4LUAA

Crystal structure of n-acetyltransferase from staphylococcus aureus mu50
Total Genus 45
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
45
sequence length
164
structure length
156
Chain Sequence
AMIEIKTLTNNDFNEYKRLVSTVNEEFTQDSHYSQTMTDTLIHDILNKCIVFGCYENETLIATAALEQIREHKSLIKYNFVTNNDKSINSELINFIINYARQNNYESLLTSIVSNNIGAKVFYSALGFDILGFEKNAIKIGNTYFDEHWLFYDLIN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords N-acetyltransferase
publication title Purification, crystallization and preliminary X-ray diffraction analysis of the N-acetyltransferase SAV0826 from Staphylococcus aureus.
pubmed doi rcsb
source organism Staphylococcus aureus subsp. aureus
total genus 45
structure length 156
sequence length 164
ec nomenclature
pdb deposition date 2013-07-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13420 Acetyltransf_4 Acetyltransferase (GNAT) domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.630.30 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Aminopeptidase 4luaA00
2HUZA 3R96A 1Z4RA 1Z9UA 4CRYB 3PZJA 4LX9A 1S7KA 3QAHA 5CNPA 2Z10A 3DNSA 3WR7A 2PSWA 3P2HA 3FBUA 2VI7A 2ZW4A 4NEXA 3P2FA 3FIXA 4OLLA 2R8VA 1S7NA 3FXTA 4UA3A 2P6GA 2OH1A 3EXNA 4UWIA 1WWZA 1RXTA 4PK3A 1TIQA 4JXRA 3R9FA 4DNCA 1MJBA 4E8OA 4Y49B 3BJ8A 2I79A 3EY5A 2OZGA 1KZFA 2QECA 5JPHA 4FD5A 4R3LA 2OZHA 3OWCA 4KLWA 4QUSA 1M1DA 4I49A 1BOBA 4NXYA 3R1KA 4J3GA 2JDDA 4XNHB 2O28A 3W6SA 5KTDA 1XF8A 1KUVA 5F46A 3IWGA 4CAXA 2PDOA 2IL4A 4RS2A 4KLVA 3KKWA 2ZPAA 1UFHA 2QMLA 3BJ7A 2B58A 5J8CA 3I9SA 4NF1A 4K30A 4M85A 4L8AA 1QSNA 5GCNA 1S7LA 4KVOE 2KCWA 3T90A 1Y9WA 1QSRA 4AG9A 2B5GA 2I00A 3DR8A 4II9A 4Y49C 2WPXA 1V0CA 2ZW5A 2P6FA 1M4GA 2FCKA 2PQ8A 5IX3A 2B4DB 4X5KA 4KOXA 4AB7A 4YFJA 2VQYA 5E96A 1NE9A 1YLEA 2FL4A 5KTCA 1WK4A 2CNMA 4KVME 5IB0A 5EC4A 4KUAA 3W6XA 3TO7A 4CAWA 4MY3A 2JDCA 4H6ZA 4R3KA 4M3SA 2J8NA 3F8KA 4KZTA 4KOVA 3CXSA 3V8IA 3DSBA 4XPDC 4F6AA 2CY2A 2Q4YA 5HMNA 2ZW6A 2H5MA 4B5OA 3F5BA 1L0CA 3F0AA 1IICA 1YVOA 2BSWA 2FXFA 2JLMA 4ONUA 2D4PA 4HNXB 3K9UA 2Z0ZA 1IIDA 1R57A 1B6BA 3EC4A 2C27A 1RO5A 3D2PA 3RYOA 2PR8A 2R1IA 3G8WA 4UWJA 3SHPA 2X7BA 4JLYA 1IB1E 1FY7A 1IYLA 4FD6A 4U9YA 4RI1A 4B5PA 5HH1A 1XE4A 4FD7A 4KORA 2BL1A 3TOAA 1Q2DA 3FNCA 4CS0B 4OADA 2DXQA 4NSQA 2EVNA 4F0YA 4HNYB 1P0HA 4HNWB 4MI4A 2OU2A 3MGDA 4AVAA 1S60A 4XPDB 5F47A 2Q04A 2P0WA 3PP9A 2RC4A 4EVYA 4YGOA 4AVCA 2BUEA 4PSXA 2Q44A 2Q7BA 4BMHA 3SXOA 4KOTA 1XEBA 2F5IA 4R87A 1U6MA 2J8MA 1Y7RA 2HV2A 2VZZA 2VBQA 5C82A 2OB0A 1PU9A 3TFYA 4KUBA 1ON0A 4KOSA 3S6KA 5F48A 4R57A 2ATRA 2PRBA 3EFAA 1YGHA 2PC1A 3BLNA 4CRZB 2R7HA 1Y9KA 3N7ZA 3TCVA 3ZZIA 2HQYA 1J4JA 4YRHA 2Z11A 1I12A 4JXQA 1M4IA 2BEIA 2AE6A 2G3AA 2WPWA 3LD2A 1KUXA 1P4NA 5ISVA 4OAEA 3CXPA 2B4BA 1Q2CA 4PSWA 4QB9A 4QVTA 3NE7A 1YVKA 4PV6A 1CJWA 5C88A 2VXKA 3R9EA 1S3ZA 1I1DA 4MY0A 4CAVA 3SXNA 4KVXA 1CM0A 3TO9A 4H89A 3CXQA 1PUAA 2GANA 4MJ8A 2EUIA 1YX0A 4B5PB 2K5TA 3T9YA 3LODA 2CNSA 5KTAA 4LUAA 2B4DA 4QC6A 2J8RA 4KOYA 1Q2YA 1LRZA 2FE7A 1N71A 2GIVA 2QIRA 4R9MA 3IGRA 4XPLA 4IF5A 5I0CA 1QSTA 1I21A 4E2AA 2OZUA 4JJXA 1NSLA 3D3SA 1S7FA 5DWNA 1M4DA 1XMTA 5EBVA 4JD6A 3S6FA 3DR6A 3W91A 3JVNA 1Z4EA 2ZW7A 1QSOA 2ARHA 1MK4A 2Q4VA 3D8PA 4ORFA 2GE3A 3C26A 2R98A 3ZJ0A 2VZYA 5H84A 1MJAA 1NMTA 4ZBGA 1IYKA 3FB3A 4JWPA 2FIWA 2P6EA 2PR1A 2B5GB 3UY5A 3R9GA 5FVJA 4U5YA 2Q0YA 3EO4A 4KOWA 3TTHA 1GHEA 3B8GA 1SQHA 1BO4A 2B3VA 4KOUA 2REFA 4MBUA 1K4JA 2JEVA 3PGPA 1YR0A 2G0BA 1QSMA 5JQ4A 1XIXA 4UBRA 3FYNA 3G3SA 5DWMA 2CNTA 1VKCA 4MHDA 4FD4A 2VEZA 2FIAA 3VWDA 2B3UA 2Y0MA 2REEA 4AVBA 3TE4A 4U9ZA 1S5KA 3S6HA 1OZPA 3E0KA 3JUWA 3D2MA 4AG7A 3I3GA 5H86A 2G3TA 4L89A 3GYAA 4PK2A 1VHSA 1KUYA 5F49A 3QB8A 4NCZA 3TO6A 4IUSA 3VWEA 2AJ6A 4GS4A 2A4NA 4QBJA 5IV0A 1MJ9A 3DDDA 4XNHC 4H6UA 3FRMA 3R95A 2FS5A 1YK3A 3GY9A 2ZXVA 3GKRA 2D4OA 1B87A 4XPKA 3H4QA 3S6GA 4E0AA 4HKFA 1M44A 2NMTA 3TT2A 1YREA 2FT0A 3TOBA 2FSRA 5J8FA
chains in the Genus database with same CATH superfamily
4MCSA 2HUZA 3R96A 4P4DA 1Z4RA 2PJBA 2Z3LA 1Z9UA 1KWMA 4CRYB 3PZJA 4LX9A 1ELLP 1S7KA 2YGWA 3QAHA 2GREA 4YU9A 5CNPA 3TX8A 1CBXA 2Z10A 3DNSA 3FEEA 4NGSA 2ANPA 2PJ2A 3IWWA 2GLFA 2PSWA 3FBUA 2VI7A 2ZW4A 3P2HA 4NEXA 5A28A 1GYTA 3P2FA 3FIXA 4OLLA 2R8VA 1S7NA 2WZNA 3FXTA 4UA3A 2P6GA 4MCQA 2OOTA 4NGMA 5G21A 4BD9A 2OH1A 5I4MA 1VHEA 3EXNA 4UWIA 1WWZA 1RXTA 4PK3A 4X2TA 4WJBA 1TIQA 4JXRA 3IFEA 4HPSA 3R9FA 1X10A 1R3NA 4DNCA 4GXHA 4ZY1A 1MJBA 3D4UA 4PXCA 4E8OA 4ZGYB 3D7GA 1JQGA 3BJ8A 4Y49B 2I79A 3EY5A 1LCPA 2OZGA 1KZFA 4MHPA 1Q7LA 2QECA 5JPHA 1CP6A 5J1QA 2YNCA 4FD5A 4R3LA 2XEGA 3T8WA 2OZHA 2WSAA 3FEDA 3OWCA 3H8GA 4KLWA 4QUSA 1M1DA 4I49A 1BOBA 4NXYA 2V8VA 3D7FA 4TWEA 3R1KA 4J3GA 2AFXA 2JDDA 3QNVA 4XNHB 4A37A 5A27A 4OIDA 2DPTA 1Z8XA 5AG5A 2Z3OA 3N5FA 5JM6A 1YSJA 2JEWA 2O28A 3RBUA 4C2ZA 2PJAA 2ZEFA 1TKFA 2Z3NA 3W6SA 4MFJA 5KTDA 1XF8A 1KUVA 5F46A 3IWGA 2QVPA 3PFEA 4CAXA 4ZY2A 2PJ8A 1ZG7A 2V8HA 4PQAA 2PDOA 2IL4A 3S9NA 1TF9A 1OBRA 2ZEOA 2EBJA 4RS2A 4KLVA 5THWA 1XJOA 3KKWA 2ZPAA 1UFHA 2GU2A 2BOAA 2QMLA 3BJ7A 3HLPA 2B58A 5J8CA 4C2YA 5LYLA 3I9SA 4NF1A 5LRGA 3KHZA 1BPMA 3RO0A 4K30A 5LRKA 2ZENA 3NFZA 3LWUA 4M85A 3PB8X 4L8AA 3PB6X 2CXAA 1X12A 4OC2A 4UIAA 1QSNA 5F09A 5GCNA 5HVHA 1S7LA 4KVOE 1LANA 2KCWA 3PBBA 2CF4A 2RB7A 2DPSA 3T90A 3PFOA 1Y9WA 2JBJA 1LAPA 1QSRA 4AG9A 3V38A 5LYFA 4NJQA 2B5GA 2I00A 1Y0RA 3WC5A 3DR8A 4II9A 3BHXA 2PJ1A 4Y49C 4AXVA 2CTCA 2WPXA 1V0CA 1Z8LA 2ZW5A 2P6FA 2QJ8A 3PB4X 2IQ6A 1M4GA 2FCKA 2PJ7A 2PQ8A 4IK2A 4A33A 5IX3A 2B4DB 4X5KA 4A38A 3BXMA 4KOXA 4AB7A 1DTDA 1IGBA 3IO1A 2PIYA 4YFJA 4OC5A 4OC1A 2VQYA 2O4HA 4P4BA 1YMEA 1LFWA 5E96A 1PYTB 1NE9A 4B6ZA 1YLEA 2FL4A 1XMBA 5KTCA 1WK4A 3IEHA 1F57A 2CNMA 4KSFA 2HC9A 3IJ3A 5ELYA 4EMEA 1M4LA 4R7MA 3B2YA 2WUUA 3SJGA 4KVME 2ZELA 5IB0A 2NYQA 1VIXA 2HB6A 1YLOA 4KUAA 5EC4A 3W6XA 5HVFA 3TO7A 4CAWA 5AGEA 4IAVA 4MY3A 2JDCA 3SJFA 5JGFA 3FH4A 4H6ZA 4R3KA 4M3SA 2VL1A 2J8NA 3F8KA 3GUXA 1DE4C 4KZTA 1CX8A 1Y0YA 3CXSA 4KOVA 3V8IA 2Z3MA 4M6HA 4MFKA 2BO9A 5G20A 1YW4A 3DSBA 4XPDC 3BI0A 3PRTA 1HEEA 3K9TA 3KQZA 4OKOA 4OMEA 4M6GA 4F6AA 4PXDA 2CY2A 4NGRA 4UCPA 2Q4YA 5HMNA 2ZW6A 4NJRA 2AFUA 2H5MA 4B5OA 2ZEGA 3F5BA 3KHXA 1L0CA 1ZG9A 3F0AA 4C68A 4MFQA 1IICA 4DUKA 1YVOA 2BSWA 2V8GA 2FXFA 2ZEEA 2JLMA 4R8FA 4ONUA 1LOKA 3RNZA 2C6CA 3A9LA 2POKA 4MFPA 2DEAA 2D4PA 4HNXB 3K9UA 4MFLA 2Z0ZA 1IIDA 4UFVA 4LQGA 1R57A 2PRQA 4A94A 6CPAA 1B6BA 2V8DA 3EC4A 3KR4A 2C27A 3FJUA 1RO5A 5LYDA 1TF8A 4P44A 2ZEHA 3FF3A 3D2PA 3D68A 2PVVA 3V7ZA 2CTBA 1AMPA 4ONWA 3RYOA 2AFOA 4A30A 2PR8A 3B3SA 1XBUA 2R1IA 3G8WA 4UWJA 4PXEA 3SHPA 2X7BA 4JLYA 4NGNA 3SJEA 1IB1E 3QAYA 3WC6A 4W9YA 1Z8WA 3HUVA 1CP7A 4RUHA 1FY7A 1IYLA 4FD6A 4JYWA 4U9YA 4CGLA 4RI1A 4B5PA 5HH1A 4P6YA 3GIUA 4CGMA 1IOIA 1XE4A 4FD7A 4KORA 5J8FA 3S9LA 2BL1A 3TOAA 1Q2DA 2PJ4A 4R76A 3FNCA 4CS0B 4OADA 2DXQA 3SI1A 4M6IA 4NSQA 2EVNA 3S9MA 4B13A 4F0YA 4HNYB 1P0HA 4HNWB 2ZEPA 5CPAA 4MI4A 2OU2A 3MGDA 3KI9A 2PJCA 4CPAA 1NSAA 3ISXA 3MRUA 4AVAA 1S60A 1YQEA 2GLJA 3B3TA 4R6TA 4H2KA 4CYQA 4XPDB 2Q4ZA 5F47A 2YNCC 2Q7SA 2Q04A 4FAIA 3NE8A 4B12A 5K8PA 2P0WA 3SJXA 2Z3KA 2YNEA 2RC4A 3PP9A 5LRJA 4JZ0A 4A2ZA 4EVYA 1XOVA 4YGOA 4CYNA 2XEFA 3D7HA 4AVCA 4MHNA 1TKHA 5G22A 3VATA 5CBMA 2PCUA 2F7VA 4DJLA 4UEZA 2ZOFA 2ZOGA 3H8EA 1CPXA 1TKJA 1AUGA 2BUEA 3SI2A 4PSXA 2Q44A 4ZX8A 2I3CA 4UIBA 1BPNA 3B7IA 1Z5RA 3CPXA 4LQ6A 2Q7BA 4BMHA 3FVLA 4NGPA 1Z8TA 4KOTA 1HDQA 4P4FA 4UF4A 1XEBA 3SXOA 2AFMA 2F5IA 3L2NA 1PCAA 4YWYA 2YNDA 4R87A 1U6MA 2J8MA 1Y7RA 2HV2A 2VZZA 1R43A 2VBQA 5C82A 2OB0A 1PU9A 2Q51A 3RZAA 3FX6A 5HXDA 3TFYA 4KUBA 1ON0A 4KOSA 2C1CA 3S6KA 4FWUA 7CPAA 5F48A 4R57A 3CDXA 2AFSA 2O53A 2ATRA 2PRBA 3EFAA 4UEFA 1YGHA 2PC1A 3GLJA 3NH4A 4F9UA 3BLNA 4CRZB 1QQ9A 2R7HA 4A95A 2F8HA 1Y9KA 5AG7A 3N7ZA 3TCVA 4FUUA 2HQYA 3ZZIA 1J4JA 1A2ZA 4YRHA 2Z11A 1EE3P 1I12A 4JXQA 2PVWA 3FECA 1M4IA 2BEIA 2AE6A 2C6PA 2G3AA 4PPZA 2WPWA 2C6GA 2NSMA 2Q43A 4ZX9A 1IOFA 1ZLIA 3JTKA 3CT9A 3LD2A 1KUXA 3KR5A 1P4NA 3TC8A 5ISVA 3VH9A 4OAEA 4A32A 2ABZA 3CXPA 2B4BA 1RTQA 3KGQA 1F2PA 1Q2CA 4PSWA 4QB9A 4NGTA 4UEEA 4CGNA 2PJ6A 4EFDA 4QVTA 4BINA 3NE7A 1YVKA 4A39A 2PJ3A 1CJWA 2ZEDA 4PV6A 3VARA 2AFWA 5C88A 1ELMP 3PEIA 1FT7A 2VXKA 3R9EA 1S3ZA 3D67A 5K8OA 1I1DA 4G1PA 4MY0A 4MMOA 4CAVA 3SXNA 4KVXA 1CM0A 3TO9A 4H89A 4CAEA 3CXQA 1PUAA 2GANA 1XRYA 4K3NA 4MJ8A 4IHMA 2EUIA 1YX0A 4B5PB 2K5TA 3T9YA 3LODA 2CNSA 5KTAA 4LUAA 2B4DA 2XEIA 1TXRA 4QC6A 4CGPA 1ARLA 1YW6A 2Z3PA 2DF5A 2J8RA 4KOYA 1Q2YA 1LRZA 4C2XA 2FE7A 1N71A 2GIVA 4Z65A 1XFOA 3FMCA 4MFZA 2QIRA 5AG4A 4R9MA 3IGRA 2ODFA 3D66A 2PJ0A 1ZLHA 3K2KA 1IY7A 4XPLA 4IF5A 5I0CA 1QSTA 4FBEA 1I21A 4E2AA 5LYIA 3KZWA 2OZUA 4JJXA 2FVGA 1NSLA 3DGVA 3D3SA 8CPAA 3BI1A 3B3CA 4X8IA 4P45A 5JH9A 1S7FA 4CYPA 5DWNA 3IC1A 1M4DA 4ZY0A 1XMTA 3LACA 5EBVA 4JD6A 3S6FA 3DR6A 4X3RA 3W91A 3JVNA 4Q36A 1Z4EA 2ZW7A 1QSOA 1VHOA 4NFRA 2ARHA 1MK4A 2Q4VA 2CIJA 2PE3A 3H5ZA 3D8PA 4ORFA 5EMIA 2GE3A 1F2OA 3C26A 3GB0A 2RFHA 3PB9X 4MXUA 4OIWA 2R98A 4O23A 4OC0A 3ZJ0A 3PBEA 2VZYA 5H84A 3KASA 1FNOA 1MJAA 1NMTA 4ZBGA 1IYKA 3MN8A 3FB3A 5D29A 2EK8A 4JWPA 3H8FA 2FIWA 2P6EA 2PR1A 2B5GB 3DLJA 2JBKA 1HDUA 4MHZA 4MCPA 3UY5A 1Y7EA 5BWAB 3R9GA 3B3VA 2WYRA 3NH5A 4U5YA 5FVJA 2PJ5A 4DYOA 3WT4A 2Q0YA 3IU1A 3EO4A 1UWYA 4BBHA 1JWQA 4A31A 4KOWA 3NA6A 3TTHA 1GHEA 3B8GA 4EWTA 1SQHA 4P10A 1BO4A 2B3VA 4KOUA 2REFA 4MBUA 1K4JA 1IU8A 2JEVA 4Q7AA 4UCNA 3WABA 1ZO0A 4GM5A 3PGPA 1YR0A 2G0BA 1QSMA 5JQ4A 4B14A 1XIXA 2EO8A 4UBRA 3FYNA 3G3SA 2IMOA 5DWMA 1CPSA 4WWVA 2CNTA 2ZEMA 3B35A 1ZG8A 1VKCA 3SI0A 5HVGA 4MHDA 5IB9A 4FD4A 4ZI6A 2VEZA 3IU2A 2V77A 4Q38A 1QMUA 4P4JA 4UFXA 2FIAA 3VWDA 2B3UA 4UFWA 1BAVA 4ZYQA 5D8NA 2Y0MA 2REEA 3CZXA 4CYOA 3RAMA 4AVBA 3TE4A 4NGQA 4U9ZA 1S5KA 4RN7A 3KL9A 4F8ZA 2G9DA 5K8MA 1H8LA 3IIBA 3S6HA 4P4IA 1OZPA 3E0KA 5K8NA 3JUWA 3D2MA 2IJZA 4AG7A 3I3GA 5H86A 2G3TA 4L89A 3GYAA 3NH8A 1VHSA 3B3WA 3ISZA 3JRUA 1KUYA 4PK2A 4TNUA 5G1ZA 4OC3A 4MRIA 5F49A 3QB8A 4NCZA 4P4EA 3TO6A 4IUSA 3VWEA 2PJ9A 1VGYA 2AJ6A 4GS4A 1BLLE 2A4NA 3CPAA 2J9AA 1Z2LA 2XEJA 5DS0A 4QBJA 3IWEA 1LAMA 4CGOA 4PXBA 2EWBA 4KS9A 3KQXA 3WC7A 4F0XA 5IV0A 3WR7A 3D7DA 1MJ9A 4KSIA 2EK9A 3DDDA 4XNHC 1AYEA 2GFQA 4H6UA 4C7HA 3FRMA 3R95A 4C7IA 2FS5A 4CAFA 1YK3A 3I1UA 3GY9A 4MCRA 4F9VA 4B11A 2PIZA 2ZXVA 3GKRA 2QYVA 4KSAA 4OC4A 2D4OA 1B87A 4XPKA 5AG6A 3H4QA 2AFZA 3S6GA 4E0AA 3PB7X 4HKFA 4B10A 1M44A 1ARMA 3LMSA 2NMTA 1CG2A 4OP4A 3TT2A 2OR4A 4MHYA 1YREA 2FT0A 3TOBA 4UCMA 2FSRA 2BCOA
chains in the Genus database with same CATH topology
2HUZA 3R96A 1Z4RA 2Z3LA 1Z9UA 4CRYB 3PZJA 4LX9A 1S7KA 2YGWA 3QAHA 5CNPA 2Z10A 3DNSA 3WR7A 2PSWA 3P2HA 3FBUA 2VI7A 2ZW4A 4NEXA 5A28A 3P2FA 3FIXA 4OLLA 2R8VA 1S7NA 3FXTA 4UA3A 2P6GA 5G21A 2OH1A 3EXNA 4UWIA 1WWZA 1RXTA 4PK3A 1TIQA 4JXRA 3R9FA 4DNCA 1MJBA 4E8OA 4ZGYB 4Y49B 3BJ8A 2I79A 3EY5A 2OZGA 1KZFA 2QECA 5JPHA 2YNCA 4FD5A 4R3LA 2OZHA 2WSAA 3OWCA 4KLWA 4QUSA 1M1DA 4I49A 1BOBA 4NXYA 3R1KA 4J3GA 2JDDA 4XNHB 5A27A 2DPTA 5AG5A 2Z3OA 2O28A 4C2ZA 2Z3NA 3W6SA 4MFJA 5KTDA 1XF8A 1KUVA 5F46A 3IWGA 4CAXA 2PDOA 2IL4A 4RS2A 4KLVA 3KKWA 2ZPAA 1UFHA 2QMLA 3BJ7A 2B58A 5J8CA 4C2YA 3I9SA 4NF1A 4K30A 4M85A 4L8AA 2CXAA 1QSNA 5GCNA 1S7LA 4KVOE 2KCWA 3T90A 2DPSA 1Y9WA 1QSRA 4AG9A 2B5GA 2I00A 3DR8A 4II9A 4Y49C 2WPXA 1V0CA 2ZW5A 2P6FA 1M4GA 2FCKA 2PQ8A 4A33A 5IX3A 2B4DB 4X5KA 4KOXA 4AB7A 4YFJA 2VQYA 5E96A 1NE9A 1YLEA 2FL4A 5KTCA 1WK4A 2CNMA 4KSFA 2WUUA 4KVME 5IB0A 5EC4A 4KUAA 3W6XA 3TO7A 4CAWA 5AGEA 4MY3A 2JDCA 4H6ZA 4R3KA 4M3SA 2J8NA 3F8KA 4KZTA 4KOVA 3CXSA 3V8IA 2Z3MA 5G20A 4MFKA 3DSBA 4XPDC 4F6AA 2CY2A 4UCPA 2Q4YA 5HMNA 2ZW6A 2H5MA 4B5OA 3F5BA 1L0CA 3F0AA 4C68A 4MFQA 1IICA 1YVOA 2BSWA 2FXFA 2JLMA 4ONUA 3A9LA 4MFPA 2D4PA 4HNXB 3K9UA 4MFLA 2Z0ZA 1IIDA 4UFVA 1R57A 1B6BA 3EC4A 2C27A 1RO5A 3D2PA 3RYOA 4A30A 2PR8A 2R1IA 3G8WA 4UWJA 3SHPA 2X7BA 4JLYA 1IB1E 1FY7A 1IYLA 4FD6A 4U9YA 4CGLA 4RI1A 4B5PA 5HH1A 4CGMA 1XE4A 4FD7A 4KORA 2BL1A 3TOAA 1Q2DA 3FNCA 4CS0B 4OADA 2DXQA 4NSQA 2EVNA 4B13A 4F0YA 4HNYB 1P0HA 4HNWB 4MI4A 2OU2A 3MGDA 4AVAA 1S60A 4CYQA 4XPDB 5F47A 2YNCC 2Q04A 4B12A 2P0WA 2Z3KA 2YNEA 2RC4A 3PP9A 4A2ZA 4EVYA 4YGOA 4CYNA 4AVCA 5G22A 2BUEA 4PSXA 2Q44A 2Q7BA 4BMHA 3SXOA 4KOTA 1XEBA 2F5IA 2YNDA 4R87A 1U6MA 2J8MA 1Y7RA 2HV2A 2VZZA 2VBQA 5C82A 2OB0A 1PU9A 3TFYA 4KUBA 1ON0A 4KOSA 3S6KA 5F48A 4R57A 2ATRA 2PRBA 3EFAA 1YGHA 2PC1A 3BLNA 4CRZB 2R7HA 4A95A 1Y9KA 5AG7A 3N7ZA 3TCVA 3ZZIA 2HQYA 1J4JA 4YRHA 2Z11A 1I12A 4JXQA 1M4IA 2BEIA 2AE6A 2G3AA 2WPWA 3JTKA 3LD2A 1KUXA 1P4NA 5ISVA 4OAEA 4A32A 3CXPA 2B4BA 4CGNA 1Q2CA 4PSWA 4QB9A 4QVTA 3NE7A 1YVKA 4PV6A 1CJWA 5C88A 2VXKA 3R9EA 1S3ZA 1I1DA 4MY0A 4CAVA 3SXNA 4KVXA 1CM0A 3TO9A 4H89A 4CAEA 3CXQA 1PUAA 2GANA 4MJ8A 2EUIA 1YX0A 4B5PB 2K5TA 3T9YA 3LODA 2CNSA 5KTAA 4LUAA 2B4DA 4QC6A 4CGPA 2Z3PA 2J8RA 4C2XA 4KOYA 1Q2YA 1LRZA 2FE7A 1N71A 2GIVA 5AG4A 4MFZA 2QIRA 4R9MA 3IGRA 4XPLA 4IF5A 5I0CA 1QSTA 1I21A 4E2AA 2OZUA 4JJXA 1NSLA 3D3SA 1S7FA 4CYPA 5DWNA 1M4DA 1XMTA 5EBVA 4JD6A 3S6FA 3DR6A 3W91A 3JVNA 4Q36A 1Z4EA 2ZW7A 1QSOA 2ARHA 1MK4A 3H5ZA 2Q4VA 3D8PA 4ORFA 2GE3A 3C26A 2R98A 3ZJ0A 2VZYA 5H84A 1MJAA 1NMTA 4ZBGA 1IYKA 3FB3A 4JWPA 2FIWA 2P6EA 2PR1A 2B5GB 3UY5A 5BWAB 3R9GA 5FVJA 4U5YA 2Q0YA 3IU1A 3EO4A 4BBHA 4A31A 4KOWA 3TTHA 1GHEA 3B8GA 1SQHA 1BO4A 2B3VA 4KOUA 2REFA 4MBUA 1K4JA 2JEVA 4UCNA 1ZO0A 3PGPA 1YR0A 2G0BA 1QSMA 5JQ4A 4B14A 1XIXA 4UBRA 3FYNA 3G3SA 5DWMA 2CNTA 1VKCA 4MHDA 4FD4A 2VEZA 3IU2A 4Q38A 4UFXA 2FIAA 3VWDA 2B3UA 4UFWA 2Y0MA 2REEA 4CYOA 4AVBA 3TE4A 4U9ZA 1S5KA 3S6HA 1OZPA 3E0KA 3JUWA 3D2MA 4AG7A 3I3GA 5H86A 2G3TA 4L89A 3GYAA 4PK2A 1VHSA 1KUYA 5G1ZA 5F49A 3QB8A 4NCZA 3TO6A 4IUSA 3VWEA 2AJ6A 4GS4A 2A4NA 4QBJA 3IWEA 4CGOA 5IV0A 4KS9A 4F0XA 1MJ9A 3DDDA 4XNHC 4H6UA 4C7HA 3FRMA 3R95A 4C7IA 2FS5A 4CAFA 1YK3A 3GY9A 4B11A 2ZXVA 3GKRA 4KSAA 2D4OA 1B87A 4XPKA 5AG6A 3H4QA 3S6GA 4E0AA 4HKFA 4B10A 1M44A 2NMTA 3TT2A 1YREA 2FT0A 3TOBA 4UCMA 2FSRA 5J8FA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2HUZ A;  3R96 A;  1Z4R A;  1Z9U A;  4CRY B;  3PZJ A;  4LX9 A;  1S7K A;  3QAH A;  5CNP A;  2Z10 A;  3DNS A;  3WR7 A;  2PSW A;  3P2H A;  3FBU A;  2VI7 A;  2ZW4 A;  4NEX A;  3P2F A;  3FIX A;  4OLL A;  2R8V A;  1S7N A;  3FXT A;  4UA3 A;  2P6G A;  2OH1 A;  3EXN A;  4UWI A;  1WWZ A;  1RXT A;  4PK3 A;  1TIQ A;  4JXR A;  3R9F A;  4DNC A;  1MJB A;  4E8O A;  4Y49 B;  3BJ8 A;  2I79 A;  3EY5 A;  2OZG A;  1KZF A;  2QEC A;  5JPH A;  4FD5 A;  4R3L A;  2OZH A;  3OWC A;  4KLW A;  4QUS A;  1M1D A;  4I49 A;  1BOB A;  4NXY A;  3R1K A;  4J3G A;  2JDD A;  4XNH B;  2O28 A;  3W6S A;  5KTD A;  1XF8 A;  1KUV A;  5F46 A;  3IWG A;  4CAX A;  2PDO A;  2IL4 A;  4RS2 A;  4KLV A;  3KKW A;  2ZPA A;  1UFH A;  2QML A;  3BJ7 A;  2B58 A;  5J8C A;  3I9S A;  4NF1 A;  4K30 A;  4M85 A;  4L8A A;  1QSN A;  5GCN A;  1S7L A;  4KVO E;  2KCW A;  3T90 A;  1Y9W A;  1QSR A;  4AG9 A;  2B5G A;  2I00 A;  3DR8 A;  4II9 A;  4Y49 C;  2WPX A;  1V0C A;  2ZW5 A;  2P6F A;  1M4G A;  2FCK A;  2PQ8 A;  5IX3 A;  2B4D B;  4X5K A;  4KOX A;  4AB7 A;  4YFJ A;  2VQY A;  5E96 A;  1NE9 A;  1YLE A;  2FL4 A;  5KTC A;  1WK4 A;  2CNM A;  4KVM E;  5IB0 A;  5EC4 A;  4KUA A;  3W6X A;  3TO7 A;  4CAW A;  4MY3 A;  2JDC A;  4H6Z A;  4R3K A;  4M3S A;  2J8N A;  3F8K A;  4KZT A;  4KOV A;  3CXS A;  3V8I A;  3DSB A;  4XPD C;  4F6A A;  2CY2 A;  2Q4Y A;  5HMN A;  2ZW6 A;  2H5M A;  4B5O A;  3F5B A;  1L0C A;  3F0A A;  1IIC A;  1YVO A;  2BSW A;  2FXF A;  2JLM A;  4ONU A;  2D4P A;  4HNX B;  3K9U A;  2Z0Z A;  1IID A;  1R57 A;  1B6B A;  3EC4 A;  2C27 A;  1RO5 A;  3D2P A;  3RYO A;  2PR8 A;  2R1I A;  3G8W A;  4UWJ A;  3SHP A;  2X7B A;  4JLY A;  1IB1 E;  1FY7 A;  1IYL A;  4FD6 A;  4U9Y A;  4RI1 A;  4B5P A;  5HH1 A;  1XE4 A;  4FD7 A;  4KOR A;  2BL1 A;  3TOA A;  1Q2D A;  3FNC A;  4CS0 B;  4OAD A;  2DXQ A;  4NSQ A;  2EVN A;  4F0Y A;  4HNY B;  1P0H A;  4HNW B;  4MI4 A;  2OU2 A;  3MGD A;  4AVA A;  1S60 A;  4XPD B;  5F47 A;  2Q04 A;  2P0W A;  3PP9 A;  2RC4 A;  4EVY A;  4YGO A;  4AVC A;  2BUE A;  4PSX A;  2Q44 A;  2Q7B A;  4BMH A;  3SXO A;  4KOT A;  1XEB A;  2F5I A;  4R87 A;  1U6M A;  2J8M A;  1Y7R A;  2HV2 A;  2VZZ A;  2VBQ A;  5C82 A;  2OB0 A;  1PU9 A;  3TFY A;  4KUB A;  1ON0 A;  4KOS A;  3S6K A;  5F48 A;  4R57 A;  2ATR A;  2PRB A;  3EFA A;  1YGH A;  2PC1 A;  3BLN A;  4CRZ B;  2R7H A;  1Y9K A;  3N7Z A;  3TCV A;  3ZZI A;  2HQY A;  1J4J A;  4YRH A;  2Z11 A;  1I12 A;  4JXQ A;  1M4I A;  2BEI A;  2AE6 A;  2G3A A;  2WPW A;  3LD2 A;  1KUX A;  1P4N A;  5ISV A;  4OAE A;  3CXP A;  2B4B A;  1Q2C A;  4PSW A;  4QB9 A;  4QVT A;  3NE7 A;  1YVK A;  4PV6 A;  1CJW A;  5C88 A;  2VXK A;  3R9E A;  1S3Z A;  1I1D A;  4MY0 A;  4CAV A;  3SXN A;  4KVX A;  1CM0 A;  3TO9 A;  4H89 A;  3CXQ A;  1PUA A;  2GAN A;  4MJ8 A;  2EUI A;  1YX0 A;  4B5P B;  2K5T A;  3T9Y A;  3LOD A;  2CNS A;  5KTA A;  4LUA A;  2B4D A;  4QC6 A;  2J8R A;  4KOY A;  1Q2Y A;  1LRZ A;  2FE7 A;  1N71 A;  2GIV A;  2QIR A;  4R9M A;  3IGR A;  4XPL A;  4IF5 A;  5I0C A;  1QST A;  1I21 A;  4E2A A;  2OZU A;  4JJX A;  1NSL A;  3D3S A;  1S7F A;  5DWN A;  1M4D A;  1XMT A;  5EBV A;  4JD6 A;  3S6F A;  3DR6 A;  3W91 A;  3JVN A;  1Z4E A;  2ZW7 A;  1QSO A;  2ARH A;  1MK4 A;  2Q4V A;  3D8P A;  4ORF A;  2GE3 A;  3C26 A;  2R98 A;  3ZJ0 A;  2VZY A;  5H84 A;  1MJA A;  1NMT A;  4ZBG A;  1IYK A;  3FB3 A;  4JWP A;  2FIW A;  2P6E A;  2PR1 A;  2B5G B;  3UY5 A;  3R9G A;  5FVJ A;  4U5Y A;  2Q0Y A;  3EO4 A;  4KOW A;  3TTH A;  1GHE A;  3B8G A;  1SQH A;  1BO4 A;  2B3V A;  4KOU A;  2REF A;  4MBU A;  1K4J A;  2JEV A;  3PGP A;  1YR0 A;  2G0B A;  1QSM A;  5JQ4 A;  1XIX A;  4UBR A;  3FYN A;  3G3S A;  5DWM A;  2CNT A;  1VKC A;  4MHD A;  4FD4 A;  2VEZ A;  2FIA A;  3VWD A;  2B3U A;  2Y0M A;  2REE A;  4AVB A;  3TE4 A;  4U9Z A;  1S5K A;  3S6H A;  1OZP A;  3E0K A;  3JUW A;  3D2M A;  4AG7 A;  3I3G A;  5H86 A;  2G3T A;  4L89 A;  3GYA A;  4PK2 A;  1VHS A;  1KUY A;  5F49 A;  3QB8 A;  4NCZ A;  3TO6 A;  4IUS A;  3VWE A;  2AJ6 A;  4GS4 A;  2A4N A;  4QBJ A;  5IV0 A;  1MJ9 A;  3DDD A;  4XNH C;  4H6U A;  3FRM A;  3R95 A;  2FS5 A;  1YK3 A;  3GY9 A;  2ZXV A;  3GKR A;  2D4O A;  1B87 A;  4XPK A;  3H4Q A;  3S6G A;  4E0A A;  4HKF A;  1M44 A;  2NMT A;  3TT2 A;  1YRE A;  2FT0 A;  3TOB A;  2FSR A;  5J8F A; 
#chains in the Genus database with same CATH topology
 4MCS A;  2HUZ A;  3R96 A;  4P4D A;  1Z4R A;  2PJB A;  2Z3L A;  1Z9U A;  1KWM A;  4CRY B;  3PZJ A;  4LX9 A;  1ELL P;  1S7K A;  2YGW A;  3QAH A;  2GRE A;  4YU9 A;  5CNP A;  3TX8 A;  1CBX A;  2Z10 A;  3DNS A;  3FEE A;  4NGS A;  2ANP A;  2PJ2 A;  3IWW A;  2GLF A;  2PSW A;  3FBU A;  2VI7 A;  2ZW4 A;  3P2H A;  4NEX A;  5A28 A;  1GYT A;  3P2F A;  3FIX A;  4OLL A;  2R8V A;  1S7N A;  2WZN A;  3FXT A;  4UA3 A;  2P6G A;  4MCQ A;  2OOT A;  4NGM A;  5G21 A;  4BD9 A;  2OH1 A;  5I4M A;  1VHE A;  3EXN A;  4UWI A;  1WWZ A;  1RXT A;  4PK3 A;  4X2T A;  4WJB A;  1TIQ A;  4JXR A;  3IFE A;  4HPS A;  3R9F A;  1X10 A;  1R3N A;  4DNC A;  4GXH A;  4ZY1 A;  1MJB A;  3D4U A;  4PXC A;  4E8O A;  4ZGY B;  3D7G A;  1JQG A;  3BJ8 A;  4Y49 B;  2I79 A;  3EY5 A;  1LCP A;  2OZG A;  1KZF A;  4MHP A;  1Q7L A;  2QEC A;  5JPH A;  1CP6 A;  5J1Q A;  2YNC A;  4FD5 A;  4R3L A;  2XEG A;  3T8W A;  2OZH A;  2WSA A;  3FED A;  3OWC A;  3H8G A;  4KLW A;  4QUS A;  1M1D A;  4I49 A;  1BOB A;  4NXY A;  2V8V A;  3D7F A;  4TWE A;  3R1K A;  4J3G A;  2AFX A;  2JDD A;  3QNV A;  4XNH B;  4A37 A;  5A27 A;  4OID A;  2DPT A;  1Z8X A;  5AG5 A;  2Z3O A;  3N5F A;  5JM6 A;  1YSJ A;  2JEW A;  2O28 A;  3RBU A;  4C2Z A;  2PJA A;  2ZEF A;  1TKF A;  2Z3N A;  3W6S A;  4MFJ A;  5KTD A;  1XF8 A;  1KUV A;  5F46 A;  3IWG A;  2QVP A;  3PFE A;  4CAX A;  4ZY2 A;  2PJ8 A;  1ZG7 A;  2V8H A;  4PQA A;  2PDO A;  2IL4 A;  3S9N A;  1TF9 A;  1OBR A;  2ZEO A;  2EBJ A;  4RS2 A;  4KLV A;  5THW A;  1XJO A;  3KKW A;  2ZPA A;  1UFH A;  2GU2 A;  2BOA A;  2QML A;  3BJ7 A;  3HLP A;  2B58 A;  5J8C A;  4C2Y A;  5LYL A;  3I9S A;  4NF1 A;  5LRG A;  3KHZ A;  1BPM A;  3RO0 A;  4K30 A;  5LRK A;  2ZEN A;  3NFZ A;  3LWU A;  4M85 A;  3PB8 X;  4L8A A;  3PB6 X;  2CXA A;  1X12 A;  4OC2 A;  4UIA A;  1QSN A;  5F09 A;  5GCN A;  5HVH A;  1S7L A;  4KVO E;  1LAN A;  2KCW A;  3PBB A;  2CF4 A;  2RB7 A;  2DPS A;  3T90 A;  3PFO A;  1Y9W A;  2JBJ A;  1LAP A;  1QSR A;  4AG9 A;  3V38 A;  5LYF A;  4NJQ A;  2B5G A;  2I00 A;  1Y0R A;  3WC5 A;  3DR8 A;  4II9 A;  3BHX A;  2PJ1 A;  4Y49 C;  4AXV A;  2CTC A;  2WPX A;  1V0C A;  1Z8L A;  2ZW5 A;  2P6F A;  2QJ8 A;  3PB4 X;  2IQ6 A;  1M4G A;  2FCK A;  2PJ7 A;  2PQ8 A;  4IK2 A;  4A33 A;  5IX3 A;  2B4D B;  4X5K A;  4A38 A;  3BXM A;  4KOX A;  4AB7 A;  1DTD A;  1IGB A;  3IO1 A;  2PIY A;  4YFJ A;  4OC5 A;  4OC1 A;  2VQY A;  2O4H A;  4P4B A;  1YME A;  1LFW A;  5E96 A;  1PYT B;  1NE9 A;  4B6Z A;  1YLE A;  2FL4 A;  1XMB A;  5KTC A;  1WK4 A;  3IEH A;  1F57 A;  2CNM A;  4KSF A;  2HC9 A;  3IJ3 A;  5ELY A;  4EME A;  1M4L A;  4R7M A;  3B2Y A;  2WUU A;  3SJG A;  4KVM E;  2ZEL A;  5IB0 A;  2NYQ A;  1VIX A;  2HB6 A;  1YLO A;  4KUA A;  5EC4 A;  3W6X A;  5HVF A;  3TO7 A;  4CAW A;  5AGE A;  4IAV A;  4MY3 A;  2JDC A;  3SJF A;  5JGF A;  3FH4 A;  4H6Z A;  4R3K A;  4M3S A;  2VL1 A;  2J8N A;  3F8K A;  3GUX A;  1DE4 C;  4KZT A;  1CX8 A;  1Y0Y A;  3CXS A;  4KOV A;  3V8I A;  2Z3M A;  4M6H A;  4MFK A;  2BO9 A;  5G20 A;  1YW4 A;  3DSB A;  4XPD C;  3BI0 A;  3PRT A;  1HEE A;  3K9T A;  3KQZ A;  4OKO A;  4OME A;  4M6G A;  4F6A A;  4PXD A;  2CY2 A;  4NGR A;  4UCP A;  2Q4Y A;  5HMN A;  2ZW6 A;  4NJR A;  2AFU A;  2H5M A;  4B5O A;  2ZEG A;  3F5B A;  3KHX A;  1L0C A;  1ZG9 A;  3F0A A;  4C68 A;  4MFQ A;  1IIC A;  4DUK A;  1YVO A;  2BSW A;  2V8G A;  2FXF A;  2ZEE A;  2JLM A;  4R8F A;  4ONU A;  1LOK A;  3RNZ A;  2C6C A;  3A9L A;  2POK A;  4MFP A;  2DEA A;  2D4P A;  4HNX B;  3K9U A;  4MFL A;  2Z0Z A;  1IID A;  4UFV A;  4LQG A;  1R57 A;  2PRQ A;  4A94 A;  6CPA A;  1B6B A;  2V8D A;  3EC4 A;  3KR4 A;  2C27 A;  3FJU A;  1RO5 A;  5LYD A;  1TF8 A;  4P44 A;  2ZEH A;  3FF3 A;  3D2P A;  3D68 A;  2PVV A;  3V7Z A;  2CTB A;  1AMP A;  4ONW A;  3RYO A;  2AFO A;  4A30 A;  2PR8 A;  3B3S A;  1XBU A;  2R1I A;  3G8W A;  4UWJ A;  4PXE A;  3SHP A;  2X7B A;  4JLY A;  4NGN A;  3SJE A;  1IB1 E;  3QAY A;  3WC6 A;  4W9Y A;  1Z8W A;  3HUV A;  1CP7 A;  4RUH A;  1FY7 A;  1IYL A;  4FD6 A;  4JYW A;  4U9Y A;  4CGL A;  4RI1 A;  4B5P A;  5HH1 A;  4P6Y A;  3GIU A;  4CGM A;  1IOI A;  1XE4 A;  4FD7 A;  4KOR A;  5J8F A;  3S9L A;  2BL1 A;  3TOA A;  1Q2D A;  2PJ4 A;  4R76 A;  3FNC A;  4CS0 B;  4OAD A;  2DXQ A;  3SI1 A;  4M6I A;  4NSQ A;  2EVN A;  3S9M A;  4B13 A;  4F0Y A;  4HNY B;  1P0H A;  4HNW B;  2ZEP A;  5CPA A;  4MI4 A;  2OU2 A;  3MGD A;  3KI9 A;  2PJC A;  4CPA A;  1NSA A;  3ISX A;  3MRU A;  4AVA A;  1S60 A;  1YQE A;  2GLJ A;  3B3T A;  4R6T A;  4H2K A;  4CYQ A;  4XPD B;  2Q4Z A;  5F47 A;  2YNC C;  2Q7S A;  2Q04 A;  4FAI A;  3NE8 A;  4B12 A;  5K8P A;  2P0W A;  3SJX A;  2Z3K A;  2YNE A;  2RC4 A;  3PP9 A;  5LRJ A;  4JZ0 A;  4A2Z A;  4EVY A;  1XOV A;  4YGO A;  4CYN A;  2XEF A;  3D7H A;  4AVC A;  4MHN A;  1TKH A;  5G22 A;  3VAT A;  5CBM A;  2PCU A;  2F7V A;  4DJL A;  4UEZ A;  2ZOF A;  2ZOG A;  3H8E A;  1CPX A;  1TKJ A;  1AUG A;  2BUE A;  3SI2 A;  4PSX A;  2Q44 A;  4ZX8 A;  2I3C A;  4UIB A;  1BPN A;  3B7I A;  1Z5R A;  3CPX A;  4LQ6 A;  2Q7B A;  4BMH A;  3FVL A;  4NGP A;  1Z8T A;  4KOT A;  1HDQ A;  4P4F A;  4UF4 A;  1XEB A;  3SXO A;  2AFM A;  2F5I A;  3L2N A;  1PCA A;  4YWY A;  2YND A;  4R87 A;  1U6M A;  2J8M A;  1Y7R A;  2HV2 A;  2VZZ A;  1R43 A;  2VBQ A;  5C82 A;  2OB0 A;  1PU9 A;  2Q51 A;  3RZA A;  3FX6 A;  5HXD A;  3TFY A;  4KUB A;  1ON0 A;  4KOS A;  2C1C A;  3S6K A;  4FWU A;  7CPA A;  5F48 A;  4R57 A;  3CDX A;  2AFS A;  2O53 A;  2ATR A;  2PRB A;  3EFA A;  4UEF A;  1YGH A;  2PC1 A;  3GLJ A;  3NH4 A;  4F9U A;  3BLN A;  4CRZ B;  1QQ9 A;  2R7H A;  4A95 A;  2F8H A;  1Y9K A;  5AG7 A;  3N7Z A;  3TCV A;  4FUU A;  2HQY A;  3ZZI A;  1J4J A;  1A2Z A;  4YRH A;  2Z11 A;  1EE3 P;  1I12 A;  4JXQ A;  2PVW A;  3FEC A;  1M4I A;  2BEI A;  2AE6 A;  2C6P A;  2G3A A;  4PPZ A;  2WPW A;  2C6G A;  2NSM A;  2Q43 A;  4ZX9 A;  1IOF A;  1ZLI A;  3JTK A;  3CT9 A;  3LD2 A;  1KUX A;  3KR5 A;  1P4N A;  3TC8 A;  5ISV A;  3VH9 A;  4OAE A;  4A32 A;  2ABZ A;  3CXP A;  2B4B A;  1RTQ A;  3KGQ A;  1F2P A;  1Q2C A;  4PSW A;  4QB9 A;  4NGT A;  4UEE A;  4CGN A;  2PJ6 A;  4EFD A;  4QVT A;  4BIN A;  3NE7 A;  1YVK A;  4A39 A;  2PJ3 A;  1CJW A;  2ZED A;  4PV6 A;  3VAR A;  2AFW A;  5C88 A;  1ELM P;  3PEI A;  1FT7 A;  2VXK A;  3R9E A;  1S3Z A;  3D67 A;  5K8O A;  1I1D A;  4G1P A;  4MY0 A;  4MMO A;  4CAV A;  3SXN A;  4KVX A;  1CM0 A;  3TO9 A;  4H89 A;  4CAE A;  3CXQ A;  1PUA A;  2GAN A;  1XRY A;  4K3N A;  4MJ8 A;  4IHM A;  2EUI A;  1YX0 A;  4B5P B;  2K5T A;  3T9Y A;  3LOD A;  2CNS A;  5KTA A;  4LUA A;  2B4D A;  2XEI A;  1TXR A;  4QC6 A;  4CGP A;  1ARL A;  1YW6 A;  2Z3P A;  2DF5 A;  2J8R A;  4KOY A;  1Q2Y A;  1LRZ A;  4C2X A;  2FE7 A;  1N71 A;  2GIV A;  4Z65 A;  1XFO A;  3FMC A;  4MFZ A;  2QIR A;  5AG4 A;  4R9M A;  3IGR A;  2ODF A;  3D66 A;  2PJ0 A;  1ZLH A;  3K2K A;  1IY7 A;  4XPL A;  4IF5 A;  5I0C A;  1QST A;  4FBE A;  1I21 A;  4E2A A;  5LYI A;  3KZW A;  2OZU A;  4JJX A;  2FVG A;  1NSL A;  3DGV A;  3D3S A;  8CPA A;  3BI1 A;  3B3C A;  4X8I A;  4P45 A;  5JH9 A;  1S7F A;  4CYP A;  5DWN A;  3IC1 A;  1M4D A;  4ZY0 A;  1XMT A;  3LAC A;  5EBV A;  4JD6 A;  3S6F A;  3DR6 A;  4X3R A;  3W91 A;  3JVN A;  4Q36 A;  1Z4E A;  2ZW7 A;  1QSO A;  1VHO A;  4NFR A;  2ARH A;  1MK4 A;  2Q4V A;  2CIJ A;  2PE3 A;  3H5Z A;  3D8P A;  4ORF A;  5EMI A;  2GE3 A;  1F2O A;  3C26 A;  3GB0 A;  2RFH A;  3PB9 X;  4MXU A;  4OIW A;  2R98 A;  4O23 A;  4OC0 A;  3ZJ0 A;  3PBE A;  2VZY A;  5H84 A;  3KAS A;  1FNO A;  1MJA A;  1NMT A;  4ZBG A;  1IYK A;  3MN8 A;  3FB3 A;  5D29 A;  2EK8 A;  4JWP A;  3H8F A;  2FIW A;  2P6E A;  2PR1 A;  2B5G B;  3DLJ A;  2JBK A;  1HDU A;  4MHZ A;  4MCP A;  3UY5 A;  1Y7E A;  5BWA B;  3R9G A;  3B3V A;  2WYR A;  3NH5 A;  4U5Y A;  5FVJ A;  2PJ5 A;  4DYO A;  3WT4 A;  2Q0Y A;  3IU1 A;  3EO4 A;  1UWY A;  4BBH A;  1JWQ A;  4A31 A;  4KOW A;  3NA6 A;  3TTH A;  1GHE A;  3B8G A;  4EWT A;  1SQH A;  4P10 A;  1BO4 A;  2B3V A;  4KOU A;  2REF A;  4MBU A;  1K4J A;  1IU8 A;  2JEV A;  4Q7A A;  4UCN A;  3WAB A;  1ZO0 A;  4GM5 A;  3PGP A;  1YR0 A;  2G0B A;  1QSM A;  5JQ4 A;  4B14 A;  1XIX A;  2EO8 A;  4UBR A;  3FYN A;  3G3S A;  2IMO A;  5DWM A;  1CPS A;  4WWV A;  2CNT A;  2ZEM A;  3B35 A;  1ZG8 A;  1VKC A;  3SI0 A;  5HVG A;  4MHD A;  5IB9 A;  4FD4 A;  4ZI6 A;  2VEZ A;  3IU2 A;  2V77 A;  4Q38 A;  1QMU A;  4P4J A;  4UFX A;  2FIA A;  3VWD A;  2B3U A;  4UFW A;  1BAV A;  4ZYQ A;  5D8N A;  2Y0M A;  2REE A;  3CZX A;  4CYO A;  3RAM A;  4AVB A;  3TE4 A;  4NGQ A;  4U9Z A;  1S5K A;  4RN7 A;  3KL9 A;  4F8Z A;  2G9D A;  5K8M A;  1H8L A;  3IIB A;  3S6H A;  4P4I A;  1OZP A;  3E0K A;  5K8N A;  3JUW A;  3D2M A;  2IJZ A;  4AG7 A;  3I3G A;  5H86 A;  2G3T A;  4L89 A;  3GYA A;  3NH8 A;  1VHS A;  3B3W A;  3ISZ A;  3JRU A;  1KUY A;  4PK2 A;  4TNU A;  5G1Z A;  4OC3 A;  4MRI A;  5F49 A;  3QB8 A;  4NCZ A;  4P4E A;  3TO6 A;  4IUS A;  3VWE A;  2PJ9 A;  1VGY A;  2AJ6 A;  4GS4 A;  1BLL E;  2A4N A;  3CPA A;  2J9A A;  1Z2L A;  2XEJ A;  5DS0 A;  4QBJ A;  3IWE A;  1LAM A;  4CGO A;  4PXB A;  2EWB A;  4KS9 A;  3KQX A;  3WC7 A;  4F0X A;  5IV0 A;  3WR7 A;  3D7D A;  1MJ9 A;  4KSI A;  2EK9 A;  3DDD A;  4XNH C;  1AYE A;  2GFQ A;  4H6U A;  4C7H A;  3FRM A;  3R95 A;  4C7I A;  2FS5 A;  4CAF A;  1YK3 A;  3I1U A;  3GY9 A;  4MCR A;  4F9V A;  4B11 A;  2PIZ A;  2ZXV A;  3GKR A;  2QYV A;  4KSA A;  4OC4 A;  2D4O A;  1B87 A;  4XPK A;  5AG6 A;  3H4Q A;  2AFZ A;  3S6G A;  4E0A A;  3PB7 X;  4HKF A;  4B10 A;  1M44 A;  1ARM A;  3LMS A;  2NMT A;  1CG2 A;  4OP4 A;  3TT2 A;  2OR4 A;  4MHY A;  1YRE A;  2FT0 A;  3TOB A;  4UCM A;  2FSR A;  2BCO A; 
#chains in the Genus database with same CATH homology
 2HUZ A;  3R96 A;  1Z4R A;  2Z3L A;  1Z9U A;  4CRY B;  3PZJ A;  4LX9 A;  1S7K A;  2YGW A;  3QAH A;  5CNP A;  2Z10 A;  3DNS A;  3WR7 A;  2PSW A;  3P2H A;  3FBU A;  2VI7 A;  2ZW4 A;  4NEX A;  5A28 A;  3P2F A;  3FIX A;  4OLL A;  2R8V A;  1S7N A;  3FXT A;  4UA3 A;  2P6G A;  5G21 A;  2OH1 A;  3EXN A;  4UWI A;  1WWZ A;  1RXT A;  4PK3 A;  1TIQ A;  4JXR A;  3R9F A;  4DNC A;  1MJB A;  4E8O A;  4ZGY B;  4Y49 B;  3BJ8 A;  2I79 A;  3EY5 A;  2OZG A;  1KZF A;  2QEC A;  5JPH A;  2YNC A;  4FD5 A;  4R3L A;  2OZH A;  2WSA A;  3OWC A;  4KLW A;  4QUS A;  1M1D A;  4I49 A;  1BOB A;  4NXY A;  3R1K A;  4J3G A;  2JDD A;  4XNH B;  5A27 A;  2DPT A;  5AG5 A;  2Z3O A;  2O28 A;  4C2Z A;  2Z3N A;  3W6S A;  4MFJ A;  5KTD A;  1XF8 A;  1KUV A;  5F46 A;  3IWG A;  4CAX A;  2PDO A;  2IL4 A;  4RS2 A;  4KLV A;  3KKW A;  2ZPA A;  1UFH A;  2QML A;  3BJ7 A;  2B58 A;  5J8C A;  4C2Y A;  3I9S A;  4NF1 A;  4K30 A;  4M85 A;  4L8A A;  2CXA A;  1QSN A;  5GCN A;  1S7L A;  4KVO E;  2KCW A;  3T90 A;  2DPS A;  1Y9W A;  1QSR A;  4AG9 A;  2B5G A;  2I00 A;  3DR8 A;  4II9 A;  4Y49 C;  2WPX A;  1V0C A;  2ZW5 A;  2P6F A;  1M4G A;  2FCK A;  2PQ8 A;  4A33 A;  5IX3 A;  2B4D B;  4X5K A;  4KOX A;  4AB7 A;  4YFJ A;  2VQY A;  5E96 A;  1NE9 A;  1YLE A;  2FL4 A;  5KTC A;  1WK4 A;  2CNM A;  4KSF A;  2WUU A;  4KVM E;  5IB0 A;  5EC4 A;  4KUA A;  3W6X A;  3TO7 A;  4CAW A;  5AGE A;  4MY3 A;  2JDC A;  4H6Z A;  4R3K A;  4M3S A;  2J8N A;  3F8K A;  4KZT A;  4KOV A;  3CXS A;  3V8I A;  2Z3M A;  5G20 A;  4MFK A;  3DSB A;  4XPD C;  4F6A A;  2CY2 A;  4UCP A;  2Q4Y A;  5HMN A;  2ZW6 A;  2H5M A;  4B5O A;  3F5B A;  1L0C A;  3F0A A;  4C68 A;  4MFQ A;  1IIC A;  1YVO A;  2BSW A;  2FXF A;  2JLM A;  4ONU A;  3A9L A;  4MFP A;  2D4P A;  4HNX B;  3K9U A;  4MFL A;  2Z0Z A;  1IID A;  4UFV A;  1R57 A;  1B6B A;  3EC4 A;  2C27 A;  1RO5 A;  3D2P A;  3RYO A;  4A30 A;  2PR8 A;  2R1I A;  3G8W A;  4UWJ A;  3SHP A;  2X7B A;  4JLY A;  1IB1 E;  1FY7 A;  1IYL A;  4FD6 A;  4U9Y A;  4CGL A;  4RI1 A;  4B5P A;  5HH1 A;  4CGM A;  1XE4 A;  4FD7 A;  4KOR A;  2BL1 A;  3TOA A;  1Q2D A;  3FNC A;  4CS0 B;  4OAD A;  2DXQ A;  4NSQ A;  2EVN A;  4B13 A;  4F0Y A;  4HNY B;  1P0H A;  4HNW B;  4MI4 A;  2OU2 A;  3MGD A;  4AVA A;  1S60 A;  4CYQ A;  4XPD B;  5F47 A;  2YNC C;  2Q04 A;  4B12 A;  2P0W A;  2Z3K A;  2YNE A;  2RC4 A;  3PP9 A;  4A2Z A;  4EVY A;  4YGO A;  4CYN A;  4AVC A;  5G22 A;  2BUE A;  4PSX A;  2Q44 A;  2Q7B A;  4BMH A;  3SXO A;  4KOT A;  1XEB A;  2F5I A;  2YND A;  4R87 A;  1U6M A;  2J8M A;  1Y7R A;  2HV2 A;  2VZZ A;  2VBQ A;  5C82 A;  2OB0 A;  1PU9 A;  3TFY A;  4KUB A;  1ON0 A;  4KOS A;  3S6K A;  5F48 A;  4R57 A;  2ATR A;  2PRB A;  3EFA A;  1YGH A;  2PC1 A;  3BLN A;  4CRZ B;  2R7H A;  4A95 A;  1Y9K A;  5AG7 A;  3N7Z A;  3TCV A;  3ZZI A;  2HQY A;  1J4J A;  4YRH A;  2Z11 A;  1I12 A;  4JXQ A;  1M4I A;  2BEI A;  2AE6 A;  2G3A A;  2WPW A;  3JTK A;  3LD2 A;  1KUX A;  1P4N A;  5ISV A;  4OAE A;  4A32 A;  3CXP A;  2B4B A;  4CGN A;  1Q2C A;  4PSW A;  4QB9 A;  4QVT A;  3NE7 A;  1YVK A;  4PV6 A;  1CJW A;  5C88 A;  2VXK A;  3R9E A;  1S3Z A;  1I1D A;  4MY0 A;  4CAV A;  3SXN A;  4KVX A;  1CM0 A;  3TO9 A;  4H89 A;  4CAE A;  3CXQ A;  1PUA A;  2GAN A;  4MJ8 A;  2EUI A;  1YX0 A;  4B5P B;  2K5T A;  3T9Y A;  3LOD A;  2CNS A;  5KTA A;  4LUA A;  2B4D A;  4QC6 A;  4CGP A;  2Z3P A;  2J8R A;  4C2X A;  4KOY A;  1Q2Y A;  1LRZ A;  2FE7 A;  1N71 A;  2GIV A;  5AG4 A;  4MFZ A;  2QIR A;  4R9M A;  3IGR A;  4XPL A;  4IF5 A;  5I0C A;  1QST A;  1I21 A;  4E2A A;  2OZU A;  4JJX A;  1NSL A;  3D3S A;  1S7F A;  4CYP A;  5DWN A;  1M4D A;  1XMT A;  5EBV A;  4JD6 A;  3S6F A;  3DR6 A;  3W91 A;  3JVN A;  4Q36 A;  1Z4E A;  2ZW7 A;  1QSO A;  2ARH A;  1MK4 A;  3H5Z A;  2Q4V A;  3D8P A;  4ORF A;  2GE3 A;  3C26 A;  2R98 A;  3ZJ0 A;  2VZY A;  5H84 A;  1MJA A;  1NMT A;  4ZBG A;  1IYK A;  3FB3 A;  4JWP A;  2FIW A;  2P6E A;  2PR1 A;  2B5G B;  3UY5 A;  5BWA B;  3R9G A;  5FVJ A;  4U5Y A;  2Q0Y A;  3IU1 A;  3EO4 A;  4BBH A;  4A31 A;  4KOW A;  3TTH A;  1GHE A;  3B8G A;  1SQH A;  1BO4 A;  2B3V A;  4KOU A;  2REF A;  4MBU A;  1K4J A;  2JEV A;  4UCN A;  1ZO0 A;  3PGP A;  1YR0 A;  2G0B A;  1QSM A;  5JQ4 A;  4B14 A;  1XIX A;  4UBR A;  3FYN A;  3G3S A;  5DWM A;  2CNT A;  1VKC A;  4MHD A;  4FD4 A;  2VEZ A;  3IU2 A;  4Q38 A;  4UFX A;  2FIA A;  3VWD A;  2B3U A;  4UFW A;  2Y0M A;  2REE A;  4CYO A;  4AVB A;  3TE4 A;  4U9Z A;  1S5K A;  3S6H A;  1OZP A;  3E0K A;  3JUW A;  3D2M A;  4AG7 A;  3I3G A;  5H86 A;  2G3T A;  4L89 A;  3GYA A;  4PK2 A;  1VHS A;  1KUY A;  5G1Z A;  5F49 A;  3QB8 A;  4NCZ A;  3TO6 A;  4IUS A;  3VWE A;  2AJ6 A;  4GS4 A;  2A4N A;  4QBJ A;  3IWE A;  4CGO A;  5IV0 A;  4KS9 A;  4F0X A;  1MJ9 A;  3DDD A;  4XNH C;  4H6U A;  4C7H A;  3FRM A;  3R95 A;  4C7I A;  2FS5 A;  4CAF A;  1YK3 A;  3GY9 A;  4B11 A;  2ZXV A;  3GKR A;  4KSA A;  2D4O A;  1B87 A;  4XPK A;  5AG6 A;  3H4Q A;  3S6G A;  4E0A A;  4HKF A;  4B10 A;  1M44 A;  2NMT A;  3TT2 A;  1YRE A;  2FT0 A;  3TOB A;  4UCM A;  2FSR A;  5J8F A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...