  2C1C A;  3VWE A;  2ODF A;  4R3L A;  2CF4 A;  2Q04 A;  1IYK A;  1TKF A;  8CPA A;  2PJ9 A;  3B35 A;  4XNH B;  4UCM A;  1Q7L A;  4HNW B;  4BBH A;  4KSF A;  3S6F A;  1Y0R A;  5JPH A;  2ANP A;  4HKF A;  1JWQ A;  2BEI A;  1CP6 A;  3FMC A;  4KOW A;  2YNC A;  4R8F A;  5HVH A;  5LYF A;  4P4F A;  2ATR A;  1HDQ A;  3RNZ A;  3DGV A;  3H8E A;  4KVX A;  5G20 A;  1QMU A;  3PZJ A;  5H86 A;  1IYL A;  1CPX A;  4AG7 A;  4DJL A;  1S3Z A;  3H4Q A;  2BCO A;  4MXU A;  2Z10 A;  1XFO A;  3H8F A;  4P6Y A;  1F2P A;  4R57 A;  4UIA A;  2QVP A;  2WPX A;  4NGP A;  4MHZ A;  1XMB A;  1F57 A;  4E8O A;  3BI0 A;  2FT0 A;  3FED A;  1XE4 A;  2WUU A;  2ZED A;  4KSA A;  4A31 A;  3T90 A;  3ZZI A;  4H89 A;  2K5T A;  4KOV A;  2PJ8 A;  1MJ9 A;  2V8V A;  4B5P B;  2DPS A;  3SHP A;  3LMS A;  4ZX8 A;  1Y7E A;  2NMT A;  2A4N A;  1AMP A;  1JQG A;  1A2Z A;  2IMO A;  3FRM A;  4G1P A;  1M1D A;  4MBU A;  4MY3 A;  1IOI A;  1FT7 A;  3CZX A;  2EO8 A;  2PR8 A;  1Q2D A;  1YGH A;  4PXB A;  2PIY A;  4MHP A;  3S6K A;  2REF A;  4EVY A;  2PJ6 A;  4F9V A;  2JEV A;  1QSR A;  1Z4R A;  2J9A A;  3D66 A;  3JTK A;  4J3G A;  1SQH A;  5GCN A;  2RFH A;  1KUV A;  4CRY B;  3FH4 A;  4NCZ A;  1CJW A;  3W6X A;  2AFX A;  3IU2 A;  4M6G A;  4UBR A;  4X3R A;  2QEC A;  4QUS A;  2J8N A;  5BWA B;  1TKJ A;  2OZU A;  2PSW A;  4OIW A;  4F9U A;  3MRU A;  3VWD A;  3IGR A;  4H2K A;  3D67 A;  2G9D A;  5JM6 A; 
#chains in the Genus database with same CATH homology
 3DNS A;  4CAX A;  3G8W A;  4UCN A;  4KOS A;  2YND A;  2JLM A;  3SXO A;  3JVN A;  3TT2 A;  5FVJ A;  5IX3 A;  4JWP A;  3KKW A;  4CAW A;  5HH1 A;  5I0C A;  1M4D A;  2R8V A;  1Z9U A;  4KVM E;  4NXY A;  4K30 A;  4OAE A;  4E2A A;  2Z3M A;  2PC1 A;  4UFX A;  3FBU A;  4L8A A;  2P6E A;  4DNC A;  4CAV A;  3QB8 A;  4HNX B;  4C2X A;  4C7I A;  2CY2 A;  2R1I A;  4UFW A;  2Z11 A;  4UA3 A;  2ZW6 A;  4RS2 A;  5C82 A;  4MFP A;  1YX0 A;  2Q4Y A;  1P0H A;  1WWZ A;  2Y0M A;  1IB1 E;  3IWG A;  2R7H A;  3F0A A;  3RYO A;  4PK2 A;  5AGE A;  4MFK A;  4QVT A;  2FIW A;  4MFQ A;  4OAD A;  4CAE A;  1MJB A;  1CM0 A;  5G21 A;  4B11 A;  3TO9 A;  3TO6 A;  3CXS A;  2CNS A;  1QSN A;  4JLY A;  4KLV A;  4PV6 A;  3D2P A;  4B5P A;  5F49 A;  4B13 A;  3TOB A;  2FS5 A;  4LUA A;  4JJX A;  4U5Y A;  3W6S A;  4CGP A;  5A28 A;  4CGL A;  1YLE A;  2CXA A;  1V0C A;  1Q2Y A;  3IU1 A;  4AVA A;  5IV0 A;  1P4N A;  3BJ7 A;  4R3K A;  1FY7 A;  4CGO A;  2HV2 A;  2B5G A;  2OH1 A;  4F0Y A;  5AG7 A;  4A33 A;  2IL4 A;  4BMH A;  2PQ8 A;  1RXT A;  4KLW A;  3W91 A;  4AVB A;  2YNC C;  2GE3 A;  3TCV A;  4M85 A;  5E96 A;  4CGN A;  3OWC A;  1Y9K A;  4KOT A;  3EO4 A;  1PUA A;  2I79 A;  1QSM A;  4JXR A;  2REE A;  3DR6 A;  4H6Z A;  1IIC A;  2AJ6 A;  2JDD A;  4R9M A;  4XPD C;  3TOA A;  4KUA A;  1S60 A;  2DXQ A;  5DWM A;  1I12 A;  3P2H A;  5C88 A;  2OB0 A;  2B3U A;  4C68 A;  2CNM A;  2QIR A;  4ZBG A;  4KOX A;  5DWN A;  3CXP A;  1KUX A;  1TIQ A;  5EBV A;  4KOR A;  3LOD A;  2EVN A;  4IUS A;  1R57 A;  1Z4E A;  5IB0 A;  4ZGY B;  2ZXV A;  2GIV A;  4A95 A;  2PR1 A;  3WR7 A;  1XEB A;  3CXQ A;  2Z3N A;  5AG4 A;  1YK3 A;  4B5O A;  5CNP A;  3R96 A;  4CRZ B;  1XMT A;  3EY5 A;  4QB9 A;  5KTC A;  4AG9 A;  4KOU A;  4A32 A;  4C7H A;  3SXN A;  1S7F A;  1Y9W A;  2B58 A;  2AE6 A;  2FCK A;  3JUW A;  4M3S A;  4JXQ A;  2Z3P A;  4CGM A;  2VZZ A;  5J8C A;  1K4J A;  2Z3O A;  2ZW5 A;  2Z3L A;  3BJ8 A;  1QSO A;  4QC6 A;  5H84 A;  5HMN A;  3EXN A;  5J8F A;  3V8I A;  4CAF A;  1RO5 A;  4CYQ A;  3K9U A;  2Z0Z A;  3F8K A;  3ZJ0 A;  4MJ8 A;  2WSA A;  2Q0Y A;  4UCP A;  4YGO A;  1B6B A;  2R98 A;  4OLL A;  4MI4 A;  4II9 A;  4UFV A;  3DDD A;  2EUI A;  4XNH C;  4PSX A;  2D4P A;  1YVK A;  5G22 A;  1B87 A;  2FE7 A;  2BUE A;  4B14 A;  1KZF A;  5AG6 A;  4GS4 A;  3S6H A;  2PRB A;  2G3A A;  3R1K A;  3FNC A;  1MK4 A;  2HQY A;  4Y49 B;  1S7N A;  3FXT A;  1NMT A;  1OZP A;  3BLN A;  4A30 A;  2B4D B;  3GYA A;  4CS0 B;  1M4I A;  2FIA A;  5JQ4 A;  1Q2C A;  4A2Z A;  2ZPA A;  2KCW A;  4R87 A;  5KTA A;  5KTD A;  5F46 A;  4XPK A;  1M4G A;  2H5M A;  3FYN A;  4UWI A;  3P2F A;  4KZT A;  2FSR A;  2VXK A;  1S7K A;  2B5G B;  2I00 A;  4LX9 A;  4MHD A;  3B8G A;  2DPT A;  4MFJ A;  1BO4 A;  2ZW7 A;  3DR8 A;  4U9Y A;  3TE4 A;  2OZH A;  1LRZ A;  2VEZ A;  3F5B A;  4AB7 A;  2Q4V A;  3GY9 A;  3N7Z A;  1IID A;  3EFA A;  3PP9 A;  3I3G A;  4H6U A;  3DSB A;  3D3S A;  2ARH A;  4YFJ A;  4MFZ A;  2G3T A;  1N71 A;  4ONU A;  5G1Z A;  1ZO0 A;  1UFH A;  1U6M A;  1Y7R A;  2VI7 A;  4JD6 A;  2J8R A;  4FD6 A;  2OZG A;  4QBJ A;  2FL4 A;  4CYO A;  3QAH A;  4PK3 A;  4CYP A;  5F47 A;  4ORF A;  2JDC A;  5AG5 A;  2ZW4 A;  3A9L A;  1WK4 A;  4HNY B;  2F5I A;  3R95 A;  2FXF A;  2YGW A;  5ISV A;  2Q44 A;  2B4D A;  3PGP A;  4YRH A;  2VBQ A;  4FD5 A;  1XIX A;  3NE7 A;  3IWE A;  4NSQ A;  2HUZ A;  3GKR A;  2BSW A;  1YRE A;  4C2Z A;  1L0C A;  1YR0 A;  1NSL A;  3G3S A;  2B4B A;  3TFY A;  4B12 A;  2D4O A;  4UWJ A;  2PDO A;  2G0B A;  3H5Z A;  4E0A A;  1QST A;  1GHE A;  2B3V A;  3TO7 A;  4L89 A;  4F6A A;  1ON0 A;  3LD2 A;  5EC4 A;  4KOY A;  5F48 A;  3UY5 A;  4U9Z A;  1S7L A;  2X7B A;  4XPL A;  2O28 A;  3R9F A;  1XF8 A;  1NE9 A;  2RC4 A;  4MY0 A;  2VQY A;  3D8P A;  4B10 A;  1I21 A;  2P6G A;  4KS9 A;  4RI1 A;  3T9Y A;  3MGD A;  2QML A;  2J8M A;  1J4J A;  5A27 A;  4PSW A;  2VZY A;  3FB3 A;  4MFL A;  1BOB A;  4Q38 A;  1S5K A;  2Z3K A;  3EC4 A;  1PU9 A;  3D2M A;  1VHS A;  3E0K A;  3R9E A;  4IF5 A;  4KVO E;  4NEX A;  2P6F A;  4F0X A;  1VKC A;  4CYN A;  4KUB A;  2GAN A;  3FIX A;  3TTH A;  4NF1 A;  4Q36 A;  3S6G A;  4I49 A;  2WPW A;  1KUY A;  1I1D A;  4FD4 A;  2P0W A;  2OU2 A;  4FD7 A;  3I9S A;  4XPD B;  3C26 A;  2BL1 A;  4X5K A;  4AVC A;  3R9G A;  1MJA A;  2C27 A;  2CNT A;  4Y49 C;  1YVO A;  4C2Y A;  2Q7B A;  2YNE A;  1M44 A;  3VWE A;  4R3L A;  2Q04 A;  1IYK A;  4XNH B;  4UCM A;  4HNW B;  4BBH A;  4KSF A;  3S6F A;  5JPH A;  4HKF A;  2BEI A;  4KOW A;  2YNC A;  2ATR A;  4KVX A;  5G20 A;  3PZJ A;  5H86 A;  1IYL A;  4AG7 A;  1S3Z A;  3H4Q A;  2Z10 A;  4R57 A;  2WPX A;  4E8O A;  2FT0 A;  1XE4 A;  2WUU A;  4KSA A;  4A31 A;  3T90 A;  3ZZI A;  4H89 A;  2K5T A;  4KOV A;  1MJ9 A;  4B5P B;  2DPS A;  3SHP A;  2NMT A;  2A4N A;  3FRM A;  1M1D A;  4MBU A;  4MY3 A;  2PR8 A;  1Q2D A;  1YGH A;  3S6K A;  2REF A;  4EVY A;  1QSR A;  2JEV A;  1Z4R A;  4J3G A;  3JTK A;  5GCN A;  1SQH A;  1KUV A;  4CRY B;  4NCZ A;  1CJW A;  3W6X A;  3IU2 A;  4UBR A;  2QEC A;  4QUS A;  2J8N A;  5BWA B;  2OZU A;  2PSW A;  3VWD A;  3IGR A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...