4OLLA

Camp-binding acyltransferase from mycobacterium smegmatis
Total Genus 86
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
86
sequence length
333
structure length
316
Chain Sequence
VAELTEVRAADLAALEFFTGCRPSALEPLATQLRPLKAEPGQVLIRQGDPALTFMLIESGRVQVSHAVADGPPIVLDIELIIGEIALLRDAPRTATVVAAEPVIGWVGDRDAFDTILHLPGMFDRLVRIARQRLAAFITPIPVQVRTGEWFYLRPVLPGDVERTYRRFQSVRKPTRALLEYLFEVDYADHFVWVMTEGALGPVIADARFVREGHNATMAEVAFTVGDDYQGRGIGSFLMGALIVSANYVGVQRFNARVLTDNMAMRKIMDRLGAVWVREVVMTEVDVPPVDTVPFEPELIDQIRDATRKVIRAVSQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords Acetyltransferase Pat
publication title Allostery and Conformational Dynamics in cAMP-binding Acyltransferases.
pubmed doi rcsb
source organism Mycobacterium smegmatis
total genus 86
structure length 316
sequence length 333
ec nomenclature ec 2.3.1.-:
pdb deposition date 2014-01-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00027 cNMP_binding Cyclic nucleotide-binding domain
A PF13302 Acetyltransf_3 Acetyltransferase (GNAT) domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.10 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 4ollA01
3.40.630.30 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Aminopeptidase 4ollA02
3OF1A 3P2HA 1HW5A 2IXIA 3BB6A 1J3RA 1NMTA 1YLLA 4IUSA 2ZKLA 3S7IA 1XF8A 2NMTA 2R1IA 1BOBA 2FXFA 3OWCA 5I0RA 2G3AA 4PK2A 1YHFA 2EVXA 3ZZIA 2ATRA 4CAXA 1Q2YA 4R87A 4RD7A 2MHFA 1M4GA 4META 3D2PA 1EP0A 2B58A 4QGMA 4FD5A 4B5OA 4HZFA 1I1DA 4HNWB 4K30A 4I02A 4Q29A 3PP9A 1H1IA 2XKPA 3FFQA 4EROA 1YWKA 3FIXA 2BEOA 2D4PA 3TCVA 5FDBA 5AVPA 3SCHA 3H1WA 5C6CA 2PC1A 4KLWA 5C8WA 3TNQA 2VPVA 3RYPA 1NZCA 4JTOA 3E6CC 3PZJA 4KORA 4DINB 4AG7A 1ZVFA 4KVME 1RGSA 3TOAA 3EO6A 2IL4A 4HVOA 4I09A 2OB0A 4XFCA 4CAWA 1TIQA 2VXKA 2FS5A 1XE4A 2GC1A 4PJYA 1UCXA 2XLAA 4KUAA 5I0CA 4KOVA 1MJBA 3LA3A 4IETA 3SCFA 1Z9UA 1X82A 1Q2DA 5KTDA 5KBFA 3U10A 2GE3A 1CAWA 1NE6A 4ZBGA 2EUIA 1YLEA 4CS0B 2R8VA 1LR5A 4PSWA 1YFXA 4XFBA 4Y49C 5I91A 1YVOA 4XF4A 1O3SA 2K0GA 3R6SA 2QDRA 1S7NA 3LODA 1DZTA 1J3QA 4NVPA 2P17A 3H3ZA 4MY3A 2ET7A 3C26A 1Y3TA 1LRHA 1QSTA 4WBBA 4LA2A 2DXQA 3FE5A 1CM0A 2P6GA 1WGPA 1YVKA 4R57A 2A4NA 2B3UA 2GU9A 2OU2A 2GC0A 4P9GA 1CAVA 4KVXA 1Y7RA 4QB9A 3DKWA 2B4DA 3CL1A 1I6XA 1DGWA 4D7TA 3TO6A 5I0TA 5I8YA 1NYWA 1FT9A 1XEBA 1RO5A 3L2HA 3TFYA 2GC2A 1CAXA 1JUHA 1XRUA 1WA4A 4AXOA 3D8PA 2GZWA 2VEZA 4OADA 4R3LA 3T90A 4X6QB 3ELNA 4XFFA 4EWDA 1V70A 3R9EA 1VJ2A 1SQHA 1OD5A 3SHRA 3TOBA 4BH9A 2PR1A 2ZXVA 3LD2A 1PM7A 5HMNA 4XNHC 1J58A 1OI6A 4F7ZA 2P0WA 4LLOA 1YUDA 2Q44A 4LUKA 2OZGA 2IXLA 1O5UA 2OH1A 4U9ZA 3I7DA 4KU8A 5FLHA 4QMAA 1CAUA 4IEWA 2UY9A 1IYKA 3N7ZA 3KKWA 3H7JA 4XF3A 3H1MA 3EBRA 3WW2A 3D82A 3HQXA 3KCCA 3G7DA 1NE4A 1P4NA 2VZZA 2KXLA 1GHEA 5CU1A 2VI7A 3UY5A 1UIJA 3R9GA 4J1WA 2PYTA 4HMZA 3LAGA 4MY0A 3W6XA 4LUMA 4I2OA 4BMHA 4JVAA 4XFIA 1O4TA 2IXKA 2E9QA 1YFUA 3C3VA 4E2QA 4AVBA 4L8AA 1G6NA 1ZRRA 1OMIA 1B6BA 1KZFA 4KWJA 1Q3EA 3BLNA 1IPJA 3SHPA 4E2AA 3UKTA 2JEVA 2JDCA 3CO2A 3ES4A 5GCNA 4IEPA 1KUVA 3NVCA 2QMLA 5BV6A 4K8FA 3N4MA 3VWEA 3W91A 2BNMA 3HIFA 2PSWA 4KU7A 4JLYA 5CVRA 1IICA 1FI2A 2XLGA 3CEWA 3GBFA 3IDBB 4IEVA 4LEJA 1O3RA 5DWMA 3FWEA 5F48A 3R9FA 4CRYB 4FBFA 3DR6A 2J8NA 2CNSA 3QOPA 2QVSB 4BIFA 1O3QA 1S3ZA 3FXTA 3O14A 3WW3A 1M4DA 4ONUA 4I49A 1VR3A 2F4PA 2CGPA 4EVYA 3TO7A 1RC6A 2PTMA 3SMHA 2ZW7A 2Y0MA 1YREA 2WC2A 4MGZE 1QWRA 5KHKA 1WWZA 3E6BA 1ZZ7A 1J59A 3LOIA 4PIYA 4GS4A 4LULA 2O28A 3F8KA 2B5GA 3NL1A 3CXSA 2PQQA 1QSMA 4I01A 3GYAA 4Q0UA 2Q7BA 4FAGA 2N7GA 3I54A 2H6BA 3MYXA 4YFJA 3FZ3A 1CAVB 3USSA 4KOXA 5F49A 4O9GA 2PRBA 3T9YA 1J4JA 2B4DB 2PFWA 4KL1A 1PMIA 5H86A 2Q04A 1UIKA 3FX3A 1RUNA 1OZPA 2PAEA 5FCCA 1YFWA 4MUVA 3ZDSA 1YX0A 3ZJ0A 1CAXB 3IDCB 2Z10A 3EJKA 5LEJA 3R95A 1Y9WA 4PV6A 4E2GA 5C82A 1EY2A 4IEZA 2PDOA 4NEXA 4FD7A 2ATFA 2HUZA 4XPKA 2OYZA 4IEUA 1KUYA 3U0ZA 2B4BA 4PIZA 3S6KA 3PNAA 2Q4YA 3WW4A 5F47A 3FHIB 1QY4A 1GQHA 4LTAA 4ORFA 2VQYA 5JSPA 1WK4A 4MI4A 3ROUA 1CJWA 4R3KA 2KCWA 4MZUA 4B29A 4XPLA 1O7FA 2ZPAA 4LUAA 3KGLA 3PGPA 1CAUB 4HNYB 1GQGA 2PHLA 1Q2CA 2B5HA 3EHKA 4YARA 1RL3A 4NXYA 2MNGA 3BALA 1K4JA 4IEOA 3UKNA 1I5ZA 4IEQA 5BPXA 3LA2A 2OZHA 1ZZ8A 4KWLA 2Q0AA 1S7KA 2ET1A 4N9HA 1ZNPA 2FL4A 4I0BA 4XF9A 3RZZA 1XE8A 1MJAA 3PVBB 2R7HA 4MH0E 4XFAA 1PUAA 2HKXA 2P6EA 1U12A 3RYRA 4KLVA 3EY5A 5JSRA 3F0AA 2AE6A 1RXTA 5J3UA 3FBUA 4MGIE 5EZWA 3VWDA 4QGLA 5ISVA 2REEA 3SXOA 2FQPA 3IIAA 5J7MA 4QBJA 3FJSA 3VHRA 5I93A 1YK3A 2UYBA 2ZW4A 2JLMA 2GH2A 2Y0OA 2OZ6A 3RYOA 2PHDA 3LA7A 1PU9A 3H1YA 4BHPA 2XLFA 3H7YA 3CF6E 3BCWA 3HT1A 4Q0QA 4ZU7A 2JDDA 2BL1A 2FIWA 4FD6A 4ZU5A 4QUSA 2HQYA 1Y9QA 2XKOA 2ZW6A 4CRZB 3ACLA 1X7NA 3RPQA 2O1QA 1QSNA 2I00A 5J8CA 2ARHA 4R9MA 4YNIA 2GIVA 4Y49B 3D0SA 2GC3A 2D5FA 4FD4A 1J3PA 3E5QA 3JZVA 2H5MA 3OCPA 2BYVE 4HSJA 4MGKE 1L0CA 4OLLA 1B87A 3I59A 2QIRA 2XL9A 5IX3A 2FT0A 4YGOA 5LEKA 2WPWA 5J8FA 4EV0A 3ES1A 4WZCA 3GKRA 4B5PA 1FXZA 5EFUA 1NE9A 4MV2A 4AVAA 1YGHA 1M4IA 2C27A 1SFNA 2MPFA 4N9IA 1U6MA 2B3VA 4HVQA 2FIAA 3F5BA 5I8SA 2Q1ZB 5HI0A 3S6FA 5FLIA 1IYLA 1M1DA 2UY8A 2Z0ZA 4QC6A 1TQ5A 3MPBA 3BU7A 4UXAA 4XFGA 2GAUA 4I3PA 5EBVA 5KTCA 4JWPA 3FB3A 1MJ9A 2BGCA 2Z69A 2VBQA 3H9AA 4HBNA 4L2NA 5F1RA 3IGRA 4H89A 4KOTA 3E6DA 1Q5OA 2CY2A 4QXKA 3IBMA 4O9EA 2ZW5A 3G3SA 3D0JA 5F46A 4YSFA 4QX5A 2PAKA 3EFAA 1WLTA 4XPDB 4L11A 4YRHA 3TTHA 2D5HA 5CADA 1LKNA 3NJZA 1CAWB 3BPZA 4MGYE 1UFHA 3KGZA 3S6HA 4Q0PA 5BY5A 1L3JA 1LRZA 3W6SA 4IESA 1N71A 4XFHA 3R96A 1FY7A 2EVNA 3EO4A 4KUBA 5JSOA 1X8EA 3DL3A 3CXQA 2FE7A 5KHHA 3I3GA 4L89A 2BNNA 3P2FA 1NSLA 4HVRA 2IXCA 3JVNA 1CX4A 1EYBA 3CJXA 3G8WA 4AVCA 5I8TA 2CNTA 4HKFA 4H7LA 1P0HA 3WW1A 3RDIA 1H1MA 1UD1A 5HH1A 3FRMA 2J8MA 4JV4A 5T3NA 4CYDA 1XE7A 2Q4SA 3IWZA 3DSBA 4QGNA 1RUOA 1QSOA 1QSRA 1ZZBA 3HT2A 1J1LA 4HN0A 3B02A 5JCTA 4M3SA 3H3UA 1DZRA 3E5UA 2OZUA 4AQ2A 2GANA 3D3SA 1IPKA 2PAMA 1UW8A 2BEIA 4F0YA 3PLQA 3S0MA 3QAHA 1ZZ9A 4NCZA 4R8HA 3U11A 3DR8A 4IF5A 4I0AA 4X6RB 4J3GA 4QVTA 4UBRA 2J8RA 1O5LA 2CAUA 2XL7A 2V09A 3CXPA 4YYOA 5FQ0A 1QXJA 3QB8A 2CNMA 2BNOA 1V0CA 5FVJA 4MX3A 2ZCWA 4TLFA 2I45A 2OPKA 3R1KA 4KWKA 4YRDA 3B8GA 4U9YA 5K8SA 2F5IA 4R52A 2REFA 3I59B 4Q0VA 4KOSA 3TT2A 2VZYA 4IEXA 3D2MA 4JJXA 2K5TA 4LA3A 2X7BA 4LX9A 3OGJA 3E5XA 3E97A 5I0SA 4FAHA 2EAAA 2K9ZA 3KMHA 1VP6A 4B5PB 1QXRA 2OZJA 1SQ4A 3QACA 1I21A 1XIXA 2FCKA 3V8IA 4KZTA 2CAVA 1ZRDA 1S5KA 4JXRA 1Q43A 3RYKA 4E8OA 3H50A 2UYAA 2ETEA 3NW4A 1R57A 2R98A 4II9A 4RS2A 3KSCA 1S60A 1KUXA 4CAVA 3UKVA 5JPHA 3BJ8A 5EC4A 5FPZA 4DNCA 3LWCA 3S7EA 1BO4A 2AJ6A 1VKCA 4E2SA 2VECA 4JTNA 5IB0A 1Z4EA 1ZREA 3JUWA 3M3IA 2H0VA 4QM8A 4OAEA 3GYDA 3NSTA 4AB7A 3H8UA 3CLPA 2BUEA 4F6AA 2H6CA 2OA2A 1S7FA 1M44A 4HN1A 4NF1A 5FLJA 4H6UA 5IV0A 2QECA 3DN7A 4AQ6A 4BYYA 4IERA 1ZZ6A 3IWGA 1IB1E 1ZRCA 2XGXA 2VQAA 4E0AA 4FT8A 4J1XA 5E16A 3OD0A 1SEFA 1I12A 4JXQA 4U5YA 2Q0YA 3NKTA 4Z82A 5C88A 4AG9A 2PQ8A 5JAXA 1EPZA 1CGPA 1VHSA 2Z2SB 2D40A 4GULA 5FPXA 2QNKA 1MK4A 1ZZCA 2B5GB 3EXNA 3S6GA 2QJVA 5I0UA 3EC4A 4F8AA 3M70A 2O8QA 4PSXA 2QCSB 4EWAA 2FSRA 3ST7A 1ON0A 3FYNA 5LRRA 3NE7A 2RC4A 3SXNA 4MJ8A 5DWNA 2HV2A 1ZRFA 4MBUA 4OFGA 2EA7A 1XMTA 1S7LA 4X5KA 5J48A 3WR7A 2WFPA 3OTFA 5KHJA 3SXWA 1YR0A 3LZZA 4XPDC 4Q0SA 1RTVA 2C0ZA 4UBGA 4WVZA 1YFYA 2P6FA 2IC1A 4XNHB 4A2UA 4RI1A 4PK3A 5E1RA 3TNPB 2Q4VA 3K9UA 1UPIA 2CV6A 4XETA 2XHKA 5FQ0B 3BJ7A 4UBHA 2Q30A 4NSQA 4XEZA 5LRSA 4QM9A 3E0KA 4EWEA 3DNSA 4HNXB 5JQ4A 1LB2A 2D93A 3ETQA 3GY9A 2G3TA 5KTAA 4M85A 1X8MA 4KOYA 5KHGA 1OFNA 4H6ZA 4IEYA 3EQEA 4D7SA 3MZHA 5D1IA 3MDPA 3RNSA 2B9UA 4HLTA 5JR7B 1O3TA 2PR8A 2I79A 1Z4RA 2Z11A 2HJIA 2PA7A 3TE4A 2IXJA 4XF0A 1NXMA 3DV8A 5H84A 4UWJA 3MGDA 4MHDA 5E96A 3FNCA 2G0BA 5CNPA 1IIDA 2WPXA 3I9SA 2B8MA 2DCTA 5BUVA 1DGRA 4PIXA 1Y9KA 4KOUA 2D4OA 2FMYA 2IXHA 4ZU4A 4JD6A 4KVOE 4HSLA 4KOWA 5BXXA 4XF1A 3DDDA 3H4QA 4UA3A 4UWIA 3TO9A 1ZX5A 4Z07A 2BSWA 5KHIA 3SCGA
chains in the Genus database with same CATH superfamily
1V6NA 4JYWA 2ZX2A 2IXIA 3FMGA 3ZFFA 1PYTB 1DGLA 1PZ8A 3ZM8A 4HANA 1M4GA 3BOWA 4B5OA 2P34A 4GWJA 3FFQA 1KJRA 2ABZA 3SCHA 1W6PA 5AC91 5FZ1A 1DP0A 2JXAA 2W1UA 3KV4A 4NMIA 2UU8A 2VXKA 4XDPA 4CDXC 4IE0A 1Q2DA 5JOZA 2XH6A 3C2UA 3ZOIA 4BK4A 5JXIA 2R49A 4E4DX 3VBHC 1IS6A 2PIYA 4PLMA 3R6SA 2W08A 5A32B 3GLJA 1BJQA 1BZWA 2B3UA 3TO6A 3ZYIB 1NYWA 4JGZA 3WNKA 4N7UA 2D97A 1EV12 3AYCA 4FTBA 3R9EA 1CWPA 2HWF2 2E63A 2EXKA 2ORZA 4P4EA 4QMAA 3N7ZA 1RUH1 1RUC1 2VZZA 1BAVA 5CU1A 4ISQA 5IVCA 4LO7A 3WD5A 3BYWA 1BEV2 3KQ4B 3CDZB 4L8AA 1X36A 4Q4V1 2A3WA 1IPJA 1LEDA 3WF2A 2JDCA 3SEEA 3OUIA 1QJY1 3KR5A 3VKFC 5AGEA 2E32A 3PVOA 1FNYA 1IICA 2QE3A 1HB2A 2JKBA 2VW0A 1BMV1 3HAGA 5JOYA 2DFCA 4QQPA 1LAPA 2ZGKA 5FYSA 2VXRA 1ZZ7A 3LOIA 2GALA 2PQQA 1XNAA 5DABA 1RJ7A 1W6MA 3KHBA 3BODA 4B12A 3SJXA 2RM22 5CKNA 1AL21 5L9BA 2VXJA 3VDDB 2FDKA 1QY4A 4LTAA 4MI4A 5DN2A 3EHKA 1MEC2 4ZY1A 2MNGA 4K1ZA 1LHWA 1FT7A 3LA2A 4N9HA 1ZNPA 1XRYA 1MJAA 2QFEA 2VL4A 3GM8A 2GREA 4OQ9A 1W6OA 4XQWA 3U37A 3ORJA 3ZO0B 3ALQA 4NPMA 2E7AA 4C91A 4B8EA 5JIUA 2Y6JA 3IIAA 4CRQA 4BDVB 3PUHA 2JENA 2UYBA 4YW1A 3RYOA 3H1YA 4A6SA 2FIWA 3PFEA 1NZIA 1MS3A 4UW6A 5FZLA 4OMDA 4MGKE 4MCSA 5CPAA 2KR2A 2XL9A 2WT2A 5EJ3A 3USUA 2X5IA 3S6PA 2WPWA 3J26N 2YC4A 3Q8CA 3B9CA 2Y6HA 2VNOA 4YGDA 2YUEA 3DPRA 2ZACA 4KSIA 1GLHA 5CNAA 2PHUA 2CDOA 4K6BA 1TQ5A 4UXAA 3VZKA 4NAOA 5BNOA 1REDA 4HBNA 2JD9A 3ISZA 3FEEA 1CAWB 3B3QE 3EO4A 2IFRA 4IAVA 1NSLA 1Q8QA 3ZIXA 3O7OA 3ZFGA 3SLIA 3RZMA 1XOVA 5A7SA 1RXGA 4CYDA 4QGNA 1QSRA 2V72A 1ACCA 1MS8A 1X10A 2OZUA 4ONWA 1KEXA 2BEIA 1ONAA 4UBRA 3V7ZA 1QXJA 3QB8A 2C9AA 1FV3A 4W9YA 1BEV3 3W5MA 1SDDB 4YRDA 4U9YA 1GP5A 2FD8A 3TT2A 3NV3A 2ERFA 3MI8A 2EAAA 5KXDA 1MVQA 1XIXA 1R082 4OUSA 1RINA 4CDUC 3RAMA 2OQ6A 1UKRA 1BPNA 5BWAB 5HCHA 1Z8XA 5IB0A 5FYYA 2ZX4A 3GYDA 3NSTA 4FWUA 2AFZA 2ZEZA 5DPNA 4J1XA 4NGPA 1SEFA 3IO1A 3ZR6A 2HWD3 2RM23 4H2AA 4EWAA 3LGRA 3WDUA 1ZRFA 3EYPA 5HVFA 3POBA 1MEC3 2Q4VA 4BIOA 4CYQA 1IG3A 2GMPA 4GMP3 2W68A 5KR7A 5A3UA 1VGYA 5IHRA 1GZCA 5JUVA 4EN0A 2ZEXA 2XDVA 2WUUA 4XF0A 3IEHA 3TEXA 4FFIA 3I9SA 1AXZA 4PIXA 1VBA2 1QQP2 1V9U2 1UWWA 5CIRA 4YW5A 3T08A 2WZR1 4AEDB 3VZLA 4KOWA 3U14A 3MFAA 3BB6A 1DQ0A 2QQMA 4R7MA 4PK2A 4OC0A 1KFXL 4Y22A 4K30A 2D6KA 2HB6A 2LUWA 5LWBA 2ZELA 1DLCA 3NNJA 3J8F2 2MEV2 5AVAA 2G9DA 2GC1A 5E6HA 1UCXA 2DWRA 1Z9UA 4ZBGA 3V0AA 3AB0A 4FXGB 2Z3NA 2JDMA 4AQTA 1SCSA 4Y49C 4QPIA 1PO11 3WEZA 4NVPA 5A6YA 5A7PA 4QHZA 4YVSB 3LFIA 5EP9A 4KVXA 1Y7RA 5JWPA 2B4DA 4XBQA 1IKPA 3Q8EA 1YQCA 4BMEA 3KCYA 4XFFA 3BKZA 4QPGC 1OD5A 1UY0A 3KQXA 3LD2A 1LGNA 2YGWA 5F32A 2UY9A 3I2GA 1TME2 3P1IA 2DF7A 1NE4A 3UY5A 4MFKA 1R083 4CZSA 4LMFA 4P4FA 1NCQA 4IE5A 2ZHNA 1PK6A 5EJZB 3MV01 4YM3A 1N3OA 3ZXEA 4XACA 5BNNB 2J8NA 2CNSA 2ZZQA 3KQRA 2WWJA 4DO0A 1JZ3A 3OGVA 3WNNA 3UV9A 1LGBA 1WCKA 3FFZA 1C28A 5A3NA 1Y7EA 3SC7X 4UEEA 5AG6A 2NN8A 3HMYA 1YFWA 4MUVA 3RJ2X 5JM6A 4FOYA 2WS91 3THCA 3GZUC 3I4IA 5AFEA 2D3PA 3JQWA 2WO3A 2HUZA 4XJ8A 4LBNA 4XPVA 4XPLA 1PZ9A 5FXXA 1RUE1 2PJ2A 3BALA 3UGFA 1K4JA 1JH5A 4BXFA 4LPLA 1XPWA 2ET1A 4XFAA 1QQP3 1V9U3 2FBEA 1NCRB 1Z7S2 3VBRA 4UW3A 5E88A 4BHPA 1K12A 2O1QA 1CZVA 1B87A 4FUUA 4AYUA 5LBCA 1W28A 1KRIA 3J8F3 2MEV3 2ZJCA 2P3IA 1VBC1 2W92A 3RFRA 1S4CA 3T4HB 1AYM2 3MHZA 1J83A 3WR0A 2VCMA 4GH4A 5HI0A 3PB6X 5EBVA 4A94A 2VQ0A 1H8VA 3O1VA 1NLSA 3THPA 1LKNA 2B46X 2ZENA 3I2KA 4BCUA 1IGOA 4D6QA 4HVRA 4YWAA 3PVNA 3VDDC 3GIUA 4ISRA 1NAEA 1FAYA 1L7LA 4XCBA 1TME3 3OUJA 3D3SA 1IPKA 2PAMA 1WKYA 3FVLA 4BZ4A 1PX4A 4XCAA 1VB2A 2VZRA 2CNMA 2ID4A 3R1KA 3DGTA 3OSDA 4R52A 4GMP0 2DTYA 2YBPA 4E9KA 4MOAA 4G9SB 2VOVA 1H0BA 1VP6A 1QXRA 3QACA 4K1YA 3WX5A 3MLJA 2VUJA 2AC1A 5T52A 2YV8A 1AYN2 1C5IA 4RS2A 1RHI1 3JQXA 3O1MA 2QKDA 2QQWA 2ZBJA 1VLNA 4XMIA 3VDAA 1UAIA 2WNUC 5LCWL 3IMNA 1LHVA 3IWGA 4GD4A 1IB1E 1ZRCA 4NGRA 3LIGA 4CEWB 2ENRA 5DZFA 3K46A 4MFQA 5C4WA 4LKSA 5A6QA 5KHJA 5IK8A 2RDQA 2XVLA 2CTBA 2BV4A 1W3VA 2CV6A 4DNYA 4OZXA 3DNSA 6CPAA 4M85A 2V77A 4A30A 4IEYA 3MZHA 3RNSA 3MDPA 1LOKA 1Z4RA 3GHMA 3T30A 3HWJA 1W05A 5GZCA 1E5RA 2VC9A 1Z7S3 2X29A 4XBLA 3I49A 2DYCA 1AR93 5CNPA 4JHZA 2OX0A 3LE0A 1AVBA 4BISA 4AVSA 3PU3A 5FYHA 4DXRA 4IUSA 2GLJA 2OR4A 1YHFA 3TAYA 1SBFA 1AYM3 2QQOA 2YDEA 5FZ0A 4HNWB 4E8DA 1YWKA 5JZGB 5AVPA 3PZJA 3NAPC 4ET7A 4JQRA 4NGSA 5CFCC 4Y1UA 2GE3A 2GH8A 3NJXA 4IE6A 4MYEA 3ZXAC 2EUIA 3VD9A 1YVOA 1VALA 4F9UA 1TE1B 1VAKA 3LEIA 1NA1A 1PNGA 1QSTA 2Q43A 1YVKA 4R57A 2ZGSA 2A4NA 4QU1A 2JJ6A 4P9GA 4B7KA 3GB0A 4I0WB 4L97A 1XEBA 1FMD2 1RO5A 3ZYGA 4BE3A 4OADA 1CZSA 1Q8VA 4FPFA 4EWDA 2X05A 2HWB2 1J58A 2VAUA 4XUPA 2OZGA 2OH1A 5GALA 2D44A 4JRAA 2WNOA 1UU5A 2VO5A 3ZXGA 1YIPA 2YNCC 4PXBA 4QQHA 3F2ZA 1OKQA 4HPSA 3R4DB 3U78A 3X29B 4ZY9A 3B3SA 2W0XA 2JEMA 4D69A 1JODA 2IXKA 3TEYA 1AYN3 1GYTA 2VU9A 2NMNA 3MEPA 4N53A 3O5SA 1HQLA 4BMBA 1A6CA 4QDQA 5IATA 3NRUA 2Y38A 1DTDA 4AEDC 3W58A 1LOFA 1OLQA 3M2MA 3JD71 4OC1A 2YBSA 2AREA 2C4XA 2D3SA 4CRYB 2QVSB 1S3ZA 4IV1B 1VRH2 3SMHA 4MGSA 2GSYA 2WC2A 1OQEA 3T3YA 1M06G 2WAOA 2Q7SA 3MYXA 3FZ3A 1W8HA 1XQNA 5F6LB 3IB3A 3FX3A 2Z10A 3DECA 4NRQA 2V8DA 5GZDA 1EY2A 2ATFA 2D7FA 3RG0A 1PNFA 4ARXA 3VDCA 2PHLA 5FPAA 1GZTA 4YVSC 1PM4A 4CDQA 5LYIA 3G6JB 3PVBB 3WV6A 3AVRA 1C1FA 3IMMA 1A78A 3FBUA 2J1TA 4YM0A 1PU9A 4B7EA 4UIBA 5CG9A 4DYOA 1WMEA 3I2DA 3OBAA 1GUIA 1RMU1 2HEYF 1HV0A 2VZSA 4GB31 2PE3A 1YQ5A 3FLPA 2I2SA 3B93A 2CTCA 1RVF1 4PQ9A 4QKBA 5A3MA 2P5BA 5FOBB 1S2EA 1YLOA 2ZGPA 1V6LA 3TBDA 4H89A 4L2NA 4QQLA 3HNBM 2Y64A 3IBMA 3FF3A 2ZX1A 3AZYA 4Q4Y2 1XBFA 5IVFA 1FY7A 1FMD3 5FUIA 3I2OA 2GDFA 2X09A 5CISA 4CUAA 4OIDA 1UD1A 3W20A 2HWB3 2YYOA 1JN2P 2XB6C 4XIOA 3KI9A 3HBZA 1MVEA 3JXSA 4I0AA 2BBVA 1A2ZA 3ZIWA 4XILA 1JHJA 3IPVA 2BNOA 5K8SA 4RS5A 4KOSA 1OC1A 3VKOA 2PJ7A 2BWAA 2VZVA 2XG3A 1NCRC 3RZAA 2OIIA 2XVGA 2OZJA 1W90A 1CJDA 3CMGA 3NW4A 2RDNA 1WW4A 5EYYA 3NFZA 5HBAA 4PBPA 3UKVA 4S2FA 1VRH3 3GCXA 5LA9A 1O4YA 1DQ2A 2VMGA 3N9OA 4HN1A 5D8AB 2VQAA 4Z82A 2VCAA 1CPXA 1ZG7A 4F8AA 3CJIC 3VHPA 4PSXA 2C6CA 1QJX1 4URAA 4C0HA 2YGLA 2JD4A 1FOD3 5F2WA 5KXEA 2VBPA 2YFZA 2VM9A 2JWPA 4AHYA 2FZ1A 5KHGA 4BLIA 2VH9A 3GJBA 1TMF1 1HV1A 3OY8B 4QB6A 3FNCA 5BNPB 4OQ8A 2RS31 1JI6A 4OHZA 3FLTA 1Z5RA 2JG8B 2BSWA 2VZPA 1J3RA 4B4PA 1BOBA 1AR71 4CAXA 5LYDA 2B58A 1NUKA 2OQ7A 3H8FA 3RZJA 3BVCA 4LHLA 3WG4A 2VPVA 1NX9A 3NV1A 1RGSA 2XLAA 3IIBA 4Q4Y3 3AP4A 3U10A 5J1XA 1R1ZA 1F9KA 3BN6A 3C7FA 4LKFA 3LODA 4CEWC 3ZSMA 1LRHA 1RXFA 2OPWA 5FY7A 3IN9A 5J09A 2AFUA 4PBOA 1JUHA 2PJ5A 4E4ZA 5DUUA 4LHNA 5JMOA 4LLOA 4CU8A 2AFXA 5GLUA 5FZEA 4D8MA 4XQ4A 2J1SA 1XNDA 1RUD1 3KCCA 2JDZA 1V0AA 1POQA 1O4ZA 1ENXA 1SLAA 3WQBA 3R9GA 5K8MA 1VBD1 4HMZA 4JX0A 3THDA 1EUUA 1JYXA 1QEXA 3PUSA 3C3VA 4XE9A 1DYPA 4YVWB 3CQOA 3UT0A 1OMIA 4KWJA 1CX8A 2RB7A 3CO2A 3ZXJA 4RGAA 3ZYBA 2QTWB 4FTSA 1HXS2 4RR3B 2BTVC 3CNAA 2XEJA 2PN5A 4ONUA 2F4PA 1OBRA 1JOBA 3LSEA 1HRV2 5JZGC 4MVTA 3ZFEC 3MIHA 2L9LA 3MGUA 5JXHA 5IB9A 4A7ZA 3USSA 3FUQA 3ZPYA 5A28A 2YMZA 2WZPP 3I3QA 1CAXB 3R95A 4PV6A 1PO22 4C7HA 4MADA 1AR62 2RJKA 5JI9A 4RHV1 1WD4A 2LALA 3WW4A 5F47A 4LHKA 1U0AA 2A6ZA 2BP6A 3B35A 3DKQA 3LFMA 4YARA 4R9AA 1UX7A 4Q4V2 5EWSA 1S7KA 2PQSA 1W6NA 2RDSA 5F9TA 1QJY2 3BXMA 3EY5A 5EZWA 5ISVA 2Y34A 2A6XA 2ZOFA 2OZ6A 4Z65A 2ZX0A 3HT1A 2Z5WA 5FZ6A 1AMPA 1LOAA 2VQTA 5J8CA 2I00A 5GZGA 1H9WA 4R9MA 4JZ0A 2QIRA 1TG7A 3D7GA 4N43A 1F31A 5C7GA 1LJ7A 1G8WA 2AZ5A 4UCPA 3AC0A 1SFNA 1BXHA 2VUAA 1Y43B 3IDEA 3VDBA 5F5IA 2CY2A 3D0JA 4QDSA 4XPDB 3BPZA 1UFHA 3ZYPA 4LK6A 1EYBA 4XIKA 4P10A 2BFUL 3RDIA 3VH9A 3NH8A 2F8HA 1C1LA 1CP6A 4W50A 1EV11 3H3UA 5T5PA 3AZVA 2GANA 5A33B 2HWF1 2WDBA 4XJ9A 3NA6A 3OGGA 4J3GA 4AAXA 3TB0A 4LBQD 2AFOA 4IK2A 5FMBA 4R8FA 4W6XA 4NOTA 1KGYA 3R4UA 4KWKA 1DGRN 3WABA 3BTXA 4WM7B 3KGQA 3HR9A 1W8ZA 2A6WA 4NGQA 2X7BA 3ABZA 2K9ZA 1W06A 3AK0A 2AFWA 2HEVF 1JZ5A 1GWLA 1X33A 1XNKA 3J4UH 1VPHA 1G9DA 3BJ8A 4JKLA 3BIEA 3S7EA 2AJ6A 2RS52 5EQUA 1LAMA 2ZMKA 1HRV3 4OAEA 2ZXQA 1RYYA 3KB5A 5FLJA 5IUQA 2NYYA 1I12A 2OW4A 1Q8SA 4BM8A 1PO23 5FPXA 2B5GB 4M0HA 4BD9A 5I0UA 1AR63 1X9PA 3NNFA 3VBUC 1MZ5A 2ZKNA 1AL0G 3SXNA 2XJVA 2AACA 2JDPA 1YR0A 5DUVA 2C26A 3WDWA 1DE4C 3N9MA 2PVVA 5E1RA 4Q4V3 2Y33A 1J1TA 4KI5M 3BJ7A 5LRSA 4EWEA 5A32A 2CF4A 3GY9A 1MEC1 1QJY3 2FHRA 4LQ6A 1SDWA 1VRBA 1U5IA 2JDUA 5D1IA 2XJTA 4CEYB 3H3LA 3N9PA 3VZOA 3T2QA 3W21A 1H30A 2G0BA 1IY7A 2WNVC 2B8MA 1GZWB 3KVAA 4MHPA 5BXXA 3H4QA 3TWIA 4DMIA 3GZAA 1GYKA 1W03A 1ND3C 2VVFA 4TZDA 2G3AA 3Q8AA 3O1TA 1W99A 5DG1A 1G86A 4HZFA 3AX4A 2XKPA 5CKQA 1YSJA 2PC1A 1Y4WA 3ZYFA 1SPPB 3WY6A 2YPDA 1TIQA 4BQ2A 4J6GA 2R32A 1DF0A 1US2A 2PJBA 1GV9A 5D8AC 3RO0A 2QQUA 1UYPA 3FX6A 3QH6A 5FZGA 4WBBA 2FDJA 5JOXA 1DYOA 2ZGLA 3S9NA 5FBJA 3CL1A 1IS3A 3L2HA 4H7MA 2ZGQA 3ZYRA 1I5PA 3TOBA 4C0BA 2ZXVA 2WO2A 4F7ZA 4LUKA 4ATEA 1UO9A 1JTZX 1UXXX 1GWMA 3H7JA 1GOFA 4EE2A 1IKQA 5DZEA 5F37A 2R1BA 4DUKA 3W6XA 1REFA 5BNPC 1HJFA 4LBQB 3RWKX 2Q8CA 4XAAA 2W91A 2DBIA 2VMCA 4CP9B 3IAPA 2VZTA 5FY8A 1R081 5FBZA 2JECA 2RS53 4PF1A 2R072 4B10A 1ELLP 3IT8A 1DYKA 1BLLE 3IDBB 1PO12 3ME2A 3LACA 4BIFA 1O3QA 1QHDA 3OEBA 5ISLA 4NHMA 3LIHA 1NY72 3LB9A 5K4LA 1M4DA 2GNBA 3I97A 2BPA2 1WWZA 5A1FA 2G9GA 2RG4A 4EJRA 3MLLA 1AXYA 5DAWA 1OZPA 2SBAA 4BOWA 2WJSA 4CA9A 4E4HA 1XC6A 2LW8A 3S9MA 1MZFA 3ROUA 4B29A 2ZS6B 4OUEA 5BPXA 2VOXA 4KWLA 3AKQA 1HN1A 4XF9A 4BA6A 2YU2A 3POJA 1OFSA 5JSRA 2B39A 4WWVA 2CWSA 4D94A 1VBA1 1QQP1 1V9U1 1LOEA 1SHWB 4FO9A 3UYJA 4DUWA 2GIVA 3LKJA 3E5QA 5EPAA 2R041 2X53S 3SKVA 2PJ3A 1JWQA 5L9VA 4AVAA 2PJAA 2O0OA 2BW8A 2XPJA 4RR3C 4IGOA 2MEV1 5FMOL 1RUE2 2FMDA 5CG8A 3ASIA 4O9EA 5FJKA 4YSFA 2AYHA 1L3JA 2WZR3 3DL3A 2IXCA 4XUNA 2AEZA 4BQXA 4H7LA 3INAA 3FRMA 2RMU2 1XE7A 3HBKA 1JZ8A 1N3PA 1SFYA 2FDIA 2BRTA 2CGNA 3H8XA 3VARA 2QBXA 1Q7LA 3U11A 4IF5A 1EUTA 4HK8A 4QVTA 4HT1T 1VBC2 4TLFA 4ZONA 1TME1 3LDRA 2QUOA 4LX9A 1MS0A 1JZ2A 2R073 4AI9A 1LOCA 4KZTA 1PO13 4KH9A 4YW6A 5K0UB 3RRDA 2GMEA 4R9CA 4AEDA 1MS5A 4UFWA 5HV4A 4LXLA 4E2SA 3PHMA 1ULEA 5G05L 4DOUA 4LORA 3CLPA 2BZDA 2OA2A 1M44A 1ZZ6A 1UY4A 2PQ8A 3RJRA 1ZLHA 4HETA 1JS9A 3JCIA 3C8XA 4GM5A 4DXZA 3Q9OA 1W3XA 1QU0A 1IGBA 1AR81 4K3UA 4XPDC 1RUF2 1YFYA 1JZ6A 3H8RA 1OF4A 4OHWA 5BYNA 2Q30A 2WZEA 5JQ4A 2G3TA 5FUPA 2Y6KA 3VL9A 2QQLA 1O3TA 2EO8A 1AXKA 5A7WA 3D5OA 5KC6A 1W04A 4S2HA 2EWBA 4K7JA 4OC3A 1YW4A 1WBLA 2DCTA 5BUVA 4YG6A 2IXHA 2VVEA 1NQJA 4JD6A 1KJLA 1Z7S1 4JDMA 1AX0A 3K2KA 1TNFA 2ZKLA 2R1IA 3OWCA 5I0RA 1R43A 4WM7C 2WA4A 2E7QA 1ND2A 2MHFA 4META 2C1FA 4NRMA 2P6HA 2A1XA 2F4LA 4B4QA 3H1WA 4KLWA 3A9LA 1RUE3 3RYPA 5FO8B 4I3GA 3B3CA 1UZYA 1AYM1 2IL4A 4TN7A 1XE4A 4KUAA 4CP2A 5BNNA 2VBDA 2W3JA 3KZWA 5KBFA 2BFUS 4CS0B 2RVAA 1GP6A 1YFXA 1ZYBA 4IUGA 3JBG2 5FJHA 1M4WA 5JPNB 1W8OA 1IHMA 2RMU3 2OU2A 1VE0A 1EAH2 1A8DA 4DUVA 2Q8OA 4PF5A 1WZXA 3D8PA 1OKOA 1V70A 2F7VA 3POFA 3KVBA 2PR1A 4Y1XA 1NKGA 2FDFA 4KS9A 4ITCA 1VBC3 3N7LA 3HVDA 4Q36A 4IEWA 4ZX9A 1GANA 2VUCA 2NQYA 3LSDA 4P00B 4S2DA 2JBKA 4CEYC 1ULCA 3LAGA 3C7GA 4I2OA 3B2YA 4M4RA 4QKFA 2LRPA 5BV6A 3N4MA 5ACA1 1GP4A 2WFF2 5EHDA 4QXBA 1JZ4A 4LK7A 1DIWA 4NPRA 3BIWE 4BJ0A 5HCFA 3VZNA 3BTAA 4KOXA 5FP7A 5FYBA 4R9BA 1RUNA 1C3HA 5D2AA 1Y9WA 4AL9A 4PPZA 1KUYA 1UMHA 1UL9A 3OBRA 1O7FA 4AGRA 2Z79A 1D0GA 1WW6A 2WYRA 3VBSB 1O59A 4IEOA 1RHI3 1YQ8A 3GBGA 3T1MA 3IU2A 1TKHA 4A2ZA 1ULGA 4BQWA 4AGGA 3FJSA 3CKHA 3WDVA 2JLMA 4JGYC 4CDXB 3JRUA 3PTYA 2HBTA 3RMXA 2Z3KA 2XKOA 3KD4A 3J7LA 3RI8A 4NHKA 2ARHA 5FZ8A 2OS2A 4Q4W2 4WM8B 2EALA 2AFSA 5J8FA 2V8HA 2ZGRA 3GZEA 1M4IA 4P9WA 5HVHA 3MRUA 1YO8A 1CESA 5C9AA 2Z0ZA 2A5ZA 3MPBA 2LS6A 5JMCA 2WSUA 3JBG3 4UFIA 2ZW5A 3G3SA 3EFAA 3K4ZA 4YRHA 1EAH3 5JSOA 4CEWA 4P9YA 4IV3C 4RYDA 4AVCA 3GZTB 4W8JA 4RQPC 5FP3A 2J8MA 2WLPA 3OPZA 4K20A 2XJSA 3CZXA 1ZZBA 1FMD1 1ODNA 4EN8B 3WP6A 3NV2A 3VBOA 1K3IA 2YG0A 4JGZB 3SJEA 2WBKA 1PX3A 2HWB1 3QAHA 1RMU2 5E8AA 1O5LA 4MX3A 2ZCWA 3D68A 1R1A1 5LA2A 2K5TA 2GN3A 3SI1A 5IK4A 2JDKA 4DS0A 3JTKA 1Q43A 2WFF3 4FFGA 1UKGA 2P37A 4Y5TA 1KUXA 1URXA 3M3EA 2BOAA 5TSWA 3AM2A 2Y6GA 3B94A 4DEVA 3PDQA 1NLQA 4A3ZA 2WN3A 2XGXA 4CYPA 3KZ4C 4U5YA 4AG9A 2D40A 5K8NA 3EC4A 3MF9A 3AMQA 1SG3A 1DQ4A 5IAVA 2K46A 1W6MB 2ADEA 3UJQA 4A6OA 3GDBA 3TNPB 1UPIA 4XETA 2A6YA 3WHUA 4KSAA 3A0KA 4BPZA 3V64A 3ZPOA 3S5QA 2JB8A 3EB7A 2IMOA 3AJYA 2UWAA 2PJ1A 5H84A 4DFSA 1CPMA 1NLRA 4EN7B 4S2GA 4KOUA 1GSLA 4ZKTB 3DDDA 4Q4W3 1D4VB 1ZLIA 4Z07A 2F17A 3P2HA 1HW5A 1NMTA 2DPSA 3S7IA 3NH4A 2DPTA 1UYXA 3E1F1 3LEGA 3S30A 2OXBA 4BK5A 5FMOS 3FJUA 4QGMA 3PUIA 3WOGA 4Q29A 3USUB 5G22A 5C8WA 4NWWA 2VMIA 4KORA 3FH4A 4NPLA 1ODMA 3EO6A 4CAWA 1V6KA 4XFCA 3GUXA 5A3WA 3KHZA 4WV8A 4IV1A 3PJQA 1OF3A 2JX9A 3VD3A 2R8VA 1OOPB 1OQDA 2K0GA 4PDWB 1UY3A 2RS32 1D2SA 2VVDA 3GJAA 2JDYA 2GC2A 3ZFGB 4CDUB 4EZ4A 2JEWA 1RMU3 2Q5TA 4ZZ8A 2Y0IA 3VATA 3HN1A 2VMFA 4KU8A 1IYKA 2CNAA 4XF3A 2BJSA 2IFWA 3I2IA 5FR3A 1DCSA 2KXLA 3DEMA 4NHLA 1UIJA 5IJRA 2ZGNA 2JE9A 1HX6A 1O4TA 1G6NA 5FY4A 1Y9MA 4LITA 4EN9B 2J9AA 2BNMA 5JGFA 1W0PA 3QOPA 3WW3A 2VGDA 3OPTA 4XUTA 3LEKA 3S5AA 1YREA 2VNRA 1QWRA 3NL1A 3AYAA 1CG2A 3OJBA 1UIKA 5FY5A 2DEAA 2C5DA 1W8WA 5ABJB 1S2BA 1OH4A 2O8OA 2OYZA 1RUD2 2Q4YA 4GKXA 5C8CC 2VZQA 3U4XA 1E5IA 4LIVA 2WRAA 4XXPA 4OVEA 3U1XA 3RZHA 1N1SA 3P5BA 3IM0A 2P6EA 4AHWA 3F0AA 5J3UA 3VWDA 1JBCA 3WF4A 4INDA 2ADDA 4Q26A 5L7OC 3MIGA 4JRLA 3THTA 4CRZB 3WNLA 3B3VA 4Y49B 5LYLA 4FD4A 1J3PA 3ZKUA 3JZVA 4HXCA 1OXCA 3DYPA 1QJX3 2DVBA 2ZEWA 5K9YA 1YCIA 3WP3A 2YY1A 1Y9GA 1NE9A 5DZGA 3JU9A 1U6MA 4A37A 4QPGB 3BU7A 1JHNA 4UIAA 1UY1A 1WLDA 5I0DA 4QXKA 4QX5A 3VBFA 1MQTA 1PMHX 1IOIA 5CADA 2RS33 4MGYE 4JZRA 5D8AA 1VMFA 4RFT0 4UF0B 2ZEFA 3CXQA 5H9SA 2HEWF 4Y5SA 3MIFA 1YYNA 5G21A 4HFSA 1AR73 3IWZA 2JG9C 5FFOC 3JB4C 5GLVA 5JCTA 4M3SA 4TXWA 4BINA 1ZZ9A 3VBSC 4OMCA 2SLIA 4YYOA 4IL7A 4P02B 3LPGA 4QKNA 5T50A 2XEFA 4QHOA 4LIUA 2VZOA 3LMSA 4CU6A 5F5QA 3WP5A 2P3JA 1NCQB 1AYEA 5IK7A 3B5LB 3TC8A 5LRJA 1OHFA 5H9PA 1PK6B 1JQGA 2C6SA 1HXS1 2JG8A 4AFBA 3B01A 4WM8C 1HLCA 3ZFFC 4MXUA 4F6AA 4KBBA 3VD5A 1QNYA 3HD8B 4CYOA 1JXNA 2D43A 2NPIA 1HRV1 4LE4A 5JAXA 4GULA 1ZZCA 3EXNA 5J1QA 4DY5A 3T0DA 4P4DA 3NQHA 3ZSKA 5A3PA 1RUD3 1ON0A 4MFJA 4X2TA 2XJPA 1Z8WA 1VBD3 1UQXA 2D6PA 1PO21 1AR61 5D8NA 4Q0SA 2XJUA 2P6FA 1BVP1 3V0BB 2IC1A 2AEYA 1Y0YA 3S57A 2NP0A 5KXBA 2LROA 5CFDB 1C8M2 3HNYM 1RJ8A 2O53A 1HQNA 2I79A 2Z11A 1SMVA 4EQVA 3DV8A 1B35A 1JZ7A 4JGZC 2WPXA 2UWBA 2X10A 2JE7A 4KVOE 5J37A 3VBRB 1G9FA 4B14A 3OB8A 5A27A 2ATRA 2YNDA 2D6LX 3D2PA 3MICA 4FD5A 4Q38A 4RHV3 2LM3A 1I1DA 2NM1A 3PP9A 3MW2A 2AGSA 2D4PA 4YVWA 4YGEA 1H8TB 4CPBD 1WD3A 3E6CC 5F8PA 2C6PA 4AG7A 4KVME 2XVKA 4I09A 3QNVA 3CZUA 4RR3A 3AMHA 5H9RA 3IU1A 3CU7A 5FK8A 3SCFA 4GH4B 5KTDA 5FZ4A 3N7MA 5ERLA 1PVC1 1DZTA 2QQKA 4LA2A 4NHXA 3MIEA 1GOGA 2ZOGA 3ECQA 4AG4A 1CAXA 3DF0A 3T90A 4UEZA 5SV5A 4FCAA 1OD3A 3CT9A 5FY1A 3ZMOA 2WO7A 2WNUB 5LK5A 1GU3A 3G7DA 2EIBA 1GHEA 2VW1A 3OPWA 4J1WA 4SBVA 1Q3EA 4P4JA 4ASLA 2YC2A 1OVSA 3ES4A 4IEPA 2QMLA 3HIFA 1WMFA 5CVRA 4LEJA 4MCPA 5DWMA 4Q8LA 4FBFA 1YI7A 4CTEA 2RS51 1N47A 5K7PA 1UYYA 4BWOA 1POV1 4GS4A 4PIYA 1EV13 3MO4A 1SLBA 4KGGA 4R6TA 4K3NA 2HWF3 4ZGYB 4MCRA 3FECA 3FBYA 2Z3PA 1WWYA 3U07A 2P1BA 2XJQA 1OPOA 4DZGA 3ZDSA 1W2UA 3ZXFA 3DPRC 4Z1VA 5C4WB 1L7QA 1WA6X 3D6EA 4XPKA 2B4BA 3U0ZA 5BNOC 2V4VA 4GJYA 4R3KA 4ZX8A 1OOPC 1C8M3 1H4GA 4PDWC 2B5HA 4NXYA 2ZEPA 1TF9A 3R05A 4BQ5A 2DCZA 4Y26A 5FKCA 2GFQA 4GWIA 1SBDA 3ZFGC 1V6JA 2VR4A 2AE6A 1RXTA 1LNSA 1G9AA 3NAPB 1YNAA 5I93A 3B9IA 4UFVA 3R4SA 5A33A 4Q0QA 4ZU7A 5CFCB 4QUSA 4ZU5A 2PJ0A 1ZG9A 1LECA 3QAYA 3D0SA 3EXUA 3N9LA 2XEGA 3L2NA 4PXEA 1L7RA 5FPVA 5IX3A 4WM7A 3QBQA 2FCTA 3VLBB 4CSWA 4MV2A 2MPFA 3HN3A 2XJRA 3AYEA 5KTCA 1KDKA 2PHFA 1NQDA 1KITA 5FYVA 2IJZA 3VB9A 4IESA 2O4HA 1IOFA 2BU9A 2DFBA 1VBB2 1CONA 3I3GA 5DUWA 2EK8A 1RITA 1CX4A 3CJXA 3WDXA 5ABJC 5JOWA 3ON7A 2JB4A 4HN0A 3WT4A 3B02A 1HB4A 2WUHA 2R042 3DR8A 5A3LA 4HK9A 1MS9A 1IU8A 5LB6A 1D4M2 3PBEA 5ELYA 4Q0VA 3QH7A 1JYVA 3T0AA 4LA3A 3E97A 1W6QB 2JIJA 4AEMA 1QJU2 1E57A 1ARLA 4GXLA 4N53B 4FTEA 4GAZA 3WNOA 2R071 3RS6A 1Z4EA 1JUIA 4QM8A 4LO5B 4MHYA 1S7FA 1NY71 4MLOA 4IERA 3H8EA 4YZ1A 4XUQA 5FP4A 2RS12 4CVUA 1ULFA 1CGPA 1MK4A 2GP3A 2P4EA 1SPPA 4KQ7A 2ZZJA 3VZJA 3BI0A 3WR7A 5GKAC 4B1MA 1ENRA 4XABA 5T55A 4RI1A 1TVGA 2XHKA 4NSQA 4Q4X1 4YM1A 3PBBA 2YU1A 1DQ1A 1D7PM 1PGW2 2JIGA 3OBTA 1X9TA 3SJFA 1KWMA 4TTGA 4CDQB 2IXJA 3TE4A 2NZ9A 1LHOA 4NROA 1IIDA 2ZEEA 5D29A 3RVHA 4P6YA 1XBUA 2LTNA 5HPOA 4UA3A 3TO9A 4QPYA 1ZX5A 1FPN2 4LQGA 5IK5A 2FXFA 2EVXA 3WF1A 5IAXA 4QX8A 1FYUA 5LBEA 4FBEA 3S9LA 4I02A 5H9QA 4LBQA 1NCQC 1ALYA 3OEAA 1AX1A 4CP9A 1PK6C 1AR82 2HC9A 5HXDA 1KS5A 2A3XA 2FS5A 1HEEA 3K2OA 1QXPA 2PVWA 1MJBA 2QQNA 4K8RB 5DMYA 2C1CA 2PLV1 4E4SA 1VBB3 3AMNA 3KT1A 1O8SA 1DG6A 1VMHA 1AX2A 3TYJA 2ZEMA 1S7NA 1VBA3 3D8CA 3DKWA 4UFLA 2WZNA 2OUHA 2R043 2RMU1 4BH9A 1QOOA 2VTXA 1D4M3 5CFDC 4CGOA 1LU1A 1TZOA 4LBJA 5A7OA 1RUG2 1AUYA 4O61A 1VAMA 1QJU3 4LUMA 4WZFA 1CQ9A 5LBBA 4MFPA 3CPXA 4RS5B 4YZ3A 5IVVA 4YZ5A 3CJIB 1OUXA 4URTA 1E5SA 4Q7AA 1W8NA 4RL7A 3PUQA 3VBRC 5F48A 3FWEA 3MW4A 1OBNA 3O14A 2PHWA 3CBNA 4EVYA 2RS13 4QX2A 3P6BA 2V5YA 3UETA 4PQAA 1N1TA 2DUOA 3F8KA 1H8TC 3CXSA 4I01A 3I54A 4NAMA 4HKLA 4O9GA 1LHUA 3ZJ0A 4GH4C 4UT5A 3AJZA 4IXLA 1ZBA1 5JR2A 5GZEA 4UWDA 2VQYA 5FMCA 1YQEA 5FZ7A 4XDQA 1WK4A 2VNGA 1UZVA 3PGPA 2JE8A 1RUF1 4CCKA 5A3OA 2BUKA 5DDJ2 3FUOA 1I5ZA 3MIDA 4O7XA 4OUMA 3RBUA 4MH0E 1PUAA 1U12A 5ACA2 5DAPA 4FOQA 3MFCA 1UU4A 1A3KA 4HG6B 3SH4A 3ISXA 2GP5A 1FPN3 3AKSA 2HBUA 1YRZA 5F7UA 2ZW6A 1TKFA 3SI0A 4H14A 2GC3A 2D5FA 2XUEA 3OG2A 3MF6A 4YGOA 4UFXA 5KC5A 1W0OA 3K77A 1AR83 2WA3A 4D3WA 2JDAA 3GKRA 4LQRA 2VW2A 4BBHA 2ZABA 3RZLA 4K9SA 4NJRA 5K0UA 4EFDA 5FREA 2BGCA 2QDNA 2B42B 4UI9L 1BYHA 2FCVA 3A21A 2PAKA 4YW2A 2CIJA 4Q0PA 4LR4A 5E89A 3R96A 2EK9A 3JBG1 5F3CA 5AFBA 2BNNA 1OQ1A 1P0HA 3AZWA 3WW1A 1EAH1 5C4WC 4H2KA 1IPSA 5T3NA 4IW3A 4IGPA 4IDZA 2GU2A 1COV2 1FNZA 1UW8A 1RUG3 4X6RB 4OP4A 1VIXA 1ASJ2 5FO7B 3N35A 5FPUA 3ZYHA 2DURA 3ZFEB 3BU0A 2C6GA 5CYYA 5A80A 3LOBA 1AUGA 3P3NA 1S5KA 3ZN4A 4X8NA 4II9A 1W2TA 3ZR5A 4XDOA 4OIWA 4R4ZA 5L73A 1YJKA 2WFF1 4CYNA 1UWYA 5IT6A 4NF1A 5FIXA 4AQ6A 4CGMA 3ZDVA 4OKOA 4FXKB 3JB8A 1CX1A 1EPZA 3WUDA 2QNKA 4OHVA 1H6XA 4P5YA 2FSRA 2PELA 4OCTA 4WJBA 4YZ4A 1ZBE1 3N9QA 3WVJA 1WCSA 4MSVA 2WFPA 3SXWA 4CCMA 5DDJ3 2C0ZA 1R1A2 1ENSA 1SCRA 1OT5A 1DU3D 4J25A 4LJHA 4LO6B 4M4PA 1NA1C 5ACA3 3EQEA 3WC6A 5FK7A 1KS4A 2HJIA 3UGGA 1JYNA 2OKXA 3PURA 2R062 5DG2A 3OF1A 1K5MA 1F2NA 4QKDA 4ASKA 2PRQA 5LYFA 4RD7A 2WYFA 4Q4W1 3ACFA 1C5HA 1HN0A 3FIXA 2JKXA 3POEA 5D21A 4A41A 4N43B 3GALA 4YU9A 3TNQA 4N53C 1K42A 4DINB 2PJ6A 1G9BA 2ES3A 4P08A 1LOFC 4BU2A 1K45A 4LBKA 5A7QA 3MUZ1 3MBWA 1XMBA 2IZWA 2WQ4A 1I9RA 4NIAA 2P17A 5AG5A 1CM0A 1UZZA 5LK7B 2XEIA 4JCKA 1DQ5A 1J84A 2YHJA 5FPLA 1COV3 2GZWA 4Y33A 3B3WA 1F5JA 2WWSA 5FZOB 1Q8PA 1PM7A 1V6MA 2CXAA 2Q44A 3GGLA 1XU1A 1XSRA 2IXLA 2CSGA 1ASJ3 4W4ZA 3VBSA 8CPAA 3FBMA 5LASA 5FXWA 2Y8KA 4CDQC 1QIQA 4DQAA 5GLZA 3H8OA 4A31A 3T4VA 1PVXA 4E2AA 3VBUB 1XFOA 1IG0A 5FYZA 1FNOA 4B4RA 4CDXA 4UYBA 5CBMA 1QJEA 4CU7A 3DR6A 4NIGA 5LW9A 2ODFA 4X8PA 1VR3A 3VBHA 3TO7A 2PTMA 4WM8A 1V6OA 3RSJA 2H6BA 3DCQA 1BBT2 3VGIA 3TOJA 1QGLA 2DVGA 2PFWA 1T2XA 4Y20A 5FZ9A 2WNVB 1KFUL 4PXCA 1VBE2 3ILNA 2YXSA 1R1A3 1GWKA 3BTYA 1N3QA 3GXUA 2YFUA 4H3WA 4PIZA 3PNAA 1GQHA 1XXNA 4XBNA 1LFWA 4NFRA 5JSPA 4NRPA 3K3NA 1DLLA 4EMEA 1H2KA 1ND3B 1JYWA 1CR7A 4N8MA 5C3PA 3VKMA 1WCUA 4OI0A 1XE8A 2R063 3DLJA 2YB7A 4RSUA 1SLLA 1WLWA 4ZZ5A 5HXMA 1YK3A 3VHRA 3KT7A 1ZO0A 3I2HA 2JDDA 4Y4RA 3ZSEA 5LRGA 2P2KA 1W0NA 3AKTA 4M0NA 1QMUA 3RPQA 2OOTA 1LEMA 1F15A 3WNXA 4RS5C 4BQYA 2FT0A 2QZ2A 1PGL2 4CCDA 3WZ1A 1KXGA 4G3YC 1NXD1 2GNDA 1S1AA 4E8CA 5C3OA 2RR11 2WZ8A 2I07B 2ZMNA 2X8KA 1GR3A 2ARCA 3H9AA 2G9FA 2E31A 5F46A 1S0FA 4L11A 4AXVA 3UK9A 1T6BX 2BWCA 4F0XA 2J1RA 5KHHA 2FE7A 1JOPA 2WQ8A 4AFCA 2GMMA 2Q4SA 4JQTA 1PIV2 4M6IA 2NSMA 1J1LA 2XHNA 2VQUA 3TRSB 4ZS2A 2HWD2 4CAFA 1DZRA 4YZ2A 1YQ2A 1TKJA 5DAVA 3CXPA 5FVJA 1W2AX 4UEFA 4FVVA 5I4MA 5HVGA 4QT6A 4BQ1A 2F5IA 2P3YA 4PI0A 3PFOA 4TNUA 1WMXA 4O23A 4TYSA 3V8IA 4FFFA 4YW7A 2UYAA 3VUOA 3N7JA 5FYMA 1S60A 4CAVA 3W59A 3TEWA 3HLPA 2RJLA 2HH9A 2VZ1A 1W8FA 5T54A 4LE3A 3DN7A 1BBT3 3O12A 2J1VA 4E0AA 4FT8A 1F57A 3OD0A 1HJGA 3HPNA 1D2QA 2H0BA 2IUWA 4AGVA 4UCNA 2HWE2 4Y3OA 2W87A 1VBE3 2VTFA 3SITA 4P44A 3MUY1 3ZXDA 3O1RA 1CVNA 3ST7A 2RE9A 1SLIA 1TNRA 2EA7A 5C3SA 1OLMA 2Q51A 3OGRA 4UBGA 1K5JA 4AZZA 1OOPA 4QM9A 4XZPA 4PDWA 1LB2A 1W9SA 4YGCA 4A7YA 5JR7B 5T5LA 3MIBA 1X12A 4O65A 1LCLA 4MHDA 2HWC2 4OC2A 4CDUA 2DDUA 2PJCA 1Y9KA 3BI3A 1XNTA 4AVVA 4DXSA 2Y6LA 4YW3A 1ZRIA 3K51A 4IGQA 5FYCA 3DGVA 3L2YA 2VBBA 5JXGA 3N9NA 3V38A 2VNVA 2EIGA 2J7MA 4CUCA 3SJGA 4ES9A 4UFHA 4XTMA 3VKNA 3N7KA 1IQDC 2FVGA 3LA3A 4IETA 1LULA 1LR5A 4ZPIA 3O1SA 4MY3A 5C33A 1LTEA 5THWA 1PIV3 4XJZA 4QB9A 1DGWA 5FP8A 4D7TA 1FT9A 4AAPA 3LF7A 4WVMB 4Q1PA 4X6QB 5ABJA 5JLVA 4OHYA 1BKZA 3SHRA 4IHMA 5HMNA 1H6YA 3BTZA 1YUDA 4Q27A 3HOBA 3EBRA 3N5FA 3RNZA 4XVHA 2PYTA 4JAAA 3WCSA 4PI2A 4JVAA 4CCJA 4E2QA 4NUBA 4AQSA 1DHKB 3AZXA 3BUCA 5G1ZA 4YM2A 4KU7A 3RZGA 2R30A 3CEWA 4IEVA 4GQ7A 1PVC2 2VOTA 4HKOA 2RHPA 4DRRA 2AUYA 5IVJA 2CGPA 1RC6A 4MXWB 2HWE3 5F2SA 1RIRA 1OA3A 4N43C 2Q7BA 5EYXA 4RFRB 5F49A 2CTVA 3T9YA 1YXWA 2A3YA 1J4JA 4XYXA 4KL1A 1UU6A 2PAEA 1Z2LA 3IDCB 3AMPA 5LEJA 2ZAHA 2PDOA 4QPGA 3FHIB 4ORFA 1H9PA 3O0VA 2KM2A 3PTRB 4C90A 1CAUB 4C2XA 5A70A 4FPYA 3B00A 4B11A 3UKNA 4ZHNA 4UF0A 2OZHA 1ZZ8A 3D4KA 2Q0AA 3ACIA 3QD6A 2FL4A 4CGNA 3SI2A 1C8M1 1HXS3 3PB8X 1LHNA 4OHXA 2HWC3 4WVVA 5F5CA 1N1VA 1OH3A 2PHTA 3W9AA 5A7WB 2PHRA 2AH2A 2TBVA 1RUJ1 2XQXA 2EXIA 1HDQA 3C7OA 4P9JA 2ZEHA 3AYDA 3H7YA 2BL1A 4AF9A 2ZHLA 5IWFA 1X7NA 5A7NA 2WWUA 2GN7A 1HDKA 4JDNA 2H5MA 2YGMA 5LEKA 5LY2A 1ND2B 3AXEA 3WT3A 3GBWA 4HOOA 5EFUA 3WP4A 1M1DA 1EPWA 1Z8LA 2GAUA 4I3PA 3IWWA 3J9SA 5F1RA 1R64A 1Q5OA 4V2VA 3D7HA 2PJ4A 3PMSA 5BY5A 1Q56A 2J1AA 1N71A 4IE7A 1X8EA 2WT1A 2XBO2 2ZX3A 3JVNA 2VJXA 4XUOA 1RUOA 3V56A 5FYTA 5K8PA 1UF2C 3V0BA 5FTTC 2J8RA 2E33A 1BK1A 5GLTA 5CFDA 1CP7A 3I59B 4OI1A 4FPGA 3D2MA 4OC4A 3LQCA 1BHGA 1XSQA 2EXJA 4UOJA 1NOVA 4SLIA 4WVWA 4JXRA 5JVVA 3H50A 2ETEA 1PVC3 3NNLA 4JHTA 5BNQA 1WLCA 3A0NA 2RFHA 3TEZA 5EC4A 4CP0A 3GHNA 1AR92 3PIGA 4LO8A 3M3IA 2PIZA 3T2PA 2BUEA 2P3KA 3WF0A 3VHNA 4H6UA 1MS1A 4M3CE 1WCQA 2Q0YA 1H4HA 4DJLA 1H8TA 4RN7A 3PUAA 4NJQA 3VDDA 3M70A 2O8QA 4A45A 1PMJX 1UMZA 5LRRA 2RC4A 1IS5A 3D67A 4OFGA 1PHMA 4JGYB 4QDRA 1QDCA 4HPKB 4TSVA 4PK3A 3K9UA 1AHSA 5GJ6A 1IZ3A 3KWVA 2VTXJ 2IWGB 4HNXB 5IVBA 2D93A 4ARYA 4KOYA 2TUNA 4AR2A 3GCWA 1Z0HA 4BQ3A 3QCWA 5E96A 2JICA 1MZ6A 2B9VA 1POV3 3FHAA 3LPFA 3SCGA 1H2MA 2WNUA 2BGOA 4AI0A 1FV2A 3BPSA 4AFDA 1GMMA 3POGA 2J1UA 1H1IA 4IV3B 5C6CA 3URFA 4RQPB 1UOBA 4L0PA 4COZA 2OB0A 4FPJA 3Q8FA 4PJYA 3KV5A 4Q4X2 4KOVA 3SH5A 5C9AB 1CAWA 2R0HA 4PSWA 5I91A 2XBO3 5FY9A 3D7DA 3C26A 3PB9X 1ULDA 1WGPA 1VBB1 1UX6A 5JPMB 4KNCA 1I6XA 1YQ6A 4HL0A 5FZAA 5I0TA 2YPJA 4C68A 3VD4A 2W95A 4C2YA 1XRUA 3AZZA 2VG9A 4Y5Z0 1SQHA 4UCMA 5FUNA 4ATFA 2W1SA 3VBOB 4L9BA 2WYSA 1O5UA 1QNWA 1WUVA 2KA3A 3PVEA 5JDBA 4CP1A 4MY0A 4A33A 1D4M1 2K2SA 4GWNA 3IJ3A 3WSOA 1ZRRA 4K40A 5CB7A 3UKTA 3NAPA 3RI9A 1QJU1 3NVCA 4K8FA 2PLV2 3QLQA 2XLGA 5CFCA 4AFAA 1W9FA 4ZXEA 5C71A 3PJYA 3SH3A 4RGKA 4NWVA 4QHBA 1QSMA 1KQRA 1CAVB 2RS11 4QPWA 1Z78A 3ZN5A 2R7EB 5H86A 1W8UA 1M4LA 1WCDJ 3DUIA 4ZYQA 1RUI1 4AHXA 4CDWB 4FD7A 3BHXA 4CPBA 2AENA 1GQGA 1QMJA 1I1EA 4UF4A 2YNCA 1XE0A 4K21A 4IEQA 1VHEA 1PGW1 2WABA 2HKXA 4QU2A 2NLRA 3LCPA 3DYOA 5G20A 4H55A 2PHXA 4LNVA 3WQ0A 2Y0OA 5L9RA 1HIXA 5IVEA 2PHDA 3ZVXA 1VB4A 4AI2A 4UW4A 3NO8A 5IYYA 1QSNA 3ITQA 4A95A 1LODA 4D0QA 1FPN1 2ILMA 3NH5A 1L0CA 5FV3A 2ZAAA 3RWNA 3AP5A 4QQOA 3NMBA 5M0TA 1W6QA 3POYA 1ZBA2 3OYWB 2F6BA 2B3VA 2FIAA 4Q4X3 3J7HA 5I8SA 2Q1ZB 3KLSA 2YNEA 3F95A 5FLIA 2UY8A 4GJZA 2Q8EA 4JWPA 1I3HA 2VBQA 2Z69A 4F8ZA 4KOTA 3WLUA 1UXZA 4HONA 1RB8G 5AG7A 4FPEA 4YVSA 4UFJA 4M3CB 1S0BA 3B3TA 3DXTA 3H5ZA 2R0FA 4A7KA 2CNTA 4OMEA 2P6CA 3K48A 4COVA 1XJAA 1UYZA 1QSOA 1LCPA 4GALA 3ZLIA 2ZHMA 3E5UA 2VCCA 4AQ2A 4F0YA 4GA9A 3ATGA 3KV9A 3PLQA 2HYKA 1O8PA 4XZUG 3FMCA 1GNZA 1V0CA 2I45A 4CPAA 4YG0A 4CGLA 1WW7A 4JKMA 1N1YA 2C24A 1RUG1 1OVPA 4C1XA 2ZMLA 1FOD2 5KWRA 3TN91 2XQRA 4B5PB 1SQ4A 4LBOA 3WC7A 2PLV3 3RYKA 3B7MA 1GNHA 1U5ZA 1POV0 1S0JA 4CCOA 4DNCA 5C8CB 4EWTA 5GM0A 1ULOA 4AB7A 1H1AA 2QECA 4BYYA 1ND2C 4MHZA 2QVPA 2EIEA 1SFPA 2WQZC 5E16A 1LENA 3NKTA 2Q1FA 5C70A 3KASA 2Q4ZA 1CPSA 3S6GA 2QJVA 4QX7A 3SEPA 2B7YA 5J48A 3OTFA 5L7OB 5BNNC 3AXDA 1TEIA 1MZEA 5C5TA 5FQ0B 4M01A 3ETQA 4AWDA 4FQZA 1X8MA 5DDJ1 4V2WA 4F3JA 3KHCA 4Z8BA 2D98A 2PR8A 1NCRA 2PA7A 5HCAA 3K3OA 2Z3MA 3MGDA 4XURA 1OA4A 2W46A 3AP9A 2DCKA 1DGRA 4LKDA 2ZPXA 4MO3M 4ZU4A 3L9JT 3ZN6B 1ZG8A 4LBLA 5KHIA 5FP9A 2O14A 4XMAA 1YLLA 1R092 4XTPA 3KL9A 4NGNA 5J98B 4R87A 1EP0A 4FPLA 1ZBA3 1ZBE2 1OSGA 1OPMA 3ENRA 2DUQA 1RUF3 3CJIA 1ZVFA 4MXVA 2XR4A 2JG9B 2EXHA 4C8DA 2I3CA 1DDLA 4GXHA 4XFBA 4QX1A 4XF4A 5B2GB 1O3SA 5JI7A 2QDRA 4AE2A 4P4BA 3VBFB 1MQTB 3HEIA 2DXQA 2UURA 5FMDA 2GC0A 4V1PA 2QQJA 4COUA 2YC0A 1YC61 4CCLA 5HV0A 2VEZA 5DXDA 4YFZA 3M3CA 2BVVA 5LATA 4KBZA 2DBNA 4QAWA 3VD7A 3NV4A 1QKQA 4P4IA 4XJWA 1COV1 1KD7A 3ZFFB 3D82A 1UNBA 1ASJ1 4JC1A 4B1LA 2J1EA 4XFIA 4XQDA 3VN4A 1HKDA 4XXAA 1W6PB 1Q8OA 4QB2A 1W2OA 1KZFA 2R16A 4QXHA 1HRI2 2V73A 4COYA 1KUVA 2CL2A 1YMEA 2E7TA 1G7YA 1BPMA 3IFEA 4MFLA 2DF5A 1C4RA 1W39A 2WNEA 3MW3A 4MGZE 3E6BA 2VULA 4BXSV 3RQ0A 3GYAA 2WT0A 4Q0UA 4FAGA 1F35A 4YFJA 1IS4A 3KQZA 3HJRA 2I74A 2VOKA 2Q04A 4EYUA 1YX0A 3U75A 4FSJA 4NN0A 4E2GA 3C7EA 5C82A 4Y1ZA 4IEZA 4NEXA 5C9AC 3Q8BA 1TXRA 4X8IA 3T2OA 1CJWA 4MZUA 4LUAA 5A1AA 4HNYB 1U5XA 1RL3A 3O1OA 2POKA 3VKLA 5C3QA 4CUGA 4R9DA 2EIDA 4DPNA 1GZ9A 1LU2A 4NIHA 1HB1A 3LDBA 2W52A 4PCRA 2VL1A 3KCXA 5APAA 4QGLA 3BGAA 2REEA 3UGHA 1B35B 2GH2A 2R061 3P3PA 3VBOC 2W2IA 1R093 1S0CA 5B4XA 2ZTNA 3BCWA 2HQYA 4UW5A 4CXXA 1IQAA 1MPXA 1XNCA 5DS0A 4OLLA 1ZBE3 4LBMA 5JZGA 1UMIA 4DEQA 3ZFEA 4MGQA 5LZ6A 3C7HA 3EMRA 2QQVA 4EV0A 5AC92 4WZCA 1LAJA 1KDMA 2VCBA 5C3RA 1YGHA 2C27A 2XWBB 5FZIA 4A38A 4R76A 3OGSA 2V4AA 3WNPA 4XFGA 3T09A 4LKEA 1MS4A 5FPBA 4XJUA 4YGBA 4DIQA 3O1UA 3FLRA 3HUVA 5FZCA 3H8GA 1WLTA 3OUHA 2D6OX 3TTHA 2DU0A 1C57A 3M1HA 3W6SA 4AEJA 2EVNA 3KF3A 2CU5A 3I8TA 1W6OB 5I8TA 1E5HA 1H1MA 2XOMA 2A75A 4CDWC 4GKYA 3DSBA 2WINB 5CBLA 4HKWA 2DV9A 1MACA 3S0MA 4R8HA 3SQOA 2JDHA 2E51A 5F09A 1RUH2 1RUC2 4DUXA 3NJYA 5EMIA 3TX8A 4UFMA 2OPKA 5DAQA 3B8GA 2BOJA 4QB1A 1VIWB 4IE4A 4FOWA 1OLRA 2X5IB 3OGJA 4Q5OA 2RR12 4FAHA 1HRI3 4C7IA 2WAAA 3HNMA 3DPRB 1R57A 2D3RA 2BERA 2OT7A 5LRKA 4PT6A 3PEIA 4MHNA 1BMV2 5BNOB 1BO4A 1ZREA 2DUPA 4ASMB 1GNYA 3FN9A 5IV0A 3N36A 1YI9A 3R0RA 4CCEA 2NMOA 5C88A 5AG4A 1F4HA 1US3A 2FDGA 1ELMP 5FY0A 5C5UA 2BDRA 1BBT1 1AL22 4MMOA 3H0OA 3NE7A 4NGTA 4A39A 1VBE1 4DXTA 2PJ9A 2FZ2A 3POIA 1RTVA 2VE1A 4WVZA 4XC9A 4XNHB 4IV1C 2A70A 1S0DA 2DU1A 3KF5A 2ANPA 1W2NA 2W94A 1ZM1A 1DBNA 2B9UA 2KD7A 4QQ2A 1NXMA 5FWJA 1RTQA 4ZS3A 4KWUA 4MHUA 5FZOA 2YROA 2FMYA 5JXJA 4W6WA 4A42A 1XNBA 2V5DA 1XB9A 5FXZA 3WHTA 1UY2A 3RGBA 2A71A 2NMTA 1GOHA 2ARAA 1D0HA 4PQQA 5AC93 1Q2YA 2VMEA 4A32A 1CIWA 1PGL1 5FDBA 2VUDA 4QWNA 1QDOA 4KMQA 4JTOA 4B3NA 3VBUA 5F39A 3TOAA 1BEV1 3OOXA 3KHXA 3WQ7A 4CE8A 4DB5A 2Z3LA 2J42A 3NJVA 1NT0A 2QJ8A 4QXCA 1YLEA 2IVIB 1GBGA 1S0EA 1J3QA 4NIDA 1EE3P 1YW6A 3FC0A 1Y3TA 2PJ8A 2P6GA 4CGPA 1QJZA 3TFYA 3T2TA 4AXOA 2WNVA 2WR9A 2ZGOA 4R3LA 1LANA 5B4NA 2Z4FA 1VJ2A 5FZDA 4PLNA 1PIV1 1RUH3 1RUC3 3ACGA 1XYNA 2BVBA 2HWD1 2RM21 4U9ZA 1LOGA 3I7DA 4MG2A 4YWYA 1ND3A 2GNMA 3WW2A 3HQXA 2VI7A 2RR13 4Y22B 5FYUA 3AL6A 4W65A 1YFUA 4LO4B 3KM5A 1B6BA 3I1UA 1QOSA 4GMP1 5CKMA 3I3MA 1XYOA 4QX3A 2PSWA 4NIIA 4OYUA 3GBFA 3FXTA 4N7IA 5FZ3A 2R6QA 3V0AB 4I49A 3LWUA 2W5FA 1TF8A 3AFKA 4XAEA 3ZX7A 4QPIB 1F2PA 2B45X 2V8GA 4UFKA 1XJOA 1J59A 1CPNA 4LULA 2O28A 4Q8KA 4Y1YA 1AL23 2ZGTA 2N7GA 3T1LA 2HWE1 2B4DB 2NYQA 1ULPA 1SLTA 1OUSA 2Y60A 4W6YA 3I3EA 1CN1A 4IEUA 3PB7X 3PB4X 2ZA9A 1U5YA 3M3QA 2ZPAA 1JW6A 3D7FA 3VBFC 1MQTC 3UJOA 3POSA 3OY8A 5BNPA 3MLKA 2ORXA 3NKGA 2QZ3A 1DZQA 4KLVA 5FWEA 5CZKA 3J7MA 4MFZA 3WF3A 4MGIE 3SXOA 2FQPA 2WKKA 4QBJA 3IAQA 2WZR2 2HWC1 4FPKA 3U4SA 5L19A 3LA7A 2XLFA 3CF6E 4AI3A 4FD6A 4Z2WA 5CA6A 3CIHA 1DGWX 4P9XA 5FOJB 4M6GA 2FDHA 1GFF2 4PLOA 3M3OA 3K4AA 2WLQA 2WL1A 3NNGA 4N9IA 3ZXKA 4HVQA 2OVUA 5J36A 3F5BA 3S6FA 4QC6A 3WNMA 2RJ2A 2ZGMA 3CZJA 3FB3A 1MJ9A 3IGRA 2JG8C 3E6DA 1S0GA 2D5HA 4FAIA 4AOCA 3WCRA 3NJZA 3S6HA 3I3DA 1LRZA 5FAXA 1DFQA 4XFHA 3AFGA 1V6IA 1H2NA 1RUJ2 4L89A 5A6ZA 2CY6A 5HH1A 2E26A 5EIYB 3I2JA 1PCAA 3HT2A 2ZEGA 5SV8A 2CHHA 4MCQA 3PRTA 1SLCA 1C8NA 5LBFA 3VZMA 4RGGA 2ZHKA 4KG8A 2XONA 3E5XA 4EZHA 2YZ4A 4FFHA 2CAVA 1B35C 2XUMA 3IZOA 1STMA 4TLGA 3KSCA 2DCYA 2BOIA 5FPZA 3LWCA 4CCCA 5HCBA 4JDOA 2VECA 2H0VA 5CAZA 3H8UA 4E27A 3W5NA 1QOTA 2XMLA 3A23A 4BB3A 4Q2FA 4FPCA 3WXPA 1VHSA 5T5JA 4YVWC 4OI2A 2WS92 1CZTA 1LESA 3WDYA 4MJ8A 5FKBA 4X5KA 3ZSJA 3J8F1 1W9TA 4Y24A 4UBHA 3E0KA 4H6ZA 4D7SA 2VMHA 1JU4A 1BLZA 4A3XA 1CD3G 3WDTA 3I2FA 2Q8DA 4D6RA 4WVMA 3H42B 4KG0A 3O1PA 2GLFA 1WMDA 2AR6A 2BO9A 1HB3A 5DAXA 1SBEA 4UWIA 1BK0A 4JKKA 3FL7A 3GNEA 1UOFA 4NJ4A 2X5IC 3ZZIA 4L92A 1W9YA 4XOGA 3GF6A 5A6XA 4EROA 2BEOA 3UESA 2A7AA 2YBKA 2ARXA 3ZXLA 1AF9A 5I0CA 5FZFA 2G4IA 4OULA 1X82A 3HQRA 3K9TA 3ETPA 4NE9A 4MXWA 1RUJ3 3H3ZA 1SACA 3B69A 4GIQA 4NGMA 5JH9A 4UAPA 4MRIA 3IKWA 2XBO1 1JYCA 4NR1A 5KXCA 5I8YA 3A4UA 4AEKA 2UWCA 1WA4A 3VHOA 4GWMA 4ZXKA 2IQ6A 4XNHC 1GICA 4ES8A 1CAUA 3KKWA 3PU8A 1XYPA 2D6MA 3T0BA 2WO1A 3KS7A 3PMEA 1F4AA 3AVSA 4XW3A 4GZ9A 4PXDA 3WQ1A 3FEDA 1RHI2 4QX0A 3VWEA 1AJOA 1CJPA 5FZHA 3WC5A 2BGPA 4NHYA 4JLYA 3WG1A 1FI2A 1O3RA 3R9FA 1OA2A 3K4DA 1A34A 1AR91 2ZW7A 5J96B 2Y0MA 2W47A 1NA1B 3N3HA 2WS93 2B5GA 2CWMA 1UZ0A 5F6KA 4LHSA 2PRBA 3ZMNA 1PMIA 5IFPA 5FCCA 3SKJE 3EJKA 2ZGUA 4AI8A 1LOBA 3VV1A 3M8LA 3AP6A 1Q2CA 3SISA 5FO9B 1REEA 2WIIB 4CEYA 3M7AA 3CHXA 3RZZA 2ZEYA 1GZWA 4L99A 4Y1VA 5J7MA 4DRVA 1WW5A 1BVVA 2WSAA 4FI9A 1ST8A 3ZKYA 1F8VA 3D66A 1H8LA 3OCPA 4HSJA 1V00A 3I59A 1K5MB 4Z92B 3RZKA 5EV7A 3WUCA 1Z8TA 3ES1A 1RUI2 2BQPA 4TWTA 1FXZA 4OZOA 4FPOB 4FPHA 2C9KA 3WINE 1UOJA 4YFWA 3IDAA 2CDPA 4F9VA 1IYLA 4N90A 5LA1A 5IW0A 5IVYA 1AYN1 4QPIC 1OLME 3UL2A 1GKBA 3RMYA 1T6GC 3SNMA 4FOVA 3AL5A 3KGZA 4BLJA 2ZOEB 4RUHA 4D6SA 3P2FA 1YIFA 1QQ9A 3G8WA 4HKFA 4KGQA 4LOTA 3I3BA 4JV4A 1G9CA 5JIAA 4JGYA 4I30A 4COWA 2ZEDA 5ANQA 4B6ZA 5GZFA 4HPKA 4NCZA 1F2OA 2VD7A 3MPPG 3CDXA 4XJAA 4M00A 3IC1A 1CBXA 2BCOA 4RA0A 2REFA 1W9WA 2Y6FA 2VZYA 4IEXA 4Z2AA 5A3TA 3A7QA 5I0SA 2G19A 2G9ZA 5DQ0A 2FCKA 2ZEOA 1QH7A 4AVTA 1ZRDA 4BQ4A 2R98A 2D6NA 2QQIA 1ARMA 3JD72 4OI4A 1ZA4A 4JTNA 3JUWA 2H6CA 4XHXA 4EN6B 3KT4A 2PMWB 3VBHB 4JXQA 2Y26A 3KV6A 3OD4A 3PL0A 4IV3A 2Z2SB 5ANNA 4RQPA 1XOYA 3OBZA 5FZBA 2QCSB 4AFMA 3FYNA 3LDKA 5DWNA 4Y20B 3LZZA 3MV11 3IIIA 4A2UA 3AKPA 3IPVB 3TN92 1UOGA 5K8OA 1OFNA 3ACHA 5FRAA 1JYIA 4P5HA 3K75B 1JYTA 1S0IA 4AK3A 2W39A 4LOSA 4MHRA 2JDNA 1XF8A 4P14A 4GB32 1YEWA 1LGCA 1RUI3 5EXOA 3CPAA 2A6VA 2TEPA 4RN5A 3ZSLA 3TCVA 3HQUA 1YJLA 1R3NA 2DVAA 1RVF2 4A44A 1NZCA 1A8MA 3POWA 1QF3A 3BOPA 2A73B 4R4XA 4C1WA 1W8TA 4HVOA 4C2ZA 4AHZA 2VZ3A 1JOJA 2RDRA 1NE6A 4X3RA 3J7NA 1GQPA 1S2KA 1WBFA 4M6HA 4ZY0A 2ET7A 3FE5A 2EF6A 1B09A 1VRH1 1BQPA 2GU9A 4G1PA 1CAVA 1UN1A 4U2AA 2W1WA 3MN8A 5FZMA 3ELNA 4CDWA 3NE8A 3ILFA 1OI6A 2P0WA 3O0WA 5FLHA 3LD8A 2VMDA 3H1MA 3DXUA 1O6UA 1P4NA 5LA0A 4BMHA 2QQPA 2E9QA 4AVBA 3JD73 1FOD1 3BLNA 3SHPA 3VL8A 2JEVA 5GCNA 3W91A 3APBA 2HLEA 1X50A 4CXYA 2HYXA 4U36A 1H2LA 4YPJA 5F3EA 3T8WA 2JBJA 2Z42A 1VHOA 5KHKA 2AFMA 2E6VA 2XWJB 1HQWA 5GLWA 5HXVA 4CCNA 3OYWA 1QJFA 1QH6A 1QJX2 5IFTA 1AZDA 5K0UC 3KR4A 4FP2A 4D7YA 3S6KA 1O91A 2J22A 3TN93 4CUBA 2ARBA 2KCWA 3KGLA 2OUJA 4PHZA 4A4AA 5A1LA 4L8QA 1CIYA 4M3CA 4DY3A 1XU2A 4I0BA 1TMF2 2R7HA 3A22A 4Q4Y1 4MGTA 1Y7BA 3JUUA 3RYRA 2DVFA 5FXVA 4P9IA 2IVJA 2PXJA 2W1QA 4CU9A 2ZW4A 2R1DA 1ENQA 1IOAA 2WSVA 4GB33 1DQ6A 1Y9QA 4F83A 3ACLA 2E53A 1AR72 3NNMA 4XHBA 4YNIA 1PGSA 4CAEA 1FX5A 1UZWA 2BYVE 1R091 4B13A 3ILRA 3DYMA 1RVF3 1NG0A 3D3AA 3B7IA 2DCJA 4P9LA 3FHQA 4B5PA 3IWEA 1OURA 4FQ4A 5F3IA 4ZY2A 2TNFA 3WG2A 2XXZA 4NO4A 5C8CA 3D4UA 2DVDA 5FYIA 2QYVA 1FATA 5CEHA 1F5FA 1P8JA 5G04L 5L36A 3M4FA 3AP7A 4KUBA 2BBAA 1W6NB 4IQPA 4LT5A 3AKRA 2FCUA 3ZYJB 1Y0RA 7CPAA 1VAVA 3V65A 3UNPA 3BI1A 4YW4A 1JMUB 2B4KA 5L7OA 1SZBA 3AMMA 2CGOA 2CAUA 2XL7A 2V09A 5FQ0A 4CXWA 1VBD2 4LLFA 2G1MA 5EJ1B 2W9XA 4JJXA 3O0XA 2V8VA 1AJKA 3KMHA 1I21A 1PZ7A 2EAKA 1JU3A 4E8OA 3NWKA 2VY0A 1VMJA 5JPHA 1HRI1 2Z3OA 4OC5A 3ZN6A 1BCXA 1UPSA 1VKCA 4QD2A 4G4FA 1HDUA 2EICA 4FP3A 2VOWA 1K5MC 1NSAA 3WG3A 1S55A 4Q1RA 2Q1MA 1ZA7A 5DUXA 2CYFA 2PCUA 3PIJA 4TWEA 1MR5A 2JG9A 2RV9A 4RHV2 2HV2A 4MBUA 4AW7A 1S7LA 1XMTA 4YLZA 4AI1A 2VZUA 4M3CF 4ZI6A 4KSFA 2EBJA 4XEZA 1TMF3 2DTWA 4YG3A 5KTAA 2WN2A 4Y4YA 5LY1A 1APNA 3LEMA 4HLTA 4P45A 4UWJA 5FZKA 5F5AA 2D4OA 4HSLA 5F3GA 2GNTA 4XF1A 5T5OA
chains in the Genus database with same CATH topology
1V6NA 1GYKA 4XMAA 1FPN2 2IXIA 2ZX2A 3FMGA 1ND3C 1YLLA 2VVFA 3ZFFA 1R092 4TZDA 4XTPA 5IK5A 2FXFA 2G3AA 5J98B 1DGLA 2EVXA 5DG1A 4R87A 1PZ8A 1G86A 4HANA 3BOWA 1M4GA 1EP0A 1FYUA 4FPLA 4B5OA 4HZFA 1ZBA3 3AX4A 2P34A 4I02A 3FFQA 2XKPA 5H9QA 1KJRA 4LBQA 1ZBE2 1NCQC 1OSGA 3SCHA 2PC1A 1W6PA 1ALYA 1OPMA 3ENRA 5AC91 2DUQA 1AX1A 1RUF3 3CJIA 1PK6C 2JXAA 1ZVFA 1AR82 4MXVA 2UU8A 2JG9B 3WY6A 1KS5A 2A3XA 2EXHA 1TIQA 2VXKA 2FS5A 1DDLA 1QXPA 4CDXC 1MJBA 4J6GA 2R32A 1DF0A 1Q2DA 5JOZA 1GV9A 2XH6A 3C2UA 2PLV1 5D8AC 4E4SA 2R49A 1VBB3 3AMNA 4E4DX 3KT1A 4XFBA 3VBHC 1IS6A 4XF4A 1DG6A 4PLMA 1AX2A 5JI7A 3R6SA 2QDRA 2W08A 5A32B 3TYJA 4AE2A 1S7NA 1BJQA 1BZWA 3QH6A 3VBFB 4WBBA 1MQTB 2DXQA 5JOXA 1VBA3 3D8CA 2UURA 2B3UA 2ZGLA 2GC0A 4V1PA 4COUA 3DKWA 3CL1A 2YC0A 1IS3A 3TO6A 3ZYIB 1NYWA 3L2HA 4JGZA 4H7MA 2VEZA 2ZGQA 2OUHA 4N7UA 2D97A 1EV12 2R043 3AYCA 5DXDA 2RMU1