3VH9A

Crystal structure of aeromonas proteolytica aminopeptidase complexed with 8-quinolinol
Total Genus 116
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
116
sequence length
291
structure length
291
Chain Sequence
MPPITQQATVTAWLPQVDASQITGTISSLESFTNRFYTTTSGAQASDWIASEWQALSASLPNASVKQVSHSGYNQKSVVMTITGSEAPDEWIVIGGHLDSTIGSHTNEQSVAPGADDDASGIAAVTEVIRVLSENNFQPKRSIAFMAYAAEEVGLRGSQDLANQYKSEGKNVVSALQLDMTNYKGSAQDVVFITDYTDSNFTQYLTQLMDEYLPSLTYGFDTCGYACSDHASWHNAGYPAAMPFESKFNDYNPRIHTTQDTLANSDPTGSHAKKFTQLGLAYAIEMGSATG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Bacterial leucyl aminopeptidase
publication title Potent inhibition of dinuclear zinc(II) peptidase, an aminopeptidase from Aeromonas proteolytica, by 8-quinolinol derivatives: inhibitor design based on Zn(2+) fluorophores, kinetic, and X-ray crystallographic study.
pubmed doi rcsb
molecule tags Hydrolase/hydrolase inhibitor
total genus 116
structure length 291
sequence length 291
ec nomenclature ec 3.4.11.10: Bacterial leucyl aminopeptidase.
pdb deposition date 2011-08-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF04389 Peptidase_M28 Peptidase family M28
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.630.10 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Zn peptidases 3vh9A00
2AFUA 3JRUA 1ZLHA 3KZWA 3IFEA 5CBMA 3VARA 2PJ0A 4W9YA 2V8VA 4FBEA 2ZOFA 4UEEA 2C6PA 2Q4ZA 2ZEOA 3KASA 1XFOA 1PYTB 4P45A 2PJ1A 2NYQA 4Q7AA 2CIJA 5IB9A 3BI0A 5K8PA 1ZLIA 3SI1A 4IK2A 8CPAA 3IJ3A 4UEZA 4JYWA 1ARMA 3FECA 3KQZA 4TWEA 2C1CA 2V8DA 3VATA 2C6GA 4NGMA 3D7FA 1Y7EA 3FJUA 3N5FA 2XEIA 3BHXA 1JQGA 1LOKA 5HVFA 3GUXA 3TX8A 1FT7A 2I3CA 1CPSA 2ABZA 3IO1A 1TKHA 4OC3A 2PJ3A 3MN8A 3NH8A 3KL9A 2IJZA 4O23A 3KR5A 3KR4A 3D7GA 4MRIA 3ISXA 4MCRA 2PJ2A 4NJRA 4PXDA 4UF4A 1IGBA 3FH4A 3KI9A 4ZY0A 4FWUA 4PQAA 2PJAA 5LRJA 4P4DA 4X3RA 5ELYA 6CPAA 3PB8X 2Q43A 1NSAA 3PBEA 2XEFA 4H2KA 4TNUA 1BLLE 1ELLP 2BO9A 3FVLA 4PPZA 4GM5A 4A37A 1BAVA 2PRQA 2ZEPA 3I1UA 3H8EA 4MXUA 2XEGA 2ZEEA 3IIBA 3FEDA 2CTBA 3NH4A 4FUUA 3S9LA 2PIZA 1YMEA 3IEHA 4ZY2A 3B3SA 3CPAA 3RAMA 4MHZA 3WABA 5HVHA 3PFOA 4R8FA 1YLOA 3K9TA 4OP4A 5DS0A 3WT4A 2IQ6A 2PIYA 2PVWA 2PJ6A 3D7DA 1LANA 1ZG9A 4OC1A 4RUHA 1DTDA 2VL1A 3CDXA 4P4EA 3B2YA 4MHPA 3PB9X 2PJCA 2ZEHA 2NSMA 4Z65A 4EFDA 5JGFA 1XRYA 4PXEA 2POKA 2O53A 3D68A 4YWYA 1FNOA 3KGQA 4NGSA 1ZG7A 4MMOA 2GU2A 4OKOA 3FX6A 1QMUA 2G9DA 1R3NA 1TKFA 1YW6A 4ZY1A 4UEFA 4EWTA 3D67A 1DE4C 1F2PA 3LWUA 2JEWA 5HVGA 1VHEA 5LYLA 4ZYQA 2GLFA 3ISZA 4NGQA 1EE3P 2HB6A 4A38A 1Y0RA 1LAPA 5D8NA 2ZENA 3CPXA 4NGPA 4UIAA 2ZOGA 3D66A 1H8LA 4CPAA 4ZI6A 2C6CA 3IC1A 2BOAA 4A94A 4DUKA 3PB7X 2AFMA 5D29A 4K3NA 2QVPA 4A39A 4MCSA 1R43A 2AFOA 1F2OA 2V8GA 3SJEA 1AMPA 2ZEMA 4P4FA 1IY7A 2OR4A 4B6ZA 1Z5RA 2EK9A 3H8GA 4LQGA 1Y0YA 1LFWA 3WC6A 4AXVA 1XBUA 2F8HA 2RB7A 4R7MA 3HLPA 3DLJA 1VGYA 2PVVA 4G1PA 5CPAA 5F09A 1CP6A 4P4JA 1ZG8A 4OC5A 5LYDA 2FVGA 1TXRA 3VH9A 1ARLA 2ZEGA 3PB4X 4PXCA 3WC7A 5LRGA 1Q7LA 2PJ9A 1RTQA 4OC4A 4IHMA 4KSIA 2CTCA 2J9AA 3V7ZA 2ZEFA 2QYVA 1CX8A 3KHXA 3B3TA 2BCOA 4MCPA 2WZNA 3NH5A 3PEIA 3FEEA 1CPXA 4MHNA 2PE3A 4OIWA 4ZX9A 1Z2LA 4BD9A 3RBUA 4ONWA 2PCUA 1AYEA 2PJ7A 4R76A 1TKJA 2GLJA 4PXBA 4FAIA 3FMCA 3B7IA 1BPMA 5LYFA 3KQXA 3PRTA 5LYIA 2V8HA 2AFZA 2AFSA 4NGRA 1UWYA 5JM6A 2DEAA 2GREA 3L2NA 4R6TA 3B35A 3B3CA 5J1QA 4NGNA 4UIBA 3H8FA 3PFEA 3CT9A 3QNVA 3T8WA 3NA6A 2ZELA 4OC2A 1ELMP 3SI2A 3GLJA 2JBKA 2F7VA 4WJBA 2HC9A 4OMEA 1GYTA 4X2TA 4OIDA 5THWA 1PCAA 4F9VA 3SJGA 4P6YA 4ZX8A 1HDUA 2PJBA 1TF8A 3D4UA 3B3WA 4P4IA 4P44A 4DYOA 3S9NA 3NFZA 4MHYA 4WWVA 2PJ8A 2EK8A 2ZEDA 4DJLA 4IAVA 1BPNA 3BI1A 3WC5A 2V77A 1HEEA 1F57A 3RZAA 1M4LA 1YSJA 1CG2A 1XJOA 5HXDA 4F9UA 4NGTA 4F8ZA 1Z8LA 3KHZA 2IMOA 3K2KA 5K8OA 3BXMA 1YW4A 5I4MA 3GB0A 3SI0A 3IWWA 4X8IA 3FF3A 4NJQA 1VIXA 2CF4A 4JZ0A 3MRUA 5K8NA 2XEJA 1CP7A 4NFRA 5LRKA 3PBBA 4P4BA 2PJ5A 3LMSA 3SJFA 3S9MA 1KWMA 1XMBA 7CPAA 3HUVA 5JH9A 2EWBA 5K8MA 4OC0A 1VHOA 3B3VA 2WYRA 2PJ4A 2ANPA 4MCQA 2AFXA 3SJXA 3TC8A 2Q51A 1LAMA 1LCPA 2AFWA 2RFHA 2OOTA 1TF9A 2JBJA 2O4HA 1OBRA 3D7HA 2QJ8A 4YU9A 3V38A 1HDQA 1CBXA 4EMEA 4P10A 3PB6X 3DGVA 1QQ9A
chains in the Genus database with same CATH superfamily
1IB1E 2VZYA 2R7HA 3DDDA 2H5MA 3FYNA 2PR8A 2AFUA 3TTHA 3JRUA 2VI7A 4A31A 1ZLHA 4YRHA 3KZWA 3P2HA 3BJ8A 3I9SA 4LUAA 3IFEA 2OZHA 5CBMA 4KVME 3VARA 1ON0A 2YNCC 2Z3NA 2PJ0A 4W9YA 2V8VA 1P4NA 4FBEA 1CM0A 4R87A 2ZOFA 1S7KA 2C6PA 4UEEA 1S60A 2Q4ZA 1U6MA 2ZEOA 1XFOA 3KASA 1PYTB 4MFLA 1YK3A 4P45A 4QC6A 2Z11A 2PJ1A 2NYQA 4Q7AA 1RO5A 2CIJA 1MJAA 5F48A 5IB9A 3BI0A 1S7FA 4NEXA 5K8PA 1ZLIA 3SI1A 4IK2A 5JQ4A 8CPAA 1YVOA 3IJ3A 2JDDA 4UEZA 4JYWA 1ARMA 3FECA 3KQZA 4KZTA 4QVTA 4UFWA 4TWEA 1GHEA 2YGWA 2C1CA 2V8DA 3VATA 2C6GA 4NGMA 3D7FA 1Y7EA 3FJUA 2ARHA 3N5FA 5DWMA 1I12A 2XEIA 3BHXA 4JLYA 4EVYA 1JQGA 1LOKA 3FXTA 5HVFA 2Z0ZA 5I0CA 3GUXA 3TX8A 4CAFA 1FT7A 1I1DA 1ZO0A 2I3CA 3EO4A 5EMIA 1CPSA 1XEBA 2ABZA 4HNYB 3QAHA 3IO1A 1TKHA 4OC3A 3RYOA 2PJ3A 3MN8A 3NH8A 3KL9A 4H6ZA 2EBJA 2HUZA 2IJZA 3C26A 3KR5A 4O23A 3KR4A 3D7GA 4MRIA 3ISXA 4MCRA 4XPKA 4ZBGA 1Q2DA 2PJ2A 1IIDA 4L89A 4NJRA 4UFVA 4PXDA 4QUSA 2B4DB 4UF4A 4E0AA 1IGBA 3FH4A 2G3AA 2I79A 3KI9A 4GXHA 3GYAA 3E0KA 4M3SA 4ZY0A 4FWUA 5J8FA 5KTAA 4KLVA 4PQAA 2PJAA 5LRJA 4P4DA 2GANA 4X3RA 5ELYA 6CPAA 2FIWA 4R3LA 3PB8X 4KSFA 3IU1A 2Q43A 1NSAA 4AVCA 1A2ZA 1QSRA 2OB0A 3PBEA 2XEFA 4XNHC 4H2KA 4TNUA 3R9GA 1Z4EA 1BLLE 1ELLP 2BO9A 3W91A 3NE7A 3PGPA 3S6HA 1R57A 3FVLA 4C2YA 4PPZA 3KKWA 4GM5A 4CAEA 4A37A 1CJWA 2G3TA 1J4JA 1IICA 4HPSA 1BAVA 2PRQA 2R8VA 2REFA 3DR8A 4IF5A 4UWJA 2ZEPA 4A30A 2ZW7A 4XPDC 3WABA 4L8AA 3I1UA 4UBRA 4C2XA 4E2AA 3S6FA 4II9A 3H8EA 2AE6A 4MXUA 2PRBA 1MJBA 2DPSA 2XEGA 2ZEEA 3IIBA 3IU2A 3FEDA 4UA3A 4CGPA 2CTBA 3NH4A 4FUUA 3S9LA 4AVAA 2PIZA 1FY7A 1P0HA 4A33A 1PU9A 1YMEA 3IEHA 3B3SA 3CPAA 4ZY2A 2C27A 4MHZA 3RAMA 2FCKA 5HVHA 4NSQA 3PFOA 4R8FA 1YLOA 2FIAA 3K9TA 4MFQA 4XPLA 2O28A 4H89A 4F0XA 4CRYB 3LACA 2VXKA 4KOYA 4OP4A 4UCMA 2CY2A 5DS0A 3WT4A 3D2PA 3D2MA 2IQ6A 4R9MA 1YLEA 2PIYA 4IUSA 2DPTA 2PVWA 2PJ6A 3D7DA 4Q36A 1LANA 1XIXA 1ZG9A 2YNDA 4OC1A 2R1IA 2YNEA 4JD6A 4RUHA 3TCVA 5G20A 1DTDA 2QMLA 2VL1A 2HV2A 3CDXA 4UCNA 1X12A 4P4EA 1QSMA 3V8IA 2NMTA 3B2YA 4MHPA 1Z8WA 3PB9X 2PJCA 2ZEHA 4NXYA 1RXTA 1VHSA 2NSMA 4Z65A 3CXSA 4MFJA 4UCPA 5EBVA 2Q04A 4EFDA 5JGFA 1XRYA 1Z8XA 2REEA 3BJ7A 4OLLA 4ORFA 4PXEA 2POKA 2O53A 3R95A 4FD7A 3D68A 1PUAA 4YWYA 4CS0B 2FSRA 4PV6A 3TO9A 2HQYA 1SQHA 4F6AA 1FNOA 3EXNA 3KGQA 4RS2A 4B14A 4NGSA 1KZFA 1ZG7A 4MMOA 5AG6A 3K9UA 1BO4A 2GU2A 3FX6A 1QMUA 4OKOA 4XPDB 2B5GB 2D4OA 3UY5A 2VEZA 2G9DA 4KOXA 3DR6A 1S7NA 3S6GA 1R3NA 1TKFA 2X7BA 3TO7A 4CRZB 2P6FA 2VZZA 1YW6A 4ZY1A 3TE4A 4UEFA 4EWTA 3D67A 1DE4C 4PK2A 3FBUA 1F2PA 4KUAA 2JEVA 3LWUA 2JEWA 2Z3LA 4JJXA 1YGHA 2J8MA 4MY3A 4A95A 5HVGA 1VHEA 2G0BA 3D3SA 4K30A 5LYLA 2FXFA 2Z3KA 4ZYQA 2GLFA 3ISZA 4NGQA 1QSNA 2WPXA 4YGOA 1EE3P 2HB6A 4A38A 1Y0RA 1LAPA 4LQ6A 5D8NA 2ZENA 3CPXA 3JUWA 4NGPA 4B13A 3LD2A 5IX3A 4UIAA 2ZOGA 1XF8A 3D66A 1H8LA 4CPAA 4ZI6A 1Y9KA 5FVJA 2C6CA 4BINA 3IC1A 4NF1A 2RC4A 3W6SA 4E8OA 3FNCA 2Z3MA 1JWQA 2BOAA 2JLMA 4A94A 4UFXA 3PB7X 4BBHA 4DUKA 3DSBA 2A4NA 2AFMA 3DNSA 3CXQA 2B4DA 5H86A 1QSTA 2VQYA 4CAWA 5D29A 4K3NA 2OH1A 2P6EA 1B6BA 2QVPA 4A39A 3TFYA 4MCSA 1R43A 2YNCA 5E96A 2AFOA 4AVBA 2EVNA 2B3VA 1VKCA 4QBJA 1F2OA 2V8GA 3R1KA 3SJEA 1IOIA 1AMPA 1KUVA 2ZEMA 4CYNA 4P4FA 4AG9A 2PR1A 1IY7A 2OR4A 1IYKA 4B6ZA 2B4BA 4CAXA 5A27A 2OZGA 2Y0MA 1Z5RA 3IGRA 1M44A 2EK9A 5AGEA 3H8GA 4CYOA 4Y49C 1UFHA 4LQGA 1M4GA 1IOFA 1Y0YA 1N71A 1LFWA 3WC6A 2BL1A 3G3SA 4AXVA 4R57A 1XBUA 2F8HA 2PC1A 2Z3OA 4FD5A 4QB9A 2BUEA 2Q7SA 2RB7A 4CYPA 2OZUA 4R7MA 3HLPA 3DLJA 4B5PB 1WK4A 1Y7RA 3CZXA 1VGYA 5KTDA 2PVVA 4G1PA 5CPAA 5F09A 1CP6A 5IV0A 4B12A 2K5TA 4P4JA 1ZG8A 4MY0A 4OC5A 5LYDA 2DXQA 2FVGA 4A32A 5F46A 3JVNA 1TXRA 2ODFA 2CNSA 1ARLA 2ZEGA 3IWEA 3VH9A 3PB4X 4PXCA 5DWNA 4OADA 4R3KA 3WC7A 4KSAA 5LRGA 4KS9A 4CGOA 1XMTA 4M85A 4GS4A 4U5YA 1Q7LA 5CNPA 2PJ9A 1RTQA 4H6UA 3ZJ0A 4OC4A 5C82A 2I00A 4CYQA 4IHMA 4KSIA 5G22A 2GFQA 2CTCA 2J9AA 3I3GA 4AG7A 2IL4A 5BWAB 3V7ZA 4FD4A 1Z8TA 5J8CA 4AB7A 2EUIA 2ZEFA 2CNTA 2QYVA 1CX8A 3KHXA 3B8GA 3N7ZA 4MFKA 3B3TA 2BCOA 4MCPA 3WR7A 4C2ZA 5HMNA 2WZNA 3F5BA 3NH5A 2GIVA 2P6GA 4U9ZA 4F0YA 3PEIA 2Q44A 3FEEA 1CPXA 4MHNA 4HNWB 1MJ9A 1M4IA 2PE3A 4OIWA 4ZX9A 1XOVA 4FD6A 1Z2LA 3T9YA 3GKRA 4A2ZA 4BD9A 3RBUA 4ONWA 4Y49B 4MBUA 4XNHB 3CXPA 2OU2A 2PCUA 1AYEA 2PJ7A 2F5IA 2WPWA 3F8KA 4J3GA 2WUUA 3GY9A 3NE8A 4R76A 1XE4A 1V0CA 1TKJA 2GLJA 3GIUA 2FL4A 4PXBA 1YQEA 4OAEA 4FAIA 2FS5A 3EY5A 3FMCA 3B7IA 3FB3A 4KOUA 1BPMA 1NSLA 5LYFA 3KQXA 3SXOA 3PRTA 4HNXB 5LYIA 4JXQA 1OZPA 2V8HA 1AUGA 2AFSA 2AFZA 5GCNA 4NGRA 1YR0A 1UWYA 2Q0YA 3BLNA 4PSXA 5F49A 3TO6A 5JM6A 2DEAA 4X5KA 1X10A 4KOVA 5H84A 2GREA 3L2NA 4R6TA 3B35A 3B3CA 3R9FA 3TOAA 3TT2A 5J1QA 4NGNA 4UIBA 3H8FA 3PFEA 3FIXA 5IB0A 3QB8A 3CT9A 3D8PA 2VBQA 3QNVA 3R96A 1IU8A 1TIQA 2Z3PA 1S7LA 2PQ8A 3T8WA 3ZZIA 3NA6A 2ZELA 3MGDA 4OC2A 2AJ6A 4KORA 1ELMP 3SXNA 3SI2A 4CGNA 5AG5A 3GLJA 2JBKA 2F7VA 3OWCA 2PDOA 4WJBA 1QSOA 2HC9A 4OMEA 1M4DA 1GYTA 4X2TA 4OIDA 4CGLA 5THWA 3RO0A 1IYLA 1PCAA 3T90A 4F9VA 4CGMA 3SJGA 4P6YA 4KOTA 1KUXA 3JTKA 5F47A 4ZX8A 1HDUA 1L0CA 2J8RA 2PJBA 5AG4A 4YFJA 5C88A 4M6GA 1TF8A 3D4UA 3RNZA 2GE3A 3B3WA 1B87A 1Q2CA 4P4IA 4P44A 4DYOA 1K4JA 2PSWA 3PZJA 3S9NA 2Z10A 3NFZA 4MHYA 4WWVA 2PJ8A 1S3ZA 2EK8A 2ZEDA 4KVOE 4DJLA 1S5KA 2FE7A 4IAVA 1BPNA 1KUYA 3SHPA 1Z9UA 3BI1A 5HH1A 2V77A 3WC5A 4C7HA 4RN7A 1HEEA 4MFZA 1F57A 2ATRA 2CXAA 3RZAA 3VWEA 1M4LA 1BOBA 1YSJA 1CG2A 1XJOA 2DF5A 5HXDA 4F9UA 1Y9WA 4NGTA 4F8ZA 5AG7A 4Q38A 1Z8LA 3KHZA 2IMOA 5ISVA 3H5ZA 3K2KA 2Q4VA 3BXMA 5K8OA 1YW4A 2J8NA 3GB0A 5I4MA 2QECA 3SI0A 4KOSA 3IWWA 4X8IA 1MK4A 2BSWA 3FF3A 3S6KA 4NJQA 3EFAA 1VIXA 2ZXVA 4LX9A 4B5PA 3H4QA 3F0AA 4MHDA 2CF4A 4M6HA 4M6IA 2Q4YA 4B10A 3FRMA 4JZ0A 4RI1A 3MRUA 4KUBA 5K8NA 2Q7BA 2XEJA 4I49A 2ZPAA 2BEIA 4NCZA 1CP7A 4NFRA 2JDCA 3TOBA 5EC4A 3PBBA 5LRKA 2QIRA 4CAVA 4P4BA 2PJ5A 3LMSA 4MJ8A 3G8WA 3SJFA 1LRZA 3S9MA 1KWMA 1XMBA 7CPAA 4C68A 2CNMA 2WSAA 3HUVA 4KLWA 2ZW5A 2EWBA 5JH9A 5K8MA 4KOWA 1M1DA 5G21A 5JPHA 4B11A 3VWDA 4OC0A 4PK3A 1VHOA 3QAYA 3B3VA 5KTCA 2WYRA 1YX0A 2PJ4A 4U9YA 3IWGA 5G1ZA 3W6XA 2ZW4A 4BMHA 2ANPA 4JXRA 4MCQA 1WWZA 2AFXA 3PP9A 4HKFA 3SJXA 4DNCA 3TC8A 2Q51A 4MI4A 1LAMA 3EC4A 4B5OA 4JWPA 5A28A 1LCPA 1Z4RA 2AFWA 2RFHA 4PSWA 2OOTA 1TF9A 2JBJA 2O4HA 3LODA 2P0WA 2B3UA 4C7IA 3P2FA 4MFPA 1OBRA 2R98A 3D7HA 2QJ8A 4KVXA 4YU9A 2EO8A 4ZGYB 1NE9A 2KCWA 2D4PA 2ZW6A 3V38A 1HDQA 4UWIA 1CBXA 2B5GA 4EMEA 1YVKA 2FT0A 3A9LA 1YREA 1I21A 1NMTA 1Q2YA 4ONUA 2B58A 3PB6X 3DGVA 4P10A 1QQ9A 3R9EA
chains in the Genus database with same CATH topology
2AFUA 3JRUA 1ZLHA 3KZWA 3IFEA 5CBMA 3VARA 2PJ0A 4W9YA 2V8VA 4FBEA 2ZOFA 4UEEA 2C6PA 2Q4ZA 2ZEOA 3KASA 1XFOA 1PYTB 4P45A 2PJ1A 2NYQA 4Q7AA 2CIJA 5IB9A 3BI0A 5K8PA 1ZLIA 3SI1A 4IK2A 8CPAA 3IJ3A 4UEZA 4JYWA 1ARMA 3FECA 3KQZA 4TWEA 2C1CA 2V8DA 3VATA 2C6GA 4NGMA 3D7FA 1Y7EA 3FJUA 3N5FA 2XEIA 3BHXA 1JQGA 1LOKA 5HVFA 3GUXA 3TX8A 1FT7A 2I3CA 1CPSA 2ABZA 3IO1A 1TKHA 4OC3A 2PJ3A 3MN8A 3NH8A 3KL9A 2IJZA 4O23A 3KR5A 3KR4A 3D7GA 4MRIA 3ISXA 4MCRA 2PJ2A 4NJRA 4PXDA 4UF4A 1IGBA 3FH4A 3KI9A 4ZY0A 4FWUA 4PQAA 2PJAA 5LRJA 4P4DA 4X3RA 5ELYA 6CPAA 3PB8X 2Q43A 1NSAA 3PBEA 2XEFA 4H2KA 4TNUA 1BLLE 1ELLP 2BO9A 3FVLA 4PPZA 4GM5A 4A37A 1BAVA 2PRQA 2ZEPA 3I1UA 3H8EA 4MXUA 2XEGA 2ZEEA 3IIBA 3FEDA 2CTBA 3NH4A 4FUUA 3S9LA 2PIZA 1YMEA 3IEHA 4ZY2A 3B3SA 3CPAA 3RAMA 4MHZA 3WABA 5HVHA 3PFOA 4R8FA 1YLOA 3K9TA 4OP4A 5DS0A 3WT4A 2IQ6A 2PIYA 2PVWA 2PJ6A 3D7DA 1LANA 1ZG9A 4OC1A 4RUHA 1DTDA 2VL1A 3CDXA 4P4EA 3B2YA 4MHPA 3PB9X 2PJCA 2ZEHA 2NSMA 4Z65A 4EFDA 5JGFA 1XRYA 4PXEA 2POKA 2O53A 3D68A 4YWYA 1FNOA 3KGQA 4NGSA 1ZG7A 4MMOA 2GU2A 4OKOA 3FX6A 1QMUA 2G9DA 1R3NA 1TKFA 1YW6A 4ZY1A 4UEFA 4EWTA 3D67A 1DE4C 1F2PA 3LWUA 2JEWA 5HVGA 1VHEA 5LYLA 4ZYQA 2GLFA 3ISZA 4NGQA 1EE3P 2HB6A 4A38A 1Y0RA 1LAPA 5D8NA 2ZENA 3CPXA 4NGPA 4UIAA 2ZOGA 3D66A 1H8LA 4CPAA 4ZI6A 2C6CA 3IC1A 2BOAA 4A94A 4DUKA 3PB7X 2AFMA 5D29A 4K3NA 2QVPA 4A39A 4MCSA 1R43A 2AFOA 1F2OA 2V8GA 3SJEA 1AMPA 2ZEMA 4P4FA 1IY7A 2OR4A 4B6ZA 1Z5RA 2EK9A 3H8GA 4LQGA 1Y0YA 1LFWA 3WC6A 4AXVA 1XBUA 2F8HA 2RB7A 4R7MA 3HLPA 3DLJA 1VGYA 2PVVA 4G1PA 5CPAA 5F09A 1CP6A 4P4JA 1ZG8A 4OC5A 5LYDA 2FVGA 1TXRA 3VH9A 1ARLA 2ZEGA 3PB4X 4PXCA 3WC7A 5LRGA 1Q7LA 2PJ9A 1RTQA 4OC4A 4IHMA 4KSIA 2CTCA 2J9AA 3V7ZA 2ZEFA 2QYVA 1CX8A 3KHXA 3B3TA 2BCOA 4MCPA 2WZNA 3NH5A 3PEIA 3FEEA 1CPXA 4MHNA 2PE3A 4OIWA 4ZX9A 1Z2LA 4BD9A 3RBUA 4ONWA 2PCUA 1AYEA 2PJ7A 4R76A 1TKJA 2GLJA 4PXBA 4FAIA 3FMCA 3B7IA 1BPMA 5LYFA 3KQXA 3PRTA 5LYIA 2V8HA 2AFZA 2AFSA 4NGRA 1UWYA 5JM6A 2DEAA 2GREA 3L2NA 4R6TA 3B35A 3B3CA 5J1QA 4NGNA 4UIBA 3H8FA 3PFEA 3CT9A 3QNVA 3T8WA 3NA6A 2ZELA 4OC2A 1ELMP 3SI2A 3GLJA 2JBKA 2F7VA 4WJBA 2HC9A 4OMEA 1GYTA 4X2TA 4OIDA 5THWA 1PCAA 4F9VA 3SJGA 4P6YA 4ZX8A 1HDUA 2PJBA 1TF8A 3D4UA 3B3WA 4P4IA 4P44A 4DYOA 3S9NA 3NFZA 4MHYA 4WWVA 2PJ8A 2EK8A 2ZEDA 4DJLA 4IAVA 1BPNA 3BI1A 3WC5A 2V77A 1HEEA 1F57A 3RZAA 1M4LA 1YSJA 1CG2A 1XJOA 5HXDA 4F9UA 4NGTA 4F8ZA 1Z8LA 3KHZA 2IMOA 3K2KA 5K8OA 3BXMA 1YW4A 5I4MA 3GB0A 3SI0A 3IWWA 4X8IA 3FF3A 4NJQA 1VIXA 2CF4A 4JZ0A 3MRUA 5K8NA 2XEJA 1CP7A 4NFRA 5LRKA 3PBBA 4P4BA 2PJ5A 3LMSA 3SJFA 3S9MA 1KWMA 1XMBA 7CPAA 3HUVA 5JH9A 2EWBA 5K8MA 4OC0A 1VHOA 3B3VA 2WYRA 2PJ4A 2ANPA 4MCQA 2AFXA 3SJXA 3TC8A 2Q51A 1LAMA 1LCPA 2AFWA 2RFHA 2OOTA 1TF9A 2JBJA 2O4HA 1OBRA 3D7HA 2QJ8A 4YU9A 3V38A 1HDQA 1CBXA 4EMEA 4P10A 3PB6X 3DGVA 1QQ9A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2AFU A;  3JRU A;  1ZLH A;  3KZW A;  3IFE A;  5CBM A;  3VAR A;  2PJ0 A;  4W9Y A;  2V8V A;  4FBE A;  2ZOF A;  4UEE A;  2C6P A;  2Q4Z A;  2ZEO A;  3KAS A;  1XFO A;  1PYT B;  4P45 A;  2PJ1 A;  2NYQ A;  4Q7A A;  2CIJ A;  5IB9 A;  3BI0 A;  5K8P A;  1ZLI A;  3SI1 A;  4IK2 A;  8CPA A;  3IJ3 A;  4UEZ A;  4JYW A;  1ARM A;  3FEC A;  3KQZ A;  4TWE A;  2C1C A;  2V8D A;  3VAT A;  2C6G A;  4NGM A;  3D7F A;  1Y7E A;  3FJU A;  3N5F A;  2XEI A;  3BHX A;  1JQG A;  1LOK A;  5HVF A;  3GUX A;  3TX8 A;  1FT7 A;  2I3C A;  1CPS A;  2ABZ A;  3IO1 A;  1TKH A;  4OC3 A;  2PJ3 A;  3MN8 A;  3NH8 A;  3KL9 A;  2IJZ A;  4O23 A;  3KR5 A;  3KR4 A;  3D7G A;  4MRI A;  3ISX A;  4MCR A;  2PJ2 A;  4NJR A;  4PXD A;  4UF4 A;  1IGB A;  3FH4 A;  3KI9 A;  4ZY0 A;  4FWU A;  4PQA A;  2PJA A;  5LRJ A;  4P4D A;  4X3R A;  5ELY A;  6CPA A;  3PB8 X;  2Q43 A;  1NSA A;  3PBE A;  2XEF A;  4H2K A;  4TNU A;  1BLL E;  1ELL P;  2BO9 A;  3FVL A;  4PPZ A;  4GM5 A;  4A37 A;  1BAV A;  2PRQ A;  2ZEP A;  3I1U A;  3H8E A;  4MXU A;  2XEG A;  2ZEE A;  3IIB A;  3FED A;  2CTB A;  3NH4 A;  4FUU A;  3S9L A;  2PIZ A;  1YME A;  3IEH A;  4ZY2 A;  3B3S A;  3CPA A;  3RAM A;  4MHZ A;  3WAB A;  5HVH A;  3PFO A;  4R8F A;  1YLO A;  3K9T A;  4OP4 A;  5DS0 A;  3WT4 A;  2IQ6 A;  2PIY A;  2PVW A;  2PJ6 A;  3D7D A;  1LAN A;  1ZG9 A;  4OC1 A;  4RUH A;  1DTD A;  2VL1 A;  3CDX A;  4P4E A;  3B2Y A;  4MHP A;  3PB9 X;  2PJC A;  2ZEH A;  2NSM A;  4Z65 A;  4EFD A;  5JGF A;  1XRY A;  4PXE A;  2POK A;  2O53 A;  3D68 A;  4YWY A;  1FNO A;  3KGQ A;  4NGS A;  1ZG7 A;  4MMO A;  2GU2 A;  4OKO A;  3FX6 A;  1QMU A;  2G9D A;  1R3N A;  1TKF A;  1YW6 A;  4ZY1 A;  4UEF A;  4EWT A;  3D67 A;  1DE4 C;  1F2P A;  3LWU A;  2JEW A;  5HVG A;  1VHE A;  5LYL A;  4ZYQ A;  2GLF A;  3ISZ A;  4NGQ A;  1EE3 P;  2HB6 A;  4A38 A;  1Y0R A;  1LAP A;  5D8N A;  2ZEN A;  3CPX A;  4NGP A;  4UIA A;  2ZOG A;  3D66 A;  1H8L A;  4CPA A;  4ZI6 A;  2C6C A;  3IC1 A;  2BOA A;  4A94 A;  4DUK A;  3PB7 X;  2AFM A;  5D29 A;  4K3N A;  2QVP A;  4A39 A;  4MCS A;  1R43 A;  2AFO A;  1F2O A;  2V8G A;  3SJE A;  1AMP A;  2ZEM A;  4P4F A;  1IY7 A;  2OR4 A;  4B6Z A;  1Z5R A;  2EK9 A;  3H8G A;  4LQG A;  1Y0Y A;  1LFW A;  3WC6 A;  4AXV A;  1XBU A;  2F8H A;  2RB7 A;  4R7M A;  3HLP A;  3DLJ A;  1VGY A;  2PVV A;  4G1P A;  5CPA A;  5F09 A;  1CP6 A;  4P4J A;  1ZG8 A;  4OC5 A;  5LYD A;  2FVG A;  1TXR A;  3VH9 A;  1ARL A;  2ZEG A;  3PB4 X;  4PXC A;  3WC7 A;  5LRG A;  1Q7L A;  2PJ9 A;  1RTQ A;  4OC4 A;  4IHM A;  4KSI A;  2CTC A;  2J9A A;  3V7Z A;  2ZEF A;  2QYV A;  1CX8 A;  3KHX A;  3B3T A;  2BCO A;  4MCP A;  2WZN A;  3NH5 A;  3PEI A;  3FEE A;  1CPX A;  4MHN A;  2PE3 A;  4OIW A;  4ZX9 A;  1Z2L A;  4BD9 A;  3RBU A;  4ONW A;  2PCU A;  1AYE A;  2PJ7 A;  4R76 A;  1TKJ A;  2GLJ A;  4PXB A;  4FAI A;  3FMC A;  3B7I A;  1BPM A;  5LYF A;  3KQX A;  3PRT A;  5LYI A;  2V8H A;  2AFZ A;  2AFS A;  4NGR A;  1UWY A;  5JM6 A;  2DEA A;  2GRE A;  3L2N A;  4R6T A;  3B35 A;  3B3C A;  5J1Q A;  4NGN A;  4UIB A;  3H8F A;  3PFE A;  3CT9 A;  3QNV A;  3T8W A;  3NA6 A;  2ZEL A;  4OC2 A;  1ELM P;  3SI2 A;  3GLJ A;  2JBK A;  2F7V A;  4WJB A;  2HC9 A;  4OME A;  1GYT A;  4X2T A;  4OID A;  5THW A;  1PCA A;  4F9V A;  3SJG A;  4P6Y A;  4ZX8 A;  1HDU A;  2PJB A;  1TF8 A;  3D4U A;  3B3W A;  4P4I A;  4P44 A;  4DYO A;  3S9N A;  3NFZ A;  4MHY A;  4WWV A;  2PJ8 A;  2EK8 A;  2ZED A;  4DJL A;  4IAV A;  1BPN A;  3BI1 A;  3WC5 A;  2V77 A;  1HEE A;  1F57 A;  3RZA A;  1M4L A;  1YSJ A;  1CG2 A;  1XJO A;  5HXD A;  4F9U A;  4NGT A;  4F8Z A;  1Z8L A;  3KHZ A;  2IMO A;  3K2K A;  5K8O A;  3BXM A;  1YW4 A;  5I4M A;  3GB0 A;  3SI0 A;  3IWW A;  4X8I A;  3FF3 A;  4NJQ A;  1VIX A;  2CF4 A;  4JZ0 A;  3MRU A;  5K8N A;  2XEJ A;  1CP7 A;  4NFR A;  5LRK A;  3PBB A;  4P4B A;  2PJ5 A;  3LMS A;  3SJF A;  3S9M A;  1KWM A;  1XMB A;  7CPA A;  3HUV A;  5JH9 A;  2EWB A;  5K8M A;  4OC0 A;  1VHO A;  3B3V A;  2WYR A;  2PJ4 A;  2ANP A;  4MCQ A;  2AFX A;  3SJX A;  3TC8 A;  2Q51 A;  1LAM A;  1LCP A;  2AFW A;  2RFH A;  2OOT A;  1TF9 A;  2JBJ A;  2O4H A;  1OBR A;  3D7H A;  2QJ8 A;  4YU9 A;  3V38 A;  1HDQ A;  1CBX A;  4EME A;  4P10 A;  3PB6 X;  3DGV A;  1QQ9 A; 
#chains in the Genus database with same CATH topology
 1IB1 E;  2VZY A;  2R7H A;  3DDD A;  2H5M A;  3FYN A;  2PR8 A;  2AFU A;  3TTH A;  3JRU A;  2VI7 A;  4A31 A;  1ZLH A;  4YRH A;  3KZW A;  3P2H A;  3BJ8 A;  3I9S A;  4LUA A;  3IFE A;  2OZH A;  5CBM A;  4KVM E;  3VAR A;  1ON0 A;  2YNC C;  2Z3N A;  2PJ0 A;  4W9Y A;  2V8V A;  1P4N A;  4FBE A;  1CM0 A;  4R87 A;  2ZOF A;  1S7K A;  2C6P A;  4UEE A;  1S60 A;  2Q4Z A;  1U6M A;  2ZEO A;  1XFO A;  3KAS A;  1PYT B;  4MFL A;  1YK3 A;  4P45 A;  4QC6 A;  2Z11 A;  2PJ1 A;  2NYQ A;  4Q7A A;  1RO5 A;  2CIJ A;  1MJA A;  5F48 A;  5IB9 A;  3BI0 A;  1S7F A;  4NEX A;  5K8P A;  1ZLI A;  3SI1 A;  4IK2 A;  5JQ4 A;  8CPA A;  1YVO A;  3IJ3 A;  2JDD A;  4UEZ A;  4JYW A;  1ARM A;  3FEC A;  3KQZ A;  4KZT A;  4QVT A;  4UFW A;  4TWE A;  1GHE A;  2YGW A;  2C1C A;  2V8D A;  3VAT A;  2C6G A;  4NGM A;  3D7F A;  1Y7E A;  3FJU A;  2ARH A;  3N5F A;  5DWM A;  1I12 A;  2XEI A;  3BHX A;  4JLY A;  4EVY A;  1JQG A;  1LOK A;  3FXT A;  5HVF A;  2Z0Z A;  5I0C A;  3GUX A;  3TX8 A;  4CAF A;  1FT7 A;  1I1D A;  1ZO0 A;  2I3C A;  3EO4 A;  5EMI A;  1CPS A;  1XEB A;  2ABZ A;  4HNY B;  3QAH A;  3IO1 A;  1TKH A;  4OC3 A;  3RYO A;  2PJ3 A;  3MN8 A;  3NH8 A;  3KL9 A;  4H6Z A;  2EBJ A;  2HUZ A;  2IJZ A;  3C26 A;  3KR5 A;  4O23 A;  3KR4 A;  3D7G A;  4MRI A;  3ISX A;  4MCR A;  4XPK A;  4ZBG A;  1Q2D A;  2PJ2 A;  1IID A;  4L89 A;  4NJR A;  4UFV A;  4PXD A;  4QUS A;  2B4D B;  4UF4 A;  4E0A A;  1IGB A;  3FH4 A;  2G3A A;  2I79 A;  3KI9 A;  4GXH A;  3GYA A;  3E0K A;  4M3S A;  4ZY0 A;  4FWU A;  5J8F A;  5KTA A;  4KLV A;  4PQA A;  2PJA A;  5LRJ A;  4P4D A;  2GAN A;  4X3R A;  5ELY A;  6CPA A;  2FIW A;  4R3L A;  3PB8 X;  4KSF A;  3IU1 A;  2Q43 A;  1NSA A;  4AVC A;  1A2Z A;  1QSR A;  2OB0 A;  3PBE A;  2XEF A;  4XNH C;  4H2K A;  4TNU A;  3R9G A;  1Z4E A;  1BLL E;  1ELL P;  2BO9 A;  3W91 A;  3NE7 A;  3PGP A;  3S6H A;  1R57 A;  3FVL A;  4C2Y A;  4PPZ A;  3KKW A;  4GM5 A;  4CAE A;  4A37 A;  1CJW A;  2G3T A;  1J4J A;  1IIC A;  4HPS A;  1BAV A;  2PRQ A;  2R8V A;  2REF A;  3DR8 A;  4IF5 A;  4UWJ A;  2ZEP A;  4A30 A;  2ZW7 A;  4XPD C;  3WAB A;  4L8A A;  3I1U A;  4UBR A;  4C2X A;  4E2A A;  3S6F A;  4II9 A;  3H8E A;  2AE6 A;  4MXU A;  2PRB A;  1MJB A;  2DPS A;  2XEG A;  2ZEE A;  3IIB A;  3IU2 A;  3FED A;  4UA3 A;  4CGP A;  2CTB A;  3NH4 A;  4FUU A;  3S9L A;  4AVA A;  2PIZ A;  1FY7 A;  1P0H A;  4A33 A;  1PU9 A;  1YME A;  3IEH A;  3B3S A;  3CPA A;  4ZY2 A;  2C27 A;  4MHZ A;  3RAM A;  2FCK A;  5HVH A;  4NSQ A;  3PFO A;  4R8F A;  1YLO A;  2FIA A;  3K9T A;  4MFQ A;  4XPL A;  2O28 A;  4H89 A;  4F0X A;  4CRY B;  3LAC A;  2VXK A;  4KOY A;  4OP4 A;  4UCM A;  2CY2 A;  5DS0 A;  3WT4 A;  3D2P A;  3D2M A;  2IQ6 A;  4R9M A;  1YLE A;  2PIY A;  4IUS A;  2DPT A;  2PVW A;  2PJ6 A;  3D7D A;  4Q36 A;  1LAN A;  1XIX A;  1ZG9 A;  2YND A;  4OC1 A;  2R1I A;  2YNE A;  4JD6 A;  4RUH A;  3TCV A;  5G20 A;  1DTD A;  2QML A;  2VL1 A;  2HV2 A;  3CDX A;  4UCN A;  1X12 A;  4P4E A;  1QSM A;  3V8I A;  2NMT A;  3B2Y A;  4MHP A;  1Z8W A;  3PB9 X;  2PJC A;  2ZEH A;  4NXY A;  1RXT A;  1VHS A;  2NSM A;  4Z65 A;  3CXS A;  4MFJ A;  4UCP A;  5EBV A;  2Q04 A;  4EFD A;  5JGF A;  1XRY A;  1Z8X A;  2REE A;  3BJ7 A;  4OLL A;  4ORF A;  4PXE A;  2POK A;  2O53 A;  3R95 A;  4FD7 A;  3D68 A;  1PUA A;  4YWY A;  4CS0 B;  2FSR A;  4PV6 A;  3TO9 A;  2HQY A;  1SQH A;  4F6A A;  1FNO A;  3EXN A;  3KGQ A;  4RS2 A;  4B14 A;  4NGS A;  1KZF A;  1ZG7 A;  4MMO A;  5AG6 A;  3K9U A;  1BO4 A;  2GU2 A;  3FX6 A;  1QMU A;  4OKO A;  4XPD B;  2B5G B;  2D4O A;  3UY5 A;  2VEZ A;  2G9D A;  4KOX A;  3DR6 A;  1S7N A;  3S6G A;  1R3N A;  1TKF A;  2X7B A;  3TO7 A;  4CRZ B;  2P6F A;  2VZZ A;  1YW6 A;  4ZY1 A;  3TE4 A;  4UEF A;  4EWT A;  3D67 A;  1DE4 C;  4PK2 A;  3FBU A;  1F2P A;  4KUA A;  2JEV A;  3LWU A;  2JEW A;  2Z3L A;  4JJX A;  1YGH A;  2J8M A;  4MY3 A;  4A95 A;  5HVG A;  1VHE A;  2G0B A;  3D3S A;  4K30 A;  5LYL A;  2FXF A;  2Z3K A;  4ZYQ A;  2GLF A;  3ISZ A;  4NGQ A;  1QSN A;  2WPX A;  4YGO A;  1EE3 P;  2HB6 A;  4A38 A;  1Y0R A;  1LAP A;  4LQ6 A;  5D8N A;  2ZEN A;  3CPX A;  3JUW A;  4NGP A;  4B13 A;  3LD2 A;  5IX3 A;  4UIA A;  2ZOG A;  1XF8 A;  3D66 A;  1H8L A;  4CPA A;  4ZI6 A;  1Y9K A;  5FVJ A;  2C6C A;  4BIN A;  3IC1 A;  4NF1 A;  2RC4 A;  3W6S A;  4E8O A;  3FNC A;  2Z3M A;  1JWQ A;  2BOA A;  2JLM A;  4A94 A;  4UFX A;  3PB7 X;  4BBH A;  4DUK A;  3DSB A;  2A4N A;  2AFM A;  3DNS A;  3CXQ A;  2B4D A;  5H86 A;  1QST A;  2VQY A;  4CAW A;  5D29 A;  4K3N A;  2OH1 A;  2P6E A;  1B6B A;  2QVP A;  4A39 A;  3TFY A;  4MCS A;  1R43 A;  2YNC A;  5E96 A;  2AFO A;  4AVB A;  2EVN A;  2B3V A;  1VKC A;  4QBJ A;  1F2O A;  2V8G A;  3R1K A;  3SJE A;  1IOI A;  1AMP A;  1KUV A;  2ZEM A;  4CYN A;  4P4F A;  4AG9 A;  2PR1 A;  1IY7 A;  2OR4 A;  1IYK A;  4B6Z A;  2B4B A;  4CAX A;  5A27 A;  2OZG A;  2Y0M A;  1Z5R A;  3IGR A;  1M44 A;  2EK9 A;  5AGE A;  3H8G A;  4CYO A;  4Y49 C;  1UFH A;  4LQG A;  1M4G A;  1IOF A;  1Y0Y A;  1N71 A;  1LFW A;  3WC6 A;  2BL1 A;  3G3S A;  4AXV A;  4R57 A;  1XBU A;  2F8H A;  2PC1 A;  2Z3O A;  4FD5 A;  4QB9 A;  2BUE A;  2Q7S A;  2RB7 A;  4CYP A;  2OZU A;  4R7M A;  3HLP A;  3DLJ A;  4B5P B;  1WK4 A;  1Y7R A;  3CZX A;  1VGY A;  5KTD A;  2PVV A;  4G1P A;  5CPA A;  5F09 A;  1CP6 A;  5IV0 A;  4B12 A;  2K5T A;  4P4J A;  1ZG8 A;  4MY0 A;  4OC5 A;  5LYD A;  2DXQ A;  2FVG A;  4A32 A;  5F46 A;  3JVN A;  1TXR A;  2ODF A;  2CNS A;  1ARL A;  2ZEG A;  3IWE A;  3VH9 A;  3PB4 X;  4PXC A;  5DWN A;  4OAD A;  4R3K A;  3WC7 A;  4KSA A;  5LRG A;  4KS9 A;  4CGO A;  1XMT A;  4M85 A;  4GS4 A;  4U5Y A;  1Q7L A;  5CNP A;  2PJ9 A;  1RTQ A;  4H6U A;  3ZJ0 A;  4OC4 A;  5C82 A;  2I00 A;  4CYQ A;  4IHM A;  4KSI A;  5G22 A;  2GFQ A;  2CTC A;  2J9A A;  3I3G A;  4AG7 A;  2IL4 A;  5BWA B;  3V7Z A;  4FD4 A;  1Z8T A;  5J8C A;  4AB7 A;  2EUI A;  2ZEF A;  2CNT A;  2QYV A;  1CX8 A;  3KHX A;  3B8G A;  3N7Z A;  4MFK A;  3B3T A;  2BCO A;  4MCP A;  3WR7 A;  4C2Z A;  5HMN A;  2WZN A;  3F5B A;  3NH5 A;  2GIV A;  2P6G A;  4U9Z A;  4F0Y A;  3PEI A;  2Q44 A;  3FEE A;  1CPX A;  4MHN A;  4HNW B;  1MJ9 A;  1M4I A;  2PE3 A;  4OIW A;  4ZX9 A;  1XOV A;  4FD6 A;  1Z2L A;  3T9Y A;  3GKR A;  4A2Z A;  4BD9 A;  3RBU A;  4ONW A;  4Y49 B;  4MBU A;  4XNH B;  3CXP A;  2OU2 A;  2PCU A;  1AYE A;  2PJ7 A;  2F5I A;  2WPW A;  3F8K A;  4J3G A;  2WUU A;  3GY9 A;  3NE8 A;  4R76 A;  1XE4 A;  1V0C A;  1TKJ A;  2GLJ A;  3GIU A;  2FL4 A;  4PXB A;  1YQE A;  4OAE A;  4FAI A;  2FS5 A;  3EY5 A;  3FMC A;  3B7I A;  3FB3 A;  4KOU A;  1BPM A;  1NSL A;  5LYF A;  3KQX A;  3SXO A;  3PRT A;  4HNX B;  5LYI A;  4JXQ A;  1OZP A;  2V8H A;  1AUG A;  2AFS A;  2AFZ A;  5GCN A;  4NGR A;  1YR0 A;  1UWY A;  2Q0Y A;  3BLN A;  4PSX A;  5F49 A;  3TO6 A;  5JM6 A;  2DEA A;  4X5K A;  1X10 A;  4KOV A;  5H84 A;  2GRE A;  3L2N A;  4R6T A;  3B35 A;  3B3C A;  3R9F A;  3TOA A;  3TT2 A;  5J1Q A;  4NGN A;  4UIB A;  3H8F A;  3PFE A;  3FIX A;  5IB0 A;  3QB8 A;  3CT9 A;  3D8P A;  2VBQ A;  3QNV A;  3R96 A;  1IU8 A;  1TIQ A;  2Z3P A;  1S7L A;  2PQ8 A;  3T8W A;  3ZZI A;  3NA6 A;  2ZEL A;  3MGD A;  4OC2 A;  2AJ6 A;  4KOR A;  1ELM P;  3SXN A;  3SI2 A;  4CGN A;  5AG5 A;  3GLJ A;  2JBK A;  2F7V A;  3OWC A;  2PDO A;  4WJB A;  1QSO A;  2HC9 A;  4OME A;  1M4D A;  1GYT A;  4X2T A;  4OID A;  4CGL A;  5THW A;  3RO0 A;  1IYL A;  1PCA A;  3T90 A;  4F9V A;  4CGM A;  3SJG A;  4P6Y A;  4KOT A;  1KUX A;  3JTK A;  5F47 A;  4ZX8 A;  1HDU A;  1L0C A;  2J8R A;  2PJB A;  5AG4 A;  4YFJ A;  5C88 A;  4M6G A;  1TF8 A;  3D4U A;  3RNZ A;  2GE3 A;  3B3W A;  1B87 A;  1Q2C A;  4P4I A;  4P44 A;  4DYO A;  1K4J A;  2PSW A;  3PZJ A;  3S9N A;  2Z10 A;  3NFZ A;  4MHY A;  4WWV A;  2PJ8 A;  1S3Z A;  2EK8 A;  2ZED A;  4KVO E;  4DJL A;  1S5K A;  2FE7 A;  4IAV A;  1BPN A;  1KUY A;  3SHP A;  1Z9U A;  3BI1 A;  5HH1 A;  2V77 A;  3WC5 A;  4C7H A;  4RN7 A;  1HEE A;  4MFZ A;  1F57 A;  2ATR A;  2CXA A;  3RZA A;  3VWE A;  1M4L A;  1BOB A;  1YSJ A;  1CG2 A;  1XJO A;  2DF5 A;  5HXD A;  4F9U A;  1Y9W A;  4NGT A;  4F8Z A;  5AG7 A;  4Q38 A;  1Z8L A;  3KHZ A;  2IMO A;  5ISV A;  3H5Z A;  3K2K A;  2Q4V A;  3BXM A;  5K8O A;  1YW4 A;  2J8N A;  3GB0 A;  5I4M A;  2QEC A;  3SI0 A;  4KOS A;  3IWW A;  4X8I A;  1MK4 A;  2BSW A;  3FF3 A;  3S6K A;  4NJQ A;  3EFA A;  1VIX A;  2ZXV A;  4LX9 A;  4B5P A;  3H4Q A;  3F0A A;  4MHD A;  2CF4 A;  4M6H A;  4M6I A;  2Q4Y A;  4B10 A;  3FRM A;  4JZ0 A;  4RI1 A;  3MRU A;  4KUB A;  5K8N A;  2Q7B A;  2XEJ A;  4I49 A;  2ZPA A;  2BEI A;  4NCZ A;  1CP7 A;  4NFR A;  2JDC A;  3TOB A;  5EC4 A;  3PBB A;  5LRK A;  2QIR A;  4CAV A;  4P4B A;  2PJ5 A;  3LMS A;  4MJ8 A;  3G8W A;  3SJF A;  1LRZ A;  3S9M A;  1KWM A;  1XMB A;  7CPA A;  4C68 A;  2CNM A;  2WSA A;  3HUV A;  4KLW A;  2ZW5 A;  2EWB A;  5JH9 A;  5K8M A;  4KOW A;  1M1D A;  5G21 A;  5JPH A;  4B11 A;  3VWD A;  4OC0 A;  4PK3 A;  1VHO A;  3QAY A;  3B3V A;  5KTC A;  2WYR A;  1YX0 A;  2PJ4 A;  4U9Y A;  3IWG A;  5G1Z A;  3W6X A;  2ZW4 A;  4BMH A;  2ANP A;  4JXR A;  4MCQ A;  1WWZ A;  2AFX A;  3PP9 A;  4HKF A;  3SJX A;  4DNC A;  3TC8 A;  2Q51 A;  4MI4 A;  1LAM A;  3EC4 A;  4B5O A;  4JWP A;  5A28 A;  1LCP A;  1Z4R A;  2AFW A;  2RFH A;  4PSW A;  2OOT A;  1TF9 A;  2JBJ A;  2O4H A;  3LOD A;  2P0W A;  2B3U A;  4C7I A;  3P2F A;  4MFP A;  1OBR A;  2R98 A;  3D7H A;  2QJ8 A;  4KVX A;  4YU9 A;  2EO8 A;  4ZGY B;  1NE9 A;  2KCW A;  2D4P A;  2ZW6 A;  3V38 A;  1HDQ A;  4UWI A;  1CBX A;  2B5G A;  4EME A;  1YVK A;  2FT0 A;  3A9L A;  1YRE A;  1I21 A;  1NMT A;  1Q2Y A;  4ONU A;  2B58 A;  3PB6 X;  3DGV A;  4P10 A;  1QQ9 A;  3R9E A; 
#chains in the Genus database with same CATH homology
 2AFU A;  3JRU A;  1ZLH A;  3KZW A;  3IFE A;  5CBM A;  3VAR A;  2PJ0 A;  4W9Y A;  2V8V A;  4FBE A;  2ZOF A;  4UEE A;  2C6P A;  2Q4Z A;  2ZEO A;  3KAS A;  1XFO A;  1PYT B;  4P45 A;  2PJ1 A;  2NYQ A;  4Q7A A;  2CIJ A;  5IB9 A;  3BI0 A;  5K8P A;  1ZLI A;  3SI1 A;  4IK2 A;  8CPA A;  3IJ3 A;  4UEZ A;  4JYW A;  1ARM A;  3FEC A;  3KQZ A;  4TWE A;  2C1C A;  2V8D A;  3VAT A;  2C6G A;  4NGM A;  3D7F A;  1Y7E A;  3FJU A;  3N5F A;  2XEI A;  3BHX A;  1JQG A;  1LOK A;  5HVF A;  3GUX A;  3TX8 A;  1FT7 A;  2I3C A;  1CPS A;  2ABZ A;  3IO1 A;  1TKH A;  4OC3 A;  2PJ3 A;  3MN8 A;  3NH8 A;  3KL9 A;  2IJZ A;  4O23 A;  3KR5 A;  3KR4 A;  3D7G A;  4MRI A;  3ISX A;  4MCR A;  2PJ2 A;  4NJR A;  4PXD A;  4UF4 A;  1IGB A;  3FH4 A;  3KI9 A;  4ZY0 A;  4FWU A;  4PQA A;  2PJA A;  5LRJ A;  4P4D A;  4X3R A;  5ELY A;  6CPA A;  3PB8 X;  2Q43 A;  1NSA A;  3PBE A;  2XEF A;  4H2K A;  4TNU A;  1BLL E;  1ELL P;  2BO9 A;  3FVL A;  4PPZ A;  4GM5 A;  4A37 A;  1BAV A;  2PRQ A;  2ZEP A;  3I1U A;  3H8E A;  4MXU A;  2XEG A;  2ZEE A;  3IIB A;  3FED A;  2CTB A;  3NH4 A;  4FUU A;  3S9L A;  2PIZ A;  1YME A;  3IEH A;  4ZY2 A;  3B3S A;  3CPA A;  3RAM A;  4MHZ A;  3WAB A;  5HVH A;  3PFO A;  4R8F A;  1YLO A;  3K9T A;  4OP4 A;  5DS0 A;  3WT4 A;  2IQ6 A;  2PIY A;  2PVW A;  2PJ6 A;  3D7D A;  1LAN A;  1ZG9 A;  4OC1 A;  4RUH A;  1DTD A;  2VL1 A;  3CDX A;  4P4E A;  3B2Y A;  4MHP A;  3PB9 X;  2PJC A;  2ZEH A;  2NSM A;  4Z65 A;  4EFD A;  5JGF A;  1XRY A;  4PXE A;  2POK A;  2O53 A;  3D68 A;  4YWY A;  1FNO A;  3KGQ A;  4NGS A;  1ZG7 A;  4MMO A;  2GU2 A;  4OKO A;  3FX6 A;  1QMU A;  2G9D A;  1R3N A;  1TKF A;  1YW6 A;  4ZY1 A;  4UEF A;  4EWT A;  3D67 A;  1DE4 C;  1F2P A;  3LWU A;  2JEW A;  5HVG A;  1VHE A;  5LYL A;  4ZYQ A;  2GLF A;  3ISZ A;  4NGQ A;  1EE3 P;  2HB6 A;  4A38 A;  1Y0R A;  1LAP A;  5D8N A;  2ZEN A;  3CPX A;  4NGP A;  4UIA A;  2ZOG A;  3D66 A;  1H8L A;  4CPA A;  4ZI6 A;  2C6C A;  3IC1 A;  2BOA A;  4A94 A;  4DUK A;  3PB7 X;  2AFM A;  5D29 A;  4K3N A;  2QVP A;  4A39 A;  4MCS A;  1R43 A;  2AFO A;  1F2O A;  2V8G A;  3SJE A;  1AMP A;  2ZEM A;  4P4F A;  1IY7 A;  2OR4 A;  4B6Z A;  1Z5R A;  2EK9 A;  3H8G A;  4LQG A;  1Y0Y A;  1LFW A;  3WC6 A;  4AXV A;  1XBU A;  2F8H A;  2RB7 A;  4R7M A;  3HLP A;  3DLJ A;  1VGY A;  2PVV A;  4G1P A;  5CPA A;  5F09 A;  1CP6 A;  4P4J A;  1ZG8 A;  4OC5 A;  5LYD A;  2FVG A;  1TXR A;  3VH9 A;  1ARL A;  2ZEG A;  3PB4 X;  4PXC A;  3WC7 A;  5LRG A;  1Q7L A;  2PJ9 A;  1RTQ A;  4OC4 A;  4IHM A;  4KSI A;  2CTC A;  2J9A A;  3V7Z A;  2ZEF A;  2QYV A;  1CX8 A;  3KHX A;  3B3T A;  2BCO A;  4MCP A;  2WZN A;  3NH5 A;  3PEI A;  3FEE A;  1CPX A;  4MHN A;  2PE3 A;  4OIW A;  4ZX9 A;  1Z2L A;  4BD9 A;  3RBU A;  4ONW A;  2PCU A;  1AYE A;  2PJ7 A;  4R76 A;  1TKJ A;  2GLJ A;  4PXB A;  4FAI A;  3FMC A;  3B7I A;  1BPM A;  5LYF A;  3KQX A;  3PRT A;  5LYI A;  2V8H A;  2AFZ A;  2AFS A;  4NGR A;  1UWY A;  5JM6 A;  2DEA A;  2GRE A;  3L2N A;  4R6T A;  3B35 A;  3B3C A;  5J1Q A;  4NGN A;  4UIB A;  3H8F A;  3PFE A;  3CT9 A;  3QNV A;  3T8W A;  3NA6 A;  2ZEL A;  4OC2 A;  1ELM P;  3SI2 A;  3GLJ A;  2JBK A;  2F7V A;  4WJB A;  2HC9 A;  4OME A;  1GYT A;  4X2T A;  4OID A;  5THW A;  1PCA A;  4F9V A;  3SJG A;  4P6Y A;  4ZX8 A;  1HDU A;  2PJB A;  1TF8 A;  3D4U A;  3B3W A;  4P4I A;  4P44 A;  4DYO A;  3S9N A;  3NFZ A;  4MHY A;  4WWV A;  2PJ8 A;  2EK8 A;  2ZED A;  4DJL A;  4IAV A;  1BPN A;  3BI1 A;  3WC5 A;  2V77 A;  1HEE A;  1F57 A;  3RZA A;  1M4L A;  1YSJ A;  1CG2 A;  1XJO A;  5HXD A;  4F9U A;  4NGT A;  4F8Z A;  1Z8L A;  3KHZ A;  2IMO A;  3K2K A;  5K8O A;  3BXM A;  1YW4 A;  5I4M A;  3GB0 A;  3SI0 A;  3IWW A;  4X8I A;  3FF3 A;  4NJQ A;  1VIX A;  2CF4 A;  4JZ0 A;  3MRU A;  5K8N A;  2XEJ A;  1CP7 A;  4NFR A;  5LRK A;  3PBB A;  4P4B A;  2PJ5 A;  3LMS A;  3SJF A;  3S9M A;  1KWM A;  1XMB A;  7CPA A;  3HUV A;  5JH9 A;  2EWB A;  5K8M A;  4OC0 A;  1VHO A;  3B3V A;  2WYR A;  2PJ4 A;  2ANP A;  4MCQ A;  2AFX A;  3SJX A;  3TC8 A;  2Q51 A;  1LAM A;  1LCP A;  2AFW A;  2RFH A;  2OOT A;  1TF9 A;  2JBJ A;  2O4H A;  1OBR A;  3D7H A;  2QJ8 A;  4YU9 A;  3V38 A;  1HDQ A;  1CBX A;  4EME A;  4P10 A;  3PB6 X;  3DGV A;  1QQ9 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...