3VH9A

Crystal structure of aeromonas proteolytica aminopeptidase complexed with 8-quinolinol
Total Genus 116
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
116
sequence length
291
structure length
291
Chain Sequence
b'MPPITQQATVTAWLPQVDASQITGTISSLESFTNRFYTTTSGAQASDWIASEWQALSASLPNASVKQVSHSGYNQKSVVMTITGSEAPDEWIVIGGHLDSTIGSHTNEQSVAPGADDDASGIAAVTEVIRVLSENNFQPKRSIAFMAYAAEEVGLRGSQDLANQYKSEGKNVVSALQLDMTNYKGSAQDVVFITDYTDSNFTQYLTQLMDEYLPSLTYGFDTCGYACSDHASWHNAGYPAAMPFESKFNDYNPRIHTTQDTLANSDPTGSHAKKFTQLGLAYAIEMGSATG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Bacterial leucyl aminopeptidase
publication title Potent inhibition of dinuclear zinc(II) peptidase, an aminopeptidase from Aeromonas proteolytica, by 8-quinolinol derivatives: inhibitor design based on Zn(2+) fluorophores, kinetic, and X-ray crystallographic study.
pubmed doi rcsb
molecule tags Hydrolase/hydrolase inhibitor
total genus 116
structure length 291
sequence length 291
ec nomenclature ec 3.4.11.10: Bacterial leucyl aminopeptidase.
pdb deposition date 2011-08-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF04389 Peptidase_M28 Peptidase family M28
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.630.10 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Zn peptidases 3vh9A00
4Z65A 4MHYA 2PJBA 3ISXA 4W9YA 4R7MA 1HEEA 2Q43A 4P4DA 3CPAA 2ZEEA 2GLFA 1M4LA 3TC8A 4UF4A 3DLJA 3D4UA 4O23A 1CX8A 2DEAA 3PB8X 4P6YA 4OC2A 3LWUA 4MXUA 2EK9A 4UEZA 3B3TA 2GREA 3K9TA 1VHOA 5THWA 2PVWA 2ZEOA 2JEWA 3SJFA 3SI0A 4PXEA 2Q51A 4R76A 4DJLA 1BLLE 2PVVA 4K3NA 4MRIA 4YWYA 3PB6X 2OOTA 4OC3A 4IHMA 4PXCA 2EK8A 1CPSA 2V8DA 2CF4A 3MRUA 1Z2LA 4A39A 3VH9A 2BOAA 3S9NA 4PPZA 3D7FA 3T8WA 1Z8LA 1QMUA 4A94A 1TF8A 2GU2A 2G9DA 1DTDA 4ZY1A 3D7GA 3N5FA 3PB4X 3CT9A 4NGRA 2C6CA 1F2PA 3DGVA 2V8HA 3IIBA 1TF9A 3FECA 3IC1A 1PYTB 3PFOA 3NA6A 4P44A 5HVGA 2OR4A 2BO9A 1TXRA 5DS0A 3QNVA 4Q7AA 2ZENA 2PJ6A 3B35A 1XFOA 3V38A 4G1PA 4MMOA 5F09A 3B3VA 3B3CA 3PBEA 2RFHA 2HC9A 4ZY2A 4UIBA 1CPXA 1QQ9A 5CBMA 2F8HA 3D7DA 2PJ2A 4FWUA 5K8PA 2PIZA 2C6GA 1LCPA 4ONWA 4PXDA 3WABA 1EE3P 5K8NA 4EMEA 1YW4A 3BI0A 4NJRA 1HDQA 2V8GA 2PJ8A 4OC0A 4UEFA 2ABZA 3D7HA 2BCOA 4P10A 3KQZA 2IMOA 1PCAA 3KI9A 1XMBA 3MN8A 1CG2A 1ZLHA 1JQGA 2PJ9A 1TKFA 4OC1A 4MCPA 2V8VA 2XEGA 4PQAA 1ARLA 3PB9X 2CIJA 2NSMA 4P4JA 2QYVA 1ELLP 1ZG7A 3IO1A 3H8EA 3ISZA 2NYQA 3VATA 4RUHA 3PRTA 3KZWA 1DE4C 2VL1A 4FAIA 1OBRA 3RAMA 5LYIA 3KL9A 3PB7X 2ZEGA 3S9LA 4NFRA 4IAVA 3SJEA 2PRQA 3KASA 3S9MA 4UEEA 3L2NA 5K8MA 4WWVA 1BPNA 1Z5RA 4H2KA 2Q4ZA 3V7ZA 4MCQA 3KQXA 3FF3A 3BHXA 4A38A 3SJGA 3JRUA 2J9AA 3H8FA 4P45A 2RB7A 5I4MA 2AFXA 3PFEA 2XEFA 3FX6A 3WT4A 3PBBA 2AFMA 2C6PA 4JZ0A 4TWEA 4OP4A 2PIYA 3IEHA 4OIWA 4CPAA 3KR5A 5LYFA 4ZI6A 1Q7LA 3D66A 3GB0A 5JM6A 1VIXA 3SI1A 2QJ8A 5K8OA 1CP6A 1Y0YA 3IWWA 1ARMA 1LFWA 2XEIA 2ANPA 3IFEA 3KHZA 3SI2A 1LANA 2PJ4A 3D67A 3BXMA 2PE3A 1RTQA 2JBJA 3WC5A 4GM5A 4OC4A 4UIAA 4EFDA 3PEIA 1KWMA 3WC6A 1F2OA 5D29A 1XJOA 4IK2A 4JYWA 3HLPA 3FJUA 4NGPA 1CBXA 2FVGA 3CDXA 3FH4A 3B3WA 2GLJA 3GLJA 1LOKA 3LMSA 1LAMA 4DUKA 4EWTA 5LYDA 1YLOA 4MCRA 3FEDA 5JGFA 4OIDA 4F9UA 1BAVA 2PJ5A 2POKA 4FBEA 5JH9A 5LRGA 2EWBA 2PCUA 2WYRA 3NH8A 2ZEHA 3NH5A 3VARA 4OMEA 1ELMP 3NFZA 1HDUA 4NGNA 5CPAA 4B6ZA 1VGYA 3B3SA 3I1UA 1H8LA 1YSJA 1ZLIA 6CPAA 2IQ6A 4ZX9A 4ZY0A 1F57A 2PJCA 4X8IA 3FEEA 2I3CA 3KHXA 3GUXA 5D8NA 4P4BA 4F8ZA 2ZEDA 2PJAA 4OKOA 2JBKA 8CPAA 5HXDA 1XBUA 2PJ1A 4ZYQA 2AFUA 3CPXA 1AMPA 3NH4A 4P4FA 1LAPA 5LRKA 3H8GA 4A37A 1FT7A 3B2YA 3K2KA 4P4IA 1GYTA 3D68A 4MHPA 4WJBA 4MHNA 1CP7A 1R3NA 2AFOA 1VHEA 2ZOFA 4NGQA 1Y7EA 2PJ3A 2C1CA 4NGSA 2ZEPA 4R6TA 4X3RA 3SJXA 2AFZA 4F9VA 3RZAA 4TNUA 4P4EA 1FNOA 1BPMA 1YW6A 3B7IA 4BD9A 4YU9A 2F7VA 2ZEMA 1IY7A 4ZX8A 2ZEFA 5LRJA 2V77A 2PJ0A 5LYLA 3FMCA 4MHZA 1YMEA 3IJ3A 1ZG9A 5IB9A 4OC5A 1UWYA 1IGBA 5ELYA 1AYEA 5HVFA 2CTBA 7CPAA 1TKHA 4PXBA 1R43A 2AFWA 2IJZA 4R8FA 5J1QA 1NSAA 4NJQA 2QVPA 2ZELA 4DYOA 1Y0RA 3KGQA 2AFSA 2XEJA 4LQGA 4KSIA 3HUVA 4X2TA 1TKJA 3FVLA 2ZOGA 4MCSA 2PJ7A 4FUUA 1XRYA 2O53A 4NGMA 3TX8A 4AXVA 1ZG8A 2CTCA 2WZNA 3BI1A 3WC7A 2O4HA 2HB6A 3RBUA 4NGTA 3KR4A 5HVHA
chains in the Genus database with same CATH superfamily
4Z65A 4MHYA 2G0BA 2PJBA 2Q04A 3ISXA 5IX3A 4W9YA 4U9YA 4R7MA 4Y49B 1HEEA 2Q43A 4P4DA 3CPAA 1M1DA 1RXTA 2FSRA 2ZEEA 3S6KA 2GLFA 1M4LA 3TT2A 4M85A 1Q2YA 3T9YA 3TC8A 1YREA 1NMTA 1N71A 3CXQA 3DLJA 4UF4A 2Y0MA 1Q2CA 1IOIA 4U9ZA 3D4UA 4O23A 2A4NA 1J4JA 4F6AA 1CX8A 2DEAA 3PB8X 1I12A 2J8NA 4M3SA 2JDCA 4AVBA 5EMIA 4P6YA 3GKRA 3IFEA 1Z4RA 3EFAA 1MK4A 2Q44A 3FB3A 3LWUA 4OC2A 4UFXA 4RS2A 5C88A 2Q4YA 4MXUA 2EK9A 4UEZA 1Y9KA 3B3TA 1ZO0A 2B5GA 2GREA 3F5BA 3K9TA 3R1KA 4E8OA 2Z3PA 1VHOA 1YVOA 3LACA 4II9A 4NSQA 2VI7A 4R87A 5THWA 4NCZA 2P6EA 2PVWA 3NE8A 2ZEOA 4H89A 4UCMA 4B5PA 2JEWA 3NE7A 3SJFA 4CRZB 1MJ9A 4FD5A 3SI0A 1XOVA 4PXEA 3CZXA 2Q51A 4R76A 2Z3MA 4A2ZA 4DJLA 3C26A 1BLLE 2PVVA 4K3NA 4MRIA 4YWYA 3TCVA 2D4PA 3PB6X 2OOTA 2RC4A 4OC3A 1KZFA 4IHMA 4PXCA 5HH1A 4A95A 2AE6A 2EK8A 1CPSA 2B4DB 2V8DA 4R57A 2CF4A 3MRUA 1Z2LA 1QSMA 3SXNA 3VH9A 4KOTA 5AG5A 4A39A 2BOAA 3S9NA 2JDDA 4PPZA 3D7FA 3T8WA 1Z8LA 1QMUA 2GANA 1TF8A 1ON0A 2GU2A 4A94A 2B4BA 2DF5A 2G9DA 1DTDA 2PR1A 4ZY1A 3D7GA 4CYPA 3N5FA 3PB4X 1I21A 3GYAA 2Z10A 1AUGA 3CT9A 4NGRA 4C2YA 2P0WA 2C6CA 1F2PA 3DGVA 2V8HA 3IIBA 1TF9A 3FECA 1Z9UA 2YNCA 4KOSA 2BUEA 3IC1A 4MBUA 1PYTB 1IOFA 4F0YA 3PFOA 4B13A 4CYNA 2BSWA 3NA6A 4P44A 4B14A 2Z0ZA 5HVGA 2OR4A 2BO9A 2PDOA 2FS5A 2YNEA 1TXRA 3B8GA 3CXPA 5DWNA 3QNVA 4Q7AA 5DS0A 2DPTA 2ZENA 2PJ6A 3B35A 1XFOA 2ZPAA 3V38A 5G1ZA 4G1PA 1Z8TA 1BOBA 4MMOA 5F09A 3B3VA 4MY3A 3B3CA 4CRYB 3OWCA 3PBEA 3W6XA 2RFHA 2HC9A 2DXQA 4ZY2A 4CAXA 4UIBA 5F49A 1IIDA 1WK4A 1CPXA 1Y9WA 1QQ9A 5CBMA 5KTCA 4E0AA 3FYNA 2F5IA 2F8HA 1PUAA 3D7DA 3DR8A 1KUXA 2PJ2A 4FWUA 4B5OA 3BJ8A 5K8PA 3SXOA 2PIZA 3DNSA 2C6GA 1LCPA 4ONWA 4PXDA 5DWMA 3D2PA 3WABA 1EE3P 5K8NA 4EMEA 1YW4A 3BI0A 4NJRA 4R3KA 1HDQA 2PC1A 2V8GA 2Z11A 4KSAA 1QSTA 2PJ8A 4OC0A 4K30A 4UEFA 2ABZA 4YGOA 3V8IA 3D7HA 2BCOA 4C68A 4M6IA 1UFHA 4A30A 2GE3A 4OLLA 4P10A 1BO4A 3TOAA 1S7LA 5CNPA 1S7NA 1S3ZA 2IMOA 2QMLA 3KQZA 4KUAA 1PCAA 1IB1E 5AG6A 3T90A 2J8RA 3KI9A 4Y49C 4JLYA 1XMBA 3TTHA 3MN8A 1B87A 1CG2A 1ZLHA 1JQGA 4UCPA 2PJ9A 1TKFA 1PU9A 4OC1A 4ORFA 4MCPA 2V8VA 2XEGA 2Z3NA 1A2ZA 4PQAA 1GHEA 1ARLA 3PB9X 2OB0A 2CIJA 3WC5A 1YK3A 2NSMA 4P4JA 4U5YA 2QYVA 4NEXA 3ZZIA 3QAYA 1CJWA 1ELLP 4KOVA 1ZG7A 3IO1A 2VXKA 3H8EA 3ISZA 2NYQA 4MFLA 1WWZA 2G3TA 5GCNA 3VATA 4RUHA 5KTAA 3PRTA 4A32A 4KVOE 4KORA 3R9EA 3KZWA 4JJXA 3LD2A 4UWIA 2EO8A 4B10A 1YVKA 3IU1A 1DE4C 5HVHA 1M4GA 2VL1A 4FAIA 2JLMA 4B12A 1OBRA 3RAMA 5F46A 4BBHA 5LYIA 4CYOA 3KL9A 1XE4A 2FT0A 2ZEGA 2P6FA 3PB7X 4NFRA 3S9LA 4IAVA 3JTKA 3SJEA 2PRQA 3KASA 4I49A 1Q2DA 4YRHA 3S9MA 4UEEA 4L89A 3L2NA 1K4JA 1VKCA 3F8KA 3GY9A 1MJBA 4MFZA 4B11A 1Z4EA 2CNSA 5K8MA 5A27A 5BWAB 4WWVA 1BPNA 4GXHA 1Z5RA 1JWQA 1IYKA 2Q4ZA 2ZXVA 4H2KA 3IWEA 3FRMA 4HKFA 2Z3OA 1XF8A 4MCQA 1TIQA 3KQXA 4PK2A 4UFWA 3FF3A 3V7ZA 3BHXA 2R1IA 3VWDA 4PSWA 4A38A 2EUIA 4JXRA 3DDDA 3SJGA 1L0CA 4MFJA 3JRUA 2J9AA 2PSWA 3H8FA 4P45A 2RB7A 5I4MA 2AFXA 3PFEA 2XEFA 3FX6A 4BMHA 2WUUA 3WT4A 4QC6A 4M6GA 4UWJA 3R95A 3PBBA 2AFMA 5G20A 4GS4A 2C6PA 4JZ0A 4TWEA 2ZW7A 4OP4A 2B5GB 2PRBA 2PIYA 3PZJA 3IEHA 4OIWA 3IWGA 2EBJA 4KOUA 3KR5A 4CPAA 5LYFA 1FY7A 4ZI6A 2IL4A 4MHDA 1Q7LA 4RN7A 2BEIA 3D66A 4QB9A 2OZUA 3EXNA 4B5PB 1YX0A 3GB0A 2AJ6A 3KKWA 5JM6A 3EC4A 1VIXA 3SI1A 3G3SA 4KZTA 3DSBA 2QJ8A 5K8OA 4XPDB 1CP6A 1Y0YA 3IWWA 5AG7A 3TO6A 4EVYA 1ARMA 1LFWA 2FIWA 2ANPA 2CNMA 2J8MA 2KCWA 2XEIA 2Z3KA 1X10A 3DR6A 2VBQA 3KHZA 5F47A 1LANA 3SI2A 1XEBA 4CYQA 2PJ4A 2Q4VA 5C82A 3D67A 3BXMA 2PE3A 4KOYA 3I3GA 1RTQA 2JBJA 4KLWA 1QSRA 2ZW6A 4GM5A 1I1DA 4OC4A 2QIRA 4HNYB 4UIAA 4C2XA 4EFDA 3PEIA 1KWMA 4MFKA 3WC6A 2CNTA 1F2OA 5KTDA 5D29A 1XJOA 4IK2A 4PSXA 4C7HA 4UA3A 2HV2A 4JYWA 3WR7A 3HLPA 2G3AA 3TE4A 3FJUA 4NGPA 2OU2A 5G22A 1CBXA 1NSLA 2FVGA 3CDXA 3FH4A 4KVME 3B3WA 1MJAA 4IUSA 2FXFA 4JWPA 4F0XA 1NE9A 4FD6A 3R9GA 1M44A 2GLJA 3GLJA 1LOKA 2QECA 4NXYA 2CXAA 3LMSA 1SQHA 1LAMA 2FE7A 4CAFA 2B58A 4DUKA 1S7KA 4EWTA 2R8VA 5LYDA 4CGMA 1YLOA 1Z8XA 3JUWA 3FEDA 4MCRA 4Q38A 4ZGYB 4H6UA 1M4DA 2K5TA 2YNDA 5JGFA 4OIDA 4F9UA 5J8CA 1B6BA 3D2MA 3TO9A 4FD7A 5HMNA 1YGHA 2FIAA 3D8PA 1BAVA 2PJ5A 2NMTA 2POKA 4FBEA 1P4NA 3MGDA 2OH1A 3ZJ0A 5JH9A 5LRGA 2EWBA 2PCUA 2I79A 3QB8A 2WYRA 3NH8A 2ZW5A 3FXTA 2ZEHA 1U6MA 3NH5A 3VARA 4OMEA 2PQ8A 3BLNA 4XNHB 1ELMP 3NFZA 5IV0A 3H5ZA 1HDUA 4NGNA 5CPAA 3TO7A 3R9FA 1VGYA 4B6ZA 3B3SA 3I1UA 1IU8A 5IB0A 3P2FA 1H8LA 4AG9A 1YSJA 2WSAA 1ZLIA 6CPAA 2IQ6A 2B3VA 4ZX9A 3EO4A 4C7IA 4CGNA 4QBJA 4ZY0A 2R98A 3QAHA 2Q7BA 2JEVA 2X7BA 4UFVA 1XIXA 1CM0A 1YQEA 2R7HA 5H86A 4CGPA 4CGLA 4A33A 1F57A 4XPLA 4MY0A 4BINA 2PJCA 3UY5A 4X8IA 4HNWB 3BJ7A 2I3CA 2VEZA 3FEEA 3KHXA 5JPHA 1YR0A 4AG7A 3GUXA 2B4DA 5D8NA 3SHPA 4NF1A 4P4BA 3GIUA 2P6GA 2GFQA 3A9LA 5EBVA 4F8ZA 1QSNA 2VZZA 4YFJA 3FIXA 4C2ZA 2ZEDA 2DPSA 2PJAA 2FL4A 2ZW4A 4OKOA 2JBKA 5FVJA 3R96A 8CPAA 1S7FA 2O28A 5HXDA 1XBUA 1S5KA 4RI1A 2WPXA 1IYLA 2PJ1A 4ZYQA 2AFUA 3CPXA 1AMPA 2OZHA 4CS0B 3NH4A 4P4FA 1RO5A 2REEA 1LAPA 3I9SA 5LRKA 3FBUA 3H8GA 3H4QA 3W91A 2D4OA 4A37A 3TFYA 1FT7A 4X5KA 3RYOA 3B2YA 3K2KA 2WPWA 4P4IA 3E0KA 4DNCA 1R57A 5H84A 2ARHA 2B3UA 2GIVA 3P2HA 1GYTA 4XPKA 3D68A 4CAEA 4MHPA 5AG4A 4UBRA 2OZGA 4QUSA 4MHNA 4KVXA 1CP7A 1R3NA 2HUZA 2AFOA 4LUAA 4WJBA 1IICA 4KUBA 1VHEA 2ZOFA 4M6HA 4NGQA 3EY5A 1Y7EA 2Q0YA 4A31A 1KUVA 2PJ3A 3FNCA 4ONUA 4LQ6A 2C1CA 4NGSA 5EC4A 3K9UA 3S6FA 2ZEPA 4R6TA 4X3RA 3SJXA 2AFZA 3IGRA 3F0AA 4XPDC 4F9VA 5JQ4A 3RZAA 4TNUA 4P4EA 4LX9A 2VQYA 3W6SA 5G21A 1M4IA 3N7ZA 1FNOA 2CY2A 2C27A 4HPSA 4PV6A 4CAVA 4AVAA 5J8FA 2Z3LA 5AGEA 4PK3A 1BPMA 1YW6A 3B7IA 5I0CA 5ISVA 1KUYA 4BD9A 4YU9A 2EVNA 2F7VA 2ZEMA 4UCNA 1IY7A 4R9MA 4ZX8A 2ZEFA 4KOWA 3RO0A 2H5MA 5LRJA 2V77A 2PJ0A 5LYLA 3FMCA 4MHZA 1YMEA 1X12A 2HQYA 3PP9A 4KLVA 3D3SA 2ATRA 2VZYA 3IJ3A 2YNCC 1Y7RA 1ZG9A 3S6GA 5IB9A 4H6ZA 4OC5A 4AVCA 4CAWA 3RNZA 1LRZA 1UWYA 4R3LA 4MFPA 1XMTA 5F48A 1IGBA 2BL1A 4MI4A 5ELYA 3CXSA 3VWEA 5A28A 1AYEA 5HVFA 2CTBA 4JXQA 4L8AA 7CPAA 1TKHA 4PXBA 1R43A 1QSOA 2AFWA 2IJZA 4R8FA 2I00A 4KOXA 2Q7SA 3IU2A 1P0HA 1Z8WA 5J1QA 3JVNA 1NSAA 4MJ8A 4NJQA 2QVPA 2ZELA 4MFQA 3G8WA 1V0CA 4DYOA 4QVTA 1S60A 1Y0RA 1OZPA 4JD6A 3KGQA 2AFSA 2XEJA 4CGOA 4LQGA 4HNXB 2ODFA 4KSIA 3HUVA 4X2TA 1TKJA 3FVLA 1YLEA 2ZOGA 2YGWA 3TOBA 4MCSA 4AB7A 2PJ7A 4FUUA 1XRYA 2O53A 4IF5A 4OAEA 4NGMA 2FCKA 1VHSA 4XNHC 3TX8A 4AXVA 1ZG8A 3LODA 2CTCA 2WZNA 3BI1A 3S6HA 3WC7A 3PGPA 2O4HA 4OADA 2HB6A 4KS9A 4KSFA 5E96A 3RBUA 2REFA 4Q36A 4ZBGA 2PR8A 4NGTA 4FD4A 3KR4A 4J3GA 4E2AA
chains in the Genus database with same CATH topology
4Z65A 4MHYA 2PJBA 3ISXA 4W9YA 4R7MA 1HEEA 2Q43A 4P4DA 3CPAA 2ZEEA 2GLFA 1M4LA 3TC8A 4UF4A 3DLJA 3D4UA 4O23A 1CX8A 2DEAA 3PB8X 4P6YA 4OC2A 3LWUA 4MXUA 2EK9A 4UEZA 3B3TA 2GREA 3K9TA 1VHOA 5THWA 2PVWA 2ZEOA 2JEWA 3SJFA 3SI0A 4PXEA 2Q51A 4R76A 4DJLA 1BLLE 2PVVA 4K3NA 4MRIA 4YWYA 3PB6X 2OOTA 4OC3A 4IHMA 4PXCA 2EK8A 1CPSA 2V8DA 2CF4A 3MRUA 1Z2LA 4A39A 3VH9A 2BOAA 3S9NA 4PPZA 3D7FA 3T8WA 1Z8LA 1QMUA 4A94A 1TF8A 2GU2A 2G9DA 1DTDA 4ZY1A 3D7GA 3N5FA 3PB4X 3CT9A 4NGRA 2C6CA 1F2PA 3DGVA 2V8HA 3IIBA 1TF9A 3FECA 3IC1A 1PYTB 3PFOA 3NA6A 4P44A 5HVGA 2OR4A 2BO9A 1TXRA 5DS0A 3QNVA 4Q7AA 2ZENA 2PJ6A 3B35A 1XFOA 3V38A 4G1PA 4MMOA 5F09A 3B3VA 3B3CA 3PBEA 2RFHA 2HC9A 4ZY2A 4UIBA 1CPXA 1QQ9A 5CBMA 2F8HA 3D7DA 2PJ2A 4FWUA 5K8PA 2PIZA 2C6GA 1LCPA 4ONWA 4PXDA 3WABA 1EE3P 5K8NA 4EMEA 1YW4A 3BI0A 4NJRA 1HDQA 2V8GA 2PJ8A 4OC0A 4UEFA 2ABZA 3D7HA 2BCOA 4P10A 3KQZA 2IMOA 1PCAA 3KI9A 1XMBA 3MN8A 1CG2A 1ZLHA 1JQGA 2PJ9A 1TKFA 4OC1A 4MCPA 2V8VA 2XEGA 4PQAA 1ARLA 3PB9X 2CIJA 2NSMA 4P4JA 2QYVA 1ELLP 1ZG7A 3IO1A 3H8EA 3ISZA 2NYQA 3VATA 4RUHA 3PRTA 3KZWA 1DE4C 2VL1A 4FAIA 1OBRA 3RAMA 5LYIA 3KL9A 3PB7X 2ZEGA 3S9LA 4NFRA 4IAVA 3SJEA 2PRQA 3KASA 3S9MA 4UEEA 3L2NA 5K8MA 4WWVA 1BPNA 1Z5RA 4H2KA 2Q4ZA 3V7ZA 4MCQA 3KQXA 3FF3A 3BHXA 4A38A 3SJGA 3JRUA 2J9AA 3H8FA 4P45A 2RB7A 5I4MA 2AFXA 3PFEA 2XEFA 3FX6A 3WT4A 3PBBA 2AFMA 2C6PA 4JZ0A 4TWEA 4OP4A 2PIYA 3IEHA 4OIWA 4CPAA 3KR5A 5LYFA 4ZI6A 1Q7LA 3D66A 3GB0A 5JM6A 1VIXA 3SI1A 2QJ8A 5K8OA 1CP6A 1Y0YA 3IWWA 1ARMA 1LFWA 2XEIA 2ANPA 3IFEA 3KHZA 3SI2A 1LANA 2PJ4A 3D67A 3BXMA 2PE3A 1RTQA 2JBJA 3WC5A 4GM5A 4OC4A 4UIAA 4EFDA 3PEIA 1KWMA 3WC6A 1F2OA 5D29A 1XJOA 4IK2A 4JYWA 3HLPA 3FJUA 4NGPA 1CBXA 2FVGA 3CDXA 3FH4A 3B3WA 2GLJA 3GLJA 1LOKA 3LMSA 1LAMA 4DUKA 4EWTA 5LYDA 1YLOA 4MCRA 3FEDA 5JGFA 4OIDA 4F9UA 1BAVA 2PJ5A 2POKA 4FBEA 5JH9A 5LRGA 2EWBA 2PCUA 2WYRA 3NH8A 2ZEHA 3NH5A 3VARA 4OMEA 1ELMP 3NFZA 1HDUA 4NGNA 5CPAA 4B6ZA 1VGYA 3B3SA 3I1UA 1H8LA 1YSJA 1ZLIA 6CPAA 2IQ6A 4ZX9A 4ZY0A 1F57A 2PJCA 4X8IA 3FEEA 2I3CA 3KHXA 3GUXA 5D8NA 4P4BA 4F8ZA 2ZEDA 2PJAA 4OKOA 2JBKA 8CPAA 5HXDA 1XBUA 2PJ1A 4ZYQA 2AFUA 3CPXA 1AMPA 3NH4A 4P4FA 1LAPA 5LRKA 3H8GA 4A37A 1FT7A 3B2YA 3K2KA 4P4IA 1GYTA 3D68A 4MHPA 4WJBA 4MHNA 1CP7A 1R3NA 2AFOA 1VHEA 2ZOFA 4NGQA 1Y7EA 2PJ3A 2C1CA 4NGSA 2ZEPA 4R6TA 4X3RA 3SJXA 2AFZA 4F9VA 3RZAA 4TNUA 4P4EA 1FNOA 1BPMA 1YW6A 3B7IA 4BD9A 4YU9A 2F7VA 2ZEMA 1IY7A 4ZX8A 2ZEFA 5LRJA 2V77A 2PJ0A 5LYLA 3FMCA 4MHZA 1YMEA 3IJ3A 1ZG9A 5IB9A 4OC5A 1UWYA 1IGBA 5ELYA 1AYEA 5HVFA 2CTBA 7CPAA 1TKHA 4PXBA 1R43A 2AFWA 2IJZA 4R8FA 5J1QA 1NSAA 4NJQA 2QVPA 2ZELA 4DYOA 1Y0RA 3KGQA 2AFSA 2XEJA 4LQGA 4KSIA 3HUVA 4X2TA 1TKJA 3FVLA 2ZOGA 4MCSA 2PJ7A 4FUUA 1XRYA 2O53A 4NGMA 3TX8A 4AXVA 1ZG8A 2CTCA 2WZNA 3BI1A 3WC7A 2O4HA 2HB6A 3RBUA 4NGTA 3KR4A 5HVHA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4Z65 A;  4MHY A;  2PJB A;  3ISX A;  4W9Y A;  4R7M A;  1HEE A;  2Q43 A;  4P4D A;  3CPA A;  2ZEE A;  2GLF A;  1M4L A;  3TC8 A;  4UF4 A;  3DLJ A;  3D4U A;  4O23 A;  1CX8 A;  2DEA A;  3PB8 X;  4P6Y A;  4OC2 A;  3LWU A;  4MXU A;  2EK9 A;  4UEZ A;  3B3T A;  2GRE A;  3K9T A;  1VHO A;  5THW A;  2PVW A;  2ZEO A;  2JEW A;  3SJF A;  3SI0 A;  4PXE A;  2Q51 A;  4R76 A;  4DJL A;  1BLL E;  2PVV A;  4K3N A;  4MRI A;  4YWY A;  3PB6 X;  2OOT A;  4OC3 A;  4IHM A;  4PXC A;  2EK8 A;  1CPS A;  2V8D A;  2CF4 A;  3MRU A;  1Z2L A;  4A39 A;  3VH9 A;  2BOA A;  3S9N A;  4PPZ A;  3D7F A;  3T8W A;  1Z8L A;  1QMU A;  4A94 A;  1TF8 A;  2GU2 A;  2G9D A;  1DTD A;  4ZY1 A;  3D7G A;  3N5F A;  3PB4 X;  3CT9 A;  4NGR A;  2C6C A;  1F2P A;  3DGV A;  2V8H A;  3IIB A;  1TF9 A;  3FEC A;  3IC1 A;  1PYT B;  3PFO A;  3NA6 A;  4P44 A;  5HVG A;  2OR4 A;  2BO9 A;  1TXR A;  5DS0 A;  3QNV A;  4Q7A A;  2ZEN A;  2PJ6 A;  3B35 A;  1XFO A;  3V38 A;  4G1P A;  4MMO A;  5F09 A;  3B3V A;  3B3C A;  3PBE A;  2RFH A;  2HC9 A;  4ZY2 A;  4UIB A;  1CPX A;  1QQ9 A;  5CBM A;  2F8H A;  3D7D A;  2PJ2 A;  4FWU A;  5K8P A;  2PIZ A;  2C6G A;  1LCP A;  4ONW A;  4PXD A;  3WAB A;  1EE3 P;  5K8N A;  4EME A;  1YW4 A;  3BI0 A;  4NJR A;  1HDQ A;  2V8G A;  2PJ8 A;  4OC0 A;  4UEF A;  2ABZ A;  3D7H A;  2BCO A;  4P10 A;  3KQZ A;  2IMO A;  1PCA A;  3KI9 A;  1XMB A;  3MN8 A;  1CG2 A;  1ZLH A;  1JQG A;  2PJ9 A;  1TKF A;  4OC1 A;  4MCP A;  2V8V A;  2XEG A;  4PQA A;  1ARL A;  3PB9 X;  2CIJ A;  2NSM A;  4P4J A;  2QYV A;  1ELL P;  1ZG7 A;  3IO1 A;  3H8E A;  3ISZ A;  2NYQ A;  3VAT A;  4RUH A;  3PRT A;  3KZW A;  1DE4 C;  2VL1 A;  4FAI A;  1OBR A;  3RAM A;  5LYI A;  3KL9 A;  3PB7 X;  2ZEG A;  3S9L A;  4NFR A;  4IAV A;  3SJE A;  2PRQ A;  3KAS A;  3S9M A;  4UEE A;  3L2N A;  5K8M A;  4WWV A;  1BPN A;  1Z5R A;  4H2K A;  2Q4Z A;  3V7Z A;  4MCQ A;  3KQX A;  3FF3 A;  3BHX A;  4A38 A;  3SJG A;  3JRU A;  2J9A A;  3H8F A;  4P45 A;  2RB7 A;  5I4M A;  2AFX A;  3PFE A;  2XEF A;  3FX6 A;  3WT4 A;  3PBB A;  2AFM A;  2C6P A;  4JZ0 A;  4TWE A;  4OP4 A;  2PIY A;  3IEH A;  4OIW A;  4CPA A;  3KR5 A;  5LYF A;  4ZI6 A;  1Q7L A;  3D66 A;  3GB0 A;  5JM6 A;  1VIX A;  3SI1 A;  2QJ8 A;  5K8O A;  1CP6 A;  1Y0Y A;  3IWW A;  1ARM A;  1LFW A;  2XEI A;  2ANP A;  3IFE A;  3KHZ A;  3SI2 A;  1LAN A;  2PJ4 A;  3D67 A;  3BXM A;  2PE3 A;  1RTQ A;  2JBJ A;  3WC5 A;  4GM5 A;  4OC4 A;  4UIA A;  4EFD A;  3PEI A;  1KWM A;  3WC6 A;  1F2O A;  5D29 A;  1XJO A;  4IK2 A;  4JYW A;  3HLP A;  3FJU A;  4NGP A;  1CBX A;  2FVG A;  3CDX A;  3FH4 A;  3B3W A;  2GLJ A;  3GLJ A;  1LOK A;  3LMS A;  1LAM A;  4DUK A;  4EWT A;  5LYD A;  1YLO A;  4MCR A;  3FED A;  5JGF A;  4OID A;  4F9U A;  1BAV A;  2PJ5 A;  2POK A;  4FBE A;  5JH9 A;  5LRG A;  2EWB A;  2PCU A;  2WYR A;  3NH8 A;  2ZEH A;  3NH5 A;  3VAR A;  4OME A;  1ELM P;  3NFZ A;  1HDU A;  4NGN A;  5CPA A;  4B6Z A;  1VGY A;  3B3S A;  3I1U A;  1H8L A;  1YSJ A;  1ZLI A;  6CPA A;  2IQ6 A;  4ZX9 A;  4ZY0 A;  1F57 A;  2PJC A;  4X8I A;  3FEE A;  2I3C A;  3KHX A;  3GUX A;  5D8N A;  4P4B A;  4F8Z A;  2ZED A;  2PJA A;  4OKO A;  2JBK A;  8CPA A;  5HXD A;  1XBU A;  2PJ1 A;  4ZYQ A;  2AFU A;  3CPX A;  1AMP A;  3NH4 A;  4P4F A;  1LAP A;  5LRK A;  3H8G A;  4A37 A;  1FT7 A;  3B2Y A;  3K2K A;  4P4I A;  1GYT A;  3D68 A;  4MHP A;  4WJB A;  4MHN A;  1CP7 A;  1R3N A;  2AFO A;  1VHE A;  2ZOF A;  4NGQ A;  1Y7E A;  2PJ3 A;  2C1C A;  4NGS A;  2ZEP A;  4R6T A;  4X3R A;  3SJX A;  2AFZ A;  4F9V A;  3RZA A;  4TNU A;  4P4E A;  1FNO A;  1BPM A;  1YW6 A;  3B7I A;  4BD9 A;  4YU9 A;  2F7V A;  2ZEM A;  1IY7 A;  4ZX8 A;  2ZEF A;  5LRJ A;  2V77 A;  2PJ0 A;  5LYL A;  3FMC A;  4MHZ A;  1YME A;  3IJ3 A;  1ZG9 A;  5IB9 A;  4OC5 A;  1UWY A;  1IGB A;  5ELY A;  1AYE A;  5HVF A;  2CTB A;  7CPA A;  1TKH A;  4PXB A;  1R43 A;  2AFW A;  2IJZ A;  4R8F A;  5J1Q A;  1NSA A;  4NJQ A;  2QVP A;  2ZEL A;  4DYO A;  1Y0R A;  3KGQ A;  2AFS A;  2XEJ A;  4LQG A;  4KSI A;  3HUV A;  4X2T A;  1TKJ A;  3FVL A;  2ZOG A;  4MCS A;  2PJ7 A;  4FUU A;  1XRY A;  2O53 A;  4NGM A;  3TX8 A;  4AXV A;  1ZG8 A;  2CTC A;  2WZN A;  3BI1 A;  3WC7 A;  2O4H A;  2HB6 A;  3RBU A;  4NGT A;  3KR4 A;  5HVH A; 
#chains in the Genus database with same CATH topology
 4Z65 A;  4MHY A;  2G0B A;  2PJB A;  2Q04 A;  3ISX A;  5IX3 A;  4W9Y A;  4U9Y A;  4R7M A;  4Y49 B;  1HEE A;  2Q43 A;  4P4D A;  3CPA A;  1M1D A;  1RXT A;  2FSR A;  2ZEE A;  3S6K A;  2GLF A;  1M4L A;  3TT2 A;  4M85 A;  1Q2Y A;  3T9Y A;  3TC8 A;  1YRE A;  1NMT A;  1N71 A;  3CXQ A;  3DLJ A;  4UF4 A;  2Y0M A;  1Q2C A;  1IOI A;  4U9Z A;  3D4U A;  4O23 A;  2A4N A;  1J4J A;  4F6A A;  1CX8 A;  2DEA A;  3PB8 X;  1I12 A;  2J8N A;  4M3S A;  2JDC A;  4AVB A;  5EMI A;  4P6Y A;  3GKR A;  3IFE A;  1Z4R A;  3EFA A;  1MK4 A;  2Q44 A;  3FB3 A;  3LWU A;  4OC2 A;  4UFX A;  4RS2 A;  5C88 A;  2Q4Y A;  4MXU A;  2EK9 A;  4UEZ A;  1Y9K A;  3B3T A;  1ZO0 A;  2B5G A;  2GRE A;  3F5B A;  3K9T A;  3R1K A;  4E8O A;  2Z3P A;  1VHO A;  1YVO A;  3LAC A;  4II9 A;  4NSQ A;  2VI7 A;  4R87 A;  5THW A;  4NCZ A;  2P6E A;  2PVW A;  3NE8 A;  2ZEO A;  4H89 A;  4UCM A;  4B5P A;  2JEW A;  3NE7 A;  3SJF A;  4CRZ B;  1MJ9 A;  4FD5 A;  3SI0 A;  1XOV A;  4PXE A;  3CZX A;  2Q51 A;  4R76 A;  2Z3M A;  4A2Z A;  4DJL A;  3C26 A;  1BLL E;  2PVV A;  4K3N A;  4MRI A;  4YWY A;  3TCV A;  2D4P A;  3PB6 X;  2OOT A;  2RC4 A;  4OC3 A;  1KZF A;  4IHM A;  4PXC A;  5HH1 A;  4A95 A;  2AE6 A;  2EK8 A;  1CPS A;  2B4D B;  2V8D A;  4R57 A;  2CF4 A;  3MRU A;  1Z2L A;  1QSM A;  3SXN A;  3VH9 A;  4KOT A;  5AG5 A;  4A39 A;  2BOA A;  3S9N A;  2JDD A;  4PPZ A;  3D7F A;  3T8W A;  1Z8L A;  1QMU A;  2GAN A;  1TF8 A;  1ON0 A;  2GU2 A;  4A94 A;  2B4B A;  2DF5 A;  2G9D A;  1DTD A;  2PR1 A;  4ZY1 A;  3D7G A;  4CYP A;  3N5F A;  3PB4 X;  1I21 A;  3GYA A;  2Z10 A;  1AUG A;  3CT9 A;  4NGR A;  4C2Y A;  2P0W A;  2C6C A;  1F2P A;  3DGV A;  2V8H A;  3IIB A;  1TF9 A;  3FEC A;  1Z9U A;  2YNC A;  4KOS A;  2BUE A;  3IC1 A;  4MBU A;  1PYT B;  1IOF A;  4F0Y A;  3PFO A;  4B13 A;  4CYN A;  2BSW A;  3NA6 A;  4P44 A;  4B14 A;  2Z0Z A;  5HVG A;  2OR4 A;  2BO9 A;  2PDO A;  2FS5 A;  2YNE A;  1TXR A;  3B8G A;  3CXP A;  5DWN A;  3QNV A;  4Q7A A;  5DS0 A;  2DPT A;  2ZEN A;  2PJ6 A;  3B35 A;  1XFO A;  2ZPA A;  3V38 A;  5G1Z A;  4G1P A;  1Z8T A;  1BOB A;  4MMO A;  5F09 A;  3B3V A;  4MY3 A;  3B3C A;  4CRY B;  3OWC A;  3PBE A;  3W6X A;  2RFH A;  2HC9 A;  2DXQ A;  4ZY2 A;  4CAX A;  4UIB A;  5F49 A;  1IID A;  1WK4 A;  1CPX A;  1Y9W A;  1QQ9 A;  5CBM A;  5KTC A;  4E0A A;  3FYN A;  2F5I A;  2F8H A;  1PUA A;  3D7D A;  3DR8 A;  1KUX A;  2PJ2 A;  4FWU A;  4B5O A;  3BJ8 A;  5K8P A;  3SXO A;  2PIZ A;  3DNS A;  2C6G A;  1LCP A;  4ONW A;  4PXD A;  5DWM A;  3D2P A;  3WAB A;  1EE3 P;  5K8N A;  4EME A;  1YW4 A;  3BI0 A;  4NJR A;  4R3K A;  1HDQ A;  2PC1 A;  2V8G A;  2Z11 A;  4KSA A;  1QST A;  2PJ8 A;  4OC0 A;  4K30 A;  4UEF A;  2ABZ A;  4YGO A;  3V8I A;  3D7H A;  2BCO A;  4C68 A;  4M6I A;  1UFH A;  4A30 A;  2GE3 A;  4OLL A;  4P10 A;  1BO4 A;  3TOA A;  1S7L A;  5CNP A;  1S7N A;  1S3Z A;  2IMO A;  2QML A;  3KQZ A;  4KUA A;  1PCA A;  1IB1 E;  5AG6 A;  3T90 A;  2J8R A;  3KI9 A;  4Y49 C;  4JLY A;  1XMB A;  3TTH A;  3MN8 A;  1B87 A;  1CG2 A;  1ZLH A;  1JQG A;  4UCP A;  2PJ9 A;  1TKF A;  1PU9 A;  4OC1 A;  4ORF A;  4MCP A;  2V8V A;  2XEG A;  2Z3N A;  1A2Z A;  4PQA A;  1GHE A;  1ARL A;  3PB9 X;  2OB0 A;  2CIJ A;  3WC5 A;  1YK3 A;  2NSM A;  4P4J A;  4U5Y A;  2QYV A;  4NEX A;  3ZZI A;  3QAY A;  1CJW A;  1ELL P;  4KOV A;  1ZG7 A;  3IO1 A;  2VXK A;  3H8E A;  3ISZ A;  2NYQ A;  4MFL A;  1WWZ A;  2G3T A;  5GCN A;  3VAT A;  4RUH A;  5KTA A;  3PRT A;  4A32 A;  4KVO E;  4KOR A;  3R9E A;  3KZW A;  4JJX A;  3LD2 A;  4UWI A;  2EO8 A;  4B10 A;  1YVK A;  3IU1 A;  1DE4 C;  5HVH A;  1M4G A;  2VL1 A;  4FAI A;  2JLM A;  4B12 A;  1OBR A;  3RAM A;  5F46 A;  4BBH A;  5LYI A;  4CYO A;  3KL9 A;  1XE4 A;  2FT0 A;  2ZEG A;  2P6F A;  3PB7 X;  4NFR A;  3S9L A;  4IAV A;  3JTK A;  3SJE A;  2PRQ A;  3KAS A;  4I49 A;  1Q2D A;  4YRH A;  3S9M A;  4UEE A;  4L89 A;  3L2N A;  1K4J A;  1VKC A;  3F8K A;  3GY9 A;  1MJB A;  4MFZ A;  4B11 A;  1Z4E A;  2CNS A;  5K8M A;  5A27 A;  5BWA B;  4WWV A;  1BPN A;  4GXH A;  1Z5R A;  1JWQ A;  1IYK A;  2Q4Z A;  2ZXV A;  4H2K A;  3IWE A;  3FRM A;  4HKF A;  2Z3O A;  1XF8 A;  4MCQ A;  1TIQ A;  3KQX A;  4PK2 A;  4UFW A;  3FF3 A;  3V7Z A;  3BHX A;  2R1I A;  3VWD A;  4PSW A;  4A38 A;  2EUI A;  4JXR A;  3DDD A;  3SJG A;  1L0C A;  4MFJ A;  3JRU A;  2J9A A;  2PSW A;  3H8F A;  4P45 A;  2RB7 A;  5I4M A;  2AFX A;  3PFE A;  2XEF A;  3FX6 A;  4BMH A;  2WUU A;  3WT4 A;  4QC6 A;  4M6G A;  4UWJ A;  3R95 A;  3PBB A;  2AFM A;  5G20 A;  4GS4 A;  2C6P A;  4JZ0 A;  4TWE A;  2ZW7 A;  4OP4 A;  2B5G B;  2PRB A;  2PIY A;  3PZJ A;  3IEH A;  4OIW A;  3IWG A;  2EBJ A;  4KOU A;  3KR5 A;  4CPA A;  5LYF A;  1FY7 A;  4ZI6 A;  2IL4 A;  4MHD A;  1Q7L A;  4RN7 A;  2BEI A;  3D66 A;  4QB9 A;  2OZU A;  3EXN A;  4B5P B;  1YX0 A;  3GB0 A;  2AJ6 A;  3KKW A;  5JM6 A;  3EC4 A;  1VIX A;  3SI1 A;  3G3S A;  4KZT A;  3DSB A;  2QJ8 A;  5K8O A;  4XPD B;  1CP6 A;  1Y0Y A;  3IWW A;  5AG7 A;  3TO6 A;  4EVY A;  1ARM A;  1LFW A;  2FIW A;  2ANP A;  2CNM A;  2J8M A;  2KCW A;  2XEI A;  2Z3K A;  1X10 A;  3DR6 A;  2VBQ A;  3KHZ A;  5F47 A;  1LAN A;  3SI2 A;  1XEB A;  4CYQ A;  2PJ4 A;  2Q4V A;  5C82 A;  3D67 A;  3BXM A;  2PE3 A;  4KOY A;  3I3G A;  1RTQ A;  2JBJ A;  4KLW A;  1QSR A;  2ZW6 A;  4GM5 A;  1I1D A;  4OC4 A;  2QIR A;  4HNY B;  4UIA A;  4C2X A;  4EFD A;  3PEI A;  1KWM A;  4MFK A;  3WC6 A;  2CNT A;  1F2O A;  5KTD A;  5D29 A;  1XJO A;  4IK2 A;  4PSX A;  4C7H A;  4UA3 A;  2HV2 A;  4JYW A;  3WR7 A;  3HLP A;  2G3A A;  3TE4 A;  3FJU A;  4NGP A;  2OU2 A;  5G22 A;  1CBX A;  1NSL A;  2FVG A;  3CDX A;  3FH4 A;  4KVM E;  3B3W A;  1MJA A;  4IUS A;  2FXF A;  4JWP A;  4F0X A;  1NE9 A;  4FD6 A;  3R9G A;  1M44 A;  2GLJ A;  3GLJ A;  1LOK A;  2QEC A;  4NXY A;  2CXA A;  3LMS A;  1SQH A;  1LAM A;  2FE7 A;  4CAF A;  2B58 A;  4DUK A;  1S7K A;  4EWT A;  2R8V A;  5LYD A;  4CGM A;  1YLO A;  1Z8X A;  3JUW A;  3FED A;  4MCR A;  4Q38 A;  4ZGY B;  4H6U A;  1M4D A;  2K5T A;  2YND A;  5JGF A;  4OID A;  4F9U A;  5J8C A;  1B6B A;  3D2M A;  3TO9 A;  4FD7 A;  5HMN A;  1YGH A;  2FIA A;  3D8P A;  1BAV A;  2PJ5 A;  2NMT A;  2POK A;  4FBE A;  1P4N A;  3MGD A;  2OH1 A;  3ZJ0 A;  5JH9 A;  5LRG A;  2EWB A;  2PCU A;  2I79 A;  3QB8 A;  2WYR A;  3NH8 A;  2ZW5 A;  3FXT A;  2ZEH A;  1U6M A;  3NH5 A;  3VAR A;  4OME A;  2PQ8 A;  3BLN A;  4XNH B;  1ELM P;  3NFZ A;  5IV0 A;  3H5Z A;  1HDU A;  4NGN A;  5CPA A;  3TO7 A;  3R9F A;  1VGY A;  4B6Z A;  3B3S A;  3I1U A;  1IU8 A;  5IB0 A;  3P2F A;  1H8L A;  4AG9 A;  1YSJ A;  2WSA A;  1ZLI A;  6CPA A;  2IQ6 A;  2B3V A;  4ZX9 A;  3EO4 A;  4C7I A;  4CGN A;  4QBJ A;  4ZY0 A;  2R98 A;  3QAH A;  2Q7B A;  2JEV A;  2X7B A;  4UFV A;  1XIX A;  1CM0 A;  1YQE A;  2R7H A;  5H86 A;  4CGP A;  4CGL A;  4A33 A;  1F57 A;  4XPL A;  4MY0 A;  4BIN A;  2PJC A;  3UY5 A;  4X8I A;  4HNW B;  3BJ7 A;  2I3C A;  2VEZ A;  3FEE A;  3KHX A;  5JPH A;  1YR0 A;  4AG7 A;  3GUX A;  2B4D A;  5D8N A;  3SHP A;  4NF1 A;  4P4B A;  3GIU A;  2P6G A;  2GFQ A;  3A9L A;  5EBV A;  4F8Z A;  1QSN A;  2VZZ A;  4YFJ A;  3FIX A;  4C2Z A;  2ZED A;  2DPS A;  2PJA A;  2FL4 A;  2ZW4 A;  4OKO A;  2JBK A;  5FVJ A;  3R96 A;  8CPA A;  1S7F A;  2O28 A;  5HXD A;  1XBU A;  1S5K A;  4RI1 A;  2WPX A;  1IYL A;  2PJ1 A;  4ZYQ A;  2AFU A;  3CPX A;  1AMP A;  2OZH A;  4CS0 B;  3NH4 A;  4P4F A;  1RO5 A;  2REE A;  1LAP A;  3I9S A;  5LRK A;  3FBU A;  3H8G A;  3H4Q A;  3W91 A;  2D4O A;  4A37 A;  3TFY A;  1FT7 A;  4X5K A;  3RYO A;  3B2Y A;  3K2K A;  2WPW A;  4P4I A;  3E0K A;  4DNC A;  1R57 A;  5H84 A;  2ARH A;  2B3U A;  2GIV A;  3P2H A;  1GYT A;  4XPK A;  3D68 A;  4CAE A;  4MHP A;  5AG4 A;  4UBR A;  2OZG A;  4QUS A;  4MHN A;  4KVX A;  1CP7 A;  1R3N A;  2HUZ A;  2AFO A;  4LUA A;  4WJB A;  1IIC A;  4KUB A;  1VHE A;  2ZOF A;  4M6H A;  4NGQ A;  3EY5 A;  1Y7E A;  2Q0Y A;  4A31 A;  1KUV A;  2PJ3 A;  3FNC A;  4ONU A;  4LQ6 A;  2C1C A;  4NGS A;  5EC4 A;  3K9U A;  3S6F A;  2ZEP A;  4R6T A;  4X3R A;  3SJX A;  2AFZ A;  3IGR A;  3F0A A;  4XPD C;  4F9V A;  5JQ4 A;  3RZA A;  4TNU A;  4P4E A;  4LX9 A;  2VQY A;  3W6S A;  5G21 A;  1M4I A;  3N7Z A;  1FNO A;  2CY2 A;  2C27 A;  4HPS A;  4PV6 A;  4CAV A;  4AVA A;  5J8F A;  2Z3L A;  5AGE A;  4PK3 A;  1BPM A;  1YW6 A;  3B7I A;  5I0C A;  5ISV A;  1KUY A;  4BD9 A;  4YU9 A;  2EVN A;  2F7V A;  2ZEM A;  4UCN A;  1IY7 A;  4R9M A;  4ZX8 A;  2ZEF A;  4KOW A;  3RO0 A;  2H5M A;  5LRJ A;  2V77 A;  2PJ0 A;  5LYL A;  3FMC A;  4MHZ A;  1YME A;  1X12 A;  2HQY A;  3PP9 A;  4KLV A;  3D3S A;  2ATR A;  2VZY A;  3IJ3 A;  2YNC C;  1Y7R A;  1ZG9 A;  3S6G A;  5IB9 A;  4H6Z A;  4OC5 A;  4AVC A;  4CAW A;  3RNZ A;  1LRZ A;  1UWY A;  4R3L A;  4MFP A;  1XMT A;  5F48 A;  1IGB A;  2BL1 A;  4MI4 A;  5ELY A;  3CXS A;  3VWE A;  5A28 A;  1AYE A;  5HVF A;  2CTB A;  4JXQ A;  4L8A A;  7CPA A;  1TKH A;  4PXB A;  1R43 A;  1QSO A;  2AFW A;  2IJZ A;  4R8F A;  2I00 A;  4KOX A;  2Q7S A;  3IU2 A;  1P0H A;  1Z8W A;  5J1Q A;  3JVN A;  1NSA A;  4MJ8 A;  4NJQ A;  2QVP A;  2ZEL A;  4MFQ A;  3G8W A;  1V0C A;  4DYO A;  4QVT A;  1S60 A;  1Y0R A;  1OZP A;  4JD6 A;  3KGQ A;  2AFS A;  2XEJ A;  4CGO A;  4LQG A;  4HNX B;  2ODF A;  4KSI A;  3HUV A;  4X2T A;  1TKJ A;  3FVL A;  1YLE A;  2ZOG A;  2YGW A;  3TOB A;  4MCS A;  4AB7 A;  2PJ7 A;  4FUU A;  1XRY A;  2O53 A;  4IF5 A;  4OAE A;  4NGM A;  2FCK A;  1VHS A;  4XNH C;  3TX8 A;  4AXV A;  1ZG8 A;  3LOD A;  2CTC A;  2WZN A;  3BI1 A;  3S6H A;  3WC7 A;  3PGP A;  2O4H A;  4OAD A;  2HB6 A;  4KS9 A;  4KSF A;  5E96 A;  3RBU A;  2REF A;  4Q36 A;  4ZBG A;  2PR8 A;  4NGT A;  4FD4 A;  3KR4 A;  4J3G A;  4E2A A; 
#chains in the Genus database with same CATH homology
 4Z65 A;  4MHY A;  2PJB A;  3ISX A;  4W9Y A;  4R7M A;  1HEE A;  2Q43 A;  4P4D A;  3CPA A;  2ZEE A;  2GLF A;  1M4L A;  3TC8 A;  4UF4 A;  3DLJ A;  3D4U A;  4O23 A;  1CX8 A;  2DEA A;  3PB8 X;  4P6Y A;  4OC2 A;  3LWU A;  4MXU A;  2EK9 A;  4UEZ A;  3B3T A;  2GRE A;  3K9T A;  1VHO A;  5THW A;  2PVW A;  2ZEO A;  2JEW A;  3SJF A;  3SI0 A;  4PXE A;  2Q51 A;  4R76 A;  4DJL A;  1BLL E;  2PVV A;  4K3N A;  4MRI A;  4YWY A;  3PB6 X;  2OOT A;  4OC3 A;  4IHM A;  4PXC A;  2EK8 A;  1CPS A;  2V8D A;  2CF4 A;  3MRU A;  1Z2L A;  4A39 A;  3VH9 A;  2BOA A;  3S9N A;  4PPZ A;  3D7F A;  3T8W A;  1Z8L A;  1QMU A;  4A94 A;  1TF8 A;  2GU2 A;  2G9D A;  1DTD A;  4ZY1 A;  3D7G A;  3N5F A;  3PB4 X;  3CT9 A;  4NGR A;  2C6C A;  1F2P A;  3DGV A;  2V8H A;  3IIB A;  1TF9 A;  3FEC A;  3IC1 A;  1PYT B;  3PFO A;  3NA6 A;  4P44 A;  5HVG A;  2OR4 A;  2BO9 A;  1TXR A;  5DS0 A;  3QNV A;  4Q7A A;  2ZEN A;  2PJ6 A;  3B35 A;  1XFO A;  3V38 A;  4G1P A;  4MMO A;  5F09 A;  3B3V A;  3B3C A;  3PBE A;  2RFH A;  2HC9 A;  4ZY2 A;  4UIB A;  1CPX A;  1QQ9 A;  5CBM A;  2F8H A;  3D7D A;  2PJ2 A;  4FWU A;  5K8P A;  2PIZ A;  2C6G A;  1LCP A;  4ONW A;  4PXD A;  3WAB A;  1EE3 P;  5K8N A;  4EME A;  1YW4 A;  3BI0 A;  4NJR A;  1HDQ A;  2V8G A;  2PJ8 A;  4OC0 A;  4UEF A;  2ABZ A;  3D7H A;  2BCO A;  4P10 A;  3KQZ A;  2IMO A;  1PCA A;  3KI9 A;  1XMB A;  3MN8 A;  1CG2 A;  1ZLH A;  1JQG A;  2PJ9 A;  1TKF A;  4OC1 A;  4MCP A;  2V8V A;  2XEG A;  4PQA A;  1ARL A;  3PB9 X;  2CIJ A;  2NSM A;  4P4J A;  2QYV A;  1ELL P;  1ZG7 A;  3IO1 A;  3H8E A;  3ISZ A;  2NYQ A;  3VAT A;  4RUH A;  3PRT A;  3KZW A;  1DE4 C;  2VL1 A;  4FAI A;  1OBR A;  3RAM A;  5LYI A;  3KL9 A;  3PB7 X;  2ZEG A;  3S9L A;  4NFR A;  4IAV A;  3SJE A;  2PRQ A;  3KAS A;  3S9M A;  4UEE A;  3L2N A;  5K8M A;  4WWV A;  1BPN A;  1Z5R A;  4H2K A;  2Q4Z A;  3V7Z A;  4MCQ A;  3KQX A;  3FF3 A;  3BHX A;  4A38 A;  3SJG A;  3JRU A;  2J9A A;  3H8F A;  4P45 A;  2RB7 A;  5I4M A;  2AFX A;  3PFE A;  2XEF A;  3FX6 A;  3WT4 A;  3PBB A;  2AFM A;  2C6P A;  4JZ0 A;  4TWE A;  4OP4 A;  2PIY A;  3IEH A;  4OIW A;  4CPA A;  3KR5 A;  5LYF A;  4ZI6 A;  1Q7L A;  3D66 A;  3GB0 A;  5JM6 A;  1VIX A;  3SI1 A;  2QJ8 A;  5K8O A;  1CP6 A;  1Y0Y A;  3IWW A;  1ARM A;  1LFW A;  2XEI A;  2ANP A;  3IFE A;  3KHZ A;  3SI2 A;  1LAN A;  2PJ4 A;  3D67 A;  3BXM A;  2PE3 A;  1RTQ A;  2JBJ A;  3WC5 A;  4GM5 A;  4OC4 A;  4UIA A;  4EFD A;  3PEI A;  1KWM A;  3WC6 A;  1F2O A;  5D29 A;  1XJO A;  4IK2 A;  4JYW A;  3HLP A;  3FJU A;  4NGP A;  1CBX A;  2FVG A;  3CDX A;  3FH4 A;  3B3W A;  2GLJ A;  3GLJ A;  1LOK A;  3LMS A;  1LAM A;  4DUK A;  4EWT A;  5LYD A;  1YLO A;  4MCR A;  3FED A;  5JGF A;  4OID A;  4F9U A;  1BAV A;  2PJ5 A;  2POK A;  4FBE A;  5JH9 A;  5LRG A;  2EWB A;  2PCU A;  2WYR A;  3NH8 A;  2ZEH A;  3NH5 A;  3VAR A;  4OME A;  1ELM P;  3NFZ A;  1HDU A;  4NGN A;  5CPA A;  4B6Z A;  1VGY A;  3B3S A;  3I1U A;  1H8L A;  1YSJ A;  1ZLI A;  6CPA A;  2IQ6 A;  4ZX9 A;  4ZY0 A;  1F57 A;  2PJC A;  4X8I A;  3FEE A;  2I3C A;  3KHX A;  3GUX A;  5D8N A;  4P4B A;  4F8Z A;  2ZED A;  2PJA A;  4OKO A;  2JBK A;  8CPA A;  5HXD A;  1XBU A;  2PJ1 A;  4ZYQ A;  2AFU A;  3CPX A;  1AMP A;  3NH4 A;  4P4F A;  1LAP A;  5LRK A;  3H8G A;  4A37 A;  1FT7 A;  3B2Y A;  3K2K A;  4P4I A;  1GYT A;  3D68 A;  4MHP A;  4WJB A;  4MHN A;  1CP7 A;  1R3N A;  2AFO A;  1VHE A;  2ZOF A;  4NGQ A;  1Y7E A;  2PJ3 A;  2C1C A;  4NGS A;  2ZEP A;  4R6T A;  4X3R A;  3SJX A;  2AFZ A;  4F9V A;  3RZA A;  4TNU A;  4P4E A;  1FNO A;  1BPM A;  1YW6 A;  3B7I A;  4BD9 A;  4YU9 A;  2F7V A;  2ZEM A;  1IY7 A;  4ZX8 A;  2ZEF A;  5LRJ A;  2V77 A;  2PJ0 A;  5LYL A;  3FMC A;  4MHZ A;  1YME A;  3IJ3 A;  1ZG9 A;  5IB9 A;  4OC5 A;  1UWY A;  1IGB A;  5ELY A;  1AYE A;  5HVF A;  2CTB A;  7CPA A;  1TKH A;  4PXB A;  1R43 A;  2AFW A;  2IJZ A;  4R8F A;  5J1Q A;  1NSA A;  4NJQ A;  2QVP A;  2ZEL A;  4DYO A;  1Y0R A;  3KGQ A;  2AFS A;  2XEJ A;  4LQG A;  4KSI A;  3HUV A;  4X2T A;  1TKJ A;  3FVL A;  2ZOG A;  4MCS A;  2PJ7 A;  4FUU A;  1XRY A;  2O53 A;  4NGM A;  3TX8 A;  4AXV A;  1ZG8 A;  2CTC A;  2WZN A;  3BI1 A;  3WC7 A;  2O4H A;  2HB6 A;  3RBU A;  4NGT A;  3KR4 A;  5HVH A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...