2OH1A

Crystal structure of acetyltransferase gnat family (yp_013287.1) from listeria monocytogenes 4b f2365 at 1.46 a resolution
Total Genus 47
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
47
sequence length
175
structure length
175
Chain Sequence
NKITAGGLEFLVRFAAPTDRLKINDLMIDTARWLKESGSTQWSDILHGFDVHNIEQRIELGEVALFETEAGALAGAMIIRKTPSDWDTDLWEDLAIDKAYYLHRIMVSRAFSGISLSKQMIYFAEKLGIEMSVPFIRLDCIESNETLNQMYVRYGFQFSGKKNGFYLYQKELSQK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Acetyltransferase, GNAT family
publication title Crystal structure of acetyltransferase GNAT family (YP_013287.1) from Listeria monocytogenes 4b F2365 at 1.46 A resolution
rcsb
source organism Listeria monocytogenes str. 4b
molecule tags Transferase
total genus 47
structure length 175
sequence length 175
chains with identical sequence B, C, D
ec nomenclature ec 2.3.-.-:
pdb deposition date 2007-01-09
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.630.30 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Aminopeptidase 2oh1A00
3LODA 4R87A 3LD2A 3TCVA 2OB0A 4II9A 4QB9A 5HMNA 3B8GA 3PP9A 2Z11A 4AVBA 3DR8A 1QSOA 4UWJA 2QECA 1S5KA 1Z9UA 2Y0MA 1K4JA 4MBUA 5CNPA 4JD6A 1IIDA 3EXNA 1M44A 4H89A 2ZW5A 4B5OA 3DSBA 1BO4A 2B4DB 3N7ZA 2J8NA 2QMLA 2B3VA 3W6SA 1MJAA 1Z4RA 3RYOA 4MI4A 2FCKA 4ONUA 5KTAA 2FIAA 2OZUA 4M3SA 4KVXA 1IYLA 2Q0YA 2Q7BA 3SXNA 2GE3A 3DDDA 4JLYA 4CAXA 2R7HA 3C26A 3CXSA 1V0CA 3R1KA 5ISVA 1TIQA 2O28A 1XMTA 1CM0A 2VZYA 1CJWA 2IL4A 3TOBA 4PSXA 4KOYA 4UWIA 1I12A 3I9SA 1QSRA 1Y9WA 3G8WA 2R1IA 2GIVA 2PR1A 3SHPA 3EO4A 4OADA 5DWMA 1RXTA 4PSWA 1WWZA 2D4PA 1U6MA 2VI7A 1KZFA 3BJ8A 1S7LA 3K9UA 2PC1A 4KOSA 1GHEA 4NCZA 1N71A 2CNSA 1OZPA 5C82A 4R3KA 3F5BA 5F49A 3NE7A 3D2PA 5E96A 3FBUA 3FIXA 5IB0A 4XNHC 4JXRA 3G3SA 4HNYB 3TTHA 3S6GA 4CAVA 3R9FA 3FXTA 4HNWB 4MJ8A 1I1DA 3R9EA 3FRMA 4H6UA 4QBJA 3VWDA 4QUSA 2B58A 3FB3A 3GY9A 4K30A 2PRBA 4PK3A 2KCWA 2R98A 3D3SA 1QSMA 3BLNA 4MY3A 4PV6A 4XPLA 3JVNA 4HNXB 1M4IA 2FXFA 1YR0A 4JWPA 3DNSA 4CS0B 2G3AA 1YGHA 3TOAA 4KZTA 4Y49B 4F6AA 3TE4A 3EFAA 1YX0A 2ZW7A 1MJ9A 4ZBGA 1ON0A 1M4GA 2GANA 2J8RA 1XF8A 2BEIA 2WPXA 3F0AA 2WPWA 3PZJA 1IYKA 4E8OA 3WR7A 2JDDA 2OZHA 2B5GB 4XPKA 4L8AA 4AG9A 2B4BA 2Q04A 2B4DA 1BOBA 5KTCA 1WK4A 4E2AA 1S7FA 2BL1A 2OU2A 2D4OA 1IB1E 3CXQA 1MK4A 3T90A 4I49A 4KORA 1YLEA 4CRZB 1KUYA 2B3UA 4X5KA 4KUAA 2OZGA 2JLMA 4QC6A 1RO5A 5C88A 1QSTA 5EBVA 4ORFA 4KOXA 4OLLA 2CNMA 3DR6A 1YREA 2REEA 4E0AA 2X7BA 3E0KA 4QVTA 2AE6A 3IGRA 2F5IA 5KTDA 3GKRA 1XEBA 4UA3A 2P6FA 3OWCA 2BSWA 3S6HA 4UBRA 1Q2YA 3BJ7A 5F46A 2ZPAA 2BUEA 2P6GA 4KUBA 2P6EA 3JUWA 2ARHA 4RS2A 2FSRA 2PSWA 2FE7A 2DXQA 2Q44A 2R8VA 4RI1A 4CAWA 1IICA 4H6ZA 4U9YA 3T9YA 3MGDA 4DNCA 2FL4A 3R95A 1Q2DA 4OAEA 3SXOA 1NSLA 3QAHA 3W91A 1VHSA 4U5YA 2CNTA 3QB8A 1P4NA 1YVKA 4MHDA 2P0WA 5EC4A 2EUIA 2ZW6A 3TT2A 3TO7A 4FD6A 3R96A 4B5PA 2VBQA 4FD7A 2VQYA 4KOUA 3S6KA 5JQ4A 3FNCA 4NXYA 3I3GA 5IX3A 4BMHA 1LRZA 4FD5A 4CRYB 3VWEA 1Y9KA 1Z4EA 3PGPA 4NF1A 2JDCA 3ZJ0A 4XPDB 4JJXA 2H5MA 5H86A 3P2FA 2ZW4A 3GYAA 4HKFA 2HQYA 4KLVA 2PDOA 4PK2A 5HH1A 3EY5A 1Y7RA 5J8FA 4KOVA 1MJBA 1UFHA 2A4NA 1M4DA 3W6XA 3EC4A 1NMTA 4GS4A 3V8IA 5I0CA 3S6FA 1J4JA 2B5GA 1L0CA 2Z10A 2OH1A 2FT0A 5JPHA 1PUAA 4U9ZA 4R9MA 2CY2A 3ZZIA 1R57A 2VEZA 2HV2A 1B6BA 5FVJA 1YVOA 2Q4YA 4KOTA 2C27A 4IUSA 1NE9A 3H4QA 5DWNA 1KUXA 5F48A 2RC4A 2PQ8A 2ZXVA 1YK3A 1XE4A 4NSQA 3F8KA 4AVAA 4R57A 2G0BA 2PR8A 2ATRA 2VZZA 4YRHA 4KOWA 2HUZA 3TFYA 4KVME 2K5TA 4L89A 1I21A 2REFA 4LX9A 3TO6A 1S3ZA 1P0HA 3D2MA 2JEVA 3KKWA 4Y49C 1QSNA 1FY7A 4JXQA 4XPDC 3UY5A 1VKCA 3D8PA 4M85A 2FIWA 4LUAA 1S7KA 4J3GA 1Q2CA 4F0YA 1B87A 2J8MA 5F47A 5GCNA 4KLWA 5IV0A 1XIXA 1S60A 2QIRA 2NMTA 2Z0ZA 4KVOE 2VXKA 1PU9A 4YGOA 1SQHA 3IWGA 4AG7A 4AB7A 4AVCA 4FD4A 2Q4VA 2FS5A 5J8CA 3R9GA 4MY0A 4B5PB 4IF5A 2I79A 4EVYA 3P2HA 2AJ6A 2G3TA 4R3LA 1S7NA 4XNHB 2I00A 5H84A 2EVNA 1M1DA 1KUVA 3CXPA 3TO9A 4NEXA 3FYNA 4YFJA
chains in the Genus database with same CATH superfamily
1XRYA 3LODA 4R87A 3LD2A 3TCVA 1CG2A 2OB0A 4FUUA 4II9A 4QB9A 5HMNA 3B8GA 1TKFA 1ZG7A 2Z11A 2EBJA 3PP9A 4AVBA 4P4BA 4BINA 4OC0A 3DR8A 1QSOA 1TF8A 4UWJA 2QECA 5LYIA 1S5KA 5AG4A 1Z9UA 2EK9A 3CZXA 4NGNA 2Y0MA 4CYNA 1K4JA 4MBUA 4KSFA 5CNPA 5LYDA 4CYPA 4JD6A 1IIDA 3EXNA 1M44A 4H89A 2ZW5A 4B5OA 3DSBA 3WC7A 1BO4A 2B4DB 2PJ7A 4C2YA 4CAFA 3N7ZA 2HB6A 2J8NA 2QMLA 2B3VA 3W6SA 4C2ZA 4CGNA 1MJAA 1VHEA 1Z4RA 3RYOA 2GLFA 3B2YA 1YW4A 4P4FA 1JWQA 2Z3NA 3QAYA 4MI4A 2FCKA 2VL1A 4ONUA 3ISZA 5KTAA 2FIAA 4UEFA 3BI0A 2V8VA 1M4LA 2OZUA 4PPZA 3T8WA 4M3SA 1Q7LA 4NGMA 4KVXA 1IYLA 4JZ0A 2Q0YA 4BD9A 5D29A 3MN8A 4C2XA 2Q7BA 3SXNA 2ZEFA 2GE3A 4PXEA 1TF9A 4EMEA 3DDDA 4JLYA 5AG5A 2R7HA 3C26A 4CAXA 3CXSA 5AG7A 4FAIA 1V0CA 3R1KA 5ISVA 5A27A 1TIQA 4M6HA 2O28A 1YQEA 4P44A 2PJ4A 1XMTA 1CM0A 1QMUA 2VZYA 3IU2A 3VARA 1CJWA 2IL4A 4X2TA 3TOBA 5HVFA 3NA6A 4PSXA 2Z3KA 3LACA 4ZY2A 4KOYA 4R6TA 4UWIA 1I12A 1XFOA 3DGVA 2Z3MA 3I9SA 4P4DA 1QSRA 2IJZA 2O53A 2GFQA 3CDXA 1Y9WA 3PFOA 3G8WA 2R1IA 2GIVA 4MFJA 5J1QA 4UCPA 2PR1A 3SHPA 2PJ9A 3EO4A 4OADA 5DWMA 4FBEA 2DPTA 2F8HA 2PJ0A 1F2OA 1RXTA 1BPNA 2Z3PA 1WWZA 2D4PA 4PSWA 1U6MA 2XEGA 4KSAA 4TWEA 2VI7A 2I3CA 4OC2A 2DEAA 3QNVA 1KZFA 2ZELA 3BJ8A 1S7LA 2XEJA 3K9UA 4MFQA 2AFSA 5A28A 3BHXA 2PC1A 1YSJA 1GHEA 4KOSA 1ZG8A 4X8IA 4NCZA 1OBRA 4UCNA 1N71A 2Z3LA 2CNSA 2PE3A 2XEIA 4KSIA 1OZPA 5C82A 4R3KA 3F5BA 5K8NA 5F49A 3I1UA 3NE7A 3D2PA 5E96A 4A95A 3FBUA 3FIXA 1YW6A 5IB0A 1BAVA 3KQXA 4XNHC 4JXRA 3G3SA 4HNYB 3TTHA 3S6GA 4CAVA 4P4EA 2YGWA 3R9FA 4RUHA 5D8NA 4OIDA 3FXTA 1Z5RA 4HNWB 4MJ8A 3CT9A 3WC6A 4X3RA 1I1DA 3R9EA 3B3TA 3FRMA 4H6UA 4QBJA 3VWDA 1XOVA 1XMBA 4B14A 4CYQA 2PJ3A 4MCQA 4A30A 3D68A 4QUSA 1CPSA 4UFVA 2B58A 3FB3A 3GY9A 3PB8X 4PQAA 4K30A 2PRQA 3B3SA 5G22A 5HVHA 2PRBA 4OMEA 2KCWA 1IY7A 4PK3A 2R98A 4CPAA 3D3SA 4B6ZA 1QSMA 5CPAA 4YWYA 3BLNA 4MY3A 4PV6A 4XPLA 3JVNA 4HNXB 3IO1A 4ZY1A 2BO9A 1M4IA 4MCPA 1BLLE 3PBEA 5AG6A 2FXFA 1YR0A 3H8EA 3DNSA 4JWPA 4M6GA 1Z8TA 4CS0B 2G3AA 5G20A 5K8PA 1YGHA 3TOAA 4BBHA 4KZTA 4Y49B 4H2KA 4F6AA 3TE4A 3EFAA 1YX0A 3LMSA 1IGBA 3SJFA 4R76A 1ZLIA 4Q36A 1H8LA 5K8OA 2ZW7A 3FVLA 1MJ9A 4ZBGA 3IC1A 3L2NA 2WUUA 3WT4A 5CBMA 2ZOFA 3FEDA 1ON0A 5IB9A 1M4GA 1LOKA 2AFZA 1ZO0A 2GANA 4NJRA 1NSAA 1YMEA 2J8RA 1UWYA 1XF8A 2BEIA 2PJAA 2AFXA 2WPXA 3D67A 2XEFA 1Z8LA 2WPWA 1IYKA 3F0AA 3PZJA 4E8OA 1YLOA 2EWBA 2JBJA 4MFKA 3WR7A 1X10A 3GB0A 3V7ZA 2JDDA 2OZHA 2B5GB 4HPSA 4XPKA 5AGEA 2ZEEA 3D66A 3PB7X 2ZEGA 4L8AA 4AG9A 1QQ9A 2B4BA 2Q04A 4A2ZA 4A32A 2AFMA 1HDQA 1BOBA 2B4DA 3SI1A 5KTCA 4CAEA 2ZEOA 3CPXA 1WK4A 3S9LA 4O23A 1GYTA 1R43A 1S7FA 2OU2A 2BL1A 2D4OA 4K3NA 4E2AA 3D7HA 1IB1E 3CXQA 2GREA 1MK4A 3PEIA 5K8MA 4R7MA 4I49A 3T90A 4MFZA 4KORA 1YLEA 2RFHA 4CRZB 3N5FA 4MXUA 4DYOA 1KUYA 2B3UA 3IWEA 4UIAA 1CX8A 2PJ5A 4X5KA 3RNZA 3KR5A 1Y0YA 3D7FA 4OC4A 2IQ6A 2V8GA 2OZGA 4KUAA 4B12A 5LRKA 4NGRA 2YNEA 3S9MA 2JLMA 4QC6A 4TNUA 1RO5A 4Q7AA 5C88A 3B3VA 4WJBA 1ELMP 1TKHA 2ODFA 1QSTA 5EBVA 3CPAA 4NGSA 3KZWA 2EK8A 1AMPA 4DJLA 2RB7A 3IJ3A 4IK2A 2CF4A 4M6IA 3WC5A 4ORFA 4KOXA 4OLLA 4A94A 2CNMA 3DR6A 3WABA 1YREA 2J9AA 2REEA 3H8FA 3KR4A 1LAMA 1VGYA 4NJQA 4E0AA 1ZLHA 2ANPA 4MHYA 4P45A 1DTDA 2X7BA 3E0KA 2AE6A 2BOAA 3DLJA 3IGRA 4QVTA 4UEEA 3S9NA 2BCOA 2F5IA 3GKRA 5KTDA 1XEBA 2ZOGA 4P4IA 3D4UA 3JTKA 3RO0A 4UA3A 2P6FA 3RBUA 3OWCA 5G21A 4FWUA 2BSWA 3S6HA 4CGPA 4UBRA 3B3WA 1Q2YA 3BJ7A 4ONWA 5F46A 1A2ZA 2ZPAA 2BUEA 4W9YA 4EFDA 4ZGYB 2P6GA 3TX8A 4KUBA 4F9UA 2P6EA 3JUWA 2ARHA 4RS2A 4P10A 2FSRA 2PSWA 4LQGA 2FE7A 2CTBA 5LRGA 2DXQA 2Q44A 2R8VA 4RI1A 2PIZA 4MHNA 4WWVA 4CAWA 1IICA 4H6ZA 2C6CA 1KWMA 4U9YA 4MFPA 3IFEA 3T9YA 2PJBA 3MGDA 4OC3A 4F8ZA 2QVPA 4MFLA 4DNCA 2FL4A 2YNCC 3R95A 1Q2DA 4OAEA 4LQ6A 3FX6A 2Z3OA 3FECA 3FMCA 3SXOA 1NSLA 4F0XA 1LAPA 4GXHA 3B35A 1F2PA 3QAHA 1EE3P 4MCRA 3W91A 4Z65A 1VHSA 4U5YA 5LRJA 2CNTA 1Z2LA 3QB8A 2YNDA 4P6YA 4ZX8A 5HVGA 1P4NA 1VIXA 1YVKA 2Q43A 3KHXA 4MHDA 3KASA 2P0WA 3KQZA 3H5ZA 5ELYA 6CPAA 3PB6X 5EC4A 5I4MA 2EUIA 2ZW6A 3K2KA 3TT2A 2PJ8A 3K9TA 3RZAA 3TO7A 3GLJA 4FD6A 1F57A 4A31A 3R96A 1FT7A 4B5PA 3FEEA 4G1PA 2VBQA 2GLJA 1AYEA 4FD7A 2VQYA 3HLPA 1CPXA 3KHZA 4KOUA 3S6KA 4B11A 5JQ4A 3FNCA 4OC1A 1Y7EA 4NXYA 3I3GA 2ABZA 4OC5A 3VATA 5IX3A 1JQGA 5BWAB 4BMHA 1LRZA 2YNCA 2ZENA 4FD5A 4CRYB 1FNOA 2C1CA 3VWEA 1Y9KA 1Z4EA 2GU2A 3PGPA 4NF1A 1IOFA 2JDCA 3ZJ0A 4XPDB 4JJXA 1TKJA 2H5MA 4R8FA 4YU9A 5H86A 1LANA 1Z8XA 3P2FA 2ZW4A 2WZNA 5F09A 4MRIA 4PXCA 4ZYQA 5LYLA 2OR4A 3GYAA 4HKFA 2HQYA 3A9LA 4KLVA 3KGQA 2PDOA 1TXRA 4PK2A 5HH1A 2PIYA 4IAVA 3EY5A 1Y7RA 5J8FA 4KOVA 1MJBA 1UFHA 4NGQA 5LYFA 2EO8A 4MHZA 2A4NA 1M4DA 3W6XA 3EC4A 4C68A 1NMTA 4GS4A 3V8IA 5I0CA 4CGMA 3S6FA 2PJCA 2JEWA 3KL9A 4PXDA 1J4JA 1XBUA 2B5GA 2Q7SA 4MHPA 3LWUA 4AXVA 1L0CA 2PJ6A 1CP6A 2Z10A 1PYTB 2OH1A 4UFWA 3IWWA 1IU8A 2FT0A 2WYRA 1R3NA 5G1ZA 1PUAA 5JPHA 1IOIA 4U9ZA 4R9MA 4OIWA 4MCSA 2CY2A 3ZZIA 3JRUA 4UCMA 1R57A 4B10A 2VEZA 2HV2A 2O4HA 1B6BA 3D7DA 3PBBA 5FVJA 1YVOA 2Q4YA 3ISXA 4KOTA 2PVVA 7CPAA 1X12A 2OOTA 5EMIA 2C27A 4A38A 4MMOA 3H8GA 5THWA 3PFEA 3NH8A 4IUSA 3PRTA 1NE9A 3H4QA 1RTQA 3FF3A 2ZEPA 2CXAA 3FJUA 4F9VA 5DWNA 4OKOA 1KUXA 5HXDA 5F48A 2IMOA 3SJEA 2AFUA 2RC4A 2PQ8A 2ZXVA 3FH4A 4DUKA 4B13A 3SJXA 4CGOA 1YK3A 1XE4A 2Q4ZA 4RN7A 3B7IA 2V77A 4OP4A 4UFXA 3SJGA 3B3CA 4NSQA 3VH9A 3F8KA 4AVAA 4R57A 2G0BA 4ZI6A 2PR8A 3GUXA 2ATRA 1DE4C 3RAMA 2FVGA 2VZZA 4ZY0A 4YRHA 4KOWA 4P4JA 3KI9A 2DF5A 4A39A 2G9DA 2HC9A 2HUZA 1ARMA 3IEHA 3TFYA 4KVME 2K5TA 2PCUA 2PVWA 4CYOA 5DS0A 2PJ1A 4ZX9A 2QJ8A 3NH4A 4L89A 1I21A 2REFA 8CPAA 2DPSA 4LX9A 1XJOA 3TO6A 2F7VA 4CGLA 1S3ZA 1P0HA 4UIBA 1CBXA 4Q38A 1ELLP 3GIUA 3PB9X 3D2MA 2JEVA 3KKWA 4Y49C 3BI1A 3SI2A 1QSNA 1HDUA 1FY7A 3TC8A 2WSAA 4A33A 4JXQA 4A37A 4NGTA 2ZEHA 1ARLA 3PB4X 4XPDC 3UY5A 1VKCA 2CTCA 2ZEDA 3D8PA 2AFOA 3NH5A 4JYWA 2FIWA 4M85A 4LUAA 3V38A 1S7KA 2ZEMA 4KS9A 2QYVA 4J3GA 1Q2CA 1Y0RA 3IIBA 4UF4A 4F0YA 2J8MA 1B87A 1CP7A 5F47A 5GCNA 4IHMA 1HEEA 4KLWA 1VHOA 2JBKA 5IV0A 2NYQA 2AFWA 1PCAA 1XIXA 1S60A 2QIRA 2NMTA 2Z0ZA 4KVOE 2VXKA 2NSMA 1PU9A 2PJ2A 2C6PA 4NFRA 4UEZA 2CIJA 2V8HA 4YGOA 1SQHA 3IWGA 1LFWA 1ZG9A 4AG7A 5JH9A 4AB7A 4PXBA 1AUGA 4AVCA 4FD4A 2POKA 3NE8A 4EWTA 3D7GA 2Q4VA 2FS5A 4C7IA 2C6GA 5J8CA 3R9GA 4MY0A 4B5PB 4IF5A 2I79A 4EVYA 3IU1A 2AJ6A 3P2HA 1LCPA 2G3TA 2V8DA 4NGPA 5JM6A 3MRUA 4R3LA 3SI0A 1S7NA 4XNHB 2I00A 3BXMA 5H84A 5JGFA 2EVNA 1M1DA 2Q51A 1KUVA 4C7HA 3HUVA 4GM5A 3CXPA 3TO9A 3NFZA 4NEXA 3FYNA 4YFJA 1BPMA 1Z8WA
chains in the Genus database with same CATH topology
3LODA 4R87A 3LD2A 3TCVA 2OB0A 4II9A 4QB9A 5HMNA 3B8GA 3PP9A 2Z11A 4AVBA 3DR8A 1QSOA 4UWJA 2QECA 1S5KA 5AG4A 1Z9UA 2Y0MA 4CYNA 1K4JA 4MBUA 4KSFA 5CNPA 4CYPA 4JD6A 1IIDA 3EXNA 1M44A 4H89A 2ZW5A 4B5OA 3DSBA 1BO4A 2B4DB 4CAFA 4C2YA 3N7ZA 4C2ZA 2J8NA 2QMLA 2B3VA 3W6SA 4CGNA 1MJAA 1Z4RA 3RYOA 2Z3NA 4MI4A 2FCKA 4ONUA 5KTAA 2FIAA 2OZUA 4M3SA 4KVXA 1IYLA 2Q0YA 4C2XA 2Q7BA 3SXNA 2GE3A 3DDDA 4JLYA 5AG5A 2R7HA 3C26A 4CAXA 3CXSA 5AG7A 1V0CA 3R1KA 5ISVA 5A27A 1TIQA 2O28A 1XMTA 1CM0A 2VZYA 3IU2A 1CJWA 2IL4A 3TOBA 4PSXA 2Z3KA 4KOYA 4UWIA 1I12A 2Z3MA 3I9SA 1QSRA 1Y9WA 3G8WA 2R1IA 2GIVA 4MFJA 4UCPA 2PR1A 3SHPA 3EO4A 4OADA 5DWMA 2DPTA 1RXTA 4PSWA 2Z3PA 1WWZA 2D4PA 1U6MA 4KSAA 2VI7A 1KZFA 3BJ8A 4MFQA 1S7LA 3K9UA 5A28A 2PC1A 4KOSA 1GHEA 4NCZA 4UCNA 1N71A 2Z3LA 2CNSA 1OZPA 5C82A 4R3KA 3F5BA 5F49A 3NE7A 3D2PA 5E96A 4A95A 3FBUA 3FIXA 5IB0A 4XNHC 4JXRA 3G3SA 4HNYB 3TTHA 3S6GA 4CAVA 3R9FA 2YGWA 3FXTA 4HNWB 4MJ8A 1I1DA 3R9EA 3FRMA 4H6UA 4QBJA 3VWDA 4B14A 4CYQA 4A30A 4QUSA 4UFVA 2B58A 3FB3A 3GY9A 4K30A 5G22A 2PRBA 4PK3A 2KCWA 2R98A 3D3SA 1QSMA 3BLNA 4MY3A 4PV6A 4XPLA 3JVNA 4HNXB 1M4IA 5AG6A 2FXFA 1YR0A 4JWPA 3DNSA 4CS0B 2G3AA 5G20A 1YGHA 3TOAA 4BBHA 4KZTA 4Y49B 4F6AA 3TE4A 3EFAA 1YX0A 4Q36A 2ZW7A 1MJ9A 4ZBGA 2WUUA 1ON0A 1M4GA 2GANA 1ZO0A 2J8RA 1XF8A 2BEIA 2WPXA 3F0AA 2WPWA 3PZJA 1IYKA 4E8OA 4MFKA 3WR7A 2JDDA 2OZHA 2B5GB 4XPKA 5AGEA 4L8AA 4AG9A 2B4BA 2Q04A 4A2ZA 4A32A 2B4DA 1BOBA 5KTCA 4CAEA 1WK4A 4E2AA 1S7FA 2BL1A 2OU2A 2D4OA 1IB1E 3CXQA 1MK4A 3T90A 4I49A 4MFZA 4KORA 1YLEA 4CRZB 1KUYA 2B3UA 3IWEA 4X5KA 4KUAA 2OZGA 4B12A 2YNEA 2JLMA 4QC6A 1RO5A 5C88A 1QSTA 5EBVA 4ORFA 4KOXA 4OLLA 2CNMA 3DR6A 1YREA 2REEA 4E0AA 5G1ZA 2X7BA 3E0KA 4QVTA 2AE6A 3IGRA 2F5IA 5KTDA 3GKRA 1XEBA 3JTKA 4UA3A 2P6FA 3OWCA 5G21A 2BSWA 3S6HA 4CGPA 4UBRA 1Q2YA 3BJ7A 5F46A 2ZPAA 2BUEA 4ZGYB 2P6GA 4KUBA 2P6EA 3JUWA 2ARHA 4RS2A 2FSRA 2PSWA 2FE7A 2DXQA 2Q44A 2R8VA 4RI1A 4CAWA 1IICA 4H6ZA 4U9YA 4MFPA 3T9YA 3MGDA 4MFLA 4DNCA 2FL4A 2YNCC 3R95A 1Q2DA 4OAEA 2Z3OA 3SXOA 1NSLA 4F0XA 3QAHA 3W91A 1VHSA 4U5YA 2CNTA 3QB8A 2YNDA 1P4NA 1YVKA 4MHDA 2P0WA 3H5ZA 5EC4A 2EUIA 2ZW6A 3TT2A 3TO7A 4FD6A 4A31A 3R96A 4B5PA 2VBQA 4FD7A 2VQYA 4KOUA 3S6KA 4B11A 5JQ4A 3FNCA 4NXYA 3I3GA 5IX3A 5BWAB 4BMHA 1LRZA 2YNCA 4FD5A 4CRYB 3VWEA 1Y9KA 1Z4EA 3PGPA 4NF1A 2JDCA 3ZJ0A 4XPDB 4JJXA 2H5MA 5H86A 3P2FA 2ZW4A 3GYAA 4HKFA 2HQYA 3A9LA 4KLVA 2PDOA 4PK2A 5HH1A 3EY5A 1Y7RA 5J8FA 4KOVA 1MJBA 1UFHA 2A4NA 1M4DA 3W6XA 3EC4A 4C68A 1NMTA 4GS4A 3V8IA 5I0CA 4CGMA 3S6FA 1J4JA 2B5GA 1L0CA 2Z10A 2OH1A 4UFWA 2FT0A 5JPHA 1PUAA 4U9ZA 4R9MA 2CY2A 3ZZIA 4UCMA 1R57A 4B10A 2VEZA 2HV2A 1B6BA 5FVJA 1YVOA 2Q4YA 4KOTA 2C27A 4IUSA 1NE9A 3H4QA 2CXAA 5DWNA 1KUXA 5F48A 2RC4A 2PQ8A 2ZXVA 4B13A 4CGOA 1YK3A 1XE4A 4UFXA 4NSQA 3F8KA 4AVAA 4R57A 2G0BA 2PR8A 2ATRA 2VZZA 4YRHA 4KOWA 2HUZA 3TFYA 4KVME 2K5TA 4CYOA 4L89A 1I21A 2REFA 2DPSA 4LX9A 3TO6A 4CGLA 1S3ZA 1P0HA 4Q38A 3D2MA 2JEVA 3KKWA 4Y49C 1QSNA 1FY7A 2WSAA 4A33A 4JXQA 4XPDC 3UY5A 1VKCA 3D8PA 4M85A 2FIWA 4LUAA 1S7KA 4KS9A 4J3GA 1Q2CA 4F0YA 1B87A 2J8MA 5F47A 5GCNA 4KLWA 5IV0A 1XIXA 1S60A 2QIRA 2NMTA 2Z0ZA 4KVOE 2VXKA 1PU9A 4YGOA 1SQHA 3IWGA 4AG7A 4AB7A 4AVCA 4FD4A 2Q4VA 2FS5A 4C7IA 5J8CA 3R9GA 4MY0A 4B5PB 4IF5A 2I79A 4EVYA 3IU1A 2AJ6A 3P2HA 2G3TA 4R3LA 1S7NA 4XNHB 2I00A 5H84A 2EVNA 1M1DA 1KUVA 4C7HA 3CXPA 3TO9A 4NEXA 3FYNA 4YFJA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3LOD A;  4R87 A;  3LD2 A;  3TCV A;  2OB0 A;  4II9 A;  4QB9 A;  5HMN A;  3B8G A;  3PP9 A;  2Z11 A;  4AVB A;  3DR8 A;  1QSO A;  4UWJ A;  2QEC A;  1S5K A;  1Z9U A;  2Y0M A;  1K4J A;  4MBU A;  5CNP A;  4JD6 A;  1IID A;  3EXN A;  1M44 A;  4H89 A;  2ZW5 A;  4B5O A;  3DSB A;  1BO4 A;  2B4D B;  3N7Z A;  2J8N A;  2QML A;  2B3V A;  3W6S A;  1MJA A;  1Z4R A;  3RYO A;  4MI4 A;  2FCK A;  4ONU A;  5KTA A;  2FIA A;  2OZU A;  4M3S A;  4KVX A;  1IYL A;  2Q0Y A;  2Q7B A;  3SXN A;  2GE3 A;  3DDD A;  4JLY A;  4CAX A;  2R7H A;  3C26 A;  3CXS A;  1V0C A;  3R1K A;  5ISV A;  1TIQ A;  2O28 A;  1XMT A;  1CM0 A;  2VZY A;  1CJW A;  2IL4 A;  3TOB A;  4PSX A;  4KOY A;  4UWI A;  1I12 A;  3I9S A;  1QSR A;  1Y9W A;  3G8W A;  2R1I A;  2GIV A;  2PR1 A;  3SHP A;  3EO4 A;  4OAD A;  5DWM A;  1RXT A;  4PSW A;  1WWZ A;  2D4P A;  1U6M A;  2VI7 A;  1KZF A;  3BJ8 A;  1S7L A;  3K9U A;  2PC1 A;  4KOS A;  1GHE A;  4NCZ A;  1N71 A;  2CNS A;  1OZP A;  5C82 A;  4R3K A;  3F5B A;  5F49 A;  3NE7 A;  3D2P A;  5E96 A;  3FBU A;  3FIX A;  5IB0 A;  4XNH C;  4JXR A;  3G3S A;  4HNY B;  3TTH A;  3S6G A;  4CAV A;  3R9F A;  3FXT A;  4HNW B;  4MJ8 A;  1I1D A;  3R9E A;  3FRM A;  4H6U A;  4QBJ A;  3VWD A;  4QUS A;  2B58 A;  3FB3 A;  3GY9 A;  4K30 A;  2PRB A;  4PK3 A;  2KCW A;  2R98 A;  3D3S A;  1QSM A;  3BLN A;  4MY3 A;  4PV6 A;  4XPL A;  3JVN A;  4HNX B;  1M4I A;  2FXF A;  1YR0 A;  4JWP A;  3DNS A;  4CS0 B;  2G3A A;  1YGH A;  3TOA A;  4KZT A;  4Y49 B;  4F6A A;  3TE4 A;  3EFA A;  1YX0 A;  2ZW7 A;  1MJ9 A;  4ZBG A;  1ON0 A;  1M4G A;  2GAN A;  2J8R A;  1XF8 A;  2BEI A;  2WPX A;  3F0A A;  2WPW A;  3PZJ A;  1IYK A;  4E8O A;  3WR7 A;  2JDD A;  2OZH A;  2B5G B;  4XPK A;  4L8A A;  4AG9 A;  2B4B A;  2Q04 A;  2B4D A;  1BOB A;  5KTC A;  1WK4 A;  4E2A A;  1S7F A;  2BL1 A;  2OU2 A;  2D4O A;  1IB1 E;  3CXQ A;  1MK4 A;  3T90 A;  4I49 A;  4KOR A;  1YLE A;  4CRZ B;  1KUY A;  2B3U A;  4X5K A;  4KUA A;  2OZG A;  2JLM A;  4QC6 A;  1RO5 A;  5C88 A;  1QST A;  5EBV A;  4ORF A;  4KOX A;  4OLL A;  2CNM A;  3DR6 A;  1YRE A;  2REE A;  4E0A A;  2X7B A;  3E0K A;  4QVT A;  2AE6 A;  3IGR A;  2F5I A;  5KTD A;  3GKR A;  1XEB A;  4UA3 A;  2P6F A;  3OWC A;  2BSW A;  3S6H A;  4UBR A;  1Q2Y A;  3BJ7 A;  5F46 A;  2ZPA A;  2BUE A;  2P6G A;  4KUB A;  2P6E A;  3JUW A;  2ARH A;  4RS2 A;  2FSR A;  2PSW A;  2FE7 A;  2DXQ A;  2Q44 A;  2R8V A;  4RI1 A;  4CAW A;  1IIC A;  4H6Z A;  4U9Y A;  3T9Y A;  3MGD A;  4DNC A;  2FL4 A;  3R95 A;  1Q2D A;  4OAE A;  3SXO A;  1NSL A;  3QAH A;  3W91 A;  1VHS A;  4U5Y A;  2CNT A;  3QB8 A;  1P4N A;  1YVK A;  4MHD A;  2P0W A;  5EC4 A;  2EUI A;  2ZW6 A;  3TT2 A;  3TO7 A;  4FD6 A;  3R96 A;  4B5P A;  2VBQ A;  4FD7 A;  2VQY A;  4KOU A;  3S6K A;  5JQ4 A;  3FNC A;  4NXY A;  3I3G A;  5IX3 A;  4BMH A;  1LRZ A;  4FD5 A;  4CRY B;  3VWE A;  1Y9K A;  1Z4E A;  3PGP A;  4NF1 A;  2JDC A;  3ZJ0 A;  4XPD B;  4JJX A;  2H5M A;  5H86 A;  3P2F A;  2ZW4 A;  3GYA A;  4HKF A;  2HQY A;  4KLV A;  2PDO A;  4PK2 A;  5HH1 A;  3EY5 A;  1Y7R A;  5J8F A;  4KOV A;  1MJB A;  1UFH A;  2A4N A;  1M4D A;  3W6X A;  3EC4 A;  1NMT A;  4GS4 A;  3V8I A;  5I0C A;  3S6F A;  1J4J A;  2B5G A;  1L0C A;  2Z10 A;  2OH1 A;  2FT0 A;  5JPH A;  1PUA A;  4U9Z A;  4R9M A;  2CY2 A;  3ZZI A;  1R57 A;  2VEZ A;  2HV2 A;  1B6B A;  5FVJ A;  1YVO A;  2Q4Y A;  4KOT A;  2C27 A;  4IUS A;  1NE9 A;  3H4Q A;  5DWN A;  1KUX A;  5F48 A;  2RC4 A;  2PQ8 A;  2ZXV A;  1YK3 A;  1XE4 A;  4NSQ A;  3F8K A;  4AVA A;  4R57 A;  2G0B A;  2PR8 A;  2ATR A;  2VZZ A;  4YRH A;  4KOW A;  2HUZ A;  3TFY A;  4KVM E;  2K5T A;  4L89 A;  1I21 A;  2REF A;  4LX9 A;  3TO6 A;  1S3Z A;  1P0H A;  3D2M A;  2JEV A;  3KKW A;  4Y49 C;  1QSN A;  1FY7 A;  4JXQ A;  4XPD C;  3UY5 A;  1VKC A;  3D8P A;  4M85 A;  2FIW A;  4LUA A;  1S7K A;  4J3G A;  1Q2C A;  4F0Y A;  1B87 A;  2J8M A;  5F47 A;  5GCN A;  4KLW A;  5IV0 A;  1XIX A;  1S60 A;  2QIR A;  2NMT A;  2Z0Z A;  4KVO E;  2VXK A;  1PU9 A;  4YGO A;  1SQH A;  3IWG A;  4AG7 A;  4AB7 A;  4AVC A;  4FD4 A;  2Q4V A;  2FS5 A;  5J8C A;  3R9G A;  4MY0 A;  4B5P B;  4IF5 A;  2I79 A;  4EVY A;  3P2H A;  2AJ6 A;  2G3T A;  4R3L A;  1S7N A;  4XNH B;  2I00 A;  5H84 A;  2EVN A;  1M1D A;  1KUV A;  3CXP A;  3TO9 A;  4NEX A;  3FYN A;  4YFJ A; 
#chains in the Genus database with same CATH topology
 1XRY A;  3LOD A;  4R87 A;  3LD2 A;  3TCV A;  1CG2 A;  2OB0 A;  4FUU A;  4II9 A;  4QB9 A;  5HMN A;  3B8G A;  1TKF A;  1ZG7 A;  2Z11 A;  2EBJ A;  3PP9 A;  4AVB A;  4P4B A;  4BIN A;  4OC0 A;  3DR8 A;  1QSO A;  1TF8 A;  4UWJ A;  2QEC A;  5LYI A;  1S5K A;  5AG4 A;  1Z9U A;  2EK9 A;  3CZX A;  4NGN A;  2Y0M A;  4CYN A;  1K4J A;  4MBU A;  4KSF A;  5CNP A;  5LYD A;  4CYP A;  4JD6 A;  1IID A;  3EXN A;  1M44 A;  4H89 A;  2ZW5 A;  4B5O A;  3DSB A;  3WC7 A;  1BO4 A;  2B4D B;  2PJ7 A;  4C2Y A;  4CAF A;  3N7Z A;  2HB6 A;  2J8N A;  2QML A;  2B3V A;  3W6S A;  4C2Z A;  4CGN A;  1MJA A;  1VHE A;  1Z4R A;  3RYO A;  2GLF A;  3B2Y A;  1YW4 A;  4P4F A;  1JWQ A;  2Z3N A;  3QAY A;  4MI4 A;  2FCK A;  2VL1 A;  4ONU A;  3ISZ A;  5KTA A;  2FIA A;  4UEF A;  3BI0 A;  2V8V A;  1M4L A;  2OZU A;  4PPZ A;  3T8W A;  4M3S A;  1Q7L A;  4NGM A;  4KVX A;  1IYL A;  4JZ0 A;  2Q0Y A;  4BD9 A;  5D29 A;  3MN8 A;  4C2X A;  2Q7B A;  3SXN A;  2ZEF A;  2GE3 A;  4PXE A;  1TF9 A;  4EME A;  3DDD A;  4JLY A;  5AG5 A;  2R7H A;  3C26 A;  4CAX A;  3CXS A;  5AG7 A;  4FAI A;  1V0C A;  3R1K A;  5ISV A;  5A27 A;  1TIQ A;  4M6H A;  2O28 A;  1YQE A;  4P44 A;  2PJ4 A;  1XMT A;  1CM0 A;  1QMU A;  2VZY A;  3IU2 A;  3VAR A;  1CJW A;  2IL4 A;  4X2T A;  3TOB A;  5HVF A;  3NA6 A;  4PSX A;  2Z3K A;  3LAC A;  4ZY2 A;  4KOY A;  4R6T A;  4UWI A;  1I12 A;  1XFO A;  3DGV A;  2Z3M A;  3I9S A;  4P4D A;  1QSR A;  2IJZ A;  2O53 A;  2GFQ A;  3CDX A;  1Y9W A;  3PFO A;  3G8W A;  2R1I A;  2GIV A;  4MFJ A;  5J1Q A;  4UCP A;  2PR1 A;  3SHP A;  2PJ9 A;  3EO4 A;  4OAD A;  5DWM A;  4FBE A;  2DPT A;  2F8H A;  2PJ0 A;  1F2O A;  1RXT A;  1BPN A;  2Z3P A;  1WWZ A;  2D4P A;  4PSW A;  1U6M A;  2XEG A;  4KSA A;  4TWE A;  2VI7 A;  2I3C A;  4OC2 A;  2DEA A;  3QNV A;  1KZF A;  2ZEL A;  3BJ8 A;  1S7L A;  2XEJ A;  3K9U A;  4MFQ A;  2AFS A;  5A28 A;  3BHX A;  2PC1 A;  1YSJ A;  1GHE A;  4KOS A;  1ZG8 A;  4X8I A;  4NCZ A;  1OBR A;  4UCN A;  1N71 A;  2Z3L A;  2CNS A;  2PE3 A;  2XEI A;  4KSI A;  1OZP A;  5C82 A;  4R3K A;  3F5B A;  5K8N A;  5F49 A;  3I1U A;  3NE7 A;  3D2P A;  5E96 A;  4A95 A;  3FBU A;  3FIX A;  1YW6 A;  5IB0 A;  1BAV A;  3KQX A;  4XNH C;  4JXR A;  3G3S A;  4HNY B;  3TTH A;  3S6G A;  4CAV A;  4P4E A;  2YGW A;  3R9F A;  4RUH A;  5D8N A;  4OID A;  3FXT A;  1Z5R A;  4HNW B;  4MJ8 A;  3CT9 A;  3WC6 A;  4X3R A;  1I1D A;  3R9E A;  3B3T A;  3FRM A;  4H6U A;  4QBJ A;  3VWD A;  1XOV A;  1XMB A;  4B14 A;  4CYQ A;  2PJ3 A;  4MCQ A;  4A30 A;  3D68 A;  4QUS A;  1CPS A;  4UFV A;  2B58 A;  3FB3 A;  3GY9 A;  3PB8 X;  4PQA A;  4K30 A;  2PRQ A;  3B3S A;  5G22 A;  5HVH A;  2PRB A;  4OME A;  2KCW A;  1IY7 A;  4PK3 A;  2R98 A;  4CPA A;  3D3S A;  4B6Z A;  1QSM A;  5CPA A;  4YWY A;  3BLN A;  4MY3 A;  4PV6 A;  4XPL A;  3JVN A;  4HNX B;  3IO1 A;  4ZY1 A;  2BO9 A;  1M4I A;  4MCP A;  1BLL E;  3PBE A;  5AG6 A;  2FXF A;  1YR0 A;  3H8E A;  3DNS A;  4JWP A;  4M6G A;  1Z8T A;  4CS0 B;  2G3A A;  5G20 A;  5K8P A;  1YGH A;  3TOA A;  4BBH A;  4KZT A;  4Y49 B;  4H2K A;  4F6A A;  3TE4 A;  3EFA A;  1YX0 A;  3LMS A;  1IGB A;  3SJF A;  4R76 A;  1ZLI A;  4Q36 A;  1H8L A;  5K8O A;  2ZW7 A;  3FVL A;  1MJ9 A;  4ZBG A;  3IC1 A;  3L2N A;  2WUU A;  3WT4 A;  5CBM A;  2ZOF A;  3FED A;  1ON0 A;  5IB9 A;  1M4G A;  1LOK A;  2AFZ A;  1ZO0 A;  2GAN A;  4NJR A;  1NSA A;  1YME A;  2J8R A;  1UWY A;  1XF8 A;  2BEI A;  2PJA A;  2AFX A;  2WPX A;  3D67 A;  2XEF A;  1Z8L A;  2WPW A;  1IYK A;  3F0A A;  3PZJ A;  4E8O A;  1YLO A;  2EWB A;  2JBJ A;  4MFK A;  3WR7 A;  1X10 A;  3GB0 A;  3V7Z A;  2JDD A;  2OZH A;  2B5G B;  4HPS A;  4XPK A;  5AGE A;  2ZEE A;  3D66 A;  3PB7 X;  2ZEG A;  4L8A A;  4AG9 A;  1QQ9 A;  2B4B A;  2Q04 A;  4A2Z A;  4A32 A;  2AFM A;  1HDQ A;  1BOB A;  2B4D A;  3SI1 A;  5KTC A;  4CAE A;  2ZEO A;  3CPX A;  1WK4 A;  3S9L A;  4O23 A;  1GYT A;  1R43 A;  1S7F A;  2OU2 A;  2BL1 A;  2D4O A;  4K3N A;  4E2A A;  3D7H A;  1IB1 E;  3CXQ A;  2GRE A;  1MK4 A;  3PEI A;  5K8M A;  4R7M A;  4I49 A;  3T90 A;  4MFZ A;  4KOR A;  1YLE A;  2RFH A;  4CRZ B;  3N5F A;  4MXU A;  4DYO A;  1KUY A;  2B3U A;  3IWE A;  4UIA A;  1CX8 A;  2PJ5 A;  4X5K A;  3RNZ A;  3KR5 A;  1Y0Y A;  3D7F A;  4OC4 A;  2IQ6 A;  2V8G A;  2OZG A;  4KUA A;  4B12 A;  5LRK A;  4NGR A;  2YNE A;  3S9M A;  2JLM A;  4QC6 A;  4TNU A;  1RO5 A;  4Q7A A;  5C88 A;  3B3V A;  4WJB A;  1ELM P;  1TKH A;  2ODF A;  1QST A;  5EBV A;  3CPA A;  4NGS A;  3KZW A;  2EK8 A;  1AMP A;  4DJL A;  2RB7 A;  3IJ3 A;  4IK2 A;  2CF4 A;  4M6I A;  3WC5 A;  4ORF A;  4KOX A;  4OLL A;  4A94 A;  2CNM A;  3DR6 A;  3WAB A;  1YRE A;  2J9A A;  2REE A;  3H8F A;  3KR4 A;  1LAM A;  1VGY A;  4NJQ A;  4E0A A;  1ZLH A;  2ANP A;  4MHY A;  4P45 A;  1DTD A;  2X7B A;  3E0K A;  2AE6 A;  2BOA A;  3DLJ A;  3IGR A;  4QVT A;  4UEE A;  3S9N A;  2BCO A;  2F5I A;  3GKR A;  5KTD A;  1XEB A;  2ZOG A;  4P4I A;  3D4U A;  3JTK A;  3RO0 A;  4UA3 A;  2P6F A;  3RBU A;  3OWC A;  5G21 A;  4FWU A;  2BSW A;  3S6H A;  4CGP A;  4UBR A;  3B3W A;  1Q2Y A;  3BJ7 A;  4ONW A;  5F46 A;  1A2Z A;  2ZPA A;  2BUE A;  4W9Y A;  4EFD A;  4ZGY B;  2P6G A;  3TX8 A;  4KUB A;  4F9U A;  2P6E A;  3JUW A;  2ARH A;  4RS2 A;  4P10 A;  2FSR A;  2PSW A;  4LQG A;  2FE7 A;  2CTB A;  5LRG A;  2DXQ A;  2Q44 A;  2R8V A;  4RI1 A;  2PIZ A;  4MHN A;  4WWV A;  4CAW A;  1IIC A;  4H6Z A;  2C6C A;  1KWM A;  4U9Y A;  4MFP A;  3IFE A;  3T9Y A;  2PJB A;  3MGD A;  4OC3 A;  4F8Z A;  2QVP A;  4MFL A;  4DNC A;  2FL4 A;  2YNC C;  3R95 A;  1Q2D A;  4OAE A;  4LQ6 A;  3FX6 A;  2Z3O A;  3FEC A;  3FMC A;  3SXO A;  1NSL A;  4F0X A;  1LAP A;  4GXH A;  3B35 A;  1F2P A;  3QAH A;  1EE3 P;  4MCR A;  3W91 A;  4Z65 A;  1VHS A;  4U5Y A;  5LRJ A;  2CNT A;  1Z2L A;  3QB8 A;  2YND A;  4P6Y A;  4ZX8 A;  5HVG A;  1P4N A;  1VIX A;  1YVK A;  2Q43 A;  3KHX A;  4MHD A;  3KAS A;  2P0W A;  3KQZ A;  3H5Z A;  5ELY A;  6CPA A;  3PB6 X;  5EC4 A;  5I4M A;  2EUI A;  2ZW6 A;  3K2K A;  3TT2 A;  2PJ8 A;  3K9T A;  3RZA A;  3TO7 A;  3GLJ A;  4FD6 A;  1F57 A;  4A31 A;  3R96 A;  1FT7 A;  4B5P A;  3FEE A;  4G1P A;  2VBQ A;  2GLJ A;  1AYE A;  4FD7 A;  2VQY A;  3HLP A;  1CPX A;  3KHZ A;  4KOU A;  3S6K A;  4B11 A;  5JQ4 A;  3FNC A;  4OC1 A;  1Y7E A;  4NXY A;  3I3G A;  2ABZ A;  4OC5 A;  3VAT A;  5IX3 A;  1JQG A;  5BWA B;  4BMH A;  1LRZ A;  2YNC A;  2ZEN A;  4FD5 A;  4CRY B;  1FNO A;  2C1C A;  3VWE A;  1Y9K A;  1Z4E A;  2GU2 A;  3PGP A;  4NF1 A;  1IOF A;  2JDC A;  3ZJ0 A;  4XPD B;  4JJX A;  1TKJ A;  2H5M A;  4R8F A;  4YU9 A;  5H86 A;  1LAN A;  1Z8X A;  3P2F A;  2ZW4 A;  2WZN A;  5F09 A;  4MRI A;  4PXC A;  4ZYQ A;  5LYL A;  2OR4 A;  3GYA A;  4HKF A;  2HQY A;  3A9L A;  4KLV A;  3KGQ A;  2PDO A;  1TXR A;  4PK2 A;  5HH1 A;  2PIY A;  4IAV A;  3EY5 A;  1Y7R A;  5J8F A;  4KOV A;  1MJB A;  1UFH A;  4NGQ A;  5LYF A;  2EO8 A;  4MHZ A;  2A4N A;  1M4D A;  3W6X A;  3EC4 A;  4C68 A;  1NMT A;  4GS4 A;  3V8I A;  5I0C A;  4CGM A;  3S6F A;  2PJC A;  2JEW A;  3KL9 A;  4PXD A;  1J4J A;  1XBU A;  2B5G A;  2Q7S A;  4MHP A;  3LWU A;  4AXV A;  1L0C A;  2PJ6 A;  1CP6 A;  2Z10 A;  1PYT B;  2OH1 A;  4UFW A;  3IWW A;  1IU8 A;  2FT0 A;  2WYR A;  1R3N A;  5G1Z A;  1PUA A;  5JPH A;  1IOI A;  4U9Z A;  4R9M A;  4OIW A;  4MCS A;  2CY2 A;  3ZZI A;  3JRU A;  4UCM A;  1R57 A;  4B10 A;  2VEZ A;  2HV2 A;  2O4H A;  1B6B A;  3D7D A;  3PBB A;  5FVJ A;  1YVO A;  2Q4Y A;  3ISX A;  4KOT A;  2PVV A;  7CPA A;  1X12 A;  2OOT A;  5EMI A;  2C27 A;  4A38 A;  4MMO A;  3H8G A;  5THW A;  3PFE A;  3NH8 A;  4IUS A;  3PRT A;  1NE9 A;  3H4Q A;  1RTQ A;  3FF3 A;  2ZEP A;  2CXA A;  3FJU A;  4F9V A;  5DWN A;  4OKO A;  1KUX A;  5HXD A;  5F48 A;  2IMO A;  3SJE A;  2AFU A;  2RC4 A;  2PQ8 A;  2ZXV A;  3FH4 A;  4DUK A;  4B13 A;  3SJX A;  4CGO A;  1YK3 A;  1XE4 A;  2Q4Z A;  4RN7 A;  3B7I A;  2V77 A;  4OP4 A;  4UFX A;  3SJG A;  3B3C A;  4NSQ A;  3VH9 A;  3F8K A;  4AVA A;  4R57 A;  2G0B A;  4ZI6 A;  2PR8 A;  3GUX A;  2ATR A;  1DE4 C;  3RAM A;  2FVG A;  2VZZ A;  4ZY0 A;  4YRH A;  4KOW A;  4P4J A;  3KI9 A;  2DF5 A;  4A39 A;  2G9D A;  2HC9 A;  2HUZ A;  1ARM A;  3IEH A;  3TFY A;  4KVM E;  2K5T A;  2PCU A;  2PVW A;  4CYO A;  5DS0 A;  2PJ1 A;  4ZX9 A;  2QJ8 A;  3NH4 A;  4L89 A;  1I21 A;  2REF A;  8CPA A;  2DPS A;  4LX9 A;  1XJO A;  3TO6 A;  2F7V A;  4CGL A;  1S3Z A;  1P0H A;  4UIB A;  1CBX A;  4Q38 A;  1ELL P;  3GIU A;  3PB9 X;  3D2M A;  2JEV A;  3KKW A;  4Y49 C;  3BI1 A;  3SI2 A;  1QSN A;  1HDU A;  1FY7 A;  3TC8 A;  2WSA A;  4A33 A;  4JXQ A;  4A37 A;  4NGT A;  2ZEH A;  1ARL A;  3PB4 X;  4XPD C;  3UY5 A;  1VKC A;  2CTC A;  2ZED A;  3D8P A;  2AFO A;  3NH5 A;  4JYW A;  2FIW A;  4M85 A;  4LUA A;  3V38 A;  1S7K A;  2ZEM A;  4KS9 A;  2QYV A;  4J3G A;  1Q2C A;  1Y0R A;  3IIB A;  4UF4 A;  4F0Y A;  2J8M A;  1B87 A;  1CP7 A;  5F47 A;  5GCN A;  4IHM A;  1HEE A;  4KLW A;  1VHO A;  2JBK A;  5IV0 A;  2NYQ A;  2AFW A;  1PCA A;  1XIX A;  1S60 A;  2QIR A;  2NMT A;  2Z0Z A;  4KVO E;  2VXK A;  2NSM A;  1PU9 A;  2PJ2 A;  2C6P A;  4NFR A;  4UEZ A;  2CIJ A;  2V8H A;  4YGO A;  1SQH A;  3IWG A;  1LFW A;  1ZG9 A;  4AG7 A;  5JH9 A;  4AB7 A;  4PXB A;  1AUG A;  4AVC A;  4FD4 A;  2POK A;  3NE8 A;  4EWT A;  3D7G A;  2Q4V A;  2FS5 A;  4C7I A;  2C6G A;  5J8C A;  3R9G A;  4MY0 A;  4B5P B;  4IF5 A;  2I79 A;  4EVY A;  3IU1 A;  2AJ6 A;  3P2H A;  1LCP A;  2G3T A;  2V8D A;  4NGP A;  5JM6 A;  3MRU A;  4R3L A;  3SI0 A;  1S7N A;  4XNH B;  2I00 A;  3BXM A;  5H84 A;  5JGF A;  2EVN A;  1M1D A;  2Q51 A;  1KUV A;  4C7H A;  3HUV A;  4GM5 A;  3CXP A;  3TO9 A;  3NFZ A;  4NEX A;  3FYN A;  4YFJ A;  1BPM A;  1Z8W A; 
#chains in the Genus database with same CATH homology
 3LOD A;  4R87 A;  3LD2 A;  3TCV A;  2OB0 A;  4II9 A;  4QB9 A;  5HMN A;  3B8G A;  3PP9 A;  2Z11 A;  4AVB A;  3DR8 A;  1QSO A;  4UWJ A;  2QEC A;  1S5K A;  5AG4 A;  1Z9U A;  2Y0M A;  4CYN A;  1K4J A;  4MBU A;  4KSF A;  5CNP A;  4CYP A;  4JD6 A;  1IID A;  3EXN A;  1M44 A;  4H89 A;  2ZW5 A;  4B5O A;  3DSB A;  1BO4 A;  2B4D B;  4CAF A;  4C2Y A;  3N7Z A;  4C2Z A;  2J8N A;  2QML A;  2B3V A;  3W6S A;  4CGN A;  1MJA A;  1Z4R A;  3RYO A;  2Z3N A;  4MI4 A;  2FCK A;  4ONU A;  5KTA A;  2FIA A;  2OZU A;  4M3S A;  4KVX A;  1IYL A;  2Q0Y A;  4C2X A;  2Q7B A;  3SXN A;  2GE3 A;  3DDD A;  4JLY A;  5AG5 A;  2R7H A;  3C26 A;  4CAX A;  3CXS A;  5AG7 A;  1V0C A;  3R1K A;  5ISV A;  5A27 A;  1TIQ A;  2O28 A;  1XMT A;  1CM0 A;  2VZY A;  3IU2 A;  1CJW A;  2IL4 A;  3TOB A;  4PSX A;  2Z3K A;  4KOY A;  4UWI A;  1I12 A;  2Z3M A;  3I9S A;  1QSR A;  1Y9W A;  3G8W A;  2R1I A;  2GIV A;  4MFJ A;  4UCP A;  2PR1 A;  3SHP A;  3EO4 A;  4OAD A;  5DWM A;  2DPT A;  1RXT A;  4PSW A;  2Z3P A;  1WWZ A;  2D4P A;  1U6M A;  4KSA A;  2VI7 A;  1KZF A;  3BJ8 A;  4MFQ A;  1S7L A;  3K9U A;  5A28 A;  2PC1 A;  4KOS A;  1GHE A;  4NCZ A;  4UCN A;  1N71 A;  2Z3L A;  2CNS A;  1OZP A;  5C82 A;  4R3K A;  3F5B A;  5F49 A;  3NE7 A;  3D2P A;  5E96 A;  4A95 A;  3FBU A;  3FIX A;  5IB0 A;  4XNH C;  4JXR A;  3G3S A;  4HNY B;  3TTH A;  3S6G A;  4CAV A;  3R9F A;  2YGW A;  3FXT A;  4HNW B;  4MJ8 A;  1I1D A;  3R9E A;  3FRM A;  4H6U A;  4QBJ A;  3VWD A;  4B14 A;  4CYQ A;  4A30 A;  4QUS A;  4UFV A;  2B58 A;  3FB3 A;  3GY9 A;  4K30 A;  5G22 A;  2PRB A;  4PK3 A;  2KCW A;  2R98 A;  3D3S A;  1QSM A;  3BLN A;  4MY3 A;  4PV6 A;  4XPL A;  3JVN A;  4HNX B;  1M4I A;  5AG6 A;  2FXF A;  1YR0 A;  4JWP A;  3DNS A;  4CS0 B;  2G3A A;  5G20 A;  1YGH A;  3TOA A;  4BBH A;  4KZT A;  4Y49 B;  4F6A A;  3TE4 A;  3EFA A;  1YX0 A;  4Q36 A;  2ZW7 A;  1MJ9 A;  4ZBG A;  2WUU A;  1ON0 A;  1M4G A;  2GAN A;  1ZO0 A;  2J8R A;  1XF8 A;  2BEI A;  2WPX A;  3F0A A;  2WPW A;  3PZJ A;  1IYK A;  4E8O A;  4MFK A;  3WR7 A;  2JDD A;  2OZH A;  2B5G B;  4XPK A;  5AGE A;  4L8A A;  4AG9 A;  2B4B A;  2Q04 A;  4A2Z A;  4A32 A;  2B4D A;  1BOB A;  5KTC A;  4CAE A;  1WK4 A;  4E2A A;  1S7F A;  2BL1 A;  2OU2 A;  2D4O A;  1IB1 E;  3CXQ A;  1MK4 A;  3T90 A;  4I49 A;  4MFZ A;  4KOR A;  1YLE A;  4CRZ B;  1KUY A;  2B3U A;  3IWE A;  4X5K A;  4KUA A;  2OZG A;  4B12 A;  2YNE A;  2JLM A;  4QC6 A;  1RO5 A;  5C88 A;  1QST A;  5EBV A;  4ORF A;  4KOX A;  4OLL A;  2CNM A;  3DR6 A;  1YRE A;  2REE A;  4E0A A;  5G1Z A;  2X7B A;  3E0K A;  4QVT A;  2AE6 A;  3IGR A;  2F5I A;  5KTD A;  3GKR A;  1XEB A;  3JTK A;  4UA3 A;  2P6F A;  3OWC A;  5G21 A;  2BSW A;  3S6H A;  4CGP A;  4UBR A;  1Q2Y A;  3BJ7 A;  5F46 A;  2ZPA A;  2BUE A;  4ZGY B;  2P6G A;  4KUB A;  2P6E A;  3JUW A;  2ARH A;  4RS2 A;  2FSR A;  2PSW A;  2FE7 A;  2DXQ A;  2Q44 A;  2R8V A;  4RI1 A;  4CAW A;  1IIC A;  4H6Z A;  4U9Y A;  4MFP A;  3T9Y A;  3MGD A;  4MFL A;  4DNC A;  2FL4 A;  2YNC C;  3R95 A;  1Q2D A;  4OAE A;  2Z3O A;  3SXO A;  1NSL A;  4F0X A;  3QAH A;  3W91 A;  1VHS A;  4U5Y A;  2CNT A;  3QB8 A;  2YND A;  1P4N A;  1YVK A;  4MHD A;  2P0W A;  3H5Z A;  5EC4 A;  2EUI A;  2ZW6 A;  3TT2 A;  3TO7 A;  4FD6 A;  4A31 A;  3R96 A;  4B5P A;  2VBQ A;  4FD7 A;  2VQY A;  4KOU A;  3S6K A;  4B11 A;  5JQ4 A;  3FNC A;  4NXY A;  3I3G A;  5IX3 A;  5BWA B;  4BMH A;  1LRZ A;  2YNC A;  4FD5 A;  4CRY B;  3VWE A;  1Y9K A;  1Z4E A;  3PGP A;  4NF1 A;  2JDC A;  3ZJ0 A;  4XPD B;  4JJX A;  2H5M A;  5H86 A;  3P2F A;  2ZW4 A;  3GYA A;  4HKF A;  2HQY A;  3A9L A;  4KLV A;  2PDO A;  4PK2 A;  5HH1 A;  3EY5 A;  1Y7R A;  5J8F A;  4KOV A;  1MJB A;  1UFH A;  2A4N A;  1M4D A;  3W6X A;  3EC4 A;  4C68 A;  1NMT A;  4GS4 A;  3V8I A;  5I0C A;  4CGM A;  3S6F A;  1J4J A;  2B5G A;  1L0C A;  2Z10 A;  2OH1 A;  4UFW A;  2FT0 A;  5JPH A;  1PUA A;  4U9Z A;  4R9M A;  2CY2 A;  3ZZI A;  4UCM A;  1R57 A;  4B10 A;  2VEZ A;  2HV2 A;  1B6B A;  5FVJ A;  1YVO A;  2Q4Y A;  4KOT A;  2C27 A;  4IUS A;  1NE9 A;  3H4Q A;  2CXA A;  5DWN A;  1KUX A;  5F48 A;  2RC4 A;  2PQ8 A;  2ZXV A;  4B13 A;  4CGO A;  1YK3 A;  1XE4 A;  4UFX A;  4NSQ A;  3F8K A;  4AVA A;  4R57 A;  2G0B A;  2PR8 A;  2ATR A;  2VZZ A;  4YRH A;  4KOW A;  2HUZ A;  3TFY A;  4KVM E;  2K5T A;  4CYO A;  4L89 A;  1I21 A;  2REF A;  2DPS A;  4LX9 A;  3TO6 A;  4CGL A;  1S3Z A;  1P0H A;  4Q38 A;  3D2M A;  2JEV A;  3KKW A;  4Y49 C;  1QSN A;  1FY7 A;  2WSA A;  4A33 A;  4JXQ A;  4XPD C;  3UY5 A;  1VKC A;  3D8P A;  4M85 A;  2FIW A;  4LUA A;  1S7K A;  4KS9 A;  4J3G A;  1Q2C A;  4F0Y A;  1B87 A;  2J8M A;  5F47 A;  5GCN A;  4KLW A;  5IV0 A;  1XIX A;  1S60 A;  2QIR A;  2NMT A;  2Z0Z A;  4KVO E;  2VXK A;  1PU9 A;  4YGO A;  1SQH A;  3IWG A;  4AG7 A;  4AB7 A;  4AVC A;  4FD4 A;  2Q4V A;  2FS5 A;  4C7I A;  5J8C A;  3R9G A;  4MY0 A;  4B5P B;  4IF5 A;  2I79 A;  4EVY A;  3IU1 A;  2AJ6 A;  3P2H A;  2G3T A;  4R3L A;  1S7N A;  4XNH B;  2I00 A;  5H84 A;  2EVN A;  1M1D A;  1KUV A;  4C7H A;  3CXP A;  3TO9 A;  4NEX A;  3FYN A;  4YFJ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...