2OH1A

Crystal structure of acetyltransferase gnat family (yp_013287.1) from listeria monocytogenes 4b f2365 at 1.46 a resolution
Total Genus 47
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
47
sequence length
175
structure length
175
Chain Sequence
NKITAGGLEFLVRFAAPTDRLKINDLMIDTARWLKESGSTQWSDILHGFDVHNIEQRIELGEVALFETEAGALAGAMIIRKTPSDWDTDLWEDLAIDKAYYLHRIMVSRAFSGISLSKQMIYFAEKLGIEMSVPFIRLDCIESNETLNQMYVRYGFQFSGKKNGFYLYQKELSQK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords Acetyltransferase, GNAT family
publication title Crystal structure of acetyltransferase GNAT family (YP_013287.1) from Listeria monocytogenes 4b F2365 at 1.46 A resolution
rcsb
source organism Listeria monocytogenes str. 4b
total genus 47
structure length 175
sequence length 175
chains with identical sequence B, C, D
ec nomenclature ec 2.3.-.-:
pdb deposition date 2007-01-09
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.630.30 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Aminopeptidase 2oh1A00
4HNWB 1NE9A 2VZZA 3E0KA 2HUZA 3CXQA 2HV2A 4NEXA 2J8MA 4AVBA 2VI7A 3H4QA 2FT0A 5E96A 1M4GA 2DXQA 2IL4A 3TCVA 3D2MA 3GKRA 2R7HA 2QMLA 2VEZA 2JEVA 3R96A 1YK3A 1I1DA 4LUAA 4HNXB 3UY5A 5JQ4A 2JLMA 4F0YA 5IX3A 1GHEA 4PSWA 3WR7A 1B87A 3K9UA 2J8NA 1MJBA 5JPHA 2FS5A 3DSBA 4UA3A 3IGRA 2FCKA 4XPDB 3TOAA 3F0AA 5HMNA 4KLVA 1CJWA 1N71A 4MY3A 2PQ8A 1XEBA 2P6EA 1YVOA 4CS0B 4FD6A 3D2PA 4NXYA 5C82A 1QSRA 2FXFA 2PDOA 4U9YA 1YVKA 3SHPA 4YRHA 4R9MA 1Z9UA 5HH1A 1S60A 3S6GA 1CM0A 1J4JA 2GIVA 3TO7A 4KOSA 2JDDA 4JXRA 2FL4A 3G8WA 2QECA 1PUAA 1VKCA 4KOVA 1XE4A 4FD4A 2FSRA 5IB0A 4PK3A 4JWPA 4XNHB 4CAVA 1OZPA 4Y49C 1BO4A 1PU9A 1SQHA 4KOUA 2C27A 4GS4A 3G3SA 3EFAA 4BMHA 4RI1A 2Q0YA 4NF1A 3R9FA 2WPWA 5C88A 1Q2CA 2B5GB 1M1DA 1S3ZA 3F8KA 3GY9A 4CAXA 2CNTA 4FD7A 3VWDA 1S7NA 4U9ZA 2Z0ZA 4AG9A 2PR1A 4ORFA 3FNCA 2NMTA 4OAEA 4AB7A 4JLYA 2REFA 3PP9A 2X7BA 3TO6A 4F6AA 3QAHA 4EVYA 3FRMA 1KUVA 2Q7BA 4MHDA 2CY2A 4M85A 1IICA 4JXQA 5H86A 2CNSA 4KLWA 2H5MA 4PSXA 3F5BA 2J8RA 3FXTA 5F49A 2PRBA 3TE4A 2PC1A 4MJ8A 3R9GA 2ZPAA 2P0WA 3OWCA 4QC6A 3VWEA 2R8VA 3PGPA 1UFHA 3IWGA 2VBQA 3DDDA 4ONUA 2FE7A 4XPKA 3V8IA 4H89A 1M4IA 1KUYA 2ZXVA 1NSLA 3BLNA 5KTCA 1V0CA 3SXOA 2CNMA 4KUBA 2ATRA 2JDCA 5EC4A 2G3TA 5F48A 4R87A 3RYOA 1QSNA 1LRZA 4NSQA 4HNYB 3R95A 3BJ7A 3T9YA 3S6FA 2OH1A 2D4PA 3CXPA 2OZGA 1I21A 4CAWA 4IF5A 1XIXA 2FIAA 3S6KA 1P4NA 1FY7A 2RC4A 4MY0A 1U6MA 2KCWA 2VXKA 4XPDC 1S7KA 4QBJA 1MJAA 3W6SA 3ZZIA 3I3GA 2B5GA 3JUWA 3KKWA 2WPXA 4PK2A 2R1IA 4HKFA 1L0CA 1XMTA 4J3GA 1YX0A 2ZW7A 1S7LA 4KVXA 4LX9A 4E8OA 2ZW5A 3FIXA 4QB9A 3T90A 1IYKA 2HQYA 1M44A 2Y0MA 5F47A 4XNHC 5IV0A 3BJ8A 2BL1A 4IUSA 3CXSA 1QSOA 1KUXA 4I49A 3C26A 1VHSA 4M3SA 4JJXA 4YGOA 5FVJA 4II9A 3EXNA 5F46A 2R98A 4KVME 2AJ6A 3FBUA 4AG7A 5H84A 3EC4A 3D3SA 5DWNA 1WK4A 1Z4RA 4L8AA 2Q4VA 3TTHA 5DWMA 4R3LA 3N7ZA 2B4DA 2P6FA 1IIDA 4CRYB 1YLEA 4MI4A 4FD5A 3R1KA 4KOXA 4KOWA 2QIRA 3P2FA 4PV6A 2OZHA 4NCZA 4H6ZA 2VQYA 2Z10A 1BOBA 4E0AA 2Q4YA 2B3VA 1B6BA 2F5IA 2D4OA 4AVCA 3NE7A 5J8FA 1IB1E 3TO9A 2B4DB 2O28A 2Z11A 2ZW4A 2ARHA 2Q44A 5KTAA 4KOTA 3TT2A 3R9EA 2I00A 3W91A 4UBRA 1ON0A 4CRZB 4AVAA 4X5KA 1NMTA 5GCNA 2BUEA 2BEIA 4MBUA 2A4NA 2B4BA 1YREA 5ISVA 2REEA 1WWZA 3DR6A 2PR8A 4OADA 3DNSA 4KORA 5CNPA 3TFYA 4R57A 3EO4A 2I79A 4QUSA 2G0BA 3FB3A 1R57A 3SXNA 4ZBGA 3FYNA 4RS2A 4KUAA 3B8GA 1YGHA 1QSMA 2EUIA 4QVTA 4Y49B 1RO5A 4E2AA 3GYAA 4UWJA 2VZYA 2ZW6A 4L89A 2B58A 1MK4A 3JVNA 3LD2A 4XPLA 3MGDA 4B5PA 4YFJA 1Q2YA 2BSWA 1I12A 1MJ9A 1S5KA 4JD6A 4B5OA 1K4JA 1XF8A 2Q04A 3TOBA 3ZJ0A 3EY5A 4DNCA 2B3UA 3P2HA 4K30A 4OLLA 2K5TA 1YR0A 4KVOE 1Y9WA 3D8PA 4KZTA 1Z4EA 2OB0A 2PSWA 4R3KA 1M4DA 2P6GA 1Y9KA 4U5YA 4B5PB 5I0CA 3DR8A 2OU2A 3S6HA 3QB8A 2G3AA 3W6XA 1P0HA 3LODA 5EBVA 1QSTA 1S7FA 1TIQA 1KZFA 3PZJA 4H6UA 1IYLA 2GANA 5J8CA 4KOYA 3I9SA 5KTDA 1RXTA 1Q2DA 2OZUA 2AE6A 1Y7RA 4UWIA 2FIWA 2EVNA 2GE3A
chains in the Genus database with same CATH superfamily
4P45A 4PPZA 3BI0A 4HNWB 4A33A 4A95A 1NE9A 4NGSA 2VZZA 2NSMA 4NGPA 3E0KA 4C2XA 1TKFA 2HUZA 3CXQA 5LRJA 1F2PA 5LYFA 3WC6A 4CAFA 2HV2A 4NEXA 4MCQA 2J8MA 4AVBA 4C68A 4C7HA 2VI7A 3H4QA 3NH5A 2FT0A 5E96A 1TKHA 3H8FA 4CGOA 2ZEGA 1M4GA 1ZLHA 3NE8A 2DXQA 2IL4A 3TCVA 2ZOGA 3IWEA 4UCNA 2XEJA 3GUXA 3D2MA 1Z8XA 3GKRA 1LOKA 2AFSA 2AFZA 4Q36A 4Z65A 1CPXA 2R7HA 2QMLA 2PCUA 4R7MA 5AGEA 2VEZA 1QMUA 4H2KA 2JEVA 3R96A 1YK3A 1AYEA 1I1DA 4LUAA 3RBUA 2HB6A 3BHXA 2YGWA 4HNXB 3UY5A 2GFQA 2WSAA 3BXMA 4OMEA 4UEEA 5JQ4A 4CYNA 2JLMA 2OR4A 4OIDA 3FEEA 2F7VA 2YNDA 4YU9A 4F0YA 4CGMA 5IX3A 4WJBA 4X3RA 2ABZA 2C6GA 1GHEA 3LMSA 4EWTA 1YQEA 3WC7A 5BWAB 3KR5A 3GLJA 4OC5A 4PSWA 1B87A 3WR7A 3K9UA 2J8NA 1MJBA 3VH9A 1JQGA 2FS5A 4A30A 5JPHA 3DSBA 4CGPA 2AFWA 1BAVA 2Z3LA 4Q38A 1AMPA 3IGRA 4UA3A 4UF4A 4F8ZA 1VIXA 4P4EA 2FCKA 4XPDB 4DYOA 3TOAA 3SJGA 3F0AA 6CPAA 1Y0YA 4KLVA 1CJWA 5HMNA 1N71A 3KHZA 4MY3A 5LYDA 3KASA 2PQ8A 2Q51A 1XEBA 2P6EA 3IO1A 5THWA 4CGNA 5IB9A 1YVOA 2GU2A 4CS0B 2IJZA 4C2YA 1Q7LA 4FD6A 3D2PA 4NXYA 1ZO0A 3GIUA 3LACA 4NJRA 5C82A 1QSRA 3V38A 2FXFA 4BINA 3B7IA 1CP6A 2PDOA 4U9YA 1YVKA 3PFEA 4MMOA 3PB8X 1VGYA 3SHPA 4YRHA 4R9MA 4P4DA 3JRUA 1Z9UA 4UCMA 5HH1A 1S60A 4MRIA 3S6GA 4X2TA 1CM0A 1J4JA 2GIVA 2VL1A 4UCPA 4KOSA 2JDDA 4JXRA 3TO7A 2FL4A 2C6CA 2QECA 3G8WA 5K8PA 5G1ZA 3D7HA 1PUAA 1VKCA 4OC2A 4KOVA 5EMIA 1XE4A 1BLLE 3FEDA 1KWMA 4FD4A 1VHOA 4UFXA 2FSRA 4W9YA 2Z3PA 5IB0A 1DTDA 3KR4A 4PK3A 5J1QA 4JWPA 3IU1A 4MXUA 4XNHB 4CAVA 3B3TA 5HVFA 1OZPA 4Y49C 1BO4A 1FNOA 3TX8A 2V8DA 1PU9A 1SQHA 2AFUA 5JH9A 4KOUA 1IOFA 2C27A 3D67A 4PXDA 4GS4A 4ZI6A 3G3SA 5HVHA 3FECA 3EFAA 2ZELA 3VARA 4CPAA 4OKOA 2PJBA 2DF5A 1PYTB 4BMHA 4RI1A 1OBRA 2Q0YA 4DJLA 3JTKA 4MFZA 3RAMA 4OC0A 4NF1A 1RTQA 2I3CA 1NSAA 3R9FA 2WPWA 3DGVA 5C88A 1Q2CA 2B5GB 1M1DA 1S3ZA 2V77A 2ZEHA 3F8KA 4B12A 4ZY1A 3GY9A 4F9VA 4CAXA 2ZEEA 5HVGA 2CNTA 4EFDA 2NYQA 4ZX8A 4FD7A 2Z3OA 1ZG9A 1X10A 5K8MA 4MFPA 3VWDA 2DPTA 1S7NA 4FWUA 4U9ZA 3CPAA 5A27A 1CP7A 4BBHA 4ZYQA 2Z0ZA 4AG9A 2PR1A 4ORFA 2JBJA 3FNCA 2NMTA 1LCPA 4ZY0A 4OAEA 4AB7A 3A9LA 4JLYA 2REFA 3PP9A 2X7BA 3TO6A 1GYTA 4PXEA 3K2KA 1QQ9A 4F6AA 3QAHA 4EVYA 3FRMA 4PXBA 1Z8TA 1ZG7A 2DPSA 1KUVA 4NFRA 2O53A 2Q7BA 3IFEA 3FMCA 4MHDA 4P4FA 1CG2A 2CY2A 4M85A 1IICA 3HLPA 1X12A 4JXQA 4TNUA 5H86A 4CGLA 3H8EA 2CNSA 1R43A 3WT4A 4KLWA 2H5MA 4PSXA 4OC1A 3F5BA 3QNVA 3H8GA 5JGFA 2J8RA 3NH4A 1TF8A 3FXTA 1YW4A 5F49A 2PRBA 3TE4A 2PC1A 4P4JA 4MJ8A 3R9GA 2ZPAA 3PRTA 2P0WA 3GB0A 3CDXA 3OWCA 2FVGA 1HDQA 3IIBA 4P10A 2JEWA 2EK9A 1IGBA 4UFWA 2ODFA 1TKJA 2R8VA 3PGPA 4QC6A 1BPMA 1UFHA 2XEFA 3CT9A 2Q4ZA 3IWGA 3QAYA 2PJ0A 2VBQA 3DDDA 1CX8A 2FE7A 4ONUA 4XPKA 3V8IA 4F9UA 4H89A 1M4IA 1KUYA 2ZXVA 4FAIA 1NSLA 5LYLA 5K8OA 1IY7A 4MCPA 3BLNA 4MFQA 5KTCA 2Z3NA 4NJQA 1YMEA 3S9MA 1V0CA 3SXOA 4C2ZA 3I1UA 2CNMA 3D7FA 4NGQA 4G1PA 4KUBA 3NFZA 5AG5A 2ATRA 2JDCA 4Q7AA 5EC4A 4M6IA 2G3TA 3NA6A 4R87A 5F48A 3RYOA 1QSNA 1XMBA 3SJXA 1LRZA 4NSQA 5F09A 4HNYB 1Z2LA 3R95A 1ARLA 3BJ7A 3T9YA 1ELLP 1Y7EA 3S6FA 2OH1A 2HC9A 4UIAA 2D4PA 1HDUA 3CXPA 3KQXA 2OZGA 1I21A 5ELYA 3SJFA 2ZEOA 3WABA 4CAWA 4IF5A 1XIXA 2FIAA 3S6KA 1P4NA 1FY7A 2RC4A 4JYWA 4MY0A 4UFVA 1F57A 2CIJA 3IJ3A 1ZLIA 1U6MA 2KCWA 2XEGA 2QJ8A 2PVWA 2VXKA 4XPDC 1S7KA 5G21A 4CYOA 1MJAA 4QBJA 3NH8A 3MRUA 3W6SA 5D29A 4A2ZA 2DEAA 1LAMA 3B3VA 3ZZIA 3I3GA 2B5GA 3JUWA 4KSFA 3KKWA 2CTCA 2WPXA 4PK2A 2R1IA 4HKFA 2EK8A 1L0CA 4EMEA 2RFHA 3MN8A 4WWVA 2QYVA 1DE4C 4UEZA 2PJ7A 1XMTA 3B2YA 3PB9X 4AXVA 4RUHA 1ELMP 3SI0A 4CYPA 4J3GA 1YX0A 2PJCA 3FH4A 5LRGA 4M6HA 2ZW7A 2O4HA 4RN7A 4ONWA 1S7LA 5CBMA 4R6TA 4KVXA 4LX9A 2Z3MA 4E8OA 2YNCA 2ZW5A 3L2NA 4JZ0A 3FIXA 4QB9A 3T90A 1IYKA 3S9NA 4OP4A 2HQYA 1M44A 4MFLA 2PJ1A 2WZNA 4ZY2A 2Y0MA 1F2OA 4XNHC 5F47A 4YWYA 5IV0A 5LRKA 2PJ6A 4M6GA 3BJ8A 4X8IA 2BL1A 4IUSA 5JM6A 2PJ5A 1EE3P 1YW6A 5LYIA 3CXSA 4MHNA 3D7DA 2EBJA 2PIZA 2BO9A 8CPAA 3K9TA 4HPSA 1QSOA 3KHXA 4LQ6A 2XEIA 1KUXA 3N5FA 3C26A 4I49A 2F8HA 5D8NA 2G9DA 4A38A 4A32A 2PIYA 2AFOA 1ARMA 3IC1A 4CAEA 1VHSA 4B10A 4M3SA 4JJXA 4YGOA 2ZEPA 3FX6A 1PCAA 5I4MA 4K3NA 5FVJA 4II9A 1Y0RA 3EXNA 2Z3KA 5F46A 2IMOA 2R98A 3PEIA 4IHMA 1XBUA 3KQZA 4KVME 2AJ6A 2OOTA 3FBUA 4AG7A 2WUUA 5H84A 3EC4A 3T8WA 3D3SA 5DWNA 2GLJA 4GM5A 4OIWA 1WK4A 1Z4RA 2JBKA 3ISXA 4L8AA 2Q4VA 3TTHA 5DWMA 1XJOA 4R3LA 2GREA 4UEFA 3N7ZA 2PRQA 4UIBA 2B4DA 2P6FA 1IIDA 2C6PA 2PJ2A 2RB7A 4CRYB 1YLEA 3B35A 2PE3A 4MI4A 4FD5A 2YNCC 3R1KA 4IAVA 4KOXA 3SI2A 4B11A 3SJEA 4KOWA 2QIRA 3P2FA 2QVPA 4O23A 3FJUA 5AG7A 4PV6A 4DUKA 3RO0A 2OZHA 4BD9A 4NCZA 1UWYA 4H6ZA 2VQYA 2Z10A 1BOBA 4E0AA 1IU8A 2Q4YA 2B3VA 1B6BA 1LAPA 4MFKA 4P4BA 2F5IA 2D4OA 4AVCA 3NE7A 4KS9A 5J8FA 1IB1E 3B3CA 3TO9A 4B14A 1IOIA 2CXAA 1VHEA 4FBEA 2B4DB 4B6ZA 4P6YA 5AG6A 3S9LA 2O28A 2Z11A 2ZW4A 2ARHA 3PB6X 2Q44A 4GXHA 4KOTA 4MFJA 4MCRA 5KTAA 2PJAA 1Z5RA 2GLFA 4NGRA 3TT2A 2YNEA 2ZENA 3R9EA 2I00A 3IEHA 3W91A 2CTBA 1LFWA 4UBRA 7CPAA 1ON0A 5G20A 2BOAA 1HEEA 3KI9A 4AVAA 4CRZB 5AG4A 4X5KA 1NMTA 5GCNA 2BUEA 3BI1A 2PJ3A 4A39A 2ANPA 2BEIA 1M4LA 2A4NA 4MBUA 2B4BA 4NGTA 4P44A 1YREA 5ISVA 5CPAA 2REEA 1WWZA 4F0XA 3DR6A 2PR8A 4ZGYB 3KGQA 5DS0A 4OADA 3DNSA 4KORA 5A28A 3KL9A 5K8NA 5CNPA 3TFYA 1TF9A 2V8GA 3D68A 1YLOA 4P4IA 3HUVA 4A94A 3IU2A 4R57A 4C7IA 2PVVA 3EO4A 2I79A 4QUSA 2G0BA 3FB3A 2V8VA 3PB4X 1FT7A 1R57A 4FUUA 3PB7X 3SXNA 4R8FA 2ZEFA 3FYNA 4RS2A 4ZBGA 4KUAA 2J9AA 2EWBA 3B8GA 3PFOA 1XRYA 2EO8A 1H8LA 3WC5A 1YGHA 1QSMA 2EUIA 2Q7SA 1JWQA 4QVTA 1XOVA 4LQGA 4CYQA 4Y49B 1RO5A 4E2AA 1BPNA 3GYAA 4UWJA 3KZWA 2VZYA 1LANA 2ZW6A 3FVLA 3LWUA 4L89A 2Q43A 4NGMA 4OC4A 2B58A 1MK4A 3JVNA 3LD2A 4MHPA 3MGDA 4XPLA 4ZX9A 4B5PA 4YFJA 2V8HA 4KSIA 1Q2YA 1Z8WA 4PXCA 3CPXA 3D66A 2BSWA 1YSJA 1I12A 1MJ9A 4R76A 3V7ZA 3FF3A 5HXDA 2PJ4A 1S5KA 4JD6A 4B5OA 1K4JA 1XF8A 2C1CA 3VWEA 2Q04A 3TOBA 3RZAA 3ZJ0A 3EY5A 3TC8A 2CF4A 2B3UA 3VATA 3P2HA 4DNCA 4K30A 4OLLA 3DLJA 2K5TA 1YR0A 4KVOE 1Y9WA 1AUGA 3D8PA 4KZTA 3H5ZA 4B13A 1A2ZA 1Z4EA 2OB0A 2PSWA 3B3SA 1M4DA 2P6GA 3IWWA 4R3KA 1CPSA 3ISZA 3RNZA 3D4UA 1Y9KA 4MCSA 3CZXA 1CBXA 4U5YA 1R3NA 4B5PB 5I0CA 4PQAA 3DR8A 2OU2A 3PBEA 3QB8A 2G3AA 3S6HA 3W6XA 2ZEMA 2AFXA 4IK2A 1P0HA 1Z8LA 3SI1A 2PJ9A 3LODA 2WYRA 4MHZA 5EBVA 1QSTA 1S7FA 1TIQA 2PJ8A 3PBBA 1KZFA 1TXRA 3PZJA 4H6UA 1IYLA 2IQ6A 2GANA 4A37A 5J8CA 4KOYA 5G22A 3I9SA 4A31A 5KTDA 1RXTA 2ZOFA 1ZG8A 1Q2DA 4TWEA 2OZUA 2AE6A 1Y7RA 4UWIA 4KSAA 2FIWA 2ZEDA 2EVNA 2AFMA 4NGNA 2GE3A 3D7GA 2POKA 4MHYA 2BCOA 4OC3A 3B3WA 1XFOA
chains in the Genus database with same CATH topology
4HNWB 4A33A 4A95A 1NE9A 2VZZA 3E0KA 4C2XA 2HUZA 3CXQA 4CAFA 2HV2A 4NEXA 2J8MA 4AVBA 4C68A 4C7HA 2VI7A 3H4QA 2FT0A 5E96A 4CGOA 1M4GA 2DXQA 2IL4A 3TCVA 3IWEA 4UCNA 3D2MA 3GKRA 4Q36A 2R7HA 2QMLA 5AGEA 2VEZA 2JEVA 3R96A 1YK3A 1I1DA 4LUAA 2YGWA 4HNXB 3UY5A 2WSAA 5JQ4A 2JLMA 2YNDA 4F0YA 4CGMA 5IX3A 1GHEA 5BWAB 4PSWA 3WR7A 1B87A 3K9UA 2J8NA 1MJBA 5JPHA 2FS5A 4A30A 3DSBA 4CGPA 2Z3LA 4Q38A 3IGRA 4UA3A 2FCKA 4XPDB 3TOAA 3F0AA 5HMNA 4KLVA 1CJWA 1N71A 4MY3A 2PQ8A 1XEBA 2P6EA 4CGNA 1YVOA 4CS0B 4C2YA 4FD6A 3D2PA 4NXYA 1ZO0A 5C82A 1QSRA 2FXFA 2PDOA 4U9YA 1YVKA 3SHPA 4YRHA 4R9MA 1Z9UA 4UCMA 5HH1A 1S60A 3S6GA 4CYNA 1CM0A 1J4JA 2GIVA 4CYOA 4UCPA 4KOSA 2JDDA 4JXRA 3TO7A 2FL4A 3G8WA 2QECA 5G1ZA 1PUAA 1VKCA 4KOVA 1XE4A 4FD4A 4UFXA 2FSRA 5IB0A 2Z3PA 4PK3A 4JWPA 3IU1A 4XNHB 4CAVA 1OZPA 4Y49C 1BO4A 1PU9A 1SQHA 4KOUA 2C27A 4GS4A 3G3SA 3EFAA 4BMHA 4RI1A 2Q0YA 3JTKA 4MFZA 4NF1A 3R9FA 2WPWA 5C88A 1Q2CA 2B5GB 1M1DA 1S3ZA 4B12A 3F8KA 3GY9A 4CAXA 2CNTA 4FD7A 2Z3OA 4MFPA 3VWDA 2DPTA 1S7NA 4U9ZA 5A27A 4BBHA 2Z0ZA 4AG9A 2PR1A 4ORFA 3FNCA 2NMTA 4OAEA 4AB7A 3A9LA 4JLYA 2REFA 3PP9A 2X7BA 3TO6A 4F6AA 3QAHA 4EVYA 3FRMA 2DPSA 1KUVA 2Q7BA 4MHDA 2CY2A 4M85A 1IICA 4JXQA 5H86A 4CGLA 2CNSA 4KLWA 2H5MA 4PSXA 3F5BA 2J8RA 3FXTA 5F49A 2PRBA 3TE4A 2PC1A 4MJ8A 3R9GA 2ZPAA 2P0WA 3OWCA 4UFWA 4QC6A 3VWEA 2R8VA 3PGPA 1UFHA 3IWGA 2VBQA 3DDDA 4ONUA 2FE7A 4XPKA 3V8IA 4H89A 1M4IA 1KUYA 2ZXVA 1NSLA 3BLNA 4MFQA 5KTCA 2Z3NA 1V0CA 3SXOA 4C2ZA 2CNMA 4KUBA 5AG5A 2ATRA 2JDCA 5EC4A 2G3TA 5F48A 4R87A 3RYOA 1QSNA 1LRZA 4NSQA 4HNYB 3R95A 3BJ7A 3T9YA 3S6FA 2OH1A 2D4PA 3CXPA 2OZGA 1I21A 4CAWA 4IF5A 1XIXA 2FIAA 3S6KA 1P4NA 1FY7A 2RC4A 4MY0A 4UFVA 1U6MA 2KCWA 5G21A 2VXKA 4XPDC 1S7KA 4QBJA 1MJAA 3W6SA 4A2ZA 3ZZIA 3I3GA 2B5GA 3JUWA 4KSFA 3KKWA 2WPXA 4PK2A 2R1IA 4HKFA 1L0CA 1XMTA 4CYPA 4J3GA 1YX0A 2ZW7A 1S7LA 4KVXA 4LX9A 2Z3MA 4E8OA 2YNCA 2ZW5A 3FIXA 4QB9A 3T90A 1IYKA 2HQYA 1M44A 4MFLA 2Y0MA 5F47A 4XNHC 5IV0A 3BJ8A 2BL1A 4IUSA 3CXSA 1QSOA 1KUXA 4I49A 3C26A 4A32A 4CAEA 1VHSA 4B10A 4M3SA 4JJXA 4YGOA 5FVJA 4II9A 3EXNA 2Z3KA 5F46A 2R98A 4KVME 2AJ6A 3FBUA 4AG7A 2WUUA 5H84A 3EC4A 3D3SA 5DWNA 1WK4A 1Z4RA 4L8AA 2Q4VA 3TTHA 5DWMA 4R3LA 3N7ZA 2B4DA 2P6FA 1IIDA 4CRYB 1YLEA 4MI4A 4FD5A 2YNCC 3R1KA 4KOXA 4B11A 4KOWA 2QIRA 3P2FA 5AG7A 4PV6A 2OZHA 4NCZA 4H6ZA 2VQYA 2Z10A 1BOBA 4E0AA 2Q4YA 2B3VA 1B6BA 4MFKA 2F5IA 2D4OA 4AVCA 3NE7A 4KS9A 5J8FA 1IB1E 3TO9A 4B14A 2CXAA 2B4DB 5AG6A 2O28A 2Z11A 2ZW4A 2ARHA 2Q44A 4MFJA 4KOTA 5KTAA 3TT2A 2YNEA 3R9EA 2I00A 3W91A 4UBRA 1ON0A 5G20A 4CRZB 4AVAA 5AG4A 4X5KA 1NMTA 5GCNA 2BUEA 2BEIA 4MBUA 2A4NA 2B4BA 1YREA 5ISVA 2REEA 1WWZA 4F0XA 3DR6A 2PR8A 4ZGYB 4OADA 3DNSA 4KORA 5A28A 5CNPA 3TFYA 3IU2A 4R57A 4C7IA 3EO4A 2I79A 4QUSA 2G0BA 3FB3A 1R57A 3SXNA 4ZBGA 3FYNA 4RS2A 4KUAA 3B8GA 1YGHA 1QSMA 2EUIA 4QVTA 4CYQA 4Y49B 1RO5A 4E2AA 3GYAA 4UWJA 2VZYA 2ZW6A 4L89A 2B58A 1MK4A 3JVNA 3LD2A 4XPLA 3MGDA 4B5PA 4YFJA 1Q2YA 2BSWA 1I12A 1MJ9A 1S5KA 4JD6A 4B5OA 1K4JA 1XF8A 2Q04A 3TOBA 3ZJ0A 3EY5A 4DNCA 2B3UA 3P2HA 4K30A 4OLLA 2K5TA 1YR0A 4KVOE 1Y9WA 3D8PA 4KZTA 3H5ZA 4B13A 1Z4EA 2OB0A 2PSWA 4R3KA 1M4DA 2P6GA 1Y9KA 4U5YA 4B5PB 5I0CA 3DR8A 2OU2A 3S6HA 3QB8A 2G3AA 3W6XA 1P0HA 3LODA 5EBVA 1QSTA 1S7FA 1TIQA 1KZFA 3PZJA 4H6UA 1IYLA 2GANA 5J8CA 4KOYA 5G22A 3I9SA 4A31A 5KTDA 1RXTA 1Q2DA 2OZUA 2AE6A 1Y7RA 4UWIA 4KSAA 2FIWA 2EVNA 2GE3A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4HNW B;  1NE9 A;  2VZZ A;  3E0K A;  2HUZ A;  3CXQ A;  2HV2 A;  4NEX A;  2J8M A;  4AVB A;  2VI7 A;  3H4Q A;  2FT0 A;  5E96 A;  1M4G A;  2DXQ A;  2IL4 A;  3TCV A;  3D2M A;  3GKR A;  2R7H A;  2QML A;  2VEZ A;  2JEV A;  3R96 A;  1YK3 A;  1I1D A;  4LUA A;  4HNX B;  3UY5 A;  5JQ4 A;  2JLM A;  4F0Y A;  5IX3 A;  1GHE A;  4PSW A;  3WR7 A;  1B87 A;  3K9U A;  2J8N A;  1MJB A;  5JPH A;  2FS5 A;  3DSB A;  4UA3 A;  3IGR A;  2FCK A;  4XPD B;  3TOA A;  3F0A A;  5HMN A;  4KLV A;  1CJW A;  1N71 A;  4MY3 A;  2PQ8 A;  1XEB A;  2P6E A;  1YVO A;  4CS0 B;  4FD6 A;  3D2P A;  4NXY A;  5C82 A;  1QSR A;  2FXF A;  2PDO A;  4U9Y A;  1YVK A;  3SHP A;  4YRH A;  4R9M A;  1Z9U A;  5HH1 A;  1S60 A;  3S6G A;  1CM0 A;  1J4J A;  2GIV A;  3TO7 A;  4KOS A;  2JDD A;  4JXR A;  2FL4 A;  3G8W A;  2QEC A;  1PUA A;  1VKC A;  4KOV A;  1XE4 A;  4FD4 A;  2FSR A;  5IB0 A;  4PK3 A;  4JWP A;  4XNH B;  4CAV A;  1OZP A;  4Y49 C;  1BO4 A;  1PU9 A;  1SQH A;  4KOU A;  2C27 A;  4GS4 A;  3G3S A;  3EFA A;  4BMH A;  4RI1 A;  2Q0Y A;  4NF1 A;  3R9F A;  2WPW A;  5C88 A;  1Q2C A;  2B5G B;  1M1D A;  1S3Z A;  3F8K A;  3GY9 A;  4CAX A;  2CNT A;  4FD7 A;  3VWD A;  1S7N A;  4U9Z A;  2Z0Z A;  4AG9 A;  2PR1 A;  4ORF A;  3FNC A;  2NMT A;  4OAE A;  4AB7 A;  4JLY A;  2REF A;  3PP9 A;  2X7B A;  3TO6 A;  4F6A A;  3QAH A;  4EVY A;  3FRM A;  1KUV A;  2Q7B A;  4MHD A;  2CY2 A;  4M85 A;  1IIC A;  4JXQ A;  5H86 A;  2CNS A;  4KLW A;  2H5M A;  4PSX A;  3F5B A;  2J8R A;  3FXT A;  5F49 A;  2PRB A;  3TE4 A;  2PC1 A;  4MJ8 A;  3R9G A;  2ZPA A;  2P0W A;  3OWC A;  4QC6 A;  3VWE A;  2R8V A;  3PGP A;  1UFH A;  3IWG A;  2VBQ A;  3DDD A;  4ONU A;  2FE7 A;  4XPK A;  3V8I A;  4H89 A;  1M4I A;  1KUY A;  2ZXV A;  1NSL A;  3BLN A;  5KTC A;  1V0C A;  3SXO A;  2CNM A;  4KUB A;  2ATR A;  2JDC A;  5EC4 A;  2G3T A;  5F48 A;  4R87 A;  3RYO A;  1QSN A;  1LRZ A;  4NSQ A;  4HNY B;  3R95 A;  3BJ7 A;  3T9Y A;  3S6F A;  2OH1 A;  2D4P A;  3CXP A;  2OZG A;  1I21 A;  4CAW A;  4IF5 A;  1XIX A;  2FIA A;  3S6K A;  1P4N A;  1FY7 A;  2RC4 A;  4MY0 A;  1U6M A;  2KCW A;  2VXK A;  4XPD C;  1S7K A;  4QBJ A;  1MJA A;  3W6S A;  3ZZI A;  3I3G A;  2B5G A;  3JUW A;  3KKW A;  2WPX A;  4PK2 A;  2R1I A;  4HKF A;  1L0C A;  1XMT A;  4J3G A;  1YX0 A;  2ZW7 A;  1S7L A;  4KVX A;  4LX9 A;  4E8O A;  2ZW5 A;  3FIX A;  4QB9 A;  3T90 A;  1IYK A;  2HQY A;  1M44 A;  2Y0M A;  5F47 A;  4XNH C;  5IV0 A;  3BJ8 A;  2BL1 A;  4IUS A;  3CXS A;  1QSO A;  1KUX A;  4I49 A;  3C26 A;  1VHS A;  4M3S A;  4JJX A;  4YGO A;  5FVJ A;  4II9 A;  3EXN A;  5F46 A;  2R98 A;  4KVM E;  2AJ6 A;  3FBU A;  4AG7 A;  5H84 A;  3EC4 A;  3D3S A;  5DWN A;  1WK4 A;  1Z4R A;  4L8A A;  2Q4V A;  3TTH A;  5DWM A;  4R3L A;  3N7Z A;  2B4D A;  2P6F A;  1IID A;  4CRY B;  1YLE A;  4MI4 A;  4FD5 A;  3R1K A;  4KOX A;  4KOW A;  2QIR A;  3P2F A;  4PV6 A;  2OZH A;  4NCZ A;  4H6Z A;  2VQY A;  2Z10 A;  1BOB A;  4E0A A;  2Q4Y A;  2B3V A;  1B6B A;  2F5I A;  2D4O A;  4AVC A;  3NE7 A;  5J8F A;  1IB1 E;  3TO9 A;  2B4D B;  2O28 A;  2Z11 A;  2ZW4 A;  2ARH A;  2Q44 A;  5KTA A;  4KOT A;  3TT2 A;  3R9E A;  2I00 A;  3W91 A;  4UBR A;  1ON0 A;  4CRZ B;  4AVA A;  4X5K A;  1NMT A;  5GCN A;  2BUE A;  2BEI A;  4MBU A;  2A4N A;  2B4B A;  1YRE A;  5ISV A;  2REE A;  1WWZ A;  3DR6 A;  2PR8 A;  4OAD A;  3DNS A;  4KOR A;  5CNP A;  3TFY A;  4R57 A;  3EO4 A;  2I79 A;  4QUS A;  2G0B A;  3FB3 A;  1R57 A;  3SXN A;  4ZBG A;  3FYN A;  4RS2 A;  4KUA A;  3B8G A;  1YGH A;  1QSM A;  2EUI A;  4QVT A;  4Y49 B;  1RO5 A;  4E2A A;  3GYA A;  4UWJ A;  2VZY A;  2ZW6 A;  4L89 A;  2B58 A;  1MK4 A;  3JVN A;  3LD2 A;  4XPL A;  3MGD A;  4B5P A;  4YFJ A;  1Q2Y A;  2BSW A;  1I12 A;  1MJ9 A;  1S5K A;  4JD6 A;  4B5O A;  1K4J A;  1XF8 A;  2Q04 A;  3TOB A;  3ZJ0 A;  3EY5 A;  4DNC A;  2B3U A;  3P2H A;  4K30 A;  4OLL A;  2K5T A;  1YR0 A;  4KVO E;  1Y9W A;  3D8P A;  4KZT A;  1Z4E A;  2OB0 A;  2PSW A;  4R3K A;  1M4D A;  2P6G A;  1Y9K A;  4U5Y A;  4B5P B;  5I0C A;  3DR8 A;  2OU2 A;  3S6H A;  3QB8 A;  2G3A A;  3W6X A;  1P0H A;  3LOD A;  5EBV A;  1QST A;  1S7F A;  1TIQ A;  1KZF A;  3PZJ A;  4H6U A;  1IYL A;  2GAN A;  5J8C A;  4KOY A;  3I9S A;  5KTD A;  1RXT A;  1Q2D A;  2OZU A;  2AE6 A;  1Y7R A;  4UWI A;  2FIW A;  2EVN A;  2GE3 A; 
#chains in the Genus database with same CATH topology
 4P45 A;  4PPZ A;  3BI0 A;  4HNW B;  4A33 A;  4A95 A;  1NE9 A;  4NGS A;  2VZZ A;  2NSM A;  4NGP A;  3E0K A;  4C2X A;  1TKF A;  2HUZ A;  3CXQ A;  5LRJ A;  1F2P A;  5LYF A;  3WC6 A;  4CAF A;  2HV2 A;  4NEX A;  4MCQ A;  2J8M A;  4AVB A;  4C68 A;  4C7H A;  2VI7 A;  3H4Q A;  3NH5 A;  2FT0 A;  5E96 A;  1TKH A;  3H8F A;  4CGO A;  2ZEG A;  1M4G A;  1ZLH A;  3NE8 A;  2DXQ A;  2IL4 A;  3TCV A;  2ZOG A;  3IWE A;  4UCN A;  2XEJ A;  3GUX A;  3D2M A;  1Z8X A;  3GKR A;  1LOK A;  2AFS A;  2AFZ A;  4Q36 A;  4Z65 A;  1CPX A;  2R7H A;  2QML A;  2PCU A;  4R7M A;  5AGE A;  2VEZ A;  1QMU A;  4H2K A;  2JEV A;  3R96 A;  1YK3 A;  1AYE A;  1I1D A;  4LUA A;  3RBU A;  2HB6 A;  3BHX A;  2YGW A;  4HNX B;  3UY5 A;  2GFQ A;  2WSA A;  3BXM A;  4OME A;  4UEE A;  5JQ4 A;  4CYN A;  2JLM A;  2OR4 A;  4OID A;  3FEE A;  2F7V A;  2YND A;  4YU9 A;  4F0Y A;  4CGM A;  5IX3 A;  4WJB A;  4X3R A;  2ABZ A;  2C6G A;  1GHE A;  3LMS A;  4EWT A;  1YQE A;  3WC7 A;  5BWA B;  3KR5 A;  3GLJ A;  4OC5 A;  4PSW A;  1B87 A;  3WR7 A;  3K9U A;  2J8N A;  1MJB A;  3VH9 A;  1JQG A;  2FS5 A;  4A30 A;  5JPH A;  3DSB A;  4CGP A;  2AFW A;  1BAV A;  2Z3L A;  4Q38 A;  1AMP A;  3IGR A;  4UA3 A;  4UF4 A;  4F8Z A;  1VIX A;  4P4E A;  2FCK A;  4XPD B;  4DYO A;  3TOA A;  3SJG A;  3F0A A;  6CPA A;  1Y0Y A;  4KLV A;  1CJW A;  5HMN A;  1N71 A;  3KHZ A;  4MY3 A;  5LYD A;  3KAS A;  2PQ8 A;  2Q51 A;  1XEB A;  2P6E A;  3IO1 A;  5THW A;  4CGN A;  5IB9 A;  1YVO A;  2GU2 A;  4CS0 B;  2IJZ A;  4C2Y A;  1Q7L A;  4FD6 A;  3D2P A;  4NXY A;  1ZO0 A;  3GIU A;  3LAC A;  4NJR A;  5C82 A;  1QSR A;  3V38 A;  2FXF A;  4BIN A;  3B7I A;  1CP6 A;  2PDO A;  4U9Y A;  1YVK A;  3PFE A;  4MMO A;  3PB8 X;  1VGY A;  3SHP A;  4YRH A;  4R9M A;  4P4D A;  3JRU A;  1Z9U A;  4UCM A;  5HH1 A;  1S60 A;  4MRI A;  3S6G A;  4X2T A;  1CM0 A;  1J4J A;  2GIV A;  2VL1 A;  4UCP A;  4KOS A;  2JDD A;  4JXR A;  3TO7 A;  2FL4 A;  2C6C A;  2QEC A;  3G8W A;  5K8P A;  5G1Z A;  3D7H A;  1PUA A;  1VKC A;  4OC2 A;  4KOV A;  5EMI A;  1XE4 A;  1BLL E;  3FED A;  1KWM A;  4FD4 A;  1VHO A;  4UFX A;  2FSR A;  4W9Y A;  2Z3P A;  5IB0 A;  1DTD A;  3KR4 A;  4PK3 A;  5J1Q A;  4JWP A;  3IU1 A;  4MXU A;  4XNH B;  4CAV A;  3B3T A;  5HVF A;  1OZP A;  4Y49 C;  1BO4 A;  1FNO A;  3TX8 A;  2V8D A;  1PU9 A;  1SQH A;  2AFU A;  5JH9 A;  4KOU A;  1IOF A;  2C27 A;  3D67 A;  4PXD A;  4GS4 A;  4ZI6 A;  3G3S A;  5HVH A;  3FEC A;  3EFA A;  2ZEL A;  3VAR A;  4CPA A;  4OKO A;  2PJB A;  2DF5 A;  1PYT B;  4BMH A;  4RI1 A;  1OBR A;  2Q0Y A;  4DJL A;  3JTK A;  4MFZ A;  3RAM A;  4OC0 A;  4NF1 A;  1RTQ A;  2I3C A;  1NSA A;  3R9F A;  2WPW A;  3DGV A;  5C88 A;  1Q2C A;  2B5G B;  1M1D A;  1S3Z A;  2V77 A;  2ZEH A;  3F8K A;  4B12 A;  4ZY1 A;  3GY9 A;  4F9V A;  4CAX A;  2ZEE A;  5HVG A;  2CNT A;  4EFD A;  2NYQ A;  4ZX8 A;  4FD7 A;  2Z3O A;  1ZG9 A;  1X10 A;  5K8M A;  4MFP A;  3VWD A;  2DPT A;  1S7N A;  4FWU A;  4U9Z A;  3CPA A;  5A27 A;  1CP7 A;  4BBH A;  4ZYQ A;  2Z0Z A;  4AG9 A;  2PR1 A;  4ORF A;  2JBJ A;  3FNC A;  2NMT A;  1LCP A;  4ZY0 A;  4OAE A;  4AB7 A;  3A9L A;  4JLY A;  2REF A;  3PP9 A;  2X7B A;  3TO6 A;  1GYT A;  4PXE A;  3K2K A;  1QQ9 A;  4F6A A;  3QAH A;  4EVY A;  3FRM A;  4PXB A;  1Z8T A;  1ZG7 A;  2DPS A;  1KUV A;  4NFR A;  2O53 A;  2Q7B A;  3IFE A;  3FMC A;  4MHD A;  4P4F A;  1CG2 A;  2CY2 A;  4M85 A;  1IIC A;  3HLP A;  1X12 A;  4JXQ A;  4TNU A;  5H86 A;  4CGL A;  3H8E A;  2CNS A;  1R43 A;  3WT4 A;  4KLW A;  2H5M A;  4PSX A;  4OC1 A;  3F5B A;  3QNV A;  3H8G A;  5JGF A;  2J8R A;  3NH4 A;  1TF8 A;  3FXT A;  1YW4 A;  5F49 A;  2PRB A;  3TE4 A;  2PC1 A;  4P4J A;  4MJ8 A;  3R9G A;  2ZPA A;  3PRT A;  2P0W A;  3GB0 A;  3CDX A;  3OWC A;  2FVG A;  1HDQ A;  3IIB A;  4P10 A;  2JEW A;  2EK9 A;  1IGB A;  4UFW A;  2ODF A;  1TKJ A;  2R8V A;  3PGP A;  4QC6 A;  1BPM A;  1UFH A;  2XEF A;  3CT9 A;  2Q4Z A;  3IWG A;  3QAY A;  2PJ0 A;  2VBQ A;  3DDD A;  1CX8 A;  2FE7 A;  4ONU A;  4XPK A;  3V8I A;  4F9U A;  4H89 A;  1M4I A;  1KUY A;  2ZXV A;  4FAI A;  1NSL A;  5LYL A;  5K8O A;  1IY7 A;  4MCP A;  3BLN A;  4MFQ A;  5KTC A;  2Z3N A;  4NJQ A;  1YME A;  3S9M A;  1V0C A;  3SXO A;  4C2Z A;  3I1U A;  2CNM A;  3D7F A;  4NGQ A;  4G1P A;  4KUB A;  3NFZ A;  5AG5 A;  2ATR A;  2JDC A;  4Q7A A;  5EC4 A;  4M6I A;  2G3T A;  3NA6 A;  4R87 A;  5F48 A;  3RYO A;  1QSN A;  1XMB A;  3SJX A;  1LRZ A;  4NSQ A;  5F09 A;  4HNY B;  1Z2L A;  3R95 A;  1ARL A;  3BJ7 A;  3T9Y A;  1ELL P;  1Y7E A;  3S6F A;  2OH1 A;  2HC9 A;  4UIA A;  2D4P A;  1HDU A;  3CXP A;  3KQX A;  2OZG A;  1I21 A;  5ELY A;  3SJF A;  2ZEO A;  3WAB A;  4CAW A;  4IF5 A;  1XIX A;  2FIA A;  3S6K A;  1P4N A;  1FY7 A;  2RC4 A;  4JYW A;  4MY0 A;  4UFV A;  1F57 A;  2CIJ A;  3IJ3 A;  1ZLI A;  1U6M A;  2KCW A;  2XEG A;  2QJ8 A;  2PVW A;  2VXK A;  4XPD C;  1S7K A;  5G21 A;  4CYO A;  1MJA A;  4QBJ A;  3NH8 A;  3MRU A;  3W6S A;  5D29 A;  4A2Z A;  2DEA A;  1LAM A;  3B3V A;  3ZZI A;  3I3G A;  2B5G A;  3JUW A;  4KSF A;  3KKW A;  2CTC A;  2WPX A;  4PK2 A;  2R1I A;  4HKF A;  2EK8 A;  1L0C A;  4EME A;  2RFH A;  3MN8 A;  4WWV A;  2QYV A;  1DE4 C;  4UEZ A;  2PJ7 A;  1XMT A;  3B2Y A;  3PB9 X;  4AXV A;  4RUH A;  1ELM P;  3SI0 A;  4CYP A;  4J3G A;  1YX0 A;  2PJC A;  3FH4 A;  5LRG A;  4M6H A;  2ZW7 A;  2O4H A;  4RN7 A;  4ONW A;  1S7L A;  5CBM A;  4R6T A;  4KVX A;  4LX9 A;  2Z3M A;  4E8O A;  2YNC A;  2ZW5 A;  3L2N A;  4JZ0 A;  3FIX A;  4QB9 A;  3T90 A;  1IYK A;  3S9N A;  4OP4 A;  2HQY A;  1M44 A;  4MFL A;  2PJ1 A;  2WZN A;  4ZY2 A;  2Y0M A;  1F2O A;  4XNH C;  5F47 A;  4YWY A;  5IV0 A;  5LRK A;  2PJ6 A;  4M6G A;  3BJ8 A;  4X8I A;  2BL1 A;  4IUS A;  5JM6 A;  2PJ5 A;  1EE3 P;  1YW6 A;  5LYI A;  3CXS A;  4MHN A;  3D7D A;  2EBJ A;  2PIZ A;  2BO9 A;  8CPA A;  3K9T A;  4HPS A;  1QSO A;  3KHX A;  4LQ6 A;  2XEI A;  1KUX A;  3N5F A;  3C26 A;  4I49 A;  2F8H A;  5D8N A;  2G9D A;  4A38 A;  4A32 A;  2PIY A;  2AFO A;  1ARM A;  3IC1 A;  4CAE A;  1VHS A;  4B10 A;  4M3S A;  4JJX A;  4YGO A;  2ZEP A;  3FX6 A;  1PCA A;  5I4M A;  4K3N A;  5FVJ A;  4II9 A;  1Y0R A;  3EXN A;  2Z3K A;  5F46 A;  2IMO A;  2R98 A;  3PEI A;  4IHM A;  1XBU A;  3KQZ A;  4KVM E;  2AJ6 A;  2OOT A;  3FBU A;  4AG7 A;  2WUU A;  5H84 A;  3EC4 A;  3T8W A;  3D3S A;  5DWN A;  2GLJ A;  4GM5 A;  4OIW A;  1WK4 A;  1Z4R A;  2JBK A;  3ISX A;  4L8A A;  2Q4V A;  3TTH A;  5DWM A;  1XJO A;  4R3L A;  2GRE A;  4UEF A;  3N7Z A;  2PRQ A;  4UIB A;  2B4D A;  2P6F A;  1IID A;  2C6P A;  2PJ2 A;  2RB7 A;  4CRY B;  1YLE A;  3B35 A;  2PE3 A;  4MI4 A;  4FD5 A;  2YNC C;  3R1K A;  4IAV A;  4KOX A;  3SI2 A;  4B11 A;  3SJE A;  4KOW A;  2QIR A;  3P2F A;  2QVP A;  4O23 A;  3FJU A;  5AG7 A;  4PV6 A;  4DUK A;  3RO0 A;  2OZH A;  4BD9 A;  4NCZ A;  1UWY A;  4H6Z A;  2VQY A;  2Z10 A;  1BOB A;  4E0A A;  1IU8 A;  2Q4Y A;  2B3V A;  1B6B A;  1LAP A;  4MFK A;  4P4B A;  2F5I A;  2D4O A;  4AVC A;  3NE7 A;  4KS9 A;  5J8F A;  1IB1 E;  3B3C A;  3TO9 A;  4B14 A;  1IOI A;  2CXA A;  1VHE A;  4FBE A;  2B4D B;  4B6Z A;  4P6Y A;  5AG6 A;  3S9L A;  2O28 A;  2Z11 A;  2ZW4 A;  2ARH A;  3PB6 X;  2Q44 A;  4GXH A;  4KOT A;  4MFJ A;  4MCR A;  5KTA A;  2PJA A;  1Z5R A;  2GLF A;  4NGR A;  3TT2 A;  2YNE A;  2ZEN A;  3R9E A;  2I00 A;  3IEH A;  3W91 A;  2CTB A;  1LFW A;  4UBR A;  7CPA A;  1ON0 A;  5G20 A;  2BOA A;  1HEE A;  3KI9 A;  4AVA A;  4CRZ B;  5AG4 A;  4X5K A;  1NMT A;  5GCN A;  2BUE A;  3BI1 A;  2PJ3 A;  4A39 A;  2ANP A;  2BEI A;  1M4L A;  2A4N A;  4MBU A;  2B4B A;  4NGT A;  4P44 A;  1YRE A;  5ISV A;  5CPA A;  2REE A;  1WWZ A;  4F0X A;  3DR6 A;  2PR8 A;  4ZGY B;  3KGQ A;  5DS0 A;  4OAD A;  3DNS A;  4KOR A;  5A28 A;  3KL9 A;  5K8N A;  5CNP A;  3TFY A;  1TF9 A;  2V8G A;  3D68 A;  1YLO A;  4P4I A;  3HUV A;  4A94 A;  3IU2 A;  4R57 A;  4C7I A;  2PVV A;  3EO4 A;  2I79 A;  4QUS A;  2G0B A;  3FB3 A;  2V8V A;  3PB4 X;  1FT7 A;  1R57 A;  4FUU A;  3PB7 X;  3SXN A;  4R8F A;  2ZEF A;  3FYN A;  4RS2 A;  4ZBG A;  4KUA A;  2J9A A;  2EWB A;  3B8G A;  3PFO A;  1XRY A;  2EO8 A;  1H8L A;  3WC5 A;  1YGH A;  1QSM A;  2EUI A;  2Q7S A;  1JWQ A;  4QVT A;  1XOV A;  4LQG A;  4CYQ A;  4Y49 B;  1RO5 A;  4E2A A;  1BPN A;  3GYA A;  4UWJ A;  3KZW A;  2VZY A;  1LAN A;  2ZW6 A;  3FVL A;  3LWU A;  4L89 A;  2Q43 A;  4NGM A;  4OC4 A;  2B58 A;  1MK4 A;  3JVN A;  3LD2 A;  4MHP A;  3MGD A;  4XPL A;  4ZX9 A;  4B5P A;  4YFJ A;  2V8H A;  4KSI A;  1Q2Y A;  1Z8W A;  4PXC A;  3CPX A;  3D66 A;  2BSW A;  1YSJ A;  1I12 A;  1MJ9 A;  4R76 A;  3V7Z A;  3FF3 A;  5HXD A;  2PJ4 A;  1S5K A;  4JD6 A;  4B5O A;  1K4J A;  1XF8 A;  2C1C A;  3VWE A;  2Q04 A;  3TOB A;  3RZA A;  3ZJ0 A;  3EY5 A;  3TC8 A;  2CF4 A;  2B3U A;  3VAT A;  3P2H A;  4DNC A;  4K30 A;  4OLL A;  3DLJ A;  2K5T A;  1YR0 A;  4KVO E;  1Y9W A;  1AUG A;  3D8P A;  4KZT A;  3H5Z A;  4B13 A;  1A2Z A;  1Z4E A;  2OB0 A;  2PSW A;  3B3S A;  1M4D A;  2P6G A;  3IWW A;  4R3K A;  1CPS A;  3ISZ A;  3RNZ A;  3D4U A;  1Y9K A;  4MCS A;  3CZX A;  1CBX A;  4U5Y A;  1R3N A;  4B5P B;  5I0C A;  4PQA A;  3DR8 A;  2OU2 A;  3PBE A;  3QB8 A;  2G3A A;  3S6H A;  3W6X A;  2ZEM A;  2AFX A;  4IK2 A;  1P0H A;  1Z8L A;  3SI1 A;  2PJ9 A;  3LOD A;  2WYR A;  4MHZ A;  5EBV A;  1QST A;  1S7F A;  1TIQ A;  2PJ8 A;  3PBB A;  1KZF A;  1TXR A;  3PZJ A;  4H6U A;  1IYL A;  2IQ6 A;  2GAN A;  4A37 A;  5J8C A;  4KOY A;  5G22 A;  3I9S A;  4A31 A;  5KTD A;  1RXT A;  2ZOF A;  1ZG8 A;  1Q2D A;  4TWE A;  2OZU A;  2AE6 A;  1Y7R A;  4UWI A;  4KSA A;  2FIW A;  2ZED A;  2EVN A;  2AFM A;  4NGN A;  2GE3 A;  3D7G A;  2POK A;  4MHY A;  2BCO A;  4OC3 A;  3B3W A;  1XFO A; 
#chains in the Genus database with same CATH homology
 4HNW B;  4A33 A;  4A95 A;  1NE9 A;  2VZZ A;  3E0K A;  4C2X A;  2HUZ A;  3CXQ A;  4CAF A;  2HV2 A;  4NEX A;  2J8M A;  4AVB A;  4C68 A;  4C7H A;  2VI7 A;  3H4Q A;  2FT0 A;  5E96 A;  4CGO A;  1M4G A;  2DXQ A;  2IL4 A;  3TCV A;  3IWE A;  4UCN A;  3D2M A;  3GKR A;  4Q36 A;  2R7H A;  2QML A;  5AGE A;  2VEZ A;  2JEV A;  3R96 A;  1YK3 A;  1I1D A;  4LUA A;  2YGW A;  4HNX B;  3UY5 A;  2WSA A;  5JQ4 A;  2JLM A;  2YND A;  4F0Y A;  4CGM A;  5IX3 A;  1GHE A;  5BWA B;  4PSW A;  3WR7 A;  1B87 A;  3K9U A;  2J8N A;  1MJB A;  5JPH A;  2FS5 A;  4A30 A;  3DSB A;  4CGP A;  2Z3L A;  4Q38 A;  3IGR A;  4UA3 A;  2FCK A;  4XPD B;  3TOA A;  3F0A A;  5HMN A;  4KLV A;  1CJW A;  1N71 A;  4MY3 A;  2PQ8 A;  1XEB A;  2P6E A;  4CGN A;  1YVO A;  4CS0 B;  4C2Y A;  4FD6 A;  3D2P A;  4NXY A;  1ZO0 A;  5C82 A;  1QSR A;  2FXF A;  2PDO A;  4U9Y A;  1YVK A;  3SHP A;  4YRH A;  4R9M A;  1Z9U A;  4UCM A;  5HH1 A;  1S60 A;  3S6G A;  4CYN A;  1CM0 A;  1J4J A;  2GIV A;  4CYO A;  4UCP A;  4KOS A;  2JDD A;  4JXR A;  3TO7 A;  2FL4 A;  3G8W A;  2QEC A;  5G1Z A;  1PUA A;  1VKC A;  4KOV A;  1XE4 A;  4FD4 A;  4UFX A;  2FSR A;  5IB0 A;  2Z3P A;  4PK3 A;  4JWP A;  3IU1 A;  4XNH B;  4CAV A;  1OZP A;  4Y49 C;  1BO4 A;  1PU9 A;  1SQH A;  4KOU A;  2C27 A;  4GS4 A;  3G3S A;  3EFA A;  4BMH A;  4RI1 A;  2Q0Y A;  3JTK A;  4MFZ A;  4NF1 A;  3R9F A;  2WPW A;  5C88 A;  1Q2C A;  2B5G B;  1M1D A;  1S3Z A;  4B12 A;  3F8K A;  3GY9 A;  4CAX A;  2CNT A;  4FD7 A;  2Z3O A;  4MFP A;  3VWD A;  2DPT A;  1S7N A;  4U9Z A;  5A27 A;  4BBH A;  2Z0Z A;  4AG9 A;  2PR1 A;  4ORF A;  3FNC A;  2NMT A;  4OAE A;  4AB7 A;  3A9L A;  4JLY A;  2REF A;  3PP9 A;  2X7B A;  3TO6 A;  4F6A A;  3QAH A;  4EVY A;  3FRM A;  2DPS A;  1KUV A;  2Q7B A;  4MHD A;  2CY2 A;  4M85 A;  1IIC A;  4JXQ A;  5H86 A;  4CGL A;  2CNS A;  4KLW A;  2H5M A;  4PSX A;  3F5B A;  2J8R A;  3FXT A;  5F49 A;  2PRB A;  3TE4 A;  2PC1 A;  4MJ8 A;  3R9G A;  2ZPA A;  2P0W A;  3OWC A;  4UFW A;  4QC6 A;  3VWE A;  2R8V A;  3PGP A;  1UFH A;  3IWG A;  2VBQ A;  3DDD A;  4ONU A;  2FE7 A;  4XPK A;  3V8I A;  4H89 A;  1M4I A;  1KUY A;  2ZXV A;  1NSL A;  3BLN A;  4MFQ A;  5KTC A;  2Z3N A;  1V0C A;  3SXO A;  4C2Z A;  2CNM A;  4KUB A;  5AG5 A;  2ATR A;  2JDC A;  5EC4 A;  2G3T A;  5F48 A;  4R87 A;  3RYO A;  1QSN A;  1LRZ A;  4NSQ A;  4HNY B;  3R95 A;  3BJ7 A;  3T9Y A;  3S6F A;  2OH1 A;  2D4P A;  3CXP A;  2OZG A;  1I21 A;  4CAW A;  4IF5 A;  1XIX A;  2FIA A;  3S6K A;  1P4N A;  1FY7 A;  2RC4 A;  4MY0 A;  4UFV A;  1U6M A;  2KCW A;  5G21 A;  2VXK A;  4XPD C;  1S7K A;  4QBJ A;  1MJA A;  3W6S A;  4A2Z A;  3ZZI A;  3I3G A;  2B5G A;  3JUW A;  4KSF A;  3KKW A;  2WPX A;  4PK2 A;  2R1I A;  4HKF A;  1L0C A;  1XMT A;  4CYP A;  4J3G A;  1YX0 A;  2ZW7 A;  1S7L A;  4KVX A;  4LX9 A;  2Z3M A;  4E8O A;  2YNC A;  2ZW5 A;  3FIX A;  4QB9 A;  3T90 A;  1IYK A;  2HQY A;  1M44 A;  4MFL A;  2Y0M A;  5F47 A;  4XNH C;  5IV0 A;  3BJ8 A;  2BL1 A;  4IUS A;  3CXS A;  1QSO A;  1KUX A;  4I49 A;  3C26 A;  4A32 A;  4CAE A;  1VHS A;  4B10 A;  4M3S A;  4JJX A;  4YGO A;  5FVJ A;  4II9 A;  3EXN A;  2Z3K A;  5F46 A;  2R98 A;  4KVM E;  2AJ6 A;  3FBU A;  4AG7 A;  2WUU A;  5H84 A;  3EC4 A;  3D3S A;  5DWN A;  1WK4 A;  1Z4R A;  4L8A A;  2Q4V A;  3TTH A;  5DWM A;  4R3L A;  3N7Z A;  2B4D A;  2P6F A;  1IID A;  4CRY B;  1YLE A;  4MI4 A;  4FD5 A;  2YNC C;  3R1K A;  4KOX A;  4B11 A;  4KOW A;  2QIR A;  3P2F A;  5AG7 A;  4PV6 A;  2OZH A;  4NCZ A;  4H6Z A;  2VQY A;  2Z10 A;  1BOB A;  4E0A A;  2Q4Y A;  2B3V A;  1B6B A;  4MFK A;  2F5I A;  2D4O A;  4AVC A;  3NE7 A;  4KS9 A;  5J8F A;  1IB1 E;  3TO9 A;  4B14 A;  2CXA A;  2B4D B;  5AG6 A;  2O28 A;  2Z11 A;  2ZW4 A;  2ARH A;  2Q44 A;  4MFJ A;  4KOT A;  5KTA A;  3TT2 A;  2YNE A;  3R9E A;  2I00 A;  3W91 A;  4UBR A;  1ON0 A;  5G20 A;  4CRZ B;  4AVA A;  5AG4 A;  4X5K A;  1NMT A;  5GCN A;  2BUE A;  2BEI A;  4MBU A;  2A4N A;  2B4B A;  1YRE A;  5ISV A;  2REE A;  1WWZ A;  4F0X A;  3DR6 A;  2PR8 A;  4ZGY B;  4OAD A;  3DNS A;  4KOR A;  5A28 A;  5CNP A;  3TFY A;  3IU2 A;  4R57 A;  4C7I A;  3EO4 A;  2I79 A;  4QUS A;  2G0B A;  3FB3 A;  1R57 A;  3SXN A;  4ZBG A;  3FYN A;  4RS2 A;  4KUA A;  3B8G A;  1YGH A;  1QSM A;  2EUI A;  4QVT A;  4CYQ A;  4Y49 B;  1RO5 A;  4E2A A;  3GYA A;  4UWJ A;  2VZY A;  2ZW6 A;  4L89 A;  2B58 A;  1MK4 A;  3JVN A;  3LD2 A;  4XPL A;  3MGD A;  4B5P A;  4YFJ A;  1Q2Y A;  2BSW A;  1I12 A;  1MJ9 A;  1S5K A;  4JD6 A;  4B5O A;  1K4J A;  1XF8 A;  2Q04 A;  3TOB A;  3ZJ0 A;  3EY5 A;  4DNC A;  2B3U A;  3P2H A;  4K30 A;  4OLL A;  2K5T A;  1YR0 A;  4KVO E;  1Y9W A;  3D8P A;  4KZT A;  3H5Z A;  4B13 A;  1Z4E A;  2OB0 A;  2PSW A;  4R3K A;  1M4D A;  2P6G A;  1Y9K A;  4U5Y A;  4B5P B;  5I0C A;  3DR8 A;  2OU2 A;  3S6H A;  3QB8 A;  2G3A A;  3W6X A;  1P0H A;  3LOD A;  5EBV A;  1QST A;  1S7F A;  1TIQ A;  1KZF A;  3PZJ A;  4H6U A;  1IYL A;  2GAN A;  5J8C A;  4KOY A;  5G22 A;  3I9S A;  4A31 A;  5KTD A;  1RXT A;  1Q2D A;  2OZU A;  2AE6 A;  1Y7R A;  4UWI A;  4KSA A;  2FIW A;  2EVN A;  2GE3 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...