3CXQA

Crystal structure of human glucosamine 6-phosphate n-acetyltransferase 1 bound to glcn6p
Total Genus 45
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
45
sequence length
182
structure length
182
Chain Sequence
KPDETPMFDPSLLKEVDWSQNTATFSPAISPTHPGEGLVLRPLCTADLNRGFFKVLGQLTETGVVSPEQFMKSFEHMKKSGDYYVTVVEDVTLGQIVATATLIIEHKFIHSCAKRGRVEDVVVSDECRGKQLGKLLLSTLTLLSKKLNCYKITLECLPQNVGFYKKFGYTVSEENYMCRRFL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords Glucosamine 6-phosphate N-acetyltransferase
publication title Acceptor substrate binding revealed by crystal structure of human glucosamine-6-phosphate N-acetyltransferase 1
pubmed doi rcsb
source organism Homo sapiens
total genus 45
structure length 182
sequence length 182
ec nomenclature ec 2.3.1.4: Glucosamine-phosphate N-acetyltransferase.
pdb deposition date 2008-04-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00583 Acetyltransf_1 Acetyltransferase (GNAT) family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.630.30 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Aminopeptidase 3cxqA01
4KOYA 5H84A 4KVOE 5H86A 2HQYA 4KORA 2PQ8A 3NE7A 4KOSA 3FB3A 1PUAA 4NCZA 4FD6A 4E0AA 4UA3A 2FXFA 4LUAA 4FD4A 4YRHA 1FY7A 4JD6A 3D3SA 4AVCA 2OH1A 3BJ8A 4YFJA 1Z4RA 2ZW5A 2VQYA 1VHSA 4OAEA 1CM0A 1S60A 1OZPA 3ZJ0A 1WWZA 1SQHA 2P6EA 2FIWA 4R87A 2NMTA 4H6ZA 2G3TA 2WPWA 2OB0A 3R9GA 5E96A 3IGRA 5EBVA 3CXPA 5HH1A 1RO5A 3TE4A 2FSRA 3P2HA 4KVXA 4PV6A 3R96A 1KZFA 3DNSA 4I49A 3D2PA 2BUEA 1N71A 2GIVA 1S7LA 1MK4A 3PGPA 4KUBA 3TCVA 3LD2A 3R95A 4HNWB 3BLNA 1IIDA 2KCWA 4R3LA 3QB8A 5JPHA 1IICA 2B5GA 4PSWA 4R9MA 3EFAA 2Q44A 4MY3A 1M4GA 2Q7BA 2C27A 3G3SA 3S6FA 1I12A 1Q2CA 2ZW6A 3DR6A 2B5GB 2OZHA 2OZUA 1RXTA 1NSLA 1YR0A 1Z9UA 1KUVA 5ISVA 1Y9KA 4MBUA 2OU2A 3VWEA 2HUZA 1YREA 1QSNA 2I79A 3P2FA 5C82A 2BEIA 4KOWA 2CNMA 3S6GA 3EY5A 4KLWA 5F49A 3T9YA 4EVYA 1ON0A 4KOUA 2Z0ZA 3C26A 4M85A 1U6MA 4JXQA 1Z4EA 2AE6A 2GE3A 3UY5A 2ZW7A 4ORFA 1IB1E 2WPXA 4KOTA 2ZPAA 2J8NA 4MI4A 4AB7A 4DNCA 2D4PA 3DSBA 2PRBA 4OLLA 1S7KA 3W6XA 1S5KA 2REFA 5JQ4A 2ARHA 1P4NA 1M4IA 2PDOA 3F0AA 3S6KA 5F46A 1BOBA 4L8AA 3W6SA 3R9EA 4PSXA 3JUWA 1M1DA 2FE7A 3FIXA 3FRMA 5CNPA 2DXQA 3T90A 1S7NA 3KKWA 3DDDA 4F6AA 1KUXA 1QSOA 2HV2A 2VEZA 3TFYA 2B4BA 5F48A 1GHEA 2JLMA 4YGOA 3TOAA 2FL4A 1P0HA 2P0WA 3EXNA 4B5OA 3EO4A 3LODA 3JVNA 4BMHA 2JDCA 3D8PA 1B6BA 4H89A 1MJ9A 1WK4A 1Q2YA 4QVTA 1XF8A 2ATRA 3R9FA 2IL4A 2VI7A 1YVKA 1J4JA 2BSWA 3GYAA 4MY0A 4UWJA 2JEVA 2VZYA 5IB0A 2FIAA 4JLYA 5C88A 3PZJA 4QB9A 4H6UA 3K9UA 2I00A 3G8WA 3PP9A 2CNTA 1L0CA 3N7ZA 3I9SA 4JWPA 5KTAA 2Q4VA 4KOXA 1LRZA 1I1DA 4U9ZA 4IF5A 4AVBA 4KLVA 2A4NA 1CJWA 4II9A 4HNXB 2Z10A 4XNHC 2G3AA 1UFHA 2J8MA 3SXNA 5KTCA 4RS2A 4B5PA 2K5TA 2ZW4A 2P6GA 3DR8A 4B5PB 5J8FA 2G0BA 4CAXA 3D2MA 4ONUA 5IV0A 4OADA 4IUSA 1Q2DA 2VBQA 4HNYB 2VZZA 3V8IA 3OWCA 5IX3A 4AG7A 3QAHA 2R7HA 2AJ6A 4ZBGA 2REEA 3MGDA 4E2AA 4KUAA 2QECA 2P6FA 3I3GA 4NSQA 4NXYA 1BO4A 3FBUA 5DWMA 3WR7A 5I0CA 2R98A 3CXSA 4JJXA 2VXKA 4CAWA 1I21A 1NMTA 2X7BA 4QC6A 1TIQA 2Q0YA 5DWNA 3TOBA 4NF1A 5GCNA 3E0KA 4QBJA 2OZGA 4KZTA 3SHPA 5EC4A 1Y9WA 2CY2A 3RYOA 4XPKA 3ZZIA 1XMTA 4E8OA 2QMLA 1PU9A 1XEBA 4NEXA 2J8RA 2R1IA 4FD5A 3R1KA 5F47A 2FS5A 1XE4A 4XPDB 3TT2A 4CS0B 1VKCA 4UBRA 3B8GA 3H4QA 1QSTA 4XPDC 1S7FA 4L89A 4CRZB 3FXTA 3FYNA 1XIXA 4JXRA 3TO9A 3IWGA 1YX0A 5J8CA 4U5YA 2B58A 1KUYA 2PR8A 2CNSA 1MJAA 4RI1A 2B4DA 3W91A 2ZXVA 1MJBA 2F5IA 5HMNA 1YK3A 1YVOA 4Y49B 2B3VA 4CAVA 3F5BA 2PC1A 4U9YA 2B4DB 2B3UA 4Y49C 4J3GA 1NE9A 1YLEA 2O28A 4PK2A 4MHDA 3TO6A 3TTHA 2FT0A 4HKFA 5FVJA 4K30A 2Y0MA 4QUSA 5KTDA 3VWDA 3TO7A 4GS4A 1K4JA 3SXOA 4XNHB 3BJ7A 2PR1A 2JDDA 4F0YA 2D4OA 2QIRA 2GANA 2BL1A 4AG9A 4KVME 4PK3A 1QSMA 3FNCA 2EVNA 4LX9A 2PSWA 3EC4A 1YGHA 2FCKA 3GY9A 4R3KA 4M3SA 1M44A 2Q04A 1M4DA 2EUIA 1IYKA 2H5MA 1QSRA 3F8KA 1R57A 4MJ8A 4X5KA 4CRYB 2RC4A 2Q4YA 2R8VA 4XPLA 1Y7RA 3GKRA 4UWIA 1IYLA 2Z11A 1B87A 1V0CA 3S6HA 4AVAA 1S3ZA 4R57A 4FD7A 3CXQA 4KOVA
chains in the Genus database with same CATH superfamily
1XMBA 4KOYA 4RUHA 1Z8WA 5H84A 4KVOE 1QQ9A 1IOFA 4X8IA 4Q36A 5H86A 2QVPA 2HQYA 4KORA 1Z8LA 2PQ8A 3NE7A 3H8FA 5CBMA 3HLPA 4A32A 4ZGYB 4KOSA 4A33A 3FB3A 3WT4A 1PUAA 4NCZA 2QYVA 4FD6A 4E0AA 4UA3A 2FXFA 4LUAA 2V8HA 4C2YA 2JEWA 4FD4A 4MHZA 4ZX8A 4YRHA 5ELYA 2CTBA 5LYFA 1FY7A 4JD6A 3D3SA 4AVCA 2OH1A 3BJ8A 4YFJA 2V77A 5K8PA 1HDUA 3RZAA 3SI0A 3FVLA 1RTQA 1Z4RA 4C7HA 3HUVA 2ZW5A 2PJ4A 1VHSA 2VQYA 2V8DA 4OAEA 1CM0A 1S60A 1OZPA 5LRJA 1FNOA 5HVFA 2Z3KA 4R8FA 3ZJ0A 4FAIA 5AG7A 1WWZA 3PRTA 1LAMA 3A9LA 2PJ6A 4LQ6A 1SQHA 1YLOA 4P4JA 3SJGA 2Q7SA 4CGLA 4DJLA 2IJZA 3K9TA 2P6EA 2VL1A 1ARMA 4OC4A 1IOIA 2FIWA 3FMCA 4A30A 2O53A 4R87A 2XEIA 2NMTA 4H6ZA 1CBXA 3KGQA 1GYTA 1A2ZA 2G3TA 4PXDA 2WPWA 2OB0A 3R9GA 3D7FA 3IIBA 5E96A 3IGRA 5EBVA 1QMUA 3CXPA 2EK9A 1KWMA 2C1CA 5HH1A 4ZY0A 3H5ZA 4NGRA 1RO5A 4BBHA 3TE4A 3H8EA 2FSRA 3FH4A 3P2HA 1VHOA 3MN8A 4KVXA 4PXCA 3NFZA 2PIYA 1PYTB 4PV6A 4BD9A 2IMOA 5JGFA 3R96A 1KZFA 4A95A 4CYNA 5JH9A 3DNSA 4I49A 1CPXA 2BUEA 3D2PA 1N71A 1R43A 3JTKA 4W9YA 2GIVA 2Q4ZA 2Z3PA 1S7LA 1MK4A 3PGPA 4KUBA 2AFXA 3TCVA 3B3VA 3LD2A 5G20A 1ZG7A 1VIXA 3WABA 4BINA 3R95A 4HNWB 3CZXA 2G9DA 3PBEA 2PJ1A 3BLNA 4PXEA 4ZY2A 1Z8XA 3VH9A 2PIZA 3LACA 1IIDA 2KCWA 4R3LA 3QB8A 3FX6A 5JPHA 1IICA 3D7HA 2B5GA 3N5FA 4PSWA 4R9MA 3EFAA 2Q44A 4MY3A 1M4GA 2Q7BA 3WC6A 5LYIA 2C27A 3G3SA 4JYWA 4UFXA 3S6FA 1Q2CA 1I12A 2ZW6A 4UCNA 2AFZA 3PFOA 2CTCA 2XEFA 3DR6A 2B5GB 2OZHA 2OZUA 3TX8A 1RXTA 4R76A 1VGYA 3S9MA 3DLJA 1NSLA 4CGPA 1YR0A 1Z9UA 5JM6A 1KUVA 3FEEA 4MHNA 5ISVA 1Y9KA 4WJBA 4EMEA 2AFWA 2F7VA 4MBUA 2OU2A 1X10A 2EWBA 3VWEA 1TXRA 2HUZA 1M4LA 1YREA 1QSNA 2I79A 3P2FA 3IWWA 3WC7A 5C82A 4MCQA 2BEIA 5BWAB 1F2OA 2CNMA 4KOWA 2WUUA 3D7DA 3S6GA 1UWYA 2V8VA 2Z3OA 3EY5A 4KLWA 5F49A 3T9YA 4EVYA 4KSAA 4MFZA 2ZOFA 1ON0A 2ZENA 4KOUA 3SJXA 1Z2LA 4OC1A 1PCAA 5THWA 2Z0ZA 4A37A 4UEFA 1BLLE 3C26A 3PEIA 4M85A 4MMOA 1U6MA 1ZO0A 2ZEFA 4B13A 1F2PA 1DTDA 4JXQA 4O23A 4CAEA 1Z4EA 2AE6A 2GE3A 4Z65A 1XBUA 3UY5A 4C2XA 4OP4A 3GB0A 4OC5A 2ZW7A 4Q7AA 3SJEA 1Z8TA 4NGNA 1IB1E 4ORFA 3VATA 2OR4A 2WPXA 2ZEPA 3PB4X 4KS9A 4MXUA 5AG6A 4KOTA 2ZPAA 2F8HA 4NGPA 2J8NA 4MI4A 2ZEGA 1ELMP 4CYOA 4AXVA 4AB7A 3IO1A 4NGMA 4DNCA 2D4PA 3DSBA 2ZOGA 3RAMA 4UEEA 2PRBA 4OLLA 1S7KA 2YGWA 2O4HA 3W6XA 3IC1A 3RNZA 2RFHA 3MRUA 1S5KA 3KQZA 4A94A 3PB9X 2PJ8A 2PJ7A 4LQGA 3PFEA 2REFA 1CX8A 2ODFA 4DUKA 5JQ4A 2FVGA 4B6ZA 4IAVA 2ARHA 2PJ9A 3B7IA 3KHXA 1P4NA 1M4IA 2PDOA 3F0AA 3S6KA 4CPAA 2C6PA 3IJ3A 5F46A 3KASA 1BOBA 4L8AA 4B14A 3W6SA 4HPSA 4IK2A 3R9EA 4PSXA 3JUWA 1M1DA 5I4MA 2FE7A 3FIXA 3B3TA 3D66A 5K8MA 3FRMA 2DF5A 5CNPA 1IY7A 2DXQA 3NA6A 1S7NA 3KKWA 4MCSA 3T90A 4A2ZA 3IEHA 3DDDA 3VARA 4PXBA 4F6AA 1DE4C 1KUXA 1QSOA 2HV2A 2VEZA 4M6GA 4ZY1A 3TFYA 2B4BA 3NH5A 5F48A 1GHEA 2JLMA 4YGOA 4B10A 3TOAA 2FL4A 1P0HA 2P0WA 3PB7X 3EXNA 4IHMA 4B5OA 3EO4A 4F8ZA 3LODA 3JVNA 2PJAA 1IGBA 2CF4A 5G21A 4BMHA 2XEGA 1XOVA 2GFQA 1TKFA 2JDCA 1B6BA 3D8PA 4JZ0A 4H89A 1MJ9A 3B2YA 3B3CA 3IFEA 1WK4A 1Q2YA 4QVTA 3FF3A 4OIWA 5LYDA 1XF8A 2ATRA 2ZEEA 2ZEDA 4MFPA 3R9FA 2BO9A 2IL4A 2VI7A 3FEDA 1YVKA 1J4JA 4GXHA 1LOKA 3V38A 3H8GA 2BSWA 4UCPA 4YWYA 4NGTA 1XFOA 4FBEA 3KL9A 4X3RA 3GYAA 4B11A 4MY0A 3B3SA 4UWJA 2I3CA 2JEVA 2VZYA 1XRYA 4UIAA 5IB0A 2FIAA 4JLYA 5C88A 2Q51A 3LMSA 3S9NA 3PZJA 4QB9A 4H6UA 3K9UA 1YQEA 2GU2A 2I00A 3G8WA 4WWVA 3WC5A 1ZG9A 3PP9A 8CPAA 2CNTA 3JRUA 1L0CA 2ABZA 3KR5A 4UCMA 3N7ZA 2GREA 2AFUA 3I9SA 3RBUA 4JWPA 1CPSA 5KTAA 2Q4VA 3GLJA 4P4DA 4KOXA 1LRZA 1I1DA 4ONWA 4U9ZA 5LYLA 1ARLA 4KOVA 4OKOA 2JBKA 4IF5A 4AVBA 2A4NA 4KLVA 2NSMA 1CJWA 1Y0YA 2YNDA 4II9A 4HNXB 2Z10A 4NJRA 4XNHC 4EWTA 2EBJA 1ZLHA 4A38A 3KR4A 2BOAA 3CT9A 2G3AA 3IU2A 2PJCA 1IU8A 2J8MA 1Y0RA 5LRGA 4M6IA 3SXNA 5KTCA 4RS2A 1AMPA 2ZEHA 2K5TA 3D68A 4B5PA 6CPAA 2PRQA 2C6GA 4PQAA 4P45A 2AFSA 4UFVA 4R7MA 3NH4A 2ZW4A 1Z5RA 3KZWA 3TC8A 2P6GA 4CAFA 3DR8A 3BHXA 3FJUA 4CGOA 4B5PB 5J8FA 2G0BA 3CDXA 2AFOA 4UEZA 3D2MA 4CAXA 3BI1A 1TF9A 2WZNA 4ONUA 5IV0A 2CXAA 2PE3A 2GLJA 4OADA 4IUSA 5D29A 5A27A 1Q2DA 2VBQA 1ZLIA 1X12A 4HNYB 2VZZA 4NJQA 5G22A 3PB8X 1TKJA 3V8IA 2ZEOA 1BPMA 5AG4A 3OWCA 5IX3A 4AG7A 3RO0A 4UF4A 3QAHA 2R7HA 2WYRA 2AJ6A 4ZBGA 2REEA 3PB6X 3MGDA 2OOTA 1EE3P 3S9LA 4A39A 2PJ3A 4E2AA 2QECA 2P6FA 3I3GA 4KUAA 4NSQA 4NXYA 2PJ2A 4KSIA 1BO4A 3FBUA 5DWMA 4P4EA 3WR7A 4A31A 5I0CA 2R98A 3CXSA 2NYQA 4JJXA 5IB9A 5CPAA 2VXKA 4CAWA 1I21A 1NMTA 2DEAA 2X7BA 4QC6A 1TIQA 2Q0YA 5DWNA 3QAYA 2Z3LA 3TOBA 3ISZA 4OC3A 4CYPA 3KI9A 1BAVA 3T8WA 4NF1A 3FECA 5HVHA 5GCNA 3E0KA 1JWQA 4MFJA 3KQXA 4YU9A 4C2ZA 3KHZA 4QBJA 1LCPA 1YW6A 2OZGA 5A28A 4UIBA 3D67A 5LRKA 5J1QA 4KZTA 3SHPA 4TWEA 5AG5A 1Y9WA 2CY2A 2PJ5A 5EC4A 4XPKA 4TNUA 3LWUA 1BPNA 4R6TA 3RYOA 3ZZIA 1XMTA 3B35A 4E8OA 4CGNA 2QMLA 1PU9A 3V7ZA 3QNVA 1XEBA 2EO8A 4NEXA 5F09A 2J8RA 2R1IA 5K8NA 3PBBA 4FD5A 3R1KA 1CP6A 4OMEA 5F47A 4ZI6A 4B12A 3D4UA 2FS5A 1JQGA 5G1ZA 1XE4A 3BI0A 1NSAA 3BXMA 2ANPA 4XPDB 1LFWA 3GUXA 3TT2A 4CS0B 1VKCA 3GIUA 4MRIA 4UBRA 3B8GA 4ZX9A 4ZYQA 3H4QA 2YNEA 4CYQA 1QSTA 4K3NA 4FUUA 4XPDC 4EFDA 1LANA 1S7FA 2PJBA 4L89A 4Q38A 4CRZB 3FXTA 4G1PA 3FYNA 1XIXA 4JXRA 3TO9A 3IWGA 1F57A 1YX0A 2EK8A 2JBJA 4U5YA 2B58A 5J8CA 1KUYA 2PR8A 4KSFA 2CNSA 1MJAA 4RI1A 2B4DA 5D8NA 2HB6A 2PJ0A 5DS0A 1H8LA 7CPAA 3W91A 2ZXVA 1MJBA 2AFMA 1YSJA 1ZG8A 2F5IA 2XEJA 2DPTA 5HMNA 4P10A 1YK3A 4X2TA 1YVOA 4Y49B 4C68A 2B3VA 5HXDA 4OC0A 2BCOA 4NGQA 4CAVA 3F5BA 2PC1A 3I1UA 2B4DB 4U9YA 2Z3MA 2B3UA 4MHPA 4RN7A 4Y49C 4DYOA 2RB7A 5AGEA 1YMEA 4J3GA 1NE9A 1AYEA 1YLEA 1YW4A 2O28A 4PK2A 4P44A 3NE8A 3IU1A 1AUGA 1ELLP 4MHDA 5K8OA 3TO6A 3SJFA 3TTHA 4C7IA 2FT0A 4HKFA 5FVJA 4PPZA 1TF8A 2CIJA 4K30A 2Y0MA 1Y7EA 4OIDA 3IWEA 4QUSA 5KTDA 3VWDA 4CGMA 4OC2A 3TO7A 4F9UA 3ISXA 4GS4A 3D7GA 4MFQA 4F9VA 1K4JA 1FT7A 4MCRA 3SXOA 4XNHB 3BJ7A 2PR1A 2JDDA 4F0YA 1HDQA 5EMIA 2D4OA 2QIRA 2GANA 4MCPA 2QJ8A 3DGVA 1CG2A 3B3WA 4P4IA 1VHEA 5HVGA 1TKHA 2BL1A 2J9AA 4AG9A 4KVME 4PK3A 4F0XA 1QSMA 2ZELA 3FNCA 2EVNA 4NFRA 1R3NA 4LX9A 2PSWA 3EC4A 1YGHA 2YNCA 4MFLA 2FCKA 2ZEMA 3GY9A 2WSAA 4NGSA 1OBRA 4R3KA 4M3SA 1M44A 2V8GA 2Q04A 1LAPA 1M4DA 2Z3NA 2EUIA 4M6HA 1IYKA 2H5MA 4UFWA 4P4BA 3NH8A 1CP7A 1XJOA 4P4FA 1QSRA 3F8KA 4MHYA 2C6CA 1R57A 1Q7LA 4MJ8A 4X5KA 2POKA 4CRYB 2RC4A 2Q4YA 2R8VA 2DPSA 4XPLA 2YNCC 2Q43A 4MFKA 1Y7RA 3GKRA 2GLFA 4UWIA 1IYLA 2PVWA 2Z11A 1B87A 1V0CA 3CPXA 3S6HA 4AVAA 1S3ZA 4R57A 4FWUA 3CPAA 2HC9A 3L2NA 3SI1A 3SI2A 2PCUA 4FD7A 4H2KA 2IQ6A 4P6YA 4GM5A 3CXQA 2PVVA 1HEEA 3K2KA 1UFHA
chains in the Genus database with same CATH topology
4KOYA 5H84A 4KVOE 4Q36A 5H86A 2HQYA 4KORA 2PQ8A 3NE7A 4A32A 4ZGYB 4KOSA 4A33A 3FB3A 1PUAA 4NCZA 4FD6A 4E0AA 4UA3A 2FXFA 4LUAA 4C2YA 4FD4A 4YRHA 1FY7A 4JD6A 3D3SA 4AVCA 2OH1A 3BJ8A 4YFJA 1Z4RA 4C7HA 2ZW5A 2VQYA 1VHSA 4OAEA 1CM0A 1S60A 1OZPA 2Z3KA 3ZJ0A 5AG7A 1WWZA 3A9LA 1SQHA 4CGLA 2P6EA 4A30A 2FIWA 4R87A 4B10A 2NMTA 4H6ZA 2G3TA 2WPWA 2OB0A 3R9GA 5E96A 3IGRA 5EBVA 3CXPA 5HH1A 3H5ZA 1RO5A 4BBHA 3TE4A 2FSRA 3P2HA 4KVXA 4PV6A 3R96A 1KZFA 4A95A 4CYNA 3DNSA 4I49A 3D2PA 2BUEA 1N71A 3JTKA 2GIVA 2Z3PA 1S7LA 1MK4A 3PGPA 4KUBA 3TCVA 3LD2A 5G20A 3R95A 4HNWB 3BLNA 1IIDA 2KCWA 4R3LA 3QB8A 5JPHA 1IICA 2B5GA 4PSWA 4R9MA 3EFAA 2Q44A 4MY3A 1M4GA 2Q7BA 2C27A 3G3SA 4UFXA 3S6FA 1I12A 1Q2CA 2ZW6A 4UCNA 3DR6A 2B5GB 2OZHA 2OZUA 1RXTA 1NSLA 4CGPA 1YR0A 1Z9UA 1KUVA 5ISVA 1Y9KA 4MBUA 2OU2A 3VWEA 2HUZA 1YREA 1QSNA 2I79A 3P2FA 5C82A 2BEIA 5BWAB 4KOWA 2CNMA 2WUUA 3S6GA 2Z3OA 3EY5A 4KLWA 5F49A 3T9YA 4EVYA 4KSAA 4MFZA 1ON0A 4KOUA 2Z0ZA 3C26A 4M85A 1U6MA 1ZO0A 4B13A 4JXQA 4CAEA 1Z4EA 2AE6A 2GE3A 3UY5A 4C2XA 2ZW7A 4ORFA 1IB1E 2WPXA 4KS9A 5AG6A 4KOTA 2ZPAA 2J8NA 4MI4A 4CYOA 4AB7A 4DNCA 2D4PA 3DSBA 2PRBA 4OLLA 1S7KA 2YGWA 3W6XA 1S5KA 2REFA 5JQ4A 2ARHA 1P4NA 1M4IA 2PDOA 3F0AA 3S6KA 5F46A 1BOBA 4L8AA 4B14A 3W6SA 3R9EA 4PSXA 3JUWA 1M1DA 2FE7A 3FIXA 3FRMA 5CNPA 2DXQA 3T90A 1S7NA 3KKWA 4A2ZA 3DDDA 4F6AA 1KUXA 1QSOA 2HV2A 2VEZA 3TFYA 2B4BA 5F48A 1GHEA 2JLMA 4YGOA 3TOAA 2FL4A 1P0HA 2P0WA 3EXNA 4B5OA 3EO4A 3LODA 3JVNA 5G21A 4BMHA 2JDCA 3D8PA 1B6BA 4H89A 1MJ9A 1WK4A 1Q2YA 4QVTA 1XF8A 2ATRA 4MFPA 3R9FA 2IL4A 2VI7A 1YVKA 1J4JA 2BSWA 4UCPA 4B11A 3GYAA 4MY0A 4UWJA 2JEVA 2VZYA 5IB0A 2FIAA 4JLYA 5C88A 3PZJA 4QB9A 4H6UA 3K9UA 2I00A 3G8WA 3PP9A 2CNTA 1L0CA 4UCMA 3N7ZA 3I9SA 4JWPA 5KTAA 2Q4VA 4KOXA 1LRZA 1I1DA 4U9ZA 4KOVA 4IF5A 4AVBA 2A4NA 4KLVA 1CJWA 2YNDA 4II9A 4HNXB 2Z10A 4XNHC 2G3AA 3IU2A 2J8MA 3SXNA 5KTCA 4RS2A 4B5PA 2K5TA 4UFVA 2ZW4A 2P6GA 4CAFA 3DR8A 4CGOA 4B5PB 5J8FA 2G0BA 4CAXA 3D2MA 4ONUA 5IV0A 2CXAA 4OADA 5A27A 4IUSA 1Q2DA 2VBQA 4HNYB 2VZZA 5G22A 5AG4A 3V8IA 3OWCA 5IX3A 4AG7A 3QAHA 2R7HA 2AJ6A 4ZBGA 2REEA 3MGDA 4E2AA 2QECA 2P6FA 3I3GA 4KUAA 4NSQA 4NXYA 3FBUA 1BO4A 5DWMA 3WR7A 4A31A 5I0CA 2R98A 3CXSA 4JJXA 2VXKA 4CAWA 1I21A 1NMTA 2X7BA 4QC6A 1TIQA 2Q0YA 5DWNA 3TOBA 2Z3LA 4CYPA 4NF1A 5GCNA 3E0KA 4MFJA 4C2ZA 4QBJA 5A28A 2OZGA 4KZTA 3SHPA 5EC4A 5AG5A 1Y9WA 2CY2A 3RYOA 4XPKA 3ZZIA 1XMTA 4E8OA 4CGNA 2QMLA 1PU9A 1XEBA 4NEXA 2J8RA 2R1IA 4FD5A 3R1KA 5F47A 4B12A 2FS5A 5G1ZA 1XE4A 4XPDB 3TT2A 4CS0B 1VKCA 4UBRA 3B8GA 3H4QA 2YNEA 1QSTA 4XPDC 4Q38A 1S7FA 4L89A 4CRZB 3FXTA 3FYNA 1XIXA 4JXRA 3TO9A 3IWGA 1YX0A 5J8CA 4U5YA 2B58A 1KUYA 2PR8A 4KSFA 2CNSA 1MJAA 4RI1A 2B4DA 3W91A 2ZXVA 1MJBA 2F5IA 5HMNA 2DPTA 1YK3A 1YVOA 4Y49B 4C68A 2B3VA 4CAVA 3F5BA 2PC1A 4U9YA 2B4DB 2Z3MA 2B3UA 4Y49C 5AGEA 4J3GA 1NE9A 1YLEA 2O28A 4PK2A 3IU1A 4MHDA 3TO6A 3TTHA 4C7IA 2FT0A 4HKFA 5FVJA 4K30A 2Y0MA 3IWEA 4QUSA 5KTDA 3VWDA 4CGMA 3TO7A 4GS4A 4MFQA 1K4JA 3SXOA 4XNHB 3BJ7A 2PR1A 2JDDA 4F0YA 2D4OA 2QIRA 2GANA 2BL1A 4AG9A 4KVME 4PK3A 4F0XA 1QSMA 3FNCA 2EVNA 4LX9A 2PSWA 3EC4A 1YGHA 2YNCA 4MFLA 2FCKA 3GY9A 2WSAA 4R3KA 4M3SA 1M44A 2Q04A 1M4DA 2Z3NA 2EUIA 1IYKA 2H5MA 4UFWA 1QSRA 3F8KA 1R57A 4MJ8A 4X5KA 4CRYB 2RC4A 2Q4YA 2R8VA 2DPSA 4XPLA 2YNCC 4MFKA 1Y7RA 3GKRA 4UWIA 1IYLA 2Z11A 1B87A 1V0CA 3S6HA 4AVAA 1S3ZA 4R57A 4CYQA 4FD7A 3CXQA 1UFHA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4KOY A;  5H84 A;  4KVO E;  5H86 A;  2HQY A;  4KOR A;  2PQ8 A;  3NE7 A;  4KOS A;  3FB3 A;  1PUA A;  4NCZ A;  4FD6 A;  4E0A A;  4UA3 A;  2FXF A;  4LUA A;  4FD4 A;  4YRH A;  1FY7 A;  4JD6 A;  3D3S A;  4AVC A;  2OH1 A;  3BJ8 A;  4YFJ A;  1Z4R A;  2ZW5 A;  2VQY A;  1VHS A;  4OAE A;  1CM0 A;  1S60 A;  1OZP A;  3ZJ0 A;  1WWZ A;  1SQH A;  2P6E A;  2FIW A;  4R87 A;  2NMT A;  4H6Z A;  2G3T A;  2WPW A;  2OB0 A;  3R9G A;  5E96 A;  3IGR A;  5EBV A;  3CXP A;  5HH1 A;  1RO5 A;  3TE4 A;  2FSR A;  3P2H A;  4KVX A;  4PV6 A;  3R96 A;  1KZF A;  3DNS A;  4I49 A;  3D2P A;  2BUE A;  1N71 A;  2GIV A;  1S7L A;  1MK4 A;  3PGP A;  4KUB A;  3TCV A;  3LD2 A;  3R95 A;  4HNW B;  3BLN A;  1IID A;  2KCW A;  4R3L A;  3QB8 A;  5JPH A;  1IIC A;  2B5G A;  4PSW A;  4R9M A;  3EFA A;  2Q44 A;  4MY3 A;  1M4G A;  2Q7B A;  2C27 A;  3G3S A;  3S6F A;  1I12 A;  1Q2C A;  2ZW6 A;  3DR6 A;  2B5G B;  2OZH A;  2OZU A;  1RXT A;  1NSL A;  1YR0 A;  1Z9U A;  1KUV A;  5ISV A;  1Y9K A;  4MBU A;  2OU2 A;  3VWE A;  2HUZ A;  1YRE A;  1QSN A;  2I79 A;  3P2F A;  5C82 A;  2BEI A;  4KOW A;  2CNM A;  3S6G A;  3EY5 A;  4KLW A;  5F49 A;  3T9Y A;  4EVY A;  1ON0 A;  4KOU A;  2Z0Z A;  3C26 A;  4M85 A;  1U6M A;  4JXQ A;  1Z4E A;  2AE6 A;  2GE3 A;  3UY5 A;  2ZW7 A;  4ORF A;  1IB1 E;  2WPX A;  4KOT A;  2ZPA A;  2J8N A;  4MI4 A;  4AB7 A;  4DNC A;  2D4P A;  3DSB A;  2PRB A;  4OLL A;  1S7K A;  3W6X A;  1S5K A;  2REF A;  5JQ4 A;  2ARH A;  1P4N A;  1M4I A;  2PDO A;  3F0A A;  3S6K A;  5F46 A;  1BOB A;  4L8A A;  3W6S A;  3R9E A;  4PSX A;  3JUW A;  1M1D A;  2FE7 A;  3FIX A;  3FRM A;  5CNP A;  2DXQ A;  3T90 A;  1S7N A;  3KKW A;  3DDD A;  4F6A A;  1KUX A;  1QSO A;  2HV2 A;  2VEZ A;  3TFY A;  2B4B A;  5F48 A;  1GHE A;  2JLM A;  4YGO A;  3TOA A;  2FL4 A;  1P0H A;  2P0W A;  3EXN A;  4B5O A;  3EO4 A;  3LOD A;  3JVN A;  4BMH A;  2JDC A;  3D8P A;  1B6B A;  4H89 A;  1MJ9 A;  1WK4 A;  1Q2Y A;  4QVT A;  1XF8 A;  2ATR A;  3R9F A;  2IL4 A;  2VI7 A;  1YVK A;  1J4J A;  2BSW A;  3GYA A;  4MY0 A;  4UWJ A;  2JEV A;  2VZY A;  5IB0 A;  2FIA A;  4JLY A;  5C88 A;  3PZJ A;  4QB9 A;  4H6U A;  3K9U A;  2I00 A;  3G8W A;  3PP9 A;  2CNT A;  1L0C A;  3N7Z A;  3I9S A;  4JWP A;  5KTA A;  2Q4V A;  4KOX A;  1LRZ A;  1I1D A;  4U9Z A;  4IF5 A;  4AVB A;  4KLV A;  2A4N A;  1CJW A;  4II9 A;  4HNX B;  2Z10 A;  4XNH C;  2G3A A;  1UFH A;  2J8M A;  3SXN A;  5KTC A;  4RS2 A;  4B5P A;  2K5T A;  2ZW4 A;  2P6G A;  3DR8 A;  4B5P B;  5J8F A;  2G0B A;  4CAX A;  3D2M A;  4ONU A;  5IV0 A;  4OAD A;  4IUS A;  1Q2D A;  2VBQ A;  4HNY B;  2VZZ A;  3V8I A;  3OWC A;  5IX3 A;  4AG7 A;  3QAH A;  2R7H A;  2AJ6 A;  4ZBG A;  2REE A;  3MGD A;  4E2A A;  4KUA A;  2QEC A;  2P6F A;  3I3G A;  4NSQ A;  4NXY A;  1BO4 A;  3FBU A;  5DWM A;  3WR7 A;  5I0C A;  2R98 A;  3CXS A;  4JJX A;  2VXK A;  4CAW A;  1I21 A;  1NMT A;  2X7B A;  4QC6 A;  1TIQ A;  2Q0Y A;  5DWN A;  3TOB A;  4NF1 A;  5GCN A;  3E0K A;  4QBJ A;  2OZG A;  4KZT A;  3SHP A;  5EC4 A;  1Y9W A;  2CY2 A;  3RYO A;  4XPK A;  3ZZI A;  1XMT A;  4E8O A;  2QML A;  1PU9 A;  1XEB A;  4NEX A;  2J8R A;  2R1I A;  4FD5 A;  3R1K A;  5F47 A;  2FS5 A;  1XE4 A;  4XPD B;  3TT2 A;  4CS0 B;  1VKC A;  4UBR A;  3B8G A;  3H4Q A;  1QST A;  4XPD C;  1S7F A;  4L89 A;  4CRZ B;  3FXT A;  3FYN A;  1XIX A;  4JXR A;  3TO9 A;  3IWG A;  1YX0 A;  5J8C A;  4U5Y A;  2B58 A;  1KUY A;  2PR8 A;  2CNS A;  1MJA A;  4RI1 A;  2B4D A;  3W91 A;  2ZXV A;  1MJB A;  2F5I A;  5HMN A;  1YK3 A;  1YVO A;  4Y49 B;  2B3V A;  4CAV A;  3F5B A;  2PC1 A;  4U9Y A;  2B4D B;  2B3U A;  4Y49 C;  4J3G A;  1NE9 A;  1YLE A;  2O28 A;  4PK2 A;  4MHD A;  3TO6 A;  3TTH A;  2FT0 A;  4HKF A;  5FVJ A;  4K30 A;  2Y0M A;  4QUS A;  5KTD A;  3VWD A;  3TO7 A;  4GS4 A;  1K4J A;  3SXO A;  4XNH B;  3BJ7 A;  2PR1 A;  2JDD A;  4F0Y A;  2D4O A;  2QIR A;  2GAN A;  2BL1 A;  4AG9 A;  4KVM E;  4PK3 A;  1QSM A;  3FNC A;  2EVN A;  4LX9 A;  2PSW A;  3EC4 A;  1YGH A;  2FCK A;  3GY9 A;  4R3K A;  4M3S A;  1M44 A;  2Q04 A;  1M4D A;  2EUI A;  1IYK A;  2H5M A;  1QSR A;  3F8K A;  1R57 A;  4MJ8 A;  4X5K A;  4CRY B;  2RC4 A;  2Q4Y A;  2R8V A;  4XPL A;  1Y7R A;  3GKR A;  4UWI A;  1IYL A;  2Z11 A;  1B87 A;  1V0C A;  3S6H A;  4AVA A;  1S3Z A;  4R57 A;  4FD7 A;  3CXQ A;  4KOV A; 
#chains in the Genus database with same CATH topology
 1XMB A;  4KOY A;  4RUH A;  1Z8W A;  5H84 A;  4KVO E;  1QQ9 A;  1IOF A;  4X8I A;  4Q36 A;  5H86 A;  2QVP A;  2HQY A;  4KOR A;  1Z8L A;  2PQ8 A;  3NE7 A;  3H8F A;  5CBM A;  3HLP A;  4A32 A;  4ZGY B;  4KOS A;  4A33 A;  3FB3 A;  3WT4 A;  1PUA A;  4NCZ A;  2QYV A;  4FD6 A;  4E0A A;  4UA3 A;  2FXF A;  4LUA A;  2V8H A;  4C2Y A;  2JEW A;  4FD4 A;  4MHZ A;  4ZX8 A;  4YRH A;  5ELY A;  2CTB A;  5LYF A;  1FY7 A;  4JD6 A;  3D3S A;  4AVC A;  2OH1 A;  3BJ8 A;  4YFJ A;  2V77 A;  5K8P A;  1HDU A;  3RZA A;  3SI0 A;  3FVL A;  1RTQ A;  1Z4R A;  4C7H A;  3HUV A;  2ZW5 A;  2PJ4 A;  1VHS A;  2VQY A;  2V8D A;  4OAE A;  1CM0 A;  1S60 A;  1OZP A;  5LRJ A;  1FNO A;  5HVF A;  2Z3K A;  4R8F A;  3ZJ0 A;  4FAI A;  5AG7 A;  1WWZ A;  3PRT A;  1LAM A;  3A9L A;  2PJ6 A;  4LQ6 A;  1SQH A;  1YLO A;  4P4J A;  3SJG A;  2Q7S A;  4CGL A;  4DJL A;  2IJZ A;  3K9T A;  2P6E A;  2VL1 A;  1ARM A;  4OC4 A;  1IOI A;  2FIW A;  3FMC A;  4A30 A;  2O53 A;  4R87 A;  2XEI A;  2NMT A;  4H6Z A;  1CBX A;  3KGQ A;  1GYT A;  1A2Z A;  2G3T A;  4PXD A;  2WPW A;  2OB0 A;  3R9G A;  3D7F A;  3IIB A;  5E96 A;  3IGR A;  5EBV A;  1QMU A;  3CXP A;  2EK9 A;  1KWM A;  2C1C A;  5HH1 A;  4ZY0 A;  3H5Z A;  4NGR A;  1RO5 A;  4BBH A;  3TE4 A;  3H8E A;  2FSR A;  3FH4 A;  3P2H A;  1VHO A;  3MN8 A;  4KVX A;  4PXC A;  3NFZ A;  2PIY A;  1PYT B;  4PV6 A;  4BD9 A;  2IMO A;  5JGF A;  3R96 A;  1KZF A;  4A95 A;  4CYN A;  5JH9 A;  3DNS A;  4I49 A;  1CPX A;  2BUE A;  3D2P A;  1N71 A;  1R43 A;  3JTK A;  4W9Y A;  2GIV A;  2Q4Z A;  2Z3P A;  1S7L A;  1MK4 A;  3PGP A;  4KUB A;  2AFX A;  3TCV A;  3B3V A;  3LD2 A;  5G20 A;  1ZG7 A;  1VIX A;  3WAB A;  4BIN A;  3R95 A;  4HNW B;  3CZX A;  2G9D A;  3PBE A;  2PJ1 A;  3BLN A;  4PXE A;  4ZY2 A;  1Z8X A;  3VH9 A;  2PIZ A;  3LAC A;  1IID A;  2KCW A;  4R3L A;  3QB8 A;  3FX6 A;  5JPH A;  1IIC A;  3D7H A;  2B5G A;  3N5F A;  4PSW A;  4R9M A;  3EFA A;  2Q44 A;  4MY3 A;  1M4G A;  2Q7B A;  3WC6 A;  5LYI A;  2C27 A;  3G3S A;  4JYW A;  4UFX A;  3S6F A;  1Q2C A;  1I12 A;  2ZW6 A;  4UCN A;  2AFZ A;  3PFO A;  2CTC A;  2XEF A;  3DR6 A;  2B5G B;  2OZH A;  2OZU A;  3TX8 A;  1RXT A;  4R76 A;  1VGY A;  3S9M A;  3DLJ A;  1NSL A;  4CGP A;  1YR0 A;  1Z9U A;  5JM6 A;  1KUV A;  3FEE A;  4MHN A;  5ISV A;  1Y9K A;  4WJB A;  4EME A;  2AFW A;  2F7V A;  4MBU A;  2OU2 A;  1X10 A;  2EWB A;  3VWE A;  1TXR A;  2HUZ A;  1M4L A;  1YRE A;  1QSN A;  2I79 A;  3P2F A;  3IWW A;  3WC7 A;  5C82 A;  4MCQ A;  2BEI A;  5BWA B;  1F2O A;  2CNM A;  4KOW A;  2WUU A;  3D7D A;  3S6G A;  1UWY A;  2V8V A;  2Z3O A;  3EY5 A;  4KLW A;  5F49 A;  3T9Y A;  4EVY A;  4KSA A;  4MFZ A;  2ZOF A;  1ON0 A;  2ZEN A;  4KOU A;  3SJX A;  1Z2L A;  4OC1 A;  1PCA A;  5THW A;  2Z0Z A;  4A37 A;  4UEF A;  1BLL E;  3C26 A;  3PEI A;  4M85 A;  4MMO A;  1U6M A;  1ZO0 A;  2ZEF A;  4B13 A;  1F2P A;  1DTD A;  4JXQ A;  4O23 A;  4CAE A;  1Z4E A;  2AE6 A;  2GE3 A;  4Z65 A;  1XBU A;  3UY5 A;  4C2X A;  4OP4 A;  3GB0 A;  4OC5 A;  2ZW7 A;  4Q7A A;  3SJE A;  1Z8T A;  4NGN A;  1IB1 E;  4ORF A;  3VAT A;  2OR4 A;  2WPX A;  2ZEP A;  3PB4 X;  4KS9 A;  4MXU A;  5AG6 A;  4KOT A;  2ZPA A;  2F8H A;  4NGP A;  2J8N A;  4MI4 A;  2ZEG A;  1ELM P;  4CYO A;  4AXV A;  4AB7 A;  3IO1 A;  4NGM A;  4DNC A;  2D4P A;  3DSB A;  2ZOG A;  3RAM A;  4UEE A;  2PRB A;  4OLL A;  1S7K A;  2YGW A;  2O4H A;  3W6X A;  3IC1 A;  3RNZ A;  2RFH A;  3MRU A;  1S5K A;  3KQZ A;  4A94 A;  3PB9 X;  2PJ8 A;  2PJ7 A;  4LQG A;  3PFE A;  2REF A;  1CX8 A;  2ODF A;  4DUK A;  5JQ4 A;  2FVG A;  4B6Z A;  4IAV A;  2ARH A;  2PJ9 A;  3B7I A;  3KHX A;  1P4N A;  1M4I A;  2PDO A;  3F0A A;  3S6K A;  4CPA A;  2C6P A;  3IJ3 A;  5F46 A;  3KAS A;  1BOB A;  4L8A A;  4B14 A;  3W6S A;  4HPS A;  4IK2 A;  3R9E A;  4PSX A;  3JUW A;  1M1D A;  5I4M A;  2FE7 A;  3FIX A;  3B3T A;  3D66 A;  5K8M A;  3FRM A;  2DF5 A;  5CNP A;  1IY7 A;  2DXQ A;  3NA6 A;  1S7N A;  3KKW A;  4MCS A;  3T90 A;  4A2Z A;  3IEH A;  3DDD A;  3VAR A;  4PXB A;  4F6A A;  1DE4 C;  1KUX A;  1QSO A;  2HV2 A;  2VEZ A;  4M6G A;  4ZY1 A;  3TFY A;  2B4B A;  3NH5 A;  5F48 A;  1GHE A;  2JLM A;  4YGO A;  4B10 A;  3TOA A;  2FL4 A;  1P0H A;  2P0W A;  3PB7 X;  3EXN A;  4IHM A;  4B5O A;  3EO4 A;  4F8Z A;  3LOD A;  3JVN A;  2PJA A;  1IGB A;  2CF4 A;  5G21 A;  4BMH A;  2XEG A;  1XOV A;  2GFQ A;  1TKF A;  2JDC A;  1B6B A;  3D8P A;  4JZ0 A;  4H89 A;  1MJ9 A;  3B2Y A;  3B3C A;  3IFE A;  1WK4 A;  1Q2Y A;  4QVT A;  3FF3 A;  4OIW A;  5LYD A;  1XF8 A;  2ATR A;  2ZEE A;  2ZED A;  4MFP A;  3R9F A;  2BO9 A;  2IL4 A;  2VI7 A;  3FED A;  1YVK A;  1J4J A;  4GXH A;  1LOK A;  3V38 A;  3H8G A;  2BSW A;  4UCP A;  4YWY A;  4NGT A;  1XFO A;  4FBE A;  3KL9 A;  4X3R A;  3GYA A;  4B11 A;  4MY0 A;  3B3S A;  4UWJ A;  2I3C A;  2JEV A;  2VZY A;  1XRY A;  4UIA A;  5IB0 A;  2FIA A;  4JLY A;  5C88 A;  2Q51 A;  3LMS A;  3S9N A;  3PZJ A;  4QB9 A;  4H6U A;  3K9U A;  1YQE A;  2GU2 A;  2I00 A;  3G8W A;  4WWV A;  3WC5 A;  1ZG9 A;  3PP9 A;  8CPA A;  2CNT A;  3JRU A;  1L0C A;  2ABZ A;  3KR5 A;  4UCM A;  3N7Z A;  2GRE A;  2AFU A;  3I9S A;  3RBU A;  4JWP A;  1CPS A;  5KTA A;  2Q4V A;  3GLJ A;  4P4D A;  4KOX A;  1LRZ A;  1I1D A;  4ONW A;  4U9Z A;  5LYL A;  1ARL A;  4KOV A;  4OKO A;  2JBK A;  4IF5 A;  4AVB A;  2A4N A;  4KLV A;  2NSM A;  1CJW A;  1Y0Y A;  2YND A;  4II9 A;  4HNX B;  2Z10 A;  4NJR A;  4XNH C;  4EWT A;  2EBJ A;  1ZLH A;  4A38 A;  3KR4 A;  2BOA A;  3CT9 A;  2G3A A;  3IU2 A;  2PJC A;  1IU8 A;  2J8M A;  1Y0R A;  5LRG A;  4M6I A;  3SXN A;  5KTC A;  4RS2 A;  1AMP A;  2ZEH A;  2K5T A;  3D68 A;  4B5P A;  6CPA A;  2PRQ A;  2C6G A;  4PQA A;  4P45 A;  2AFS A;  4UFV A;  4R7M A;  3NH4 A;  2ZW4 A;  1Z5R A;  3KZW A;  3TC8 A;  2P6G A;  4CAF A;  3DR8 A;  3BHX A;  3FJU A;  4CGO A;  4B5P B;  5J8F A;  2G0B A;  3CDX A;  2AFO A;  4UEZ A;  3D2M A;  4CAX A;  3BI1 A;  1TF9 A;  2WZN A;  4ONU A;  5IV0 A;  2CXA A;  2PE3 A;  2GLJ A;  4OAD A;  4IUS A;  5D29 A;  5A27 A;  1Q2D A;  2VBQ A;  1ZLI A;  1X12 A;  4HNY B;  2VZZ A;  4NJQ A;  5G22 A;  3PB8 X;  1TKJ A;  3V8I A;  2ZEO A;  1BPM A;  5AG4 A;  3OWC A;  5IX3 A;  4AG7 A;  3RO0 A;  4UF4 A;  3QAH A;  2R7H A;  2WYR A;  2AJ6 A;  4ZBG A;  2REE A;  3PB6 X;  3MGD A;  2OOT A;  1EE3 P;  3S9L A;  4A39 A;  2PJ3 A;  4E2A A;  2QEC A;  2P6F A;  3I3G A;  4KUA A;  4NSQ A;  4NXY A;  2PJ2 A;  4KSI A;  1BO4 A;  3FBU A;  5DWM A;  4P4E A;  3WR7 A;  4A31 A;  5I0C A;  2R98 A;  3CXS A;  2NYQ A;  4JJX A;  5IB9 A;  5CPA A;  2VXK A;  4CAW A;  1I21 A;  1NMT A;  2DEA A;  2X7B A;  4QC6 A;  1TIQ A;  2Q0Y A;  5DWN A;  3QAY A;  2Z3L A;  3TOB A;  3ISZ A;  4OC3 A;  4CYP A;  3KI9 A;  1BAV A;  3T8W A;  4NF1 A;  3FEC A;  5HVH A;  5GCN A;  3E0K A;  1JWQ A;  4MFJ A;  3KQX A;  4YU9 A;  4C2Z A;  3KHZ A;  4QBJ A;  1LCP A;  1YW6 A;  2OZG A;  5A28 A;  4UIB A;  3D67 A;  5LRK A;  5J1Q A;  4KZT A;  3SHP A;  4TWE A;  5AG5 A;  1Y9W A;  2CY2 A;  2PJ5 A;  5EC4 A;  4XPK A;  4TNU A;  3LWU A;  1BPN A;  4R6T A;  3RYO A;  3ZZI A;  1XMT A;  3B35 A;  4E8O A;  4CGN A;  2QML A;  1PU9 A;  3V7Z A;  3QNV A;  1XEB A;  2EO8 A;  4NEX A;  5F09 A;  2J8R A;  2R1I A;  5K8N A;  3PBB A;  4FD5 A;  3R1K A;  1CP6 A;  4OME A;  5F47 A;  4ZI6 A;  4B12 A;  3D4U A;  2FS5 A;  1JQG A;  5G1Z A;  1XE4 A;  3BI0 A;  1NSA A;  3BXM A;  2ANP A;  4XPD B;  1LFW A;  3GUX A;  3TT2 A;  4CS0 B;  1VKC A;  3GIU A;  4MRI A;  4UBR A;  3B8G A;  4ZX9 A;  4ZYQ A;  3H4Q A;  2YNE A;  4CYQ A;  1QST A;  4K3N A;  4FUU A;  4XPD C;  4EFD A;  1LAN A;  1S7F A;  2PJB A;  4L89 A;  4Q38 A;  4CRZ B;  3FXT A;  4G1P A;  3FYN A;  1XIX A;  4JXR A;  3TO9 A;  3IWG A;  1F57 A;  1YX0 A;  2EK8 A;  2JBJ A;  4U5Y A;  2B58 A;  5J8C A;  1KUY A;  2PR8 A;  4KSF A;  2CNS A;  1MJA A;  4RI1 A;  2B4D A;  5D8N A;  2HB6 A;  2PJ0 A;  5DS0 A;  1H8L A;  7CPA A;  3W91 A;  2ZXV A;  1MJB A;  2AFM A;  1YSJ A;  1ZG8 A;  2F5I A;  2XEJ A;  2DPT A;  5HMN A;  4P10 A;  1YK3 A;  4X2T A;  1YVO A;  4Y49 B;  4C68 A;  2B3V A;  5HXD A;  4OC0 A;  2BCO A;  4NGQ A;  4CAV A;  3F5B A;  2PC1 A;  3I1U A;  2B4D B;  4U9Y A;  2Z3M A;  2B3U A;  4MHP A;  4RN7 A;  4Y49 C;  4DYO A;  2RB7 A;  5AGE A;  1YME A;  4J3G A;  1NE9 A;  1AYE A;  1YLE A;  1YW4 A;  2O28 A;  4PK2 A;  4P44 A;  3NE8 A;  3IU1 A;  1AUG A;  1ELL P;  4MHD A;  5K8O A;  3TO6 A;  3SJF A;  3TTH A;  4C7I A;  2FT0 A;  4HKF A;  5FVJ A;  4PPZ A;  1TF8 A;  2CIJ A;  4K30 A;  2Y0M A;  1Y7E A;  4OID A;  3IWE A;  4QUS A;  5KTD A;  3VWD A;  4CGM A;  4OC2 A;  3TO7 A;  4F9U A;  3ISX A;  4GS4 A;  3D7G A;  4MFQ A;  4F9V A;  1K4J A;  1FT7 A;  4MCR A;  3SXO A;  4XNH B;  3BJ7 A;  2PR1 A;  2JDD A;  4F0Y A;  1HDQ A;  5EMI A;  2D4O A;  2QIR A;  2GAN A;  4MCP A;  2QJ8 A;  3DGV A;  1CG2 A;  3B3W A;  4P4I A;  1VHE A;  5HVG A;  1TKH A;  2BL1 A;  2J9A A;  4AG9 A;  4KVM E;  4PK3 A;  4F0X A;  1QSM A;  2ZEL A;  3FNC A;  2EVN A;  4NFR A;  1R3N A;  4LX9 A;  2PSW A;  3EC4 A;  1YGH A;  2YNC A;  4MFL A;  2FCK A;  2ZEM A;  3GY9 A;  2WSA A;  4NGS A;  1OBR A;  4R3K A;  4M3S A;  1M44 A;  2V8G A;  2Q04 A;  1LAP A;  1M4D A;  2Z3N A;  2EUI A;  4M6H A;  1IYK A;  2H5M A;  4UFW A;  4P4B A;  3NH8 A;  1CP7 A;  1XJO A;  4P4F A;  1QSR A;  3F8K A;  4MHY A;  2C6C A;  1R57 A;  1Q7L A;  4MJ8 A;  4X5K A;  2POK A;  4CRY B;  2RC4 A;  2Q4Y A;  2R8V A;  2DPS A;  4XPL A;  2YNC C;  2Q43 A;  4MFK A;  1Y7R A;  3GKR A;  2GLF A;  4UWI A;  1IYL A;  2PVW A;  2Z11 A;  1B87 A;  1V0C A;  3CPX A;  3S6H A;  4AVA A;  1S3Z A;  4R57 A;  4FWU A;  3CPA A;  2HC9 A;  3L2N A;  3SI1 A;  3SI2 A;  2PCU A;  4FD7 A;  4H2K A;  2IQ6 A;  4P6Y A;  4GM5 A;  3CXQ A;  2PVV A;  1HEE A;  3K2K A;  1UFH A; 
#chains in the Genus database with same CATH homology
 4KOY A;  5H84 A;  4KVO E;  4Q36 A;  5H86 A;  2HQY A;  4KOR A;  2PQ8 A;  3NE7 A;  4A32 A;  4ZGY B;  4KOS A;  4A33 A;  3FB3 A;  1PUA A;  4NCZ A;  4FD6 A;  4E0A A;  4UA3 A;  2FXF A;  4LUA A;  4C2Y A;  4FD4 A;  4YRH A;  1FY7 A;  4JD6 A;  3D3S A;  4AVC A;  2OH1 A;  3BJ8 A;  4YFJ A;  1Z4R A;  4C7H A;  2ZW5 A;  2VQY A;  1VHS A;  4OAE A;  1CM0 A;  1S60 A;  1OZP A;  2Z3K A;  3ZJ0 A;  5AG7 A;  1WWZ A;  3A9L A;  1SQH A;  4CGL A;  2P6E A;  4A30 A;  2FIW A;  4R87 A;  4B10 A;  2NMT A;  4H6Z A;  2G3T A;  2WPW A;  2OB0 A;  3R9G A;  5E96 A;  3IGR A;  5EBV A;  3CXP A;  5HH1 A;  3H5Z A;  1RO5 A;  4BBH A;  3TE4 A;  2FSR A;  3P2H A;  4KVX A;  4PV6 A;  3R96 A;  1KZF A;  4A95 A;  4CYN A;  3DNS A;  4I49 A;  3D2P A;  2BUE A;  1N71 A;  3JTK A;  2GIV A;  2Z3P A;  1S7L A;  1MK4 A;  3PGP A;  4KUB A;  3TCV A;  3LD2 A;  5G20 A;  3R95 A;  4HNW B;  3BLN A;  1IID A;  2KCW A;  4R3L A;  3QB8 A;  5JPH A;  1IIC A;  2B5G A;  4PSW A;  4R9M A;  3EFA A;  2Q44 A;  4MY3 A;  1M4G A;  2Q7B A;  2C27 A;  3G3S A;  4UFX A;  3S6F A;  1I12 A;  1Q2C A;  2ZW6 A;  4UCN A;  3DR6 A;  2B5G B;  2OZH A;  2OZU A;  1RXT A;  1NSL A;  4CGP A;  1YR0 A;  1Z9U A;  1KUV A;  5ISV A;  1Y9K A;  4MBU A;  2OU2 A;  3VWE A;  2HUZ A;  1YRE A;  1QSN A;  2I79 A;  3P2F A;  5C82 A;  2BEI A;  5BWA B;  4KOW A;  2CNM A;  2WUU A;  3S6G A;  2Z3O A;  3EY5 A;  4KLW A;  5F49 A;  3T9Y A;  4EVY A;  4KSA A;  4MFZ A;  1ON0 A;  4KOU A;  2Z0Z A;  3C26 A;  4M85 A;  1U6M A;  1ZO0 A;  4B13 A;  4JXQ A;  4CAE A;  1Z4E A;  2AE6 A;  2GE3 A;  3UY5 A;  4C2X A;  2ZW7 A;  4ORF A;  1IB1 E;  2WPX A;  4KS9 A;  5AG6 A;  4KOT A;  2ZPA A;  2J8N A;  4MI4 A;  4CYO A;  4AB7 A;  4DNC A;  2D4P A;  3DSB A;  2PRB A;  4OLL A;  1S7K A;  2YGW A;  3W6X A;  1S5K A;  2REF A;  5JQ4 A;  2ARH A;  1P4N A;  1M4I A;  2PDO A;  3F0A A;  3S6K A;  5F46 A;  1BOB A;  4L8A A;  4B14 A;  3W6S A;  3R9E A;  4PSX A;  3JUW A;  1M1D A;  2FE7 A;  3FIX A;  3FRM A;  5CNP A;  2DXQ A;  3T90 A;  1S7N A;  3KKW A;  4A2Z A;  3DDD A;  4F6A A;  1KUX A;  1QSO A;  2HV2 A;  2VEZ A;  3TFY A;  2B4B A;  5F48 A;  1GHE A;  2JLM A;  4YGO A;  3TOA A;  2FL4 A;  1P0H A;  2P0W A;  3EXN A;  4B5O A;  3EO4 A;  3LOD A;  3JVN A;  5G21 A;  4BMH A;  2JDC A;  3D8P A;  1B6B A;  4H89 A;  1MJ9 A;  1WK4 A;  1Q2Y A;  4QVT A;  1XF8 A;  2ATR A;  4MFP A;  3R9F A;  2IL4 A;  2VI7 A;  1YVK A;  1J4J A;  2BSW A;  4UCP A;  4B11 A;  3GYA A;  4MY0 A;  4UWJ A;  2JEV A;  2VZY A;  5IB0 A;  2FIA A;  4JLY A;  5C88 A;  3PZJ A;  4QB9 A;  4H6U A;  3K9U A;  2I00 A;  3G8W A;  3PP9 A;  2CNT A;  1L0C A;  4UCM A;  3N7Z A;  3I9S A;  4JWP A;  5KTA A;  2Q4V A;  4KOX A;  1LRZ A;  1I1D A;  4U9Z A;  4KOV A;  4IF5 A;  4AVB A;  2A4N A;  4KLV A;  1CJW A;  2YND A;  4II9 A;  4HNX B;  2Z10 A;  4XNH C;  2G3A A;  3IU2 A;  2J8M A;  3SXN A;  5KTC A;  4RS2 A;  4B5P A;  2K5T A;  4UFV A;  2ZW4 A;  2P6G A;  4CAF A;  3DR8 A;  4CGO A;  4B5P B;  5J8F A;  2G0B A;  4CAX A;  3D2M A;  4ONU A;  5IV0 A;  2CXA A;  4OAD A;  5A27 A;  4IUS A;  1Q2D A;  2VBQ A;  4HNY B;  2VZZ A;  5G22 A;  5AG4 A;  3V8I A;  3OWC A;  5IX3 A;  4AG7 A;  3QAH A;  2R7H A;  2AJ6 A;  4ZBG A;  2REE A;  3MGD A;  4E2A A;  2QEC A;  2P6F A;  3I3G A;  4KUA A;  4NSQ A;  4NXY A;  3FBU A;  1BO4 A;  5DWM A;  3WR7 A;  4A31 A;  5I0C A;  2R98 A;  3CXS A;  4JJX A;  2VXK A;  4CAW A;  1I21 A;  1NMT A;  2X7B A;  4QC6 A;  1TIQ A;  2Q0Y A;  5DWN A;  3TOB A;  2Z3L A;  4CYP A;  4NF1 A;  5GCN A;  3E0K A;  4MFJ A;  4C2Z A;  4QBJ A;  5A28 A;  2OZG A;  4KZT A;  3SHP A;  5EC4 A;  5AG5 A;  1Y9W A;  2CY2 A;  3RYO A;  4XPK A;  3ZZI A;  1XMT A;  4E8O A;  4CGN A;  2QML A;  1PU9 A;  1XEB A;  4NEX A;  2J8R A;  2R1I A;  4FD5 A;  3R1K A;  5F47 A;  4B12 A;  2FS5 A;  5G1Z A;  1XE4 A;  4XPD B;  3TT2 A;  4CS0 B;  1VKC A;  4UBR A;  3B8G A;  3H4Q A;  2YNE A;  1QST A;  4XPD C;  4Q38 A;  1S7F A;  4L89 A;  4CRZ B;  3FXT A;  3FYN A;  1XIX A;  4JXR A;  3TO9 A;  3IWG A;  1YX0 A;  5J8C A;  4U5Y A;  2B58 A;  1KUY A;  2PR8 A;  4KSF A;  2CNS A;  1MJA A;  4RI1 A;  2B4D A;  3W91 A;  2ZXV A;  1MJB A;  2F5I A;  5HMN A;  2DPT A;  1YK3 A;  1YVO A;  4Y49 B;  4C68 A;  2B3V A;  4CAV A;  3F5B A;  2PC1 A;  4U9Y A;  2B4D B;  2Z3M A;  2B3U A;  4Y49 C;  5AGE A;  4J3G A;  1NE9 A;  1YLE A;  2O28 A;  4PK2 A;  3IU1 A;  4MHD A;  3TO6 A;  3TTH A;  4C7I A;  2FT0 A;  4HKF A;  5FVJ A;  4K30 A;  2Y0M A;  3IWE A;  4QUS A;  5KTD A;  3VWD A;  4CGM A;  3TO7 A;  4GS4 A;  4MFQ A;  1K4J A;  3SXO A;  4XNH B;  3BJ7 A;  2PR1 A;  2JDD A;  4F0Y A;  2D4O A;  2QIR A;  2GAN A;  2BL1 A;  4AG9 A;  4KVM E;  4PK3 A;  4F0X A;  1QSM A;  3FNC A;  2EVN A;  4LX9 A;  2PSW A;  3EC4 A;  1YGH A;  2YNC A;  4MFL A;  2FCK A;  3GY9 A;  2WSA A;  4R3K A;  4M3S A;  1M44 A;  2Q04 A;  1M4D A;  2Z3N A;  2EUI A;  1IYK A;  2H5M A;  4UFW A;  1QSR A;  3F8K A;  1R57 A;  4MJ8 A;  4X5K A;  4CRY B;  2RC4 A;  2Q4Y A;  2R8V A;  2DPS A;  4XPL A;  2YNC C;  4MFK A;  1Y7R A;  3GKR A;  4UWI A;  1IYL A;  2Z11 A;  1B87 A;  1V0C A;  3S6H A;  4AVA A;  1S3Z A;  4R57 A;  4CYQ A;  4FD7 A;  3CXQ A;  1UFH A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...