4LUAA

Crystal structure of n-acetyltransferase from staphylococcus aureus mu50
Total Genus 45
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
45
sequence length
164
structure length
156
Chain Sequence
b'AMIEIKTLTNNDFNEYKRLVSTVNEEFTQDSHYSQTMTDTLIHDILNKCIVFGCYENETLIATAALEQIREHKSLIKYNFVTNNDKSINSELINFIINYARQNNYESLLTSIVSNNIGAKVFYSALGFDILGFEKNAIKIGNTYFDEHWLFYDLIN'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords N-acetyltransferase
publication title Purification, crystallization and preliminary X-ray diffraction analysis of the N-acetyltransferase SAV0826 from Staphylococcus aureus.
pubmed doi rcsb
source organism Staphylococcus aureus subsp. aureus
molecule tags Transferase
total genus 45
structure length 156
sequence length 164
ec nomenclature
pdb deposition date 2013-07-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13420 Acetyltransf_4 Acetyltransferase (GNAT) domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.630.30 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Aminopeptidase 4luaA00
3FB3A 4NF1A 3F0AA 2VZYA 4M85A 3F8KA 2Q7BA 4MBUA 3ZJ0A 2P0WA 4XPKA 4R9MA 4FD4A 2ZW6A 3IWGA 2C27A 2B5GA 3KKWA 2ZW7A 2R98A 3BJ7A 4PSXA 4KORA 5EC4A 3SHPA 5C88A 2P6FA 2ZW4A 2CNSA 2QECA 1QSNA 2BUEA 1Q2YA 1S3ZA 4JJXA 3T90A 2VEZA 4R3LA 4L89A 3PZJA 2Z0ZA 2QMLA 3UY5A 1B87A 3EY5A 3C26A 2J8RA 1YGHA 2FIAA 4FD5A 1QSOA 2O28A 3TOBA 3VWEA 2A4NA 4U9YA 4E0AA 3PGPA 1P4NA 2QIRA 2B58A 1S60A 2OH1A 4HNXB 2Q44A 4R57A 5CNPA 3D3SA 3TE4A 4KVOE 4MHDA 2AE6A 3DR6A 4HNWB 4XPDB 1IYKA 1RXTA 3R1KA 4NCZA 4ZBGA 2FSRA 2G0BA 2GANA 3G3SA 1KUYA 2EVNA 5IX3A 4MY0A 4CRYB 3TO6A 1QSRA 2VQYA 2B4DA 3BLNA 3QAHA 3S6KA 5GCNA 4KOUA 4KOYA 4M3SA 4UWIA 1XIXA 2FL4A 4I49A 4QBJA 5EBVA 4LUAA 2VI7A 2Q4YA 4X5KA 4UWJA 3K9UA 3N7ZA 2R8VA 1S7FA 5KTDA 5J8FA 4QC6A 1M4IA 4KVXA 4B5PB 1GHEA 2FIWA 3FYNA 2PR8A 4CAXA 2PC1A 1BO4A 3I3GA 4FD7A 3G8WA 3T9YA 4MI4A 3W6XA 4Y49B 4KOWA 4AVBA 1VKCA 1Z9UA 2CY2A 1B6BA 4XNHC 4QB9A 4AVCA 3GY9A 4L8AA 4OAEA 4JXRA 5IB0A 1BOBA 1L0CA 4CRZB 1OZPA 4B5PA 5HH1A 1KUVA 1K4JA 5F49A 2B3VA 2J8MA 4NSQA 1MK4A 3JVNA 4EVYA 3JUWA 3TOAA 1YX0A 3S6GA 4MJ8A 3FXTA 2WPXA 4RS2A 1I12A 2R1IA 4LX9A 2PRBA 2JEVA 2CNTA 1XMTA 3EXNA 5F47A 1IB1E 3DSBA 5IV0A 4BMHA 2DXQA 5ISVA 5H86A 4OADA 4YFJA 1M44A 1Q2CA 4GS4A 4JLYA 1MJ9A 2P6GA 3GKRA 2G3TA 1XEBA 1IYLA 3H4QA 3F5BA 3LODA 4KUBA 3DDDA 3CXSA 3TTHA 3R9GA 2HV2A 3W6SA 4H89A 4J3GA 3FIXA 4E2AA 2ATRA 1YK3A 5JQ4A 3EO4A 2VBQA 1I21A 3DNSA 2WPWA 4IUSA 3FRMA 2EUIA 2ARHA 4MY3A 3D8PA 1YVOA 3VWDA 3CXPA 1KUXA 3R9EA 5KTCA 4XPDC 4KOSA 2OZHA 2G3AA 2Z11A 3I9SA 4KLVA 2PSWA 4R3KA 3RYOA 4UA3A 4QVTA 4F6AA 2ZPAA 3IGRA 2FXFA 5E96A 1R57A 3P2FA 1MJAA 1RO5A 1M4GA 5F46A 2BEIA 2AJ6A 5F48A 3TO7A 1IIDA 4K30A 2FT0A 1WWZA 3TO9A 1YLEA 4II9A 2VXKA 4AG7A 4XPLA 2RC4A 3CXQA 2Q0YA 4U5YA 2REEA 3PP9A 3B8GA 3DR8A 3ZZIA 4KOXA 3S6FA 4AG9A 2B4BA 1Q2DA 2HQYA 2Z10A 2JDDA 4Y49C 2Y0MA 2FE7A 5I0CA 2HUZA 4PK2A 1V0CA 4FD6A 1S5KA 2B5GB 5J8CA 1YR0A 3R96A 4CAWA 2OB0A 3TCVA 2ZW5A 1QSTA 3NE7A 5H84A 5KTAA 2B3UA 1QSMA 4KOTA 3D2MA 1ON0A 2K5TA 4KLWA 1XE4A 4PK3A 2VZZA 1S7KA 3P2HA 2GIVA 2I00A 1WK4A 2OU2A 2CNMA 4HKFA 1MJBA 4UBRA 2Q4VA 2NMTA 2D4PA 1N71A 1PUAA 4HNYB 1Z4EA 4ONUA 3FNCA 3TT2A 2OZUA 1Y9KA 4NXYA 3W91A 3GYAA 4B5OA 2OZGA 1M1DA 1XF8A 2PDOA 5DWNA 2KCWA 5DWMA 4KOVA 4RI1A 3MGDA 3FBUA 2F5IA 1YREA 2PR1A 3OWCA 1Y9WA 1NSLA 3TFYA 1CJWA 2B4DB 2GE3A 3R95A 3S6HA 1S7LA 4H6UA 4F0YA 4KZTA 2IL4A 3E0KA 1VHSA 1KZFA 3SXOA 3R9FA 5JPHA 4QUSA 4OLLA 4H6ZA 3EC4A 1S7NA 4DNCA 4R87A 1U6MA 2BSWA 2I79A 3BJ8A 1UFHA 3EFAA 1J4JA 1FY7A 2Q04A 4YGOA 4JWPA 4IF5A 4CS0B 2REFA 4CAVA 5C82A 3V8IA 2PQ8A 1LRZA 2D4OA 2JLMA 4NEXA 4E8OA 4AB7A 4KVME 4AVAA 1Z4RA 2JDCA 2P6EA 5FVJA 1NE9A 2H5MA 2X7BA 1M4DA 4ORFA 2BL1A 3QB8A 1SQHA 4KUAA 2FS5A 4PSWA 1TIQA 4JD6A 5HMNA 2R7HA 1Y7RA 1P0HA 1IICA 2ZXVA 1YVKA 1I1DA 3D2PA 3WR7A 4XNHB 3SXNA 4YRHA 4U9ZA 3LD2A 1CM0A 2FCKA 2J8NA 4JXQA 1PU9A 4PV6A 1NMTA
chains in the Genus database with same CATH superfamily
4JZ0A 2POKA 3FB3A 4NF1A 1ELMP 1IU8A 2VZYA 3B3VA 1F57A 3F0AA 3DLJA 3F8KA 4M85A 4MBUA 2Q7BA 3ZJ0A 2P0WA 4XPKA 4R9MA 2J9AA 2JBKA 4FD4A 2PJBA 2ZW6A 3IWGA 2C27A 2C6CA 3KI9A 4MHPA 2PIYA 2B5GA 2F7VA 3NFZA 3KKWA 5AG6A 2ZW7A 3GUXA 2R98A 2XEIA 3PB6X 2ODFA 4C7IA 2EK9A 7CPAA 1XOVA 3BJ7A 2V8GA 4PSXA 2PJAA 4A33A 1CG2A 4KORA 5EC4A 3SHPA 4CAEA 2P6FA 2Q7SA 2CNSA 2ZW4A 2QECA 5C88A 1QSNA 2BUEA 1Q2YA 1S3ZA 4JJXA 3T90A 2VEZA 4R3LA 4L89A 3PZJA 4UEEA 4HPSA 3SJEA 2Z0ZA 3B3TA 3D7HA 4NJQA 3S9MA 2IMOA 1H8LA 2QMLA 3UY5A 1B87A 2ZENA 3C26A 3EY5A 3LWUA 5HVHA 3WABA 2YNCC 2YNDA 2J8RA 2PJ4A 4NGRA 4B11A 1YGHA 2FIAA 4R76A 3D7GA 4UFVA 4FD5A 3BI1A 1QSOA 2O28A 2ZEDA 4P44A 3TOBA 4ZY1A 4B6ZA 4CGNA 3IJ3A 3H5ZA 5J1QA 2ABZA 3VWEA 4FUUA 3IC1A 2A4NA 4CGLA 4OC2A 1Y0RA 4UF4A 4U9YA 3IIBA 4E0AA 3PGPA 3NH8A 3PB7X 1P4NA 1QMUA 2QIRA 2GREA 2Z3LA 4H2KA 5K8PA 2B58A 1S60A 2OH1A 4HNXB 2Q44A 4FBEA 4R57A 1Z5RA 5CNPA 1FT7A 2DEAA 3D3SA 3NE8A 3TE4A 4KVOE 3SI1A 4MHDA 2AE6A 3WC7A 2CF4A 3DR6A 4MFQA 3KHZA 3PRTA 4R7MA 2IQ6A 4HNWB 3FF3A 4MFZA 3S9NA 4XPDB 1X10A 1IYKA 1RXTA 2PJ6A 2ZEPA 1BPMA 2FSRA 3R1KA 4NCZA 5AG7A 4ZBGA 4A94A 4A31A 4F0XA 5JH9A 2G0BA 2GANA 3G3SA 1KUYA 4P4IA 5IB9A 2EVNA 4ZI6A 5IX3A 4MY0A 4CRYB 2Z3MA 4YU9A 3TO6A 2V8HA 2XEGA 1QSRA 2VQYA 2B4DA 3BLNA 3BI0A 3CDXA 4ZY2A 4NGQA 3QAHA 4BINA 4OKOA 5GCNA 3S6KA 4A38A 5EMIA 2F8HA 4KOUA 3D7FA 4KOYA 4M3SA 3PB4X 4UWIA 1XIXA 5G1ZA 2FL4A 2Q4ZA 4P45A 2C6PA 2CIJA 4I49A 4MCQA 3TC8A 3RO0A 5EBVA 2BCOA 4QBJA 2VL1A 4LUAA 2VI7A 2Q4YA 5D29A 4X5KA 5THWA 4ZY0A 4UWJA 3K9UA 4OC4A 3K2KA 3PEIA 4CGPA 3KASA 4RUHA 3N7ZA 2R8VA 1S7FA 3IEHA 5KTDA 5J8FA 1BAVA 4QC6A 4NGSA 3B2YA 1M4IA 4KVXA 4B5PB 3ISXA 4P4FA 1GHEA 2FIWA 1ZG7A 2Z3NA 4MFLA 3FYNA 2PR8A 3GB0A 5G22A 5A28A 1JWQA 5LYLA 4CAXA 2PC1A 1BO4A 1Y0YA 3I3GA 4FD7A 2QVPA 2EO8A 3G8WA 4MFKA 3RAMA 3T9YA 4MI4A 3W6XA 4Y49B 4KOWA 3CPXA 4AVBA 1VKCA 1Z9UA 2CY2A 2CTBA 2XEJA 1B6BA 4GM5A 2ZEMA 4OIWA 4XNHC 1KWMA 1LCPA 4QB9A 4G1PA 4AVCA 3GY9A 4L8AA 3D7DA 1Y7EA 1ARMA 4OAEA 2GU2A 3B3WA 3CPAA 2GLJA 4JXRA 1VHOA 1BOBA 1ZG8A 1L0CA 3KR5A 5IB0A 2PJ2A 3PBBA 4CRZB 2I3CA 1TKFA 1OZPA 4RN7A 5JGFA 4MXUA 5HVFA 4CYQA 4B5PA 4P4JA 2RFHA 1KUVA 5HH1A 2BOAA 1K4JA 5F49A 2HB6A 3QNVA 1YLOA 2B3VA 2ZEGA 2J8MA 4KSFA 4YWYA 4NSQA 4A95A 2Z3PA 3GLJA 4A37A 1EE3P 1MK4A 3JVNA 4EVYA 1Z8XA 4FAIA 3JUWA 3TOAA 1YX0A 3LACA 5G21A 2PVVA 2ZEFA 3S6GA 4P4BA 3FEDA 4MJ8A 3FXTA 1FNOA 1YSJA 2WPXA 4RS2A 1I12A 1IGBA 2R1IA 4LX9A 2PRBA 2JEVA 2CNTA 1XMTA 3EXNA 3FJUA 5F47A 5LYFA 4DJLA 1IB1E 3DSBA 5IV0A 1ARLA 3IU2A 3V38A 4BMHA 2DXQA 4MHZA 5ISVA 5H86A 4CAFA 3LMSA 4OADA 4OC1A 3HLPA 1Q7LA 2OOTA 1M44A 1Q2CA 4GS4A 4JLYA 4YFJA 1MJ9A 2NYQA 3QAYA 2P6GA 3FH4A 1LANA 5AG5A 3JTKA 3B3SA 5LRKA 3A9LA 3GKRA 4OIDA 2G3TA 2AFXA 1XEBA 1IYLA 3H4QA 2XEFA 3F5BA 3LODA 4KUBA 4A39A 1YQEA 1YW4A 3CXSA 3DDDA 1F2PA 4MCPA 3TTHA 1IOIA 3R9GA 1XJOA 2HV2A 3W6SA 4H89A 3FIXA 4J3GA 4B13A 2ZEHA 4E2AA 2ATRA 1YK3A 4EWTA 2PJCA 3EO4A 5JQ4A 2VBQA 1I21A 3DNSA 4OC5A 4MHNA 2WPWA 4IUSA 3MRUA 2PIZA 3BHXA 3FRMA 2HC9A 3VARA 4UCMA 4Q38A 3B7IA 2EUIA 2ARHA 3T8WA 4MY3A 3D8PA 1YVOA 1R3NA 2PJ8A 3BXMA 3VWDA 3CXPA 1KUXA 1PYTB 3R9EA 4NFRA 1HEEA 5KTCA 4XPDC 4F9UA 4KOSA 2QJ8A 2OZHA 2G3AA 2Z11A 4C2ZA 2JBJA 3I9SA 5LYDA 4KLVA 2PSWA 4DYOA 4R3KA 2EWBA 3RYOA 4UA3A 4QVTA 4F6AA 4DUKA 2ZPAA 2ZOFA 3IGRA 1DE4C 2YNEA 2FXFA 5E96A 2PE3A 1R57A 1TF8A 4MCSA 5DS0A 3D68A 3P2FA 1MJAA 4LQ6A 1TXRA 2AFOA 1YW6A 1RO5A 1M4GA 2NSMA 5F46A 2BEIA 2AJ6A 5BWAB 5F48A 2CTCA 3TO7A 4B10A 1IIDA 4K30A 2FT0A 1WWZA 4ZX9A 3TO9A 1YLEA 3WC5A 4A30A 4PXCA 4II9A 2VXKA 4K3NA 4MCRA 3KHXA 4XPLA 4AG7A 2RC4A 3CXQA 1CPXA 1NSAA 2Q0YA 4Q7AA 4U5YA 3WT4A 2REEA 4M6IA 1IY7A 4IAVA 3B35A 3PP9A 5CPAA 3B8GA 2PRQA 3VH9A 3DR8A 3ZZIA 4B12A 4UFXA 4KOXA 5HVGA 3RZAA 3S6FA 3IU1A 4AG9A 4UCNA 2B4BA 1Q2DA 2HQYA 3NA6A 1A2ZA 1BLLE 2CXAA 3FMCA 4UIAA 3D66A 2ANPA 2Z10A 4P10A 2JDDA 4C68A 2GFQA 3ISZA 4Y49C 2Y0MA 2FE7A 2DF5A 3CT9A 5I0CA 2HUZA 4PK2A 1V0CA 2PVWA 4FD6A 3NH5A 4ZX8A 1S5KA 3FEEA 2B5GB 1ELLP 3SJFA 1LAMA 4PXEA 5J8CA 2PCUA 1HDUA 4W9YA 2JEWA 5JM6A 4TNUA 1UWYA 3KQZA 5K8NA 1YR0A 3KQXA 2O4HA 3R96A 4CAWA 1DTDA 2OB0A 4OC0A 4F9VA 4P6YA 8CPAA 5LRJA 1LOKA 1ZLIA 3TCVA 1VHEA 2ZW5A 1QSTA 3NE7A 4JYWA 5H84A 4AXVA 2WZNA 5KTAA 3GIUA 2B3UA 1QSMA 2O53A 2EBJA 4KOTA 3D2MA 1ON0A 6CPAA 5I4MA 2K5TA 4IK2A 3VATA 3FVLA 4KLWA 1XE4A 4PK3A 4Q36A 3PBEA 2VZZA 1AUGA 1S7KA 3P2HA 2DPSA 2IJZA 2GIVA 5K8MA 2I00A 3N5FA 1XMBA 4WWVA 4X8IA 1WK4A 2DPTA 2OU2A 4PXBA 2CNMA 4HKFA 1MJBA 4C2XA 2ZOGA 5D8NA 4UBRA 2Q4VA 2NMTA 2D4PA 1N71A 1VIXA 3RBUA 3KR4A 1PUAA 3CZXA 3KGQA 4HNYB 2C1CA 1Z4EA 5G20A 4PQAA 2Q43A 1X12A 4ONUA 3FNCA 3TT2A 1TKJA 3L2NA 4PXDA 2OZUA 3H8EA 1Y9KA 4ZGYB 4NXYA 4X2TA 3W91A 3GYAA 1ZG9A 1Z8LA 4B5OA 2OZGA 1LAPA 2GLFA 1M1DA 3S9LA 1XF8A 1Z2LA 2PDOA 4KSAA 5DWNA 4FWUA 4P4DA 1LFWA 3D67A 2KCWA 5DWMA 3HUVA 4KOVA 3KL9A 1YMEA 4RI1A 3I1UA 3MGDA 5F09A 3FBUA 2AFZA 3FX6A 2F5IA 1YREA 2PR1A 4CYOA 2ZEEA 4C7HA 3IWEA 3OWCA 1Y9WA 2AFMA 2ZELA 1NSLA 5K8OA 1TKHA 3V7ZA 3TFYA 1CJWA 2B4DB 2WSAA 3PFOA 2GE3A 2PJ0A 2G9DA 2QYVA 3R95A 3S6HA 1RTQA 2Q51A 2RB7A 4NJRA 4CGMA 1S7LA 2PJ5A 4H6UA 4CYPA 4F0YA 4KZTA 2IL4A 3WC6A 3E0KA 4KSIA 1VHSA 1KZFA 3FECA 1XFOA 1QQ9A 2WYRA 3RNZA 3SXOA 3R9FA 3H8FA 4ONWA 4EMEA 4M6GA 2Z3KA 2YNCA 4PPZA 4QUSA 1GYTA 1PCAA 3SI2A 5JPHA 4OLLA 1ZO0A 4H6ZA 4IHMA 4X3RA 3EC4A 4MRIA 4OC3A 2PJ9A 1S7NA 2OR4A 2PJ1A 4DNCA 4R87A 1U6MA 2BSWA 4UCPA 2I79A 2Z3OA 3BJ8A 5AGEA 1UFHA 3EFAA 4B14A 4CGOA 2EK8A 1J4JA 1FY7A 2Q04A 3H8GA 4OMEA 4YGOA 4JWPA 4A2ZA 4IF5A 1CX8A 3K9TA 1CP7A 4CS0B 2REFA 4MMOA 4CAVA 4R6TA 4UIBA 5HXDA 4O23A 5C82A 3V8IA 3NH4A 4R8FA 3MN8A 3SI0A 1AYEA 5A27A 3B3CA 4MHYA 4Z65A 4NGMA 2WUUA 3SJGA 1JQGA 2PQ8A 1LRZA 2AFWA 1BPNA 2D4OA 4UFWA 2JLMA 4P4EA 3TX8A 4MFJA 4NEXA 2PJ3A 4E8OA 1AMPA 4OP4A 5LRGA 4KVME 4AB7A 4AVAA 1Z4RA 1CP6A 2JDCA 2V8VA 2P6EA 4NGNA 5FVJA 1NE9A 1ZLHA 5LYIA 2H5MA 2X7BA 1M4DA 4ORFA 3SJXA 4WJBA 5ELYA 2BL1A 2AFSA 1SQHA 3QB8A 2FS5A 4KUAA 2V77A 4PSWA 4BD9A 4CPAA 4EFDA 4F8ZA 4C2YA 3IO1A 4M6HA 4UEZA 2YGWA 1TIQA 4JD6A 4NGTA 5AG4A 5HMNA 2R7HA 1Y7RA 1P0HA 1TF9A 1Z8WA 1F2OA 4KS9A 1R43A 4BBHA 4ZYQA 2ZEOA 1IICA 2V8DA 2ZXVA 2C6GA 1Z8TA 2BO9A 1M4LA 2FVGA 1YVKA 1I1DA 3D2PA 3WR7A 3IFEA 4CYNA 4XNHB 1XRYA 3JRUA 3SXNA 3D4UA 4YRHA 4U9ZA 3LD2A 4GXHA 1VGYA 3DGVA 1CBXA 4UEFA 1CM0A 2AFUA 4LQGA 2FCKA 3PB9X 2PJ7A 2J8NA 4NGPA 4A32A 4JXQA 3KZWA 3IWWA 3PFEA 1IOFA 1PU9A 4TWEA 4MFPA 1CPSA 4PV6A 1HDQA 1OBRA 3PB8X 1XBUA 1NMTA 5CBMA
chains in the Genus database with same CATH topology
3FB3A 4NF1A 3F0AA 2VZYA 4M85A 3F8KA 2Q7BA 4MBUA 3ZJ0A 2P0WA 4XPKA 4R9MA 4FD4A 2ZW6A 3IWGA 2C27A 2B5GA 3KKWA 5AG6A 2ZW7A 2R98A 4C7IA 3BJ7A 4PSXA 4A33A 4KORA 5EC4A 3SHPA 4CAEA 2P6FA 2ZW4A 2CNSA 5C88A 2QECA 1QSNA 2BUEA 1Q2YA 1S3ZA 4JJXA 3T90A 2VEZA 4R3LA 4L89A 3PZJA 2Z0ZA 2QMLA 3UY5A 1B87A 3EY5A 3C26A 2YNCC 2YNDA 2J8RA 4B11A 1YGHA 2FIAA 4UFVA 4FD5A 1QSOA 2O28A 3TOBA 4CGNA 3H5ZA 3VWEA 4CGLA 2A4NA 4U9YA 4E0AA 3PGPA 1P4NA 2QIRA 2Z3LA 2B58A 1S60A 2OH1A 4HNXB 2Q44A 4R57A 5CNPA 3D3SA 3TE4A 4KVOE 4MHDA 2AE6A 3DR6A 4MFQA 4HNWB 4MFZA 4XPDB 1IYKA 1RXTA 3R1KA 4NCZA 5AG7A 2FSRA 4ZBGA 4A31A 4F0XA 2G0BA 2GANA 3G3SA 1KUYA 2EVNA 5IX3A 4MY0A 4CRYB 2Z3MA 3TO6A 1QSRA 2VQYA 2B4DA 3BLNA 3QAHA 3S6KA 5GCNA 4KOUA 4KOYA 4M3SA 5G1ZA 4UWIA 1XIXA 2FL4A 4I49A 4QBJA 5EBVA 4LUAA 2VI7A 2Q4YA 4X5KA 4UWJA 3K9UA 4CGPA 3N7ZA 2R8VA 1S7FA 5KTDA 5J8FA 4QC6A 1M4IA 4KVXA 4B5PB 1GHEA 2FIWA 2Z3NA 4MFLA 3FYNA 2PR8A 5G22A 5A28A 4CAXA 2PC1A 1BO4A 3I3GA 4FD7A 3G8WA 4MFKA 3T9YA 4MI4A 3W6XA 4Y49B 4KOWA 4AVBA 1VKCA 1Z9UA 2CY2A 1B6BA 4XNHC 4QB9A 4AVCA 3GY9A 4L8AA 4OAEA 4JXRA 5IB0A 1BOBA 1L0CA 4CRZB 1OZPA 4CYQA 4B5PA 5HH1A 1KUVA 1K4JA 5F49A 2B3VA 2J8MA 4KSFA 4NSQA 4A95A 2Z3PA 1MK4A 3JVNA 4EVYA 3JUWA 3TOAA 1YX0A 5G21A 3S6GA 4MJ8A 3FXTA 2WPXA 4RS2A 1I12A 2R1IA 4LX9A 2PRBA 2JEVA 2CNTA 1XMTA 3EXNA 5F47A 1IB1E 3DSBA 5IV0A 3IU2A 4BMHA 2DXQA 5ISVA 5H86A 4CAFA 4OADA 4YFJA 1M44A 1Q2CA 4GS4A 4JLYA 1MJ9A 2P6GA 5AG5A 3JTKA 3A9LA 3GKRA 2G3TA 1XEBA 1IYLA 3H4QA 3F5BA 3LODA 4KUBA 3DDDA 3CXSA 3TTHA 3R9GA 2HV2A 3W6SA 4H89A 4J3GA 3FIXA 4B13A 4E2AA 2ATRA 1YK3A 5JQ4A 3EO4A 2VBQA 1I21A 3DNSA 2WPWA 4IUSA 3FRMA 4UCMA 4Q38A 2EUIA 2ARHA 4MY3A 3D8PA 1YVOA 3VWDA 3CXPA 1KUXA 3R9EA 5KTCA 4XPDC 4KOSA 2OZHA 2G3AA 2Z11A 4C2ZA 3I9SA 4KLVA 2PSWA 4R3KA 3RYOA 4UA3A 4QVTA 4F6AA 2ZPAA 3IGRA 2YNEA 2FXFA 5E96A 1R57A 3P2FA 1MJAA 1RO5A 1M4GA 5F46A 2BEIA 2AJ6A 5BWAB 5F48A 3TO7A 4B10A 1IIDA 4K30A 2FT0A 1WWZA 3TO9A 1YLEA 4A30A 4II9A 2VXKA 4AG7A 4XPLA 2RC4A 3CXQA 2Q0YA 4U5YA 2REEA 3PP9A 3B8GA 3DR8A 3ZZIA 4B12A 4UFXA 4KOXA 3S6FA 3IU1A 4AG9A 4UCNA 2B4BA 1Q2DA 2HQYA 2CXAA 2Z10A 2JDDA 4C68A 4Y49C 2Y0MA 2FE7A 5I0CA 2HUZA 4PK2A 1V0CA 4FD6A 1S5KA 2B5GB 5J8CA 1YR0A 3R96A 4CAWA 2OB0A 3TCVA 2ZW5A 1QSTA 3NE7A 5H84A 5KTAA 2B3UA 1QSMA 4KOTA 3D2MA 1ON0A 2K5TA 4KLWA 1XE4A 4PK3A 4Q36A 2VZZA 1S7KA 3P2HA 2DPSA 2GIVA 2I00A 1WK4A 2DPTA 2OU2A 4HKFA 2CNMA 1MJBA 4C2XA 4UBRA 2Q4VA 2NMTA 2D4PA 1N71A 1PUAA 4HNYB 1Z4EA 5G20A 4ONUA 3FNCA 3TT2A 2OZUA 1Y9KA 4ZGYB 4NXYA 3W91A 3GYAA 4B5OA 2OZGA 1M1DA 1XF8A 4KSAA 2PDOA 5DWNA 2KCWA 5DWMA 4KOVA 4RI1A 3MGDA 3FBUA 2F5IA 1YREA 2PR1A 4CYOA 4C7HA 3IWEA 3OWCA 1Y9WA 1NSLA 3TFYA 1CJWA 2B4DB 2WSAA 2GE3A 3R95A 3S6HA 4CGMA 1S7LA 4CYPA 4H6UA 4F0YA 4KZTA 2IL4A 3E0KA 1VHSA 1KZFA 3SXOA 3R9FA 2Z3KA 2YNCA 5JPHA 4QUSA 4OLLA 1ZO0A 4H6ZA 3EC4A 1S7NA 4DNCA 4R87A 1U6MA 2BSWA 4UCPA 2I79A 2Z3OA 3BJ8A 5AGEA 1UFHA 3EFAA 4B14A 4CGOA 1J4JA 1FY7A 2Q04A 4YGOA 4JWPA 4A2ZA 4IF5A 4CS0B 2REFA 4CAVA 5C82A 3V8IA 5A27A 2WUUA 2PQ8A 1LRZA 2D4OA 4UFWA 2JLMA 4MFJA 4NEXA 4E8OA 4AB7A 4KVME 4AVAA 1Z4RA 2JDCA 2P6EA 5FVJA 1NE9A 2H5MA 2X7BA 1M4DA 4ORFA 2BL1A 3QB8A 1SQHA 4KUAA 2FS5A 4PSWA 4C2YA 2YGWA 1TIQA 4JD6A 5AG4A 5HMNA 2R7HA 1Y7RA 1P0HA 4KS9A 4BBHA 1IICA 2ZXVA 1YVKA 1I1DA 3D2PA 3WR7A 4CYNA 4XNHB 3SXNA 4YRHA 4U9ZA 3LD2A 1CM0A 2FCKA 2J8NA 4A32A 4JXQA 1PU9A 4MFPA 4PV6A 1NMTA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3FB3 A;  4NF1 A;  3F0A A;  2VZY A;  4M85 A;  3F8K A;  2Q7B A;  4MBU A;  3ZJ0 A;  2P0W A;  4XPK A;  4R9M A;  4FD4 A;  2ZW6 A;  3IWG A;  2C27 A;  2B5G A;  3KKW A;  2ZW7 A;  2R98 A;  3BJ7 A;  4PSX A;  4KOR A;  5EC4 A;  3SHP A;  5C88 A;  2P6F A;  2ZW4 A;  2CNS A;  2QEC A;  1QSN A;  2BUE A;  1Q2Y A;  1S3Z A;  4JJX A;  3T90 A;  2VEZ A;  4R3L A;  4L89 A;  3PZJ A;  2Z0Z A;  2QML A;  3UY5 A;  1B87 A;  3EY5 A;  3C26 A;  2J8R A;  1YGH A;  2FIA A;  4FD5 A;  1QSO A;  2O28 A;  3TOB A;  3VWE A;  2A4N A;  4U9Y A;  4E0A A;  3PGP A;  1P4N A;  2QIR A;  2B58 A;  1S60 A;  2OH1 A;  4HNX B;  2Q44 A;  4R57 A;  5CNP A;  3D3S A;  3TE4 A;  4KVO E;  4MHD A;  2AE6 A;  3DR6 A;  4HNW B;  4XPD B;  1IYK A;  1RXT A;  3R1K A;  4NCZ A;  4ZBG A;  2FSR A;  2G0B A;  2GAN A;  3G3S A;  1KUY A;  2EVN A;  5IX3 A;  4MY0 A;  4CRY B;  3TO6 A;  1QSR A;  2VQY A;  2B4D A;  3BLN A;  3QAH A;  3S6K A;  5GCN A;  4KOU A;  4KOY A;  4M3S A;  4UWI A;  1XIX A;  2FL4 A;  4I49 A;  4QBJ A;  5EBV A;  4LUA A;  2VI7 A;  2Q4Y A;  4X5K A;  4UWJ A;  3K9U A;  3N7Z A;  2R8V A;  1S7F A;  5KTD A;  5J8F A;  4QC6 A;  1M4I A;  4KVX A;  4B5P B;  1GHE A;  2FIW A;  3FYN A;  2PR8 A;  4CAX A;  2PC1 A;  1BO4 A;  3I3G A;  4FD7 A;  3G8W A;  3T9Y A;  4MI4 A;  3W6X A;  4Y49 B;  4KOW A;  4AVB A;  1VKC A;  1Z9U A;  2CY2 A;  1B6B A;  4XNH C;  4QB9 A;  4AVC A;  3GY9 A;  4L8A A;  4OAE A;  4JXR A;  5IB0 A;  1BOB A;  1L0C A;  4CRZ B;  1OZP A;  4B5P A;  5HH1 A;  1KUV A;  1K4J A;  5F49 A;  2B3V A;  2J8M A;  4NSQ A;  1MK4 A;  3JVN A;  4EVY A;  3JUW A;  3TOA A;  1YX0 A;  3S6G A;  4MJ8 A;  3FXT A;  2WPX A;  4RS2 A;  1I12 A;  2R1I A;  4LX9 A;  2PRB A;  2JEV A;  2CNT A;  1XMT A;  3EXN A;  5F47 A;  1IB1 E;  3DSB A;  5IV0 A;  4BMH A;  2DXQ A;  5ISV A;  5H86 A;  4OAD A;  4YFJ A;  1M44 A;  1Q2C A;  4GS4 A;  4JLY A;  1MJ9 A;  2P6G A;  3GKR A;  2G3T A;  1XEB A;  1IYL A;  3H4Q A;  3F5B A;  3LOD A;  4KUB A;  3DDD A;  3CXS A;  3TTH A;  3R9G A;  2HV2 A;  3W6S A;  4H89 A;  4J3G A;  3FIX A;  4E2A A;  2ATR A;  1YK3 A;  5JQ4 A;  3EO4 A;  2VBQ A;  1I21 A;  3DNS A;  2WPW A;  4IUS A;  3FRM A;  2EUI A;  2ARH A;  4MY3 A;  3D8P A;  1YVO A;  3VWD A;  3CXP A;  1KUX A;  3R9E A;  5KTC A;  4XPD C;  4KOS A;  2OZH A;  2G3A A;  2Z11 A;  3I9S A;  4KLV A;  2PSW A;  4R3K A;  3RYO A;  4UA3 A;  4QVT A;  4F6A A;  2ZPA A;  3IGR A;  2FXF A;  5E96 A;  1R57 A;  3P2F A;  1MJA A;  1RO5 A;  1M4G A;  5F46 A;  2BEI A;  2AJ6 A;  5F48 A;  3TO7 A;  1IID A;  4K30 A;  2FT0 A;  1WWZ A;  3TO9 A;  1YLE A;  4II9 A;  2VXK A;  4AG7 A;  4XPL A;  2RC4 A;  3CXQ A;  2Q0Y A;  4U5Y A;  2REE A;  3PP9 A;  3B8G A;  3DR8 A;  3ZZI A;  4KOX A;  3S6F A;  4AG9 A;  2B4B A;  1Q2D A;  2HQY A;  2Z10 A;  2JDD A;  4Y49 C;  2Y0M A;  2FE7 A;  5I0C A;  2HUZ A;  4PK2 A;  1V0C A;  4FD6 A;  1S5K A;  2B5G B;  5J8C A;  1YR0 A;  3R96 A;  4CAW A;  2OB0 A;  3TCV A;  2ZW5 A;  1QST A;  3NE7 A;  5H84 A;  5KTA A;  2B3U A;  1QSM A;  4KOT A;  3D2M A;  1ON0 A;  2K5T A;  4KLW A;  1XE4 A;  4PK3 A;  2VZZ A;  1S7K A;  3P2H A;  2GIV A;  2I00 A;  1WK4 A;  2OU2 A;  2CNM A;  4HKF A;  1MJB A;  4UBR A;  2Q4V A;  2NMT A;  2D4P A;  1N71 A;  1PUA A;  4HNY B;  1Z4E A;  4ONU A;  3FNC A;  3TT2 A;  2OZU A;  1Y9K A;  4NXY A;  3W91 A;  3GYA A;  4B5O A;  2OZG A;  1M1D A;  1XF8 A;  2PDO A;  5DWN A;  2KCW A;  5DWM A;  4KOV A;  4RI1 A;  3MGD A;  3FBU A;  2F5I A;  1YRE A;  2PR1 A;  3OWC A;  1Y9W A;  1NSL A;  3TFY A;  1CJW A;  2B4D B;  2GE3 A;  3R95 A;  3S6H A;  1S7L A;  4H6U A;  4F0Y A;  4KZT A;  2IL4 A;  3E0K A;  1VHS A;  1KZF A;  3SXO A;  3R9F A;  5JPH A;  4QUS A;  4OLL A;  4H6Z A;  3EC4 A;  1S7N A;  4DNC A;  4R87 A;  1U6M A;  2BSW A;  2I79 A;  3BJ8 A;  1UFH A;  3EFA A;  1J4J A;  1FY7 A;  2Q04 A;  4YGO A;  4JWP A;  4IF5 A;  4CS0 B;  2REF A;  4CAV A;  5C82 A;  3V8I A;  2PQ8 A;  1LRZ A;  2D4O A;  2JLM A;  4NEX A;  4E8O A;  4AB7 A;  4KVM E;  4AVA A;  1Z4R A;  2JDC A;  2P6E A;  5FVJ A;  1NE9 A;  2H5M A;  2X7B A;  1M4D A;  4ORF A;  2BL1 A;  3QB8 A;  1SQH A;  4KUA A;  2FS5 A;  4PSW A;  1TIQ A;  4JD6 A;  5HMN A;  2R7H A;  1Y7R A;  1P0H A;  1IIC A;  2ZXV A;  1YVK A;  1I1D A;  3D2P A;  3WR7 A;  4XNH B;  3SXN A;  4YRH A;  4U9Z A;  3LD2 A;  1CM0 A;  2FCK A;  2J8N A;  4JXQ A;  1PU9 A;  4PV6 A;  1NMT A; 
#chains in the Genus database with same CATH topology
 4JZ0 A;  2POK A;  3FB3 A;  4NF1 A;  1ELM P;  1IU8 A;  2VZY A;  3B3V A;  1F57 A;  3F0A A;  3DLJ A;  3F8K A;  4M85 A;  4MBU A;  2Q7B A;  3ZJ0 A;  2P0W A;  4XPK A;  4R9M A;  2J9A A;  2JBK A;  4FD4 A;  2PJB A;  2ZW6 A;  3IWG A;  2C27 A;  2C6C A;  3KI9 A;  4MHP A;  2PIY A;  2B5G A;  2F7V A;  3NFZ A;  3KKW A;  5AG6 A;  2ZW7 A;  3GUX A;  2R98 A;  2XEI A;  3PB6 X;  2ODF A;  4C7I A;  2EK9 A;  7CPA A;  1XOV A;  3BJ7 A;  2V8G A;  4PSX A;  2PJA A;  4A33 A;  1CG2 A;  4KOR A;  5EC4 A;  3SHP A;  4CAE A;  2P6F A;  2Q7S A;  2CNS A;  2ZW4 A;  2QEC A;  5C88 A;  1QSN A;  2BUE A;  1Q2Y A;  1S3Z A;  4JJX A;  3T90 A;  2VEZ A;  4R3L A;  4L89 A;  3PZJ A;  4UEE A;  4HPS A;  3SJE A;  2Z0Z A;  3B3T A;  3D7H A;  4NJQ A;  3S9M A;  2IMO A;  1H8L A;  2QML A;  3UY5 A;  1B87 A;  2ZEN A;  3C26 A;  3EY5 A;  3LWU A;  5HVH A;  3WAB A;  2YNC C;  2YND A;  2J8R A;  2PJ4 A;  4NGR A;  4B11 A;  1YGH A;  2FIA A;  4R76 A;  3D7G A;  4UFV A;  4FD5 A;  3BI1 A;  1QSO A;  2O28 A;  2ZED A;  4P44 A;  3TOB A;  4ZY1 A;  4B6Z A;  4CGN A;  3IJ3 A;  3H5Z A;  5J1Q A;  2ABZ A;  3VWE A;  4FUU A;  3IC1 A;  2A4N A;  4CGL A;  4OC2 A;  1Y0R A;  4UF4 A;  4U9Y A;  3IIB A;  4E0A A;  3PGP A;  3NH8 A;  3PB7 X;  1P4N A;  1QMU A;  2QIR A;  2GRE A;  2Z3L A;  4H2K A;  5K8P A;  2B58 A;  1S60 A;  2OH1 A;  4HNX B;  2Q44 A;  4FBE A;  4R57 A;  1Z5R A;  5CNP A;  1FT7 A;  2DEA A;  3D3S A;  3NE8 A;  3TE4 A;  4KVO E;  3SI1 A;  4MHD A;  2AE6 A;  3WC7 A;  2CF4 A;  3DR6 A;  4MFQ A;  3KHZ A;  3PRT A;  4R7M A;  2IQ6 A;  4HNW B;  3FF3 A;  4MFZ A;  3S9N A;  4XPD B;  1X10 A;  1IYK A;  1RXT A;  2PJ6 A;  2ZEP A;  1BPM A;  2FSR A;  3R1K A;  4NCZ A;  5AG7 A;  4ZBG A;  4A94 A;  4A31 A;  4F0X A;  5JH9 A;  2G0B A;  2GAN A;  3G3S A;  1KUY A;  4P4I A;  5IB9 A;  2EVN A;  4ZI6 A;  5IX3 A;  4MY0 A;  4CRY B;  2Z3M A;  4YU9 A;  3TO6 A;  2V8H A;  2XEG A;  1QSR A;  2VQY A;  2B4D A;  3BLN A;  3BI0 A;  3CDX A;  4ZY2 A;  4NGQ A;  3QAH A;  4BIN A;  4OKO A;  5GCN A;  3S6K A;  4A38 A;  5EMI A;  2F8H A;  4KOU A;  3D7F A;  4KOY A;  4M3S A;  3PB4 X;  4UWI A;  1XIX A;  5G1Z A;  2FL4 A;  2Q4Z A;  4P45 A;  2C6P A;  2CIJ A;  4I49 A;  4MCQ A;  3TC8 A;  3RO0 A;  5EBV A;  2BCO A;  4QBJ A;  2VL1 A;  4LUA A;  2VI7 A;  2Q4Y A;  5D29 A;  4X5K A;  5THW A;  4ZY0 A;  4UWJ A;  3K9U A;  4OC4 A;  3K2K A;  3PEI A;  4CGP A;  3KAS A;  4RUH A;  3N7Z A;  2R8V A;  1S7F A;  3IEH A;  5KTD A;  5J8F A;  1BAV A;  4QC6 A;  4NGS A;  3B2Y A;  1M4I A;  4KVX A;  4B5P B;  3ISX A;  4P4F A;  1GHE A;  2FIW A;  1ZG7 A;  2Z3N A;  4MFL A;  3FYN A;  2PR8 A;  3GB0 A;  5G22 A;  5A28 A;  1JWQ A;  5LYL A;  4CAX A;  2PC1 A;  1BO4 A;  1Y0Y A;  3I3G A;  4FD7 A;  2QVP A;  2EO8 A;  3G8W A;  4MFK A;  3RAM A;  3T9Y A;  4MI4 A;  3W6X A;  4Y49 B;  4KOW A;  3CPX A;  4AVB A;  1VKC A;  1Z9U A;  2CY2 A;  2CTB A;  2XEJ A;  1B6B A;  4GM5 A;  2ZEM A;  4OIW A;  4XNH C;  1KWM A;  1LCP A;  4QB9 A;  4G1P A;  4AVC A;  3GY9 A;  4L8A A;  3D7D A;  1Y7E A;  1ARM A;  4OAE A;  2GU2 A;  3B3W A;  3CPA A;  2GLJ A;  4JXR A;  1VHO A;  1BOB A;  1ZG8 A;  1L0C A;  3KR5 A;  5IB0 A;  2PJ2 A;  3PBB A;  4CRZ B;  2I3C A;  1TKF A;  1OZP A;  4RN7 A;  5JGF A;  4MXU A;  5HVF A;  4CYQ A;  4B5P A;  4P4J A;  2RFH A;  1KUV A;  5HH1 A;  2BOA A;  1K4J A;  5F49 A;  2HB6 A;  3QNV A;  1YLO A;  2B3V A;  2ZEG A;  2J8M A;  4KSF A;  4YWY A;  4NSQ A;  4A95 A;  2Z3P A;  3GLJ A;  4A37 A;  1EE3 P;  1MK4 A;  3JVN A;  4EVY A;  1Z8X A;  4FAI A;  3JUW A;  3TOA A;  1YX0 A;  3LAC A;  5G21 A;  2PVV A;  2ZEF A;  3S6G A;  4P4B A;  3FED A;  4MJ8 A;  3FXT A;  1FNO A;  1YSJ A;  2WPX A;  4RS2 A;  1I12 A;  1IGB A;  2R1I A;  4LX9 A;  2PRB A;  2JEV A;  2CNT A;  1XMT A;  3EXN A;  3FJU A;  5F47 A;  5LYF A;  4DJL A;  1IB1 E;  3DSB A;  5IV0 A;  1ARL A;  3IU2 A;  3V38 A;  4BMH A;  2DXQ A;  4MHZ A;  5ISV A;  5H86 A;  4CAF A;  3LMS A;  4OAD A;  4OC1 A;  3HLP A;  1Q7L A;  2OOT A;  1M44 A;  1Q2C A;  4GS4 A;  4JLY A;  4YFJ A;  1MJ9 A;  2NYQ A;  3QAY A;  2P6G A;  3FH4 A;  1LAN A;  5AG5 A;  3JTK A;  3B3S A;  5LRK A;  3A9L A;  3GKR A;  4OID A;  2G3T A;  2AFX A;  1XEB A;  1IYL A;  3H4Q A;  2XEF A;  3F5B A;  3LOD A;  4KUB A;  4A39 A;  1YQE A;  1YW4 A;  3CXS A;  3DDD A;  1F2P A;  4MCP A;  3TTH A;  1IOI A;  3R9G A;  1XJO A;  2HV2 A;  3W6S A;  4H89 A;  3FIX A;  4J3G A;  4B13 A;  2ZEH A;  4E2A A;  2ATR A;  1YK3 A;  4EWT A;  2PJC A;  3EO4 A;  5JQ4 A;  2VBQ A;  1I21 A;  3DNS A;  4OC5 A;  4MHN A;  2WPW A;  4IUS A;  3MRU A;  2PIZ A;  3BHX A;  3FRM A;  2HC9 A;  3VAR A;  4UCM A;  4Q38 A;  3B7I A;  2EUI A;  2ARH A;  3T8W A;  4MY3 A;  3D8P A;  1YVO A;  1R3N A;  2PJ8 A;  3BXM A;  3VWD A;  3CXP A;  1KUX A;  1PYT B;  3R9E A;  4NFR A;  1HEE A;  5KTC A;  4XPD C;  4F9U A;  4KOS A;  2QJ8 A;  2OZH A;  2G3A A;  2Z11 A;  4C2Z A;  2JBJ A;  3I9S A;  5LYD A;  4KLV A;  2PSW A;  4DYO A;  4R3K A;  2EWB A;  3RYO A;  4UA3 A;  4QVT A;  4F6A A;  4DUK A;  2ZPA A;  2ZOF A;  3IGR A;  1DE4 C;  2YNE A;  2FXF A;  5E96 A;  2PE3 A;  1R57 A;  1TF8 A;  4MCS A;  5DS0 A;  3D68 A;  3P2F A;  1MJA A;  4LQ6 A;  1TXR A;  2AFO A;  1YW6 A;  1RO5 A;  1M4G A;  2NSM A;  5F46 A;  2BEI A;  2AJ6 A;  5BWA B;  5F48 A;  2CTC A;  3TO7 A;  4B10 A;  1IID A;  4K30 A;  2FT0 A;  1WWZ A;  4ZX9 A;  3TO9 A;  1YLE A;  3WC5 A;  4A30 A;  4PXC A;  4II9 A;  2VXK A;  4K3N A;  4MCR A;  3KHX A;  4XPL A;  4AG7 A;  2RC4 A;  3CXQ A;  1CPX A;  1NSA A;  2Q0Y A;  4Q7A A;  4U5Y A;  3WT4 A;  2REE A;  4M6I A;  1IY7 A;  4IAV A;  3B35 A;  3PP9 A;  5CPA A;  3B8G A;  2PRQ A;  3VH9 A;  3DR8 A;  3ZZI A;  4B12 A;  4UFX A;  4KOX A;  5HVG A;  3RZA A;  3S6F A;  3IU1 A;  4AG9 A;  4UCN A;  2B4B A;  1Q2D A;  2HQY A;  3NA6 A;  1A2Z A;  1BLL E;  2CXA A;  3FMC A;  4UIA A;  3D66 A;  2ANP A;  2Z10 A;  4P10 A;  2JDD A;  4C68 A;  2GFQ A;  3ISZ A;  4Y49 C;  2Y0M A;  2FE7 A;  2DF5 A;  3CT9 A;  5I0C A;  2HUZ A;  4PK2 A;  1V0C A;  2PVW A;  4FD6 A;  3NH5 A;  4ZX8 A;  1S5K A;  3FEE A;  2B5G B;  1ELL P;  3SJF A;  1LAM A;  4PXE A;  5J8C A;  2PCU A;  1HDU A;  4W9Y A;  2JEW A;  5JM6 A;  4TNU A;  1UWY A;  3KQZ A;  5K8N A;  1YR0 A;  3KQX A;  2O4H A;  3R96 A;  4CAW A;  1DTD A;  2OB0 A;  4OC0 A;  4F9V A;  4P6Y A;  8CPA A;  5LRJ A;  1LOK A;  1ZLI A;  3TCV A;  1VHE A;  2ZW5 A;  1QST A;  3NE7 A;  4JYW A;  5H84 A;  4AXV A;  2WZN A;  5KTA A;  3GIU A;  2B3U A;  1QSM A;  2O53 A;  2EBJ A;  4KOT A;  3D2M A;  1ON0 A;  6CPA A;  5I4M A;  2K5T A;  4IK2 A;  3VAT A;  3FVL A;  4KLW A;  1XE4 A;  4PK3 A;  4Q36 A;  3PBE A;  2VZZ A;  1AUG A;  1S7K A;  3P2H A;  2DPS A;  2IJZ A;  2GIV A;  5K8M A;  2I00 A;  3N5F A;  1XMB A;  4WWV A;  4X8I A;  1WK4 A;  2DPT A;  2OU2 A;  4PXB A;  2CNM A;  4HKF A;  1MJB A;  4C2X A;  2ZOG A;  5D8N A;  4UBR A;  2Q4V A;  2NMT A;  2D4P A;  1N71 A;  1VIX A;  3RBU A;  3KR4 A;  1PUA A;  3CZX A;  3KGQ A;  4HNY B;  2C1C A;  1Z4E A;  5G20 A;  4PQA A;  2Q43 A;  1X12 A;  4ONU A;  3FNC A;  3TT2 A;  1TKJ A;  3L2N A;  4PXD A;  2OZU A;  3H8E A;  1Y9K A;  4ZGY B;  4NXY A;  4X2T A;  3W91 A;  3GYA A;  1ZG9 A;  1Z8L A;  4B5O A;  2OZG A;  1LAP A;  2GLF A;  1M1D A;  3S9L A;  1XF8 A;  1Z2L A;  2PDO A;  4KSA A;  5DWN A;  4FWU A;  4P4D A;  1LFW A;  3D67 A;  2KCW A;  5DWM A;  3HUV A;  4KOV A;  3KL9 A;  1YME A;  4RI1 A;  3I1U A;  3MGD A;  5F09 A;  3FBU A;  2AFZ A;  3FX6 A;  2F5I A;  1YRE A;  2PR1 A;  4CYO A;  2ZEE A;  4C7H A;  3IWE A;  3OWC A;  1Y9W A;  2AFM A;  2ZEL A;  1NSL A;  5K8O A;  1TKH A;  3V7Z A;  3TFY A;  1CJW A;  2B4D B;  2WSA A;  3PFO A;  2GE3 A;  2PJ0 A;  2G9D A;  2QYV A;  3R95 A;  3S6H A;  1RTQ A;  2Q51 A;  2RB7 A;  4NJR A;  4CGM A;  1S7L A;  2PJ5 A;  4H6U A;  4CYP A;  4F0Y A;  4KZT A;  2IL4 A;  3WC6 A;  3E0K A;  4KSI A;  1VHS A;  1KZF A;  3FEC A;  1XFO A;  1QQ9 A;  2WYR A;  3RNZ A;  3SXO A;  3R9F A;  3H8F A;  4ONW A;  4EME A;  4M6G A;  2Z3K A;  2YNC A;  4PPZ A;  4QUS A;  1GYT A;  1PCA A;  3SI2 A;  5JPH A;  4OLL A;  1ZO0 A;  4H6Z A;  4IHM A;  4X3R A;  3EC4 A;  4MRI A;  4OC3 A;  2PJ9 A;  1S7N A;  2OR4 A;  2PJ1 A;  4DNC A;  4R87 A;  1U6M A;  2BSW A;  4UCP A;  2I79 A;  2Z3O A;  3BJ8 A;  5AGE A;  1UFH A;  3EFA A;  4B14 A;  4CGO A;  2EK8 A;  1J4J A;  1FY7 A;  2Q04 A;  3H8G A;  4OME A;  4YGO A;  4JWP A;  4A2Z A;  4IF5 A;  1CX8 A;  3K9T A;  1CP7 A;  4CS0 B;  2REF A;  4MMO A;  4CAV A;  4R6T A;  4UIB A;  5HXD A;  4O23 A;  5C82 A;  3V8I A;  3NH4 A;  4R8F A;  3MN8 A;  3SI0 A;  1AYE A;  5A27 A;  3B3C A;  4MHY A;  4Z65 A;  4NGM A;  2WUU A;  3SJG A;  1JQG A;  2PQ8 A;  1LRZ A;  2AFW A;  1BPN A;  2D4O A;  4UFW A;  2JLM A;  4P4E A;  3TX8 A;  4MFJ A;  4NEX A;  2PJ3 A;  4E8O A;  1AMP A;  4OP4 A;  5LRG A;  4KVM E;  4AB7 A;  4AVA A;  1Z4R A;  1CP6 A;  2JDC A;  2V8V A;  2P6E A;  4NGN A;  5FVJ A;  1NE9 A;  1ZLH A;  5LYI A;  2H5M A;  2X7B A;  1M4D A;  4ORF A;  3SJX A;  4WJB A;  5ELY A;  2BL1 A;  2AFS A;  1SQH A;  3QB8 A;  2FS5 A;  4KUA A;  2V77 A;  4PSW A;  4BD9 A;  4CPA A;  4EFD A;  4F8Z A;  4C2Y A;  3IO1 A;  4M6H A;  4UEZ A;  2YGW A;  1TIQ A;  4JD6 A;  4NGT A;  5AG4 A;  5HMN A;  2R7H A;  1Y7R A;  1P0H A;  1TF9 A;  1Z8W A;  1F2O A;  4KS9 A;  1R43 A;  4BBH A;  4ZYQ A;  2ZEO A;  1IIC A;  2V8D A;  2ZXV A;  2C6G A;  1Z8T A;  2BO9 A;  1M4L A;  2FVG A;  1YVK A;  1I1D A;  3D2P A;  3WR7 A;  3IFE A;  4CYN A;  4XNH B;  1XRY A;  3JRU A;  3SXN A;  3D4U A;  4YRH A;  4U9Z A;  3LD2 A;  4GXH A;  1VGY A;  3DGV A;  1CBX A;  4UEF A;  1CM0 A;  2AFU A;  4LQG A;  2FCK A;  3PB9 X;  2PJ7 A;  2J8N A;  4NGP A;  4A32 A;  4JXQ A;  3KZW A;  3IWW A;  3PFE A;  1IOF A;  1PU9 A;  4TWE A;  4MFP A;  1CPS A;  4PV6 A;  1HDQ A;  1OBR A;  3PB8 X;  1XBU A;  1NMT A;  5CBM A; 
#chains in the Genus database with same CATH homology
 3FB3 A;  4NF1 A;  3F0A A;  2VZY A;  4M85 A;  3F8K A;  2Q7B A;  4MBU A;  3ZJ0 A;  2P0W A;  4XPK A;  4R9M A;  4FD4 A;  2ZW6 A;  3IWG A;  2C27 A;  2B5G A;  3KKW A;  5AG6 A;  2ZW7 A;  2R98 A;  4C7I A;  3BJ7 A;  4PSX A;  4A33 A;  4KOR A;  5EC4 A;  3SHP A;  4CAE A;  2P6F A;  2ZW4 A;  2CNS A;  5C88 A;  2QEC A;  1QSN A;  2BUE A;  1Q2Y A;  1S3Z A;  4JJX A;  3T90 A;  2VEZ A;  4R3L A;  4L89 A;  3PZJ A;  2Z0Z A;  2QML A;  3UY5 A;  1B87 A;  3EY5 A;  3C26 A;  2YNC C;  2YND A;  2J8R A;  4B11 A;  1YGH A;  2FIA A;  4UFV A;  4FD5 A;  1QSO A;  2O28 A;  3TOB A;  4CGN A;  3H5Z A;  3VWE A;  4CGL A;  2A4N A;  4U9Y A;  4E0A A;  3PGP A;  1P4N A;  2QIR A;  2Z3L A;  2B58 A;  1S60 A;  2OH1 A;  4HNX B;  2Q44 A;  4R57 A;  5CNP A;  3D3S A;  3TE4 A;  4KVO E;  4MHD A;  2AE6 A;  3DR6 A;  4MFQ A;  4HNW B;  4MFZ A;  4XPD B;  1IYK A;  1RXT A;  3R1K A;  4NCZ A;  5AG7 A;  2FSR A;  4ZBG A;  4A31 A;  4F0X A;  2G0B A;  2GAN A;  3G3S A;  1KUY A;  2EVN A;  5IX3 A;  4MY0 A;  4CRY B;  2Z3M A;  3TO6 A;  1QSR A;  2VQY A;  2B4D A;  3BLN A;  3QAH A;  3S6K A;  5GCN A;  4KOU A;  4KOY A;  4M3S A;  5G1Z A;  4UWI A;  1XIX A;  2FL4 A;  4I49 A;  4QBJ A;  5EBV A;  4LUA A;  2VI7 A;  2Q4Y A;  4X5K A;  4UWJ A;  3K9U A;  4CGP A;  3N7Z A;  2R8V A;  1S7F A;  5KTD A;  5J8F A;  4QC6 A;  1M4I A;  4KVX A;  4B5P B;  1GHE A;  2FIW A;  2Z3N A;  4MFL A;  3FYN A;  2PR8 A;  5G22 A;  5A28 A;  4CAX A;  2PC1 A;  1BO4 A;  3I3G A;  4FD7 A;  3G8W A;  4MFK A;  3T9Y A;  4MI4 A;  3W6X A;  4Y49 B;  4KOW A;  4AVB A;  1VKC A;  1Z9U A;  2CY2 A;  1B6B A;  4XNH C;  4QB9 A;  4AVC A;  3GY9 A;  4L8A A;  4OAE A;  4JXR A;  5IB0 A;  1BOB A;  1L0C A;  4CRZ B;  1OZP A;  4CYQ A;  4B5P A;  5HH1 A;  1KUV A;  1K4J A;  5F49 A;  2B3V A;  2J8M A;  4KSF A;  4NSQ A;  4A95 A;  2Z3P A;  1MK4 A;  3JVN A;  4EVY A;  3JUW A;  3TOA A;  1YX0 A;  5G21 A;  3S6G A;  4MJ8 A;  3FXT A;  2WPX A;  4RS2 A;  1I12 A;  2R1I A;  4LX9 A;  2PRB A;  2JEV A;  2CNT A;  1XMT A;  3EXN A;  5F47 A;  1IB1 E;  3DSB A;  5IV0 A;  3IU2 A;  4BMH A;  2DXQ A;  5ISV A;  5H86 A;  4CAF A;  4OAD A;  4YFJ A;  1M44 A;  1Q2C A;  4GS4 A;  4JLY A;  1MJ9 A;  2P6G A;  5AG5 A;  3JTK A;  3A9L A;  3GKR A;  2G3T A;  1XEB A;  1IYL A;  3H4Q A;  3F5B A;  3LOD A;  4KUB A;  3DDD A;  3CXS A;  3TTH A;  3R9G A;  2HV2 A;  3W6S A;  4H89 A;  4J3G A;  3FIX A;  4B13 A;  4E2A A;  2ATR A;  1YK3 A;  5JQ4 A;  3EO4 A;  2VBQ A;  1I21 A;  3DNS A;  2WPW A;  4IUS A;  3FRM A;  4UCM A;  4Q38 A;  2EUI A;  2ARH A;  4MY3 A;  3D8P A;  1YVO A;  3VWD A;  3CXP A;  1KUX A;  3R9E A;  5KTC A;  4XPD C;  4KOS A;  2OZH A;  2G3A A;  2Z11 A;  4C2Z A;  3I9S A;  4KLV A;  2PSW A;  4R3K A;  3RYO A;  4UA3 A;  4QVT A;  4F6A A;  2ZPA A;  3IGR A;  2YNE A;  2FXF A;  5E96 A;  1R57 A;  3P2F A;  1MJA A;  1RO5 A;  1M4G A;  5F46 A;  2BEI A;  2AJ6 A;  5BWA B;  5F48 A;  3TO7 A;  4B10 A;  1IID A;  4K30 A;  2FT0 A;  1WWZ A;  3TO9 A;  1YLE A;  4A30 A;  4II9 A;  2VXK A;  4AG7 A;  4XPL A;  2RC4 A;  3CXQ A;  2Q0Y A;  4U5Y A;  2REE A;  3PP9 A;  3B8G A;  3DR8 A;  3ZZI A;  4B12 A;  4UFX A;  4KOX A;  3S6F A;  3IU1 A;  4AG9 A;  4UCN A;  2B4B A;  1Q2D A;  2HQY A;  2CXA A;  2Z10 A;  2JDD A;  4C68 A;  4Y49 C;  2Y0M A;  2FE7 A;  5I0C A;  2HUZ A;  4PK2 A;  1V0C A;  4FD6 A;  1S5K A;  2B5G B;  5J8C A;  1YR0 A;  3R96 A;  4CAW A;  2OB0 A;  3TCV A;  2ZW5 A;  1QST A;  3NE7 A;  5H84 A;  5KTA A;  2B3U A;  1QSM A;  4KOT A;  3D2M A;  1ON0 A;  2K5T A;  4KLW A;  1XE4 A;  4PK3 A;  4Q36 A;  2VZZ A;  1S7K A;  3P2H A;  2DPS A;  2GIV A;  2I00 A;  1WK4 A;  2DPT A;  2OU2 A;  4HKF A;  2CNM A;  1MJB A;  4C2X A;  4UBR A;  2Q4V A;  2NMT A;  2D4P A;  1N71 A;  1PUA A;  4HNY B;  1Z4E A;  5G20 A;  4ONU A;  3FNC A;  3TT2 A;  2OZU A;  1Y9K A;  4ZGY B;  4NXY A;  3W91 A;  3GYA A;  4B5O A;  2OZG A;  1M1D A;  1XF8 A;  4KSA A;  2PDO A;  5DWN A;  2KCW A;  5DWM A;  4KOV A;  4RI1 A;  3MGD A;  3FBU A;  2F5I A;  1YRE A;  2PR1 A;  4CYO A;  4C7H A;  3IWE A;  3OWC A;  1Y9W A;  1NSL A;  3TFY A;  1CJW A;  2B4D B;  2WSA A;  2GE3 A;  3R95 A;  3S6H A;  4CGM A;  1S7L A;  4CYP A;  4H6U A;  4F0Y A;  4KZT A;  2IL4 A;  3E0K A;  1VHS A;  1KZF A;  3SXO A;  3R9F A;  2Z3K A;  2YNC A;  5JPH A;  4QUS A;  4OLL A;  1ZO0 A;  4H6Z A;  3EC4 A;  1S7N A;  4DNC A;  4R87 A;  1U6M A;  2BSW A;  4UCP A;  2I79 A;  2Z3O A;  3BJ8 A;  5AGE A;  1UFH A;  3EFA A;  4B14 A;  4CGO A;  1J4J A;  1FY7 A;  2Q04 A;  4YGO A;  4JWP A;  4A2Z A;  4IF5 A;  4CS0 B;  2REF A;  4CAV A;  5C82 A;  3V8I A;  5A27 A;  2WUU A;  2PQ8 A;  1LRZ A;  2D4O A;  4UFW A;  2JLM A;  4MFJ A;  4NEX A;  4E8O A;  4AB7 A;  4KVM E;  4AVA A;  1Z4R A;  2JDC A;  2P6E A;  5FVJ A;  1NE9 A;  2H5M A;  2X7B A;  1M4D A;  4ORF A;  2BL1 A;  3QB8 A;  1SQH A;  4KUA A;  2FS5 A;  4PSW A;  4C2Y A;  2YGW A;  1TIQ A;  4JD6 A;  5AG4 A;  5HMN A;  2R7H A;  1Y7R A;  1P0H A;  4KS9 A;  4BBH A;  1IIC A;  2ZXV A;  1YVK A;  1I1D A;  3D2P A;  3WR7 A;  4CYN A;  4XNH B;  3SXN A;  4YRH A;  4U9Z A;  3LD2 A;  1CM0 A;  2FCK A;  2J8N A;  4A32 A;  4JXQ A;  1PU9 A;  4MFP A;  4PV6 A;  1NMT A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...