4OLLA

Camp-binding acyltransferase from mycobacterium smegmatis
Total Genus 86
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
86
sequence length
333
structure length
316
Chain Sequence
VAELTEVRAADLAALEFFTGCRPSALEPLATQLRPLKAEPGQVLIRQGDPALTFMLIESGRVQVSHAVADGPPIVLDIELIIGEIALLRDAPRTATVVAAEPVIGWVGDRDAFDTILHLPGMFDRLVRIARQRLAAFITPIPVQVRTGEWFYLRPVLPGDVERTYRRFQSVRKPTRALLEYLFEVDYADHFVWVMTEGALGPVIADARFVREGHNATMAEVAFTVGDDYQGRGIGSFLMGALIVSANYVGVQRFNARVLTDNMAMRKIMDRLGAVWVREVVMTEVDVPPVDTVPFEPELIDQIRDATRKVIRAVSQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Allostery and Conformational Dynamics in cAMP-binding Acyltransferases.
pubmed doi rcsb
source organism Mycobacterium smegmatis
molecule tags Transferase
molecule keywords Acetyltransferase Pat
total genus 86
structure length 316
sequence length 333
ec nomenclature ec 2.3.1.-:
pdb deposition date 2014-01-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00027 cNMP_binding Cyclic nucleotide-binding domain
A PF13302 Acetyltransf_3 Acetyltransferase (GNAT) domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.10 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 4ollA01
3.40.630.30 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Aminopeptidase 4ollA02
4BIFA 4F6AA 1IYLA 4B5OA 1S7FA 1CAWA 3TNQA 1S7KA 5JCTA 2DCTA 2D5FA 1I5ZA 4FD6A 1O5UA 3PGPA 3OF1A 4K8FA 1VHSA 1O4TA 1UIJA 4I49A 5I0UA 4E2GA 2B58A 3V8IA 4BMHA 1O3RA 3OWCA 1OFNA 4NXYA 4OAEA 4UXAA 1UD1A 1YHFA 5KBFA 4LUAA 1WLTA 1B87A 2WPXA 3TCVA 1YLLA 4E8OA 4R8HA 4XF1A 2ATRA 2B8MA 1SQ4A 4GS4A 2CNSA 1N71A 4Q0SA 3EHKA 5EBVA 5FDBA 2O28A 3F5BA 4QM9A 1S3ZA 4QXKA 3D2PA 4HKFA 4L8AA 4EWDA 3DR8A 2FIWA 1J1LA 5E96A 2Q7BA 3T9YA 2Z2SB 3SCGA 1FXZA 4FBFA 2P6GA 1WWZA 2FT0A 2Q04A 1CAXA 1H1IA 2GC0A 4KWKA 3QB8A 1OMIA 1GQGA 2Z10A 5I8YA 1HW5A 2GC1A 5JQ4A 4JTOA 1P0HA 5H86A 4MBUA 2B3VA 3QOPA 4QX5A 2B4DB 2DXQA 1G6NA 1YFYA 4XF0A 4H7LA 3E5UA 1IB1E 2ET7A 4BYYA 5J7MA 4R57A 2AJ6A 4XNHC 2B4BA 4R3KA 2R7HA 5I93A 1CAWB 1OI6A 5C8WA 3H50A 2GIVA 1L3JA 3FWEA 3RYPA 3HT2A 4CAVA 1YK3A 1CAXB 4NVPA 1J3QA 3ES4A 4KU7A 3N7ZA 4QB9A 3R9FA 4EV0A 3B8GA 4HBNA 4XFIA 1X7NA 3EO6A 1I21A 1P4NA 2QMLA 2WPWA 3DSBA 4JXQA 4MZUA 3WR7A 4NSQA 4I01A 2OZGA 4IEXA 5I0SA 3QACA 2PSWA 4UBRA 1PM7A 2IC1A 3HIFA 3PLQA 5I0TA 1VKCA 1YVOA 2PR8A 4PK2A 4LA3A 3LAGA 3TE4A 3LD2A 2OZJA 1O3SA 4IESA 4N9HA 3OD0A 1M4DA 5H84A 1FT9A 2R8VA 3ETQA 1LRHA 4BH9A 2REFA 2F4PA 3IGRA 4NEXA 4RI1A 4MI4A 2BNNA 4HN0A 3FIXA 3UKTA 3EFAA 2HUZA 3R96A 3LA7A 2GC3A 4IEYA 2WFPA 4XFHA 4OFGA 5GCNA 4CS0B 2Q0AA 4CYDA 4JWPA 1O7FA 4XFGA 2KCWA 1YUDA 4IUSA 1RGSA 4AVAA 2OZ6A 1VP6A 2V09A 3E6DA 1ON0A 4U9YA 4ZBGA 5I91A 1ZZ6A 2QIRA 3WW3A 2ZW4A 4HN1A 1YFWA 1XE8A 1XIXA 4KOWA 2O1QA 4JTNA 1QY4A 1XF8A 4TLFA 2CNTA 3BPZA 3R9GA 2OA2A 4I09A 5F49A 2MHFA 2FIAA 2BEOA 2CY2A 4FAHA 4GULA 3RYRA 3WW1A 1M44A 1Q2DA 3E6CC 5CNPA 3HT1A 1RO5A 2ZPAA 2UY8A 3H8UA 3S6HA 4U5YA 5FLIA 2D93A 1LKNA 3L2HA 3R95A 1ZRDA 1Q2YA 1ZZBA 1Y9WA 2P0WA 5EZWA 1YWKA 3WW2A 2Q0YA 4LLOA 1S5KA 2D40A 4YNIA 5JAXA 2JDCA 1KUXA 3E5QA 4PSXA 4A2UA 4D7TA 1MJAA 1Z9UA 3H3ZA 3B02A 2PHLA 3PVBB 4YSFA 4CRZB 1O5LA 3ACLA 5I0RA 1B6BA 2BEIA 4R87A 4IEPA 1GHEA 1ZNPA 2VQAA 3G3SA 4HNWB 5J8CA 1XE4A 4YGOA 1BOBA 3R9EA 1IYKA 5KHJA 3F8KA 2IL4A 3G8WA 4MY0A 3KMHA 3P2HA 2RC4A 2BNOA 4KLVA 4IETA 3E6BA 4Q0UA 4EWEA 2C0ZA 4HMZA 4U9ZA 3VWDA 4EROA 1ZREA 1EYBA 4XFFA 4E2QA 4PK3A 1VR3A 4F7ZA 2UYAA 5KHHA 3TNPB 3F0AA 1NZCA 1K4JA 4Z82A 1DZTA 1RTVA 1CGPA 4IEQA 5BUVA 5F46A 3IDCB 3GYDA 4HVRA 3LA3A 2B9UA 4QMAA 4EVYA 1Z4EA 4Y49B 4N9IA 5F48A 5C6CA 2VBQA 1OD5A 3KKWA 2K9ZA 4F8AA 1QSTA 4K30A 1SEFA 2ZCWA 2F5IA 3CO2A 2QJVA 2ZW7A 2GU9A 4LX9A 3H9AA 1DGRA 3BJ8A 1ZZCA 3O14A 3LWCA 1BO4A 1NE6A 2XKOA 3CJXA 2VXKA 3JVNA 2FQPA 3T90A 3RNSA 1EPZA 5JR7B 4ZU7A 4KU8A 2Z11A 4FD7A 1ZRRA 1NE9A 4MHDA 3TT2A 1ZZ8A 4MGKE 2C27A 3W6SA 4I3PA 5J3UA 1YLEA 4JD6A 2IXIA 5JSRA 3E0KA 4YFJA 3CLPA 3NSTA 4KOVA 5C88A 3EO4A 2VZZA 2H6CA 2D4OA 3LOIA 4MX3A 5I0CA 2QCSB 1X82A 1PU9A 2E9QA 5DWNA 3U11A 1Q2CA 2ZXVA 4YRDA 4MY3A 2PFWA 3NL1A 2H0VA 4JVAA 4MV2A 5HMNA 3NVCA 1H1MA 3FYNA 2VECA 3RDIA 1JUHA 2PR1A 2GAUA 1WGPA 1CX4A 3FZ3A 4Q0VA 2EUIA 3H4QA 4HNXB 1YGHA 3K9UA 4XEZA 4KL1A 4JLYA 2XGXA 2XLAA 1TIQA 1FY7A 4FT8A 2EA7A 1Q3EA 3EQEA 4XPLA 3G7DA 2PDOA 3BLNA 5EC4A 3SHPA 2BNMA 4IERA 5I8SA 3PP9A 4II9A 5KTDA 4I0AA 1Y7RA 4X6QB 4XF3A 4XFAA 4YYOA 3MDPA 4PIXA 4IEVA 3MGDA 1X8EA 4UBGA 4R9MA 4CAWA 3EY5A 3S7EA 3RPQA 1GQHA 1CAVB 4ONUA 4AVCA 2P6FA 3TO6A 4FAGA 2B5GA 3W6XA 4KVXA 1LB2A 3IWZA 3W91A 2CV6A 5IV0A 3E5XA 4H6ZA 1J58A 3D82A 3SXWA 2I00A 4XNHB 4B5PA 4PIYA 3GY9A 3FB3A 2H6BA 1MK4A 1ZVFA 3MZHA 1CAUB 1L0CA 4R3LA 3KGLA 4KWLA 4H89A 4L89A 3BB6A 1IPJA 5CU1A 2EVNA 4J1XA 2A4NA 2Z0ZA 4AXOA 4XPKA 2GC2A 1QSMA 2Y0OA 2Q4YA 3P2FA 4Q0PA 4WVZA 1J59A 4LULA 2PYTA 2XLFA 5K8SA 4IF5A 3RYKA 1RUNA 4QVTA 1QSRA 3VHRA 2VEZA 1EY2A 5F1RA 3IBMA 2G0BA 3TOAA 2ZW5A 2OZUA 3DN7A 2GE3A 1DZRA 4D7SA 4QUSA 1LRZA 5FQ0B 2ARHA 2CNMA 3FX3A 3ST7A 1I6XA 1KZFA 1QSNA 2BGCA 4QM8A 1QXJA 2HQYA 1M4IA 4MGZE 2VPVA 3GBFA 3NKTA 2FXFA 2XKPA 3KGZA 2HJIA 2PA7A 4Y49C 3SXNA 3H1MA 3ELNA 4FD5A 3OTFA 2J8NA 3H3UA 2FL4A 1IIDA 2FCKA 2Q44A 4OADA 4UWJA 1ZX5A 1YFXA 2X7BA 4KVOE 1YX0A 1PUAA 2Q4SA 5KHGA 1NYWA 4X6RB 3NJZA 2VZYA 1XRUA 5FPZA 4KOXA 1EP0A 4HSLA 4Q29A 4QGLA 4KOUA 5T3NA 1Q5OA 3BALA 3CEWA 1M1DA 1SQHA 5HH1A 3ZZIA 2KXLA 3LODA 3S6GA 4YARA 2O8QA 4MJ8A 2OYZA 4E2AA 3CXSA 2B5GB 3H7YA 3FJSA 5KTCA 2PQ8A 1UW8A 4B29A 2Q1ZB 1YREA 3FBUA 4DNCA 2Y0MA 3I9SA 2R98A 5AVPA 4AG7A 1FI2A 3HQXA 3SHRA 4XFBA 4CAXA 1Y9QA 4MGIE 2Z69A 3EC4A 2IXLA 3IDBB 3SCHA 5FLJA 3TOBA 5BY5A 4HVOA 1ZRCA 3H7JA 1NMTA 1OZPA 4E0AA 3TTHA 3UKNA 3D3SA 2PQQA 1YVKA 3OCPA 4XETA 4J3GA 2UY9A 4ZU5A 4IEWA 4META 2GH2A 1PMIA 4O9EA 2CGPA 4L11A 1Z4RA 3U0ZA 4PV6A 1UCXA 3EXNA 2OZHA 3UY5A 3TFYA 2XL9A 1ZRFA 5EFUA 2FE7A 4XPDC 2VI7A 4KVME 2IXCA 4BHPA 2J8MA 3GYAA 4MUVA 2B5HA 4CRYB 2BSWA 3D2MA 5LEJA 1RC6A 2PTMA 5E16A 2ATFA 4E2SA 2MPFA 2EAAA 1ZZ7A 4XFCA 3NE7A 1RL3A 3R6SA 3DNSA 4KOSA 4LTAA 3PZJA 2D5HA 5BXXA 2GANA 4YRHA 3MYXA 2B3UA 3QAHA 4ZU4A 2PRBA 3U10A 4HVQA 2QVSB 2GZWA 3H1YA 1M4GA 1QWRA 1U12A 2IXJA 5JSPA 5KTAA 3EJKA 1KUYA 5FQ0A 1YR0A 2JLMA 2ET1A 1V0CA 5FVJA 1ZZ9A 4UBHA 2J8RA 1MJ9A 4KOYA 5IB0A 1XE7A 3KSCA 4KWJA 4LUMA 2XLGA 4WZCA 4I0BA 1WK4A 3DV8A 3DDDA 4M3SA 2I79A 3MPBA 3JUWA 3WW4A 5C82A 1RUOA 3DL3A 2PAEA 3LA2A 3BU7A 1RXTA 1CM0A 3ZDSA 3KCCA 3CF6E 2OPKA 4AQ6A 1SFNA 5JSOA 2Q4VA 4X5KA 2AE6A 4AB7A 3ROUA 4H6UA 1UPIA 4KOTA 1Y3TA 1IICA 5KHKA 4O9GA 1R57A 4L2NA 5J8FA 2HV2A 2QECA 5FLHA 1J4JA 1DGWA 3S7IA 4B5PB 2WC2A 3S6KA 2Q30A 3I54A 3S0MA 2FS5A 5FCCA 4QGMA 3UKVA 2NMTA 1CJWA 2R1IA 3FNCA 3FXTA 3C3VA 3EBRA 2B4DA 1UIKA 4PIZA 4KZTA 2BUEA 5D1IA 3S6FA 1LR5A 1O3QA 3C26A 3IIAA 1KUVA 2FSRA 1X8MA 1S7LA 3CXQA 5FPXA 2OH1A 2G3AA 3IWGA 2CAUA 3E97A 4KUAA 2PHDA 2EVXA 3D0JA 3H1WA 4J1WA 3FRMA 2K0GA 2H5MA 4QC6A 4PSWA 1Q43A 1NE4A 2I45A 1CAVA 2MNGA 2IXKA 4NF1A 4ORFA 4Q0QA 2ETEA 4PJYA 5LRSA 3LZZA 1IPKA 3M3IA 4P9GA 1NXMA 4FD4A 1YFUA 4I2OA 4UWIA 3BJ7A 1I12A 3D8PA 4IEUA 3FFQA 2ZW6A 3RYOA 3M70A 2HKXA 5BPXA 5LRRA 2P6EA 2FMYA 4KUBA 5F47A 4R52A 5KHIA 3CL1A 2IXHA 5E1RA 3N4MA 2N7GA 3I3GA 2OB0A 4UA3A 3USSA 4AQ2A 2BL1A 1QXRA 1V70A 1NSLA 3DR6A 4Z07A 4HLTA 4IEZA 2K5TA 1XEBA 2XL7A 3RZZA 1U6MA 4I02A 4NCZA 3I7DA 3SXOA 4JJXA 2UYBA 4XF9A 4XPDB 5ISVA 4IEOA 3OGJA 4AG9A 1CAUA 3FHIB 4KLWA 3VWEA 4QBJA 3JZVA 3ZJ0A 3FE5A 5CVRA 4M85A 4WBBA 1UFHA 1XMTA 1TQ5A 2JDDA 5IX3A 3CXPA 4DINB 3ES1A 2JEVA 1VJ2A 4LA2A 5LEKA 4XF4A 2REEA 2VQYA 4MGYE 4RS2A 4F0YA 1S7NA 4KORA 2ZKLA 1O3TA 2G3TA 1J3RA 3NW4A 4LEJA 2OU2A 4HSJA 4RD7A 5HI0A 5I8TA 1QSOA 2CAVA 2BYVE 2PAMA 4JXRA 5DWMA 5JPHA 2PAKA 4QGNA 1WA4A 3I59A 1Y9KA 2P17A 2QNKA 2PC1A 4HZFA 3GKRA 2QDRA 3SMHA 5BV6A 5CADA 1I1DA 3D0SA 3PNAA 3I59B 4JV4A 4OLLA 3SCFA 4AVBA 2XHKA 3TO7A 3DKWA 4EWAA 1MJBA 1S60A 3R1KA 4HNYB 2D4PA 3TO9A 4MH0E 3BCWA 1J3PA 4LUKA 5J48A
chains in the Genus database with same CATH superfamily
4Q4Y3 4JGZC 4BIFA 4OKOA 4Z2AA 2RS51 3MV01 1CAWA 3A0NA 4BLJA 1J1TA 4UF0B 2OQ7A 4C1XA 1I5ZA 1GV9A 2O0OA 3WP3A 4FD6A 4K20A 1LESA 1GZWA 3CU7A 5FBJA 4UT5A 5FREA 4MFZA 3KASA 2WWSA 2DVDA 1UY0A 3ABZA 5F5IA 3WQ1A 5A1FA 1QMUA 2B58A 5T5JA 4BMHA 3OWCA 4XURA 4OAEA 1HRI2 2ARAA 2JKBA 4DY5A 3AC0A 3VZKA 2V8VA 4HANA 4XE9A 1YI9A 2WPXA 3TCVA 2ZGOA 1YLLA 1UZYA 4JGYB 4XF1A 3R4UA 1ASJ1 2B8MA 1FMD3 4Q1RA 4Q8LA 4A7ZA 5IHRA 1N71A 3MFAA 4J25A 3AX4A 5FY0A 1H8TB 4DS0A 5FDBA 3AZVA 2XR4A 3RGBA 1YLOA 2BOAA 4HKFA 2R042 5JZGA 4MCSA 2G4IA 1RUI3 3B2YA 4LBQB 4NHLA 2Z2SB 1L7LA 4FBFA 1NCQC 5M0TA 1OLMA 4CU8A 2Q04A 2VOWA 4YW1A 1MS1A 2ZX4A 3B3QE 1PIV2 5FRAA 4XDQA 5JQ4A 4LT5A 4KG8A 1P0HA 1DQ0A 3VATA 2VVEA 1NSAA 4FPCA 2ARBA 3AP4A 4MBUA 4IE7A 5FYZA 1DYOA 1OQDA 4LBLA 2V72A 4AVTA 1G6NA 4XTPA 4XAEA 1GZTA 1OLME 1ULPA 5FZBA 3O1SA 2ZENA 2UWBA 2ET7A 3T2QA 1ALYA 2IFRA 1IB1E 4QDQA 4R57A 4XNHC 4QXBA 2RS32 4LBKA 3ZR5A 4NRQA 3ZSEA 2C9KA 4R3KA 4QBJA 1JI6A 2C26A 1KQRA 1RHI3 2ZMNA 3J7MA 2BFUS 3N35A 3VKLA 3NWKA 3FEEA 1QJU2 1RUJ2 2FZ1A 3H50A 4XAAA 3ZXKA 4HKWA 5C8WA 2GIVA 4RR3A 2D4PA 3RMXA 5LA2A 4CAEA 2D6MA 2Y6HA 3VBSB 3IDEA 5CPAA 1YK3A 1CAXB 2XJUA 5FV3A 1ZA4A 1O4YA 4HFSA 4XJ9A 1UU6A 4XBQA 4GMP3 3ZFEC 3VHNA 3WY6A 4NIAA 1OD3A 1HB4A 4P4EA 4JXQA 4UW3A 4B7EA 1R082 3GGLA 5FYUA 3DEMA 4EN6B 2FCTA 4IGPA 4NSQA 4CPBA 2R061 4R9DA 5FZ1A 1ND3B 3IN9A 5FZ7A 4IEXA 2Q8OA 5I0SA 1CN1A 2PSWA 2Z3KA 4S2GA 2B42B 3HIFA 5I0TA 2G9ZA 4BQXA 3DF0A 1RXFA 1VKCA 4ATEA 4PK2A 1MACA 4R6TA 5FYVA 4N43B 3LD2A 3KHCA 5F3GA 1AR82 1G9CA 3VDDC 3MIBA 3UGFA 2R8VA 2PRQA 3KS7A 1AL21 3D5OA 2FVGA 4RI1A 3OUJA 2WKKA 2W1UA 2VMGA 2HUZA 4IEYA 3SJXA 2F17A 2BRTA 2ZEZA 4CS0B 1BKZA 2Q0AA 4JWPA 4UF4A 4M4RA 2DFCA 3S6PA 1K45A 1VBD3 4YLZA 4NHXA 1AJKA 1HN1A 3MLLA 4AVAA 1V9U1 1VP6A 3E6DA 4F9VA 3NNMA 1SDDB 2QIRA 4KOWA 2P1BA 2O1QA 2XJRA 1QY4A 3IIIA 4W4ZA 4XJWA 3VBFB 2WA4A 1YQEA 5A3TA 3FL7A 4KBBA 2VZPA 3TX8A 4XYXA 4JGYA 4ARYA 3KR4A 4XACA 5AC93 2VC9A 1G8WA 1YNAA 1VMJA 4B1MA 3I2OA 1RO5A 2PJ8A 2ZPAA 2UY8A 4QHZA 3SI1A 4CSWA 2VCCA 1Y43B 3AZWA 4YWAA 2PHRA 2D93A 3WNOA 3NH4A 4FPFA 4RS5A 4CCCA 3WW2A 2W47A 1D4M2 1S5KA 3I3DA 1DQ2A 4AI1A 2BWAA 1DGWX 1VMHA 1FPN2 4BU2A 1MJAA 2QFEA 1LHOA 1K5MC 3MLJA 4XIKA 3JU9A 1S0BA 1Q8VA 2AR6A 2VBPA 2G9FA 3ZSKA 5ELYA 3POEA 5I0RA 1B6BA 2VW2A 3ATGA 3VHPA 5A3WA 1WD4A 3J8F1 3ACIA 3MFCA 1YQ5A 1FOD3 3LPGA 2JDKA 4IEPA 1UPSA 2GDFA 5FYHA 4ASLA 4DMIA 4P4BA 1IYKA 5FP7A 4NJQA 4PF1A 3F8KA 1HXS1 3TAYA 4BB3A 4B3NA 1FPN1 2R16A 3LE0A 1W8NA 3P2HA 1LGCA 2RC4A 1W0NA 5AC92 2BNOA 5D8AC 3VD7A 5A3PA 1W8OA 1RUH2 2ABZA 3PL0A 3GCWA 1X9TA 1JYIA 3OGSA 5BNPC 1OFSA 4TXWA 4XFFA 4IV3B 1BVVA 3KVBA 4F7ZA 2ZEEA 5SV8A 3TNPB 1BQPA 5HVHA 1NZCA 2EXHA 3NAPC 2DUPA 3KHBA 4GWMA 2J1RA 4Z82A 1QGLA 1Y9GA 2Q0YA 5BUVA 1X33A 5DG1A 5F46A 1SPPA 3SLIA 2ID4A 3LA3A 1ELLP 3FMCA 3ZKUA 4HL0A 4RN5A 1Z4EA 4Y49B 3LEGA 1YI7A 3BVCA 4N9IA 1JZ2A 2EALA 2ZPXA 3FFZA 1EV11 3VKMA 5ACA2 3AXEA 1HJGA 2W3JA 1C57A 4PQQA 3DGVA 3KKWA 5FY1A 4K30A 1HRI1 2J22A 2IJZA 4CGPA 3FHAA 2ZW7A 4LX9A 1JYCA 1MS0A 3H9AA 3K4ZA 2ZX1A 1BO4A 2WNVB 5K8OA 1ZG7A 2XKOA 2A6YA 1RUG3 3OOXA 3E1F1 2PLV3 5FJKA 4DZGA 1ELMP 2VXKA 5D29A 2FQPA 3WNXA 4NO4A 2YMZA 3UL2A 4OQ9A 2Z11A 4CGOA 4N43C 4MGKE 2C27A 4YW2A 3W6SA 1X36A 3AVRA 4CXWA 1E5SA 2IXIA 2KR2A 3CBNA 1W06A 3O0XA 4L99A 3H3LA 4YFJA 1MZFA 3FC0A 1QHDA 1AR91 3FLRA 3WX5A 4DUXA 4JRAA 1QJY2 4KGQA 4XJUA 4R7MA 1LFWA 2YG0A 4COZA 1QOTA 3N7MA 4Q4Y1 5C70A 5LY2A 1UY3A 1JN2P 5A7QA 1X82A 4X8PA 4D6RA 2E9QA 3URFA 2WZR1 4CU6A 3ZX7A 1Q56A 1EV12 5ACA1 1Q2CA 4Q4V1 4MFQA 2NN8A 2RM23 3NL1A 3JCIA 3TN93 4EN9B 2EWBA 5C3RA 3ITQA 1O4ZA 4JYWA 5AGEA 3RDIA 2E26A 3KL9A 1OOPC 5DDJ2 5FAXA 5H9PA 3FZ3A 2J9AA 4HNXB 2DUOA 4U2AA 4JC1A 2WN3A 3VN4A 2AFSA 3PU3A 3VB9A 2XGXA 1TIQA 1FY7A 2LTNA 4K8RB 3H0OA 3OUHA 5FUNA 4OADA 1GNZA 1OLQA 2VW0A 4R8FA 4XPLA 3MICA 2XVLA 4NROA 3AYEA 3KT7A 2BNMA 5I8SA 1HQLA 2DBNA 3D7DA 3L2NA 4II9A 1XB9A 1DQ5A 3TOJA 1AF9A 1DLCA 3AKTA 3KB5A 2AENA 3BIWE 1ODMA 2VUCA 1X8EA 2QQJA 3OPTA 4H14A 4PIXA 3IMMA 1S0CA 3S7EA 4CP0A 1W3VA 3RZKA 2DTWA 3PIJA 4D6SA 4ZGYB 4NGPA 1LTEA 5J37A 2ZEHA 2VXRA 4ONUA 2P6FA 4NGTA 3GZAA 4LHNA 3VARA 1JBCA 5BNPB 1LU1A 1LOGA 3WNPA 3TO9A 3ZSJA 4KVXA 3W91A 1H4HA 3POIA 3E5XA 5FZOB 3POSA 4B5PA 1RTQA 5CG8A 5FPUA 2OXBA 5C3PA 5HVGA 2YC4A 4YZ5A 5KC6A 5L36A 1QOSA 1L0CA 2OUJA 2QDNA 3GHNA 2CTVA 1IPJA 4LHSA 5CU1A 5DQ0A 4TNUA 2AEZA 4J1XA 3ZYPA 2Z0ZA 1H9PA 2TEPA 3KI9A 5JM6A 1NAEA 4GH4A 2Y0OA 1CONA 2B4KA 3OY8B 2C6CA 4YVWA 3RAMA 3FLPA 4DRVA 1FX5A 4A39A 1SZBA 2R1BA 5EPAA 3U75A 4UEEA 3RYKA 1OHFA 5FJHA 1BK0A 3VHRA 2G0BA 5GZGA 2ZW5A 2FHRA 4C2YA 1BCXA 4IE0A 2GE3A 2OZUA 4FFHA 3PB6X 1PK6A 4OMDA 4P5YA 3DYMA 4I3GA 3CPXA 1QQ9A 2HQYA 2A3WA 3WZ1A 1DFQA 3PUAA 4NRMA 4AYUA 2HYXA 2VPVA 5JXHA 1F2PA 1W6NB 1MZ5A 3KGZA 3RS6A 3SXNA 2J8NA 4KSIA 3GBGA 4FPEA 2GMMA 5A28A 4GAZA 4GKXA 3Q8FA 4LXLA 3ZN5A 1YFXA 1NG0A 3TYJA 1DQ4A 4CEYA 5GZCA 2X7BA 4C2ZA 3S9LA 1LECA 3GNEA 1MQTA 1S0EA 2E31A 1PUAA 2ZMKA 2Q4SA 4Y1ZA 1COV1 3VBOC 4LO8A 3AKSA 3A0KA 3WXPA 2WQZC 5T3NA 3BALA 1PGW1 1M1DA 1ZBA1 3OEAA 4ES8A 3RWKX 4YARA 3KHXA 2F4LA 1RJ8A 2YC0A 3AVSA 5L9RA 4MJ8A 3W21A 1C5IA 5A27A 2WWUA 3B7IA 4E2AA 1JYXA 2B5GB 3SH5A 3WP5A 4BE3A 2ZX3A 3H7YA 1W39A 4ARXA 1TNRA 5LB6A 3GLJA 4YWYA 2JG9B 3FJSA 1CZTA 3ZVXA 5K0UB 2NYQA 2PQ8A 2AFXA 2CGOA 4FPOB 2C5DA 5C5UA 1A2ZA 2ZGMA 4G3YC 4BCUA 4HNWB 3IAPA 2WBKA 5LYLA 4XFBA 2IWGB 2KD7A 1UY4A 4MGIE 3ZYHA 3EC4A 3IDBB 4MCQA 5DAWA 1MEC1 3MIHA 2V77A 5BY5A 3TOBA 5TSWA 2WAAA 3ISXA 1ONAA 4OULA 3INAA 2ZZJA 5CZKA 3USUB 2YFZA 3DYPA 4NR1A 4YZ3A 2PHUA 4IV1A 5DUXA 5E8AA 5ERLA 5E6HA 2LRPA 2ZJCA 3K3NA 3UKNA 4EMEA 2V73A 1YVKA 4HXCA 4BPZA 5AFEA 2RS33 2SBAA 3NNGA 4LITA 4YVSB 2RR11 4BMBA 4JCKA 4L11A 3MW3A 3GXUA 4L97A 1Z8XA 2Q8EA 2HC9A 1WCQA 5EFUA 1OXCA 1BAVA 2VI7A 3SJGA 4GXLA 2VQ0A 2B5HA 3HNYM 4CRYB 1GOGA 4QX0A 4D3WA 4MCRA 1RC6A 1HKDA 1S2EA 2RVAA 4E2SA 1LEDA 2EAAA 4JQTA 4XFCA 3SITA 1L7RA 5AG5A 2CF4A 3R6SA 3RFRA 4KOSA 3I2IA 1JXNA 1TG7A 1XYOA 2HWD1 3OY8A 5BXXA 1K42A 3CDXA 3FUOA 3QAHA 4ZU4A 4KSAA 2R043 3B9CA 4HVQA 5L19A 1LEMA 4S2FA 1M4GA 2WZNA 4OC2A 5FVJA 1OUXA 1PCAA 1FMD2 4AFCA 1V0CA 3KV5A 3Q8AA 3MRUA 3KSCA 4CDXC 4DXZA 4M0NA 4E9KA 1HRI3 3LDRA 4FOYA 3S5QA 2PIZA 4FTEA 3D7FA 3DL3A 2PAEA 1S0DA 2JIGA 1VBE2 3LA2A 4ZX8A 4YZ4A 1B09A 1T6BX 5LCWL 1V00A 1UOGA 2V5DA 3CF6E 3AP9A 1C8NA 1BLLE 2PJ5A 2E7QA 4CVUA 4WV8A 3LDBA 4CGNA 2RDNA 4EN0A 1Y3TA 4WM7C 1VBB2 3I3BA 4LIUA 4O9GA 3VDAA 1R57A 4GKYA 5T5LA 1RIRA 1JOBA 5FYIA 1LCPA 3N9OA 2HV2A 4BQ2A 3RZLA 4P08A 1DGWA 3U37A 4CPAA 1F5JA 5FYCA 4W6YA 5FYTA 5F5QA 1DU3D 1KJLA 2EICA 1SLCA 5H9QA 1WD3A 2RS53 4UFLA 5A6XA 2ZGSA 4CU9A 4LBQA 5ANNA 3VDDB 1RUH1 5K0UA 3S57A 1R1A1 2WO1A 2CWMA 4NRPA 4CYPA 5GJ6A 1UOJA 2BVBA 4K1ZA 4N7UA 4CDWB 3S6FA 5AG4A 3WCSA 1X8MA 3S9NA 1IS6A 1MS3A 2PHTA 1PO23 2UWCA 2JKXA 1NX9A 1CIWA 2CAUA 1W9WA 1CP6A 4FPKA 4Y1UA 2VTFA 4KUAA 5K4LA 4GB32 4FFIA 5IVEA 1GYTA 1MVEA 2P34A 4TTGA 2H5MA 4QC6A 3WHTA 1XNKA 1Q43A 2HBTA 4IV1B 5H9SA 2Y34A 2JBJA 5T5PA 1WCKA 1CAVA 3GIUA 4RS5B 1RUF3 4GB31 2V4VA 3B01A 4ORFA 4PJYA 1JS9A 4OYUA 1F4HA 4NPMA 5FY9A 3T0BA 5JMCA 5DG2A 5LRSA 3M3IA 1W2TA 5FMBA 3I4IA 1GICA 1XXNA 1MS8A 1YFUA 5C9AC 1IY7A 5DZFA 3BJ7A 1I12A 4DXTA 1YMEA 2ZHKA 5C8CA 3FFQA 3PUIA 4DJLA 5DAQA 1TXRA 1ULDA 3VBSA 4D0QA 4LKSA 3OYWB 5LRRA 2FMYA 1DGLA 1UYXA 2A5ZA 1PO11 1PZ7A 1UKGA 1S0IA 2JEMA 4RL7A 4BINA 5F6LB 3W20A 2ZGPA 1CR7A 3WEZA 4UA3A 1WBLA 4IV3C 5FBZA 3USSA 1LANA 1NSLA 4OCTA 4IW3A 5L7OA 1OQ1A 5EIYB 4IEZA 4Q7AA 5D21A 2DPSA 1POV0 1IS5A 1UU5A 5DDJ1 4I02A 4NCZA 2NPIA 4JJXA 1JQGA 1WW4A 3B5LB 4JKLA 3MPPG 3N7KA 1VBB1 3JUUA 3OGJA 4IEOA 3PB4X 1Z8TA 3V0BA 1NT0A 1AL23 2ZGRA 1TQ5A 1CPMA 1WUVA 5ISLA 1WW6A 2JEVA 1YO8A 4LBQD 1GZWB 1HB2A 2VUDA 1CD3G 3ENRA 2C6GA 1IS3A 2ZKLA 1PX4A 1O3TA 2Y6KA 3NW4A 4LEJA 1XBUA 1AR72 2G3TA 4HSJA 2G9DA 1BEV3 4Q1PA 4QPWA 3N7LA 1AMPA 3FMGA 5I8TA 1R1A2 1VBA2 1W6OA 2QZ2A 3CZXA 1GUIA 3DLJA 4CUBA 2C6SA 5FYBA 4CCOA 4DPNA 2RS52 3N9MA 3UGHA 4LOTA 5F37A 1Z2LA 4NFRA 2P17A 2R062 3GKRA 4AG9A 2QDRA 2QQWA 2ZXQA 3D0SA 3PNAA 4JV4A 4OLLA 4UFKA 3TO7A 1W05A 5FZLA 3UYJA 3B94A 1GOFA 2RS13 2WLPA 1XJAA 5F7UA 1NA1C 4QPIB 5JI7A 2WO3A 1CAUB 1J3PA 3MIDA 4LUKA 5E89A 5IK4A 5K7PA 4FAIA 2JG8A 2J1UA 3T3YA 3K4DA 1EUTA 2D5FA 2WNVC 4I30A 4AI9A 1RJ7A 1U5ZA 4A7YA 4Y33A 1H1AA 5HXMA 2W1QA 3CDZB 1ND2A 1S0GA 3I2GA 3KF3A 2RS11 2CHHA 4K8FA 3T1MA 4EN7B 5A1AA 3OJBA 2EK8A 4L8AA 1O4TA 4MLOA 2VZ1A 5I0UA 4CUGA 3C2UA 2WT2A 3BI1A 2YYOA 1C28A 1O3RA 4NXYA 1QNWA 1ULGA 2DU1A 4XC9A 1UD1A 2QQUA 2PJBA 3POJA 3HJRA 4LUAA 4J6GA 3O1OA 3O1MA 1IOAA 3FEDA 2IUWA 4BQ5A 2XDVA 5CFCB 2ATRA 1I5PA 4BXFA 5EBVA 2DCYA 4YG3A 1WWYA 2VULA 2XVGA 2YHJA 5FP9A 3F2ZA 4YW3A 4GWIA 2P3JA 4D7YA 4DIQA 3T2PA 3H8RA 2BBVA 2XJVA 2CU5A 2JDYA 2EXKA 4UW4A 5IJRA 3WDYA 3LF7A 4XILA 3POGA 4YGBA 4EWDA 5B4NA 1WA6X 1MEC3 1O91A 3LCPA 4GJYA 1VRH1 4NHMA 4QPGB 1F15A 3VBOA 2I3CA 1UMIA 4LIVA 4NGRA 3H8EA 2ZGKA 4Y20A 4LQGA 1CAXA 2QQOA 1QQP2 3ORJA 4ZPIA 2PVWA 1OMIA 1GQGA 3C7HA 5I8YA 1HW5A 4WM8A 2B9VA 5FUIA 1OLRA 3JQXA 1GU3A 5H86A 2YC2A 1RUI1 1VB2A 1J83A 2B3VA 1QMJA 5JXJA 2B4DB 3IAQA 3VBUA 3UJQA 3Q9OA 2QZ3A 3ILFA 4H7LA 3I8TA 2CGNA 3E5UA 4PXCA 2AJ6A 1LOEA 1POQA 2HEYF 2VCAA 1DYPA 1HB3A 1W0OA 4A6OA 4ZS3A 5F5AA 2DCJA 1U5IA 5FKBA 4COVA 1CX1A 1OI6A 1YQ2A 4CDUB 2ZELA 1AYN1 3WUDA 1MZ6A 4BOWA 1COV2 4RFT0 3RYPA 2HWB3 2VCMA 3K4AA 3HT2A 1WCUA 1AHSA 5CB7A 4CAVA 4FPLA 2Q7SA 4L8QA 2CY6A 4YGEA 3FN9A 3POFA 1J3QA 1ZG8A 3N7ZA 1QJY3 3B8GA 4LORA 2WFF2 2VZOA 3EO6A 2QMLA 3DSBA 1RUE1 3U1XA 2VBBA 1BBT3 4MZUA 4CEYB 1Z8LA 5CG9A 5K8MA 3DGTA 4UFWA 2W52A 2OZGA 3TEXA 3ZOIA 4QX2A 2W94A 1W6PA 2C1FA 2A6VA 4GZ9A 4UBRA 2IC1A 4YZ2A 2J7MA 3HNBM 3PLQA 4FI9A 2XJQA 4LKDA 1H2NA 1R091 4LA3A 3WDXA 1ZBE2 1JZ5A 4JZ0A 5LBCA 1S2KA 4G1PA 1YCIA 2JG9C 5BNNC 4N9HA 3OD0A 2TNFA 1OKOA 3UGGA 4B4QA 1M4DA 3S9MA 4A2ZA 3BTXA 1C5HA 5A7WB 1AR62 2CTBA 3TBDA 2D97A 4BH9A 1GP5A 3G6JB 2BNNA 3ACHA 5JMOA 4F9UA 1IU8A 3UKTA 5JZGB 3EFAA 3IJ3A 1QJEA 2BGPA 4OFGA 1XNTA 4AE2A 4AQTA 4CYDA 3ZPYA 1GZCA 1QU0A 3B69A 1YUDA 1RGSA 4MXWA 2V09A 1ON0A 1HXS2 4U9YA 4AGRA 3FECA 4HOOA 1AX1A 3WW3A 4EZHA 5HBAA 1W8FA 5K0UC 4P4JA 1XF8A 2CNTA 4ZX9A 4B12A 3J8F2 3BPZA 5JDBA 2WABA 2VR4A 3R9GA 4I09A 1H2LA 2Y6LA 3WSOA 1RUH3 1TMF2 4XPVA 5ABJA 4B5OA 4GULA 3RYRA 3WW1A 1B35A 3E6CC 2RS31 1HN0A 5FYSA 3H8UA 1OF3A 3I1UA 4QQPA 3PU8A 1UYPA 4Y22B 1DDLA 1ARLA 4PQAA 4A7KA 5JH9A 2DUQA 3HBZA 1ZRDA 1ZZBA 2BPA2 1Q2YA 2P0WA 1V6JA 1VIWB 1YWKA 3HR9A 5EZWA 3TRSB 4LLOA 2AH2A 1FMD1 1US3A 3NNJA 5A32B 3PRTA 5EYXA 1KUXA 4WM8B 2JDCA 4A2UA 1UU4A 1FPN3 4I0WB 3PFOA 4MMOA 3IO1A 2ARCA 2YPJA 1BK1A 3EMRA 3F95A 1RB8G 4CRZB 4CYQA 1GP6A 1O5LA 4HK8A 4UFHA 3NV3A 5LA9A 4OUSA 1BXHA 5EYYA 1ZNPA 2XXZA 4LOSA 3G3SA 4P10A 2JD9A 2XHNA 1BOBA 1XE4A 2VG9A 3N9NA 4LJHA 3FF3A 3SI2A 2W87A 4V1PA 2ORXA 1NCQB 4MY0A 4XJZA 2ZGQA 1Z7S1 3IM0A 1YYNA 5IUQA 3SEEA 1ULOA 2BOIA 2X5IC 1TMF3 3FBMA 4QB6A 4EWEA 2C0ZA 2X09A 2K46A 4Y5TA 4U9ZA 4EROA 1CZVA 5LBBA 2ZAHA 4PK3A 1UX7A 1VR3A 3B9IA 4AF9A 1I9RA 2VZUA 4IGOA 4FP3A 3J7NA 3NMBA 2FBEA 1VBD2 3AFKA 4AGVA 1DZTA 1RTVA 2I74A 4IEQA 1CGPA 1OUSA 4AL9A 3H8GA 3D2PA 2G9GA 4AHZA 4QMAA 2B9UA 3W5NA 2LALA 4B4PA 4EVYA 1GWKA 5BNNB 2VBQA 3AMMA 3NAPB 3H8FA 2K9ZA 4F8AA 4LK7A 3UV9A 2ZCWA 1RYYA 3CO2A 4XBLA 5LYIA 2DCZA 4F0XA 1LJ7A 3WUCA 1AL0G 1UQXA 1XU2A 4XQDA 3RMYA 1ZZCA 4MVTA 3OSDA 4Z1VA 1NE6A 1RUE3 3CJXA 5JZGC 4Y1XA 4GM5A 2VGDA 1PNGA 4KUBA 4Z8BA 1OURA 2JDAA 1EV13 2P6HA 5JR7B 4CEWB 3HMYA 4FD7A 3HQRA 4MHUA 1NE9A 3APBA 5JSRA 4DEQA 3LD8A 2R49A 3E0KA 4QQLA 4XHBA 2VZZA 2H6CA 2R7EB 3M4FA 4JDMA 2D3SA 2QCSB 3ZYJB 5DWNA 3U11A 2QQLA 4AVVA 3D67A 2WYRA 1H2MA 2W2IA 1COV3 4YRDA 1YQ6A 4AZZA 3NRUA 4JVAA 4MV2A 1SLTA 2A73B 2OS2A 1PVXA 4OZOA 3UESA 3WOGA 3PB9X 4Q26A 1RUE2 4HG6B 5FZOA 2Q5TA 3UK9A 1JUHA 3WR0A 2GAUA 1WGPA 2JDMA 4Q0VA 4WM8C 2EUIA 2E53A 3RZMA 3SJFA 2OX0A 4CRQA 5FZGA 2EA7A 3OBRA 4K21A 1NLRA 1NQDA 2PDOA 1XSRA 2ZX0A 5FWJA 1W8UA 1F9KA 3PFEA 5FOBB 1GR3A 4K40A 3PP9A 4IERA 2VVFA 5KTDA 1Q7LA 4E4DX 4X6QB 4XF3A 3WF1A 2CTCA 4IEVA 4CE8A 3CKHA 4CAWA 4A32A 5C3OA 3EY5A 2GNMA 1VB4A 3GF6A 4YVSC 3RPQA 1LENA 1RVF3 4NMIA 1CAVB 2YGMA 3RJ2X 5A1LA 2CIJA 3HN1A 3TO6A 3ZYFA 1QDOA 2VL4A 3GM8A 3OB8A 2R32A 4LE4A 2TUNA 2ZOEB 3IWZA 1LB2A 1NCQA 3KZWA 1KDMA 3N9PA 1QQP1 3QH7A 4XZPA 4COUA 3PURA 1X10A 1PK6B 4UI9L 2ZOFA 2ZGTA 4LBJA 2A6WA 4N53C 4AOCA 4XNHB 1SHWB 2DYCA 4MGQA 3IU1A 4QX3A 4P9LA 3HEIA 1ZVFA 4NWWA 3AZYA 3SEPA 4UFJA 5JLVA 3KGLA 4R3LA 5LYDA 1GFF2 3ZFGC 2EVNA 2Y60A 2GP3A 3N3HA 4JRLA 2FDHA 2A4NA 2D98A 1PGSA 2VCBA 4FPGA 1VHOA 4O23A 1OA4A 1Q8SA 4FOWA 1H2KA 2JX9A 1OH4A 3ZSLA 3FX6A 3P2FA 1D2SA 1J59A 1OPOA 5K8SA 4IF5A 1V0AA 1RUNA 3ZYGA 2YROA 4YZ1A 3VV1A 4YGDA 3BKZA 1GYKA 5DAXA 3WNKA 5A6QA 2ZBJA 3AJZA 3ZXEA 4JDNA 1SLLA 4IE5A 2WLQA 4CDQC 1DZRA 5A7SA 5I0DA 2PJ7A 4QUSA 1LRZA 4NGSA 4HKOA 2Z79A 2CNMA 2R063 4M00A 2UURA 1I6XA 3AK0A 2BGCA 4QM8A 3WP6A 1LHVA 1M4IA 4OC5A 4F83A 2FXFA 3ILRA 2PA7A 1ZO0A 4X8IA 3VZLA 3BGAA 3ZPOA 1B35C 3JB4C 5A3LA 3IU2A 3H8OA 3H3UA 2WZPP 5ABJC 1YQCA 4PLNA 1LAJA 2DPTA 4S2DA 1ZX5A 1R092 2EIBA 2C1CA 4MHPA 1G9AA 4LQRA 4Q4V3 4MHRA 4X6RB 2YNCA 3RZJA 1EP0A 3L2YA 2GU2A 1QJU1 1RUJ1 1QEXA 4HSLA 3ZFFA 4KOUA 1AL22 1C1LA 1Q5OA 3CEWA 1PYTB 4FUUA 1VMFA 2E63A 2VTXJ 3OBZA 4HT1T 4YVWC 2EK9A 2A7AA 5FO7B 4PPZA 4ZHNA 5KWRA 4BISA 1M06G 1AR81 1VIXA 2VOXA 3LODA 3MGUA 2FCVA 2O8QA 2X29A 3DXTA 4HPKA 3A23A 1ENSA 1XOVA 3OBTA 1AJOA 2VZTA 3VBRC 3VHOA 1WMEA 4MCPA 4Y3OA 4CTEA 2P37A 2Q1ZB 1YREA 1YSJA 3ZM8A 2PJ2A 4X3RA 2FDFA 3I9SA 4CP9B 3SHRA 2RMU2 1ZLIA 4OHVA 1ENRA 1UL9A 2HWD2 1EUUA 3SCHA 4IUGA 4JGZA 1G9FA 2HWB2 4PI2A 4A33A 3MUZ1 1ZRCA 1A8MA 2VNVA 4CCMA 2XEFA 1AX2A 1LOAA 4E0AA 1G7YA 3TTHA 3IFEA 3VZOA 4LKEA 5GLTA 1UN1A 4FOQA 3VLBB 5J1XA 4UOJA 1Y7BA 2PQQA 3NNFA 3PMSA 4ONWA 4XETA 3OD4A 2UY9A 4ZU5A 2NMOA 1PMIA 3ZXFA 3U0ZA 2HEWF 4NHYA 4XUOA 1CG2A 2OZHA 3EXNA 2Z5WA 2XL9A 1ZRFA 2FE7A 5C7GA 3TFYA 3WDVA 3IIBA 4MHNA 2J8MA 3GYAA 5FY8A 1UYZA 1DYKA 5IYYA 2JDUA 5FIXA 3C7GA 1PIV3 3P3PA 4NWVA 4AEDA 5LEJA 2DVFA 2ATFA 2Q43A 2WT0A 1IG3A 1ZZ7A 2J1SA 2VXJA 3NE7A 4AAPA 1RUC1 3O0VA 4LTAA 4JX0A 2D5HA 1W6OB 2ORZA 1W6PB 5A70A 1ENXA 3C8XA 1NQJA 3VD5A 3ZLIA 4AVSA 4CP1A 4C90A 2PRBA 1S0JA 3H1YA 4GXHA 2VMHA 1IGBA 1POV1 2EIGA 3IPVB 3KQRA 2IXJA 1LHNA 5T54A 4CDUA 1IOFA 2FIWA 5KTAA 5JPMB 2JLMA 1TNFA 1YR0A 1VBB3 1HDQA 1XNAA 2B7YA 1NY72 1RUC3 2Q1MA 2W1WA 3AYDA 1RITA 1U5XA 4GJZA 2VW1A 3H8XA 2PJCA 3FLTA 4KWJA 2XQRA 3SI0A 4WZCA 2YPDA 5LA1A 3ZMNA 1Z8WA 4CXYA 2W9XA 4R76A 4AXVA 5C82A 3P3NA 5GM0A 5F9TA 3OPWA 1ULFA 3MN8A 1VHEA 3AZZA 3BU7A 2VM9A 4WZFA 4CDUC 3AKQA 4YW4A 4MXWB 1RXTA 3PB8X 3B3SA 3OGRA 3KCCA 1UWWA 3HD8B 3N5FA 2VH9A 4AQ6A 1ZLHA 4BQWA 4PXBA 1QF3A 3AKPA 5LK5A 3WDWA 4UEFA 4CYOA 4AB7A 3D8CA 1AYM3 5ABJB 4BDVB 2P3IA 2WN2A 1IZ3A 2W5FA 1IICA 2OR4A 1VBD1 1REFA 1HDUA 3K48A 3JXSA 1W9SA 1UNBA 1C8M3 1D4VB 2R072 4BM8A 4JGYC 5FXXA 4XUQA 4LO6B 5JOYA 2VE1A 2VNOA 2MEV3 3S0MA 4DXRA 1UF2C 1C1FA 4YVSA 1RXGA 1XPWA 4LHLA 4OC1A 4OZXA 1LODA 2NMTA 2V8GA 4RQPB 2Z3OA 2CL2A 3FXTA 5CBMA 4M3CA 3THCA 3IDAA 4G4FA 4PBOA 1UIKA 4SLIA 2I2SA 3ZR6A 2BUEA 5D1IA 2ANPA 2D7FA 1E5RA 4MSVA 3W9AA 3IIAA 2JECA 1O3QA 1S7LA 3C26A 3CXQA 1V9U3 4UIAA 4CCJA 2G3AA 1D7PM 3B3TA 4IAVA 4ZXKA 1OQEA 4ATFA 3HNMA 3B93A 1N3QA 2PHDA 3LEIA 1OOPA 2CYFA 3B35A 5D2AA 3FRMA 5IVJA 3PBBA 1L7QA 3ZKYA 1S55A 4PSWA 1GNYA 3VBFC 3NV2A 1UZWA 2RDRA 4K1YA 4YW7A 3M3CA 3M8LA 1HV0A 2MNGA 2I07B 2FDIA 2P3KA 4HK9A 1GLHA 2XUMA 4Q0QA 4B11A 4ZY0A 4DY3A 1DIWA 5EMIA 4OI0A 4UEZA 1UOBA 1YJKA 1LHUA 4OHZA 4FD4A 5AFBA 4HPSA 4I2OA 4UWIA 3ZFFB 1LGNA 5FMCA 2OW4A 1Z0HA 1PVC1 4IEUA 3RYOA 2A75A 4MHZA 5BPXA 2HKXA 4MFJA 5CFDB 3CT9A 5F47A 1KGYA 1ND3A 4GIQA 5A3OA 3I3GA 3KWVA 2JJ6A 3RSJA 4NGMA 1SBDA 4AQ2A 5FOJB 3V65A 5FZ3A 4P4IA 1QXRA 1V70A 1AXKA 1MQTB 3QCWA 1MS5A 3MHZA 4JHZA 4KMQA 4ZY9A 1DG6A 2XL7A 2K5TA 3FJUA 3J26N 5CKMA 1DF0A 5IVVA 4QHOA 1T2XA 2UYBA 1US2A 4XPDB 4DRRA 1YIFA 5J09A 1CAUA 3FHIB 4GALA 3ZJ0A 3WG3A 3FE5A 5CVRA 3VL8A 3C7OA 5IX3A 1CPNA 3LQCA 2RR13 3I2JA 4P6YA 2REEA 4LA2A 4ZY1A 4XF4A 1XYPA 4L0PA 4MGYE 4OI1A 3GHMA 2OT7A 4H2AA 4AQSA 1F2OA 1J3RA 2OU2A 4OC0A 2PHFA 1QH7A 1FNOA 4RD7A 5JOZA 1R64A 4WVVA 5FZ9A 2WIIB 3VH9A 4QXCA 4M6GA 5LRKA 5IAXA 4OI2A 4OHXA 5JOXA 5L9VA 3NQHA 1V6NA 3IB3A 4K3UA 4Y4YA 1WCSA 2HWE3 3DCQA 2VMCA 3GZEA 4ISQA 4PCRA 1A34A 4W9YA 2XJPA 1VE0A 2MEV2 1XOYA 4UAPA 4V2VA 5FWEA 3WQ0A 4Z92B 2RJLA 5FYYA 4HETA 5CKNA 2PC1A 4D8MA 2QKDA 5BV6A 2PN5A 1C8M2 2JIJA 3SCFA 5CADA 4AVBA 4KH9A 5HCFA 3ZFGA 2XHKA 4H7MA 3T1LA 3R1KA 2EO8A 4V2WA 4LNVA 5DAVA 1NCRB 3BUCA 2F7VA 5IT6A 2ZHLA 3CPAA 5J48A 2JE9A 1DZQA 3QNVA 4F6AA 5FPVA 4FWUA 4XJAA 5F5CA 1S7KA 2DVGA 5BYNA 2DCTA 1A78A 2VOTA 4Y22A 1WLDA 1OT5A 2C4XA 1NA1B 2AZ5A 2DBIA 4QPIC 4QWNA 5A33A 3JB8A 5C71A 2YNEA 4DUKA 3PGPA 3AP6A 3OF1A 1IS4A 5FMOS 5FZ0A 1VHSA 2QYVA 4KS9A 4DUWA 4OUEA 4M4PA 1QH6A 4E2GA 5A3MA 4FP2A 4UXAA 5CFCA 2VBDA 4QD2A 1OOPB 4PLMA 5KBFA 2DF7A 1WLTA 1B87A 1O59A 1IQAA 2J1VA 1TKHA 1SQ4A 2Y64A 4GS4A 3NO8A 4ZS2A 2CNSA 4AG4A 3KLSA 1RMU2 5KR7A 2O28A 4QPGA 3F5BA 4Q36A 1F4AA 2AREA 4QM9A 4AEDC 4QXKA 3MV11 3ZXAC 1RVF2 2O53A 4A31A 1DBNA 1AX0A 3WF3A 3DR8A 4QB2A 4EN8B 3T9YA 2PE3A 4JDOA 2ZEGA 3SCGA 1FXZA 1X9PA 2YGWA 4IXLA 4XDPA 5HMNA 2FT0A 2W68A 2WWJA 2GC0A 4KWKA 4XMIA 4W8JA 5CBLA 3QB8A 5IVBA 4LMFA 4Q4X3 2Z10A 2CSGA 3P6BA 4QPGC 4JTOA 4XCAA 5B4XA 4CAFA 2XBO3 4RFRB 3GJAA 4QX5A 3GBWA 5EXOA 4BQ1A 5HXVA 1YFYA 4XF0A 4EQVA 3T4VA 4BYYA 3VGIA 4AFDA 4CUAA 1JOPA 1ZM1A 1JZ7A 1JYTA 2DCKA 3THDA 1EAH1 4TWTA 2R7HA 1QOOA 1CAWB 4OMCA 1JMUB 1BBT1 1L3JA 2RM22 3FWEA 5FZ4A 4NPRA 4QPIA 3ACGA 2HWD3 3ILNA 5CEHA 4O7XA 4NVPA 1V6OA 2RMU3 2P5BA 4L92A 1OA2A 2ZHNA 5DAPA 3RWNA 1JYWA 4ASMB 3ES4A 4KU7A 4ZZ5A 2AUYA 4EV0A 4HBNA 2XH6A 1X7NA 4RYDA 4XFIA 4C8DA 4P9JA 1P4NA 2WPWA 1WW5A 2F6BA 1AYN3 4M6IA 3WR7A 2E51A 1ASJ2 1BVP1 4I01A 2P2KA 4BZ4A 1WMDA 2O8OA 4P9XA 4FTSA 1DQ1A 3QACA 2ZEDA 1PM7A 2PR8A 1KXGA 3K46A 4JKKA 4PQ9A 1YVOA 2J42A 1TME2 2A1XA 1RUG2 2O14A 2Y33A 5CYYA 3TE4A 2R071 1AR71 4QX7A 3RZHA 1M4LA 1HRV1 2YB7A 4Q8KA 1KEXA 3DPRB 1VBE1 3GDBA 5CNAA 5DUWA 3VZNA 1LRHA 3IGRA 2F4PA 4LHKA 1VAVA 5FPAA 4HN0A 4MI4A 3U4SA 4LPLA 3LA7A 2GC3A 5GCNA 3FVLA 4XFHA 4W50A 3HVDA 1K5JA 1TE1B 3L9JT 3KM5A 2WA3A 4XFGA 2PHWA 4ZBGA 2QVPA 4CDQA 2BO9A 1FT7A 1KS4A 2XJSA 4CP9A 4HN1A 1YFWA 2KA3A 1XIXA 2ZW4A 1UMZA 5C4WB 1SLBA 4NGNA 3T09A 3NE8A 5LBFA 1F31A 4JZRA 2ZEYA 3QLQA 2ZEPA 5G1ZA 1RMU1 2MHFA 2BEOA 1R081 3M2MA 4AWDA 4FAHA 2RM21 2JDPA 2FIAA 3B3VA 3NA6A 7CPAA 2BP6A 1Q2DA 5CNPA 3HT1A 5F39A 1DQ6A 1VALA 2JICA 4TSVA 4U5YA 1X50A 1H8VA 4ZZ8A 1UZ0A 1LKNA 2AFOA 2AFWA 4TWEA 1K5MB 4QHBA 1HQNA 2BWCA 2GSYA 3OYWA 1Y9WA 5EJZB 3QBQA 1RUD2 2D40A 5JAXA 3E5QA 3MLKA 4GH4B 4DOUA 2VVDA 5CAZA 2VZQA 1Z9UA 2OPWA 3PJQA 1W2NA 2ENRA 3H3ZA 4QX1A 5EWSA 3B02A 1W3XA 3MUY1 1D4M3 1PHMA 3LDKA 1TVGA 3ZN6A 3UT0A 1CX8A 4R87A 4RR3C 2BVVA 1E5IA 2VMDA 2VQAA 2C6PA 3WDUA 5JOWA 2NYYA 3HWJA 3PUSA 5FK7A 5T50A 4AEKA 3VUOA 1GKBA 2XONA 5FZIA 2NP0A 2ZEOA 3D7HA 3G8WA 4UCNA 3LKJA 4OMEA 2NM1A 4KLVA 3NFZA 1CZSA 3E6BA 4Q0UA 4AFBA 4C1WA 1X12A 1DLLA 5JXGA 4P44A 1Y0YA 4XHXA 1UXXX 2DURA 3BTAA 4M3CF 1IOIA 2WS93 4MADA 4DXSA 1HXS3 2JG9A 3F0AA 1XNCA 5FMDA 1K4JA 2ARXA 2D43A 3CHXA 4FCAA 1WZXA 3AMQA 3IDCB 3BTZA 1QJX2 2OIIA 4HVRA 2PLV1 4AGGA 4LR4A 1H8LA 3D4UA 4QDRA 3PJYA 1I3HA 2W46A 3AKRA 4FBEA 5F48A 3LOBA 5C6CA 3O0WA 5JUVA 3POYA 3BOWA 2XB6C 5FY4A 1GWLA 1KWMA 2ADEA 5JIAA 3K2KA 4EWTA 4COWA 1IGOA 3T30A 5DDJ3 2GU9A 2ZS6B 3AJYA 1DGRA 3ETPA 2CNAA 4CDXB 3BJ8A 4AFMA 4E8DA 3O14A 2JB8A 1W04A 3LWCA 1CPSA 3JVNA 4UFVA 3K77A 3T90A 1AVBA 2VAUA 3RNSA 2EF6A 5T55A 4BJ0A 4NIHA 3GB0A 2F8HA 1G86A 1EPZA 1V6MA 2E33A 2LUWA 4KU8A 4ZU7A 2HH9A 1ZRRA 5IK8A 4PI0A 3Q8BA 4WVWA 4BXSV 4RN7A 1YLEA 3CJIA 4XQWA 1AXYA 3DPRC 3CLPA 3NSTA 5JGFA 4KOVA 1XBFA 4MFKA 5C88A 3PHMA 4JQRA 4KWUA 1TME1 3EO4A 2DVAA 2VJXA 4QDSA 2XUEA 3LOIA 1W2AX 2YU2A 1C8M1 4MX3A 4ET7A 3VD4A 1NUKA 2ZEMA 1OBRA 4A95A 5THWA 1CQ9A 1LOFA 2WDBA 4GMP0 3USUA 1A6CA 1PU9A 2MEV1 2ZXVA 4MY3A 1N1YA 5K8NA 1CESA 2H0VA 1AYM1 1F5FA 1QJU3 1RUJ3 2PLV2 2X05A 2WUUA 3NVCA 1H1MA 1VBC3 3K75B 1REEA 1RHI2 1GANA 2VECA 3VBRB 5FXVA 3WDTA 2AFUA 1QNYA 5GALA 2ZMLA 4OC4A 3KT1A 3H4QA 2YNCC 1YGHA 3K9UA 4QX8A 4KL1A 4XEZA 3VBUC 4NOTA 3ZFFC 5FZHA 5ACA3 1FV3A 5DN2A 4FT8A 4DFSA 1YW4A 2JENA 1Q3EA 3EQEA 3V56A 1PMJX 4QKBA 3G7DA 3BTYA 1BPNA 2JD4A 2FDJA 2XBO2 1QJX3 4P9YA 3KCYA 3BLNA 3SISA 2VY0A 4ZONA 2HWF2 3SHPA 2D3PA 2JDHA 4PF5A 2A71A 4A42A 4I0AA 4N90A 4NAMA 1KRIA 1Y7RA 2HLEA 2GLJA 4IL7A 1W6QA 3KCXA 2HYKA 2ILMA 4C68A 3HPNA 2Y8KA 1PVC2 3M3OA 4C91A 3KV6A 1PO21 1GQHA 1POV3 1QIQA 1GNHA 4F3JA 2WUHA 5BNNA 1HJFA 1CWPA 1S0FA 2ZACA 1ND2C 2HWF1 3W6XA 1RUG1 3PVOA 5IV0A 2CV6A 5HCAA 3I3EA 3ZIWA 4H6ZA 4OC3A 1F8VA 4Q5OA 4FXKB 1J58A 2I00A 1SCSA 3W5MA 3CJIC 3FB3A 2H6BA 1MK4A 3MW4A 2BQPA 3POBA 3MZHA 4BQ4A 5LY1A 4A44A 1ND3C 4CCLA 5JI9A 1XQNA 5HPOA 2R0HA 3BB6A 1DP0A 2PJAA 3NH5A 4B14A 2BJSA 3U78A 4TN7A 4XPKA 2GC2A 2FDGA 1QSMA 8CPAA 4FFFA 2Q4YA 3RG0A 1PMHX 3A7QA 5F3IA 3BI0A 2WZR2 4LULA 2PYTA 4FPJA 5C9AA 4CUCA 4FO9A 1N1VA 4QKFA 4G9SB 3S5AA 1GBGA 1GZ9A 4XMAA 1EY2A 2BDRA 3BODA 3FUQA 5F1RA 5HV4A 4H3WA 5IW0A 2YBPA 2ZA9A 4D7SA 3MI8A 2PJ3A 1UKRA 5FQ0B 4X2TA 4PDWB 1W6MB 4R9BA 5F32A 5FYMA 1XU1A 3ST7A 2QQPA 1KZFA 1QSNA 2Q51A 3J9SA 1TKJA 1APNA 2HWE2 3GBFA 3C7FA 5FZ8A 2XKPA 1WKYA 1BJQA 2HJIA 1XFOA 4Y49C 3H1MA 3ELNA 4QQOA 1K3IA 1EPWA 1R1A3 2D6LX 3OTFA 3VBOB 4FD5A 2FL4A 1BEV2 1H30A 4BLIA 4WWVA 3AB0A 1QJFA 4KVOE 1LCLA 4XW3A 4QAWA 5F2SA 2WINB 4YPJA 1KS5A 3V0AA 3UJOA 1FYUA 1LOBA 4FSJA 1ARMA 4YW5A 3WF4A 3JTKA 3SJEA 4KOXA 5EV7A 3M3QA 1JHNA 4QGLA 1IYLA 1XMBA 2WO2A 3RO0A 2EXJA 3ZYBA 2AC1A 1W9FA 2WQ8A 1STMA 2KXLA 3CIHA 1HDKA 4JAAA 4EZ4A 2CDOA 5DPNA 3LFIA 2BUKA 4LO5B 2YU1A 2OYZA 2E6VA 1PGW2 4Z2WA 1Y7EA 5A32A 2Q4ZA 3PDQA 4IK2A 2RB7A 1KITA 2D6PA 2NZ9A 1ASJ3 1F35A 2IVJA 3VBHA 4RS5C 5DXDA 5LRGA 1BBT2 1V6IA 1ACCA 3IKWA 3ZN4A 4AEDB 4DO0A 4BQ3A 3FBUA 4DNCA 1J84A 4OVEA 3LEMA 4C0HA 4URTA 2Y0MA 4YFWA 4XOGA 4CAXA 2VMEA 3HQXA 3I3QA 3RJRA 4AG7A 3MF6A 2YZ4A 1Y9QA 4YM2A 5FZCA 2Z69A 2A6ZA 2IXLA 2ZZQA 5EJ3A 1HB1A 1AUGA 1NMTA 4C7IA 1OZPA 1IKQA 2JDNA 3DUIA 4DNYA 1JWQA 2PJ9A 2POKA 4PXDA 5J1QA 2GMPA 3K3OA 5KXBA 2EBJA 5G22A 2RDSA 4P14A 1VBC1 3B3CA 4CGLA 3BPSA 5LYFA 2ZEWA 4J3GA 1MR5A 1W8ZA 3B00A 2GH2A 4META 4GB33 3Q8EA 3MW2A 4NUBA 4O9EA 2CGPA 1UCXA 3RBUA 2QUOA 2LW8A 4CCNA 3EYPA 1OBNA 4NAOA 4KVME 2IXCA 1JZ8A 4BHPA 2WRAA 2Y6JA 3Q8CA 1MQTC 4MUVA 3D66A 2ZEFA 3PTYA 3D2MA 1QJX1 5E16A 2G1MA 5FY7A 1UOFA 4QQ2A 1A8DA 1QQP3 2MPFA 3VDDA 2D6KA 3CZUA 3ZO0B 3I3MA 1LAMA 3GUXA 1OH3A 1JH5A 3POWA 3DNSA 3HLPA 5LRJA 4B6ZA 1VPHA 5FZDA 5FZEA 1OVSA 3MYXA 1Y4WA 2VOKA 2GANA 4YRHA 3IWWA 3JBG3 2QVSB 2GZWA 1QJZA 2YBKA 1SBFA 1U12A 4TLGA 3DPRA 5FQ0A 2V5YA 4QB1A 1ZZ9A 1B35B 1D0GA 2VZSA 3ZFGB 1MJ9A 2J8RA 5IB0A 3MO4A 3ON7A 5L7OC 1G9BA 3PMEA 4LUMA 2JDZA 3TWIA 1FAYA 4I0BA 4Q4W2 2YY1A 1MS4A 2JWPA 3R0RA 4QU1A 5EP9A 1YXWA 3MPBA 3JUWA 4M3SA 2Z42A 3AM2A 3WT4A 2GN3A 3B3WA 3U14A 2QQIA 4CGMA 1JODA 4QKDA 2GLFA 1VBE3 2E32A 2Y38A 2B39A 5A7OA 3V0AB 2OPKA 4KORA 5JSOA 4BA6A 5F8PA 4PXEA 3VBHC 2AE6A 4C2XA 1F2NA 3ROUA 1AUYA 1UPIA 3NV1A 3LACA 4H6UA 4QQHA 5FXWA 3P5BA 4KOTA 5KHKA 1WMXA 2RJ2A 4L2NA 4AW7A 2KM2A 2O4HA 1HQWA 1CJPA 3CZJA 2PJ6A 3HUVA 4B5PB 1Q8QA 2D6NA 4EJRA 2WC2A 5JIUA 4LQ6A 3S6KA 4Y20B 4RQPA 2VO5A 4P00B 3NJVA 4P5HA 5G20A 3UKVA 4IDZA 3KZ4C 5IFPA 2YDEA 2ZGLA 3FNCA 4AI0A 2J1TA 4CCEA 4HKLA 3WG1A 2B4DA 2WSAA 2B45X 5FP4A 1EE3P 3W59A 3ZN6B 4MO3M 2JE8A 5FFOC 3RZGA 5IWFA 5FPXA 2OH1A 2DU0A 3N9LA 4RQPC 1JZ3A 3IWGA 2IVIB 4ISRA 1K12A 2X5IB 1CP7A 2VZ3A 5G21A 2K0GA 4W6XA 3ZYIB 3NAPA 4COYA 1MPXA 2YBSA 3VKNA 1PO13 1YJLA 5GLWA 5GKAC 2IXKA 2QQMA 1D4M1 2ETEA 5FZMA 2EAKA 3PBEA 1I1EA 3LZZA 3AP7A 3ZXJA 3H5ZA 1SLAA 1LOFC 4P9GA 1NXMA 3T8WA 3BXMA 2NMNA 1BZWA 1RVF1 3D8PA 1H9WA 1R1ZA 2XQXA 4KBZA 2YUEA 3AFGA 4RGGA 2ZW6A 3KGQA 5D8NA 5F09A 3AYAA 3M70A 2P6EA 4FFGA 1TF9A 3M1HA 4R52A 2IXHA 5E1RA 1EAH3 2N7GA 4RHV2 4UFIA 4D94A 1N1SA 4KI5M 2RFHA 1JZ6A 5FY5A 4H2KA 3I2FA 4Z07A 4N7IA 5EHDA 1AYEA 4I49A 3PVNA 1XEBA 4DB5A 4CDXA 1WLCA 3I7DA 4W65A 2HWC3 4CEYC 4HONA 1S1AA 4AI2A 1HRV3 1PO12 3AMNA 4XF9A 3OUIA 1UZZA 1QJY1 1WLWA 1Y9MA 2PHXA 4NPLA 3PUHA 1ODNA 3JZVA 4AI8A 1E57A 3TC8A 3AL5A 3NV4A 1XMTA 1LU2A 3D7GA 2R0FA 4QT6A 5A3NA 5FO9B 3CXPA 2WZ8A 3ES1A 4B4RA 3QH6A 1VJ2A 1VAMA 5LEKA 1PO22 4MXVA 4FTBA 3PB7X 4RS2A 4NGQA 2GP5A 2Q8DA 3ZYRA 4NIGA 4MG2A 4OP4A 1QDCA 1W90A 1QSOA 4MOAA 4K6BA 1XNBA 1WW7A 2PAMA 4M3CB 5HXDA 2ZAAA 5JPHA 2PAKA 3X29B 5DZGA 3T2OA 2ODFA 3VDCA 5BNPA 3ZZIA 3AXDA 2QNKA 3AZXA 4JGZB 4XTMA 3SC7X 3SMHA 3VBUB 4KSFA 1C4RA 1SDWA 5C4WA 4NJRA 3I59B 1BMV2 3ZFEA 1MJBA 3IEHA 2R1DA 3WG4A 4B8EA 4MH0E 3BCWA 4ZYQA 2VMFA 1ZBA2 2WL1A 3LSEA 1UMHA 2OVUA 2WZR3 1AYM2 4RGKA 3SNMA 2PQSA 3I49A 3TNQA 5GLZA 1S7FA 4MFPA 5JCTA 2X10A 3BYWA 1O8PA 1NCRC 3CQOA 1O5UA 3HBKA 4R4XA 4XUNA 3WHUA 4UF0A 3RNZA 1BMV1 2QQNA 4KQ7A 1SFYA 1UIJA 3V8IA 5LBEA 2P3YA 3JQWA 3OG2A 1OFNA 2WNEA 4RUHA 1JU4A 3VL9A 5BNOA 4Q4W3 5DZEA 1YHFA 3PVEA 4EFDA 4YM1A 5JXIA 2R6QA 4N43A 2VTXA 3ALQA 4WVMA 1RUC2 4R8HA 3WCRA 4E8OA 4LO4B 1LHWA 4GQ7A 3EHKA 4Q0SA 1Z7S3 3SKVA 1PZ9A 2EXIA 1TMF1 1JYVA 1IPSA 2B46X 4Y1VA 2UU8A 2WQ4A 3JBG2 1S3ZA 1TF8A 3LMSA 2XBO1 1IHMA 3ACFA 2SLIA 2LM3A 5L9BA 5JWPA 3A9LA 1J1LA 2C24A 3LEKA 5IK7A 4GA9A 5E96A 2FDKA 2Q7BA 3JRUA 1PVC3 4U36A 5F6KA 5A7WA 3WQBA 2ADDA 2PMWB 4Y26A 2JXAA 1WWZA 1W8WA 1H1IA 2CWSA 4IE4A 3JD71 2P6GA 3WC7A 4K3NA 4UCPA 5G04L 2HWF3 1S2BA 2GC1A 4SBVA 4XDOA 1Z5RA 4R9AA 3GZTB 3MIFA 5J8CA 2DDUA 2A3YA 5IVYA 1GMMA 3QOPA 1JOJA 3JD72 2DXQA 4IV1C 1W0PA 2VU9A 1JHJA 2HWB1 3LFMA 5EQUA 1ZRIA 1UO9A 4YW6A 4A4AA 3ZMOA 5J7MA 2PVVA 1XYNA 2L9LA 1XRYA 2B4BA 3A22A 5J96B 2JG8B 1AZDA 2PXJA 1VBC2 3T4HB 5I93A 1JZ4A 3VWEA 2RDQA 1OA3A 4XUPA 1YW6A 2FZ2A 2EIEA 1NLQA 4CP2A 5IVCA 2LS6A 1NCRA 4PDWA 3IZOA 2YXSA 1ND2B 5F2WA 2DEAA 5C5TA 3S6GA 2HWC1 5H9RA 5FO8B 3RZAA 4B13A 1OC1A 2FMDA 4QB9A 3JBG1 3R9FA 4QXHA 4C7HA 2YNDA 3VZMA 5CIRA 5FPBA 4CEWC 1I21A 3CJIB 2J1EA 4NIDA 4W6WA 2HWE1 1UX6A 2HBUA 1ST8A 4XZUG 2GNDA 2OKXA 1QKQA 2FCUA 2VMIA 1CPXA 3WV6A 3OEBA 3T2TA 5FP8A 2RJKA 2YFUA 5A3UA 4MHYA 3BIEA 2WSUA 3LAGA 3R4SA 2OZJA 1O3SA 5KXEA 4IESA 5FUPA 1SFPA 2X8KA 5H84A 4CYNA 5A80A 2RHPA 1FT9A 3ETQA 3VKOA 3K9TA 3HQUA 2REFA 1LOCA 3P1IA 5FPLA 2QQKA 4IQPA 5GZEA 2BERA 3SKJE 3FIXA 4NEXA 2XMLA 3R96A 5D8AA 1XJOA 2WFPA 2WR9A 2BW8A 2XEGA 1AR61 1H6YA 4OI4A 2LROA 1O7FA 1XC6A 2W39A 4A45A 4B10A 1Q8PA 1IKPA 4CA9A 2KCWA 2Y6FA 4AEJA 4IUSA 3V7ZA 1BEV1 2BTVC 2OZ6A 3KQ4B 4AK3A 2XG3A 4YG0A 2WS92 1ZZ6A 4BK5A 5I91A 3NKGA 1XE8A 5F3CA 4JTNA 2BFUL 4UCMA 2XWBB 4TLFA 1GP4A 3O12A 2OA2A 3KD4A 5F49A 2CY2A 4CDWC 4WVMB 5LZ6A 3BOPA 3WNNA 1M44A 4P45A 3I2DA 4QPYA 2V8DA 5HCHA 4LBNA 3VD3A 1H4GA 3S6HA 5FLIA 5FP3A 1VRH3 3L2HA 4FQZA 1FOD2 2X53S 3R95A 2GFQA 5CFDA 2CDPA 3O5SA 4MGSA 1H8TC 3V38A 1T6GC 4R9CA 4YNIA 4CEWA 3AMHA 4YM0A 4PSXA 1OPMA 4D7TA 4EE2A 1E5HA 3WNMA 4AAXA 3GJBA 3SQOA 4P4DA 2PHLA 2PCUA 1GWMA 4XXAA 3PVBB 3N7JA 4YSFA 1V6LA 2VUAA 5FZ6A 3ACLA 4R4ZA 2RV9A 4E8CA 2Y6GA 4ZKTB 2BEIA 5A6ZA 3KF5A 3WF2A 4OQ8A 1GHEA 1P8JA 3BN6A 1VRH2 4YGOA 1YEWA 3B7MA 3R9EA 5C33A 4YFZA 1RHI1 5KHJA 2IL4A 4YG6A 1H0BA 4AEMA 4D6QA 3KMHA 5A6YA 4H55A 1HEEA 1XNDA 1LOKA 4MFLA 3FH4A 3MEPA 2OOTA 4YM3A 4IETA 3O1UA 1RUF1 3LWUA 4HMZA 2IMOA 3DXUA 3VWDA 3J8F3 1YIPA 4Q2FA 3MIGA 2AACA 1EYBA 2P6CA 3N36A 1UXZA 3THPA 4GWJA 4E2QA 1ZREA 5L73A 3FYNA 2UYAA 5KHHA 3LGRA 4N8MA 1ENQA 3VBFA 1FATA 4M6HA 1HLCA 3ZIXA 1TZOA 1BYHA 4FVVA 3GYDA 5DS0A 1O6UA 3S30A 2BCOA 4XJ8A 5DUVA 4A38A 2WYFA 2QTWB 1OD5A 1G9DA 3GCXA 4NN0A 1QSTA 1SEFA 5SV5A 2F5IA 1DHKB 1S4CA 2QJVA 4IGQA 3IWEA 4XCBA 2AFMA 1AR83 1MZEA 3FBYA 4HPKB 3I2KA 3O1PA 1AR93 4Q27A 1TME3 3KR5A 2D6OX 3D4KA 3TN92 4OHYA 4AR2A 4MGTA 1SLIA 2WT1A 4KNCA 1YRZA 5BNOC 4E4SA 1JU3A 3TT2A 4MHDA 4XVHA 1ZZ8A 2GMEA 4I3PA 5J3UA 3ISZA 4JD6A 1K5MA 2GALA 2BZDA 4N53A 3AL6A 3UNPA 2WFF3 1UYYA 1W28A 2W95A 5A7NA 2D4OA 5FZAA 1O8SA 2WNUA 5I0CA 3BI3A 1PGL1 2PELA 4ZY2A 5AG6A 5AVAA 2VQUA 4UFMA 5C3QA 3KQXA 3A4UA 2PFWA 1R43A 2AYHA 3EB7A 4Y1YA 1CBXA 2WFF1 3KV4A 1AR92 1F57A 2YV8A 5J98B 4M0HA 5EJ1B 5ISVA 2PR1A 2WNVA 4XUTA 5K8PA 2Y26A 1CX4A 4NIIA 4JLYA 3WABA 2DV9A 1TKFA 2W0XA 2XLAA 1NLSA 1A3KA 2JEWA 1UAIA 4GD4A 5FKCA 3JD73 4KG0A 2H0BA 5HV0A 5IATA 2GNTA 4MRIA 2JB4A 4PLOA 1PIV1 2GN7A 3ZDVA 4D69A 5C4WC 3THTA 5EC4A 2GNBA 4Q4X2 4DQAA 2VNRA 4ES9A 4YYOA 4XFAA 4NE9A 5LW9A 3MDPA 4XBNA 3MGDA 2ZKNA 2ZGNA 3GZUC 4UBGA 4A6SA 4R9MA 2GH8A 2R041 1W03A 1PK6C 1RUI2 2BGOA 1V6KA 3EXUA 1VLNA 3M3EA 4AVCA 3D68A 3KHZA 3O1TA 3ZXGA 5C9AB 1RMU3 1SMVA 2Z3LA 5HVFA 4FAGA 4Q4X1 2B5GA 4BD9A 1HIXA 2XWJB 1D0HA 3RVHA 2NLRA 3D82A 3SXWA 4F8ZA 4KGGA 1WMFA 4PIYA 4UYBA 3LSDA 3T0DA 2ZGUA 1UY2A 4RSUA 3GY9A 1PNFA 5BWAB 4P9WA 3LIHA 3J7LA 1WBFA 4UWDA 4A30A 2BOJA 2W92A 4KWLA 5FZKA 5GLVA 5LK7B 3OGGA 4P9IA 3WINE 4H89A 4L89A 3TEZA 1OVPA 3PUQA 2JBKA 5C8CB 1NA1A 1Z78A 2DWRA 2W91A 5A33B 4AXOA 2DF5A 3UETA 1RUD3 4S2HA 1ZG9A 2XEJA 4XIOA 4Q0PA 3WQ7A 2WO7A 4UIBA 4K7JA 4UW6A 4WVZA 4Z65A 1YQ8A 3WC6A 2XLFA 2RE9A 3DECA 4QVTA 5GZFA 1QSRA 1R3NA 1ZYBA 1VGYA 4ITCA 3VBSC 2VEZA 3ECQA 2RS12 2WNUC 1W9YA 3IBMA 3NNLA 2A70A 2VUJA 3DN7A 4IHMA 4ZI6A 2BU9A 3HN3A 2V4AA 4ASKA 2ARHA 1OSGA 3FX3A 1JW6A 3LPFA 3TOAA 3QAYA 3WP4A 1QXJA 2Z4FA 4EYUA 1PX3A 3HOBA 4MGZE 3V0BB 3NKTA 4QKNA 4UFXA 3FHQA 4Y5Z0 4XQ4A 3RI8A 1VBA3 4O65A 3VBHB 5CKQA 4NHKA 2GREA 1IIDA 2FCKA 1BPMA 2E7AA 2Q44A 4UWJA 4YU9A 4URAA 1AR73 1HV1A 2QE3A 4YVWB 4OHWA 1YX0A 1WCDJ 2QQVA 5IFTA 5KHGA 3O7OA 2AFZA 1NYWA 4PHZA 3NJZA 3LB9A 1XRUA 5FPZA 1KD7A 2TBVA 2RR12 3NJXA 4LBMA 2VZYA 4Q29A 4CU7A 3IC1A 1AR63 3WD5A 1SQHA 1BHGA 3RQ0A 2X5IA 4BWOA 4XXPA 1FNZA 1HRV2 3KV9A 4AFAA 4WJBA 1ZBE3 4B1LA 2HWC2 3TEYA 3BHXA 1M4WA 4TZDA 1SBEA 1FV2A 3CXSA 5ANQA 5FXZA 4OIWA 1N3PA 1DGRN 2HEVF 4CCKA 3IMNA 4P4FA 2DFBA 4LO7A 3WVJA 5KTCA 3RRDA 1W6NA 4OUMA 1AYN2 4AHXA 1R083 1UW8A 3J7HA 3NJYA 4LE3A 2WNOA 3T08A 5IAVA 4B29A 4B7KA 2CXAA 1SACA 5FTTC 1CJDA 2YGLA 2R98A 4PT6A 3MF9A 4LLFA 1FI2A 5AVPA 1GSLA 4BBHA 1URXA 4UW5A 4FQ4A 3ME2A 4K9SA 2JG8C 2Q8CA 3RI9A 2IQ6A 2V8HA 4YGCA 5FLJA 3O1RA 4HVOA 4JKMA 3H7JA 1HX6A 2Z3PA 1LGBA 4NJ4A 3WC5A 1VAKA 3PIGA 3OGVA 5A7PA 3VKFC 3D3SA 4RHV1 2VD7A 5K9YA 4TYSA 2PIYA 2DTYA 3OCPA 3WT3A 3W58A 2ERFA 4IEWA 1Z4RA 2VOVA 5KXDA 4PV6A 5C8CC 3UY5A 3U4XA 3LIGA 4XPDC 1MVQA 1NOVA 1LNSA 1V9U2 3WG2A 4DYOA 3OPZA 3WNLA 2WAOA 4Y5SA 2BSWA 5LA0A 3H42B 2VQTA 5GLUA 2PTMA 4E4ZA 2RG4A 5FK8A 1RL3A 3AMPA 2D3RA 4DEVA 3SH3A 1XSQA 3PZJA 5I4MA 1MEC2 2BBAA 2Y0IA 1N47A 3M7AA 2B3UA 1W2OA 1W9TA 5FZFA 3U10A 2A6XA 1BLZA 2WS91 1U5YA 1IQDC 1XE0A 2R073 2UWAA 3SH4A 3ZXLA 1MS9A 5APAA 1QWRA 5JSPA 3K51A 1Z7S2 1OF4A 3EJKA 1KUYA 4M3CE 4Q38A 2ET1A 5AG7A 1RUD1 3IT8A 4UBHA 4O61A 1REDA 2G19A 5LATA 4KOYA 1DCSA 4CZSA 1NZIA 1XE7A 1PGL2 1FNYA 4IV3A 2XLGA 5JPNB 2A3XA 1Y0RA 2VL1A 1WK4A 3DV8A 5KC5A 3DDDA 3U07A 4FXGB 2C9AA 4BMEA 3WW4A 1D2QA 3J4UH 1RUOA 2I79A 1NY71 3GALA 5D8AB 2RMU1 2XPJA 1H6XA 4M01A 1KDKA 4FPYA 4INDA 2NSMA 1DE4C 2BV4A 2PJ1A 1CM0A 3ZDSA 1ZA7A 1Q8OA 1TEIA 5DUUA 1N3OA 4WM7B 4A3XA 1SPPB 1U0AA 3DYOA 1SFNA 2Q4VA 1KFUL 1NKGA 4CPBD 4X5KA 2ZEXA 3R05A 5F3EA 3TN91 3DKQA 4MXUA 3VBRA 1ZBA3 4PDWC 4Q4Y2 1GOHA 4L9BA 5BNOB 5J36A 1SCRA 2ZOGA 5J8FA 3I97A 4RA0A 1ZBE1 2WJSA 2QECA 5FLHA 1J4JA 3CMGA 2HB6A 4MYEA 3CNAA 3S7IA 5T5OA 2Q1FA 2ZHMA 2Q30A 3I54A 3AYCA 1LULA 4Q4W1 4BQYA 2FS5A 5FCCA 4QGMA 3KT4A 4A3ZA 1SG3A 2XOMA 4XABA 3WLUA 4C0BA 1CJWA 3C3VA 3EBRA 5T52A 2R1IA 2EIDA 2IZWA 4PIZA 5HCBA 4KZTA 2PJ4A 2NQYA 3QD6A 3PTRB 1NXD1 1LR5A 3MIEA 4IE6A 4CCDA 1KUVA 5LWBA 2FSRA 2VNGA 3VD9A 2VZRA 3AP5A 5G05L 5E88A 4CXXA 5HH1A 3E97A 4RGAA 4X8NA 4A94A 2EVXA 3D0JA 3H1WA 4J1WA 3I2HA 5FMOL 4BIOA 2VZVA 2QJ8A 1KJRA 3ZXDA 4AI3A 2ZX2A 1NE4A 1QXPA 2I45A 5LASA 4NF1A 2XJTA 3NH8A 1H8TA 1CIYA 3WF0A 5CFDC 1IPKA 1RINA 2R30A 2W1SA 5BNQA 5CFCC 4A37A 1KFXL 1PM4A 3K2OA 1W6MA 5C3SA 1FOD1 2FD8A 2Z3MA 3OBAA 1W8TA 1PZ8A 4GMP1 4LKFA 4AHYA 3KVAA 4E27A 1JYNA 1EAH2 4RHV3 5DABA 2ZTNA 1LAPA 3KQZA 1N1TA 3V64A 2OQ6A 3CL1A 1OKQA 1ULCA 4CDWA 1W8HA 1JTZX 5CISA 5KHIA 5KXCA 4E4HA 3N4MA 2OB0A 4JHTA 3T0AA 2BL1A 2PJ0A 4CDQB 4FPHA 4P02B 2P4EA 3DR6A 1CVNA 2ZABA 4GH4C 4HLTA 1W99A 1UWYA 3A21A 4GWNA 3RZZA 4LBOA 3VZJA 3O1VA 1U6MA 2Z3NA 3SXOA 5L7OB 1IG0A 2ES3A 1RUF2 2IFWA 2QBXA 4DUVA 5FR3A 4KLWA 1UY1A 2DVBA 2J1AA 4RR3B 3ZFEB 4M85A 4WBBA 4BK4A 1UFHA 2JDDA 5IB9A 4DINB 2E7TA 2VQYA 4Q4V2 5JVVA 5IVFA 3MBWA 3C7EA 4FOVA 4F0YA 1S7NA 5CA6A 1ULEA 4ZXEA 2AEYA 2WZEA 1C3HA 1R093 4AHWA 1YC61 5B2GB 3VDBA 1JUIA 1UZVA 2AGSA 2D44A 3N9QA 4N53B 4WM7A 5HI0A 3R4DB 5IK5A 1DTDA 4QU2A 1GQPA 3D3AA 2CAVA 2BYVE 3TEWA 2OUHA 3PEIA 4JXRA 4Y4RA 2WNUB 2W08A 4PBPA 4Y24A 4LK6A 5DWMA 4QGNA 2XVKA 1WA4A 1VRBA 3BU0A 4OIDA 5DMYA 3I59A 3ASIA 1AXZA 1W6QB 3D6EA 3HAGA 3TB0A 1Y9KA 2XEIA 1VBA1 4HZFA 5AC91 1I1DA 1W2UA 6CPAA 3ZSMA 5GZDA 5JR2A 2K2SA 2WYSA 3DKWA 4EWAA 2WSVA 1S60A 4HNYB 4A41A 2JE7A 3IPVA
chains in the Genus database with same CATH topology
4Q4Y3 4JGZC 4BIFA 2RS51 1CAWA 3A0NA 4BLJA 1J1TA 4C1XA 1I5ZA 1GV9A 2O0OA 3WP3A 4FD6A 4K20A 1LESA 1GZWA 3CU7A 5FREA 4MFZA 2WWSA 2DVDA 3WQ1A 4BMHA 2B58A 5T5JA 3OWCA 4OAEA 1HRI2 4DY5A 2JKBA 3VZKA 4HANA 4XE9A 1YI9A 2WPXA 3TCVA 2ZGOA 1YLLA 1UZYA 4JGYB 4XF1A 3R4UA 1ASJ1 2B8MA 1FMD3 4Q1RA 4Q8LA 4A7ZA 1N71A 3MFAA 5FDBA 3AX4A 4DS0A 1H8TB 3AZVA 4HKFA 2R042 5JZGA 2G4IA 1RUI3 4LBQB 4NHLA 2Z2SB 4FBFA 1NCQC 2Q04A 2VOWA 4YW1A 1MS1A 2ZX4A 3B3QE 1PIV2 5FRAA 4XDQA 5JQ4A 4LT5A 4KG8A 1P0HA 1DQ0A 2VVEA 4MBUA 4FPCA 2ARBA 3AP4A 1OQDA 4LBLA 4AVTA 1G6NA 4XTPA 2UWBA 2ET7A 1IB1E 1ALYA 2IFRA 4R57A 4XNHC 2RS32 4LBKA 4R3KA 3ZSEA 2ZMNA 1KQRA 1RHI3 3VKLA 2BFUS 3N35A 3NWKA 1QJU2 1RUJ2 2FZ1A 3H50A 5C8WA 3ZXKA 4HKWA 2GIVA 4RR3A 3RMXA 4CAEA 2D6MA 3VBSB 3IDEA 1YK3A 1CAXB 2XJUA 1ZA4A 1O4YA 4HFSA 4XJ9A 1UU6A 4XBQA 4GMP3 3ZFEC 3VHNA 3WY6A 4JXQA 4UW3A 4B7EA 1R082 4EN6B