3VH9A

Crystal structure of aeromonas proteolytica aminopeptidase complexed with 8-quinolinol
Total Genus 116
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
116
sequence length
291
structure length
291
Chain Sequence
MPPITQQATVTAWLPQVDASQITGTISSLESFTNRFYTTTSGAQASDWIASEWQALSASLPNASVKQVSHSGYNQKSVVMTITGSEAPDEWIVIGGHLDSTIGSHTNEQSVAPGADDDASGIAAVTEVIRVLSENNFQPKRSIAFMAYAAEEVGLRGSQDLANQYKSEGKNVVSALQLDMTNYKGSAQDVVFITDYTDSNFTQYLTQLMDEYLPSLTYGFDTCGYACSDHASWHNAGYPAAMPFESKFNDYNPRIHTTQDTLANSDPTGSHAKKFTQLGLAYAIEMGSATG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase/hydrolase inhibitor
molecule keywords Bacterial leucyl aminopeptidase
publication title Potent inhibition of dinuclear zinc(II) peptidase, an aminopeptidase from Aeromonas proteolytica, by 8-quinolinol derivatives: inhibitor design based on Zn(2+) fluorophores, kinetic, and X-ray crystallographic study.
pubmed doi rcsb
total genus 116
structure length 291
sequence length 291
ec nomenclature ec 3.4.11.10: Bacterial leucyl aminopeptidase.
pdb deposition date 2011-08-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF04389 Peptidase_M28 Peptidase family M28
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.630.10 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Zn peptidases 3vh9A00
4MRIA 2C6GA 3D7GA 1Y0YA 1BPMA 3S9NA 1YW4A 2ZEEA 3HUVA 2BCOA 1LAMA 5DS0A 3FMCA 1ELMP 3PB8X 4ONWA 4WJBA 3KZWA 2CF4A 3B7IA 2PJ3A 2ZEPA 2WZNA 4K3NA 2JBJA 4PXCA 2CTBA 5HXDA 5JH9A 3GB0A 3TC8A 1YW6A 4ZX9A 2PRQA 4OC2A 3FEEA 5THWA 4A39A 5K8PA 3HLPA 1Q7LA 3WC7A 1DE4C 4NGMA 3WABA 2QJ8A 1Y7EA 3S9LA 1Z5RA 2ZEGA 1ZG8A 2V77A 3B3TA 3BI1A 3IEHA 2ZEFA 4IHMA 2BOAA 2EWBA 2GREA 5HVGA 1F2OA 3QNVA 4F9UA 4MHPA 2IMOA 1CBXA 2ZEDA 1EE3P 4EWTA 3B3VA 2CTCA 3IWWA 1QQ9A 3D68A 2AFSA 4MMOA 5LYFA 4WWVA 3I1UA 3FVLA 4O23A 3H8EA 4G1PA 1ARLA 4EMEA 2O4HA 4PPZA 3B2YA 4NGPA 2GU2A 2CIJA 1CP6A 4P4EA 4ZY0A 2PVWA 2NYQA 3KASA 3D7FA 3CT9A 4ZX8A 3ISZA 8CPAA 4NFRA 4TWEA 4MHZA 3IC1A 4P4FA 2IJZA 4A37A 5JM6A 5K8MA 4A38A 2Q43A 2C1CA 3GUXA 3VH9A 3L2NA 1RTQA 2GLFA 2PJ4A 3B3WA 4OC4A 1AMPA 3H8FA 2EK8A 2PJ0A 4A94A 3D67A 3GLJA 5K8NA 5I4MA 3PB6X 3WT4A 3VARA 3K2KA 4MCSA 1PYTB 3PRTA 3SJXA 3PB9X 4B6ZA 1IY7A 4IAVA 4MXUA 1F2PA 2JBKA 1YSJA 3FX6A 1CPXA 3KHZA 5HVHA 4UEFA 1LCPA 4H2KA 4DYOA 1AYEA 3T8WA 2VL1A 4W9YA 4F9VA 2ZENA 3KI9A 1M4LA 4P10A 4MCQA 1R43A 2PE3A 3BHXA 5LYLA 3SJFA 4NGQA 2V8GA 3BI0A 4P4BA 3SI0A 1Z2LA 2AFZA 1XBUA 3IFEA 4UF4A 4MCPA 4R8FA 3PFEA 2ZELA 1ZG9A 3N5FA 4DJLA 4FWUA 4RUHA 4ZY2A 2OOTA 3B3CA 4NGRA 3B3SA 1R3NA 2PVVA 2PJBA 1TKHA 4P6YA 5D29A 1XRYA 2XEFA 1ZLIA 3NH8A 1VGYA 1ELLP 1NSAA 3CPXA 3NH4A 2PJ2A 4P44A 4NJQA 4OC5A 4AXVA 4PXDA 2DEAA 2RFHA 1TKFA 1TXRA 2XEGA 5ELYA 4KSIA 1ZG7A 2NSMA 4OP4A 1VHEA 2EK9A 1H8LA 3JRUA 1DTDA 4F8ZA 5IB9A 4ZI6A 4MHNA 2PCUA 2G9DA 2PJ7A 3CDXA 3KHXA 3D7DA 5LRKA 3IIBA 1ARMA 4UIAA 1VHOA 5D8NA 4ZYQA 3CPAA 1FT7A 1BAVA 4Q7AA 4PQAA 3ISXA 3KR5A 4MHYA 2AFXA 4OC1A 2FVGA 2JEWA 2AFWA 1YMEA 3VATA 3MN8A 2QVPA 3D7HA 3PEIA 5JGFA 1HDUA 1CG2A 1BPNA 3RBUA 3PFOA 1FNOA 4R6TA 1CPSA 3KQZA 2PJ1A 1YLOA 4NGTA 5K8OA 2ZOGA 4OMEA 5CBMA 4JYWA 3H8GA 2C6CA 2GLJA 2V8VA 2PJ5A 2IQ6A 3KR4A 3RZAA 4FAIA 2QYVA 3IJ3A 5HVFA 4ZY1A 2PJCA 2ZOFA 4NGSA 4FBEA 4NJRA 4X8IA 4UEZA 3SI1A 3BXMA 4Z65A 4OC3A 1VIXA 4PXBA 1CP7A 3PB7X 2POKA 3SI2A 2XEIA 4UIBA 2ZEMA 6CPAA 2WYRA 1JQGA 3PBEA 4YU9A 1ZLHA 4MCRA 1KWMA 2V8HA 2ZEHA 4BD9A 1TKJA 3DLJA 7CPAA 4P4IA 3S9MA 1XFOA 2BO9A 2OR4A 4OKOA 1TF9A 2RB7A 4NGNA 1IGBA 3WC6A 2PIYA 4OIWA 3FF3A 2PJ6A 3KGQA 1XJOA 3WC5A 4X2TA 2ZEOA 1LFWA 2PIZA 2ABZA 3KQXA 5LRGA 4DUKA 4EFDA 1BLLE 1HEEA 2HC9A 3PB4X 1F57A 3NH5A 2F7VA 3NFZA 3V38A 1QMUA 3LWUA 2Q4ZA 3SJGA 1OBRA 4JZ0A 2O53A 4X3RA 5LYIA 2F8HA 2HB6A 3D66A 4P4JA 1LAPA 2PJAA 3FEDA 2AFMA 2PJ8A 3DGVA 4UEEA 4P45A 2ANPA 1Y0RA 5CPAA 3K9TA 5J1QA 1PCAA 3KL9A 3TX8A 1LOKA 4FUUA 2AFOA 1LANA 4LQGA 4R76A 1CX8A 3FH4A 1XMBA 3FECA 5LRJA 1UWYA 3FJUA 3MRUA 1TF8A 4PXEA 2C6PA 2V8DA 4OIDA 2I3CA 2XEJA 3RAMA 2Q51A 1HDQA 2PJ9A 4TNUA 4R7MA 3V7ZA 1GYTA 4P4DA 4GM5A 4YWYA 3PBBA 4OC0A 3LMSA 3NA6A 3B35A 3IO1A 4CPAA 1Z8LA 2J9AA 3SJEA 2AFUA 5F09A 3D4UA 5LYDA 4IK2A
chains in the Genus database with same CATH superfamily
4MRIA 2C6GA 3LACA 3D7GA 1Y0YA 1BPMA 3SXNA 4CAFA 5ISVA 3S9NA 1YW4A 1Y9KA 2PDOA 1KUYA 1M4GA 4XNHB 2ZXVA 2WPXA 2ZEEA 1XIXA 2I00A 2BCOA 1LAMA 3HUVA 3FMCA 3QAHA 4KLVA 1ELMP 5DS0A 1MJBA 3PB8X 4ONWA 4WJBA 4AVAA 4B10A 3KZWA 4CGPA 3P2FA 3PGPA 4PK2A 2CF4A 3B7IA 4L89A 4UFWA 3TO9A 2PJ3A 2ZEPA 2WZNA 2ODFA 4K30A 2JBJA 4K3NA 5H84A 1BOBA 2Z11A 5F46A 3GY9A 4PXCA 4E2AA 2CTBA 5HXDA 5JH9A 3GB0A 3TC8A 5IX3A 1V0CA 4CAEA 1YW6A 4ZX9A 5I0CA 1QSNA 3K9UA 2PRQA 2JEVA 1Q2YA 4OC2A 3NE7A 3FEEA 4FD4A 4RN7A 5THWA 1M44A 4IUSA 4A39A 2R1IA 5K8PA 3HLPA 1P4NA 2CNTA 5F49A 1Q7LA 2G0BA 3WC7A 1DE4C 4AVBA 4UCPA 2YNCA 5EC4A 4CYOA 4NGMA 3WABA 4CYQA 3KKWA 1LRZA 2QJ8A 5JPHA 1Y7EA 3S9LA 1YQEA 3D8PA 4JLYA 1Z5RA 2ZEGA 4RI1A 2GIVA 3D2MA 1Z9UA 2P6EA 1ZG8A 4HNXB 3SHPA 2V77A 2BEIA 3B3TA 1FY7A 5E96A 3BI1A 3IEHA 2CY2A 1YGHA 2ZEFA 3QAYA 4HPSA 4IHMA 2BOAA 4XPDC 2EWBA 4CYNA 2GREA 4CGMA 3NE8A 4NCZA 5HVGA 1F2OA 3QNVA 4F9UA 4MHPA 3JTKA 2IMOA 1IU8A 1CBXA 2ZEDA 1EE3P 1S3ZA 4EWTA 4FD6A 4HNWB 4YFJA 3B3VA 2CTCA 3IWWA 5G1ZA 5AG7A 1QQ9A 4CAXA 3D68A 2AFSA 4MMOA 5LYFA 2PR8A 4WWVA 3I1UA 3FVLA 3DSBA 4O23A 3H8EA 4G1PA 1ARLA 3ZJ0A 4EMEA 2OH1A 2Z0ZA 2O4HA 2YNEA 4PPZA 3BLNA 4LUAA 3B2YA 5J8CA 4LX9A 4NGPA 2ZW6A 2GU2A 2CIJA 1CP6A 4P4EA 4ZY0A 3CXPA 2I79A 3W6XA 2AJ6A 2B5GA 2PVWA 4FD7A 2NYQA 3R95A 1MK4A 2WSAA 3FIXA 1NE9A 3KASA 3D7FA 3CT9A 4ZX8A 2YNCC 3ISZA 2BSWA 4NFRA 4TWEA 2BL1A 4MHZA 3IC1A 1VHSA 2IJZA 3GKRA 4KORA 2B3VA 4MFPA 3FBUA 4P4FA 4A37A 4C2XA 4A95A 4CGOA 5JM6A 5K8MA 4A38A 2Q43A 2J8MA 2BUEA 2C1CA 3GUXA 4JJXA 5G22A 3VH9A 3IGRA 4M6HA 3L2NA 1RTQA 2GLFA 2PJ4A 1Z4RA 2YNDA 3B3WA 1QSMA 4OC4A 1AMPA 3R1KA 3H8FA 2EK8A 2REEA 3E0KA 4GXHA 1CM0A 2Q04A 4CYPA 2PJ0A 4A94A 3D67A 3GLJA 1S7FA 2GE3A 5K8NA 5A28A 3IU1A 4R57A 3I3GA 5F47A 4XPKA 2Q7BA 4H89A 1X12A 5I4MA 3PB6X 3WT4A 3VARA 2AE6A 4HKFA 4M3SA 3IU2A 3K2KA 1PU9A 1Y7RA 1YLEA 4MCSA 1PYTB 3PRTA 5AGEA 3SJXA 4KOXA 3R96A 3EXNA 3PB9X 4B6ZA 1IOFA 1M4IA 1IY7A 4IAVA 4MXUA 4B14A 1ON0A 4IF5A 2JBKA 1F2PA 3MGDA 1S7KA 2HV2A 2ATRA 4B12A 1YSJA 3FX6A 4KUAA 5KTAA 1RO5A 1CPXA 3KHZA 4AB7A 5HVHA 4UEFA 1LCPA 3CZXA 4H2KA 4DYOA 1AYEA 3B8GA 3H4QA 3I9SA 3T8WA 1Z8TA 3N7ZA 3FRMA 4NSQA 4CRZB 2VL1A 1CJWA 2OB0A 4W9YA 1IYLA 4F9VA 8CPAA 2ZENA 3KI9A 1UFHA 2CXAA 1M4LA 2JDCA 4P10A 2P6GA 2VI7A 1R43A 2PE3A 2PRBA 4KZTA 4MCQA 3S6FA 3BHXA 5LYLA 3SJFA 2WPWA 4KVXA 2Z3PA 4NGQA 1XOVA 2GFQA 2V8GA 4BINA 3BI0A 1QSTA 2FL4A 4P4BA 3TOAA 4E8OA 4KSFA 3DDDA 3GIUA 4PSXA 3SI0A 5JQ4A 1IIDA 4FD5A 1Z2LA 4AVCA 1IB1E 2AFZA 3WR7A 4C7HA 1XBUA 4KOSA 5C88A 2EUIA 4C68A 3IFEA 3IWGA 4MCPA 4R8FA 4UF4A 5J8FA 1RXTA 2FXFA 3PFEA 2ZELA 1ZG9A 1SQHA 3FYNA 3N5FA 4QB9A 4DJLA 1YREA 2Q4YA 4FWUA 4QBJA 2OZHA 4RUHA 3G8WA 4ZY2A 2OOTA 3B3CA 2B4DA 1R3NA 2PVVA 3B3SA 4NGRA 3VWDA 4ZBGA 4A2ZA 4F0YA 2PJBA 1U6MA 1TKHA 4R87A 3LODA 2QECA 4P6YA 5D29A 1XRYA 4JXQA 2XEFA 1ZLIA 1ZO0A 3NH8A 4II9A 1VGYA 4KOTA 1ELLP 1NSAA 3CPXA 4C7IA 1OZPA 3NH4A 2H5MA 2J8NA 2PJ2A 4M6GA 4NJQA 1AUGA 4P44A 4R9MA 4OC5A 1XMTA 1B87A 4AXVA 1YK3A 4PXDA 3TO6A 1R57A 2DEAA 2G3AA 2RFHA 1TKFA 1TXRA 4KOVA 2XEGA 3TT2A 5ELYA 4KSIA 3F5BA 3FB3A 1ZG7A 1Z8XA 2Z3OA 2VQYA 2NSMA 4OP4A 2A4NA 1VHEA 4KS9A 2EK9A 1H8LA 3JRUA 1IYKA 1DTDA 4C2YA 2F5IA 2OU2A 2PC1A 4F8ZA 5KTCA 1A2ZA 2B5GB 2DPTA 4UFXA 5IB9A 3H5ZA 2QMLA 1BO4A 4XPLA 3GYAA 4ZI6A 2FSRA 2VZYA 2IL4A 4MHNA 2PCUA 2OZUA 2G9DA 4B13A 5DWMA 4CGLA 4UWIA 2PJ7A 4UCMA 2JLMA 3CDXA 2FS5A 5IV0A 4H6ZA 3KHXA 4J3GA 4NEXA 1M4DA 3D7DA 4Q36A 1VKCA 5LRKA 3IIBA 1ARMA 4R3LA 1VHOA 4UIAA 5D8NA 3CPAA 4ZYQA 4E0AA 3EC4A 1FT7A 2J8RA 2FCKA 2HQYA 4CAWA 1BAVA 4H6UA 4Q7AA 4PQAA 3S6HA 1XE4A 3ISXA 1NMTA 5EMIA 4A32A 4BBHA 3KR5A 4U5YA 2Z3LA 1IOIA 4MHYA 2EO8A 2HUZA 2AFXA 4A30A 4OC1A 2X7BA 2FVGA 5KTDA 2JEWA 4U9ZA 2AFWA 1YMEA 3VATA 1KZFA 3MN8A 4B5PA 2QVPA 5BWAB 4KUBA 3D7HA 3PEIA 5JGFA 1HDUA 2JDDA 1B6BA 5EBVA 4C2ZA 3BJ7A 1CG2A 1BPNA 4MFLA 5GCNA 3RBUA 4AG9A 3F8KA 2REFA 1I21A 4JWPA 4OAEA 3LD2A 4CRYB 1KUXA 3BJ8A 5G21A 3PFOA 1FNOA 4MJ8A 4R6TA 1CPSA 3KQZA 2KCWA 4NXYA 3UY5A 2PJ1A 4XPDB 3IWEA 4MFKA 4A31A 4F6AA 2D4OA 1YLOA 4UA3A 5C82A 4NGTA 1GHEA 2ZOGA 4MFZA 5K8OA 4QVTA 2FT0A 4OMEA 5CBMA 4JYWA 3H8GA 2CNMA 4ORFA 4KLWA 2C6CA 2GLJA 2V8VA 4HNYB 2PJ5A 3OWCA 2VEZA 2IQ6A 2VBQA 3KR4A 3RZAA 4FAIA 2QYVA 5H86A 3IJ3A 4PV6A 5HVFA 2VZZA 3TFYA 4ZY1A 2PJCA 1PUAA 2FE7A 2ZOFA 4KOYA 4QC6A 4NGSA 4FBEA 4MFJA 1JWQA 4NJRA 5AG6A 4ZGYB 2Z3MA 5FVJA 2Z3KA 4ONUA 3EO4A 1X10A 4X8IA 4UEZA 3TE4A 4R3KA 2YGWA 3BXMA 3SI1A 4OC3A 4UFVA 4Z65A 3G3SA 2B4DB 2FIAA 1VIXA 3PP9A 4KVOE 4PXBA 4B11A 1CP7A 4OLLA 3PB7X 2POKA 3SI2A 2XEIA 1YX0A 4UIBA 2ZEMA 6CPAA 2WYRA 4QUSA 5HMNA 1JQGA 3PBEA 5IB0A 4MI4A 4YU9A 1ZLHA 4MCRA 2D4PA 2PR1A 5F48A 4MHDA 1KWMA 2V8HA 2ZEHA 3EY5A 4BD9A 1TKJA 2P0WA 3DLJA 1P0HA 7CPAA 2DPSA 2NMTA 1I1DA 4P4IA 4MFQA 3S9MA 1XFOA 2BO9A 2DXQA 2P6FA 2OR4A 4OKOA 4YRHA 1TF9A 3P2HA 1XF8A 2RB7A 3PZJA 4NGNA 1IGBA 3D2PA 1I12A 3TTHA 3WC6A 3ZZIA 2PIYA 3T90A 3EFAA 3D3SA 3FF3A 4OIWA 4CS0B 3JUWA 5AG5A 2PJ6A 2DF5A 3KGQA 1XJOA 4PK3A 2R8VA 1MJ9A 4X2TA 3WC5A 4UWJA 3TCVA 2G3TA 2ZEOA 4I49A 1LFWA 2GANA 1YR0A 2PIZA 4F0XA 1NSLA 4Y49C 2ABZA 3KQXA 3R9EA 5CNPA 5LRGA 4DUKA 2R7HA 4EFDA 4L8AA 2RC4A 1QSOA 2B4BA 1BLLE 4MBUA 2CNSA 3RNZA 3DNSA 1HEEA 2K5TA 2HC9A 2O28A 3PB4X 4RS2A 3C26A 1KUVA 4KOWA 4XNHC 5LYDA 1F57A 4GS4A 4KSAA 1QSRA 1Q2DA 2PQ8A 2F7VA 3NFZA 3NH5A 4YGOA 4UBRA 3V38A 3VWEA 4CAVA 2VXKA 1L0CA 4NF1A 3R9FA 1QMUA 4KVME 3LWUA 2Q4ZA 4BMHA 3SJGA 1OBRA 2OZGA 1WWZA 4JZ0A 3QB8A 3S6KA 3SXOA 4DNCA 2O53A 1Z4EA 4X5KA 4X3RA 5LYIA 2Q0YA 2F8HA 4LQ6A 2EBJA 2HB6A 3D66A 2Q44A 2Y0MA 4M6IA 4P4JA 4B5PB 1LAPA 2ZW5A 2PJAA 2ARHA 3FEDA 3DR6A 2AFMA 2PJ8A 3DGVA 2ZPAA 4UEEA 1YVKA 3W91A 2FIWA 2Q7SA 2WUUA 3V8IA 4M85A 4P45A 2ANPA 2Z3NA 1N71A 1XEBA 2PSWA 4Q38A 1Y0RA 1MJAA 1Q2CA 3K9TA 1IICA 3A9LA 5CPAA 5HH1A 1PCAA 3KL9A 3TX8A 5J1QA 5G20A 2EVNA 3TOBA 3CXSA 4A33A 1LOKA 4FUUA 1S5KA 2AFOA 1LANA 1TIQA 3F0AA 4LQGA 4U9YA 5DWNA 4R76A 3JVNA 1CX8A 3FH4A 4MY0A 4JD6A 1XMBA 2ZW7A 1S7NA 3FECA 3S6GA 5LRJA 4JXRA 1S60A 3FXTA 3RO0A 1UWYA 2Z10A 3FJUA 3MRUA 4UCNA 1Z8WA 1J4JA 1TF8A 3FNCA 4MY3A 4PXEA 1WK4A 2C6PA 4OADA 3RYOA 4AG7A 2V8DA 4OIDA 2I3CA 2R98A 4KOUA 2XEJA 3RAMA 4B5OA 2Q51A 3TO7A 1HDQA 2PJ9A 4TNUA 3R9GA 4R7MA 4EVYA 1Y9WA 3V7ZA 1GYTA 2ZW4A 4P4DA 4GM5A 3W6SA 4YWYA 1YVOA 3PBBA 3DR8A 4OC0A 3T9YA 2C27A 3LMSA 2B58A 3B35A 3IO1A 3NA6A 4CPAA 1Z8LA 1K4JA 1M1DA 2QIRA 2J9AA 5AG4A 4PSWA 3CXQA 3SJEA 4Y49B 2AFUA 2B3UA 5A27A 5F09A 3D4UA 2Q4VA 4CGNA 1S7LA 4IK2A
chains in the Genus database with same CATH topology
4MRIA 2C6GA 3D7GA 1Y0YA 1BPMA 3S9NA 1YW4A 2ZEEA 3HUVA 2BCOA 1LAMA 5DS0A 3FMCA 1ELMP 3PB8X 4ONWA 4WJBA 3KZWA 2CF4A 3B7IA 2PJ3A 2ZEPA 2WZNA 4K3NA 2JBJA 4PXCA 2CTBA 5HXDA 5JH9A 3GB0A 3TC8A 1YW6A 4ZX9A 2PRQA 4OC2A 3FEEA 5THWA 4A39A 5K8PA 3HLPA 1Q7LA 3WC7A 1DE4C 4NGMA 3WABA 2QJ8A 1Y7EA 3S9LA 1Z5RA 2ZEGA 1ZG8A 2V77A 3B3TA 3BI1A 3IEHA 2ZEFA 4IHMA 2BOAA 2EWBA 2GREA 5HVGA 1F2OA 3QNVA 4F9UA 4MHPA 2IMOA 1CBXA 2ZEDA 1EE3P 4EWTA 3B3VA 2CTCA 3IWWA 1QQ9A 3D68A 2AFSA 4MMOA 5LYFA 4WWVA 3I1UA 3FVLA 4O23A 3H8EA 4G1PA 1ARLA 4EMEA 2O4HA 4PPZA 3B2YA 4NGPA 2GU2A 2CIJA 1CP6A 4P4EA 4ZY0A 2PVWA 2NYQA 3KASA 3D7FA 3CT9A 4ZX8A 3ISZA 8CPAA 4NFRA 4TWEA 4MHZA 3IC1A 4P4FA 2IJZA 4A37A 5JM6A 5K8MA 4A38A 2Q43A 2C1CA 3GUXA 3VH9A 3L2NA 1RTQA 2GLFA 2PJ4A 3B3WA 4OC4A 1AMPA 3H8FA 2EK8A 2PJ0A 4A94A 3D67A 3GLJA 5K8NA 5I4MA 3PB6X 3WT4A 3VARA 3K2KA 4MCSA 1PYTB 3PRTA 3SJXA 3PB9X 4B6ZA 1IY7A 4IAVA 4MXUA 1F2PA 2JBKA 1YSJA 3FX6A 1CPXA 3KHZA 5HVHA 4UEFA 1LCPA 4H2KA 4DYOA 1AYEA 3T8WA 2VL1A 4W9YA 4F9VA 2ZENA 3KI9A 1M4LA 4P10A 4MCQA 1R43A 2PE3A 3BHXA 5LYLA 3SJFA 4NGQA 2V8GA 3BI0A 4P4BA 3SI0A 1Z2LA 2AFZA 1XBUA 3IFEA 4UF4A 4MCPA 4R8FA 3PFEA 2ZELA 1ZG9A 3N5FA 4DJLA 4FWUA 4RUHA 4ZY2A 2OOTA 3B3CA 4NGRA 3B3SA 1R3NA 2PVVA 2PJBA 1TKHA 4P6YA 5D29A 1XRYA 2XEFA 1ZLIA 3NH8A 1VGYA 1ELLP 1NSAA 3CPXA 3NH4A 2PJ2A 4P44A 4NJQA 4OC5A 4AXVA 4PXDA 2DEAA 2RFHA 1TKFA 1TXRA 2XEGA 5ELYA 4KSIA 1ZG7A 2NSMA 4OP4A 1VHEA 2EK9A 1H8LA 3JRUA 1DTDA 4F8ZA 5IB9A 4ZI6A 4MHNA 2PCUA 2G9DA 2PJ7A 3CDXA 3KHXA 3D7DA 5LRKA 3IIBA 1ARMA 4UIAA 1VHOA 5D8NA 4ZYQA 3CPAA 1FT7A 1BAVA 4Q7AA 4PQAA 3ISXA 3KR5A 4MHYA 2AFXA 4OC1A 2FVGA 2JEWA 2AFWA 1YMEA 3VATA 3MN8A 2QVPA 3D7HA 3PEIA 5JGFA 1HDUA 1CG2A 1BPNA 3RBUA 3PFOA 1FNOA 4R6TA 1CPSA 3KQZA 2PJ1A 1YLOA 4NGTA 5K8OA 2ZOGA 4OMEA 5CBMA 4JYWA 3H8GA 2C6CA 2GLJA 2V8VA 2PJ5A 2IQ6A 3KR4A 3RZAA 4FAIA 2QYVA 3IJ3A 5HVFA 4ZY1A 2PJCA 2ZOFA 4NGSA 4FBEA 4NJRA 4X8IA 4UEZA 3SI1A 3BXMA 4Z65A 4OC3A 1VIXA 4PXBA 1CP7A 3PB7X 2POKA 3SI2A 2XEIA 4UIBA 2ZEMA 6CPAA 2WYRA 1JQGA 3PBEA 4YU9A 1ZLHA 4MCRA 1KWMA 2V8HA 2ZEHA 4BD9A 1TKJA 3DLJA 7CPAA 4P4IA 3S9MA 1XFOA 2BO9A 2OR4A 4OKOA 1TF9A 2RB7A 4NGNA 1IGBA 3WC6A 2PIYA 4OIWA 3FF3A 2PJ6A 3KGQA 1XJOA 3WC5A 4X2TA 2ZEOA 1LFWA 2PIZA 2ABZA 3KQXA 5LRGA 4DUKA 4EFDA 1BLLE 1HEEA 2HC9A 3PB4X 1F57A 3NH5A 2F7VA 3NFZA 3V38A 1QMUA 3LWUA 2Q4ZA 3SJGA 1OBRA 4JZ0A 2O53A 4X3RA 5LYIA 2F8HA 2HB6A 3D66A 4P4JA 1LAPA 2PJAA 3FEDA 2AFMA 2PJ8A 3DGVA 4UEEA 4P45A 2ANPA 1Y0RA 5CPAA 3K9TA 5J1QA 1PCAA 3KL9A 3TX8A 1LOKA 4FUUA 2AFOA 1LANA 4LQGA 4R76A 1CX8A 3FH4A 1XMBA 3FECA 5LRJA 1UWYA 3FJUA 3MRUA 1TF8A 4PXEA 2C6PA 2V8DA 4OIDA 2I3CA 2XEJA 3RAMA 2Q51A 1HDQA 2PJ9A 4TNUA 4R7MA 3V7ZA 1GYTA 4P4DA 4GM5A 4YWYA 3PBBA 4OC0A 3LMSA 3NA6A 3B35A 3IO1A 4CPAA 1Z8LA 2J9AA 3SJEA 2AFUA 5F09A 3D4UA 5LYDA 4IK2A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4MRI A;  2C6G A;  3D7G A;  1Y0Y A;  1BPM A;  3S9N A;  1YW4 A;  2ZEE A;  3HUV A;  2BCO A;  1LAM A;  5DS0 A;  3FMC A;  1ELM P;  3PB8 X;  4ONW A;  4WJB A;  3KZW A;  2CF4 A;  3B7I A;  2PJ3 A;  2ZEP A;  2WZN A;  4K3N A;  2JBJ A;  4PXC A;  2CTB A;  5HXD A;  5JH9 A;  3GB0 A;  3TC8 A;  1YW6 A;  4ZX9 A;  2PRQ A;  4OC2 A;  3FEE A;  5THW A;  4A39 A;  5K8P A;  3HLP A;  1Q7L A;  3WC7 A;  1DE4 C;  4NGM A;  3WAB A;  2QJ8 A;  1Y7E A;  3S9L A;  1Z5R A;  2ZEG A;  1ZG8 A;  2V77 A;  3B3T A;  3BI1 A;  3IEH A;  2ZEF A;  4IHM A;  2BOA A;  2EWB A;  2GRE A;  5HVG A;  1F2O A;  3QNV A;  4F9U A;  4MHP A;  2IMO A;  1CBX A;  2ZED A;  1EE3 P;  4EWT A;  3B3V A;  2CTC A;  3IWW A;  1QQ9 A;  3D68 A;  2AFS A;  4MMO A;  5LYF A;  4WWV A;  3I1U A;  3FVL A;  4O23 A;  3H8E A;  4G1P A;  1ARL A;  4EME A;  2O4H A;  4PPZ A;  3B2Y A;  4NGP A;  2GU2 A;  2CIJ A;  1CP6 A;  4P4E A;  4ZY0 A;  2PVW A;  2NYQ A;  3KAS A;  3D7F A;  3CT9 A;  4ZX8 A;  3ISZ A;  8CPA A;  4NFR A;  4TWE A;  4MHZ A;  3IC1 A;  4P4F A;  2IJZ A;  4A37 A;  5JM6 A;  5K8M A;  4A38 A;  2Q43 A;  2C1C A;  3GUX A;  3VH9 A;  3L2N A;  1RTQ A;  2GLF A;  2PJ4 A;  3B3W A;  4OC4 A;  1AMP A;  3H8F A;  2EK8 A;  2PJ0 A;  4A94 A;  3D67 A;  3GLJ A;  5K8N A;  5I4M A;  3PB6 X;  3WT4 A;  3VAR A;  3K2K A;  4MCS A;  1PYT B;  3PRT A;  3SJX A;  3PB9 X;  4B6Z A;  1IY7 A;  4IAV A;  4MXU A;  1F2P A;  2JBK A;  1YSJ A;  3FX6 A;  1CPX A;  3KHZ A;  5HVH A;  4UEF A;  1LCP A;  4H2K A;  4DYO A;  1AYE A;  3T8W A;  2VL1 A;  4W9Y A;  4F9V A;  2ZEN A;  3KI9 A;  1M4L A;  4P10 A;  4MCQ A;  1R43 A;  2PE3 A;  3BHX A;  5LYL A;  3SJF A;  4NGQ A;  2V8G A;  3BI0 A;  4P4B A;  3SI0 A;  1Z2L A;  2AFZ A;  1XBU A;  3IFE A;  4UF4 A;  4MCP A;  4R8F A;  3PFE A;  2ZEL A;  1ZG9 A;  3N5F A;  4DJL A;  4FWU A;  4RUH A;  4ZY2 A;  2OOT A;  3B3C A;  4NGR A;  3B3S A;  1R3N A;  2PVV A;  2PJB A;  1TKH A;  4P6Y A;  5D29 A;  1XRY A;  2XEF A;  1ZLI A;  3NH8 A;  1VGY A;  1ELL P;  1NSA A;  3CPX A;  3NH4 A;  2PJ2 A;  4P44 A;  4NJQ A;  4OC5 A;  4AXV A;  4PXD A;  2DEA A;  2RFH A;  1TKF A;  1TXR A;  2XEG A;  5ELY A;  4KSI A;  1ZG7 A;  2NSM A;  4OP4 A;  1VHE A;  2EK9 A;  1H8L A;  3JRU A;  1DTD A;  4F8Z A;  5IB9 A;  4ZI6 A;  4MHN A;  2PCU A;  2G9D A;  2PJ7 A;  3CDX A;  3KHX A;  3D7D A;  5LRK A;  3IIB A;  1ARM A;  4UIA A;  1VHO A;  5D8N A;  4ZYQ A;  3CPA A;  1FT7 A;  1BAV A;  4Q7A A;  4PQA A;  3ISX A;  3KR5 A;  4MHY A;  2AFX A;  4OC1 A;  2FVG A;  2JEW A;  2AFW A;  1YME A;  3VAT A;  3MN8 A;  2QVP A;  3D7H A;  3PEI A;  5JGF A;  1HDU A;  1CG2 A;  1BPN A;  3RBU A;  3PFO A;  1FNO A;  4R6T A;  1CPS A;  3KQZ A;  2PJ1 A;  1YLO A;  4NGT A;  5K8O A;  2ZOG A;  4OME A;  5CBM A;  4JYW A;  3H8G A;  2C6C A;  2GLJ A;  2V8V A;  2PJ5 A;  2IQ6 A;  3KR4 A;  3RZA A;  4FAI A;  2QYV A;  3IJ3 A;  5HVF A;  4ZY1 A;  2PJC A;  2ZOF A;  4NGS A;  4FBE A;  4NJR A;  4X8I A;  4UEZ A;  3SI1 A;  3BXM A;  4Z65 A;  4OC3 A;  1VIX A;  4PXB A;  1CP7 A;  3PB7 X;  2POK A;  3SI2 A;  2XEI A;  4UIB A;  2ZEM A;  6CPA A;  2WYR A;  1JQG A;  3PBE A;  4YU9 A;  1ZLH A;  4MCR A;  1KWM A;  2V8H A;  2ZEH A;  4BD9 A;  1TKJ A;  3DLJ A;  7CPA A;  4P4I A;  3S9M A;  1XFO A;  2BO9 A;  2OR4 A;  4OKO A;  1TF9 A;  2RB7 A;  4NGN A;  1IGB A;  3WC6 A;  2PIY A;  4OIW A;  3FF3 A;  2PJ6 A;  3KGQ A;  1XJO A;  3WC5 A;  4X2T A;  2ZEO A;  1LFW A;  2PIZ A;  2ABZ A;  3KQX A;  5LRG A;  4DUK A;  4EFD A;  1BLL E;  1HEE A;  2HC9 A;  3PB4 X;  1F57 A;  3NH5 A;  2F7V A;  3NFZ A;  3V38 A;  1QMU A;  3LWU A;  2Q4Z A;  3SJG A;  1OBR A;  4JZ0 A;  2O53 A;  4X3R A;  5LYI A;  2F8H A;  2HB6 A;  3D66 A;  4P4J A;  1LAP A;  2PJA A;  3FED A;  2AFM A;  2PJ8 A;  3DGV A;  4UEE A;  4P45 A;  2ANP A;  1Y0R A;  5CPA A;  3K9T A;  5J1Q A;  1PCA A;  3KL9 A;  3TX8 A;  1LOK A;  4FUU A;  2AFO A;  1LAN A;  4LQG A;  4R76 A;  1CX8 A;  3FH4 A;  1XMB A;  3FEC A;  5LRJ A;  1UWY A;  3FJU A;  3MRU A;  1TF8 A;  4PXE A;  2C6P A;  2V8D A;  4OID A;  2I3C A;  2XEJ A;  3RAM A;  2Q51 A;  1HDQ A;  2PJ9 A;  4TNU A;  4R7M A;  3V7Z A;  1GYT A;  4P4D A;  4GM5 A;  4YWY A;  3PBB A;  4OC0 A;  3LMS A;  3NA6 A;  3B35 A;  3IO1 A;  4CPA A;  1Z8L A;  2J9A A;  3SJE A;  2AFU A;  5F09 A;  3D4U A;  5LYD A;  4IK2 A; 
#chains in the Genus database with same CATH topology
 4MRI A;  2C6G A;  3LAC A;  3D7G A;  1Y0Y A;  1BPM A;  3SXN A;  4CAF A;  5ISV A;  3S9N A;  1YW4 A;  1Y9K A;  2PDO A;  1KUY A;  1M4G A;  4XNH B;  2ZXV A;  2WPX A;  2ZEE A;  1XIX A;  2I00 A;  2BCO A;  1LAM A;  3HUV A;  3FMC A;  3QAH A;  4KLV A;  1ELM P;  5DS0 A;  1MJB A;  3PB8 X;  4ONW A;  4WJB A;  4AVA A;  4B10 A;  3KZW A;  4CGP A;  3P2F A;  3PGP A;  4PK2 A;  2CF4 A;  3B7I A;  4L89 A;  4UFW A;  3TO9 A;  2PJ3 A;  2ZEP A;  2WZN A;  2ODF A;  4K30 A;  2JBJ A;  4K3N A;  5H84 A;  1BOB A;  2Z11 A;  5F46 A;  3GY9 A;  4PXC A;  4E2A A;  2CTB A;  5HXD A;  5JH9 A;  3GB0 A;  3TC8 A;  5IX3 A;  1V0C A;  4CAE A;  1YW6 A;  4ZX9 A;  5I0C A;  1QSN A;  3K9U A;  2PRQ A;  2JEV A;  1Q2Y A;  4OC2 A;  3NE7 A;  3FEE A;  4FD4 A;  4RN7 A;  5THW A;  1M44 A;  4IUS A;  4A39 A;  2R1I A;  5K8P A;  3HLP A;  1P4N A;  2CNT A;  5F49 A;  1Q7L A;  2G0B A;  3WC7 A;  1DE4 C;  4AVB A;  4UCP A;  2YNC A;  5EC4 A;  4CYO A;  4NGM A;  3WAB A;  4CYQ A;  3KKW A;  1LRZ A;  2QJ8 A;  5JPH A;  1Y7E A;  3S9L A;  1YQE A;  3D8P A;  4JLY A;  1Z5R A;  2ZEG A;  4RI1 A;  2GIV A;  3D2M A;  1Z9U A;  2P6E A;  1ZG8 A;  4HNX B;  3SHP A;  2V77 A;  2BEI A;  3B3T A;  1FY7 A;  5E96 A;  3BI1 A;  3IEH A;  2CY2 A;  1YGH A;  2ZEF A;  3QAY A;  4HPS A;  4IHM A;  2BOA A;  4XPD C;  2EWB A;  4CYN A;  2GRE A;  4CGM A;  3NE8 A;  4NCZ A;  5HVG A;  1F2O A;  3QNV A;  4F9U A;  4MHP A;  3JTK A;  2IMO A;  1IU8 A;  1CBX A;  2ZED A;  1EE3 P;  1S3Z A;  4EWT A;  4FD6 A;  4HNW B;  4YFJ A;  3B3V A;  2CTC A;  3IWW A;  5G1Z A;  5AG7 A;  1QQ9 A;  4CAX A;  3D68 A;  2AFS A;  4MMO A;  5LYF A;  2PR8 A;  4WWV A;  3I1U A;  3FVL A;  3DSB A;  4O23 A;  3H8E A;  4G1P A;  1ARL A;  3ZJ0 A;  4EME A;  2OH1 A;  2Z0Z A;  2O4H A;  2YNE A;  4PPZ A;  3BLN A;  4LUA A;  3B2Y A;  5J8C A;  4LX9 A;  4NGP A;  2ZW6 A;  2GU2 A;  2CIJ A;  1CP6 A;  4P4E A;  4ZY0 A;  3CXP A;  2I79 A;  3W6X A;  2AJ6 A;  2B5G A;  2PVW A;  4FD7 A;  2NYQ A;  3R95 A;  1MK4 A;  2WSA A;  3FIX A;  1NE9 A;  3KAS A;  3D7F A;  3CT9 A;  4ZX8 A;  2YNC C;  3ISZ A;  2BSW A;  4NFR A;  4TWE A;  2BL1 A;  4MHZ A;  3IC1 A;  1VHS A;  2IJZ A;  3GKR A;  4KOR A;  2B3V A;  4MFP A;  3FBU A;  4P4F A;  4A37 A;  4C2X A;  4A95 A;  4CGO A;  5JM6 A;  5K8M A;  4A38 A;  2Q43 A;  2J8M A;  2BUE A;  2C1C A;  3GUX A;  4JJX A;  5G22 A;  3VH9 A;  3IGR A;  4M6H A;  3L2N A;  1RTQ A;  2GLF A;  2PJ4 A;  1Z4R A;  2YND A;  3B3W A;  1QSM A;  4OC4 A;  1AMP A;  3R1K A;  3H8F A;  2EK8 A;  2REE A;  3E0K A;  4GXH A;  1CM0 A;  2Q04 A;  4CYP A;  2PJ0 A;  4A94 A;  3D67 A;  3GLJ A;  1S7F A;  2GE3 A;  5K8N A;  5A28 A;  3IU1 A;  4R57 A;  3I3G A;  5F47 A;  4XPK A;  2Q7B A;  4H89 A;  1X12 A;  5I4M A;  3PB6 X;  3WT4 A;  3VAR A;  2AE6 A;  4HKF A;  4M3S A;  3IU2 A;  3K2K A;  1PU9 A;  1Y7R A;  1YLE A;  4MCS A;  1PYT B;  3PRT A;  5AGE A;  3SJX A;  4KOX A;  3R96 A;  3EXN A;  3PB9 X;  4B6Z A;  1IOF A;  1M4I A;  1IY7 A;  4IAV A;  4MXU A;  4B14 A;  1ON0 A;  4IF5 A;  2JBK A;  1F2P A;  3MGD A;  1S7K A;  2HV2 A;  2ATR A;  4B12 A;  1YSJ A;  3FX6 A;  4KUA A;  5KTA A;  1RO5 A;  1CPX A;  3KHZ A;  4AB7 A;  5HVH A;  4UEF A;  1LCP A;  3CZX A;  4H2K A;  4DYO A;  1AYE A;  3B8G A;  3H4Q A;  3I9S A;  3T8W A;  1Z8T A;  3N7Z A;  3FRM A;  4NSQ A;  4CRZ B;  2VL1 A;  1CJW A;  2OB0 A;  4W9Y A;  1IYL A;  4F9V A;  8CPA A;  2ZEN A;  3KI9 A;  1UFH A;  2CXA A;  1M4L A;  2JDC A;  4P10 A;  2P6G A;  2VI7 A;  1R43 A;  2PE3 A;  2PRB A;  4KZT A;  4MCQ A;  3S6F A;  3BHX A;  5LYL A;  3SJF A;  2WPW A;  4KVX A;  2Z3P A;  4NGQ A;  1XOV A;  2GFQ A;  2V8G A;  4BIN A;  3BI0 A;  1QST A;  2FL4 A;  4P4B A;  3TOA A;  4E8O A;  4KSF A;  3DDD A;  3GIU A;  4PSX A;  3SI0 A;  5JQ4 A;  1IID A;  4FD5 A;  1Z2L A;  4AVC A;  1IB1 E;  2AFZ A;  3WR7 A;  4C7H A;  1XBU A;  4KOS A;  5C88 A;  2EUI A;  4C68 A;  3IFE A;  3IWG A;  4MCP A;  4R8F A;  4UF4 A;  5J8F A;  1RXT A;  2FXF A;  3PFE A;  2ZEL A;  1ZG9 A;  1SQH A;  3FYN A;  3N5F A;  4QB9 A;  4DJL A;  1YRE A;  2Q4Y A;  4FWU A;  4QBJ A;  2OZH A;  4RUH A;  3G8W A;  4ZY2 A;  2OOT A;  3B3C A;  2B4D A;  1R3N A;  2PVV A;  3B3S A;  4NGR A;  3VWD A;  4ZBG A;  4A2Z A;  4F0Y A;  2PJB A;  1U6M A;  1TKH A;  4R87 A;  3LOD A;  2QEC A;  4P6Y A;  5D29 A;  1XRY A;  4JXQ A;  2XEF A;  1ZLI A;  1ZO0 A;  3NH8 A;  4II9 A;  1VGY A;  4KOT A;  1ELL P;  1NSA A;  3CPX A;  4C7I A;  1OZP A;  3NH4 A;  2H5M A;  2J8N A;  2PJ2 A;  4M6G A;  4NJQ A;  1AUG A;  4P44 A;  4R9M A;  4OC5 A;  1XMT A;  1B87 A;  4AXV A;  1YK3 A;  4PXD A;  3TO6 A;  1R57 A;  2DEA A;  2G3A A;  2RFH A;  1TKF A;  1TXR A;  4KOV A;  2XEG A;  3TT2 A;  5ELY A;  4KSI A;  3F5B A;  3FB3 A;  1ZG7 A;  1Z8X A;  2Z3O A;  2VQY A;  2NSM A;  4OP4 A;  2A4N A;  1VHE A;  4KS9 A;  2EK9 A;  1H8L A;  3JRU A;  1IYK A;  1DTD A;  4C2Y A;  2F5I A;  2OU2 A;  2PC1 A;  4F8Z A;  5KTC A;  1A2Z A;  2B5G B;  2DPT A;  4UFX A;  5IB9 A;  3H5Z A;  2QML A;  1BO4 A;  4XPL A;  3GYA A;  4ZI6 A;  2FSR A;  2VZY A;  2IL4 A;  4MHN A;  2PCU A;  2OZU A;  2G9D A;  4B13 A;  5DWM A;  4CGL A;  4UWI A;  2PJ7 A;  4UCM A;  2JLM A;  3CDX A;  2FS5 A;  5IV0 A;  4H6Z A;  3KHX A;  4J3G A;  4NEX A;  1M4D A;  3D7D A;  4Q36 A;  1VKC A;  5LRK A;  3IIB A;  1ARM A;  4R3L A;  1VHO A;  4UIA A;  5D8N A;  3CPA A;  4ZYQ A;  4E0A A;  3EC4 A;  1FT7 A;  2J8R A;  2FCK A;  2HQY A;  4CAW A;  1BAV A;  4H6U A;  4Q7A A;  4PQA A;  3S6H A;  1XE4 A;  3ISX A;  1NMT A;  5EMI A;  4A32 A;  4BBH A;  3KR5 A;  4U5Y A;  2Z3L A;  1IOI A;  4MHY A;  2EO8 A;  2HUZ A;  2AFX A;  4A30 A;  4OC1 A;  2X7B A;  2FVG A;  5KTD A;  2JEW A;  4U9Z A;  2AFW A;  1YME A;  3VAT A;  1KZF A;  3MN8 A;  4B5P A;  2QVP A;  5BWA B;  4KUB A;  3D7H A;  3PEI A;  5JGF A;  1HDU A;  2JDD A;  1B6B A;  5EBV A;  4C2Z A;  3BJ7 A;  1CG2 A;  1BPN A;  4MFL A;  5GCN A;  3RBU A;  4AG9 A;  3F8K A;  2REF A;  1I21 A;  4JWP A;  4OAE A;  3LD2 A;  4CRY B;  1KUX A;  3BJ8 A;  5G21 A;  3PFO A;  1FNO A;  4MJ8 A;  4R6T A;  1CPS A;  3KQZ A;  2KCW A;  4NXY A;  3UY5 A;  2PJ1 A;  4XPD B;  3IWE A;  4MFK A;  4A31 A;  4F6A A;  2D4O A;  1YLO A;  4UA3 A;  5C82 A;  4NGT A;  1GHE A;  2ZOG A;  4MFZ A;  5K8O A;  4QVT A;  2FT0 A;  4OME A;  5CBM A;  4JYW A;  3H8G A;  2CNM A;  4ORF A;  4KLW A;  2C6C A;  2GLJ A;  2V8V A;  4HNY B;  2PJ5 A;  3OWC A;  2VEZ A;  2IQ6 A;  2VBQ A;  3KR4 A;  3RZA A;  4FAI A;  2QYV A;  5H86 A;  3IJ3 A;  4PV6 A;  5HVF A;  2VZZ A;  3TFY A;  4ZY1 A;  2PJC A;  1PUA A;  2FE7 A;  2ZOF A;  4KOY A;  4QC6 A;  4NGS A;  4FBE A;  4MFJ A;  1JWQ A;  4NJR A;  5AG6 A;  4ZGY B;  2Z3M A;  5FVJ A;  2Z3K A;  4ONU A;  3EO4 A;  1X10 A;  4X8I A;  4UEZ A;  3TE4 A;  4R3K A;  2YGW A;  3BXM A;  3SI1 A;  4OC3 A;  4UFV A;  4Z65 A;  3G3S A;  2B4D B;  2FIA A;  1VIX A;  3PP9 A;  4KVO E;  4PXB A;  4B11 A;  1CP7 A;  4OLL A;  3PB7 X;  2POK A;  3SI2 A;  2XEI A;  1YX0 A;  4UIB A;  2ZEM A;  6CPA A;  2WYR A;  4QUS A;  5HMN A;  1JQG A;  3PBE A;  5IB0 A;  4MI4 A;  4YU9 A;  1ZLH A;  4MCR A;  2D4P A;  2PR1 A;  5F48 A;  4MHD A;  1KWM A;  2V8H A;  2ZEH A;  3EY5 A;  4BD9 A;  1TKJ A;  2P0W A;  3DLJ A;  1P0H A;  7CPA A;  2DPS A;  2NMT A;  1I1D A;  4P4I A;  4MFQ A;  3S9M A;  1XFO A;  2BO9 A;  2DXQ A;  2P6F A;  2OR4 A;  4OKO A;  4YRH A;  1TF9 A;  3P2H A;  1XF8 A;  2RB7 A;  3PZJ A;  4NGN A;  1IGB A;  3D2P A;  1I12 A;  3TTH A;  3WC6 A;  3ZZI A;  2PIY A;  3T90 A;  3EFA A;  3D3S A;  3FF3 A;  4OIW A;  4CS0 B;  3JUW A;  5AG5 A;  2PJ6 A;  2DF5 A;  3KGQ A;  1XJO A;  4PK3 A;  2R8V A;  1MJ9 A;  4X2T A;  3WC5 A;  4UWJ A;  3TCV A;  2G3T A;  2ZEO A;  4I49 A;  1LFW A;  2GAN A;  1YR0 A;  2PIZ A;  4F0X A;  1NSL A;  4Y49 C;  2ABZ A;  3KQX A;  3R9E A;  5CNP A;  5LRG A;  4DUK A;  2R7H A;  4EFD A;  4L8A A;  2RC4 A;  1QSO A;  2B4B A;  1BLL E;  4MBU A;  2CNS A;  3RNZ A;  3DNS A;  1HEE A;  2K5T A;  2HC9 A;  2O28 A;  3PB4 X;  4RS2 A;  3C26 A;  1KUV A;  4KOW A;  4XNH C;  5LYD A;  1F57 A;  4GS4 A;  4KSA A;  1QSR A;  1Q2D A;  2PQ8 A;  2F7V A;  3NFZ A;  3NH5 A;  4YGO A;  4UBR A;  3V38 A;  3VWE A;  4CAV A;  2VXK A;  1L0C A;  4NF1 A;  3R9F A;  1QMU A;  4KVM E;  3LWU A;  2Q4Z A;  4BMH A;  3SJG A;  1OBR A;  2OZG A;  1WWZ A;  4JZ0 A;  3QB8 A;  3S6K A;  3SXO A;  4DNC A;  2O53 A;  1Z4E A;  4X5K A;  4X3R A;  5LYI A;  2Q0Y A;  2F8H A;  4LQ6 A;  2EBJ A;  2HB6 A;  3D66 A;  2Q44 A;  2Y0M A;  4M6I A;  4P4J A;  4B5P B;  1LAP A;  2ZW5 A;  2PJA A;  2ARH A;  3FED A;  3DR6 A;  2AFM A;  2PJ8 A;  3DGV A;  2ZPA A;  4UEE A;  1YVK A;  3W91 A;  2FIW A;  2Q7S A;  2WUU A;  3V8I A;  4M85 A;  4P45 A;  2ANP A;  2Z3N A;  1N71 A;  1XEB A;  2PSW A;  4Q38 A;  1Y0R A;  1MJA A;  1Q2C A;  3K9T A;  1IIC A;  3A9L A;  5CPA A;  5HH1 A;  1PCA A;  3KL9 A;  3TX8 A;  5J1Q A;  5G20 A;  2EVN A;  3TOB A;  3CXS A;  4A33 A;  1LOK A;  4FUU A;  1S5K A;  2AFO A;  1LAN A;  1TIQ A;  3F0A A;  4LQG A;  4U9Y A;  5DWN A;  4R76 A;  3JVN A;  1CX8 A;  3FH4 A;  4MY0 A;  4JD6 A;  1XMB A;  2ZW7 A;  1S7N A;  3FEC A;  3S6G A;  5LRJ A;  4JXR A;  1S60 A;  3FXT A;  3RO0 A;  1UWY A;  2Z10 A;  3FJU A;  3MRU A;  4UCN A;  1Z8W A;  1J4J A;  1TF8 A;  3FNC A;  4MY3 A;  4PXE A;  1WK4 A;  2C6P A;  4OAD A;  3RYO A;  4AG7 A;  2V8D A;  4OID A;  2I3C A;  2R98 A;  4KOU A;  2XEJ A;  3RAM A;  4B5O A;  2Q51 A;  3TO7 A;  1HDQ A;  2PJ9 A;  4TNU A;  3R9G A;  4R7M A;  4EVY A;  1Y9W A;  3V7Z A;  1GYT A;  2ZW4 A;  4P4D A;  4GM5 A;  3W6S A;  4YWY A;  1YVO A;  3PBB A;  3DR8 A;  4OC0 A;  3T9Y A;  2C27 A;  3LMS A;  2B58 A;  3B35 A;  3IO1 A;  3NA6 A;  4CPA A;  1Z8L A;  1K4J A;  1M1D A;  2QIR A;  2J9A A;  5AG4 A;  4PSW A;  3CXQ A;  3SJE A;  4Y49 B;  2AFU A;  2B3U A;  5A27 A;  5F09 A;  3D4U A;  2Q4V A;  4CGN A;  1S7L A;  4IK2 A; 
#chains in the Genus database with same CATH homology
 4MRI A;  2C6G A;  3D7G A;  1Y0Y A;  1BPM A;  3S9N A;  1YW4 A;  2ZEE A;  3HUV A;  2BCO A;  1LAM A;  5DS0 A;  3FMC A;  1ELM P;  3PB8 X;  4ONW A;  4WJB A;  3KZW A;  2CF4 A;  3B7I A;  2PJ3 A;  2ZEP A;  2WZN A;  4K3N A;  2JBJ A;  4PXC A;  2CTB A;  5HXD A;  5JH9 A;  3GB0 A;  3TC8 A;  1YW6 A;  4ZX9 A;  2PRQ A;  4OC2 A;  3FEE A;  5THW A;  4A39 A;  5K8P A;  3HLP A;  1Q7L A;  3WC7 A;  1DE4 C;  4NGM A;  3WAB A;  2QJ8 A;  1Y7E A;  3S9L A;  1Z5R A;  2ZEG A;  1ZG8 A;  2V77 A;  3B3T A;  3BI1 A;  3IEH A;  2ZEF A;  4IHM A;  2BOA A;  2EWB A;  2GRE A;  5HVG A;  1F2O A;  3QNV A;  4F9U A;  4MHP A;  2IMO A;  1CBX A;  2ZED A;  1EE3 P;  4EWT A;  3B3V A;  2CTC A;  3IWW A;  1QQ9 A;  3D68 A;  2AFS A;  4MMO A;  5LYF A;  4WWV A;  3I1U A;  3FVL A;  4O23 A;  3H8E A;  4G1P A;  1ARL A;  4EME A;  2O4H A;  4PPZ A;  3B2Y A;  4NGP A;  2GU2 A;  2CIJ A;  1CP6 A;  4P4E A;  4ZY0 A;  2PVW A;  2NYQ A;  3KAS A;  3D7F A;  3CT9 A;  4ZX8 A;  3ISZ A;  8CPA A;  4NFR A;  4TWE A;  4MHZ A;  3IC1 A;  4P4F A;  2IJZ A;  4A37 A;  5JM6 A;  5K8M A;  4A38 A;  2Q43 A;  2C1C A;  3GUX A;  3VH9 A;  3L2N A;  1RTQ A;  2GLF A;  2PJ4 A;  3B3W A;  4OC4 A;  1AMP A;  3H8F A;  2EK8 A;  2PJ0 A;  4A94 A;  3D67 A;  3GLJ A;  5K8N A;  5I4M A;  3PB6 X;  3WT4 A;  3VAR A;  3K2K A;  4MCS A;  1PYT B;  3PRT A;  3SJX A;  3PB9 X;  4B6Z A;  1IY7 A;  4IAV A;  4MXU A;  1F2P A;  2JBK A;  1YSJ A;  3FX6 A;  1CPX A;  3KHZ A;  5HVH A;  4UEF A;  1LCP A;  4H2K A;  4DYO A;  1AYE A;  3T8W A;  2VL1 A;  4W9Y A;  4F9V A;  2ZEN A;  3KI9 A;  1M4L A;  4P10 A;  4MCQ A;  1R43 A;  2PE3 A;  3BHX A;  5LYL A;  3SJF A;  4NGQ A;  2V8G A;  3BI0 A;  4P4B A;  3SI0 A;  1Z2L A;  2AFZ A;  1XBU A;  3IFE A;  4UF4 A;  4MCP A;  4R8F A;  3PFE A;  2ZEL A;  1ZG9 A;  3N5F A;  4DJL A;  4FWU A;  4RUH A;  4ZY2 A;  2OOT A;  3B3C A;  4NGR A;  3B3S A;  1R3N A;  2PVV A;  2PJB A;  1TKH A;  4P6Y A;  5D29 A;  1XRY A;  2XEF A;  1ZLI A;  3NH8 A;  1VGY A;  1ELL P;  1NSA A;  3CPX A;  3NH4 A;  2PJ2 A;  4P44 A;  4NJQ A;  4OC5 A;  4AXV A;  4PXD A;  2DEA A;  2RFH A;  1TKF A;  1TXR A;  2XEG A;  5ELY A;  4KSI A;  1ZG7 A;  2NSM A;  4OP4 A;  1VHE A;  2EK9 A;  1H8L A;  3JRU A;  1DTD A;  4F8Z A;  5IB9 A;  4ZI6 A;  4MHN A;  2PCU A;  2G9D A;  2PJ7 A;  3CDX A;  3KHX A;  3D7D A;  5LRK A;  3IIB A;  1ARM A;  4UIA A;  1VHO A;  5D8N A;  4ZYQ A;  3CPA A;  1FT7 A;  1BAV A;  4Q7A A;  4PQA A;  3ISX A;  3KR5 A;  4MHY A;  2AFX A;  4OC1 A;  2FVG A;  2JEW A;  2AFW A;  1YME A;  3VAT A;  3MN8 A;  2QVP A;  3D7H A;  3PEI A;  5JGF A;  1HDU A;  1CG2 A;  1BPN A;  3RBU A;  3PFO A;  1FNO A;  4R6T A;  1CPS A;  3KQZ A;  2PJ1 A;  1YLO A;  4NGT A;  5K8O A;  2ZOG A;  4OME A;  5CBM A;  4JYW A;  3H8G A;  2C6C A;  2GLJ A;  2V8V A;  2PJ5 A;  2IQ6 A;  3KR4 A;  3RZA A;  4FAI A;  2QYV A;  3IJ3 A;  5HVF A;  4ZY1 A;  2PJC A;  2ZOF A;  4NGS A;  4FBE A;  4NJR A;  4X8I A;  4UEZ A;  3SI1 A;  3BXM A;  4Z65 A;  4OC3 A;  1VIX A;  4PXB A;  1CP7 A;  3PB7 X;  2POK A;  3SI2 A;  2XEI A;  4UIB A;  2ZEM A;  6CPA A;  2WYR A;  1JQG A;  3PBE A;  4YU9 A;  1ZLH A;  4MCR A;  1KWM A;  2V8H A;  2ZEH A;  4BD9 A;  1TKJ A;  3DLJ A;  7CPA A;  4P4I A;  3S9M A;  1XFO A;  2BO9 A;  2OR4 A;  4OKO A;  1TF9 A;  2RB7 A;  4NGN A;  1IGB A;  3WC6 A;  2PIY A;  4OIW A;  3FF3 A;  2PJ6 A;  3KGQ A;  1XJO A;  3WC5 A;  4X2T A;  2ZEO A;  1LFW A;  2PIZ A;  2ABZ A;  3KQX A;  5LRG A;  4DUK A;  4EFD A;  1BLL E;  1HEE A;  2HC9 A;  3PB4 X;  1F57 A;  3NH5 A;  2F7V A;  3NFZ A;  3V38 A;  1QMU A;  3LWU A;  2Q4Z A;  3SJG A;  1OBR A;  4JZ0 A;  2O53 A;  4X3R A;  5LYI A;  2F8H A;  2HB6 A;  3D66 A;  4P4J A;  1LAP A;  2PJA A;  3FED A;  2AFM A;  2PJ8 A;  3DGV A;  4UEE A;  4P45 A;  2ANP A;  1Y0R A;  5CPA A;  3K9T A;  5J1Q A;  1PCA A;  3KL9 A;  3TX8 A;  1LOK A;  4FUU A;  2AFO A;  1LAN A;  4LQG A;  4R76 A;  1CX8 A;  3FH4 A;  1XMB A;  3FEC A;  5LRJ A;  1UWY A;  3FJU A;  3MRU A;  1TF8 A;  4PXE A;  2C6P A;  2V8D A;  4OID A;  2I3C A;  2XEJ A;  3RAM A;  2Q51 A;  1HDQ A;  2PJ9 A;  4TNU A;  4R7M A;  3V7Z A;  1GYT A;  4P4D A;  4GM5 A;  4YWY A;  3PBB A;  4OC0 A;  3LMS A;  3NA6 A;  3B35 A;  3IO1 A;  4CPA A;  1Z8L A;  2J9A A;  3SJE A;  2AFU A;  5F09 A;  3D4U A;  5LYD A;  4IK2 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...