4OLLA

Camp-binding acyltransferase from mycobacterium smegmatis
Total Genus 86
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
86
sequence length
333
structure length
316
Chain Sequence
VAELTEVRAADLAALEFFTGCRPSALEPLATQLRPLKAEPGQVLIRQGDPALTFMLIESGRVQVSHAVADGPPIVLDIELIIGEIALLRDAPRTATVVAAEPVIGWVGDRDAFDTILHLPGMFDRLVRIARQRLAAFITPIPVQVRTGEWFYLRPVLPGDVERTYRRFQSVRKPTRALLEYLFEVDYADHFVWVMTEGALGPVIADARFVREGHNATMAEVAFTVGDDYQGRGIGSFLMGALIVSANYVGVQRFNARVLTDNMAMRKIMDRLGAVWVREVVMTEVDVPPVDTVPFEPELIDQIRDATRKVIRAVSQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Allostery and Conformational Dynamics in cAMP-binding Acyltransferases.
pubmed doi rcsb
source organism Mycobacterium smegmatis
molecule tags Transferase
molecule keywords Acetyltransferase Pat
total genus 86
structure length 316
sequence length 333
ec nomenclature ec 2.3.1.-:
pdb deposition date 2014-01-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00027 cNMP_binding Cyclic nucleotide-binding domain
A PF13302 Acetyltransf_3 Acetyltransferase (GNAT) domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.10 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 4ollA01
3.40.630.30 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Aminopeptidase 4ollA02
2OYZA 1IYLA 1X7NA 2QDRA 3NJZA 2X7BA 4R9MA 3HIFA 4KOUA 5EC4A 4FD4A 2ET1A 5BUVA 2Q7BA 4NF1A 5KTAA 2PTMA 1BOBA 5E1RA 3FYNA 3C3VA 4NSQA 3LA3A 4E2AA 4KU7A 4JXQA 4LUMA 3UKTA 3NKTA 2CGPA 1LRZA 1I5ZA 5BY5A 3TTHA 5C88A 1UW8A 5JSOA 3VWEA 4B5PB 1CAUA 1N71A 3H1YA 2OZHA 2O28A 3OWCA 4CYDA 4Y49B 2R7HA 4CRYB 1B87A 4LUAA 1Z4RA 3W91A 1M4DA 5D1IA 3VWDA 1VP6A 3TO9A 2ZW6A 2QCSB 2QMLA 4PK3A 3ZJ0A 2OZGA 1EYBA 4JTNA 2D5FA 4BHPA 1G6NA 3BJ7A 5J8CA 3FZ3A 5ISVA 5BV6A 2OB0A 4HNXB 1ZX5A 2Q4SA 3WW4A 2PQ8A 1RGSA 4AG9A 1YGHA 1HW5A 1M4IA 5JSRA 5F47A 2P17A 2PYTA 3ELNA 4I09A 2BSWA 5C82A 3M3IA 2CV6A 3LAGA 4Q29A 2GZWA 4O9GA 5C6CA 1CX4A 5EZWA 4H7LA 3SCHA 5FPXA 1Q2CA 1V0CA 4H6UA 4MY0A 4UBRA 5LRRA 4XFBA 4JWPA 5LEKA 3BALA 2GE3A 4HSJA 3CEWA 4QMAA 4KWLA 2Z0ZA 5HH1A 4KOYA 2PSWA 2VBQA 4DINB 1CGPA 4I0AA 4IEVA 3K9UA 4E2GA 2IXIA 4HVRA 2XL7A 5DWNA 3R96A 4ZU4A 4LLOA 4AXOA 3S6GA 5I8YA 2FXFA 1CM0A 2IXHA 4FD7A 3ACLA 3D0SA 1H1MA 3KGLA 4UBHA 1WK4A 2P6FA 4JD6A 3GBFA 4ONUA 4PSXA 4ORFA 2UY9A 4QM9A 2KCWA 2I45A 3H1WA 2DXQA 4I01A 2IL4A 4XF1A 3FX3A 1M1DA 1S60A 2FIWA 3SCGA 3F0AA 1Y9KA 2REFA 4IEOA 3U11A 2R98A 4XPKA 3PGPA 3MZHA 2OH1A 5I0CA 1J4JA 3R9EA 4XF0A 1UIKA 1YR0A 4IEUA 5KTCA 2BUEA 4IEPA 4B5OA 5KHJA 1SFNA 1B6BA 2JEVA 2JLMA 3CF6E 4HSLA 5I8TA 2PAKA 2VEZA 1ZZ9A 4H6ZA 3S6HA 2E9QA 1YFXA 1QSTA 1O3QA 1FI2A 4XF3A 1IICA 3JVNA 4KLWA 1U12A 3DNSA 3R1KA 1CAXB 3WW2A 4I3PA 4E8OA 5J48A 1ZREA 3MDPA 3EQEA 4UBGA 5JCTA 1OZPA 5FVJA 4LA3A 3PP9A 2IXJA 4XEZA 1YHFA 1QXRA 4LUKA 2Q1ZB 4F0YA 3H3ZA 2Z11A 4XF9A 2B4BA 1NE4A 3E6DA 3LWCA 5I93A 3FB3A 5JQ4A 4LULA 4NCZA 2Q0AA 2PR1A 4HBNA 2Y0OA 3E6CC 1YFWA 1CAUB 4B29A 2Q0YA 2BGCA 4LEJA 1SQHA 3FRMA 3TOAA 4UA3A 5JSPA 4KUAA 1VJ2A 3R95A 3TOBA 4EVYA 1WLTA 3OF1A 4QGNA 3I59A 5T3NA 4JJXA 3IWZA 4AB7A 1ZZCA 3OTFA 2BEIA 2D93A 3TO6A 3EBRA 4BYYA 4HNWB 5KHGA 4BH9A 3CXQA 4II9A 3ZDSA 2JDDA 1CAWA 4IESA 5LEJA 2ARHA 4HZFA 3E0KA 3LA2A 2QECA 2VQYA 1QSMA 4KORA 1VHSA 3IDCB 2FE7A 3DDDA 4KOXA 1J3QA 2CY2A 4Q0VA 3EY5A 1SEFA 1XMTA 2GU9A 2REEA 2B5GA 4QXKA 3FNCA 2H0VA 3TFYA 1K4JA 5KBFA 1KUYA 2PAEA 1FT9A 3IDBB 1WA4A 5FPZA 5I8SA 4E2SA 5EFUA 5F49A 3BU7A 4XFAA 3C26A 4HN0A 1L3JA 4L8AA 3KGZA 3T9YA 3V8IA 3L2HA 3QOPA 3SXWA 2ZW4A 2ZW7A 2A4NA 2XKOA 2GC3A 4NVPA 1LR5A 4HNYB 1S7NA 3N4MA 2ET7A 5KHHA 1Q2YA 4XPDC 1P0HA 3GY9A 2ZKLA 4B5PA 3TT2A 2BNOA 4MGYE 3S7IA 4IETA 4R52A 3H4QA 5F48A 5FLJA 5FLHA 4D7TA 2D4OA 3EXNA 4P9GA 3F5BA 1R57A 4QM8A 4MHDA 4OFGA 1Q2DA 3S0MA 1KZFA 3G7DA 2IXCA 4AVBA 2HQYA 4Y49C 2CNTA 2B5HA 2VPVA 5HI0A 1YX0A 2H5MA 2B8MA 4IEXA 4K30A 2CNSA 5IX3A 3CXPA 5CNPA 2K9ZA 2HJIA 4I0BA 3MPBA 4XNHB 4FAGA 2ZXVA 3BCWA 4M3SA 3S6KA 4WBBA 3TNQA 3MYXA 1PMIA 4D7SA 2ETEA 3LODA 3PLQA 1OI6A 2Q4VA 4X6QB 2BNNA 1YLLA 3SXOA 2XKPA 1LRHA 4KOVA 2N7GA 4GS4A 2ZCWA 1S7FA 1Q5OA 3NSTA 3RYOA 2QVSB 2Q44A 2B58A 4CAVA 1DZTA 1TIQA 2VZYA 4JVAA 1X8EA 1S7LA 2FIAA 3U0ZA 1NSLA 2OZUA 1NZCA 4L89A 1VKCA 2Z2SB 3CO2A 1KUXA 1J1LA 1ZZ7A 3PZJA 3ES1A 3H50A 2PA7A 1IPKA 3D82A 4R3LA 1VR3A 2P6EA 3D8PA 1MJBA 3QAHA 4FD6A 4WZCA 4U9YA 1EPZA 2C0ZA 3RPQA 1Y3TA 5KHKA 2R8VA 4QC6A 5E96A 3TE4A 2PHLA 1NMTA 2HV2A 5FCCA 3H7YA 3M70A 4MX3A 4WVZA 5J8FA 4META 1UCXA 4YGOA 1IB1E 4FD5A 4JV4A 2G3TA 1YFYA 3KMHA 4XFCA 3HT2A 4QBJA 4XPLA 2I00A 2BNMA 1QY4A 4MZUA 2H6BA 1O3TA 2XLGA 2EVXA 4AQ6A 5KHIA 4EWEA 4KVXA 4KWJA 1XE7A 3ZZIA 4EROA 3NVCA 4QUSA 4J1XA 2OA2A 3LZZA 2QIRA 1EY2A 3LOIA 1GQGA 4J1WA 4FT8A 4MGKE 2NMTA 1J3PA 1GQHA 2F4PA 3RNSA 3UKVA 1O5UA 3H9AA 3E6BA 5CADA 3SHPA 4YRHA 2XHKA 3TNPB 5JAXA 4KVME 2D5HA 1DGWA 2MHFA 4EWAA 3LD2A 2FT0A 4MH0E 2PFWA 3JZVA 3OGJA 2PRBA 3W6SA 1IYKA 3EJKA 1M44A 1YREA 1H1IA 2ATFA 1PU9A 2B9UA 4N9IA 1ZVFA 4E2QA 3ROUA 3H8UA 5IB0A 4QX5A 1PM7A 5HMNA 5CVRA 2GH2A 2O1QA 3N7ZA 3I7DA 4YYOA 4QGMA 2Y0MA 4NXYA 5FQ0B 1LKNA 2B4DB 3G3SA 5IV0A 4X5KA 1TQ5A 1M4GA 4U9ZA 2PAMA 1O5LA 2R1IA 4PIYA 3DSBA 3I54A 3I3GA 4I02A 3I9SA 2J8MA 5F1RA 5H86A 4XFIA 4EWDA 2QNKA 4NEXA 1NE6A 1CAVA 2GAUA 1ZZ8A 1J3RA 3KCCA 5I0SA 3UY5A 4Q0UA 2IC1A 2BEOA 3B8GA 1OFNA 4R3KA 4CAWA 3ES4A 1RC6A 4QGLA 5I91A 2CAUA 1QXJA 5AVPA 1RO5A 1S5KA 2B3VA 1NXMA 4MI4A 4UWJA 2IXLA 1QSOA 1Q3EA 4HMZA 1FXZA 4MGZE 2B4DA 1CJWA 3WW1A 3FHIB 4CAXA 1XIXA 4KOTA 1XE8A 3NL1A 2BYVE 4XFHA 3IWGA 3O14A 4PIXA 4JLYA 1ON0A 2K0GA 4A2UA 2BL1A 4X6RB 4U5YA 4HN1A 4YFJA 3VHRA 4L11A 1EP0A 1P4NA 3IIAA 4RI1A 3U10A 1UIJA 1Z9UA 3DKWA 2FSRA 3PVBB 2O8QA 3QACA 5BPXA 4AVAA 4MUVA 3R9FA 1QWRA 2JDCA 2EUIA 5I0UA 1DZRA 3H7JA 3SMHA 5LRSA 4JTOA 2V09A 1UD1A 2FS5A 1O3SA 3E5XA 2G3AA 1RTVA 3CXSA 2OZJA 3DL3A 2IXKA 3DV8A 2Q04A 4OAEA 1DGRA 2QJVA 3DN7A 4IEYA 2K5TA 1ZRDA 1WWZA 3FE5A 3BLNA 4KUBA 1S7KA 1CAVB 2WC2A 4YARA 4EV0A 4CRZB 4R87A 4AG7A 3EHKA 1XF8A 3DR6A 4OLLA 2GC1A 3BB6A 4HVOA 4LTAA 3S6FA 4O9EA 4BMHA 1QSNA 4KVOE 2DCTA 2F5IA 4I2OA 3D3SA 4JXRA 2D4PA 4KLVA 1S3ZA 1V70A 1YFUA 2D40A 3FBUA 3DR8A 5GCNA 4ZU5A 2PR8A 2B3UA 3D2PA 2FMYA 1ZZ6A 1LB2A 1RXTA 2ATRA 1IIDA 3PNAA 3OD0A 4BIFA 2EAAA 4KL1A 4KOSA 3ETQA 4TLFA 1FY7A 4AVCA 3GKRA 1KUVA 2VI7A 4KOWA 4F8AA 1YWKA 1U6MA 2GIVA 3WW3A 4M85A 3B02A 2WPXA 1ZRFA 3EC4A 2VXKA 5C8WA 2VQAA 5JPHA 2OPKA 3JUWA 4PK2A 2OZ6A 3P2HA 3SCFA 4PJYA 1JUHA 3EO6A 2G0BA 4LX9A 4IEZA 4R57A 4H89A 5J7MA 3H3UA 4MBUA 1NYWA 4LA2A 2J8NA 1QSRA 3NW4A 4FAHA 4ZU7A 1I12A 1XE4A 4MV2A 5I0RA 3TO7A 2XLFA 3FXTA 4MY3A 2GC0A 4KWKA 4KU8A 2Z69A 3SHRA 3RZZA 4QB9A 2HKXA 2B5GB 3KKWA 1UPIA 3RYRA 1L0CA 1MK4A 3CLPA 4KZTA 4AQ2A 1MJAA 5CU1A 2J8RA 2PHDA 3P2FA 1MJ9A 1UFHA 1YVOA 4QVTA 4XNHC 1X82A 3S7EA 5FQ0A 3R6SA 3BPZA 3F8KA 3FJSA 4IERA 1YVKA 1XRUA 4GULA 2P0WA 1PUAA 3FFQA 4YSFA 4ZBGA 1I21A 4UXAA 1RL3A 4RS2A 1WGPA 1O7FA 3E97A 1ZRRA 3E5UA 1Z4EA 5FDBA 2AE6A 5F46A 3H1MA 1ZRCA 1OD5A 3RDIA 1RUOA 2OU2A 3T90A 2C27A 4MGIE 1BO4A 2AJ6A 1I6XA 1J59A 4XPDB 3GYAA 4R8HA 2MPFA 4F7ZA 5DWMA 2ZPAA 2VZZA 5EBVA 1Y9WA 1YLEA 4HLTA 3HT1A 4YRDA 1YUDA 4XF4A 1Y7RA 1NE9A 1Q43A 3I59B 3UKNA 5I0TA 3R9GA 2P6GA 3LA7A 4HVQA 4L2NA 1XEBA 4IEQA 2FQPA 1YK3A 5H84A 3BJ8A 4YNIA 2EVNA 1CAXA 2PC1A 2RC4A 3W6XA 2XGXA 2H6CA 3CJXA 2Q30A 4UWIA 2FL4A 3IGRA 4RD7A 4IF5A 2UYAA 4XETA 1IPJA 3D2MA 1GHEA 1ZNPA 5FLIA 3ST7A 2WPWA 2Z10A 2GC2A 3HQXA 4Z82A 4CS0B 4Z07A 2UY8A 3OCPA 3EO4A 4Q0SA 3FIXA 2PQQA 3QB8A 1ZZBA 4IUSA 5JR7B 2I79A 2FCKA 4OADA 3G8WA 1O3RA 4MJ8A 1I1DA 4DNCA 4PIZA 4Q0QA 5KTDA 2VECA 1Y9QA 2GANA 3FWEA 4PV6A 2WFPA 1J58A 3MGDA 4F6AA 1CAWB 2EA7A 5J3UA 4HKFA 1O4TA 1SQ4A 2XLAA 4K8FA 3RYKA 2MNGA 2KXLA 3IBMA 3RYPA 1OMIA 3EFAA 3NE7A 3SXNA 3TCVA 3WR7A 2CNMA 4FBFA 2Q4YA 3D0JA 1RUNA 4IEWA 4Q0PA 3CL1A 2ZW5A 4I49A 3GYDA 4N9HA 2PDOA 2XL9A 3E5QA 4J3GA 3KSCA 2UYBA 3USSA 5K8SA 4XFFA 4E0AA 1X8MA 5E16A 4XFGA 2HUZA 2CAVA 5BXXA 4PSWA
chains in the Genus database with same CATH superfamily
5ACA3 1W8UA 2VD7A 4IV3C 1JZ3A 4R9MA 5FZFA 3PDQA 4WVWA 3USUA 1POV1 1UMHA 4QDSA 3T08A 5FUPA 3VD4A 1OFSA 1ND3B 2UWAA 5L9RA 1BOBA 4E2AA 3C3VA 2AACA 3VKFC 3BOWA 4ZS3A 3DYPA 4H2KA 1H2KA 2PJ6A 2XUEA 4OP4A 3NKTA 2WT1A 4BJ0A 5JXHA 2CGPA 3NJXA 1UX7A 5JSOA 4B5PB 3N7LA 1D2SA 5ACA1 3GLJA 1H4GA 1KXGA 1SLBA 3OWCA 4ONWA 3ZDVA 1S0JA 3WQ0A 4E8CA 1A2ZA 1KWMA 2JENA 1PO22 3C7EA 5FKBA 1ULEA 4ARXA 2WT2A 1POV3 1B87A 1Z4RA 3W91A 5D1IA 5C8CC 4CAFA 1ARLA 4CYNA 4O23A 5C5UA 4PK3A 1OOPA 4BCUA 1BKZA 2ZX0A 2W68A 1K5JA 4MXWB 4BHPA 5FPVA 4UCMA 2ZGLA 3RO0A 5J8CA 5JM6A 5EPAA 3IZOA 4A6SA 4BQ4A 1PGSA 2QQOA 5ISVA 1MS5A 5LK7B 2PQ8A 3IKWA 4DEQA 4AG9A 4C7HA 3APBA 1HEEA 4OVEA 2P17A 1TMF2 3FN9A 3ELNA 2BSWA 4TWEA 3R4SA 5C82A 1W6QB 1PNFA 2ZS6B 4Q29A 3CDZB 2GZWA 5F6KA 4CDQB 1VBC2 1XNBA 4R4ZA 5CFCC 3T0DA 4FPGA 5FP3A 5LZ6A 1V0CA 1AX2A 2GLJA 1BBT1 4D6RA 1QU0A 1GWLA 5LCWL 5GKAC 5C7GA 2A70A 4CPAA 2GE3A 2C5DA 1H8TB 3CEWA 5AC91 4AZZA 4KWLA 5EYXA 2XOMA 1I1EA 4CU6A 1JTZX 2VBQA 4NWWA 4I0AA 4IEVA 1F2NA 3K9UA 4QPGA 5LATA 2XL7A 4CA9A 1RUJ2 4G3YC 4YVSC 1IQAA 1C8M3 4AXOA 4EE2A 2B7YA 1CM0A 4UFVA 3M2MA 4MO3M 5JOWA 3ACLA 1CJDA 1O6UA 2PHFA 3D0SA 3KGLA 5IJRA 2V8GA 3MEPA 4JD6A 3TCVA 4ORFA 3LCPA 3OPZA 5ERLA 4GWIA 2I45A 2JDNA 3POIA 2DXQA 2KCWA 3C7OA 4I01A 5ISLA 3FX3A 4MLOA 1M1DA 1S60A 3NAPC 1RUG1 2BDRA 2WR9A 3R0RA 4AI0A 2ERFA 2CWMA 3OGGA 1UX6A 5F6LB 3PGPA 4P5HA 5KTCA 4YW5A 3T30A 4CDUB 5L9BA 4OI4A 1C8M1 2DVBA 5KHJA 1G9AA 4B5OA 1JU3A 3AVSA 1F2OA 2JEVA 4Q4Y2 2JLMA 4OC4A 3UJQA 4CDWA 2PIYA 4IK2A 3ZFFA 4H6ZA 4ZX9A 3T0BA 1EE3P 2ZGUA 4OI1A 3NH5A 1VAMA 4PDWC 3SEEA 1BMV1 5ANNA 1PYTB 3FLRA 2D3PA 2VMDA 3SI1A 1RUG3 4KLWA 3R1KA 5JIAA 3WP6A 4AHYA 2QZ3A 3MRUA 3EQEA 3J8F2 4LBJA 4GB31 1OZPA 3HPNA 3MUY1 1TVGA 5FVJA 3PP9A 1REFA 1CIWA 2IXJA 1UY1A 4MYEA 4XEZA 1UXXX 1DBNA 1YHFA 1QXRA 4LUKA 2RR12 3ZM8A 3DXTA 2X5IC 2Z11A 1DQ5A 3GALA 3AKTA 4XF9A 5FFOC 1M4LA 2JJ6A 2RJLA 2NYYA 3E6DA 1BEV3 4RHV2 2F7VA 5C3SA 1AUGA 2Y0OA 4Q4W2 2BVVA 2BGCA 4W6YA 4CE8A 4LEJA 4E4HA 4GB33 2DCJA 5J98B 1S55A 2J22A 4CP9B 1IG3A 1VJ2A 2XBO3 4A4AA 2GP3A 5JSPA 3OF1A 4EVYA 1NOVA 3I2FA 2P1BA 2JDYA 1UOGA 3H3LA 3IWZA 3K4ZA 5FZOB 4D94A 3SNMA 1MS9A 2QUOA 4AI8A 5GZEA 3UYJA 5A1LA 2RJKA 1A8MA 1PO11 2VH9A 4B4RA 1SPPA 2AR6A 2Y6JA 5JXGA 2BWCA 1YCIA 1FPN1 2RS33 2ARHA 3E0KA 1WWYA 2FVGA 2VBPA 2VQYA 2VMFA 3K3OA 4YZ4A 3MLJA 1OLRA 3CPXA 1QH7A 2E7AA 2RS11 4Q0VA 1GUIA 2R061 4JYWA 5C71A 4IV3A 4UCNA 2WO7A 5IFPA 1XMTA 2QYVA 2W1UA 2B5GA 2REEA 2WYFA 2H0VA 4H55A 1K4JA 3MBWA 5KBFA 1KUYA 3BLNA 3TFYA 5FPZA 3AKSA 2C6PA 3GIUA 2JDKA 3PTYA 4E2SA 2LW8A 4LKEA 2W87A 3BU7A 3NV4A 3T8WA 1TKFA 4MHNA 4HN0A 1L3JA 4OC5A 5FYYA 1LOGA 2WNVA 2OPWA 4UT5A 2PIZA 4JQRA 5DAXA 1SBFA 1FPN2 2Z42A 4FBEA 1LU2A 3WHUA 2PJBA 2JX9A 4XJUA 4HNYB 5A80A 3N4MA 2VTFA 4LO8A 4CCMA 1Q2YA 4XPDC 2ZKLA 4UIAA 4B5PA 3NFZA 4XAAA 1RMU3 1RUH1 4R52A 2WQ8A 2FD8A 2WNOA 1PIV1 3PUSA 4E8DA 2QJ8A 2PQSA 4P08A 2XDVA 3QAYA 4Y3OA 2E7TA 4HANA 4WM7B 3WR0A 4CEWB 1AL22 1PGW1 1QIQA 4OFGA 1Y7BA 1YIPA 2R072 4P45A 1VBD3 5HI0A 1YX0A 2KD7A 4X8IA 4JDOA 1Y43B 5T54A 3CXPA 1A3KA 1JXNA 4URTA 1FATA 2VXJA 4JQTA 2CDOA 2XJSA 4AHXA 4DPNA 4A30A 5E88A 1NLRA 1G9BA 5EXOA 3NA6A 2DFBA 1V6JA 3B9CA 3VB9A 4EN8B 5A32A 1YLLA 1TEIA 2N7GA 1DQ1A 2DYCA 3R4DB 2ZCWA 1UOFA 2G9ZA 2ENRA 4XBNA 1UPSA 1BK1A 2CY6A 4RS5A 4XVHA 2A6ZA 4QU2A 5D8AA 3FHAA 4P4DA 2QVSB 4CDQC 1W9SA 2H0BA 4BQWA 1PX4A 1TIQA 4JVAA 2ADEA 4OUMA 5CKQA 2A3YA 2GMMA 4YGCA 1W8HA 4YW6A 4ES9A 5J96B 1S7LA 3HOBA 4DY5A 2LS6A 3KCXA 3Q8AA 4XAEA 1NZCA 4L89A 1E57A 1VKCA 3CO2A 1QDOA 1DHKB 1SLIA 2ZA9A 4IUGA 3FJUA 1KUXA 1N1YA 3QH7A 1RTQA 1LOFC 4Q4Y1 2ZGNA 1W0NA 4PLNA 2AFXA 3PZJA 1YRZA 3B94A 3W58A 2QQKA 1GSLA 2HWC2 2NPIA 4XC9A 3NMBA 3AP5A 3D82A 3SQOA 4R3LA 1J84A 3N5FA 2GREA 4FO9A 1ASJ3 4YVSA 4U9YA 4YVWC 4CU8A 3WVJA 5KHKA 2BQPA 2VAUA 5E8AA 2NZ9A 3J7MA 4LJHA 3TE4A 2PHLA 3LEGA 3ZFEC 4JGYA 1ZBE1 2WRAA 3KT7A 5FCCA 1AJOA 1B35C 5FY1A 2P6CA 5BNNC 4KSFA 4MX3A 2DEAA 3FX6A 3LACA 3ACIA 4YGOA 4YG0A 1YFYA 1WLCA 3KMHA 4OULA 5J36A 4AEDC 1BXHA 3OBZA 2I00A 4XPLA 1VBE1 3AZXA 5L36A 4OMCA 3THTA 1N1SA 4AQ6A 5KC5A 1VAVA 5EHDA 4KVXA 1RUD3 1LCLA 2R1DA 3IIIA 4WV8A 2YC2A 3WC5A 3S9NA 3DCQA 1ZBE3 2ILMA 4BXSV 1QEXA 4FT8A 1J3PA 1GQHA 2F4PA 2ZEXA 1AYN2 1W6OA 3UETA 4COVA 4LO5B 4XIOA 2B4KA 4QQPA 2XHKA 1JYTA 1EAH2 4H3WA 4R9BA 2F17A 2EIDA 1H8LA 2YUEA 5D8AB 1C57A 5GZDA 3MIHA 5FJKA 2PRBA 4XHXA 5H9SA 1IYKA 3LEIA 1DQ0A 1H2MA 3AMPA 4HONA 3K75B 3R4UA 5HXVA 5LA9A 3ZSEA 4M01A 2BVBA 3D7HA 4CGNA 3CJIC 2DUOA 1I5PA 1RJ8A 1V9U3 4COUA 1AXKA 1LOBA 1A8DA 1SDDB 2RMU2 1F4AA 3LQCA 4YZ2A 3BI3A 1JODA 2J1SA 3TN91 3I7DA 4LQRA 4X8NA 3PU8A 4QGMA 2ZACA 4L97A 2BFUL 1R093 3I3DA 1STMA 3ZXJA 1IKQA 5IV0A 3FH4A 2YZ4A 1AR61 1OVPA 4U9ZA 1O5LA 2R1IA 4Q4X1 3DSBA 3I9SA 1RIRA 4TNUA 5G1ZA 1Y0YA 3VBHA 2BBVA 4M4PA 2Q8EA 4DZGA 2PE3A 1NA1A 4NEXA 1ZZ8A 1AX0A 1J3RA 3GZUC 4CYOA 5D2AA 3POSA 1MVQA 3AYAA 3KCCA 4QXBA 3JXSA 4Y22B 3WQ7A 3DLJA 3M3CA 2BEOA 5F3IA 1U5YA 1OFNA 3HEIA 3SEPA 3KGQA 4QGLA 3VBHB 1RO5A 2CAUA 5AVPA 4P44A 2WAOA 4LXLA 4MI4A 1TME3 2W1WA 1CONA 5AG4A 4P4EA 3HQUA 2VG9A 4ZY1A 4HMZA 2Z79A 2WS93 1Z0HA 3ZFGA 4ZZ8A 3A9LA 4PT6A 2R071 3FUOA 1QMJA 4ZHNA 1CJWA 3KV5A 1XE8A 1IS6A 1JOBA 2VUDA 4RYDA 2D3RA 2PN5A 4DRVA 3U75A 4LQGA 4CUCA 3NAPB 3Q8FA 1UQXA 4A2UA 2VMIA 5AG6A 1ZLIA 4NHYA 3VHRA 4L11A 3VN4A 3GZAA 2ZPXA 1P4NA 2W08A 1CX8A 4RI1A 1OXCA 2PHTA 4H14A 4KG8A 4N53A 3NH4A 5D8NA 3SMHA 5FV3A 5LRSA 2BGPA 1NY71 2Z3LA 3KHCA 4K1YA 3RS6A 4WM7C 3KQXA 2V5YA 2VY0A 4RR3B 4OHZA 3IJ3A 2DF7A 2EICA 2OZJA 3VKNA 1DQ6A 2FHRA 3TRSB 5A3WA 4J25A 2Q04A 3NE8A 1TNFA 3FE5A 4XCBA 2FZ1A 4XURA 4A44A 3AKRA 3AXDA 3W20A 4X8PA 1RUD2 1RUI2 1H2NA 3DR6A 1UY2A 4LLFA 1QSNA 3MLKA 3NNGA 1COV2 4KVOE 1QMUA 5A6YA 5A7QA 4UCPA 3SJEA 5I0DA 5CAZA 2A3XA 3PHMA 2ZGQA 2EALA 5CKMA 4KGGA 4P14A 1RUE2 3LF7A 2PCUA 4IGOA 2QQIA 3DR8A 4QDRA 3FBUA 2PR8A 2B3UA 2A1XA 1ZM1A 2FMYA 5J37A 2I3CA 1W3VA 1LJ7A 3NNJA 2ZOEB 4X2TA 1URXA 4MADA 4AVCA 2A6XA 1FY7A 2VI7A 3TWIA 4DS0A 1XB9A 1U6MA 2RMU1 4MHUA 2LRPA 1PMHX 2VQAA 3GM8A 1ENXA 3L9JT 4UI9L 4PK2A 1ULOA 1AR83 3K46A 3MI8A 2DVAA 4NHXA 5HV4A 4PJYA 1OKQA 2BBAA 4RFT0 4A37A 3ZSLA 1XOVA 3IDEA 2C6GA 4MBUA 3S9LA 4LA2A 1QSRA 2D44A 3NRUA 4FAHA 3ASIA 5GZFA 1W2UA 3WNMA 5CZKA 1I12A 4BZ4A 3DGVA 4AVVA 1S1AA 4MY3A 2QZ2A 2ZMLA 4KU8A 1GQPA 2YXSA 2Z69A 3SHRA 1OVSA 3NV2A 1CD3G 1RUJ1 3T2TA 1W2TA 3TB0A 5A32B 4CZSA 2B5GB 3KKWA 5C3PA 2F8HA 4FPJA 4IV3B 3KVAA 5IUQA 2B46X 5DN2A 4AQ2A 3NV3A 1W6MB 1X36A 5CU1A 4BQ2A 3LMSA 2VCMA 3EXNA 4HXCA 3RRDA 3HAGA 4W65A 1MJ9A 1X82A 5FQ0A 3F8KA 4QVTA 4B14A 4IERA 3S6GA 4GULA 4JGYB 4Z1VA 3VBUB 2P0WA 5A3UA 1MQTC 4ZBGA 1H4HA 1I21A 4BE3A 2JE8A 2IMOA 3MGUA 3WX5A 2W1SA 3TAYA 5DG2A 3E5UA 1L7QA 4NPRA 3VDDB 3WDVA 4R6TA 1WCUA 2R7EB 1GZCA 5F46A 1BVP1 2GMEA 3V64A 5LA0A 3T90A 2CYFA 3OBRA 3VUOA 4MOAA 4ZGYB 4LHKA 4MGIE 1CBXA 3SH4A 1I6XA 5EV7A 4XPDB 4R8HA 3I3BA 1DG6A 1GZ9A 5EBVA 1NAEA 4K8RB 3H8GA 1Y9WA 2DTWA 4BDVB 3D4KA 3DPRA 4CSWA 2W39A 1A34A 1YUDA 4W9YA 2Z3PA 1LAJA 4WWVA 1Q43A 3I59B 4XDOA 5EMIA 1OKOA 2YHJA 4A42A 1Q8OA 4UFKA 2B39A 3J26N 5I0TA 3R9GA 1LU1A 5JI9A 3VKMA 1FOD1 3LA7A 5JMOA 3KD4A 4HK9A 4HVQA 4BINA 5EYYA 2OKXA 3OSDA 3LKJA 1HN0A 3Q8EA 1XEBA 3BJ8A 5H84A 2XWBB 4HPKA 1ELMP 2AH2A 1SG3A 5I4MA 2HWF2 3B7MA 2H6CA 4DRRA 4XJ8A 1O91A 4RD7A 3VBFB 4IF5A 5C9AC 3J8F3 2DURA 1AYN3 1ZNPA 4GWJA 4ZONA 1H9WA 4TYSA 4ASMB 3G6JB 5FZEA 2WPWA 2Z10A 5FYUA 3HBZA 3I3QA 2UY8A 4SLIA 1GMMA 4Q0SA 2KR2A 2VZQA 3UGFA 4IUSA 2CDPA 3QB8A 1QQP1 2HEYF 2JDPA 1OQDA 3CNAA 3LDKA 4JC1A 3ZYRA 4XTMA 3G8WA 2WN3A 3HR9A 1O3RA 1I1DA 3PEIA 4DNCA 4Q0QA 5TSWA 4CP9A 4LQ6A 1CZVA 1R1A3 2HWD2 1SCRA 3M3OA 5LA2A 3FWEA 4PV6A 5KR7A 1XXNA 3RG0A 1LFWA 2PLV3 2D3SA 3LIGA 2EA7A 4Q2FA 4GB32 4LIUA 4RN5A 3CT9A 3TC8A 2MNGA 1B35A 1NZIA 1YI9A 2KXLA 5H9PA 5J3UA 2RS12 5BNNB 3T0AA 3D66A 1V6LA 4B7KA 1NLSA 3FC0A 5JMCA 2Q4YA 3KR4A 4Q0PA 4Y5SA 2D7FA 4YVWB 5DXDA 3GB0A 1MZFA 5APAA 2DCYA 4HETA 4N53C 2AFMA 5BNNA 2JDZA 4GA9A 5L7OB 3MF6A 1X8MA 2X10A 4Z8BA 3KS7A 3UNPA 3JQXA 5GLWA 4RQPA 2HWC3 4W6WA 2YV8A 1RMU1 3ZSJA 1IYLA 3CZXA 1HRV2 1HB2A 1X7NA 7CPAA 5A27A 3NNMA 3ZIWA 5EC4A 2V73A 4C8DA 5C8CB 2GLFA 3H5ZA 4G1PA 1JZ2A 1QQP2 2P37A 3FVLA 1IOAA 4FPKA 4NF1A 1UYYA 2PTMA 3OY8A 3NJVA 1QOSA 1FV2A 4P02B 1DP0A 3SLIA 4BK4A 4QHOA 4JXQA 3KT1A 1ZA4A 1RHI1 4P9YA 5HCBA 4ASLA 3VV1A 3TTHA 2R49A 3CU7A 3VWEA 4LR4A 1CAUA 5K0UA 3H1YA 5A33A 4COYA 5ABJA 2O28A 4Y1YA 1LEMA 4CYDA 2JG9A 2LUWA 1W8OA 2IFRA 2Y6FA 4CCLA 1Z8LA 4NOTA 3WQ1A 3VL8A 4DUXA 3A4UA 4IE0A 1XRYA 3B00A 4LUAA 5FYBA 1M4DA 1OF3A 1XSQA 1Y0RA 3B01A 1W28A 3M1HA 1GZTA 1APNA 4LBKA 4QPIA 1EYBA 1GR3A 2OZGA 4JX0A 4JTNA 1UOJA 2WABA 3FLPA 2ZX4A 5CBMA 1G6NA 1LHVA 1YC61 1KS4A 4UW6A 5EJZB 5BV6A 4HNXB 4EJRA 1J1TA 1AR72 4KGQA 3WW4A 1HW5A 2D6OX 5IVVA 1JZ4A 4QX7A 1MVEA 1RMU2 2G1MA 2X29A 3EXUA 3OOXA 5ANQA 5F47A 1JZ8A 1NY72 2VNOA 2CV6A 3M3IA 5FKCA 1GYTA 4B4PA 4HT1T 1IHMA 3ZN6A 1FMD1 3UJOA 1Q8QA 1CX4A 5FY0A 1LODA 4H7LA 3SCHA 3V56A 4UBRA 3SJGA 2XJPA 2SBAA 4XFBA 5LRRA 2HBTA 3KF5A 1ASJ1 1HRV3 1US3A 4AGRA 2YGWA 5HV0A 4C2YA 3EYPA 3PB8X 3LFMA 2L9LA 4AQSA 1UY3A 3OB8A 4OHXA 4CDWC 4DINB 3NKGA 2I74A 1X50A 1YQ8A 1R081 2VE1A 3USUB 4MXWA 4E2GA 1J83A 2YMZA 1S4CA 4U2AA 1VBD2 4LLOA 1OOPB 4N7UA 3HJRA 2Q8CA 2NLRA 5I8YA 4FSJA 5FZ4A 4OQ9A 4FD7A 4B10A 2I2SA 1WK4A 2P6FA 4XUNA 4I3GA 3QD6A 1BBT3 3GBFA 5C4WC 5C9AB 1N3OA 3KI9A 3H1WA 2C9KA 4YU9A 3RZKA 2VULA 3AZYA 4KS9A 4QHZA 2YU2A 2EO8A 2OH1A 3SITA 3ETPA 3VKLA 4XF0A 5EJ3A 3WDWA 2BUEA 1I3HA 1KFUL 1UKGA 4IEPA 4OC0A 2PJ2A 5DS0A 4Y26A 1B6BA 2RB7A 1H8TA 1UAIA 4QHBA 1YQ6A 3CF6E 3PIJA 4HSLA 2PAKA 4YM2A 4UF0B 1ZZ9A 5I8TA 1Z2LA 5HVHA 4F0XA 4CEYB 1QSTA 1V6MA 2YNCA 2P6HA 4HOOA 1FI2A 5HXDA 3CIHA 5DAQA 1V9U2 4CXWA 4RGKA 1PGL2 4Q4W3 3PBBA 4JAAA 3RZAA 1U12A 2VZPA 3DYOA 2HWB3 2K46A 4XW3A 3WW2A 3GBGA 3DNSA 2GNTA 2BCOA 4OHYA 1LCPA 1TKJA 3T2PA 2YBPA 5JCTA 2YBKA 1ACCA 4JRAA 1MS4A 2X5IB 1VPHA 3FFZA 3UT0A 4HFSA 4BD9A 3ZN4A 5FO9B 2Q1ZB 5A1AA 4Y4RA 3D7GA 1RJ7A 1FOD3 3P3PA 2VOTA 3VBOB 2GDFA 4P5YA 1QNYA 1PO13 1CX1A 2EWBA 1SBEA 2VL4A 2O53A 3CKHA 4LULA 4NJ4A 2Q0AA 5ELYA 2XVLA 2MEV2 1KJLA 2OX0A 5FZ1A 5A7SA 3E6CC 4B29A 2QE3A 2VZUA 2WINB 4AWDA 1ONAA 4W6XA 2Z3OA 3H8EA 3ACHA 4KUAA 5FOJB 4L0PA 3BTZA 4AB7A 4F83A 2QQJA 1ZZCA 4QKDA 3DPRB 4JZ0A 1KS5A 4QKBA 2R30A 3POEA 2E6VA 3EBRA 4DQAA 3TO6A 3I3EA 4BYYA 4FTBA 4HNWB 2A6YA 4WVMA 4BH9A 5C3RA 4HL0A 2E33A 3VBUA 2JDDA 4BQ5A 4IESA 4MGSA 5F5CA 4HZFA 3LA2A 3WG4A 4CDQA 5A70A 3B3WA 4GH4B 2VOWA 1HXS1 3IDCB 4LHSA 4QX3A 1J3QA 4IDZA 1OHFA 1FMD2 3WV6A 4A7YA 3RZMA 4GXHA 3PFOA 2R0HA 3LSDA 5G21A 2YNEA 4XJ9A 1SEFA 4MXUA 1C1LA 4CPBA 3B69A 2RDSA 4AEKA 1DZQA 4LPLA 3H8OA 3ZFGC 1AL23 3M3QA 3IDBB 1XYNA 1PX3A 5I8SA 2YC4A 1YQEA 2PJ4A 3BXMA 2RM22 3C26A 3KGZA 2V4VA 3FHQA 5DDJ1 3RWKX 1JN2P 3L2HA 3MIGA 3QOPA 1S2EA 5AFEA 1FV3A 2ZW4A 4UFLA 1LR5A 5L73A 5KWRA 1ZYBA 5IK5A 5THWA 4CCNA 2ET7A 5FXVA 3VHOA 5FPBA 2DCZA 5T5OA 3J7NA 1YW4A 1G8WA 5FREA 3WF2A 1OA4A 4IETA 1ZG7A 2V8HA 1VBB1 3H4QA 5F48A 5JGFA 4I0WB 4M3CB 4Q1PA 2PJ0A 3WC7A 4FTSA 1YSJA 1PM4A 5FRAA 3F5BA 3SJXA 4QM8A 3HD8B 1Q2DA 5J1QA 2J7MA 2HWE1 3AC0A 2IXCA 3G7DA 1KZFA 2HQYA 5M0TA 3AYCA 2B5HA 4Q4V3 5FZLA 5C8CA 4IEXA 3FF3A 4XE9A 4K30A 2CNSA 3LDBA 2D98A 2WFF2 5CNPA 4XDQA 3C8XA 1NG0A 1KITA 2ZKNA 2FDIA 1Q56A 4M3SA 4AGGA 3LFIA 5GLZA 3KQRA 4D7SA 1Z7S1 1HQWA 3CBNA 1NXD1 2VUCA 3O12A 3OUHA 3PLQA 2Q4VA 2AFSA 3SXOA 3TEYA 2JXAA 3MPPG 3U37A 5DAVA 2ZEZA 4EZ4A 1P8JA 3N9MA 4OHVA 1VB4A 3ATGA 3VZMA 2PHRA 1REEA 1VHOA 1S0EA 1AXZA 1F9KA 2WQ4A 3RI9A 1X12A 4A32A 2B58A 4CAVA 4RR3A 1ND2A 3GDBA 1JI6A 3POYA 3R05A 4JRLA 3PJQA 3D68A 1XNAA 4UFMA 2O0OA 2Z2SB 5C3OA 1MS1A 4IV1B 4NAMA 1ZZ7A 5FUNA 2XXZA 4AK3A 5FBJA 3KR5A 1S0FA 1RYYA 1A6CA 1W9WA 2YPDA 2ZGPA 3ES1A 2X05A 2VZRA 4OQ8A 3ZLIA 2NN8A 1ENRA 1VR3A 1HLCA 1ZO0A 2K2SA 5A7OA 4XZPA 2Q5TA 4WZCA 1BPMA 2LROA 3W5MA 1B09A 4LORA 1Y3TA 5K9YA 4XQWA 5FIXA 5CBLA 1NCQC 1RUF1 2V5DA 5JXJA 3M70A 5L19A 4RHV1 5GLVA 4AW7A 1ULCA 1TKHA 1IPSA 4QX1A 1H2LA 1UCXA 2A73B 4XOGA 1W6NB 3ITQA 4JV4A 4EYUA 1LEDA 3V0BB 1W99A 2BOAA 4HPKB 1WLWA 2YDEA 3BOPA 3HT2A 4OZOA 2WBKA 4QBJA 2YNCC 5K4LA 2BNMA 1XYOA 2YG0A 3MIBA 2F6BA 2E51A 2H6BA 2XBO2 4MZUA 2XLGA 4OYUA 1O3TA 1ODMA 4LBNA 4BISA 5KHIA 1E5SA 5F3EA 3ZZIA 1XE7A 4EROA 3NVCA 4J1XA 1ASJ2 3LPGA 1QJX2 2QIRA 1EY2A 3ME2A 4GJZA 2ZHKA 1GQGA 2AEYA 4J1WA 4P00B 1DQ2A 5JLVA 2RDQA 3UL2A 4QB2A 4JCKA 5EQUA 3I4IA 1HDUA 1SDWA 3RNSA 1XFOA 2O4HA 5K8PA 1RUF2 2QQVA 3QLQA 3VBUC 3SHPA 2DU0A 2ZGKA 4XYXA 1K42A 2AYHA 4MCRA 1JZ5A 1YXWA 2BOIA 3TNPB 4LMFA 2XEGA 2WZEA 4KVME 3UGHA 4CP1A 1W2AX 1MZEA 4Q4X3 2FT0A 3AKPA 2XQXA 2PFWA 4ZYQA 1RVF3 2Y6LA 2VZVA 1K45A 3H0OA 4JGZB 5LA1A 1CP7A 3HQRA 2PXJA 5FK7A 3VDCA 2Z3MA 1VALA 1H1IA 4AQTA 3C2UA 3NNLA 2CTVA 5LYFA 2VU9A 1HXS2 1QF3A 5DZFA 2HC9A 2EK8A 1H8VA 3U07A 5A3OA 2GH2A 2HEVF 4CP2A 5IT6A 3N7ZA 5F39A 1HB3A 5JR2A 4NXYA 1IG0A 5GLTA 2OT7A 2EAKA 2NMOA 4UOJA 4X5KA 3KQZA 4KWUA 4R8FA 4AI2A 3T4HB 4NAOA 4PIYA 3LDRA 1DFQA 1W6OB 4LKDA 1VIWB 2WS91 5G04L 5IVCA 3KL9A 4EWDA 2C24A 4OUSA 4H7MA 4NO4A 3N35A 4OUEA 2ZEMA 2VMHA 1JUIA 1CAVA 2GAUA 5FY9A 3BHXA 3M3EA 4BMEA 3UV9A 4BPZA 5I0SA 4Q0UA 3GZTB 2ARBA 1NA1B 5A3NA 5IYYA 3LOBA 3B8GA 4R3KA 1VBA1 2HB6A 5I91A 4NIIA 1S5KA 1QXJA 2C6CA 5GCNA 5A1FA 4KH9A 1NXMA 4CDXA 4RA0A 2Q1FA 4P4IA 4LBLA 2ID4A 2IXLA 2YPJA 1AR91 1HV0A 4COWA 1HJFA 1Q3EA 4UEZA 1FXZA 3TYJA 3ZXFA 5FPUA 4MGZE 5LBEA 2B4DA 1SFYA 1OQ1A 2HWE2 4M3CF 3FHIB 3WW1A 4CAXA 1JHJA 3NL1A 2XHNA 2IZWA 4YW4A 6CPAA 5FP4A 4XFHA 4CXYA 1VRBA 1V6NA 1VBC3 1UWYA 3ZR5A 2Q8DA 2BOJA 3BTXA 3JRUA 4U5YA 1JMUB 4EFDA 4IE4A 4YFJA 2ZX2A 5T50A 4AVTA 1QJY3 1UZVA 3IIAA 3WHTA 4QXHA 4MFPA 1Z9UA 2V8DA 5BWAB 4QQOA 3K2OA 2J1TA 3WCSA 4E4SA 2FSRA 4RR3C 1T6GC 2A5ZA 2QTWB 2VVEA 5BPXA 3VD3A 3R9FA 1DZRA 2RM21 2XJUA 1Q8PA 3H7JA 2BU9A 3MW3A 2V09A 2DBNA 1UD1A 4WVMB 4B3NA 4BMBA 4E9KA 5C3QA 4AG4A 5CG8A 4CP0A 2G3AA 1RTVA 5A6XA 4YM1A 3DL3A 4LKSA 3BTAA 1DGRA 5CFDC 3DN7A 4IEYA 4GAZA 4KUBA 3A23A 1MR5A 1RUH3 1WMXA 4YW2A 2ZTNA 3WF0A 4AR2A 1S7KA 2E7QA 4R87A 1UOBA 4Z92B 4AG7A 1H6YA 4OLLA 2YU1A 3DECA 1WCDJ 1W8NA 4K21A 2DCTA 1RUC3 3KZ4C 3SKJE 2WNVB 1GWMA 4FPYA 2XJRA 2DPTA 2FMDA 2D4PA 1QXPA 1S3ZA 3KHXA 5AFBA 3SH5A 1XE0A 2RVAA 4V2VA 2ZX1A 3INAA 2RDNA 2X8KA 3O1OA 2CTCA 2YNDA 3IWEA 4WJBA 2ZEGA 1ZZ6A 4RL7A 1MS8A 3VBRC 3EB7A 3C7FA 4KOVA 1DU3D 1HKDA 3PNAA 2RV9A 2EAAA 4BIFA 3WLUA 5B4NA 5JOZA 1JQGA 1IS4A 4KOSA 3BU0A 2XMLA 4NGNA 2R043 1FMD3 1JW6A 2IQ6A 4M85A 2LM3A 3K3NA 3F95A 4AEJA 3NQHA 4CCJA 1ZRFA 1CP6A 4P4JA 3AP6A 1NCRC 2RDRA 3PIGA 3VZLA 3DGTA 3IPVB 1BLZA 4FPEA 3ZFFB 1SPPB 1W05A 1JUHA 2RE9A 4LX9A 4IEZA 4R57A 2DV9A 2TUNA 3RZJA 1PMJX 4C1XA 4YW1A 4Y20A 1QOOA 2YGMA 3MIDA 4ZU7A 4MV2A 5FZ6A 4N90A 4Q4Y3 2XLFA 1R43A 2GN7A 3IM0A 2GC0A 3FXTA 2J42A 1CZTA 1Q8VA 1U0AA 3AXEA 4K3NA 2XB6C 4QQ2A 1PVXA 2WNUC 2WZR1 1ZG8A 3HBKA 2W91A 1IGOA 5G20A 1L0CA 1MK4A 2JIGA 3CLPA 1W8WA 1YIFA 1ENSA 4BLJA 4DB5A 1WBLA 4UW4A 3A0KA 1BYHA 1F4HA 4WVVA 4XNHC 2VMEA 1H0BA 1UY0A 1XNCA 1YYNA 2VTXJ 2XG3A 3BPSA 3T3YA 1RUF3 3BPZA 1AR73 3FJSA 1AF9A 5LBCA 1W03A 1W8FA 2Y34A 2OR4A 3KHBA 1O4ZA 3FFQA 2RS32 4CCOA 1X10A 3B2YA 4FPLA 4UXAA 1RL3A 1RUJ3 4RS2A 2OW4A 4NUBA 5AVAA 3E97A 5BNOB 1Z4EA 1LHWA 1N3QA 4IW3A 3QH6A 3RDIA 4LT5A 1A78A 4LBQB 5DAWA 1RXFA 5FYSA 5JPNB 3BYWA 5DWMA 2ZPAA 3N3HA 2VZZA 5IAXA 3O0WA 4CDWB 4PQ9A 3T2OA 4F8ZA 1I9RA 2R16A 4F9VA 1GZWB 1PZ7A 4R9CA 1F2PA 1ZBE2 3F2ZA 1KGYA 4NPLA 1Y7RA 4B13A 1AYN1 1UWWA 1LAPA 2QQNA 4NHMA 3VD9A 4XILA 2ANPA 4C68A 1MS3A 3HNYM 3POJA 4QPIB 2PHUA 4YZ3A 3WDXA 1Z8TA 2P6GA 4NRQA 5LWBA 1MQTA 1REDA 3MHZA 2FDFA 4IEQA 1ODNA 3PB6X 1X33A 2EVNA 4XXAA 2PC1A 3CDXA 2XGXA 4R9AA 3IGRA 4FCAA 2AFWA 3TN93 2ARXA 3ZXLA 4WM8B 4IE6A 3VBRB 1CN1A 4ITCA 2OQ7A 4CS0B 5IVBA 3KT4A 3N9QA 1D4M1 3PMEA 1POV0 1LOEA 4GD4A 1IKPA 3ILNA 5DG1A 3WSOA 3V0AA 2JBJA 3EO4A 3FIXA 1ND3A 4WM7A 2XEIA 1AZDA 3MN8A 3S57A 3K9TA 4OADA 5FZ7A 1WCQA 3O0VA 4CDXC 3IO1A 3I2HA 1KDKA 2GANA 1GANA 1GNZA 1UO9A 4BOWA 1YQ5A 1JYIA 1SBDA 1US2A 2DVFA 3N9PA 2VC9A 1QGLA 4GKXA 1BEV1 2XLAA 2D6MA 2W9XA 4ZPIA 5FYMA 3RYPA 3RYKA 3EFAA 3VBOA 5AC92 2ABZA 2Z4FA 2WJSA 1QQP3 3D0JA 3POFA 1MEC3 2GNBA 4IEWA 4RGGA 3VBSB 3WY6A 1RUNA 3CL1A 5GALA 3V7ZA 2R073 4I49A 3K51A 2YB7A 3W21A 1VBE2 1R1A1 1F5FA 2WS92 3E5QA 4N9HA 3W6SA 4GMP1 4BK5A 3I1UA 1TMF1 4FUUA 3OUJA 2WZPP 3USSA 4B4QA 1MZ6A 4B1MA 5K8SA 4E0AA 4NHKA 4XFGA 2D97A 5A7WA 4Z2AA 2CAVA 5F5IA 5BXXA 2OYZA 4Y1VA 1DYOA 4ZS2A 2X7BA 1YQCA 2WAAA 3HIFA 3ZR6A 4CEYA 2X09A 3DPRC 2C9AA 4JKKA 2BFUS 4FD4A 2ET1A 3AFKA 5BUVA 1SLLA 3PFEA 3DEMA 2P3JA 1AXYA 4P9LA 4NGSA 2RM23 2Q7BA 3FECA 3FYNA 5E1RA 4EN6B 4NMIA 4NSQA 3LA3A 4A33A 3BUCA 5C5TA 1ZBA2 4Q4V1 2Y38A 4QQHA 4RFRB 4KU7A 2NMNA 2ZAAA 4LUMA 5HPOA 3B3SA 5FZKA 5GZGA 1LTEA 5BY5A 4Q5OA 4WM8A 1FNZA 1HDKA 4UYBA 3SH3A 5FY7A 1YQ2A 3VZOA 2OZHA 3A0NA 4ARYA 4Y49B 4QB6A 4C2ZA 1POQA 1DGLA 4KSAA 3A21A 4AVSA 1RVF2 4Y5Z0 5K8OA 5L7OA 1RUC1 1ZA7A 1VP6A 3TO9A 2ZW6A 3ZJ0A 3MW2A 2JB4A 3WOGA 4FWUA 2D5FA 3D6EA 4XUPA 4QPGB 5EJ1B 3BJ7A 3FZ3A 4LNVA 1AJKA 1ULGA 2OB0A 2Q4SA 3T4VA 1RGSA 1GZWA 1AYM3 4XUQA 3WDTA 2VZTA 1EAH1 1TE1B 4FXGB 5LBFA 5JSRA 5JZGB 1F57A 4NGQA 1BCXA 4I09A 4M0NA 2GALA 4BIOA 2WNUB 4S2HA 1WD4A 5EZWA 4LBQA 5FPXA 4MY0A 1HIXA 2RMU3 2WSVA 3Q8CA 1PVC3 1JH5A 2Y6GA 4UF0A 1XMBA 5DUUA 5FWJA 2JEWA 4JWPA 5JZGA 3BALA 4NROA 1WBFA 4HSJA 4QDQA 5BNOA 2RR13 5LB6A 2PSWA 1DYKA 2OIIA 2DDUA 2WDBA 2VL1A 4UFXA 3RJRA 4HVRA 5F09A 5DWNA 2BJSA 3GZEA 2R0FA 1UZWA 2IXHA 3KV4A 3PU3A 1SZBA 1RUE1 1W6QA 1W39A 4NRPA 2R042 4JHTA 4UBHA 4AEMA 1W8TA 2QQPA 4JGYC 4ONUA 4QKNA 1PVC1 5JPMB 1IZ3A 2UY9A 4QM9A 1W3XA 3ISZA 1MQTB 5FYCA 2AREA 2IL4A 3BGAA 2JDAA 5FYTA 1NCQA 2DVDA 3H42B 1OF4A 5FY8A 3SCGA 1IQDC 4IEOA 3U11A 4CCCA 1Y4WA 2VW2A 3ZYFA 2R98A 3MZHA 1XBUA 5I0CA 1J4JA 1AR71 3PB4X 1UIKA 1JWQA 1L7RA 4MCSA 4LHLA 5JUVA 2DTYA 2KA3A 4A3ZA 4CDUC 3RZLA 1LGNA 4A7KA 2WUUA 3SKVA 1YFXA 1PIV2 3TEXA 1AYM2 4HK8A 3WP5A 5CISA 4L9BA 4C0BA 1O3QA 4MGTA 4P4BA 2EIGA 3JU9A 4LO7A 3AM2A 4A6OA 4XJZA 2WNVC 4TWTA 3ZMNA 2UWBA 4XXPA 2VNGA 2VCBA 2R32A 3PUQA 3P5BA 4XIKA 1ZREA 3MIFA 3OPWA 1YNAA 4FPCA 4K7JA 4LO6B 5F5QA 5A3TA 1Y9GA 2W92A 4DO0A 1EV12 2WN2A 3WNLA 2HH9A 3VBRA 1JYCA 3BI0A 2A3WA 1LESA 4F0YA 3VARA 5LYIA 4IE7A 2B4BA 1SLAA 2OXBA 3JD71 1KFXL 1OSGA 5A3MA 5HCHA 1NE4A 3LWCA 2W46A 5I93A 2CTBA 5JQ4A 4M0HA 2RS31 4KBBA 2ZOFA 1YFWA 1CAUB 2VQ0A 1TNRA 3N9NA 5A33B 5ABJB 4BQXA 5K0UB 2Q0YA 1SQHA 1UN1A 3RWNA 2PJ5A 4N43A 4CUGA 3R95A 5HCFA 1WLTA 3AMMA 4YW7A 4QGNA 3I59A 1CQ9A 2B45X 5IATA 2BEIA 3KV9A 3OTFA 1SLCA 2D93A 3N9OA 4NRMA 2WYRA 3ZPOA 1ULPA 5KHGA 4M3CE 5GLUA 5LRGA 4II9A 3ZDSA 1CAWA 1GP6A 5FZGA 4DNYA 5T5LA 3P3NA 5FBZA 1GOHA 2BZDA 5CIRA 2QECA 1QSMA 4KORA 4DJLA 3N36A 2J1UA 1WUVA 2GN3A 2FE7A 1RINA 2J1VA 3DDDA 4KOXA 5DAPA 2CY2A 1CJPA 2VTXA 2ZGSA 4DUVA 5LBBA 4R9DA 2VMGA 3IIBA 3QNVA 2PJCA 4NGRA 2TNFA 2OQ6A 4FPOB 4O7XA 3D7FA 4MG2A 1FT9A 4O61A 4AFDA 4N8MA 1OLQA 1WA4A 2ZHMA 1IY7A 4ZZ5A 5F49A 3AKQA 5IFTA 2LTNA 4B6ZA 5F3CA 4XFAA 4EWTA 1U5XA 4UIBA 4L8AA 2HWE3 1XU1A 5JI7A 4UAPA 4C7IA 2ZW7A 4LKFA 2DUPA 2XKOA 2GC3A 3SISA 4XACA 2AENA 2A4NA 4PXBA 4OZXA 1UMIA 4D6QA 3S5QA 3GY9A 4UEFA 4ISRA 2HWC1 2IWGB 4W8JA 2BNOA 4MGYE 3S7IA 3D67A 1F31A 1D7PM 2WLPA 2VBDA 1DYPA 5FLJA 3T1MA 3BIEA 3J7HA 5CKNA 4LBOA 2D4OA 2ZENA 2XVGA 3TBDA 4A31A 3AP4A 4DOUA 1R57A 4ZXKA 3ENRA 3OGSA 4QX0A 3S0MA 1QH6A 1FNYA 5DDJ3 2KM2A 3OD4A 2PELA 4AVBA 4IGQA 1L7LA 2VPVA 2H5MA 3E1F1 1FOD2 2B8MA 2ORXA 4L8QA 5IX3A 3POGA 1LGBA 5C4WB 3WNOA 2WWJA 3C7HA 4QU1A 3NE7A 3ZXKA 2O14A 2VNVA 2ZEDA 1H1AA 4RQPB 4FAGA 3BCWA 1E5RA 1OOPC 2MEV1 3TNQA 1PMIA 3ZYPA 3LODA 2CHHA 1VMHA 4YWAA 1QQ9A 4TN7A 2JG8B 4JKMA 4X6QB 4YG6A 1SCSA 2R041 2ZGRA 4KG0A 4Y5TA 5GJ6A 4UEEA 4GS4A 1O8PA 1V0AA 1OBRA 1RUC2 3FMCA 4EN9B 3ACGA 4EN7B 2Q44A 1AR81 1WLDA 2VOVA 5IK8A 1LANA 1DZTA 1XQNA 1K5MB 5FZ0A 1YMEA 2V77A 2E63A 5FPAA 3U0ZA 4I30A 1MACA 5CA6A 2OZUA 3U4SA 2PVWA 1H9PA 1QHDA 3MFCA 4RHV3 1PGL1 3ZKUA 3VH9A 3ABZA 3VLBB 2Y0MA 5FZBA 3N7KA 2WWSA 2VCCA 2Y26A 1IPKA 1FYUA 3PRTA 1AR92 3B5LB 3D3AA 1JYNA 3QAHA 4MHPA 2ZEEA 2RS51 3P6BA 4NN0A 3NWKA 3ZO0B 1EPZA 2C0ZA 1NCRA 1WW4A 1ELLP 5FYVA 5BNPA 1RUD1 1Z8WA 4QC6A 1PHMA 2WL1A 3JBG1 5E96A 1NMTA 2HV2A 4K20A 4CU7A 3H7YA 4AEDB 1BPNA 5J8FA 4Q8KA 4UW5A 1ND2C 3PMSA 3VKOA 3RMYA 5HBAA 1IB1E 4FD5A 2ZEHA 4XFCA 1W90A 2A6VA 1Z8XA 5T5JA 3U14A 4CDXB 4YW3A 4BQ1A 1W2OA 4MHRA 4AOCA 1NQDA 1QY4A 2QQMA 2UWCA 3B9IA 2IVJA 2PRQA 3ILFA 3B3VA 3ZFFC 1W9YA 1TXRA 4EWEA 1SFPA 2FDJA 3O7OA 4KWJA 1R3NA 3JBG3 1COV3 1CVNA 1ULDA 4CCKA 4QUSA 8CPAA 3LZZA 5LASA 3LOIA 4RSUA 2POKA 2JDMA 4D8MA 4A38A 1ZBA1 1LECA 2JD9A 4OI2A 4Q4V2 3ZFEB 1AUYA 2NMTA 2DBIA 2ZEPA 4Y1UA 4D69A 3OEBA 2UU8A 4XCAA 2C4XA 3E6BA 3MV11 1O59A 2QQLA 3ZFEA 4R7MA 1VBE3 1NA1C 5JAXA 3D4UA 4PI2A 2D5HA 1DGWA 1IS5A 2MHFA 3P1IA 3HMYA 4W50A 3VDAA 4GWMA 4MH0E 3KASA 3LWUA 2UURA 4Q4W1 1COV1 4NPMA 4MGQA 4P9IA 3VD5A 2ATFA 2HWB1 3B93A 3MLLA 2G9FA 4N9IA 4E2QA 3ROUA 1RUI1 1VBA2 5LK5A 4GXLA 5CVRA 5FZ3A 1OA2A 4YGEA 2O1QA 2VBBA 4YYOA 3ZXDA 1RITA 4K40A 1JOPA 2BTVC 5A28A 2VVDA 1VBA3 3MW4A 4SBVA 3IEHA 4HKWA 3B35A 3G3SA 1EV11 3PBEA 1R082 1TQ5A 1D4M3 3NV1A 5J09A 2VZ3A 2PAMA 2W3JA 1M4GA 3BTYA 1W9FA 1DGWX 1S0GA 5F2WA 3I54A 1G9FA 4AFMA 3ON7A 2Z5WA 3POBA 4FOWA 1XNKA 2QQWA 5F1RA 2J8MA 5H86A 4IGPA 4QPYA 5BNPC 1HB4A 1NE6A 1VLNA 3CZUA 4V2WA 4M3CA 4ES8A 4YZ1A 1Y9MA 3ORJA 4D0QA 3GUXA 5KXDA 1TME2 2IC1A 2PLV1 2NYQA 4QXCA 4FOYA 2WQZC 4QWNA 1RC6A 1R091 2B3VA 4CAWA 4Y33A 1EV13 3I2OA 5FWEA 1F35A 1F15A 1GP5A 3AB0A 4FPFA 5FO7B 2C6SA 2CIJA 1QJY1 4A2ZA 2W0XA 1QJFA 4AHWA 5F2SA 2AFUA 3ECQA 1AL0G 3N7JA 4QQLA 1NSAA 1XIXA 1FPN3 4KOTA 1PK6B 4M6IA 2BYVE 3WQBA 3KWVA 4AYUA 4D7YA 4MCPA 1WCKA 3J7LA 2WO1A 4KI5M 1TMF3 4BXFA 3O14A 1YJKA 4PIXA 2XEFA 3IWGA 2X53S 1ON0A 2P3YA 3NAPA 2CXAA 1OPMA 1D0GA 1ENQA 2BL1A 2GNMA 3SI0A 3FBYA 2VGDA 4JGZA 1TME1 2PLV2 1EP0A 4LBMA 1AR93 2J1RA 3U10A 4E4ZA 1C1FA 3VBOC 1C4RA 2QKDA 2ZEWA 2O8QA 5IVJA 2A71A 2ZZQA 3L2NA 1UZ0A 5I0UA 1W8ZA 2VZSA 4JTOA 5C70A 1DTDA 5FAXA 3ZOIA 4HG6B 2FS5A 1GP4A 4Q4X2 1K5MA 5HH1A 3E5XA 2YC0A 4RQPC 1DDLA 3CXSA 4DXSA 2IXKA 3DV8A 1Y7EA 1BBT2 4OAEA 2ARAA 1ZRDA 4RS5B 3D8CA 4XPVA 2HWF3 2YROA 5FP9A 1CAVB 1WWZA 3V65A 2WC2A 3WEZA 4XJAA 1PIV3 1G86A 5FZ9A 4XUTA 4EV0A 5FYIA 4CRZB 2WKKA 3FL7A 3PJYA 3RZHA 4HVOA 4INDA 4LTAA 4BMHA 4O9EA 3I2DA 1ZRIA 3Q9OA 5F7UA 3O1VA 2F5IA 2Q51A 1ND2B 5FMDA 3D3SA 3IU1A 4JXRA 1OUSA 5JWPA 3S5AA 4XBLA 1V70A 1ZG9A 2ZHNA 3KLSA 2D40A 3UGGA 1NUKA 3KCYA 4NGMA 4GJYA 1JBCA 4C91A 2JWPA 5FYHA 2HWF1 5JDBA 1LB2A 5CFDB 5D8AC 5FZAA 1OURA 3OPTA 2W1QA 4P9WA 4YFWA 1X9PA 2PHWA 3ETQA 3OG2A 2WZR2 3LE0A 3WUDA 3KB5A 1PCAA 1LHOA 3ZPYA 1KUVA 3GKRA 4OMEA 2HWB2 2WLQA 3CMGA 4F8AA 1W0OA 1YWKA 3B02A 1XYPA 2WPXA 2WZR3 3GHMA 4KQ7A 2VXKA 1BEV2 4Y24A 5C8WA 1W2NA 3DXUA 2OPKA 3EC4A 2FZ2A 3JUWA 4FOVA 2Z3NA 2OZ6A 2GFQA 1HRV1 3SCFA 3P2HA 3RFRA 3GGLA 1NCRB 5FMOS 3GJAA 5FZIA 4H89A 4JKLA 2PJ8A 5BNQA 2J8NA 3NW4A 1R083 5FZOA 1HB1A 1HQLA 4DUKA 4ZI6A 5SV5A 3M4FA 1OD3A 1E5IA 2E31A 4Y22A 4ZY9A 1XE4A 3RNZA 3TO7A 1C5IA 4H2AA 1CG2A 4KWKA 3AP9A 5DUXA 3T2QA 4CU9A 1NCQB 4YZ5A 4QB9A 5ABJC 2HKXA 3A22A 5DPNA 5K0UC 1XNDA 1UU6A 1N47A 1UPIA 3JUUA 5FJHA 5G22A 5KXEA 4L99A 4B12A 3GHNA 4FFIA 2OS2A 2HLEA 3MFAA 5HMNA 2PHDA 4C0HA 5K8NA 3P2FA 1YVOA 1UFHA 2VZOA 4Q26A 5FXZA 3FEEA 5LRJA 3EMRA 4PHZA 4GWNA 4C1WA 2G19A 5BNPB 1M4WA 3N9LA 2WFF3 4F3JA 4MHYA 2Y6KA 4YVSB 3I49A 5JOXA 5F32A 1WGPA 4CCEA 3W9AA 3FLTA 1ZRRA 1Z5RA 3AYDA 1CR7A 2JD4A 3AX4A 1S2BA 1ZRCA 1OD5A 3RSJA 3KQ4B 1RUOA 1IS3A 2W52A 3WNNA 2JB8A 2C27A 2OU2A 4GKYA 3HNMA 1H8TC 2QDNA 3AL6A 2AJ6A 2VO5A 2RS52 3GYAA 1KQRA 1O8SA 2HEWF 4HKLA 4KMQA 2B42B 2WA3A 1KDMA 1HRI1 4HLTA 3NO8A 3WDUA 3WT3A 3IU2A 1D4M2 4XF4A 1C28A 5T5PA 2WWUA 3UESA 1NE9A 4NIHA 1XJAA 3BN6A 3MIEA 5FZMA 3O1SA 3D5OA 5EP9A 4A39A 3I8TA 3VZJA 3LD8A 3ZYGA 4Z2WA 1VMJA 4L2NA 4OHWA 2W2IA 1GNYA 2FQPA 1GNHA 4JHZA 1QJZA 1LOCA 1CAXA 2VXRA 3IDAA 4YNIA 4TXWA 3ZYHA 1BJQA 2JG9B 3ZXAC 3CJXA 1RUI3 2Q30A 1BZWA 2FL4A 4TTGA 4XETA 4YLZA 2JG9C 5CYYA 3RJ2X 2XBO1 3VZNA 1DLCA 4CCDA 5FLIA 5JIUA 3ST7A 3D2MA 3DKQA 3PB9X 1MZ5A 1W6PB 1MEC2 2GC2A 1GLHA 2VM9A 1VRH3 3HQXA 3I97A 3OCPA 4GMP0 4Z82A 4Z07A 5FYZA 2V4AA 5B4XA 3VL9A 5FK8A 4GM5A 1ZZBA 4MRIA 3OY8B 5JR7B 2FCKA 1DF0A 4CDUA 1WW7A 4TLGA 4MJ8A 1S2KA 1S0BA 2CGOA 2D6NA 2JKXA 4PIZA 5KTDA 2VECA 4MSVA 4N43B 1WMEA 1LOAA 3AP7A 4DIQA 4ATFA 5HVFA 2R062 4CEYC 5HCAA 1OPOA 4F6AA 4BU2A 2QQUA 1T6BX 5ACA2 4S2GA 4FQ4A 1N1VA 4K8FA 5FUIA 3ZYJB 2ADDA 1VRH1 1OMIA 3IBMA 2TEPA 3ZX7A 5B2GB 4ZY0A 4MVTA 2P2KA 4MFLA 4ISQA 5C33A 5T52A 1OC1A 4FI9A 2ZW5A 1D4VB 1V6KA 4YVWA 3IFEA 4CGPA 1ALYA 3GYDA 1BAVA 2PDOA 2XL9A 2Y8KA 4PCRA 2BWAA 1UL9A 2DUQA 2UYBA 2SLIA 2WT0A 3AZWA 5T55A 4NJRA 5E16A 2P3KA 2HUZA 2EIEA 1R64A 3RQ0A 4PSWA 4QPGC 2JDHA 3AL5A 2QDRA 3NJZA 5C4WA 1VE0A 2AZ5A 2CF4A 5FXXA 4KOUA 3AZZA 2HBUA 3VGIA 2BPA2 1TG7A 1UYPA 2NM1A 4LE3A 4A41A 2ZEFA 3O1PA 1GOGA 2FDKA 4MFJA 3A7QA 3IMNA 1R092 4NGTA 1W04A 1XNTA 4K1ZA 3O5SA 2YFUA 1SHWB 5FZ8A 4COZA 1WD3A 4XBQA 3UKTA 1LRZA 4KSIA 4PXDA 5LY2A 2P34A 1I5ZA 2BP6A 5DMYA 3U4XA 5C88A 1PO12 1UW8A 2ZGOA 1BVVA 1GU3A 1RHI2 1ULFA 3VBFA 1BLLE 1N71A 1EAH3 2VQTA 2P4EA 3S30A 3H8FA 4Q7AA 1Z7S3 4O65A 5GM0A 2A7AA 5BYNA 2R7HA 5F37A 4CRYB 2AGSA 2WYSA 1XPWA 3D7DA 2CGNA 5D29A 3VWDA 1UZZA 2QCSB 2QMLA 1GKBA 2ZEOA 4M6GA 3JD72 2Q7SA 2AC1A 4CYQA 2RR11 3I2KA 4BM8A 4CYPA 5K7PA 1ZX5A 4AI3A 4BQ3A 1KJRA 2RFHA 1YGHA 1AYEA 1M4IA 1GV9A 2HYXA 2FCVA 1C8M2 2PYTA 3LAGA 2JKBA 3T1LA 3K2KA 4OC1A 1MS0A 1TZOA 2VOXA 3AMHA 4O9GA 2XJVA 4W4ZA 5C6CA 1Q2CA 1UYXA 4H6UA 4ZX8A 4IQPA 5DUWA 4CXXA 5LEKA 2ZBJA 3H8XA 5F3GA 4BBHA 2XJTA 2W95A 1JOJA 4Q1RA 4QMAA 3TEWA 4NIDA 2Z0ZA 4BB3A 1JZ6A 3WINE 3BIWE 4N43C 2OUJA 4AE2A 1XJOA 4KOYA 1T2XA 2W5FA 3ZVXA 1CGPA 4YG3A 2OOTA 1BQPA 5CG9A 1CESA 2IXIA 1JU4A 3J9SA 3JQWA 4JDMA 4ZU4A 5IVYA 3R96A 3JCIA 2FXFA 1YJLA 1HN1A 2PHXA 5A7PA 3PB7X 4LITA 1W6MA 2DVGA 3JB4C 1H1MA 3LB9A 1OH3A 3IT8A 1OA3A 3J4UH 4DXZA 4PSXA 3SI2A 3S9MA 1IOIA 5FP8A 1PZ8A 3TN92 1JYWA 4P4FA 1UU5A 4LIVA 2XONA 4XF1A 2FIWA 1GOFA 5JOYA 1S0CA 2FDGA 1Y9KA 2REFA 3F0AA 4XPKA 3RAMA 4CGLA 3W59A 3IWWA 2WIIB 4YM3A 4UW3A 3LSEA 3R9EA 1YR0A 4FOQA 2CL2A 2WO2A 4IEUA 3SC7X 2DCKA 4JDNA 4NE9A 1SFNA 1AHSA 3V0AB 2R6QA 3I2JA 3O1UA 5LRKA 1PK6C 1HX6A 5FZCA 2E26A 4EZHA 3KZWA 4EQVA 2VEZA 1AMPA 3S6HA 2E9QA 5SV8A 2V8VA 1QOTA 3OJBA 1LENA 2VUAA 5L9VA 2B9VA 4XF3A 1IGBA 1IICA 2VW0A 3OGRA 4DEVA 3JVNA 4YGDA 1HDQA 2VZ1A 1CAXB 4I3PA 4OIDA 4G4FA 4AAXA 1V9U1 3U1XA 5A6ZA 3MDPA 5J48A 4E8OA 4EMEA 2W47A 4UBGA 3THCA 3ZSKA 3BKZA 4MXVA 4OC2A 4LA3A 1AR82 3X29B 3THPA 5DZEA 5J1XA 3IC1A 2R1BA 2PJ1A 3H3ZA 5DZGA 2PJ7A 1WKYA 2PMWB 5FMOL 3AJYA 5H9RA 3DYMA 5A7WB 4CGOA 1DLLA 5C9AA 4PF1A 3RGBA 3FB3A 1VAKA 4NCZA 2VQUA 2JEMA 2XH6A 3WNKA 5IK7A 4HBNA 1G9DA 2NSMA 4GQ7A 2PR1A 5A6QA 1PVC2 2XPJA 4AFCA 4AFBA 1PO21 5E6HA 3CJIA 4AGVA 3FRMA 3TOAA 4UA3A 1ND3C 1SMVA 2EBJA 2RS13 1Z78A 3TOBA 2BGOA 4C90A 4IHMA 1RB8G 5T3NA 3ALQA 4JJXA 3THDA 1VB2A 4NHLA 4Q27A 3TX8A 3ACFA 2DU1A 3JD73 3NH8A 3CXQA 4IAVA 2ZOGA 4N53B 5LEJA 2GMPA 2VUJA 2G9DA 2Q4ZA 4MFKA 1ZLHA 1CIYA 3VBHC 3ZN6B 1PO23 1UNBA 4CEWC 1VHSA 1NQJA 3N7MA 1UY4A 2G4IA 3VDDC 1VBC1 4P6YA 3LGRA 3EY5A 1H30A 3TEZA 1W9TA 5FOBB 1PNGA 3WP3A 5IHRA 3AZVA 2BERA 2GU9A 4QXKA 4X3RA 3ZXGA 5DABA 4QX8A 2PAEA 1QJX3 3TOJA 2ZGMA 2P5BA 4QPIC 4ASKA 1W6PA 4MMOA 5IB9A 4PXEA 5EFUA 3OBTA 2A6WA 3K48A 1DIWA 1C5HA 3IN9A 4XZUG 2Y60A 4TZDA 1UXZA 1OQEA 3WG1A 4NFRA 4ZY2A 3T9YA 3OYWB 3V8IA 3WABA 3K4AA 3SXWA 4KNCA 1R1A2 3GXUA 1C3HA 4NVPA 5FO8B 4K9SA 2R063 5KXBA 1S7NA 2AEZA 1TF9A 5KHHA 1TF8A 1P0HA 4ATEA 2D43A 3TT2A 2Z3KA 3O1RA 4UFHA 2J1AA 1AL21 1PGW2 2MEV3 2XQRA 5FLHA 2BW8A 3FUQA 3VDDA 4D7TA 1XBFA 3B3TA 3HNBM 3VBFC 3WG3A 3V38A 4P9GA 2C26A 5KXCA 3WD5A 4S2FA 4MHDA 5CFDA 1NLQA 2D6PA 5K8MA 4Y49C 2CNTA 1W0PA 4E27A 3FMGA 4YM0A 1EUTA 1KD7A 2VNRA 5DUVA 2GH8A 2LALA 2FIAA 1DE4C 2Q1MA 4L92A 4NGPA 2K9ZA 2QVPA 2HJIA 2XJQA 3HVDA 4I0BA 1CWPA 3MPBA 4XNHB 2ODFA 2ZXVA 1JZ7A 2RG4A 3S6KA 4DUWA 1CPNA 3FBMA 4WBBA 4A94A 3MYXA 4URAA 2ETEA 3FEDA 2A75A 3WXPA 1OI6A 1CPSA 2J1EA 2BNNA 1GFF2 2C1FA 1LRHA 1OLME 2VMCA 2XKPA 4QD2A 5IAVA 3RMXA 3BVCA 1MPXA 4LOSA 1S7FA 4B1LA 3SJFA 1GICA 1Q5OA 3NSTA 3RYOA 4FFFA 1G7YA 2JG8C 3VBSA 4CTEA 3C7GA 2ZHLA 3ZXEA 4F9UA 3M8LA 4PLOA 2VZYA 1X8EA 3PURA 4PBPA 2AFOA 4Z65A 1B35B 1NSLA 3KVBA 2D6KA 2GU2A 3OEAA 1OBNA 1AYM1 2DF5A 1N3PA 1V6IA 3JB8A 4LO4B 5DQ0A 3IPVA 1SLTA 5E89A 4A7ZA 4BQYA 1J1LA 4P9JA 3ISXA 4LBQD 3ZN5A 3POWA 5AG5A 1HV1A 3AK0A 3VATA 2Y64A 3H50A 2PA7A 3PUIA 1CZSA 4Y20B 3K4DA 4Y1XA 2P6EA 1QJY2 2FCUA 2JDUA 2O8OA 1MJBA 1QKQA 5A7NA 1JYXA 3D8PA 5FPLA 4HPSA 4PF5A 1RUG2 5FZDA 3RPQA 3WT4A 2WA4A 2R8VA 3CPAA 3QCWA 1UKRA 1UU4A 2FBEA 4JZRA 5CEHA 1SACA 3KF3A 3L2YA 1ZBA3 3RZGA 4WVZA 2ZELA 4PLMA 4META 2DFCA 3WCRA 1BK0A 2WFF1 2RJ2A 4FFHA 3GCXA 2G3TA 2IVIB 1RUE3 1R1ZA 4PDWA 3WNPA 1YEWA 2I07B 5IWFA 1V6OA 3KHZA 4DXRA 3I2IA 2EVXA 3PUAA 3HLPA 2VCAA 5FY4A 1GBGA 4RGAA 1PK6A 5A3PA 2ORZA 2OA2A 5FY5A 3ZFGB 2GSYA 1WCSA 3WNXA 4AI1A 4GIQA 2XWJB 4MGKE 4ZKTB 1HRI3 3B3QE 4IL7A 3UKVA 1O5UA 3H9AA 2PJ3A 5CADA 3PL0A 3GNEA 4JGZC 1C8NA 1HRI2 5CNAA 3U78A 4DY3A 3HUVA 4YRHA 1XOYA 1XU2A 4UFIA 1FNOA 4YGBA 3LD2A 3BI1A 4EWAA 3JZVA 3OGJA 1CPXA 2HWD1 1VIXA 3RI8A 3IAPA 5CB7A 3FNCA 3EJKA 1M44A 1YREA 5H9QA 2XEJA 4MFQA 1DGRN 3JBG2 2B9UA 1PU9A 1D2QA 1ZVFA 4KBZA 2JICA 3GCWA 1BHGA 2RHPA 1PM7A 3H8UA 4QX5A 4BA6A 4UF4A 5IB0A 3AFGA 2NP0A 5HVGA 1QNWA 1V00A 3URFA 3GBWA 1H6XA 3HN3A 4XDPA 3RVHA 5FQ0B 2GP5A 2VR4A 1LKNA 3ZMOA 4OI0A 1ARMA 2B4DB 2ZABA 4NWVA 2J9AA 2PVVA 2EXHA 4OC3A 3AVRA 4WZFA 2YGLA 3I3GA 1OLMA 4GALA 4I02A 2VW1A 5CFCA 3I3MA 3HWJA 4XFIA 1LOKA 4CEWA 1OUXA 1VBB2 2QNKA 5F9TA 3AJZA 1WW5A 3W5NA 2YFZA 5JZGC 5GZCA 2ZGTA 3UY5A 1XC6A 4FQZA 5G05L 5FZHA 2YY1A 5BNOC 4A95A 4V1PA 3B3CA 5AG7A 1IU8A 3ES4A 4GZ9A 1X9TA 4YFZA 1M06G 2VOKA 4UWJA 3WF1A 3PTRB 2Y6HA 1QSOA 4FTEA 2VVFA 3PVEA 2DWRA 1NX9A 4QAWA 5CPAA 2ZMKA 2WSUA 3CHXA 3LIHA 4XHBA 4LK7A 1QJU2 1N1TA 4FVVA 3PVNA 4FPHA 3KV6A 4CRQA 3WDYA 2IFWA 1D0HA 4GMP3 4D3WA 1XF8A 4MFZA 3O1TA 1QJU3 4JLYA 3M7AA 4AXVA 2XUMA 2IJZA 5LYLA 2K0GA 1LNSA 1OT5A 3ZIXA 4X6RB 2XR4A 2AFZA 4LE4A 1KRIA 4HN1A 4CGMA 1QJX1 1VRH2 1WMFA 1UF2C 1UIJA 3DKWA 2BV4A 1NT0A 4FP2A 3PVBB 3QACA 4AVAA 4MUVA 1JHNA 4CUBA 1QWRA 4E4DX 4LHNA 3LPFA 2EUIA 2JDCA 2PJAA 4NJQA 5FMBA 2FDHA 4AF9A 3WP4A 1O3SA 4XJWA 1QJU1 1FT7A 1RUH2 1RHI3 3Q8BA 4J6GA 1F8VA 2OVUA 3HN1A 4M6HA 4RUHA 2QJVA 4Q8LA 3S6PA 3OGVA 1G9CA 4U36A 1YLOA 2K5TA 4XUOA 1HJGA 5D21A 1VBB3 3IMMA 3OUIA 4YPJA 4YARA 2P3IA 5FR3A 5JH9A 3EHKA 2IUWA 1Q8SA 4QKFA 4XMAA 2GC1A 2TBVA 3BB6A 4NR1A 4PDWB 5JXIA 3S6FA 4D6SA 4K3UA 4AHZA 3VBSC 1W06A 3VD7A 2JE9A 3ILRA 4ET7A 1VBD1 3ZYIB 4I2OA 2JBKA 2Q43A 2ZEYA 4KLVA 1RXGA 2W94A 4XABA 1YFUA 2NQYA 4Y4YA 3UK9A 1U5ZA 1UZYA 3VHPA 4ZU5A 5KC6A 1LAMA 1EPWA 4OIWA 3WC6A 4AFAA 3D2PA 4CAEA 2DPSA 2YBSA 1RXTA 1VHEA 2Q8OA 4CUAA 2JG8A 2EIBA 1FAYA 1IIDA 2ATRA 3OD0A 4KL1A 2EK9A 1XSRA 4TLFA 3JTKA 4PQAA 2V72A 3RBUA 4KOWA 4FXKB 1JS9A 3DUIA 1VGYA 1S0IA 1WZXA 2Y33A 3WW3A 2GIVA 2VJXA 1QDCA 2EF6A 2EXIA 3NNFA 3MUZ1 4A3XA 4P10A 5JPHA 5AC93 1WA6X 1LOFA 3LEMA 4FP3A 3VZKA 3EO6A 2G0BA 4UWDA 3OYWA 5J7MA 3H3UA 1NYWA 5JVVA 2F4LA 4GH4C 4S2DA 4BWOA 5KTAA 4Y1ZA 2AUYA 2D6LX 4XQ4A 2HYKA 1S0DA 1AVBA 4CVUA 4QPWA 1K12A 2BUKA 5I0RA 5FTTC 2EXJA 2E32A 1EUUA 1NKGA 5IK4A 3GF6A 3RZZA 1DQ4A 2CSGA 3MICA 4DXTA 2XVKA 1IOFA 5CFCB 3RYRA 1CPMA 5LY1A 2RS53 4B8EA 4CPBD 3V0BA 3CQOA 4PQQA 4AI9A 1MJAA 2J8RA 1AX1A 1GWKA 4DFSA 1VMFA 3LEKA 4DMIA 4HKOA 4AEDA 1Q7LA 3S7EA 2JIJA 4UFJA 3R6SA 4KZTA 5EIYB 1YVKA 1JYVA 1XRUA 3PUHA 3I2GA 3PVOA 1PZ9A 1DCSA 1K3IA 2Y0IA 3KM5A 1GYKA 3NJYA 1PUAA 4YSFA 1YI7A 2ZXQA 5HXMA 4Q38A 4R76A 2YYOA 1O7FA 3AYEA 1LGCA 4EN0A 4UFWA 5FP7A 1BMV2 2JECA 3WG2A 3ZYBA 2AE6A 5FDBA 2WSAA 3H1MA 4RN7A 1HQNA 4QX2A 1BO4A 1J59A 2QBXA 2WNUA 1LULA 4IV1A 3MV01 2MPFA 4F7ZA 2E53A 4K6BA 1YLEA 4M4RA 1WMDA 4AL9A 2GNDA 1LHNA 1YW6A 2WZNA 3HT1A 4FD6A 2WNEA 3K77A 3WZ1A 4YRDA 5F5AA 4PPZA 2ARCA 4OKOA 5IVEA 4R4XA 3UKNA 4PXCA 5FXWA 1O4YA 5A3LA 2BRTA 2WUHA 4MCQA 3CZJA 1RVF1 1FX5A 1LHUA 4NIGA 2HWD3 3IAQA 3WF4A 4QT6A 3ZKYA 1YK3A 4LOTA 4M00A 4RS5C 3WF3A 4WM8C 3ZSMA 2CU5A 2RC4A 3W6XA 4A45A 4YWYA 1W6NA 4XQDA 4UWIA 4C2XA 4GH4A 1Z7S2 1WW6A 4IE5A 3QBQA 2UYAA 2ZZJA 1IPJA 1UMZA 4OCTA 1AR62 1GHEA 3O0XA 4B11A 5IVFA 2CNAA 4OMDA 2C1CA 2ZAHA 5L7OC 3IB3A 4XMIA 5EWSA 1AR63 4FFGA 4B7EA 4PI0A 2PQQA 1F5JA 2ES3A 1MEC1 1K5MC 2WZ8A 2ZJCA 2ZX3A 3BODA 3GJBA 3MF9A 2I79A 2BO9A 1ST8A 1KEXA 1YO8A 2CWSA 3DF0A 4IXLA 3WUCA 3O1MA 5FMCA 1Y9QA 4G9SB 3T09A 4DYOA 5AGEA 1HXS3 2WFPA 2OUHA 1J58A 3MGDA 1CAWB 1E5HA 3J8F1 5IW0A 4AAPA 4MHZA 4PBOA 1O4TA 4NIAA 1SQ4A 4HKFA 2WO3A 3H8RA 3SXNA 2ZMNA 3VDBA 3WR7A 4QB1A 3OBAA 2G9GA 4TSVA 4FBFA 2CNMA 1OH4A 3MO4A 1U5IA 2EXKA 5LW9A 2PJ9A 3AMNA 4LK6A 5DDJ2 4XTPA 5LYDA 4BLIA 2X5IA 3CJIB 5F8PA 4J3GA 4Q36A 3AMQA 4IV1C 3KSCA 4XFFA 4N7IA 4ZXEA 4P9XA 3VHNA 3B7IA 4FAIA 2QFEA 1QJEA 1UYZA 2JE7A 2FCTA
chains in the Genus database with same CATH topology
5ACA3 4IV3C 4R9MA 4WVWA 3USUA 1POV1 1OFSA 1ND3B 2UWAA 1BOBA 4E2AA 3C3VA 3VKFC 3BOWA 1H2KA 3NKTA 2WT1A 2CGPA 5JSOA 4B5PB 3N7LA 1D2SA 5ACA1 1H4GA 1KXGA 1SLBA 3OWCA 1S0JA 3WQ0A 2JENA 1PO22 1ULEA 1B87A 2WT2A 1POV3 1Z4RA 3W91A 5D1IA 5C8CC 4CAFA 4PK3A 1OOPA 4BCUA 1BKZA 2ZX0A 2W68A 4MXWB 4BHPA 4UCMA 2ZGLA 5J8CA 5ISVA 1PGSA 1MS5A 5LK7B 2PQ8A 3IKWA 4AG9A 4C7HA 3APBA 4OVEA 2P17A 1TMF2 3ELNA 2BSWA 3R4SA 5C82A 1W6QB 1PNFA 2ZS6B 4Q29A 4CDQB 2GZWA 5F6KA 1VBC2 1XNBA 4R4ZA 5CFCC 3JTKA 4FPGA 1V0CA 1AX2A 1BBT1 1QU0A 5GKAC 2A70A 2GE3A 2C5DA 1H8TB 3CEWA 5AC91 4KWLA 5EYXA 1I1EA 1JTZX 2VBQA 4NWWA 4I0AA 4IEVA 1F2NA 3K9UA 4QPGA 2XL7A 1RUJ2 4G3YC 4YVSC 1IQAA 1C8M3 4AXOA 2B7YA 1CM0A 4UFVA 3M2MA 5JOWA 3ACLA 1CJDA 3D0SA 2PHFA 3KGLA 4JD6A 3TCVA 3MEPA 4ORFA 3LCPA 3OPZA 2KCWA 2I45A 2DXQA 4I01A 1M1DA 3FX3A 4MLOA 1S60A 3NAPC 1RUG1 3R0RA 4AI0A 2ERFA 2CWMA 3OGGA