4OLLA

Camp-binding acyltransferase from mycobacterium smegmatis
Total Genus 86
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
86
sequence length
333
structure length
316
Chain Sequence
VAELTEVRAADLAALEFFTGCRPSALEPLATQLRPLKAEPGQVLIRQGDPALTFMLIESGRVQVSHAVADGPPIVLDIELIIGEIALLRDAPRTATVVAAEPVIGWVGDRDAFDTILHLPGMFDRLVRIARQRLAAFITPIPVQVRTGEWFYLRPVLPGDVERTYRRFQSVRKPTRALLEYLFEVDYADHFVWVMTEGALGPVIADARFVREGHNATMAEVAFTVGDDYQGRGIGSFLMGALIVSANYVGVQRFNARVLTDNMAMRKIMDRLGAVWVREVVMTEVDVPPVDTVPFEPELIDQIRDATRKVIRAVSQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Acetyltransferase Pat
publication title Allostery and Conformational Dynamics in cAMP-binding Acyltransferases.
pubmed doi rcsb
source organism Mycobacterium smegmatis
molecule tags Transferase
total genus 86
structure length 316
sequence length 333
ec nomenclature ec 2.3.1.-:
pdb deposition date 2014-01-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00027 cNMP_binding Cyclic nucleotide-binding domain
A PF13302 Acetyltransf_3 Acetyltransferase (GNAT) domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.10 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 4ollA01
3.40.630.30 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Aminopeptidase 4ollA02
2J8NA 4AQ2A 4LEJA 1YVKA 5JCTA 5K8SA 1H1MA 5JSPA 3LD2A 5F49A 3ELNA 4NVPA 2OZ6A 3BALA 4YYOA 4R3LA 4Q29A 2B4DA 3OWCA 4CRYB 4ZU5A 3I54A 3BPZA 3QOPA 4EWDA 1QSMA 1ZZBA 4I01A 4MY3A 1RL3A 1CAXA 2XLGA 5I93A 1YLLA 1YLEA 3SHPA 4AG7A 5F47A 3G8WA 3IIAA 2I79A 2BEIA 1IB1E 1U12A 4NSQA 4J1WA 3H1YA 4XF9A 1CAWB 1CAVB 1Q5OA 3SHRA 5HMNA 3GBFA 1O3RA 3FHIB 5H86A 3CJXA 4R57A 4U5YA 5GCNA 2O1QA 1J59A 3QAHA 4U9ZA 4CAVA 3ES1A 4RS2A 3EJKA 4E2AA 2ATRA 3EC4A 3EO6A 3OGJA 2GAUA 1LR5A 3FJSA 5EBVA 4HNWB 4MGYE 4H7LA 1I21A 1P4NA 1S7FA 2HV2A 2ETEA 3ST7A 2J8MA 2VI7A 3HIFA 1QSTA 2QMLA 4XNHB 3D82A 1R57A 2IL4A 2REEA 4KVME 4I0BA 3H4QA 3H1WA 2ZW6A 4MBUA 4N9HA 1DZTA 2HKXA 2IXHA 4KUBA 1OI6A 3R9FA 1RGSA 5BY5A 1Y9KA 2BNMA 2VQYA 3IDCB 1YR0A 3N7ZA 1O3SA 2E9QA 2F4PA 2IXJA 3ZJ0A 2BGCA 1YREA 5I0SA 2XL9A 4ZBGA 1PU9A 3L2HA 3PVBB 5FLHA 1I5ZA 1ZRRA 3FX3A 4IEQA 1RUNA 2JDDA 3WW4A 2XLAA 5BPXA 4JV4A 1GHEA 1UW8A 4K30A 4OLLA 3SCFA 3I9SA 2WPWA 3S0MA 2KXLA 4XNHC 4NF1A 3SMHA 4XPKA 3LA2A 2HUZA 3CF6E 1CM0A 4UBRA 4QGNA 4M3SA 1LKNA 5EC4A 4GS4A 1QSRA 4KOUA 5I8YA 2V09A 2ARHA 1UPIA 4I0AA 2Z11A 2VECA 1YK3A 1RTVA 5KBFA 4J1XA 1NE9A 2OZJA 4KOTA 5C88A 3HT2A 2PC1A 1WGPA 2EVNA 1YUDA 3D0SA 4CAXA 4UWIA 2PR8A 4R87A 1ZVFA 5CU1A 4MJ8A 2XL7A 3S6HA 2REFA 4IETA 1ZRFA 4QGMA 1MJBA 3S7EA 1WLTA 3TO9A 3JUWA 3R96A 4B5PB 1LRHA 4JLYA 4IERA 1UD1A 3NW4A 4JTOA 2D5HA 2B5GA 3ES4A 5D1IA 4UXAA 1NE4A 5I0UA 2PDOA 4JWPA 1B6BA 1Z4RA 2HQYA 4QXKA 2B58A 4BH9A 4HNXB 1M44A 2Q44A 5BXXA 5JAXA 4TLFA 5E16A 4DNCA 2GC1A 3NVCA 4HMZA 3SCGA 1ZRDA 3FIXA 4NXYA 3D0JA 1FT9A 3SXNA 2CY2A 2VQAA 4CAWA 1Q2DA 3H3ZA 5FPXA 4P9GA 4KLVA 2PAEA 2QCSB 2FXFA 4META 1S60A 2P0WA 4I02A 5DWNA 3S6FA 4LULA 1CJWA 4MGKE 3I59B 4Q0UA 4E2SA 1L0CA 2FSRA 4FD4A 3E97A 5FVJA 2H6CA 1B87A 3R9EA 3ETQA 2PRBA 5H84A 3ZDSA 3DDDA 4KWKA 2XHKA 2QECA 3FFQA 3PNAA 3ACLA 4LUKA 4HLTA 3FZ3A 1YVOA 1O4TA 4XF4A 4EROA 1GQHA 4R52A 1S7LA 3KMHA 4PSXA 4F6AA 2GZWA 4EWAA 1CAUB 2X7BA 3D2MA 5JQ4A 4UBGA 5I91A 5FLIA 2FQPA 3S7IA 3CXQA 1S5KA 2D5FA 1OZPA 4X6RB 2BYVE 1M4GA 2ZPAA 2UY9A 1ON0A 1OD5A 1XEBA 1LRZA 4XPLA 3TT2A 1XIXA 5EZWA 1S7KA 1O5LA 4O9EA 2PTMA 3O14A 4IEOA 1X8MA 4XFFA 1CAWA 1CAVA 4XFHA 2DXQA 2ATFA 3PZJA 3W6XA 4XF0A 2XGXA 2Q30A 5LRRA 1ZZ8A 4F7ZA 3LAGA 1N71A 2IXCA 5AVPA 1ZRCA 3V8IA 2G3AA 4I3PA 5CADA 4KWLA 5T3NA 1X7NA 2FIWA 3LWCA 3E5UA 4KU8A 1FI2A 3OTFA 3TO7A 3GKRA 1YHFA 2N7GA 3SXOA 1VP6A 2XKOA 2D93A 4BIFA 4KOYA 4Y49B 3U11A 1WWZA 5F46A 4B29A 4Q0QA 1ZX5A 2ET1A 3BJ7A 4QVTA 1YFYA 2FS5A 1KUYA 1I6XA 3QB8A 2C0ZA 2H5MA 3OCPA 4XF1A 1YFWA 4KOSA 5F48A 1DGRA 4EV0A 1PUAA 3UKTA 2D4PA 4R3KA 4HZFA 4OADA 4LLOA 3CO2A 2BSWA 4PIXA 1YFUA 2MPFA 3HT1A 1X8EA 1IYLA 4CS0B 2PR1A 3RNSA 4Z07A 3DKWA 3R95A 2AE6A 4FD7A 4UA3A 3TCVA 1NXMA 1IIDA 2PA7A 2BNOA 2PQ8A 4YGOA 1IPJA 4JVAA 1RO5A 1Q2YA 3UKVA 5I0CA 3WW2A 4KOXA 4OAEA 3CL1A 1UIJA 4IEPA 1KUVA 4QUSA 4Y49C 2CAUA 2A4NA 2OU2A 5HI0A 4R9MA 2K5TA 4QBJA 5JR7B 4XEZA 2I00A 3M3IA 3EFAA 3BB6A 4JTNA 5KTDA 2J8RA 3CEWA 4ZU7A 3TNPB 2CNTA 4FD6A 4MGZE 3LODA 2ET7A 3LZZA 4XETA 3FYNA 3IWGA 3TFYA 1DGWA 3FWEA 2Q7BA 3F5BA 3D2PA 2DCTA 1UFHA 2VPVA 4KUAA 3TO6A 1XE8A 2EVXA 2ZKLA 4MV2A 2FT0A 2ZW7A 4KL1A 1XRUA 1VHSA 3E0KA 4QB9A 4UWJA 1J1LA 1RXTA 1VJ2A 3BCWA 4JXRA 4KOVA 1VKCA 1ZZ9A 4PSWA 3W91A 2ZW4A 3TOAA 2UY8A 4HNYB 4L89A 3VHRA 2EUIA 5E96A 1YFXA 4XFIA 5FQ0B 4QGLA 1DZRA 3BJ8A 2Z0ZA 4AVAA 2FL4A 4LTAA 4E2QA 1QY4A 1UCXA 4F8AA 4I09A 2IXLA 5LRSA 2BEOA 2Q04A 1FXZA 1UIKA 4Q0SA 3D3SA 2IXIA 1JUHA 2PAMA 3CXPA 4KORA 5DWMA 1L3JA 3N4MA 4B5PA 2EAAA 2P17A 4B5OA 4RD7A 1Y7RA 3DR6A 3F0AA 4PK3A 4XPDB 5KHJA 1KUXA 4MY0A 3TTHA 4HSLA 3K9UA 3FXTA 2XLFA 4Z82A 4AB7A 3DN7A 2OPKA 2RC4A 3P2FA 2H6BA 4IEUA 1EP0A 2CV6A 1M4DA 4FBFA 3PP9A 3EY5A 3C3VA 1NSLA 3DR8A 5FDBA 3E6BA 3H7YA 1J3PA 4IEWA 4WBBA 5J7MA 4KOWA 4QMAA 1PMIA 1BO4A 2IXKA 2CAVA 4CRZB 3VWEA 3QACA 1Y3TA 1QSOA 3KGLA 3H9AA 3TE4A 3I59A 2PSWA 4WVZA 5HH1A 3RYPA 4XFAA 4KZTA 5BV6A 2PHLA 3MYXA 3MPBA 4GULA 4YARA 1XMTA 3IWZA 4E8OA 4QM8A 2BNNA 1BOBA 1IYKA 5CNPA 2QVSB 3NKTA 2O28A 4EWEA 4XPDC 2R7HA 1MK4A 1CAUA 3UY5A 1X82A 1MJ9A 5I0TA 4L2NA 2VZZA 4HSJA 2OYZA 4YFJA 4MI4A 2O8QA 4MHDA 3GYDA 3SCHA 3IGRA 1VR3A 3RDIA 4K8FA 3T90A 4IESA 3VWDA 4IEYA 2G3TA 2Q0AA 2OZUA 2OZGA 2PQQA 1I1DA 2ZXVA 3EO4A 1O3TA 5IX3A 2FMYA 5LEKA 2B4BA 2VEZA 3KCCA 5I0RA 1TIQA 2B5HA 1H1IA 2Y0OA 4OFGA 4E0AA 1ZZ7A 5I8SA 1J3RA 2UYBA 4X6QB 4QM9A 3CLPA 4HVRA 2Z2SB 3FE5A 5FLJA 4XFBA 3GYAA 3B02A 5EFUA 3FB3A 2C27A 1NYWA 5LEJA 2G0BA 3ZZIA 4AVCA 3KGZA 4AXOA 4R8HA 1YX0A 5I8TA 4HVOA 5CVRA 2PFWA 2Z10A 2Q1ZB 3LOIA 1O7FA 2FE7A 4KLWA 2B3UA 2B4DB 2D4OA 3TOBA 2Q4SA 4II9A 4LUAA 3H50A 5E1RA 3M70A 4YSFA 4IF5A 1CAXB 3ROUA 3R6SA 4AVBA 4E2GA 3DL3A 3EXNA 2VZYA 4PK2A 4PIYA 4ORFA 5C6CA 2R1IA 4NCZA 5KHGA 4Q0PA 1WA4A 1Y9QA 2K9ZA 3UKNA 1ZZCA 4DINB 2OZHA 4Q0VA 3PGPA 3NSTA 4HKFA 4IEZA 1J4JA 4I2OA 4JXQA 5J48A 1TQ5A 4H6UA 1QSNA 2GU9A 2BUEA 4ONUA 4L8AA 2WPXA 2R98A 1QXJA 4RI1A 2MNGA 1M4IA 4PV6A 4PJYA 5KTCA 2PAKA 2Q4YA 3G3SA 5IB0A 3KKWA 4AG9A 1Q43A 4FAHA 1ZZ6A 3RYKA 4YRHA 3KSCA 3H8UA 3HQXA 1PM7A 5KHKA 1M1DA 4HVQA 3EBRA 2GH2A 4HN0A 1IICA 3FRMA 1K4JA 1SQ4A 2GIVA 1RC6A 5FCCA 2PYTA 3WR7A 2CGPA 4FD5A 2WC2A 1OFNA 1YGHA 3I3GA 1EY2A 1O5UA 2HJIA 3U10A 3E5XA 4HBNA 2QIRA 1RUOA 3NL1A 4D7TA 4M85A 1Y9WA 1Z9UA 2QNKA 5KHIA 1NE6A 4FAGA 3S6GA 2AJ6A 3JZVA 3RPQA 1Q3EA 5FQ0A 2ZCWA 2NMTA 4PIZA 3H1MA 1CGPA 4HN1A 2OA2A 5IV0A 5ISVA 4KU7A 4LA2A 3MGDA 4MGIE 2B3VA 2Y0MA 4YNIA 1SEFA 3H7JA 3S6KA 1O3QA 4BYYA 2JLMA 2ZW5A 2VXKA 4H89A 4IUSA 2VBQA 2Z69A 1V0CA 4KVXA 2P6FA 5J8CA 1FY7A 5JSRA 1SQHA 3CXSA 4LX9A 1CX4A 1HW5A 4U9YA 5JPHA 3LA7A 2P6GA 2JDCA 1SFNA 2B8MA 2BL1A 3T9YA 4EVYA 1S3ZA 4QC6A 2UYAA 4IEXA 3B8GA 2D40A 2IC1A 3E5QA 3I7DA 3TNQA 1ZREA 4BMHA 3BLNA 4FT8A 5JSOA 2GC0A 2GC2A 3G7DA 4N9IA 3RZZA 3R1KA 4X5KA 4F0YA 5J3UA 3LA3A 4KWJA 3P2HA 3SXWA 4H6ZA 1KZFA 4YRDA 4A2UA 2PHDA 4CYDA 2FIAA 5KTAA 3OF1A 3DSBA 1MJAA 3DV8A 4XFGA 3EQEA 5C8WA 1XE7A 2QDRA 1NMTA 3FNCA 4LUMA 5F1RA 2OB0A 3JVNA 4O9GA 1EYBA 4JJXA 3MDPA 2JEVA 4IEVA 3U0ZA 2Q0YA 2R8VA 2K0GA 2Q4VA 2I45A 3WW1A 4MH0E 2XKPA 1GQGA 2F5IA 4WZCA 1G6NA 1ZNPA 3C26A 5BUVA 2B5GB 3WW3A 1Q2CA 3EHKA 4UBHA 2OH1A 1P0HA 1XE4A 2B9UA 4MZUA 1U6MA 4XFCA 5KHHA 3E6CC 5C82A 1LB2A 3USSA 3NE7A 1J3QA 3E6DA 2CNMA 4AQ6A 4LA3A 4KVOE 3NJZA 3RYOA 1IPKA 1QWRA 3BU7A 3F8KA 3OD0A 4I49A 2GE3A 3RYRA 1NZCA 4J3GA 3FBUA 1Z4EA 3PLQA 1I12A 4BHPA 2KCWA 2FCKA 1EPZA 1J58A 3R9GA 2QJVA 4NEXA 4XF3A 2EA7A 4L11A 1S7NA 2MHFA 3W6SA 4MX3A 5FPZA 2CNSA 4D7SA 4MUVA 4ZU4A 1XF8A 4JD6A 5J8FA 2GANA 1WK4A 1QXRA 2P6EA 2H0VA 3MZHA 3D8PA 2GC3A 3DNSA 4QX5A 3GY9A 3IBMA 1V70A 1OMIA 2WFPA 1YWKA 3H3UA 3IDBB
chains in the Genus database with same CATH superfamily
5IYYA 2POKA 3BI0A 4R4ZA 4R3LA 2W2IA 1FV3A 5AGEA 1Z78A 2A6XA 1UOBA 4P9LA 3AYEA 4AFDA 1QJEA 4LQGA 1GZWA 2XWBB 2W94A 1EAH1 2WNVC 3BTAA 4OUSA 2D6OX 4FPEA 1F35A 4UIAA 1VAMA 4KVME 3W20A 4XQDA 1R1A3 1K5MA 3KGQA 4YW1A 1RIRA 4N53A 1GZCA 3L2HA 4ZXKA 3FX3A 1RUNA 3ZFGB 2XLAA 1VBA3 3AJYA 3M7AA 5A33B 1W2AX 2IUWA 4CCEA 4M3SA 2AACA 1JODA 4M6GA 4A2ZA 1PGL1 2V8DA 4KOTA 5FPAA 3I2GA 2YNDA 3IM0A 2D5HA 1ARLA 3T1LA 1W8UA 1SLIA 4XDQA 1ZLHA 4JGZA 2UWAA 2BFUL 2WAAA 3VB9A 1IQDC 4PXCA 4XTMA 1NY72 4WVMA 1AYM2 4ASLA 4UCMA 3RVHA 2H6CA 4XHXA 3DDDA 3FFQA 5FBZA 2PIYA 2ZHLA 1QF3A 1MEC1 3VD5A 2B42B 4OZOA 1AR62 1M4GA 3B3TA 3OEBA 4MGTA 3NV1A 3O12A 2DXQA 3PZJA 2Q30A 3C7GA 2IXCA 4B13A 1SACA 3WDUA 3PIJA 1T6BX 3T1MA 2ET1A 1CPXA 1RUC1 1IQAA 3OYWA 2WJSA 3ZYBA 4M3CB 4UW5A 5F5QA 4PXBA 3SLIA 1ULFA 1UO9A 2PJ5A 4AL9A 4GJYA 3FH4A 2KA3A 3MBWA 4LO7A 3CEWA 4Q2FA 3RRDA 1ACCA 2RG4A 5A7PA 4CDXC 3B35A 2QQOA 4HNYB 4CEYC 1YFXA 4BE3A 2EO8A 4ATFA 3ACHA 4YW2A 2ZA9A 4Z92B 4JHZA 4UW6A 4QKNA 4COVA 4JQRA 4C0HA 4IXLA 1KUXA 3BI1A 3TTHA 1RUF3 1K5MC 2OPKA 3FLTA 2DVFA 3W21A 2PSWA 4UFLA 3HN1A 3MYXA 2DPTA 3MIFA 2CYFA 1LAPA 3DEMA 1XMBA 1KGYA 1OBNA 2BWAA 4OHZA 4HANA 5ABJB 2RS32 4UFJA 5FUNA 2VVEA 1CZTA 1QMJA 2RR11 3AZZA 4ITCA 3RFRA 2G3TA 2XMLA 5JPNB 1ZZ7A 1LESA 2NYYA 5JUVA 4AVCA 3J9SA 4K3NA 2AC1A 4R8HA 5FP7A 1AR91 4XCAA 4BB3A 2Q1ZB 1W8NA 4JGZC 3RZLA 2BERA 2RM21 1QJU3 2EIBA 2YNCC 5KHGA 4HOOA 3K3OA 3QBQA 3VUOA 1HDUA 1ASJ3 5FKCA 2YFZA 4L99A 2GU9A 1UZ0A 2WPXA 2NYQA 3INAA 5FYCA 3T30A 2HWB1 1JYWA 3FRMA 5IVBA 1SQ4A 2O0OA 2QIRA 4D7TA 4M85A 1Z9UA 1RUJ2 5C4WA 3UGFA 3FMCA 4HN1A 3GHNA 4KU7A 2GN3A 4A7YA 2JLMA 1P8JA 4LPLA 1E57A 3N9NA 1FNZA 1VBC1 1UMIA 4EVYA 4LHKA 4XABA 5HVFA 4N43C 5J3UA 1X12A 2JKBA 5J98B 3F95A 5KTAA 2J1VA 2ZGSA 1XQNA 2Q8DA 1DTDA 4BINA 2F5IA 5BUVA 4MFKA 1W9FA 3WNNA 2ZOEB 1JZ4A 4CEWB 2FDIA 3F8KA 1EAH2 4YLZA 1JZ6A 3VZKA 4JHTA 5F32A 4J3GA 2VZPA 4GB31 2QJVA 3D68A 2PJ9A 2EA7A 4EFDA 1WMDA 5FPZA 4ZU4A 3K51A 3S30A 2CTBA 2H0VA 4E8CA 4B11A 1HV1A 5JM6A 4AQSA 5HV0A 5K8SA 5F49A 2HB6A 1POV0 1KDKA 2B4DA 3K2OA 3P6BA 4RGGA 5F3IA 5ISLA 5FUPA 4QX7A 4RA0A 2LM3A 4Y20A 1TVGA 3AZYA 5A3LA 3ZFEB 2DPSA 1PGL2 5L7OB 4UF0A 3EB7A 1YIFA 2J8MA 1Z5RA 2PMWB 3D82A 2VOWA 3DGTA 4LBNA 3A23A 4CUBA 2A3YA 1X50A 3UV9A 2NSMA 1LEMA 2E9QA 2ZJCA 1KRIA 4AVTA 4CDWA 1PU9A 3TAYA 2ARBA 5CFDB 4DQAA 4K30A 1RHI1 2VXRA 4XPKA 2V09A 3DYMA 4I0AA 2VECA 2OZJA 4HXCA 3BPSA 4P6YA 5AG5A 5A7QA 3WT4A 1AF9A 4IETA 1ND3B 2K46A 3GZEA 4IERA 3I2DA 4Q26A 4UEEA 1C8M3 1A34A 4DNCA 1PGSA 4Q27A 1FT9A 4NMIA 3H3ZA 4P9GA 5DWNA 2VM9A 1FPN3 4AYUA 3T2QA 3SKVA 1H2KA 3T2OA 3KCYA 2ZPAA 1XEBA 1NUKA 2YGLA 2VW2A 4ATEA 1OLQA 3ILRA 4IV3B 5FO8B 4XF0A 4F7ZA 3AZXA 3V8IA 3VBFB 1PNGA 4RR3B 1Z8XA 2J1EA 3ZR6A 1LHVA 1MZ6A 2C1FA 5BNPA 4RHV1 2HBTA 4GJZA 5M0TA 2C0ZA 2BGOA 3QB8A 3VKOA 3CO2A 1O6UA 4YU9A 4Q4Y3 1MS0A 5GLVA 2GNMA 3TCVA 3B3WA 5LA1A 1XBFA 4CDUC 3M1HA 2VZVA 5KTDA 1ALYA 4Y24A 4LIUA 4GH4C 2VY0A 1BZWA 4DB5A 3CDXA 3IJ3A 2EUIA 4XFIA 1OLMA 2DF5A 4ZKTB 1W6MA 2RR12 2DUOA 2FDGA 1JHNA 4LE4A 1X10A 3AFGA 1G9DA 3EY5A 3C3VA 3TB0A 1LODA 2C6SA 2WN2A 3H7YA 2PLV3 1PMIA 4CDWC 3ZO0B 3VWEA 4M4RA 1VAVA 2OQ7A 4WVZA 3ZXLA 3KF3A 1BOBA 3W5NA 2EIEA 2RM22 2XOMA 2O28A 1OPMA 4XPDC 4YWAA 4Y1YA 1PK6B 4G1PA 5JOWA 4FTEA 3UJOA 4YGBA 4E4HA 2EXKA 1J84A 3PB6X 1FX5A 1UY1A 5J1QA 1W03A 4C90A 1GU3A 4XW3A 4HVRA 2Z2SB 1D4VB 3WZ1A 5CVRA 3A22A 2FE7A 4KLWA 2B3UA 3H50A 2XJSA 3LGRA 5DDJ3 3BOWA 4JX0A 1VBC2 4FPOB 3UKNA 4ZX9A 5CZKA 2BUEA 1X9PA 4L8AA 4Y22A 2A75A 2PJCA 1UOJA 2FZ1A 2GH2A 1RC6A 2HH9A 4QPIA 3WR7A 1XFOA 1O5UA 1YXWA 1UMZA 1KXGA 4BK4A 2QNKA 4NRPA 3MIDA 3CDZB 1GOHA 2JG8A 1VB2A 5D21A 5BNPC 2VBQA 2X5IA 1VBE1 5J8CA 3CXSA 3V0BA 5GZDA 2BZDA 2Y6GA 1POV1 2VR4A 3RZZA 4H6ZA 2AYHA 4D6RA 1GQPA 2WS91 4ZXEA 3VARA 5EV7A 4JJXA 2UU8A 1DYPA 3NNFA 1IG3A 1PIV3 1ZNPA 2QQIA 4LOTA 2VZQA 3HLPA 8CPAA 1LB2A 5FTTC 3E6DA 3C7OA 4LA3A 2LS6A 1QWRA 1TE1B 1LECA 3ME2A 4CDQB 3R9GA 1H8TB 4AAPA 2GP3A 1PZ9A 1PM4A 2R073 5FP8A 2WFPA 1UYPA 2QZ2A 3B00A 4F3JA 5JCTA 1H1MA 4NPRA 3TX8A 4LBQA 2YGMA 4INDA 4MY3A 2ADDA 1CAXA 3KQZA 4W65A 3WC5A 1RHI2 5HMNA 4U36A 4RQPC 1X9TA 4E2AA 2ATRA 2PJ7A 3OGJA 2TBVA 5LBEA 4YVWB 4NJQA 3WHTA 4HNWB 1JU3A 5FYTA 5K8PA 3HIFA 4JAAA 1UPSA 3TC8A 4QT6A 1OI6A 5LASA 2B46X 2HWF1 2RMU3 4DY5A 1PO13 3N7ZA 2JDMA 3I2KA 5G1ZA 1I5ZA 3VDDC 1BK1A 2E31A 3B5LB 4YZ1A 5FY8A 4B7KA 1YI9A 1YQ8A 3S0MA 3UETA 4AGGA 4WV8A 2W5FA 4CRQA 1VMFA 2LTNA 2W9XA 1MVQA 4FQ4A 3WC6A 4MHNA 3PDQA 3HPNA 2Z11A 4MCQA 3BUCA 2XL7A 3RZGA 1ULCA 4UEFA 4F9VA 3S7EA 3TO9A 2P1BA 5FPBA 4JTOA 3LDRA 3ES4A 4QPIC 2ZGKA 1QOSA 2RS11 3FIXA 3Q8FA 2F6BA 1V6MA 4KLVA 4HKWA 3ZX7A 4Q7AA 4LULA 4RHV2 4HFSA 4AK3A 4KWKA 2W1WA 1YSJA 2WN3A 2XBO3 3O1UA 1FNOA 3SJGA 3TT2A 1O5LA 3AZVA 3LAGA 3K2KA 1OOPC 4NOTA 3ATGA 1VLNA 3ZFFB 2R0FA 2XKOA 1D0GA 4O61A 4LK7A 2WZR1 2FS5A 3GM8A 2VTFA 2H5MA 1UU6A 3LDBA 1DGRA 3PUIA 1PUAA 1W6NB 1BCXA 4KG0A 4CS0B 3J7NA 4CYPA 1SLAA 2QBXA 2VH9A 4JCKA 5C9AC 3CL1A 3ZFGA 2WNUB 4EWTA 2K5TA 4QBJA 1GWLA 2BP6A 5A33A 1MPXA 2J8RA 3TNPB 4B4PA 1B35C 2O4HA 2ZEZA 1XE8A 3LEIA 4P4BA 1RB8G 4GD4A 2ZW4A 1U5IA 4TYSA 4PF5A 4GMP3 1QY4A 1SHWB 2IXLA 5ERLA 3MF6A 2WUUA 5I4MA 4XZUG 4MXUA 5C3PA 3ASIA 4HK9A 3HEIA 4CCDA 1HRI3 3K48A 4PLNA 4IEWA 4UFWA 4PQ9A 2CTCA 2CAVA 2PVVA 3RYPA 2JDYA 2PHLA 1XMTA 5L73A 4AVSA 4UFMA 2VVDA 4CE8A 4MGQA 4LMFA 1ULDA 2YC0A 1QOOA 3EO4A 2PVWA 2PQQA 2WL1A 2X53S 1NAEA 1QXPA 1JYIA 1GOFA 2DUPA 4AEMA 4NHKA 4R4XA 4EE2A 3WG1A 5FXXA 2Z10A 1QMUA 4II9A 3WG2A 2Y6FA 5F6KA 4P08A 1VBE2 3T08A 3PGPA 4P14A 2P3KA 3MFAA 2Y64A 1TKHA 2PJ2A 2C9AA 2AUYA 2IJZA 5LYIA 1UKGA 2VCCA 2MNGA 4BDVB 4LKSA 1QH6A 1LAMA 1IKQA 1OXCA 4FAIA 2A70A 1UZVA 1ZZ6A 5GLTA 1IS3A 1ODMA 1HQWA 1NXD1 2WC2A 2VUDA 1JMUB 4B4RA 5A32B 4CP9B 3BOPA 2NMTA 1ST8A 4MFPA 3GJBA 2HWC3 2B8MA 1SG3A 1W6PB 3I7DA 1GP5A 1ZREA 2E6VA 1EPWA 2L9LA 2R1BA 3S9NA 1AUGA 3ZFGC 2QDRA 5C3OA 4P10A 3L2NA 3SKJE 3FLPA 2MEV1 2OH1A 5ABJA 4OC4A 4UFKA 4COUA 3NJYA 5EMIA 1CZSA 1DQ5A 1REFA 2G1MA 4XF3A 4L11A 2MHFA 1R1A1 2R7EB 2BVVA 3RWNA 1VBD2 3IMMA 3WX5A 4LEJA 2CHHA 3IZOA 2ZX2A 1VBA1 5A6ZA 3WP6A 5AC92 4FPKA 3B7MA 4BQ3A 1UYZA 3PBEA 1CAVB 3POIA 1JZ7A 2ZACA 3BVCA 3APBA 4AGRA 1F4HA 1WBFA 4S2GA 4CYOA 3DPRB 3ZMOA 3CJIC 1NCRB 3C7EA 4GWIA 2IL4A 2WRAA 2E53A 2HKXA 4RGKA 4UFIA 2SBAA 2VQYA 3VBRA 3MICA 2XJQA 2YBSA 2XL9A 5JZGB 3WW4A 1XYOA 3N5FA 1GHEA 1VPHA 2GNTA 4B3NA 2D6LX 5EYXA 4FUUA 2F7VA 4GS4A 2WO7A 4CU9A 1QSRA 4C7HA 3SITA 3D7HA 3HOBA 2I07B 3N35A 3S6HA 3NNJA 3ON7A 3R96A 4B5PB 4Q4W3 4DRRA 1GP4A 5JAXA 3S57A 4CEWA 4A37A 4P02B 5A3WA 1XNTA 3ZYJB 1RUG2 5T5OA 2GU2A 2FXFA 2WZR2 3UESA 1CJWA 3PB4X 1CPMA 2WZ8A 3QD6A 3NV4A 1A78A 4LUKA 1O4TA 4XF4A 2JB8A 3EYPA 1W04A 1CAUB 4P45A 3S7IA 3VBSB 5A7NA 4HPSA 3ZYGA 3VBOB 3D7DA 5HVGA 1W3VA 2AFWA 2X09A 3AK0A 4TTGA 3T2PA 3N9QA 2C6CA 5HXMA 4I3PA 4Y26A 3ZFEA 2JD9A 5FP3A 5ABJC 1FI2A 4FPJA 4D6SA 1L7LA 5T5PA 2D93A 5L7OA 3POFA 4IGOA 1WWZA 4UF4A 4QVTA 4DY3A 1I6XA 1S0BA 2E26A 5FMCA 4AZZA 2D4PA 1RUF1 4XIOA 1QJY3 1IYLA 4NRQA 1PO21 4AEDC 4UA3A 3I3QA 4IGQA 3IEHA 3WW2A 4IEPA 3KL9A 1YI7A 3FC0A 5CFDA 1Y9MA 4ZU7A 3LODA 3L9JT 1REEA 3F5BA 1YJLA 4Y33A 5DAXA 1LHNA 3E0KA 1RXTA 2DU0A 4ZY1A 1ZZ9A 1F5FA 3W91A 1LHOA 4L89A 4OVEA 4E2QA 1R091 4IV1B 5A3OA 1ND3A 1MR5A 2Q1MA 2VBBA 1IS4A 3FBMA 3DCQA 2VQTA 2Y6JA 4FPLA 2YG0A 3SH5A 5KHJA 3DN7A 3VBRC 3DR8A 5FDBA 3FL7A 5J7MA 2OT7A 4QMAA 1Y3TA 1QJU1 2KR2A 3IAQA 4YARA 4YPJA 3OUHA 3F2ZA 3H8OA 2R7HA 3WQ0A 1YC61 1FMD3 1MJ9A 3IIBA 1OURA 4D94A 2O53A 3J4UH 3GYDA 3KF5A 3IGRA 3KHCA 1OQ1A 4K8FA 1SLTA 1K5JA 4IV3A 2B5HA 3PUQA 1QJX3 4X6QB 3VBFA 5C8CB 4QM9A 5FLJA 4IK2A 4RR3A 3BGAA 1OA4A 3LOIA 3N3HA 1QGLA 4Y1ZA 1ZG8A 1CZVA 3PJQA 4W4ZA 1TKJA 5C6CA 4NCZA 3EMRA 3BI3A 4JDMA 2RJLA 2VZUA 1LGCA 4XDPA 1QXJA 2Q43A 3AL6A 5KTCA 1ELLP 4BD9A 5IB0A 4AG9A 5FZOB 1RVF3 1SLBA 3NRUA 3FEEA 2D3SA 3WVJA 3EBRA 4E4ZA 1SDWA 3ACIA 2F8HA 4P4IA 1EY2A 1FOD3 4QPGB 1DCSA 2MEV2 1S1AA 3VBHC 4FAGA 5GZFA 1ZYBA 3ZFEC 4E8DA 2Y0MA 1TNRA 4PT6A 3VD4A 1YQEA 4B7EA 1WWYA 3UL2A 2QQVA 5IK8A 4FT8A 4FPGA 4F0YA 3I3DA 4ZS2A 3WNXA 2GNDA 3V38A 1LENA 1RUH1 4LT5A 1DGRN 1H6XA 3V64A 2ZS6B 5BNOC 1PK6A 1Z7S1 2W39A 3USSA 1Q8QA 4KVOE 3GNEA 2VCMA 3RYRA 3HN3A 1JZ8A 1D7PM 2JEMA 4TZDA 1S7NA 1ND3C 4MUVA 5DN2A 4COWA 3LEGA 1OMIA 3JQXA 2ZMKA 2WNVB 3WLUA 4CXYA 3ZSMA 3ZXDA 1HX6A 4YYOA 4OHWA 1IGOA 2XJTA 4DO0A 3ZYHA 2YUEA 4Y4RA 2XLGA 2WAOA 2DURA 3M8LA 1U12A 1ULEA 3PMEA 1WLDA 1H2LA 1JZ2A 2GAUA 3U4SA 1XJAA 1BBT3 3GXUA 4NGSA 1S0JA 1W05A 2W3JA 1Y9KA 4YZ4A 3VBFC 2JDNA 1DU3D 2RV9A 3I2OA 4LBQD 5IJRA 4RR3C 1VBB1 4ZBGA 1GOGA 1U0AA 5FMBA 5IK7A 4CUCA 1FPN1 5T5JA 3N7MA 4A32A 2BDRA 4KGGA 4A45A 5EJ3A 1QHDA 1V6KA 3S5AA 5CU1A 5LA0A 1OLME 2HC9A 1HXS1 1F15A 2VTXJ 4BQXA 4CCMA 5I0UA 2A5ZA 4HMZA 3VHOA 1RUE3 4OP4A 2VQAA 2AR6A 3NH4A 4CDQA 1AL0G 1EUUA 1H8TA 1V9U1 5A3TA 2PIZA 4Q4Y1 4DYOA 4EN8B 2VMGA 3T2TA 2F17A 2QKDA 3D2MA 1PO22 2JDZA 5KR7A 3KM5A 3V56A 4QX3A 4CXXA 5LYFA 3AP6A 1W2NA 5F3GA 5A27A 4YM3A 1ON0A 1RUI2 3VDAA 1GV9A 4Z2AA 2VOKA 3Q8AA 4O9EA 4QPWA 1IOFA 4ZZ5A 2BO9A 3VZOA 4Y1UA 1PK6C 2VUAA 4BIFA 1US2A 4YVWA 4B29A 1KUYA 4DNYA 4LHSA 2P5BA 4K3UA 1R092 3THDA 5B2GB 4UCNA 4PIXA 1F31A 1WCKA 4CDXB 2PE3A 4CEYB 2ORXA 2VNVA 4OI0A 1ZBA3 3TEXA 2X8KA 4WZFA 2VC9A 4URAA 1QJU2 3D66A 4TXWA 3K4AA 5IAVA 3ILFA 3FYNA 1BK0A 3PHMA 3U14A 1TF8A 2FT0A 1FAYA 4BZ4A 5E96A 1ZG9A 2JE8A 4GMP0 4LO6B 1Y7EA 4I09A 1FXZA 2IXIA 3CXPA 1J83A 2XHNA 3N4MA 1GNZA 4K8RB 1H0BA 4B12A 5DAPA 5F5CA 5E8AA 2R32A 1HB3A 3SEPA 3QACA 5HH1A 3MPBA 1C5IA 4MXVA 4CU8A 5A28A 2J1SA 4AEKA 3ZXKA 4OC2A 2V73A 1H1IA 4GAZA 2R0HA 1ZO0A 4C2XA 2UYBA 5EJZB 3CLPA 3ZFFA 5GLZA 1YX0A 2ZEGA 3VD3A 4AOCA 1VB4A 2JIJA 1H8TC 1YW4A 5AG6A 4F83A 1W6NA 2DTWA 4E4SA 4CZSA 1WA4A 3NAPB 4MG2A 4QX2A 3O1SA 1UL9A 3QH7A 1PMJX 1HRV3 1MZ5A 3OYWB 1GYTA 3KLSA 3H8UA 3HQXA 1F8VA 1RUH2 1K4JA 3SH4A 2GIVA 4CGPA 5G05L 4YW3A 4TN7A 1CP6A 4N43B 3LB9A 3S6GA 1Z7S2 1RXFA 5ISVA 2OA2A 3MGDA 2QUOA 3H7JA 2ZW5A 5FY9A 5E88A 3SJFA 4BLIA 3GCXA 3AL5A 4DUXA 1W0NA 3WF2A 1OH3A 2QTWB 4NJ4A 2FCUA 2ENRA 5F1RA 4K21A 4IEVA 5FZGA 1VRH2 2XKPA 4UBHA 5C3RA 4CGLA 2CNMA 5FZ0A 2ZGTA 3N9PA 5C5UA 1AR72 5FXVA 5EIYB 3NNGA 4NGMA 1Z4EA 2ZZJA 3TEWA 3SQOA 5C70A 2EBJA 4RGAA 1PO11 4LO4B 3IDBB 2J8NA 4XJWA 3VBUC 2RVAA 1AMPA 1JBCA 4Q29A 5F09A 1VBB2 2B4KA 2VOVA 4ZU5A 4EWDA 3IMNA 1R64A 1YLEA 4A7ZA 3SHRA 3T4VA 4BLJA 5FZ9A 1O3RA 2ZENA 4U5YA 4CCOA 2O1QA 4C7IA 1COV1 3NJXA 1DG6A 3NJVA 3N9MA 4XDOA 1LCLA 2PHXA 1IHMA 3C7HA 4GWMA 3H1WA 4ZX8A 1HXS2 4KUBA 3KB5A 3W5MA 5BY5A 1XC6A 2HLEA 2XWJB 4NGPA 5A32A 5FRAA 3ZFFC 1U5XA 4CP9A 2XEFA 2HEYF 4CSWA 1CIWA 2F4LA 2CIJA 2PHRA 5KXEA 1UW8A 1V9U2 1NX9A 3GB0A 2KXLA 3CF6E 4ZY0A 2XBO1 3DYPA 1AR83 5EC4A 3LIGA 1JZ3A 1OC1A 4P9WA 5CBMA 1UQXA 3JUUA 3ZSLA 3D3AA 3WDVA 1UYYA 4Q36A 3SH3A 2NZ9A 4MJ8A 2P3IA 1VIWB 2RJKA 5IVVA 5FWEA 2HQYA 4QXKA 2VMFA 1FT7A 3HQRA 3SCGA 1ZRDA 1ULOA 1TKFA 2CY2A 4PLOA 2P6HA 1EV13 5FREA 3HQUA 4LHNA 4YW7A 1OH4A 3LPFA 2XHKA 1UZYA 2BFUS 4FCAA 4HLTA 2X7BA 1S5KA 1XRYA 1A8MA 1R081 1RMU3 1UXXX 2WNOA 4ISQA 1CAVA 3WD5A 2AZ5A 3AXDA 2WYFA 4OHVA 1GBGA 2W91A 4QQ2A 4GMP1 3LWCA 5CKMA 3DPRA 4CDUB 2ZXQA 1OSGA 1NCRA 4MRIA 3PVNA 1JOJA 1SCSA 3NFZA 4GH4B 2WWSA 5EP9A 2VW0A 4B6ZA 3RNSA 2YPDA 4FD7A 1ND2B 4QX8A 2IVIB 5JZGA 2NLRA 4BMBA 2E51A 1XNCA 3KQ4B 3BB6A 5A70A 4MGZE 2ARAA 2YGWA 4KUAA 1XRUA 4MLOA 4EJRA 4QB9A 5F9TA 1VKCA 4NN0A 1IPSA 3VGIA 1W3XA 4Q0SA 3FF3A 4B5PA 4B5OA 2WUHA 5H9SA 4XPDB 4HSLA 2V4VA 4EN7B 5DG2A 4FBFA 2Z3LA 2ZAHA 1J3PA 2J42A 1BJQA 1L7QA 4QHOA 2W87A 1KWMA 2AFXA 2R16A 2D97A 3O1RA 1VMHA 3IWZA 4CA9A 4L97A 2IQ6A 3WF4A 1AJOA 1MK4A 1CAUA 2SLIA 4LITA 2V5DA 5A3PA 2XQRA 2OYZA 2PJ6A 2V4AA 2V8VA 1JYXA 3VBOA 2ZXVA 4G4FA 3KCCA 4E0AA 3ZXEA 5I8SA 2R061 2JECA 5JXJA 5LEJA 4AXOA 4XILA 4ZI6A 3WDXA 1VRBA 2Z5WA 2VZRA 2HWC1 1QU0A 3MLLA 4PK2A 2C6PA 5DZGA 3MV01 5A1AA 1ZG7A 3AMMA 2PJBA 4S2DA 1OVSA 1J4JA 4KSIA 4QQHA 3ZLIA 5BNNB 5JGFA 5DUXA 5BNPB 2Z79A 3KSCA 3K46A 3JB8A 3ZKUA 1PMHX 4YG6A 1LULA 3CZUA 3CNAA 4NHLA 1HJFA 2W52A 4YNIA 4IV1A 5DG1A 4NE9A 2Z69A 2P6FA 1C1LA 1NCRC 3JBG1 1CX4A 1AYM3 2P6GA 3TOJA 3ZVXA 4QC6A 3D67A 3B8GA 1PO12 5DMYA 1JI6A 4C0BA 4KWJA 3ACGA 4YRDA 2WO1A 1DGLA 3O1VA 3U07A 3TYJA 2QQUA 4OIDA 1AR63 1SLCA 3MDPA 4B14A 2K0GA 4CYNA 3WW1A 2JDAA 4W6XA 3WQ7A 4I0WB 2WLPA 1CIYA 1W0OA 3B94A 5FYZA 4RFT0 1TMF2 4QDSA 4NAMA 3IO1A 3O7OA 3BU7A 4AR2A 2YZ4A 1COV2 4DXSA 3RMXA 3R4SA 5CBLA 1CX1A 4XUOA 5C8CA 3LACA 1S0DA 4RQPB 1Z0HA 2XEIA 4AQ2A 4QHZA 4Q4X2 2R042 2QQMA 4OUEA 3BALA 4MCSA 3OWCA 2VZ1A 3BPZA 1GFF2 2WQ4A 2YFUA 3UK9A 5IT6A 3A0NA 4Z1VA 2CNAA 2JEWA 2LRPA 4ZY2A 2OKXA 2XVLA 1CAWB 4OI1A 3O0VA 4LNVA 5L9VA 2DU1A 2ZGRA 3VDDB 5JWPA 1UF2C 3TWIA 4Q4W1 5FZOA 2ETEA 3CU7A 4YFWA 1W2UA 3B3CA 3VBOC 1ELMP 2ZW6A 3WDWA 1HIXA 3P5BA 4P5YA 4QPGA 3IDCB 1ODNA 1O3SA 1E5RA 3OY8B 4UIBA 4IEQA 2VL4A 3WABA 4R7MA 2YPJA 4XBNA 3P3PA 3SCFA 1MQTB 4YGCA 1SCRA 4FTSA 1UPIA 1YK3A 1N3PA 4J1XA 5F5AA 1S2EA 2ZELA 2RS33 1YUDA 2D3PA 4HL0A 1OA2A 1R082 1ZRFA 1MJBA 2R6QA 1V0AA 3I49A 1LRHA 2G9FA 3V0BB 1N47A 2ZHMA 2ZABA 4UAPA 2FHRA 3OBTA 4AFMA 3R4UA 5E16A 5IB9A 5KXDA 1UZZA 4CAWA 4XPVA 4DS0A 1S60A 4N7UA 1QJY1 1L0CA 3WQBA 4CP0A 3PJYA 1K42A 2QECA 1OOPB 2WNVA 3L2YA 4F6AA 1S7LA 4R9CA 1OQEA 4HETA 5DZFA 3POGA 4D69A 4HONA 4Z8BA 4XFFA 4XFHA 3WT3A 2ATFA 1ZZ8A 2JJ6A 3H42B 2HWD2 2CGOA 4QPYA 5C9AB 4U2AA 4NAOA 4LBQB 1RUJ3 4C2ZA 4JZRA 4C8DA 4BIOA 3VV1A 1B35B 2D6PA 4OADA 4LLOA 1WCDJ 5C7GA 5C8CC 4MHZA 1WD3A 2NMNA 5DABA 2PQ8A 1KEXA 2Z3NA 4DIQA 1UIJA 1YQ5A 3FEDA 1JW6A 2GDFA 5FZDA 3PURA 1VHOA 1DE4C 4H2AA 3UT0A 4AQTA 5FOJB 1ENQA 2VPVA 3MIGA 1RTQA 4JXRA 4AFBA 2V5YA 1Y0RA 3P3NA 4MXWB 5FQ0B 1EE3P 4R9AA 4AVAA 1EAH3 2J9AA 1UIKA 3U4XA 1JUHA 1GLHA 1HB1A 3D7GA 1F4AA 2VOTA 1OFSA 4MY0A 5GALA 1JOBA 3WINE 3FXTA 2HWE3 1PX3A 2CV6A 2R062 5FY1A 3B7IA 4M6HA 2ZOGA 2A3XA 4BQYA 5JOZA 5C3QA 4EYUA 2CDOA 2HWC2 3I2FA 3J8F2 1LAJA 3GDBA 5IUQA 4XBLA 1OHFA 4HKOA 4DUKA 4XMAA 1O59A 5DQ0A 2XEGA 5TSWA 3ZR5A 3AJZA 4IW3A 5ANNA 3P1IA 3ZM8A 2NN8A 5LK5A 3UJQA 3FE5A 5EFUA 3V7ZA 2Y26A 4X8PA 1C3HA 4R6TA 2D4OA 4XC9A 4LUAA 2DCZA 1JZ5A 2W1UA 3JBG2 3Q8EA 1WW7A 4CDXA 1IG0A 4CEYA 4OC3A 1NKGA 4Q8KA 1M4IA 1N1TA 2PAKA 3OUJA 3KKWA 1PVC2 3AVSA 5KHKA 1M1DA 1U5ZA 3I2IA 1R43A 1IICA 1UY4A 3RJ2X 1PVXA 5FCCA 4FD5A 4XACA 1BKZA 4OZXA 2ERFA 3LFIA 1NE6A 1NCQC 2VO5A 3SNMA 2BV4A 4PIZA 4BYYA 2QQJA 1V0CA 1V6JA 3FFZA 3G7DA 3R1KA 2W1QA 3JTKA 2NP0A 3LEKA 1GICA 4PBOA 4OIWA 2HYXA 2DCJA 2I74A 2OS2A 3VZJA 3RYOA 1H4GA 4AEJA 2FDJA 2ZMNA 2BVBA 4XXPA 1UX7A 4RL7A 2YNCA 4Q4W2 1UMHA 4JD6A 3ZIWA 1BVVA 3MZHA 4FQZA 3GY9A 4A7KA 1RINA 4PDWC 3ELNA 1QQP1 3CJIB 1YQCA 1RL3A 3CIHA 4V2WA 5I93A 3ZXFA 4C68A 3G8WA 2GLFA 3TEZA 3WXPA 1CVNA 5CFCC 3NAPA 5FYMA 3K75B 4YW5A 3T0AA 1CD3G 4XE9A 5FZ3A 5FO7B 4DXRA 1GZTA 5G20A 1OD3A 3T0BA 4MGYE 4BBHA 5K8OA 4DEVA 2RR13 3GZTB 2VTXA 4MBUA 1RUE1 3JD72 2BNMA 4N43A 2X29A 4LKFA 1QJFA 5ACA1 2CGNA 2F4PA 3FBYA 3LKJA 3NO8A 1H30A 1CX8A 3JRUA 5BPXA 4ASMB 3POJA 5GM0A 4LBOA 3OJBA 2RM23 5L36A 4FFFA 2W95A 4IE0A 1RTVA 1US3A 1NG0A 3D0SA 4B10A 2ZEWA 1CR7A 3FUOA 3KVBA 1UD1A 5D1IA 4Y5SA 1GR3A 1SFYA 1A8DA 3ILNA 1B6BA 1VGYA 1Z4RA 1RJ8A 4YVSC 3WY6A 3JCIA 4NXYA 3SXNA 3J7MA 1KS4A 4P9JA 2JKXA 4OC1A 3LPGA 3S6FA 4BMEA 2YMZA 4FD4A 3E97A 1B87A 4XUTA 4LKEA 3RS6A 1NQDA 4EROA 1GQHA 2AFZA 1HQNA 1VBC3 3J7LA 1H1AA 1AL21 3R4DB 2P2KA 1S4CA 1O8SA 2RS52 1LRZA 2D6KA 1X8MA 2VXJA 2BTVC 5JIAA 4AEDB 1PZ7A 3MI8A 2Y0IA 3THPA 3U11A 4MSVA 4NJRA 3RBUA 1FV2A 4H2KA 4PI0A 3HT1A 1X8EA 1DP0A 4LQRA 4YM1A 1XNDA 2G9ZA 1IIDA 3IU1A 2WR9A 4DUVA 5A1LA 2X05A 3M2MA 1PX4A 5T50A 4XETA 3FWEA 1D4M2 3D2PA 2W68A 3N9LA 3VBRB 4XURA 1MS1A 1VHSA 3NAPC 4KOVA 5LYLA 1VIXA 4C1WA 1I1EA 3N9OA 2WSAA 5IK4A 1UCXA 1JQGA 3DR6A 4W6YA 1OLRA 3P2FA 4IEUA 1AJKA 3NKGA 4WBBA 3KGLA 2WLQA 2WSUA 2Q51A 4KSFA 4LORA 2BNNA 3NWKA 4EWEA 1RHI3 4JRAA 3TN91 3I3MA 2ZHNA 1HJGA 3MO4A 2VBDA 3WP4A 2QZ3A 3FJUA 1OF4A 4QX0A 3VD7A 2FVGA 2PJ8A 3ECQA 5FZLA 2IFRA 3S5QA 3KGZA 4CDUA 4XHBA 1UY3A 4IHMA 3M70A 4HKLA 4IF5A 2E7AA 4BK5A 4GH4A 2CF4A 3QNVA 4BISA 5FJKA 3U78A 4WJBA 1ND2A 3VBHB 4CPAA 1ZZCA 4L92A 4Z65A 4Q0VA 3IC1A 5K8MA 2AFUA 5ELYA 4H6UA 3OSDA 2R98A 5H9RA 3G3SA 3PB7X 4FAHA 2QQKA 3WNPA 4YGEA 2KM2A 1STMA 1MS5A 1TF9A 1YGHA 2C26A 2HJIA 2XJPA 4K40A 3PIGA 4QKDA 3T3YA 4QU2A 4PHZA 5FZ8A 4EN6B 3PEIA 2VXKA 5CNAA 4B8EA 4RHV3 5BNOB 1UXZA 2IC1A 4JKMA 1BPNA 1C5HA 1O4ZA 3P2HA 5CA6A 2VJXA 3SXWA 5JLVA 1MEC2 2PHDA 4M0HA 4CYDA 4KNCA 1QQP2 4NIAA 3WCRA 2I45A 3LD8A 2WFF3 5FXZA 4AQ6A 3AMQA 2QQPA 4HG6B 3OD0A 1YIPA 5LBCA 2FCKA 2KCWA 2CU5A 1RUC2 3PL0A 3W6SA 2BU9A 2JX9A 4GZ9A 3DNSA 4QX5A 4Q4V1 1UY2A 5C71A 3H3UA 5LYDA 1W9TA 3MIHA 4KH9A 5ACA2 4QHBA 5FZFA 2AENA 4CRYB 1TME1 5J96B 1QSMA 5F37A 1PZ8A 4I01A 1YLLA 4TSVA 3WF1A 5LCWL 3SI2A 3VDBA 1AR81 2I79A 3OGSA 4NSQA 1QDCA 5H86A 1YO8A 4QB2A 5BNNA 4XUPA 5EBVA 4PF1A 1I21A 1QSTA 2QMLA 4BQ4A 5CYYA 1I3HA 4P5HA 1VE0A 3MLKA 2Q7SA 1SDDB 2BGCA 3HWJA 1LHUA 3I3EA 5FZ6A 1XBUA 3KCXA 5LA9A 1RYYA 3VD9A 3I9SA 4RS5B 3HJRA 4QX1A 3MV11 4QKBA 1HQLA 4WM7C 1ND2C 1RMU1 4CU7A 5KBFA 4BPZA 5C88A 3HT2A 4LR4A 1AL22 4LOSA 2ZGLA 4QGMA 3GZAA 3LDKA 5LWBA 2PDOA 3AKTA 1M44A 4MOAA 3PFEA 2TNFA 4CXWA 1TNFA 2VVFA 4NHMA 2RHPA 5K0UC 1AR92 1V6NA 4IDZA 3W59A 4MGKE 4Q0UA 1UWYA 4RQPA 3PNAA 1VBE3 2GZWA 2ZEFA 3KT4A 5JQ4A 5IVJA 3ZN4A 4XJ8A 1WW6A 4X6RB 2ZZQA 5F7UA 2V72A 4BXFA 4M6IA 1CAWA 2XJRA 5B4NA 2HWB2 3LE0A 1G86A 5CADA 5T3NA 3VDDA 3B9IA 4KOYA 2D43A 4A39A 1V6LA 1XOYA 3BJ7A 1RITA 1E5SA 4R76A 1OUXA 3UKTA 3OGRA 2VMIA 2ANPA 1YFUA 2MPFA 4QKFA 3HD8B 4Z07A 1NLSA 2DVGA 3O1OA 2BUKA 3OY8A 3GGLA 3D7FA 4KOXA 2EK9A 2ZGOA 2WZEA 1MQTA 2TEPA 3TFYA 3VL8A 2EVXA 2JDKA 2DWRA 2ZW7A 4NIGA 1J1LA 3TN92 5FR3A 5BNNC 2FL4A 5D8AC 5LRSA 2ZEHA 2BEOA 4KORA 1S0GA 4GB32 4RD7A 5D29A 3NV2A 2X10A 2JG9A 2Y33A 3V0AB 2ZX1A 2DYCA 2XLFA 4K7JA 2GH8A 1VBD3 5A3MA 3A0KA 4AGVA 5BV6A 1UZWA 5EPAA 5AC93 4K9SA 1OOPA 5FYHA 3ZXGA 1WKYA 4SBVA 1DYKA 3H5ZA 1NA1B 1X36A 1GSLA 1H2NA 2ARCA 3FMGA 2FMDA 1DGWX 2ARXA 2O8QA 4NIDA 3T90A 3BYWA 1RUD3 4IEYA 2OZUA 3WNMA 1OF3A 4HPKB 5LRKA 4CUAA 2ZTNA 5C9AA 3WNLA 1E5IA 4HVOA 2XVGA 1NY71 1AYM1 1B35A 1LOGA 2VZYA 2E7TA 5JOXA 3MGUA 3MLJA 2O14A 3AKPA 4JXQA 4OI4A 1JOPA 5FZAA 3AYDA 1WMFA 4LBMA 4D0QA 4X8IA 2FZ2A 4K1ZA 3AYCA 2PYTA 3PRTA 1ULGA 4ASKA 2A7AA 5KHIA 3RZMA 3JZVA 4MXWA 5FQ0A 1WUVA 2BOJA 1KFUL 4MGIE 2XB6C 3EXUA 3OPTA 1RUG3 3AVRA 2HYKA 2JBKA 4OUMA 1D2QA 1K3IA 4JDOA 4ARYA 3H8FA 5FKBA 4Q4V2 3LA3A 3WDYA 4IQPA 1XE7A 3T09A 1F57A 1YEWA 1TME2 5LBBA 3IN9A 5IW0A 1MQTC 2JDHA 1G6NA 2B5GB 1W9WA 5LK7B 4RFRB 5SV8A 3VBUB 4MYEA 5CG9A 3E6CC 4WVVA 1J3QA 3PB8X 1BEV1 2YBPA 2YY1A 1J58A 2BW8A 2P3YA 5L9RA 4MX3A 4D7SA 2VZTA 2VAUA 4KBBA 2JG9C 5FYUA 4S2FA 2A6ZA 1LFWA 4AF9A 4KQ7A 2PJ1A 3QCWA 1ZZBA 1DZQA 3IIAA 3JXSA 1H9WA 3H1YA 3PUAA 5FZKA 2RS31 3CJXA 1J59A 3B2YA 3EO6A 4UFHA 1KQRA 5JXIA 3ZN6B 1G9FA 2FCVA 2WT1A 1HEEA 1P4NA 3UYJA 3AFKA 3K77A 5K8NA 3K4DA 4FP3A 1R57A 2IXHA 2A6WA 1G9AA 4A6SA 4TNUA 1G7YA 3PTYA 2D44A 4N7IA 2JDDA 2PHWA 2FDHA 4YW6A 2G9DA 1AYN1 3TRSB 1H2MA 4XNHC 5K4LA 2ZEDA 4QGNA 1K45A 4WM8B 1NE9A 4UW4A 4WVWA 2Q5TA 4CAXA 5IWFA 2PR8A 1ZVFA 3WP3A 1WLTA 4A3XA 4ZGYB 3JUWA 2Q8CA 4COZA 2R1DA 3DXTA 3ACFA 1RJ7A 2XUMA 4W9YA 5E89A 2GC1A 3IDEA 3PU3A 5FP4A 1IS5A 4KGQA 2VE1A 1XYPA 2QCSB 4QQOA 2RE9A 2C4XA 5HCBA 4EZHA 3CQOA 3R9EA 3ETQA 2PRBA 2A73B 2BJSA 5F2SA 3THCA 3ACLA 4EZ4A 3PU8A 4R52A 5CG8A 1XPWA 4JGYC 1OZPA 3CJIA 2EXIA 4NWVA 1FYUA 4FPHA 4IE4A 1XU2A 3OTFA 2VZ3A 2J1UA 2MEV3 2BGPA 1VP6A 1SBEA 3SXOA 4AXVA 3IWEA 3LSDA 4Q0QA 4NFRA 1YFYA 1GMMA 4Q1RA 4XF1A 2HWE1 4H7MA 1LANA 2P34A 2VU9A 1ZBE3 5F8PA 2NPIA 3KV5A 2AREA 1CPNA 4XEZA 3VKNA 3M3IA 4CCJA 5J37A 2WS92 4N90A 3PMSA 1YMEA 3VL9A 3D6EA 1W6OB 3GF6A 5LY2A 3CT9A 4K20A 3ZYFA 1AX1A 3S9MA 2IVJA 3KR4A 3KI9A 3T4HB 1S0FA 4P4JA 5FK8A 3KHXA 3K9UA 5T54A 3T0DA 4B1LA 2YROA 3VATA 3WG3A 1SBDA 3VHNA 1PCAA 1SPPB 2PXJA 3JB4C 4SLIA 5CB7A 2DVAA 1N1SA 3FECA 1WCSA 2VZZA 1AX2A 4NHXA 3SCHA 5F6LB 4IESA 2EIGA 2Q0AA 2FDFA 1O3TA 2QE3A 2B39A 1TIQA 4Q5OA 4OFGA 2VUJA 5BNQA 4AEDA 1AYEA 2G0BA 2BOAA 2HWF2 4ZYQA 1E5HA 5HXDA 2Q4SA 5GJ6A 3FLRA 3POSA 3G6JB 2LROA 1X33A 1QEXA 2UWBA 3ROUA 1CWPA 3EXNA 4UCPA 2VUCA 4I2OA 5J48A 2BWCA 4PV6A 1YW6A 3PTRB 4YG0A 3LMSA 5K7PA 4HVQA 4V1PA 4BU2A 1G8WA 1O91A 2PJ0A 4HBNA 1Y9WA 2Y6LA 4QB6A 4LLFA 2RS12 1BEV2 2EXJA 3BU0A 3U1XA 1SQHA 1HW5A 1ULPA 2WT0A 3LA7A 2JDCA 4NROA 2UYAA 1XYNA 4A42A 4X5KA 3OEAA 4AAXA 4E9KA 4CGOA 1PO23 4Q8LA 4A41A 2FIAA 3OF1A 1MJAA 2AEZA 3RMYA 4N53C 5C8WA 4Y5TA 2A3WA 2OUHA 4GWJA 5IAXA 2R8VA 4Q38A 1UOGA 1RUI3 1TG7A 3WSOA 2IMOA 3I3BA 3OOXA 5FWJA 4UT5A 2B7YA 3WW3A 4M3CF 3NNLA 3MHZA 1KD7A 3B9CA 1T6GC 4OQ8A 2BPA2 3FBUA 3TEYA 3RI8A 3IT8A 1XF8A 4G3YC 1R093 5HCFA 3NQHA 2ZOFA 5FMOL 1V70A 1YWKA 4GALA 2Z42A 1YVKA 4FPCA 2ZMLA 3PVOA 4NVPA 2OZ6A 3C7FA 3I54A 4DRVA 5FYSA 4J25A 1TZOA 3SHPA 5JI9A 4QU1A 1AYN2 4BWOA 4EN0A 4XF9A 5DAQA 2PN5A 3VBHA 3T8WA 3FHIB 4HT1T 2PJAA 1BPMA 3CBNA 2DVBA 4MO3M 5LATA 4FOVA 3SI0A 1PYTB 2A6YA 2JE7A 4I0BA 4N9HA 3KR5A 4IE7A 1UU5A 3HAGA 5G04L 3OBAA 4AI3A 2VZSA 3I8TA 3ISXA 1URXA 4V2VA 4JV4A 2WPWA 5FYVA 3PUSA 5BNOA 3WUDA 5B4XA 5CEHA 5LB6A 3RSJA 4QQPA 2P3JA 3NV3A 2FD8A 3IB3A 3MIBA 3MFCA 1F2PA 1MS9A 5DUVA 1S0CA 2QVPA 3AXEA 4OKOA 5FOBB 4MVTA 3HNBM 3OPWA 4FPYA 4DUWA 2C24A 2V8GA 3OGGA 1LJ7A 4NGNA 1MVEA 3PUHA 2PAEA 5FYYA 4META 1ASJ1 3ZDSA 1Y4WA 2D98A 2HWE2 1N3QA 3VZMA 4QXHA 5BYNA 3VZNA 1Y9GA 4OHYA 5JH9A 5FAXA 2UY9A 1CQ9A 2PTMA 3O14A 4CPBD 1ZM1A 3H8XA 5LRRA 2Z3KA 1RUH3 4NGTA 1KJLA 4Y4YA 1M4WA 4KWLA 4P00B 3HMYA 1WMXA 2G9GA 3AB0A 2FBEA 1Z7S3 3TBDA 4MMOA 4KBZA 1AXZA 1WMEA 2WSVA 5E6HA 4KOSA 4EV0A 1JU4A 5JXHA 2PR1A 1LGBA 4Y1VA 2ZPXA 2AE6A 4IAVA 2I3CA 2PA7A 1Q2YA 4LBKA 1QQ9A 4QUSA 2CAUA 5HI0A 1DLCA 3KV4A 4RS5A 4Y3OA 3O1TA 1DGWA 2C1CA 2Q7BA 1VRH3 4UFVA 3WQ1A 1VHEA 3S9LA 3ZYIB 5CIRA 4QXCA 3A9LA 4O23A 4DXTA 4ZZ8A 3DUIA 3MUY1 1AR73 2QFEA 3D3SA 1NQJA 2JE9A 1L3JA 3Q8CA 4LKDA 1R1A2 2XVKA 3WC7A 1DIWA 3PP9A 5A80A 3DLJA 3OG2A 3QH6A 3IAPA 5C4WC 1VBA2 1QSOA 3TE4A 2D7FA 1VBB3 5K9YA 4FSJA 1UY0A 1S0EA 1APNA 3S6PA 5I0TA 4L2NA 4YFJA 4DJLA 1C1FA 5FZIA 3OB8A 3VWDA 2OZGA 2B45X 3AKSA 3BTYA 3RZJA 5IX3A 3HNYM 3MW2A 2YNEA 1UWWA 4E27A 1HXS3 3FB3A 4XIKA 2VW1A 4D6QA 5FZCA 5JMCA 3ZXJA 2AFOA 5A7OA 1Q8OA 3MW4A 5FY5A 1OQDA 2DBIA 3VKFC 1CBXA 1IOAA 3D8CA 1V9U3 2EXHA 3URFA 1NCQB 2OZHA 4LJHA 4Q1PA 1TQ5A 4ONUA 3GALA 4RI1A 1XJOA 4GWNA 4XYXA 2Q4YA 1HN0A 4XOGA 2WFF1 1PM7A 1C8M1 1V00A 2Z3MA 4PQQA 3B69A 1YLOA 1BXHA 4YGDA 2AJ6A 1AVBA 1CGPA 2R49A 1N1YA 4YM2A 1S2KA 1REDA 3ZOIA 4R9DA 1C57A 1F2NA 4FWUA 5IVYA 3V0AA 3PFOA 3TNQA 3N7LA 4NHYA 2YXSA 4A6OA 4ISRA 3DSBA 1JYCA 5A6XA 1NMTA 2ZEYA 4COYA 3AP5A 2Q0YA 5FZMA 4MCRA 5GZGA 3C26A 4RS5C 1NA1A 1XE4A 4PDWB 4UOJA 4XCBA 5HCHA 3NJZA 4MHPA 5CAZA 1IPKA 4K6BA 3CZJA 3H8EA 1NT0A 1ZRIA 4HPKA 4AHXA 2GANA 5CFCB 3D8PA 3UNPA 1RUF2 5APAA 3GIUA 5JSPA 1LOCA 4QWNA 4CGNA 4MHRA 1M4LA 4AG7A 5LZ6A 4KSAA 2VL1A 2WQ8A 4BJ0A 3DKQA 1Q7LA 2J1AA 4OYUA 4RN5A 5FZ7A 1LOBA 3SI1A 2BQPA 3BTZA 4P4FA 1LR5A 2WO2A 4H7LA 1S7FA 4P9YA 4P44A 3OD4A 1JWQA 1N3OA 1JXNA 3W58A 2EK8A 1Z8LA 2PLV1 1UU4A 4LO5B 2OOTA 5EYYA 2ZHKA 1ZRRA 1DYOA 4PXEA 2VCAA 1LEDA 4FFIA 2A6VA 4CAFA 1ASJ2 4QB1A 1LKNA 2J1RA 5FZEA 4YVSB 5IK5A 4KOUA 4B1MA 3GCWA 2EAKA 5DPNA 3V65A 2WDBA 5KXBA 2REFA 3C2UA 2B5GA 3NE8A 4FXKB 2W92A 2ZGQA 3M3CA 3VBUA 1A2ZA 2Q44A 1YNAA 5BXXA 1FNYA 5F3EA 2EALA 1QIQA 3NH5A 5DDJ1 5FPXA 1Z2LA 1CESA 4D8MA 5FVJA 2XJUA 5H84A 1ARMA 3I97A 3KMHA 4EWAA 4UBGA 5I91A 2D5FA 1UN1A 2BYVE 4OCTA 1B09A 1KITA 1WW5A 1OD5A 3SJEA 1W9YA 4CGMA 5THWA 1NA1C 4QQLA 2QYVA 1Y0YA 4NIIA 4FOWA 3ZN6A 1DHKB 1XOVA 1HKDA 3DYOA 5A1FA 5KC6A 1VBD1 3R95A 3KV9A 4MADA 1YCIA 3WV6A 2BNOA 2ZX3A 3M3OA 4Z2WA 1ENXA 5HVHA 3UKVA 1H8LA 4MFZA 4Y49C 3M4FA 2OU2A 5AC91 1PIV1 3IWWA 2AEYA 2I00A 1KFXL 1HB2A 3RZHA 2DCTA 2RDSA 2XDVA 4WM8A 3BCWA 5IFPA 1CP7A 5KWRA 4PSWA 1QJZA 3TOAA 1TMF3 5J1XA 1RUD1 2WABA 3KASA 4F8AA 4EMEA 1COV3 2R071 2P17A 3BKZA 1Y7RA 3ZPYA 4IE5A 1T2XA 1Y43B 2H6BA 2DUQA 3ETPA 1NLRA 2XG3A 4Q4X3 2ZGPA 2R043 5CKNA 2JG8C 3HNMA 2X5IC 4MFLA 1IYKA 2J22A 3B93A 3KQRA 1I5PA 4J6GA 4LQ6A 3USUB 5LEKA 2RMU1 2Y0OA 4YWYA 1J1TA 2WFF2 1C8M2 4BM8A 4GM5A 2C27A 1KS5A 1A3KA 1RUG1 1M06G 2UWCA 3K4ZA 4IGPA 3D5OA 5JVVA 4CUGA 5DAVA 1FPN2 4PPZA 2VQ0A 3NSTA 4HKFA 4BCUA 2ZGUA 4NIHA 5G22A 2W1SA 2W0XA 4AI9A 2WWUA 5L9BA 4PLMA 1JYVA 1R083 4A31A 2WINB 4HN0A 4NPMA 4DZGA 2ORZA 3K9TA 1W6OA 3U10A 3E5XA 4DXZA 4LBJA 2XPJA 2GMEA 1C8NA 2VMHA 1Q3EA 5FZBA 2AFMA 4DMIA 1OPOA 3RJRA 4H89A 4KVXA 4OC5A 4BQ2A 2R30A 3FHQA 2ZKNA 4Q4Y2 1HV0A 4YZ5A 4LE3A 2XONA 1TEIA 5BWAB 2ZAAA 3AKRA 4M01A 1EYBA 5FXWA 1HLCA 2Q4VA 4MH0E 1SPPA 4WZCA 4AW7A 5A7SA 3AYAA 1P0HA 1JN2P 5FPUA 4XFCA 5KHHA 5IATA 2HWD3 1LHWA 4L0PA 2QQWA 5L19A 4WM8C 1DQ2A 4I49A 5HXVA 1NZCA 1A6CA 3U75A 4QD2A 5HPOA 3J26N 1QXRA 3B01A 2GC3A 4AHZA 4CCNA 2CDPA 5D2AA 4XTPA 5J36A 2OXBA 2PLV2 1W8TA 2ZEPA 1Y7BA 2PCUA 5JPMB 4M3CA 4KMQA 5FYIA 3DF0A 3R0RA 2QQNA 3GBFA 3WUCA 4OMDA 2VCBA 1LOEA 4W6WA 2WYSA 3EJKA 4XMIA 3EC4A 3D4KA 1CN1A 2EWBA 2BOIA 4CP1A 4JRLA 4WWVA 2JWPA 3KT7A 1HRI1 3R9FA 1RGSA 4WM7B 3NMBA 2DCKA 5LRJA 5I0SA 2R063 3KWVA 1IU8A 2ZEEA 5DDJ2 3WDTA 3CKHA 1CM0A 3CPAA 1WCUA 3J8F3 2V77A 1DLLA 2AFSA 4RYDA 5K0UB 3LEMA 3LCPA 4UEZA 1POQA 5GLUA 4A44A 2EIDA 2WKKA 1BMV1 1H9PA 4TLFA 3MRUA 4OHXA 2WWJA 2WNEA 3D0JA 4AHWA 1MACA 5JMOA 3VDCA 4E2SA 2FSRA 1S55A 4NRMA 2JB4A 1LGNA 5A6YA 3LWUA 1W8HA 3FZ3A 3JBG3 1ZBE1 2VZOA 3CXQA 1WCQA 4O65A 1C28A 2Y6KA 4XPLA 5C33A 1S7KA 1PIV2 3W6XA 1PVC3 2RFHA 1IY7A 1WD4A 1N71A 4KU8A 3TO7A 1YHFA 3IDAA 4F0XA 5LRGA 1ZX5A 2W47A 1RUD2 2XJVA 1W2TA 5EQUA 1MS3A 1YFWA 2PJ3A 4R3KA 4HZFA 2R072 4BQ5A 5A7WB 1DQ0A 5EHDA 1IPJA 1W6QB 5D8AB 2E7QA 3EFAA 2CNTA 4AI2A 3LZZA 1UFHA 3TO6A 2ZKLA 3FVLA 4CCCA 3WCSA 5DS0A 2UURA 4NPLA 1CJPA 3BJ8A 3R05A 5DWMA 2EAAA 1JH5A 2RMU2 1K12A 1GKBA 1OKOA 4TLGA 3GLJA 4QDRA 1MZEA 4FOYA 3ZXAC 2VNGA 1DDLA 1WLWA 4NGRA 4GXHA 5AFEA 1AZDA 1G9BA 4KZTA 4QXBA 1TXRA 5G21A 4A94A 2Z4FA 3NH8A 2QVSB 4XJ9A 3OBRA 2AGSA 4MI4A 5CPAA 3BXMA 2O8OA 3KQXA 1I1DA 4GXLA 2B4BA 2ODFA 4LBLA 3RG0A 4RN7A 3B02A 3ZZIA 3JD73 2VNRA 2YHJA 4O7XA 2GN7A 2JD4A 5E1RA 1YQ2A 2DCYA 1JYNA 4UW3A 5D8NA 2XBO2 2WQZC 1W06A 1QSNA 1L7RA 4YG3A 4PJYA 4W8JA 5FPVA 1RUI1 3DGVA 1Q43A 3ITQA 2CWSA 4GQ7A 4F9UA 1AUYA 2CGPA 1OFNA 4OC0A 3NL1A 1QDOA 4PI2A 2DDUA 2ZGNA 4LA2A 5FZ4A 2CXAA 6CPAA 3U37A 3MF9A 5JXGA 3VH9A 2DV9A 2VQUA 4MHYA 4TWEA 4CU6A 1W9SA 3BLNA 2GC0A 2C5DA 1KZFA 3DXUA 1H6YA 3SJXA 5FO9B 4ZPIA 4LUMA 1LOKA 2OB0A 5HV4A 3VZLA 3ZYRA 2RS53 4PXDA 3VKLA 1GQGA 2JG9B 3RNZA 5FFOC 4PQAA 1NLQA 5AVAA 4P4DA 3NE7A 2HEWF 4ONWA 2VBPA 3K3NA 2V8HA 2P37A 2KD7A 3ALQA 1HRI2 2WYRA 2AH2A 4LIVA 4P9XA 4XUQA 4UWDA 4CEWC 1D2SA 3PB9X 1YQ6A 3H8GA 1LCPA 1IB1E 3M3QA 4GIQA 4J1WA 1Q5OA 1NCQA 5C3SA 1D4M3 2ZX0A 3ABZA 3D4UA 2OPWA 5DXDA 4R57A 4U9ZA 4N8MA 3KHZA 2QQLA 1Q8PA 1BQPA 3ST7A 3MEPA 2VI7A 3VKMA 4XNHB 1IZ3A 3W9AA 3RZKA 3QLQA 1W8ZA 3IFEA 2VULA 1BMV2 1R3NA 3PVBB 2PELA 1YRZA 1Q8SA 5L7OC 2JIGA 5FZ1A 2H0BA 5H9QA 1VMJA 4OLLA 1FMD1 3O0WA 5A3UA 3LA2A 2HUZA 4UBRA 1HDKA 4MCPA 1VAKA 1XNBA 4MHUA 5FMDA 5I8YA 3OUIA 5A3NA 1ZBE2 1UNBA 2WT2A 2EVNA 2ZBJA 4RUHA 1QJX1 5CFDC 2P4EA 2ABZA 4M4PA 4JC1A 3NW4A 1AHSA 4JWPA 4PDWA 2B58A 4HNXB 3POYA 5LA2A 2Q8EA 5DUUA 4JGYB 3KT1A 3O1PA 4AHYA 1LU1A 1IOIA 2P0WA 3ZMNA 2PHTA 3I59B 3GZUC 5CFCA 1S2BA 2GMMA 1BLZA 2VMDA 1YVOA 1QNYA 5FV3A 3AMHA 1RVF1 1ENRA 3B3SA 2D6MA 2VMCA 1GNYA 1VRH1 1XIXA 2JBJA 1W8WA 1ZA7A 1FOD1 2Q8OA 1ENSA 2LALA 2G3AA 4IL7A 3O1MA 3POWA 1AR71 2Y6HA 1XB9A 3WR0A 5F48A 5T52A 2CWMA 5JIUA 2JENA 1CJDA 4IV3C 4FI9A 1GANA 1NXMA 1FATA 5T5LA 2WO3A 1RO5A 5IVEA 4KS9A 2FCTA 3WNKA 4OAEA 2TUNA 1KUVA 4XAAA 5ANQA 1MEC3 3HVDA 4AI1A 3H0OA 1LTEA 3O5SA 4FD6A 4A33A 2XEJA 4H3WA 1QQP3 4XAEA 4ARXA 4DPNA 3ZSJA 3MN8A 4YVSA 2PQSA 2YB7A 4UWJA 4XQWA 5F5IA 2UY8A 3VHRA 4S2HA 4JDNA 4QGLA 5IVCA 1W90A 5GKAC 5JOYA 1JUIA 2RJ2A 1LOAA 4OI2A 1RUC3 4ZY9A 3WNOA 2CTVA 4I3GA 1CONA 2YYOA 2C9KA 1F9KA 1NOVA 2ZX4A 4FOQA 5FK7A 4AB7A 2RC4A 5GZCA 1NSLA 5FPLA 3E6BA 3FN9A 1JS9A 4AWDA 4CRZB 5ACA3 4EN9B 4XFAA 5AG4A 4MGSA 4ES9A 1CPSA 1DBNA 4E8OA 5FY4A 1XSQA 5CNPA 3AP7A 4H55A 3I4IA 1BBT1 3WHUA 3KVAA 2YU2A 3IPVB 5FIXA 1VR3A 1DF0A 3JQWA 2WBKA 3GYAA 4AFCA 3GBWA 3C8XA 1QH7A 5C5TA 4CTEA 3IKWA 3R6SA 2WA3A 4KG8A 4E2GA 2PRQA 4PIYA 2R1IA 5AFBA 1DFQA 3AM2A 1W8FA 3LSEA 5FY0A 1GZWB 4DINB 4XZPA 4XVHA 1AXKA 2JDPA 3KD4A 1UKRA 1AL23 3SC7X 4BA6A 4YM0A 3N7KA 2GMPA 3I3GA 1SMVA 1K5MB 2OX0A 2ILMA 1XNKA 2ZCWA 4N53B 2B3VA 1OUSA 2Y8KA 1AR93 1FY7A 1QJY2 3MIEA 5JPHA 5FBJA 3HR9A 3T9YA 4IEXA 2D40A 3E5QA 4D7YA 4BMHA 4XQ4A 4NGQA 2GC2A 3WF3A 4XXAA 4A2UA 2I2SA 4HK8A 3AC0A 3DV8A 4XFGA 3EQEA 2OVUA 3U0ZA 2GNBA 1F5JA 3FHAA 1WA6X 1V6IA 1KDMA 1Q2CA 3ZKYA 2HWB3 1U6MA 1AX0A 4MZUA 3IIIA 4JYWA 4ES8A 5C82A 4A30A 4JGZB 4X3RA 5FUIA 1I12A 3USUA 1EPZA 4NEXA 4XBQA 4WVMB 4AI8A 1N1VA 4CCKA 4L8QA 4IUGA 3I2JA 2LUWA 1Z8WA 1ZBA1 4AE2A 4H14A 2ZEMA 3NA6A 4ZONA 3LD2A 3WF0A 5F47A 3AMNA 5DZEA 4CDQC 3I2HA 4A4AA 5HBAA 1O4YA 1FMD2 1Q56A 2IZWA 2J7MA 4RS2A 4M00A 2YC4A 3RQ0A 2GSYA 2WNUA 3AMPA 3TN93 3ZSEA 3FJSA 2HV2A 3H8RA 3QAYA 4AVVA 1QJX2 2REEA 2DF7A 3HUVA 4GB33 1WW4A 5JDBA 3HBZA 4GKXA 3OBZA 1YR0A 4R9BA 3ZJ0A 2BBVA 2Q1FA 1LNSA 2BRTA 4M0NA 4YVWC 3RO0A 1SFPA 4NF1A 3SMHA 3CPXA 5CKQA 1UX6A 2ES3A 1GP6A 3HBKA 3PBBA 2DVDA 1D0HA 1LOFA 2PC1A 4DFSA 1RVF2 1BVP1 4R87A 3OGVA 5AG7A 7CPAA 3CHXA 4JLYA 3M3EA 1FOD2 1MZFA 1NE4A 5IFTA 2CSGA 3AZWA 3NVCA 1MS4A 2JICA 1Q2DA 1HN1A 3ZN5A 1WLCA 2ZEOA 4CAEA 2A71A 1XNAA 1OT5A 2E32A 3BODA 1GUIA 4L9BA 3OPZA 4K1YA 2G4IA 1W0PA 2FDKA 5JR2A 1HRV1 5FLIA 1W99A 4A3ZA 2RB7A 4E4DX 2VOXA 1OBRA 2JDUA 4AFAA 5EZWA 3SEEA 2XGXA 1UOFA 4ET7A 1ZRCA 1TMF1 3POBA 4FP2A 3GKRA 2K2SA 2XR4A 2W46A 1JYTA 2BSWA 5FZHA 2LW8A 4WM7A 3DKWA 4DEQA 4FFGA 4Q4X1 2Z3PA 2R041 4Q4V3 1BLLE 1GWKA 2G19A 2A4NA 2OUJA 4XJAA 4JTNA 3VLBB 1KJRA 1TME3 2ET7A 2PHFA 4EQVA 3IWGA 4YZ3A 5HCAA 1VALA 3O0XA 2YDEA 1NZIA 2ZGMA 1W6PA 2PJ4A 1BYHA 4C2YA 2W08A 1PHMA 1VJ2A 5K0UA 4D3WA 3WG4A 2GFQA 2GP5A 5C4WB 3BIEA 1BBT2 2EICA 2WNUC 3DECA 2Q04A 3RWKX 3H4QA 2PAMA 3B3QE 2QDNA 3H3LA 4PK3A 3THTA 4Z82A 4XUNA 1EP0A 3UGHA 4CP2A 2IXKA 1H4HA 3LFMA 4C91A 3H9AA 2VNOA 3SISA 3LIHA 4GULA 1W28A 2CY6A 4PBPA 2JXAA 3UY5A 1X82A 4G9SB 3ZSKA 2E33A 1NSAA 5EWSA 1R1ZA 2P6CA 4MHDA 4UYBA 1LOFC 3RDIA 4UFXA 1SLLA 1RXGA 1YJKA 1RUE2 2XXZA 4XFBA 1NYWA 3MPPG 5I8TA 2PFWA 2B4DB 3KS7A 4CAVA 4AVBA 1WZXA 4ORFA 3AP4A 3CZXA 4M3CE 1MS8A 5A7WA 4RSUA 4Q0PA 4IE6A 4Y20B 1W8OA 4IEZA 1W6QA 4JQTA 5D8AA 3BHXA 1JTZX 4UF0B 4P9IA 1W39A 2ID4A 3RYKA 4YRHA 1XU1A 4MFJA 4DOUA 2HWD1 1EV11 5KC5A 1RUOA 3KHBA 3FUQA 3RPQA 5LBFA 4CDWB 4X2TA 1SEFA 3S6KA 4IUSA 2ZEXA 2IWGB 5JSRA 4LX9A 2D3RA 3PVEA 4LO8A 3ORJA 4CCLA 2PHUA 1JHJA 1XSRA 1ZBA2 4A95A 3RAMA 5H9PA 2CL2A 4A38A 2HEVF 3LOBA 1LU2A 3JVNA 3X29B 3LQCA 4CPBA 3BN6A 1U5YA 4KWUA 4NUBA 3FX6A 5GLWA 1UYXA 4QAWA 1S0IA 1PGW1 3VBSA 2GE3A 1F2OA 5LW9A 3Q8BA 2Y34A 3RI9A 1IS6A 2CNSA 2E63A 4F8ZA 2Y38A 2VGDA 3IBMA 1PNFA 4P4EA 1POV3 3ZIXA 2WIIB 3QOPA 3WOGA 5FMOS 4CVUA 1SZBA 2BEIA 3J8F1 1OVPA 2WS93 1QNWA 3BIWE 4I30A 5GCNA 3QAHA 2VG9A 1SBFA 3ES1A 3KZ4C 4LK6A 1O8PA 2DFCA 4UI9L 1DZTA 3WP5A 1GYKA 4BQ1A 5F39A 2IXJA 2GLJA 1YREA 5FLHA 4R8FA 2DBNA 3DPRC 5DAWA 2VD7A 3KZWA 4YW4A 3ZYPA 3MW3A 1ONAA 3KV6A 5T55A 2ARHA 2D6NA 1HRV2 1WGPA 3CMGA 4UWIA 1PVC1 5JZGC 2OR4A 5EXOA 1W6MB 3GUXA 1OKQA 2RDRA 4UXAA 2XH6A 4BQWA 4BH9A 2HBUA 2YU1A 4FXGB 4B4QA 2HWF3 5FY7A 2YC2A 5FP9A 1YYNA 4I02A 1H8VA 4YFZA 2Z3OA 1GZ9A 4JKKA 4PSXA 1UAIA 2GALA 2FQPA 4W50A 2NM1A 3GBGA 5EJ1B 5JI7A 5IVFA 3BTXA 4IEOA 2IFWA 3A21A 1Z8TA 5SV5A 5AVPA 1AXYA 3MUZ1 2A1XA 2RDNA 4C1XA 5F3CA 2FIWA 1X7NA 3E5UA 2N7GA 4Y49B 5F46A 2RS13 3VBSC 3VHPA 1BEV3 3OCPA 3I1UA 4FO9A 1C4RA 5LY1A 3JU9A 4YGOA 4JVAA 5I0CA 1AR61 3A4UA 1Q8VA 2B9VA 2DTYA 4Y22B 4R9MA 4GKYA 5JR7B 2BBAA 3UGGA 5KXCA 1GNHA 2NMOA 4FBEA 1V6OA 4Y1XA 4ZHNA 1HB4A 4MV2A 4QPIB 4KL1A 4X8NA 5A6QA 2RDQA 3AP9A 2YBKA 3WEZA 2WA4A 1CG2A 4PCRA 1IKPA 1DZRA 4BOWA 4XJUA 2Z0ZA 4LTAA 5FJHA 2JG8B 2X5IB 2WZR3 3POEA 5CISA 2OIIA 4LXLA 1QKQA 1OA3A 3F0AA 4NR1A 3JD71 4FTBA 4GA9A 3NNMA 4JGYA 1M4DA 2OQ6A 4KOWA 1BO4A 1WBLA 4QDQA 1ZLIA 2EF6A 4AI0A 3I59A 4Y5Z0 3LF7A 4IV1C 4FFHA 4QM8A 1AR82 1AYN3 1DQ1A 3NKTA 1XXNA 1DQ6A 2ADEA 4HSJA 3N7JA 5I0DA 4CYQA 2FMYA 2DFBA 3RGBA 2VEZA 5I0RA 3RZAA 1GWMA 1J3RA 4NO4A 1EV12 3ENRA 4YZ2A 2QJ8A 1O7FA 3TOBA 3IU2A 1BAVA 4YSFA 1CAXB 3DL3A 4OMEA 1Y9QA 2K9ZA 3J7HA 5FYBA 1RMU2 3ISZA 4JKLA 2OW4A 4NWWA 2RS51 3A7QA 1QOTA 2BCOA 4LHLA 1G9CA 1IGBA 1ZA4A 4XJZA 1XE0A 4JZ0A 3H1MA 5IV0A 1BHGA 1PGW2 1I9RA 4MFQA 5GZEA 1O3QA 3ZDVA 5F2WA 2VMEA 3GJAA 3B3VA 4U9YA 1SFNA 2BL1A 1W2OA 3ZPOA 1S3ZA 3E1F1 1DQ4A 1HDQA 5JSOA 4N9IA 4URTA 4QPGC 2Q4ZA 3Q9OA 2Y60A 2XQXA 2WZPP 3FNCA 5IHRA 2NQYA 3GHMA 4O9GA 2JEVA 2YV8A 1D4M1 4TWTA 2C6GA 4BXSV 4OULA 4OMCA 3AX4A 3EHKA 5J09A 2B9UA 1RUJ1 3AKQA 3N36A 2XUEA 3IPVA 4OQ9A 2WZNA 5DUWA 3PLQA 4BHPA 4KI5M 4AG4A 2DEAA 5J8FA 1WK4A 2P6EA 4FVVA 1EUTA 2GREA 4ZS3A 4FPFA 3VN4A 2J1TA
chains in the Genus database with same CATH topology
2WNVB 3WLUA 4XTPA 5J36A 2PLV2 3MIHA 4KH9A 3ZSMA 3ZXDA 1HX6A 5ACA2 4QHBA 4R4ZA 4YYOA 1Y7BA 2AENA 4R3LA 4OHWA 4CRYB 1FV3A 1TME1 1Z78A 5J96B 2A6XA 5AGEA 1IGOA 1QSMA 2XJTA 1PZ8A 2YUEA 4I01A 2XLGA 1YLLA 5JPMB 4TSVA 2DURA 3M8LA 4M3CA 1AR81 2I79A 4P9LA 1U12A 1ULEA 3DF0A 4NSQA 3AYEA 3R0RA 4AFDA 3PMEA 1WLDA 1GZWA 3GBFA 3WUCA 1QDCA 2XWBB 5H86A 1YO8A 1LOEA 1EAH1 2WNVC 3BTAA 4OUSA 4W6WA 5BNNA 2D6OX 1H2LA 3EJKA 4FPEA 4XMIA 3EC4A 2GAUA 3D4KA 5EBVA 1CN1A 1I21A 1BBT3 4JRLA 4CP1A 1QSTA 2QMLA 1VAMA 1S0JA 4KVME 3KT7A 1HRI1 1I3HA 4P5HA 3R9FA 1RGSA 1Y9KA 4XQDA 1R1A3 4YZ4A 1K5MA 4WM7B 3VBFC 2DCKA 1DU3D 3MLKA 4LBQD 4RR3C 1VBB1 2BGCA 3HWJA 4YW1A 5I0SA 1RIRA 4N53A 4ZBGA 1GZCA 2R063 3L2HA 1LHUA 4ZXKA 3FX3A 1RUNA 3ZFGB 1U0AA 2XLAA 1VBA3 5DDJ2 3AJYA 3KCXA 5IK7A 3M7AA 5A33B 1FPN1 5T5JA 3I9SA 3N7MA 3WDTA 4RS5B 4A32A 1CM0A 4KGGA 4M3SA 3J8F3 5EJ3A 1HQLA 4WM7C