4OLLA

Camp-binding acyltransferase from mycobacterium smegmatis
Total Genus 86
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
86
sequence length
333
structure length
316
Chain Sequence
VAELTEVRAADLAALEFFTGCRPSALEPLATQLRPLKAEPGQVLIRQGDPALTFMLIESGRVQVSHAVADGPPIVLDIELIIGEIALLRDAPRTATVVAAEPVIGWVGDRDAFDTILHLPGMFDRLVRIARQRLAAFITPIPVQVRTGEWFYLRPVLPGDVERTYRRFQSVRKPTRALLEYLFEVDYADHFVWVMTEGALGPVIADARFVREGHNATMAEVAFTVGDDYQGRGIGSFLMGALIVSANYVGVQRFNARVLTDNMAMRKIMDRLGAVWVREVVMTEVDVPPVDTVPFEPELIDQIRDATRKVIRAVSQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Allostery and Conformational Dynamics in cAMP-binding Acyltransferases.
pubmed doi rcsb
source organism Mycobacterium smegmatis
molecule tags Transferase
molecule keywords Acetyltransferase Pat
total genus 86
structure length 316
sequence length 333
ec nomenclature ec 2.3.1.-:
pdb deposition date 2014-01-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00027 cNMP_binding Cyclic nucleotide-binding domain
A PF13302 Acetyltransf_3 Acetyltransferase (GNAT) domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.10 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 4ollA01
3.40.630.30 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Aminopeptidase 4ollA02
2Q4YA 3EQEA 4QGLA 4K30A 4PSWA 4XF0A 2ZPAA 5KHKA 2HQYA 3USSA 1Y9WA 1OMIA 3FX3A 2ZCWA 3NVCA 1J3QA 4RS2A 2D93A 4MY0A 1J4JA 2GAUA 4QBJA 5I8YA 2FL4A 4AQ6A 4YRHA 4PV6A 1LR5A 4I09A 4XFGA 5I0SA 4MZUA 3NSTA 1QSNA 3CXSA 3V8IA 4B5OA 4CAVA 3IIAA 4KOXA 4KOUA 2OA2A 4LTAA 3H1YA 5J7MA 1IICA 5HI0A 1H1MA 2QNKA 4HN0A 5FQ0B 3G7DA 4OLLA 3TTHA 4XNHB 1U12A 3LAGA 4II9A 4R57A 1FI2A 1CAXA 4LA2A 2WC2A 2OU2A 3GYAA 2OZ6A 4LEJA 4OADA 4XF9A 2G0BA 4X5KA 4PJYA 2IXLA 4QM8A 5F47A 4KOSA 4U5YA 4BMHA 2IXHA 3ZJ0A 4JTOA 2AE6A 2BEIA 3CXQA 3D2MA 2E9QA 3SXWA 1S7FA 1J3RA 1CAXB 5KHJA 2Q4SA 1QWRA 3MYXA 2P6GA 4CRYB 5EBVA 3I7DA 4LUKA 3UKNA 2QVSB 4ONUA 1J58A 4D7SA 2CNMA 5DWNA 2IXCA 1BOBA 3DSBA 2O1QA 4KU7A 5J8FA 3DN7A 2B9UA 3E5QA 4M85A 3NKTA 5FLJA 2Z10A 4MV2A 4YSFA 2QDRA 4OFGA 3BPZA 4XFFA 2GANA 1UW8A 3TE4A 2XHKA 3EBRA 3BCWA 3M70A 3P2FA 3LA3A 4QGNA 2VQYA 3JUWA 4NF1A 3KCCA 4U9ZA 3OGJA 1YREA 3FWEA 2GC3A 3TO7A 2ZW7A 4XF1A 2CV6A 1V70A 4H7LA 5JSPA 1XIXA 4FD4A 2D5FA 4N9HA 1N71A 3RDIA 3OTFA 3NJZA 1ZRDA 1NYWA 4KORA 1LRZA 4AB7A 5J3UA 4Q29A 5LRRA 2BGCA 2O8QA 1XEBA 2C0ZA 3KKWA 1YLLA 2XKOA 4N9IA 1ZRFA 2B58A 5E96A 2IXJA 5JPHA 4HMZA 2UYBA 1Z9UA 2O28A 4QMAA 1YGHA 1CAWB 2P6EA 3GKRA 3ZDSA 4QB9A 1Z4EA 4CRZB 3D3SA 3QAHA 2XLFA 3OF1A 1S60A 4IEZA 4JD6A 2BNMA 1O3QA 3TOBA 5KTCA 5IB0A 2CNSA 5FLHA 4OAEA 3LOIA 2FIWA 4XFIA 1GQHA 1LKNA 1ZREA 3FYNA 3F5BA 2B5HA 5LEKA 4EV0A 3EJKA 3U10A 1M4DA 4YGOA 2Q0YA 2VBQA 1RUNA 4LA3A 5FPZA 1Z4RA 2R98A 4HVRA 3JZVA 2B3VA 4O9EA 1MJ9A 2EVNA 1KUVA 1KUYA 4E2SA 5F48A 4YRDA 1GHEA 2G3TA 4R9MA 5F46A 2MPFA 2VECA 4Z07A 5BXXA 2GZWA 2QIRA 1ZZCA 3R1KA 1QSRA 4QC6A 3TCVA 3KGLA 2DXQA 2GC0A 3PLQA 4L89A 4KL1A 4KLVA 1SQHA 5I0UA 5JQ4A 3N4MA 4I2OA 2GU9A 1YFXA 1ZZ7A 2B5GB 4IEOA 2IC1A 4MH0E 4FD6A 3GYDA 1FXZA 2Q30A 2FT0A 2ATRA 5KHGA 3ST7A 2PR1A 2I79A 4KOTA 4MJ8A 4UBRA 4Y49C 1VP6A 1YFUA 4EROA 1OD5A 4MGIE 4XEZA 3WW1A 1WK4A 4XPDC 5I0CA 1J3PA 4E2GA 3EFAA 1MJBA 3GBFA 3D0JA 3FZ3A 4QXKA 4FAHA 5I0TA 4YARA 2QMLA 3QACA 3ACLA 5K8SA 3BJ8A 3IWZA 3HT1A 3PZJA 1CAUB 3FE5A 2REFA 4IESA 4X6QB 2G3AA 1Y9QA 3MGDA 4KUAA 1ZX5A 3MDPA 3TNPB 1U6MA 1B6BA 5LEJA 1WWZA 4R52A 2OZJA 2Q04A 3WR7A 1VJ2A 2XGXA 2AJ6A 2BUEA 3LA2A 3PNAA 4WBBA 1YVOA 4QGMA 4F6AA 4IEWA 4QVTA 3DL3A 4CAWA 4AVCA 3FXTA 4LX9A 2PC1A 3TFYA 5FLIA 1CGPA 4KU8A 5JR7B 2JDCA 5GCNA 2CY2A 4KVME 1NE9A 3EXNA 2F4PA 4XF4A 3I54A 4E0AA 2PQ8A 5BUVA 4E2AA 1QXJA 2H0VA 1NE6A 2PHDA 3IDCB 3G3SA 3S6HA 2Q7BA 3KMHA 1Q5OA 3IBMA 1B87A 1NZCA 3HT2A 2PDOA 2B5GA 3DDDA 3C3VA 2Z11A 3F0AA 2P0WA 3I59B 3E6CC 2VZZA 2H6BA 4EWDA 3CEWA 4AXOA 4BIFA 5LRSA 2B8MA 3CJXA 4ZU7A 3U11A 2F5IA 3TOAA 4GULA 5BV6A 1IPJA 4XFAA 1IYLA 1SQ4A 5CADA 2B4BA 2I45A 2BSWA 2FCKA 3T9YA 2ZW5A 5C6CA 5EFUA 2K9ZA 1I21A 2J8RA 4HBNA 1ZRCA 4PIXA 4IF5A 1X8EA 2XKPA 3H9AA 1Y9KA 3S6GA 4F0YA 4HZFA 3EC4A 3VHRA 3H3UA 5JCTA 3ELNA 4R3LA 5JSRA 4DNCA 5FPXA 4CAXA 4J1WA 1FT9A 1QXRA 4LUMA 4XFHA 2VXKA 4YNIA 4FD7A 5J8CA 3CLPA 2BL1A 3E5XA 3M3IA 2QJVA 4FT8A 2K0GA 3EO4A 1WA4A 3PGPA 4PK3A 5BY5A 1QSOA 4R8HA 5I0RA 3H4QA 4JTNA 3O14A 3RYOA 5I8SA 3BJ7A 4Q0VA 2B4DA 1X82A 1I5ZA 2PFWA 1RUOA 2FXFA 2OZGA 3D8PA 3H1WA 4IEPA 3SXNA 4MGZE 1ZNPA 1XF8A 1I6XA 2A4NA 3D0SA 5FVJA 1S5KA 2HUZA 3R9FA 2ZXVA 2CAUA 2D5HA 4BH9A 4ZU5A 3DR8A 5CU1A 1VHSA 5FDBA 1JUHA 1R57A 3C26A 3EO6A 2HJIA 1ZVFA 4IEQA 3I3GA 2REEA 4NXYA 4META 2ET7A 4KLWA 4IEVA 2NMTA 3TNQA 3FIXA 2BNOA 1GQGA 3TT2A 2VQAA 3ES1A 2R1IA 5H84A 3FJSA 3D82A 5C82A 4EWAA 2WPXA 2Q1ZB 4KOVA 5J48A 4UXAA 2XL7A 1KUXA 2I00A 2OPKA 1Y3TA 2ET1A 2ZKLA 3E6BA 3WW4A 1TQ5A 1S3ZA 1O3RA 2Q4VA 3CXPA 4AG7A 1IB1E 1EPZA 4MGKE 3R95A 2PAKA 2Z0ZA 3WW3A 4MY3A 2BEOA 1NMTA 4M3SA 4H6ZA 2MNGA 4Q0PA 4XETA 3W6XA 3B02A 2UY9A 3E0KA 3B8GA 2PSWA 4YFJA 4BYYA 3DKWA 2CNTA 4CYDA 3I59A 4J3GA 4KWKA 2CGPA 1DZTA 1O7FA 2HV2A 3VWDA 2FQPA 3KGZA 1LB2A 1CM0A 2R7HA 4JXRA 1WLTA 4LLOA 4B5PB 4XPDB 1O4TA 2PQQA 2PTMA 1SEFA 3MPBA 4QM9A 4UBGA 4HNWB 1M4IA 1EYBA 4MI4A 3PVBB 2XLAA 5EZWA 4I01A 3KSCA 3TO9A 3N7ZA 3G8WA 3VWEA 4TLFA 4X6RB 4HVQA 1X8MA 1MK4A 3ES4A 1O3SA 5F1RA 1O5UA 3RZZA 3WW2A 1M44A 5CVRA 2JEVA 4F8AA 2OZHA 4HKFA 4MBUA 4K8FA 2X7BA 3S6FA 1J1LA 5CNPA 1Q43A 1XE8A 1I1DA 2D4PA 4I02A 1YVKA 3SCGA 1UCXA 4IEXA 1VKCA 4UA3A 3SHRA 4L8AA 4J1XA 1G6NA 3IGRA 3D2PA 3H8UA 1CX4A 4WVZA 3LD2A 4IETA 2FE7A 3FBUA 4RD7A 4FAGA 3SCFA 2J8NA 1CAVA 2Y0OA 4E2QA 2OZUA 4AG9A 1PU9A 3K9UA 3E5UA 1XE4A 2B4DB 3W91A 3BLNA 4NEXA 3QB8A 1DGWA 2QECA 2KXLA 2UYAA 3L2HA 3ROUA 5DWMA 5C88A 2WFPA 4Q0UA 5AVPA 4LUAA 5D1IA 3CL1A 1IPKA 1L3JA 2PA7A 2DCTA 2OYZA 4KVOE 1FY7A 3CO2A 3PP9A 4XNHC 3W6SA 3DV8A 2D40A 5EC4A 1ZZ9A 4H89A 3IDBB 3BB6A 1LRHA 1Y7RA 3ETQA 1Q2CA 4YYOA 1P0HA 4U9YA 1ZRRA 2XL9A 2H5MA 4O9GA 4I49A 1PMIA 3SXOA 1RTVA 2EA7A 2QCSB 2ETEA 4XFBA 3ZZIA 1DGRA 4KWLA 2VEZA 3SHPA 3JVNA 4PIYA 3S7EA 1ON0A 5I91A 2P6FA 3DR6A 3S0MA 1YFWA 2PAMA 1YHFA 3H3ZA 4JLYA 1I12A 2GIVA 3RYKA 5JSOA 4HVOA 4MX3A 1QY4A 1PUAA 3R9EA 1NXMA 5IV0A 4XF3A 2UY8A 3SMHA 3HIFA 1CAVB 2FMYA 2EAAA 3NW4A 1S7KA 3EHKA 4JJXA 3LZZA 2IL4A 2FSRA 2B3UA 4JXQA 4Q0SA 5KBFA 4D7TA 1CAWA 2GC2A 2EUIA 2FIAA 4NSQA 2P17A 3OCPA 2N7GA 3RYPA 2ZW4A 3FHIB 3LA7A 5T3NA 2XLGA 3NE7A 4CS0B 1K4JA 2JLMA 1H1IA 2Z69A 4P9GA 1Q3EA 4IUSA 3EY5A 5I8TA 1UIJA 4QX5A 3H1MA 4JV4A 4R3KA 4B5PA 1S7LA 4F7ZA 1PM7A 3UKTA 1X7NA 4HLTA 4BHPA 4NCZA 2Q0AA 3FFQA 3R6SA 2VI7A 1CAUA 2Y0MA 4ORFA 1RO5A 3FRMA 1NE4A 4QUSA 4IEUA 5KHHA 4B29A 4LULA 1YLEA 2PAEA 2PYTA 1QSTA 5E1RA 1TIQA 3DNSA 3OWCA 4HNXB 5ISVA 3UY5A 4PK2A 4PSXA 4UWJA 4AQ2A 1O3TA 4HSJA 2OB0A 5KTAA 2MHFA 2ARHA 4KVXA 2ATFA 1OZPA 1VR3A 4HN1A 2Q44A 4XPKA 3OD0A 3FNCA 3HQXA 2GC1A 4ZU4A 1OFNA 3TO6A 2IXIA 4WZCA 1KZFA 4Y49B 1Q2DA 1UFHA 3GY9A 4ZBGA 2GH2A 1IYKA 2VZYA 5E16A 2BYVE 3RYRA 4DINB 2Z2SB 1UIKA 4IERA 2VPVA 2IXKA 2PR8A 1XRUA 1RC6A 1NSLA 1Q2YA 2J8MA 4NVPA 3F8KA 1M4GA 1P4NA 5H86A 1WGPA 4JVAA 2EVXA 2D4OA 4AVAA 1MJAA 1UD1A 3U0ZA 1YUDA 1ZZ8A 1YR0A 2H6CA 5BPXA 1BO4A 3IWGA 1HW5A 4KOYA 3R96A 3S6KA 1OI6A 3H7JA 1M1DA 4XPLA 3S7IA 1YFYA 4L2NA 2OH1A 4XFCA 4L11A 3MZHA 3H50A 5C8WA 1ZZ6A 4IEYA 4EWEA 2V09A 4R87A 5JAXA 1RXTA 1XE7A 3QOPA 5IX3A 2WPWA 2RC4A 3E97A 4UBHA 4I0BA 1SFNA 1UPIA 3NL1A 4GS4A 5FCCA 4I3PA 4FBFA 3BU7A 1IIDA 3I9SA 3T90A 2HKXA 2KCWA 5KTDA 1ZZBA 5FQ0A 2FS5A 4A2UA 2PRBA 5HH1A 5HMNA 4Z82A 3RNSA 2ZW6A 4HSLA 5F49A 1YK3A 2JDDA 3E6DA 3R9GA 4Q0QA 1CJWA 1EP0A 4UWIA 4E8OA 4I0AA 2CAVA 3UKVA 5I93A 3P2HA 4KZTA 4KUBA 1O5LA 1L0CA 4FD5A 3BALA 3RPQA 5KHIA 4KWJA 4MGYE 4KOWA 2PHLA 1QSMA 1XMTA 4AVBA 4HNYB 3FB3A 4MHDA 4H6UA 3LWCA 2K5TA 1DZRA 1RGSA 1YWKA 3H7YA 2BNNA 4PIZA 1S7NA 2GE3A 1J59A 3SCHA 1V0CA 1YX0A 3LODA 4JWPA 4RI1A 4EVYA 2R8VA 1RL3A 4MUVA 3CF6E 2C27A 1EY2A
chains in the Genus database with same CATH superfamily
1KS4A 5JR2A 3V0BB 2XJPA 3EQEA 4QGLA 4E8CA 4PSWA 2ZPAA 2QQKA 3TYJA 3KT1A 2YV8A 5KHKA 3BVCA 2WT1A 3WF3A 3HOBA 1ODNA 1W6MA 2Z3OA 4CGMA 2WLPA 3ACGA 5DDJ3 3W20A 1J4JA 4CU9A 2FL4A 4ES9A 2R0HA 1PCAA 2YB7A 5B4XA 2QKDA 5DAPA 4PV6A 4YRHA 5I0SA 4XFGA 3VDDB 1C8M2 1PIV2 4MADA 2C9AA 1ZG8A 2FVGA 1F35A 3IIAA 5IVYA 3CXSA 5HPOA 4KOXA 2V5DA 4KOUA 1HXS3 1X50A 1MEC3 2SLIA 2PN5A 4FOWA 4AHXA 1LGCA 3H1YA 5J7MA 1C8M3 4AFAA 2HYXA 1BCXA 4NJRA 5LB6A 2Z3MA 2JE9A 3CPAA 5EIYB 2YFZA 3G7DA 1F57A 1LENA 2W1QA 5J96B 1QDOA 2GP3A 4XNHB 4OMEA 4DYOA 5DDJ2 1DZQA 1YLOA 2BOIA 4W50A 4YU9A 1CAXA 4LA2A 2GU2A 4MFPA 3U37A 4CUAA 1W04A 2OU2A 2VNVA 4HONA 5EMIA 2YNCA 4UFMA 4CDUB 2Y38A 1IOIA 3MN8A 4Q26A 2IXLA 1HJFA 1S0EA 2Y0IA 3UYJA 4QPGA 4ZXEA 1UY1A 1HRV1 1K5MA 1U0AA 3VBSA 3O1MA 2C6CA 4U5YA 4JTOA 3J7MA 2BVVA 4LO8A 5ABJB 4COVA 2BBVA 5FYBA 2E9QA 3K3NA 3W5NA 1SDWA 4DUXA 6CPAA 3JB8A 4RQPA 1UWYA 4AVVA 5A3WA 2RFHA 4MLOA 3PFEA 2R16A 4DUKA 4UFHA 4CRYB 2FD8A 1A3KA 4XURA 1BK0A 2CNMA 1CPXA 1ULDA 1Q8VA 3DSBA 4UW5A 1RITA 2VZRA 1FPN2 4KU7A 5T5PA 2WZR2 5DN2A 2VQTA 5JIUA 2X10A 3DN7A 3MEPA 2V4VA 2Q8EA 4JHZA 3LACA 3VZMA 2O4HA 3GHNA 1HKDA 5FP8A 4M3CA 4XFFA 2GANA 3OG2A 2XHKA 5FZEA 3BCWA 4JX0A 2ZMKA 5FY0A 5LW9A 3LA3A 4QGNA 3GCXA 3D7GA 2YPJA 1BBT1 3HBZA 1AYM1 3JQWA 4DZGA 4U9ZA 1W9YA 4A32A 4BBHA 5FZDA 1EE3P 4QB6A 4M00A 3TO7A 2ZHKA 1QIQA 4DEQA 4N9HA 1FT7A 1FOD2 1JYNA 4QBJA 3RSJA 2B39A 4C1XA 2XUEA 1UU4A 1NYWA 4UF0A 3SJFA 1J84A 1CX8A 4UIBA 2RS13 2V4AA 2PJ1A 1M4LA 2C0ZA 1RUD2 1YLLA 3AYDA 1ZRFA 3IU1A 4RQPC 4A7KA 5F09A 1JI6A 1MR5A 4CCOA 2WRAA 3NV2A 1H9PA 1V9U3 4WM7B 2PJCA 1WKYA 3BUCA 1UY3A 2O28A 1CAWB 2PHUA 5FZIA 4MHZA 4AW7A 3KCYA 2ODFA 4CRZB 2WSAA 4IK2A 3DLJA 1MVEA 1ND2C 4IEZA 2IJZA 4MMOA 4RFRB 2D7FA 4ONWA 1LULA 2WFF1 4L99A 3GF6A 4Y1YA 5GLZA 1A78A 2WNOA 3CQOA 2HWF3 3IIBA 2LRPA 3VGIA 1TMF1 2JKBA 3MFCA 4HVRA 3T4VA 1JYXA 1MJ9A 1V6OA 3DEMA 3VD4A 4YRDA 2G3TA 4R9MA 1AR82 4MFJA 1VMHA 2CHHA 2VECA 3APBA 3POWA 1EV12 2X05A 3VL8A 3Q8BA 1S1AA 4CCKA 1QKQA 3KV4A 5A3NA 2QVPA 3SEEA 4QC6A 3MF9A 2GC0A 5HCHA 1NA1A 3PLQA 2E33A 2L9LA 1ZBA2 4LBOA 4CDUA 5EYXA 1ZZ7A 2K46A 1K5JA 3D6EA 2E26A 1LFWA 2KR2A 4HETA 2F4LA 3GCWA 4MH0E 5BNOC 1SBFA 2RJKA 5H9SA 4BQYA 5FAXA 4GMP3 4MVTA 4NR1A 5CFCA 4UBRA 1UN1A 4Y49C 2YBPA 3POGA 4NMIA 1MZFA 2DEAA 3WF4A 1AJKA 1JZ2A 4JCKA 4XPVA 5A33A 5IK5A 1MJBA 1ENRA 2JG9C 4QXKA 5JZGA 1JYVA 2PIZA 4YARA 1UZZA 2GH8A 2RS11 3QACA 4PXDA 2R32A 1STMA 1XBUA 1UNBA 4ET7A 3PZJA 4DFSA 4WJBA 5FUIA 2VZSA 3FH4A 3FE5A 1C1LA 3MFAA 2RDNA 1V9U1 2XMLA 5FZ1A 1JZ8A 1R3NA 3IM0A 4AAPA 1U6MA 1CPMA 1R083 2OZJA 4WM8B 2CYFA 4NJQA 2FMDA 3WR7A 3PNAA 4WBBA 2O0OA 3SISA 4BQ5A 5FZ4A 5BWAB 1PVC2 2VOTA 1UX7A 2XQRA 4QVTA 5SV5A 3DXUA 5JGFA 4LPLA 4ES8A 3V0BA 2V8DA 1WW7A 2DYCA 4LX9A 1PVC1 2PC1A 4HG6B 1PK6A 1ULEA 2OX0A 3TFYA 2YNCC 3BTYA 1C57A 3SKVA 4ZHNA 3AFGA 4H3WA 5JZGB 3TC8A 1W6NA 3VDDA 2F4PA 4TSVA 4PXCA 1E5IA 5BUVA 1RUE3 4NIGA 3KV9A 1BMV1 3IDCB 3NNLA 5HVHA 2VMFA 3PB8X 5HCAA 2CL2A 1TMF2 3GBGA 3HT2A 4LIVA 4NWVA 1UMHA 2Z11A 3ZMNA 1CQ9A 3E6CC 4K7JA 4H55A 3BGAA 4QQ2A 4AVTA 2P3KA 4UFVA 4O23A 3J8F2 4D0QA 2B8MA 5IFPA 1Y0YA 2ZEPA 3JU9A 2F5IA 3TOAA 1UYXA 4CAVA 4GULA 4UYBA 4OI4A 2BU9A 4JGZA 4BZ4A 2BWCA 2LUWA 5CADA 1EAH2 1QMJA 5IT6A 1XB9A 1WZXA 1VB4A 1ZBA1 2K9ZA 4Q4Y3 1AXYA 3ALQA 4BQ1A 2ZGPA 5IVBA 3ZYBA 2ZEGA 2ZEWA 4OZXA 3WD5A 1JZ6A 4IF5A 1X8EA 1G9DA 1Y9KA 4P4FA 3S9MA 5LRKA 4LK6A 1RTQA 3H3UA 4IQPA 4NHYA 5DAVA 4B4RA 3THDA 3ETPA 4YW6A 4AL9A 4RUHA 3I2HA 1JZ5A 4DNCA 1XPWA 3PVOA 5FPXA 2JG8C 3RZLA 1FNZA 2YGLA 5APAA 3UNPA 1R081 4B4QA 2BCOA 3RMXA 1AYEA 5CYYA 4A37A 4AZZA 2Z3PA 1VBE3 3AVSA 5JIAA 3I3EA 4CAFA 2RR13 2Y6KA 2EF6A 3N9NA 4KNCA 3WXPA 2YYOA 4DUVA 1KJRA 1M06G 5I8SA 4LBQD 3RYOA 5JH9A 1IKPA 3OEAA 1GOFA 2VG9A 2PFWA 3D8PA 2FXFA 3SXNA 3JXSA 2GFQA 1GICA 2VBDA 2VOKA 2G19A 2XONA 2VCCA 5DUUA 2PVVA 3B35A 4PCRA 2WQ4A 1IQDC 2VMGA 3IB3A 2HUZA 4TYSA 2ZXVA 4OKOA 1N3PA 4ZU5A 5G05L 4YVWA 1B35A 2FCVA 2VVDA 2ZZQA 1F2OA 2PE3A 4JGZB 4CCCA 2R073 4NXYA 4FPHA 2BJSA 1HN0A 5CKNA 2NMTA 4C68A 5A70A 4AVSA 1GQGA 1SPPB 3ES1A 4P14A 5FZGA 2P4EA 2PHTA 4NPRA 2W92A 3FJSA 2Z5WA 1LOBA 3D82A 3M8LA 3K48A 4JGYC 5D8AB 2R043 3IN9A 1AYM2 1Z8TA 2I07B 1HRV2 2OPKA 1R082 2CSGA 5FP7A 3WW4A 4EJRA 4A39A 1O3RA 4HXCA 3RG0A 3HAGA 3R9FA 1IB1E 4AG7A 3ZVXA 3M4FA 2P34A 3VL9A 1XOYA 4XW3A 4CDXC 3MUY1 4UWDA 3WW3A 3KHCA 1HEEA 4CP2A 1NMTA 2VW0A 2FDIA 1NSAA 4H6ZA 3EMRA 3W6XA 3MRUA 1WMDA 2QZ3A 2ZKNA 3URFA 5D8AC 4BYYA 3DKWA 4Q4X1 2CNTA 1U5XA 1Y0RA 2AC1A 3PJQA 5FMOL 3WZ1A 4C0BA 4PQAA 4Y4YA 1OVSA 2HV2A 3ZXJA 4XJAA 2Y33A 2D3RA 2KM2A 5GZGA 1CM0A 2NYQA 2R7HA 2HWB1 4B5PB 4GWJA 1ND3A 4NGNA 2PQQA 4ATFA 2PTMA 4FSJA 5LYFA 4Q2FA 4QM9A 3D4UA 5ACA3 3ZO0B 2WLQA 3MIFA 4MI4A 1YNAA 3C8XA 2HLEA 1KJLA 2E7QA 4I01A 3T0AA 3VBUA 3TO9A 4M01A 3G8WA 1GP5A 4HVQA 1X8MA 1CJDA 3ZN6A 1EV13 4Y3OA 3WDTA 5A3OA 4CCLA 1JMUB 2WN3A 1ULCA 4F8AA 2OZHA 3UGHA 5ERLA 1TKFA 4K8FA 4BINA 3PURA 3FUOA 3N3HA 3ACFA 4ZS3A 1S0JA 2HWF2 1YVKA 1VRH3 3K75B 3NO8A 4A3XA 1D4M2 4HL0A 3IAPA 1EAH1 3VZNA 3OPWA 5F8PA 1HB4A 1A8DA 4CZSA 5LA0A 3LD2A 2VNRA 2FE7A 4PDWC 2WDBA 1RUC1 4B5OA 3WV6A 2ZEDA 1DQ1A 5BNNB 5BNPB 2J8NA 4OP4A 1CAVA 2Y0OA 1QNYA 3TBDA 1IGOA 2YC2A 1Z8LA 4CUGA 5FO8B 2OZUA 4EQVA 2X29A 2ZGLA 1GUIA 3E5UA 4NEXA 2W1SA 1W99A 1PGL2 4F9UA 3THCA 1NCRB 2PQSA 1DQ0A 4IE6A 3RJ2X 1BZWA 5DABA 1L3JA 4KQ7A 2PA7A 4OMDA 4YW5A 3O0XA 1JHJA 2OYZA 3CO2A 1H2NA 1FY7A 4IHMA 3PMSA 1H30A 4XE9A 4OIDA 4XNHC 2D40A 3HBKA 4Q4X3 5EC4A 2PLV3 3CNAA 1R1A1 2GP5A 3BB6A 3MUZ1 3VV1A 3OGRA 3HJRA 4YYOA 5JLVA 5JXGA 1ARMA 1LECA 2AH2A 5FMCA 4DXSA 1HB1A 5A3UA 2ETEA 4FFHA 2VCBA 1J1TA 1OA3A 1WBFA 1G9CA 2EXHA 1BEV1 2ZHNA 1NCQB 4OIWA 4FOVA 3HPNA 2R072 4S2FA 2VEZA 3SHPA 4DB5A 4CPBD 5K9YA 3S7EA 5I91A 3DR6A 5C8CA 2ZX3A 2RDQA 3O12A 1US2A 2OOTA 3H3ZA 1VB2A 4M4PA 4AEDB 1I12A 2Q8OA 1W6PB 1VAVA 1QY4A 1OFSA 2TEPA 1NXMA 4JRLA 4MX3A 4XYXA 5EP9A 2Z3NA 3PUSA 3Q8CA 4CDQB 2UY8A 3B00A 3SMHA 5IVCA 4BK4A 2EAAA 3LSEA 3VBHA 3NV3A 1S7KA 2OXBA 1BBT3 3AZYA 1CVNA 1VBD1 3EHKA 3LZZA 4PF1A 5H9RA 3VHNA 1SLLA 3JCIA 4Q0SA 3M3CA 1CAWA 3AKQA 5LA9A 5LY2A 3WQBA 4ZKTB 4P10A 3RZGA 1SACA 3FHIB 2GREA 2ZEMA 2XLGA 2NQYA 1GFF2 3LEKA 3THTA 4IUSA 2ERFA 4AI2A 3H1MA 3WOGA 4XTMA 4R3KA 4RS5B 2WNUC 1B35C 3K46A 4GH4C 4DOUA 3V56A 3KB5A 3R6SA 4AEMA 5IAXA 3KLSA 1ARLA 2VI7A 2Y0MA 1NUKA 1TG7A 1F5FA 4FFGA 1JOBA 3WCRA 3FRMA 4QUSA 1YLEA 2QQOA 3GUXA 2PAEA 3OWCA 3J7NA 4FPFA 1UZWA 1REFA 5A80A 5ISVA 3PFOA 4PK2A 2ZBJA 4YM2A 4GB33 2DURA 2WNEA 2DVFA 4QX2A 4UW3A 5KTAA 2MHFA 3WLUA 4KVXA 4YGBA 1LANA 1P8JA 3VD3A 5A32B 1RMU2 2W3JA 2Q44A 4RQPB 4HPKA 4Y1XA 1WW4A 3HQXA 4CDXA 4ZU4A 1OFNA 3SH5A 3TO6A 1NY72 1SLAA 4ZS2A 5ABJA 3FHQA 4MXWA 3VKFC 1Q2DA 3T3YA 1UFHA 3GY9A 5LYLA 1UY4A 2BYVE 1W9FA 3J9SA 2CY6A 2VNGA 2YC0A 4SLIA 4UAPA 4V1PA 4AAXA 1UIKA 1UYYA 1LOEA 1LCLA 2TBVA 4ZZ5A 3KASA 4M6IA 1TMF3 1IOAA 1ENXA 3LQCA 3AK0A 2WSVA 3FF3A 4R76A 4CDWB 5FIXA 4AVAA 3U0ZA 4GXHA 4KOYA 3CJIB 4NRPA 1HW5A 1H8LA 5M0TA 1F8VA 1Y7EA 1AX0A 4GH4A 1QH7A 3S7IA 1YFYA 4L2NA 1K5MB 4C91A 1M1DA 4QPGB 1GANA 3RGBA 4X8NA 2DPTA 1VBD3 1C5IA 5LWBA 3H50A 1POV1 1ZZ6A 3I3BA 4CP0A 2RM22 3I2DA 3PRTA 1N1YA 2ZGQA 1VBC1 4XUTA 1PX4A 2QE3A 1OPMA 2X53S 1NY71 4HK9A 3NL1A 2J1RA 4RN5A 4FBFA 1PZ7A 4XUQA 3I9SA 3J26N 2HKXA 4NHKA 4BQ3A 5HH1A 2XJVA 4PBPA 1DQ6A 2AUYA 1WLDA 4Z82A 5AVAA 1D2QA 4NAOA 5CFDC 1G9BA 3E6DA 3WF1A 1DIWA 1CPSA 1YK3A 2JDDA 2ZELA 5A6QA 1EP0A 2RS33 2KD7A 1Z7S3 5EJZB 4I0AA 5BNPA 1MPXA 1UYZA 2FDHA 4CSWA 3TN91 1F2PA 3LCPA 1O5LA 2XEFA 2DVGA 4RGKA 2YU2A 1DQ4A 1QSMA 3O1PA 2ZHMA 1COV3 4H6UA 3LWCA 3SI2A 2OR4A 3DECA 3VB9A 2BWAA 4RSUA 3FFZA 2BNNA 3B3CA 2ID4A 2GE3A 3GB0A 3SCHA 1MZ5A 3LODA 2C6SA 4S2GA 3ZSKA 4MG2A 1ZLHA 4H14A 5LATA 4MUVA 1N1SA 1W0PA 4W8JA 4WVWA 2R8VA 4X8IA 1EY2A 3H5ZA 1T6GC 4K30A 1YW4A 2EIDA 2YNDA 1S55A 2HQYA 4FCAA 4HANA 5JVVA 1Y9WA 3FX3A 2ZCWA 3NVCA 1J3QA 3PDQA 5HVGA 4COWA 1RUF1 1K42A 4CPBA 3S30A 2ZEZA 3KQZA 4LQ6A 1LR5A 4I09A 1HRI3 1TVGA 1TME2 2RS52 3NSTA 2JDNA 1WW6A 4NJ4A 4XAAA 1K3IA 1AMPA 1QSNA 4YWYA 4YFWA 4SBVA 2OA2A 3D67A 1QJEA 4OC2A 5AG7A 5FXWA 3THPA 5FXVA 4B3NA 4Z2AA 3NV1A 2ZAHA 3HLPA 4MHPA 3U75A 1IICA 3S9NA 2JIJA 2QNKA 4HN0A 3TTHA 4OLLA 2OZGA 4XOGA 3VD7A 1Z5RA 2R49A 4K6BA 3WY6A 4BD9A 1FI2A 3JQXA 2BO9A 2WC2A 4MCRA 2GMPA 4RFT0 1PK6C 3AYEA 4IV1A 4COUA 2Q51A 4COYA 1F9KA 2RS12 1W2TA 4GQ7A 4PJYA 3R4UA 1VAKA 4QM8A 1X36A 2WNUA 1IS5A 1TXRA 4KOSA 5F47A 1BYHA 5GJ6A 1YIFA 1BK1A 3AP4A 2BEIA 1VBE1 2QQMA 2ZGNA 3AYCA 4G9SB 5IVVA 4LBJA 4ASKA 4AGVA 1S7FA 1J3RA 3PBBA 1YEWA 1QJX3 2BQPA 2Q4SA 3C7EA 3H8EA 3NE7A 1DFQA 1F15A 3WR0A 1B35B 4EN6B 4D7SA 1CJPA 5LY1A 1J58A 1CZTA 2DDUA 2C6GA 3LGRA 4BLJA 4CXXA 2QZ2A 4Y22B 3GM8A 2Z10A 4BOWA 3JBG3 2HWE2 2PHXA 1NT0A 1RB8G 2GNTA 4CGOA 5LYIA 4CYNA 1S0CA 1G9FA 5CZKA 3BPZA 3LD8A 1BJQA 1H8TB 5K8MA 1PO23 3TE4A 4QQOA 3H8OA 3M70A 5FP9A 1BPNA 4XJ8A 1RUF3 4NHXA 1DGLA 3JUWA 3O1RA 2D6MA 4NIHA 3OGJA 3A21A 1D0GA 3FWEA 1AYN1 1N47A 4LKFA 2ZW7A 1Q8QA 2CV6A 1V70A 4TN7A 5ANQA 5K0UA 1XIXA 5T50A 4P6YA 3NJXA 2R041 3OTFA 3NJZA 3PUQA 2AEYA 4B7KA 2PJAA 4M0HA 2Q4ZA 1S0GA 3TN92 1LRZA 2OIIA 2FDGA 5LRRA 3N36A 4INDA 1LOFC 2NYYA 2BGCA 4QB1A 5DZFA 4CUCA 1XEBA 3A23A 2QYVA 3KKWA 2B58A 4Q36A 4OHVA 5E96A 2PJ4A 2PVWA 2ZGTA 4DXTA 2Q5TA 2EBJA 5FZLA 2DWRA 1ASJ3 2UYBA 2R062 3T1LA 4QMAA 1YGHA 1Z9UA 3GKRA 2XH6A 3LB9A 5SV8A 1NOVA 1XNBA 3PMEA 3ZDSA 5BNNC 5JDBA 1Z4EA 1Z78A 2XLFA 3OF1A 3QAHA 1ZM1A 5F3EA 1FX5A 5F2WA 3TOBA 1UF2C 2VH9A 4PF5A 3DPRA 2RMU3 5FLHA 5CFDA 2CNSA 2BZDA 4OAEA 5IB0A 5IAVA 4XFIA 1W8FA 1LKNA 1PIV3 3KZWA 4O61A 3ZKUA 2EICA 1GKBA 3ZSMA 2HWC1 2B5HA 4AF9A 2JBJA 3EJKA 2ZX1A 4YGOA 1JWQA 2ZABA 2ZGSA 2Y6JA 3MIDA 2BUKA 1XSRA 4MHUA 3WNMA 1E5SA 1VBB1 1PO22 4LA3A 4YGDA 5FPZA 3KQXA 1WCKA 2A3WA 2R30A 2ZX4A 5T5LA 4CTEA 3VKNA 4DRVA 4PQ9A 3IEHA 3SI1A 1ULFA 2VBPA 1HB2A 4RGAA 1GHEA 2HB6A 1QXPA 1RXGA 1N3OA 1QJY2 2VVFA 1VPHA 4JGYA 4Z07A 2Y8KA 5BXXA 4A3ZA 5FOJB 4DJLA 3B7MA 1IG3A 4N43A 4BM8A 3R1KA 3TCVA 3H3LA 5EHDA 2DXQA 1AHSA 5F5AA 3VDAA 4OC1A 1H6XA 2WZR1 4D6QA 4KLVA 1XE0A 5I0UA 1MS1A 3M3OA 4AE2A 3MBWA 1TE1B 3P1IA 4FPYA 2ARXA 3NJVA 4XMAA 2AFOA 4OCTA 2IC1A 1OBRA 4FD6A 2JDZA 2NLRA 3GYDA 2VOXA 4GXLA 1WD3A 3ST7A 2WQZC 2HH9A 3B01A 3GDBA 4MHNA 1W3VA 2Y60A 4XEZA 4MGIE 3RQ0A 3Q8FA 4JRAA 5I0CA 1J3PA 1LNSA 2EIGA 5A7PA 5IVJA 1RUJ3 3LEMA 3AMMA 4LK7A 4TTGA 4XUNA 3FZ3A 1HV1A 3WNPA 4FAHA 4A44A 1ZA4A 2I74A 5D2AA 5EV7A 4AFBA 3IWZA 1AL23 4QXCA 3CPXA 3KR5A 3AL5A 1CAUB 5FY1A 3B3VA 2EIEA 3QBQA 2P37A 3B69A 1FNYA 4XIKA 2REFA 1Y9QA 5A32A 2DUPA 5J98B 4MFZA 3DYOA 2Q04A 1S2EA 3W59A 4FTSA 1R1A3 1VJ2A 3GHMA 3VKOA 2XGXA 4RS5C 2AJ6A 4BB3A 1UOBA 2VZVA 5FZOB 3WNLA 1FV3A 1MZ6A 1JHNA 3AX4A 3KHXA 1PNGA 3DL3A 1FATA 1IPSA 2XBO3 4CCDA 4OC4A 1PIV1 2VZ3A 1AR92 5DUWA 3RJRA 3UGGA 4CDQC 2QQNA 3ABZA 4QPWA 3A4UA 2W91A 4P4DA 5TSWA 4DS0A 1GZWA 4CDUC 5FZ7A 2QJ8A 4BQWA 3KVAA 1OUSA 4EYUA 2PQ8A 4E0AA 5E8AA 1OHFA 5CFCC 1I3HA 2ORXA 3TEWA 1MACA 4NHLA 3IWEA 3NRUA 4EE2A 5CG8A 3VKMA 5C3QA 3PB7X 3V8IA 1NCQC 3ZFGC 3WUDA 2Q7BA 3VZKA 2ZZJA 3KMHA 2BVBA 3W9AA 1Q5OA 1XYPA 2A6WA 2DFCA 3IBMA 1VGYA 2PDOA 1SG3A 2BBAA 1ULOA 2JG9A 3FHAA 1GSLA 4FPGA 4X8PA 5LBFA 3ZXFA 2H6BA 1UPSA 4JQTA 1H4HA 3LFMA 3CEWA 1V6KA 1YRZA 3LFIA 3W5MA 5FYYA 4E4HA 4ZU7A 1IOFA 2V73A 4AEDA 1IPJA 4XFAA 1XNKA 1WMFA 5A7NA 1IYLA 4A94A 1SQ4A 1G9AA 2BSWA 2I45A 5L36A 3SH4A 1TKJA 1RHI1 2JXAA 1DF0A 4WVMA 4CA9A 5C6CA 4CUBA 1C5HA 4F3JA 3AP6A 1YQ2A 1NG0A 1OOPB 2WO1A 2Z79A 4HBNA 2GLFA 3CHXA 4PIXA 1NAEA 1YQ5A 2VUDA 1J83A 2D6OX 2RS32 2XKPA 1AX1A 3H9AA 4HZFA 3IAQA 4Q4V2 5FYIA 5IW0A 3VDCA 3WINE 4C0HA 5JCTA 3EC4A 4R3LA 1KDKA 4GB31 4IE0A 5FZ0A 3IO1A 3ISZA 1W8UA 3IIIA 4CAXA 1FT9A 2JG9B 1QXRA 3NNFA 1M4WA 4LKEA 2PXJA 5FY4A 3T2TA 2NSMA 4XFHA 5K4LA 1VE0A 4YNIA 5C71A 4KSAA 4P02B 4UEZA 3RFRA 2W87A 4DEVA 5C9AB 3F95A 1CWPA 3WT4A 2B9VA 1JYCA 3WNNA 3EO4A 5BNOB 1NCQA 2B4KA 5BY5A 3C7OA 1Q8PA 2RS51 4Z92B 3OJBA 5I0RA 3H4QA 1SFYA 1GZWB 1V6IA 3AYAA 1X82A 5BNNA 1ELLP 2E63A 3C7HA 4MGTA 4A6OA 2WZ8A 4BA6A 2OQ6A 4OC5A 3M7AA 5FRAA 2VVEA 3UETA 4OHYA 2A4NA 5FY8A 2RB7A 4RHV3 2ZOGA 2CAUA 5FP4A 1MQTA 4YG3A 2LM3A 3H8FA 5HXDA 5CU1A 4Q4V3 3WP4A 1GNYA 1JUHA 5FDBA 4FTBA 1R57A 3C26A 1ZVFA 2PCUA 4IV3B 4LXLA 3I3GA 2XJQA 3BN6A 1POV3 2ET7A 4LHSA 4KLWA 3VHPA 4LR4A 5HCFA 3U78A 1X12A 3FIXA 3PB6X 4YGEA 1UOFA 4FWUA 2VZQA 4XABA 4NGSA 4P4IA 2WPXA 2XJRA 1AXKA 1W2AX 3V0AA 5JSOA 5L9VA 2WR9A 2I00A 1QQP2 4MXVA 2Q4VA 2JENA 2R063 3HR9A 2WO3A 1ENQA 3CDXA 2NPIA 4GKXA 1LESA 4IV3C 2Z0ZA 3M1HA 5F2SA 4ZXKA 4MY3A 4UFXA 5JI7A 2Z3LA 4PQQA 4BCUA 2MNGA 3N35A 4QX8A 5FV3A 4B6ZA 1RUD1 2JD4A 1YJKA 4JQRA 4JDMA 5DZEA 3V64A 4CXYA 3V0AB 3DGTA 1H8TC 3TN93 1DU3D 3B3SA 2FBEA 4UFJA 2A71A 2A73B 4W6XA 4GD4A 5FMDA 4QX1A 4GMP0 2JDYA 4WZFA 2CGPA 4J3GA 4UEFA 2ZMLA 4QX3A 3TX8A 3MI8A 3VBUB 4DXZA 3VWDA 4JGYB 3KGZA 1LB2A 1DGRN 4JXRA 4R7MA 1XXNA 1IS4A 2C5DA 1VBC2 3R4SA 4PI2A 5FO7B 4AI0A 1LAPA 4MCSA 3BU0A 2ZGUA 2HBUA 4UBGA 2OQ7A 3O1OA 1RXFA 3ZYIB 3ATGA 1MQTB 3KSCA 4NO4A 4K1YA 5E89A 1YQEA 3P3PA 2D43A 1W8OA 2WWSA 1UQXA 3ZYRA 4CU8A 3N7ZA 4TLFA 1KGYA 4EN8B 3VWEA 3ITQA 3I2JA 5JPNB 1MK4A 3ES4A 1O3SA 4X2TA 3RZZA 3WW2A 1QJY1 3N9OA 1XU2A 2ZEOA 4MBUA 3QCWA 5CNPA 2RV9A 4DNYA 1Q43A 1XE8A 2E31A 2PJ8A 2Y26A 2UU8A 3POJA 3L2NA 2UWBA 1FPN1 1UCXA 3SCGA 5C4WA 1SFPA 5J09A 4IV3A 1HRI1 5GLUA 4YFZA 4NIAA 1G6NA 3D2PA 1QDCA 1QJX2 2JB8A 1U5YA 3LF7A 1HDUA 5FPVA 3VARA 4JAAA 1H2MA 5C9AC 4RD7A 3OOXA 3RVHA 5T52A 2CWSA 2J1UA 4OHXA 5D8AA 2OW4A 3SNMA 3U4SA 5FPLA 5GLTA 3WP5A 1RMU1 4G1PA 1FYUA 1SDDB 1OF4A 4YG0A 2XVKA 1VAMA 1W28A 3QB8A 2CIJA 1AR63 4IE7A 3AMHA 3ROUA 3VDBA 2ZS6B 3KF5A 5DMYA 2PJBA 4NGPA 3RAMA 1GOGA 1TZOA 4Q0UA 3ZFGB 5C3RA 4CGLA 3CL1A 1IPKA 2A6ZA 4CCMA 4FPLA 2W08A 1VBA2 1O8SA 3W58A 4FAIA 5F6LB 3RWNA 2ABZA 3PP9A 3W6SA 1N3QA 2J1EA 4PI0A 3KF3A 4XDQA 3BI1A 4D6RA 3IDBB 5JZGC 3M3QA 4PBOA 1EUUA 1Q2CA 1UKRA 1ZRRA 2NZ9A 2A3XA 2VTXJ 4K8RB 5KC5A 4Z1VA 1JQGA 3NFZA 2QCSB 4XFBA 3T2PA 3ZZIA 1PO13 3J8F1 2RMU2 3SJXA 1DGRA 4KWLA 1W2OA 5J36A 4RGGA 4NGTA 2VL4A 4M6HA 4A4AA 3JVNA 2EXKA 4PIYA 1YYNA 1ULPA 1IGBA 4GWMA 3S0MA 3H42B 2PAMA 1YHFA 4R9CA 3ZYJB 4GB32 1TKHA 3I1UA 4JLYA 1H2LA 2CTVA 1WMEA 2CWMA 4HVOA 5G04L 3GGLA 5IV0A 3ZXGA 2P1BA 2HWE1 2PHRA 3LEIA 3OD4A 4FXKB 5IUQA 3VZLA 3ZXDA 4BPZA 4E9KA 2Q1MA 3NW4A 4YZ3A 4GA9A 4EFDA 4ZX9A 3I3QA 3NQHA 3O7OA 1EUTA 3VZOA 4KG8A 3AVRA 1JBCA 5ACA2 2AFXA 2XDVA 2J42A 2GC2A 4D7TA 2B3UA 4JXQA 4QQHA 5T5OA 2GSYA 2VULA 2WFF3 4A7ZA 1NX9A 3KZ4C 1H0BA 5KWRA 4COZA 1H1IA 3HWJA 1K4JA 4CS0B 3EY5A 1TME1 2WYRA 4P9YA 1W6NB 4QX5A 4QKNA 4ASMB 4BIOA 1VIWB 4CU7A 5JM6A 1D4M1 1GP4A 2ZA9A 4BHPA 3RO0A 1ND2A 1Q8OA 2GALA 1PNFA 1CAUA 3IDEA 4KMQA 4ORFA 5DG2A 3IWWA 2GLJA 1LAMA 4B29A 3OUJA 3IWGA 1TIQA 3CU7A 1X9TA 5KXBA 3DNSA 4W4ZA 2QBXA 4P9JA 1PGL1 3ZXLA 5JMCA 4X3RA 1UAIA 2ARHA 4AWDA 3NH4A 2AE6A 2ATFA 2A75A 4LITA 2VUJA 5I0DA 1V0AA 2BP6A 2WNVA 4HN1A 2B7YA 3POIA 1O8PA 1YI7A 5JOXA 2GC1A 3ZR6A 1D0HA 2IXIA 1KZFA 3NNGA 3GXUA 2GH2A 2VZYA 3H0OA 4XBLA 1D7PM 3USUA 5G20A 3TRSB 2HWD1 4DPNA 1W8NA 2VPVA 1R1ZA 2CGNA 2EO8A 1WCSA 1XRUA 3WP6A 1SLIA 2ZGRA 4Y24A 2WNVB 2EK9A 3ZLIA 1P4NA 5H86A 2PJ2A 2EVXA 5FK8A 4PDWA 2WS93 3D3AA 3ZYGA 1UD1A 3ISXA 1ZZ8A 4CAEA 5C70A 1YR0A 4H2KA 4KSFA 3IMNA 3T2QA 3B3TA 3V7ZA 4ZY0A 1F31A 2XWJB 3H7JA 4XPLA 4NPLA 1ZA7A 2BFUL 2BRTA 3AZVA 4A45A 4IEYA 5D29A 2V09A 4E4ZA 4YM3A 1RXTA 4R87A 4CGNA 4LE4A 4N43B 2TUNA 4MFQA 2WO7A 2RC4A 3K4ZA 3KHZA 1UOJA 5A3TA 2V8HA 4GS4A 1UPIA 4UFWA 1WD4A 4ZY9A 5K7PA 1TME3 4I3PA 1W6QB 5FUPA 4Q8KA 5J37A 1IIDA 1D4M3 3MLJA 1HLCA 4YW2A 5C3OA 2WNVC 3O1VA 1VRH2 3T90A 3O1UA 1XRYA 4ZPIA 1HX6A 2W39A 4MRIA 3DPRC 4KBBA 2ZW6A 5FJKA 2D44A 4Z8BA 5LK5A 4Q0QA 3AKSA 2O8OA 5A7SA 4IGOA 1Y9MA 2GN7A 2JDHA 2ZXQA 5IK4A 4FTEA 4UWIA 3WG2A 3OEBA 4E8OA 2AR6A 1FAYA 3FUQA 2NM1A 4M4RA 4Q4Y2 4GH4B 1C4RA 3P2HA 3QNVA 1APNA 4R4XA 4MHYA 5GZFA 3NA6A 4KZTA 3MV01 1PX3A 1N1VA 3BALA 3QD6A 5B2GB 1L0CA 2MEV1 5FYMA 1ZBE3 2HYKA 5AC92 3UJQA 2PJ9A 4KOWA 2ZEFA 1UYPA 4R8FA 1LOKA 4FQ4A 3OPTA 1R43A 1W6OA 3J4UH 4MHDA 5LYDA 4CEWA 2C1CA 3BOWA 4XCAA 2HBTA 1DZRA 1Z0HA 1COV2 3IKWA 3HVDA 4URAA 1H4GA 3H7YA 4UEEA 3PU8A 4P9WA 4F9VA 3B2YA 1RIRA 1BBT2 4AOCA 5DZGA 4UF0B 4RI1A 4EVYA 4FPOB 1RL3A 3N9PA 1JYTA 2C27A 4ZI6A 4OQ9A 5FKBA 2SBAA 3H8GA 3Q8EA 4CVUA 1R093 1Z7S2 4Y22A 4DUWA 4PXBA 2DTYA 1BPMA 1E57A 4XF0A 4LO7A 2PJ5A 2VL1A 3FMCA 1QJU2 3AP7A 1JOPA 3USSA 4AFCA 1LODA 1VLNA 5L9BA 3BOPA 3LPGA 4RS2A 3S9LA 2D93A 3FL7A 4KS9A 3K4AA 2R7EB 2W1WA 4XMIA 4Y1VA 1LEDA 4Q27A 5EJ1B 4AQ6A 4FPCA 5BYNA 5I8YA 2AFUA 1IG0A 4N90A 1YI9A 1OLMA 4MZUA 3FMGA 4L9BA 1WCUA 2W9XA 4W65A 4XHXA 3VH9A 1KITA 1UU6A 1S0DA 1C28A 4AHYA 1PVC3 2DCJA 3OYWB 4D94A 4TNUA 2FDKA 4CYQA 2RM23 1UXZA 2PLV2 4ISRA 1ULGA 3RI8A 4B8EA 1H1MA 5HI0A 2AFSA 1S4CA 2EAKA 3I2GA 4LBQA 5FQ0B 5GKAC 4B1LA 4II9A 3QLQA 1RUE1 1V6JA 4R57A 4CEWC 4QX0A 3ZIWA 3BKZA 4P44A 2D3SA 3HN1A 4U36A 3AZZA 3AJYA 3CZUA 5CIRA 1R092 4OZOA 3GYAA 4OADA 4X5KA 4LBLA 2Z4FA 3V65A 4BLIA 4PLMA 2V8VA 4CYOA 2AFZA 4FFFA 3AKRA 5IB9A 2IVIB 3HMYA 3D2MA 4GWIA 1XYNA 5FZOA 1SLTA 1W6PA 4IV1B 1CAXB 3ZPOA 2RR12 5KHJA 2P6GA 3QH7A 1DBNA 1CONA 1UXXX 5EBVA 1OPOA 3UESA 3UKNA 1US3A 4IL7A 3D8CA 1ZBE2 5AC93 1BOBA 5A3LA 4PSXA 1OLME 4F0XA 3QAYA 3E5QA 1GMMA 2B9UA 3A7QA 5J8FA 3VBSB 3ILFA 5FLJA 4C7IA 4YSFA 1AR83 1QEXA 4TZDA 2DVBA 2PHFA 2QDRA 1AXZA 3CIHA 5FZ3A 5T5JA 2G1MA 4Q4V1 1JOJA 4BQ2A 2C6PA 2LS6A 2XJSA 2EALA 3OUIA 3PIGA 1Q8SA 3P2FA 4E4DX 2RJ2A 2XR4A 3KV6A 2ZHLA 2VQYA 4Q38A 4NF1A 4P4JA 4EN0A 4D69A 2RJLA 1YREA 2WZNA 5T55A 2C9KA 3OBTA 3ZFFB 2P3JA 2ZOEB 4NRQA 2RR11 4IAVA 4CU6A 1A6CA 1N71A 3WG3A 1ZRDA 2D97A 2IFRA 1XYOA 5ACA1 5IHRA 1DGWX 4BU2A 4AB7A 3ZYFA 1GV9A 5J3UA 8CPAA 4QU1A 5A33B 1V9U2 3RNZA 3CBNA 4N8MA 1YO8A 4N9IA 4QPIB 4XBQA 1GZCA 1ND3C 3ZFFA 3TWIA 1SHWB 2JDPA 1CIYA 2ADDA 2AZ5A 1RUD3 1S0BA 2ZAAA 5JPHA 1W6MB 3MF6A 1RUE2 4HMZA 1V00A 5H9QA 2P6EA 3ZSEA 3AB0A 2OS2A 4QB9A 1WW5A 2Q8CA 4L8QA 3ZDVA 2B42B 1H6YA 2F6BA 5FYSA 4JD6A 2BNMA 5K8NA 1CIWA 4LHKA 3UT0A 4QXBA 5IK8A 1IKQA 2HEYF 3LOIA 2PMWB 4FOYA 5F39A 4BK5A 2D6KA 2KA3A 4P9XA 1NQJA 5FUNA 1ZREA 3FYNA 5FYZA 1F5JA 3F5BA 2W95A 5LEKA 2JE7A 2WZEA 1OUXA 3CJIA 2Q0YA 1S0IA 3EXUA 2JEWA 5F3CA 1VMJA 2W5FA 4GALA 4O9EA 1KUVA 5FMOS 1ND3B 2YG0A 3B3QE 3J7LA 3ECQA 2EXJA 2PHWA 3GZAA 3ZN4A 2MPFA 4E2SA 5F46A 3RZJA 2QIRA 5FXXA 1AR81 4P45A 1GNHA 1OA4A 4OYUA 2ADEA 3RMYA 4XILA 4NHMA 3KGLA 4AEJA 1HIXA 3ZYHA 1FPN3 2W94A 3NJYA 4KL1A 1SQHA 5JQ4A 1RVF1 4D8MA 2GU9A 1W3XA 4P5HA 2PLV1 5GZDA 3TAYA 3WHTA 2B5GB 3BTXA 2ORZA 4N53B 5F9TA 1FXZA 2HWB3 2Q30A 2BW8A 1PYTB 5HXMA 2ATRA 2FT0A 4KOTA 2I79A 1VP6A 1YFUA 2WFF2 3MHZA 4CDWA 3WW1A 4EROA 5AFEA 1TF9A 4XPDC 4ZGYB 4QDRA 1F4HA 2A1XA 2X5IB 4E2GA 3O1SA 3FBMA 1AR72 4QPGC 1RUOA 1X10A 1FV2A 2PELA 3GBFA 1W2UA 2DUOA 1JXNA 3AZXA 3POBA 1UWWA 2J1AA 1UL9A 5I0TA 5L73A 5K8SA 3BJ8A 3SI0A 4ZYQA 1F4AA 3MW3A 2CTCA 2LROA 4MCQA 4HK8A 4AI8A 1HN1A 1ZLIA 4ZX8A 4IESA 4GJZA 4X6QB 4AEKA 2F8HA 1SMVA 1ZX5A 4MHRA 3TNPB 3LKJA 1B6BA 4R52A 3GZUC 1TNFA 2WAOA 3SQOA 1EAH3 4YVWB 2VZUA 3LA2A 1YVOA 4QGMA 4K21A 1MEC2 4LO5B 4YW1A 1PO11 3AM2A 3J8F3 5A6YA 1BVP1 1MEC1 3VBHB 1GWKA 1JUIA 1POQA 1CGPA 4KU8A 1FNOA 2JDCA 1MS3A 3LIGA 4KVME 4ZY1A 4LO4B 3VBFC 3FC0A 4QB2A 2ZX2A 3X29B 3I54A 4A31A 4RR3B 4BMEA 4CXWA 3KT4A 3PUHA 4CEWB 5C8CB 1BKZA 1NE6A 3LIHA 4NIIA 3O1TA 2FZ2A 4QPIC 4XHBA 3VBOA 2VUCA 4QAWA 4LT5A 4EWTA 1JYIA 5LA1A 1LCPA 1B87A 3F0AA 1ZRIA 4P08A 3PUIA 5FO9B 2B5GA 3RZKA 3I59B 5DAXA 2P0WA 3T2OA 2DCYA 5A1FA 2A3YA 1HRV3 2DVAA 1OZPA 3DGVA 5LRSA 2R042 2WWUA 4UOJA 2YPDA 3CJXA 4BQXA 4YZ4A 3WVJA 2XVGA 3U11A 3U07A 4BXFA 3SC7X 2XVLA 1OLRA 3U1XA 2JLMA 4OI0A 4Y33A 5GALA 3VBRB 2B4BA 1RUH1 2FCKA 3FN9A 3T9YA 2ZW5A 1RVF2 4O7XA 5EFUA 5A1LA 1I21A 4J6GA 4PT6A 2EXIA 2W0XA 2J8RA 5C33A 3OSDA 1NCRA 2P3IA 1CR7A 4QDSA 3MIBA 4K9SA 4Y5SA 4QKDA 3WCSA 4B13A 3NMBA 1BMV2 4GWNA 1MS0A 3I2OA 4A30A 5JSRA 4NRMA 5LRJA 2VTXA 4J1WA 5DQ0A 4C8DA 4OC3A 4L92A 3MGUA 4WV8A 2BOJA 1T6BX 1W8WA 3TOJA 3ILNA 5J8CA 1L7LA 5J1QA 2BL1A 2YNEA 2Z42A 3E5XA 4YW7A 3M3IA 4HKWA 2DUQA 2QJVA 3MW4A 4FT8A 1SLBA 1LU2A 4PDWB 2YROA 3I3DA 2Q7SA 3PGPA 1VBC3 4Y1UA 4JZ0A 2JD9A 4PK3A 3UGFA 4QKBA 4R8HA 5AGEA 1C8M1 4EMEA 1U5IA 1VBE2 1QQ9A 3O14A 3RBUA 2R6QA 5CNAA 3BJ7A 3DPRB 4R9DA 1I5PA 5CFDB 5HV0A 4QT6A 1S0FA 4YZ1A 2J1VA 3KD4A 3I97A 3H1WA 1W06A 4OUMA 3SH3A 3USUB 1W39A 1ZNPA 5FZCA 1I6XA 1GYTA 1XF8A 5G1ZA 5FVJA 2XWBB 3D0SA 4UFIA 3HD8B 2D5HA 4A33A 2RS31 4IXLA 1VHSA 4NGMA 2IVJA 2WN2A 3BTZA 2HJIA 3NV4A 4IEQA 4R9BA 1G86A 5F6KA 5JXIA 1CZVA 2REEA 1A8MA 3I2KA 3V38A 2ZMNA 4IEVA 3TNQA 2BNOA 3DYPA 2VQAA 2J1SA 2R1IA 1XOVA 4M6GA 5H84A 3ME2A 1QJZA 5LRGA 1DQ5A 3RRDA 1D4VB 2Q1ZB 4K1ZA 4UFLA 4UXAA 2AFWA 2XL7A 2NP0A 1KUXA 4A6SA 1PGSA 5F5IA 1LEMA 3NNMA 2IWGB 3VBHC 1S3ZA 1G8WA 2HWF1 1I1EA 1O4YA 4Y5TA 3WNKA 3CXPA 3P5BA 3ZKYA 2B46X 1EPZA 5FFOC 1PMHX 4YVSA 3Q8AA 2VJXA 1OH3A 3T08A 4NPMA 4DQAA 2WS92 3WT3A 2DPSA 3KQRA 1DLCA 3JD72 4YM1A 3B02A 5T54A 3LMSA 3N9LA 4CDWC 4EZ4A 4Q7AA 5HV4A 2TNFA 4O65A 1DE4C 2ZGOA 3KCXA 4E8DA 2PSWA 3IC1A 4CPAA 1C1FA 3VDDC 4YG6A 2PRQA 1EPWA 2V72A 3I59A 4KGGA 1ZBE1 4KWKA 5CKMA 1RUH2 3DF0A 1KFXL 1SPPA 4CEYC 2BERA 2LW8A 3K77A 4AQSA 3FX6A 4XPDB 3BIEA 2C1FA 1SEFA 2DF7A 3MPBA 1LOAA 2OKXA 3K9TA 4HNWB 5AG5A 1EYBA 1GZTA 3MV11 5D8NA 5A28A 2CGOA 3WSOA 5EZWA 1DYKA 2AFMA 1W90A 3KHBA 4LHNA 2XQXA 4OI2A 4URTA 1BLLE 4E27A 3BXMA 2CU5A 4HKLA 1D2SA 1VBA1 1O91A 5F1RA 1O5UA 5ABJC 3G6JB 3UJOA 1M44A 2XUMA 2JEVA 4K3NA 4GM5A 1WCDJ 4YPJA 4AG4A 3WX5A 5EWSA 2X5IA 2X7BA 1FMD1 4HKFA 1QJFA 3S6FA 4WM7C 2JDKA 2ENRA 4I02A 4LQRA 4OVEA 3SHRA 1GWLA 4L8AA 1L7QA 2WIIB 4YVSC 5EJ3A 4QD2A 1COV1 1GOHA 1CX4A 2YU1A 1TEIA 2JDAA 5L7OB 4FP2A 5DG1A 2RM21 4E4SA 4BDVB 2JE8A 1WCQA 4PXEA 4AG9A 1ENSA 4I0WB 5CBMA 3VBSC 3W91A 2JEMA 2QQIA 2VD7A 1JN2P 5KC6A 1REDA 1OVPA 4XUPA 4B4PA 2VMHA 2QECA 1OF3A 4YLZA 3L2HA 5IVEA 1OQDA 5DWMA 3LDRA 3N7MA 3BPSA 3JBG1 5CISA 5C88A 4EN7B 4CP9B 5D1IA 4LKDA 4TWTA 2CNAA 2GNBA 2DCTA 1IY7A 1XNTA 5ANNA 1RYYA 1O59A 1PO21 2VUAA 3PUAA 3DV8A 5JXHA 3BIWE 1OQEA 1ZG7A 4IGQA 1OD3A 3WF2A 2O53A 5H9PA 4MGQA 5FZKA 3MIGA 5LASA 2I3CA 2YBSA 3W21A 4CCJA 4NGQA 2XL9A 2H5MA 4O9GA 1PO12 3KGQA 1PMIA 3SXOA 1DQ2A 5FTTC 1U5ZA 5CBLA 1AF9A 3HN3A 1SLCA 3WDWA 1MZEA 3AC0A 4R9AA 2J22A 1PVXA 3IDAA 3KVBA 4TWEA 4RL7A 1W9TA 3IFEA 1ODMA 2DF5A 3INAA 5LBCA 2J9AA 5HXVA 1ST8A 2DCZA 2WA4A 4RA0A 1VBA3 2WT2A 3FBYA 3RYKA 3ZXKA 2QQLA 2VGDA 1PUAA 1YMEA 3R9EA 3A0KA 4XF3A 5CG9A 2AREA 2JG8B 3CZJA 3I2IA 5GZCA 3CDZB 2J1TA 3PHMA 2QQVA 1CAVB 4YM0A 3I49A 4UCMA 2DFBA 1FMD3 1PK6B 3KV5A 4QDQA 2JDMA 4XVHA 2CXAA 4LHLA 4IE5A 1LOFA 1QQP1 2ZJCA 3WQ0A 2IL4A 4NCZA 1NLSA 3IPVA 4BMBA 5KBFA 4NSQA 2EUIA 2B45X 2AGSA 5FZ6A 4MOAA 4C2ZA 3RYPA 2ZW4A 5EXOA 3S5QA 3LA7A 1FOD3 2GDFA 2VZOA 2WWJA 4LMFA 5T3NA 1R64A 2OUJA 2WBKA 2Z69A 3C7GA 1Q3EA 4OUSA 4P9GA 5I8TA 4QPYA 2H0BA 3WQ7A 4JV4A 1LHNA 3D66A 1AL0G 5FR3A 1PM7A 3UKTA 1X7NA 1CBXA 3D5OA 4ISQA 3JB4C 3RS6A 5FPUA 3KM5A 1RO5A 3FJUA 3ZN6B 1NE4A 3K2KA 5FZFA 3DUIA 5KHHA 1JW6A 1Y7BA 5CEHA 2PYTA 1QSTA 5E1RA 3OBRA 4HNXB 4FPEA 3UY5A 4UWJA 2O14A 4JGZC 4LKSA 4AQ2A 1GP6A 1S2KA 2CDPA 2QUOA 4HSJA 1O3TA 1Z2LA 2XEJA 4IGPA 2A6VA 2WZR3 1SBEA 4XQWA 4CP1A 5IWFA 3S6PA 1VR3A 4WM8A 3AKTA 5CFCB 1AYN3 3OD0A 5DUXA 5FREA 5FBJA 4AR2A 1WBLA 4TLGA 4ASLA 3A9LA 3FNCA 4Y49B 4WZCA 4F0YA 4IUGA 4GZ9A 4I30A 1OBNA 1XBFA 3TEZA 2PJ0A 5E16A 4HT1T 5F5CA 2EK8A 3MPPG 2Y6HA 3RWKX 2ZEYA 1NA1B 5DAQA 4OUEA 2Z2SB 4JKMA 3OGVA 4IERA 3OBZA 1Y4WA 3R05A 4DINB 5BNQA 2JG8A 1URXA 2IXKA 2PR8A 1ND2B 1RUJ1 1N1TA 1RC6A 1VALA 2VU9A 3MW2A 3ZSJA 4CDXB 5KXCA 3JUUA 4W6YA 2BTVC 4NVPA 1Q2YA 3D68A 1ASJ2 1QOTA 2VOWA 5BNOA 1CP7A 3F8KA 4FD5A 4XXAA 4JVAA 3KR4A 5C9AA 1KEXA 1DLLA 2Q1FA 1YUDA 2DU0A 2H6CA 4XDPA 1ELMP 3S6KA 4BQ4A 4FOQA 1OI6A 2Y6GA 4M0NA 1YC61 4UIAA 4K20A 3AL6A 1LHOA 3AMQA 5A27A 1RHI2 4L11A 1QQP3 3WF0A 4XTPA 3WEZA 1QMUA 4EWEA 3RZAA 4FI9A 5FZ9A 2G9GA 2VCMA 3AKPA 1XE7A 3MLKA 2E51A 4Q4W2 4GIQA 4QU2A 5IX3A 2OVUA 2WPWA 2VXRA 3LOBA 1HXS2 3ZXEA 3E97A 2XBO1 4UBHA 1LGNA 1SFNA 2P5BA 1Y43B 5FYUA 5JUVA 3DCQA 3WDUA 1L7RA 1LU1A 1HDQA 2X8KA 2RDSA 2WUHA 4WM7A 4WVMB 5AG4A 1RUF2 2KCWA 5KTDA 1ZZBA 5FQ0A 1IU8A 2FZ1A 3NAPA 4A2UA 5HMNA 1LGBA 3RNSA 4GJYA 1OA2A 3ZSLA 4D7YA 2BGOA 2IFWA 2HEWF 2WKKA 1EV11 1CJWA 3IT8A 5G21A 4ITCA 4C90A 2XG3A 4DY3A 3RZHA 2FCTA 4CDQA 4JC1A 1PGW2 1V6NA 3UKVA 5I93A 1AR73 1WUVA 3AFKA 3T0BA 2XXZA 3RPQA 4LORA 1BQPA 2VOVA 3NAPB 5KHIA 4F8ZA 2PHLA 1XMTA 4HNYB 2R1BA 4Q5OA 2JX9A 1GBGA 2HWB2 2VZ1A 3POSA 2K5TA 3ZFGA 1UY0A 3MIEA 3FB3A 3K2OA 1YWKA 5E6HA 1RUC3 3POEA 4PIZA 1JH5A 3BODA 5FY5A 1RUI2 3SEPA 3CMGA 3WG1A 4LO6B 4A42A 1S7NA 4Y20B 1YX0A 3PEIA 4OI1A 4FP3A 2NMOA 4CCNA 5IYYA 3SJEA 1K5MC 1AL21 2JDUA 3ZR5A 1CX1A 5C5UA 2CTBA 2Q4YA 4PLNA 1IQAA 1KRIA 2ILMA 3POFA 4AK3A 4AHWA 1OMIA 1Q56A 1W6OB 3OY8B 4XXPA 1W6QA 4N7UA 2J7MA 5C4WB 3QH6A 4FPKA 3HUVA 3K4DA 4LLFA 1VBB2 2GAUA 4NE9A 5FZMA 4V2VA 4MY0A 4PPZA 2VMDA 3NAPC 5J1XA 3PU3A 1NQDA 3WNOA 2Y6FA 1QOOA 2OUHA 4QQPA 4P00B 1QHDA 5FPBA 2HEVF 1YQ8A 1HB3A 4EZHA 4LTAA 4W6WA 5FMBA 4AI9A 4JDOA 5LZ6A 2RS53 4H7MA 1HRI2 1BEV3 1K45A 5FBZA 1NA1C 3NH8A 1U12A 3LAGA 1RINA 2ES3A 5IJRA 2GMMA 2ARCA 2VW1A 3B9IA 3WQ1A 1JTZX 2DU1A 4OHZA 3DXTA 3S5AA 3GBWA 4CYPA 3I8TA 4ARYA 5EQUA 2VAUA 3PB4X 4XJZA 3IZOA 1H9WA 3ZFEC 2OZ6A 2BGPA 4LEJA 2ANPA 5A7QA 4XF9A 2AACA 2G0BA 1VRH1 2WSUA 1AR71 3O0VA 4BMHA 2IXHA 3ZJ0A 2HWC2 3CXQA 2A70A 1X33A 3SXWA 2A7AA 4YW4A 4ZONA 4OQ8A 4XZUG 3MYXA 1QWRA 1XNAA 2NN8A 4IDZA 1O4ZA 2W2IA 4NGRA 2XHNA 4AGGA 3I7DA 4LUKA 2GNMA 2QVSB 3I4IA 2D6LX 4ONUA 5FYVA 5IFTA 2IXCA 4ATEA 5DWNA 1WA6X 4OMCA 5JXJA 3AJZA 7CPAA 1F2NA 2O1QA 2XJTA 2R061 2F7VA 4M85A 4WM8C 3NKTA 4KBZA 4MV2A 2IMOA 1OURA 1W0NA 4FO9A 1LTEA 2VY0A 4LIUA 4QXHA 4OFGA 1ZO0A 3ZMOA 1UO9A 1UZ0A 1DHKB 3GALA 4FFIA 2ZEEA 1AL22 1UW8A 3MO4A 1IHMA 4CRQA 1MS8A 3EBRA 3DDDA 3N7JA 2ARAA 3FEDA 3T4HB 1KDMA 4DMIA 1RUI1 3KCCA 2W47A 5LCWL 2HWD2 4LBNA 2X09A 2GC3A 3UV9A 4XF1A 2E6VA 5JSPA 1HQNA 2VE1A 4H7LA 4A7YA 4FD4A 2D5FA 4RR3C 2PIYA 4GKYA 3ZX7A 4DRRA 1AX2A 2GNDA 3AXEA 4LE3A 3RDIA 3RZMA 3WNXA 1W9WA 1UKGA 3T09A 3N7LA 3P6BA 1Y9GA 4KORA 1NZIA 1H1AA 1MS5A 4Q29A 4YGCA 3BHXA 2O8QA 1YQ6A 5FKCA 1AVBA 1VIXA 2XKOA 3PL0A 3NH5A 2IXJA 3JD71 2EIBA 4MO3M 4AHZA 3B9CA 4AEDC 3PTRB 5F7UA 3PBEA 1QJY3 2WA3A 4RYDA 3OY8A 4R6TA 4QHOA 2JBKA 4QWNA 4CP9A 3ZYPA 3KWVA 3LE0A 1HQLA 3KL9A 2G9DA 1OKOA 1NKGA 3D3SA 3NNJA 1S60A 3FEEA 2ZACA 4HOOA 4S2HA 5FZAA 1O3QA 4CE8A 5KTCA 1TNRA 5EPAA 1RUG2 1H8VA 5F32A 1W05A 2FIWA 2E7TA 4GAZA 4NOTA 2DBNA 1GQHA 2YBKA 5CKQA 4AI3A 2IZWA 4AGRA 3WDXA 1W9SA 4JKLA 4EV0A 1Q7LA 3U10A 1M4DA 5F5QA 1RMU3 2VBQA 1OOPA 1YXWA 2VNOA 5FWEA 1RUNA 1Z4RA 2R98A 3JZVA 2B3VA 3K3OA 4MXUA 4B11A 3WC6A 2EVNA 1QJU3 2VW2A 1KUYA 5F48A 3FLPA 2G4IA 4Q1RA 1AR61 4MSVA 4RR3A 5HVFA 2GN3A 2GZWA 2ZPXA 1JYWA 1XSQA 3CZXA 4JZRA 1ZZCA 3B3WA 1QSRA 3U4XA 4PLOA 4L89A 4G3YC 5F3IA 3N4MA 4I2OA 1YFXA 4OHWA 1GR3A 4IEOA 5L19A 1LHUA 5FY7A 4P9IA 2W68A 3GJBA 4UCNA 1QF3A 3B7IA 5KHGA 5GLVA 2PR1A 4MJ8A 4IV1C 3VD9A 5FP3A 1OD5A 4Q8LA 3SKJE 1WK4A 4ZY2A 1W0OA 2XOMA 1AJOA 5FYHA 3AXDA 3RYRA 3EFAA 1ONAA 2WAAA 2YUEA 4JWPA 3KS7A 3D0JA 3VUOA 2QMLA 3GLJA 1GU3A 1XNDA 3ACLA 4NUBA 3OUHA 1OH4A 3GZTB 1LOGA 3HT1A 2YC4A 1KWMA 2WQ8A 1YIPA 3NWKA 2C24A 1I9RA 5LBEA 5LBBA 4FUUA 2VR4A 2HWE3 3MGDA 2G3AA 5E88A 1LHVA 4KUAA 3LWUA 3CJIC 5FZBA 1UZVA 3MDPA 2D98A 3I2FA 5LEJA 1GWMA 1OOPC 4YZ5A 1WWZA 3FECA 4LOSA 1BXHA 1VMFA 2G9FA 5CAZA 1WLWA 1G7YA 2BUEA 3E1F1 4F6AA 4KWUA 2RHPA 4IEWA 3J7HA 1H2KA 2DVDA 5EYYA 4AXVA 1LOCA 2A5ZA 4CAWA 3AZWA 4AVCA 3FXTA 2X5IC 3P3NA 1CESA 2VMIA 2E53A 5FLIA 4JYWA 4MYEA 5JR7B 5GCNA 4A41A 4QHBA 2CY2A 2C26A 4Q4X2 1NE9A 3KI9A 4XF4A 1SCRA 4FXGB 4E2AA 1BVVA 1QXJA 1QJU1 2H0VA 4DY5A 3ZFEB 2Z3KA 1W8TA 4ZBGA 1PZ9A 2PHDA 2VQUA 1Z7S1 3G3SA 3TEYA 5IK7A 3PVNA 1GZ9A 1SBDA 3S6HA 1IZ3A 3WC7A 3DKQA 3PVEA 1NZCA 2W52A 3D4KA 3C3VA 3T30A 4AYUA 2FDFA 2ZEXA 2VZZA 4EWDA 1V6LA 4UCPA 3DYMA 4WVVA 4AXOA 4BIFA 4CCEA 2Y6LA 4L0PA 5JWPA 1FOD1 1V6MA 1LJ7A 2E32A 5BV6A 4P5YA 5K8OA 1QJX1 1AZDA 4JKKA 2XEGA 4RN7A 5DAWA 5JOZA 3LEGA 2MEV2 2D6PA 4QHZA 2HWD3 4JDNA 3CT9A 3T0DA 4UF4A 4KI5M 3B94A 4MFLA 1ACCA 1ZRCA 3K51A 3M3EA 2WINB 3IPVB 2RG4A 3S6GA 4AI1A 5FK7A 4AQTA 5C3SA 3POYA 3VHRA 1JZ7A 3D7FA 3ELNA 4XAEA 3GZEA 1E5RA 1HQWA 5C5TA 5JOYA 2AENA 2BPA2 5L7OC 3PJYA 3VBFA 3ACHA 2YFUA 1NLQA 4LUMA 3VKLA 3LSDA 4Q1PA 3H8XA 4Y26A 3CLPA 2VXKA 4FD7A 5THWA 4S2DA 4A38A 3EYPA 2YXSA 3U14A 1OC1A 2K0GA 1SZBA 1WA4A 1NSLA 3VBOC 2WO2A 4BE3A 1QSOA 2ZTNA 3VBRA 3I3MA 4A95A 4JTNA 1QNWA 2P6CA 3GIUA 2YGWA 1UU5A 2B4DA 2YMZA 4A2ZA 1I5ZA 1OSGA 2W1UA 3ASIA 3BYWA 4Y20A 4IEPA 5C7GA 4ARXA 1XFOA 2P6HA 4MGZE 1VHEA 4FBEA 3PB9X 4FPJA 1UY2A 4OULA 4P9LA 3LDKA 1X9PA 4XACA 5KXDA 1S5KA 2C4XA 4BH9A 2XJUA 4C2XA 5K0UB 4C7HA 5FZHA 3KT7A 3DR8A 3VBOB 1ALYA 2VBBA 2VQ0A 5A7WA 2VCAA 3EO6A 2ZEHA 5DPNA 2PJ3A 1T2XA 5GM0A 2ZGMA 4META 1BHGA 2DTWA 5CA6A 1AR93 1PHMA 1YCIA 4MGSA 2QQPA 2PJ6A 1AYM3 1OQ1A 2MEV3 5C8CC 4QKFA 4HPSA 3TT2A 1HJGA 5IVFA 4Q4W1 5C82A 2P3YA 4EWAA 4BJ0A 3HNYM 4KOVA 5J48A 5L7OA 3JRUA 2RDRA 1R1A2 3WC5A 1VBD2 3EXNA 1Y3TA 2ET1A 2ZKLA 1UOGA 3E6BA 1TQ5A 4RS5A 4DO0A 2JECA 4N7IA 3IMMA 5JOWA 2D3PA 1VBB3 1UZYA 2JJ6A 4HPKB 4MGKE 1Z8WA 5C3PA 3NE8A 2PAKA 3R95A 4KH9A 1VRBA 1Z8XA 4H2AA 2BEOA 1YQCA 1IS3A 2WS91 3ORJA 4M3SA 4XZPA 5K0UC 4Q0PA 4XBNA 4XETA 3VBRC 3CKHA 4LBQB 4M3CB 4EN9B 1AR62 2AYHA 2UY9A 3HEIA 3L2YA 1CG2A 3E0KA 3SITA 3B8GA 2F17A 2VTFA 3FLRA 4YFJA 5I4MA 1DDLA 4NROA 4CYDA 4XC9A 4HFSA 4B1MA 4WWVA 2WNUB 3C2UA 1DZTA 3HNBM 1O7FA 2YGMA 3MIHA 3M2MA 1AUGA 2FQPA 2I2SA 4LBKA 5DUVA 4J25A 2WUUA 1WLTA 2QQWA 2QQUA 2W46A 4LLOA 4YVSB 1O4TA 2WYFA 3ZFFC 1RUG1 1GQPA 2ZX0A 2VMCA 3BTAA 4KG0A 4U2AA 3ZPYA 4D6SA 5LK7B 5A7WB 1AUYA 2D6NA 1M4IA 3PVBB 2XLAA 1QOSA 2VM9A 3BI0A 2UURA 4XCBA 2IUWA 4X6RB 3VHOA 5A1AA 4AFMA 1LAJA 1LHWA 5L9RA 3WDYA 2VC9A 3OBAA 4DIQA 2JICA 5CVRA 5D21A 5F3GA 5FXZA 2EWBA 1ASJ1 4NIDA 4XDOA 1J1LA 2WABA 4R4ZA 2ZENA 4XJUA 1I1DA 1CN1A 1DYOA 1KS5A 1OKQA 1PZ8A 4IEXA 3SLIA 3H8RA 1VKCA 2D4PA 4NN0A 2R0FA 4ZZ8A 4UA3A 4FVVA 5CPAA 3AMPA 4CGPA 1AR91 4J1XA 2RMU1 3IGRA 3VLBB 4YW3A 3H8UA 1JZ3A 3ZN5A 1CPNA 2G9ZA 4DXRA 2V8GA 2WJSA 4WVZA 4FQZA 4IETA 2PJ7A 3PTYA 4B14A 1XJOA 4GMP1 3FBUA 4FAGA 4B10A 4Q4W3 2HWC3 4LJHA 5FYCA 3SCFA 2QTWB 5AG6A 2DV9A 4E2QA 1RJ7A 1W03A 2RE9A 1S2BA 3LDBA 3VZJA 1ZYBA 1PU9A 1XE4A 2B4DB 3K9UA 3BLNA 2CF4A 1KQRA 3WHUA 5K8PA 1DGWA 1QGLA 1R091 4Y1ZA 2KXLA 2UYAA 4CEYA 3ACIA 3IJ3A 2WFPA 5AVPA 4LUAA 3T8WA 3HNMA 2V77A 5A3MA 1UMIA 3GNEA 1C3HA 1KFUL 4KVOE 2QFEA 2Y34A 2POKA 2WZPP 1MVQA 1VHOA 1ZZ9A 2XB6C 4B7EA 2HC9A 4H89A 2NMNA 3VBFB 1ZG9A 1LRHA 1Y7RA 3ETQA 1UX6A 2GMEA 1P0HA 4I49A 4U9YA 5FZ8A 3R0RA 1RTVA 4L97A 4QQLA 2EA7A 4G4FA 3ZXAC 5A6XA 4UI9L 3RI9A 1K12A 1IS6A 1RJ8A 2A6YA 1DP0A 1POV0 1RUG3 2WT0A 4M3CF 3TB0A 2BOAA 5FWJA 2IQ6A 2VXJA 3A22A 1CZSA 3MICA 4V2WA 5FY9A 1JODA 1NLRA 3ENRA 5F37A 1PMJX 1ON0A 2P6FA 2E7AA 1DYPA 1BLZA 3EB7A 3OB8A 1YFWA 2A6XA 2LALA 2QDNA 4CEYB 4RHV2 2GIVA 5ELYA 3JBG2 4XUOA 4UW4A 5G22A 2K2SA 2V5YA 3HIFA 2FMYA 3O0WA 4C2YA 4LBMA 1QH6A 3VD5A 2OT7A 2JKXA 4P4BA 4B12A 1RUI3 5FYTA 3ZOIA 1O6UA 4P4EA 1UMZA 2FSRA 4IE4A 1SCSA 2JWPA 2QQJA 3B93A 1A2ZA 2FIAA 2P17A 3OCPA 2P2KA 3C7FA 2N7GA 2XPJA 4YZ2A 1YW6A 4XQDA 3ZFEA 4MFKA 4W9YA 4QX7A 4XJWA 1UIJA 5LA2A 5AC91 3JTKA 1H8TA 1C8NA 4YVWC 3WUCA 4B5PA 5FOBB 2YDEA 1S7LA 5A7OA 4F7ZA 4UT5A 2CDOA 4HLTA 1ZBA3 2YHJA 2Q0AA 3FFQA 4Q4Y1 1REEA 2UWCA 2BDRA 1FMD2 4KGQA 1XMBA 3JD73 3SJGA 1W2NA 3AMNA 4IEUA 5IATA 3AP5A 2AEZA 4LULA 5FJHA 5CB7A 4XQ4A 2XEIA 5AFBA 3IU2A 1YJLA 3KQ4B 4RHV1 4YWAA 2DCKA 4HKOA 4MXWB 4TXWA 2FCUA 4LOTA 1JU3A 4XIOA 1XC6A 2FDJA 2OB0A 2VZTA 1KXGA 2JB4A 2VZPA 3FVLA 1E5HA 4LNVA 4XPKA 4UW6A 3R4DB 5FPAA 3OGSA 2Q8DA 1NCRC 2WYSA 1GYKA 4JHTA 1DG6A 1HDKA 3NKGA 4F83A 1IYKA 3HQRA 4N43C 4Z65A 3Q9OA 5DXDA 3OYWA 1WWYA 1RHI3 4C1WA 5ISLA 4K40A 3UK9A 3VATA 5GZEA 5BNPC 5C4WC 2DBIA 2BFUS 1PGW1 1WLCA 1KD7A 2FHRA 2J8MA 3N5FA 1GNZA 3AP9A 3F2ZA 4NFRA 1M4GA 2WL1A 3N9MA 1B09A 3PIJA 3MLLA 1WGPA 4I3GA 3N7KA 3ZIXA 1A34A 2D4OA 4N53A 1MJAA 1W8HA 4NAMA 1QU0A 5BPXA 3LPFA 1BO4A 1DCSA 3R96A 4JJXA 5DDJ1 1W8ZA 1BAVA 2LTNA 1JZ4A 2OH1A 1WMXA 3T1MA 4XFCA 2R071 1JU4A 2Y64A 3VBUC 1OLQA 5JMOA 3MZHA 1BEV2 5C8WA 5KXEA 4IW3A 2XBO2 5JAXA 2RVAA 3QOPA 3BI3A 3ILRA 3GJAA 1HXS1 1DTDA 3B5LB 4UFKA 4BXSV 1YSJA 3ON7A 4AFDA 4M3CE 3WDVA 4MCPA 4I0BA 1AYN2 4PHZA 1MQTC 5FCCA 5DS0A 3WABA 3BU7A 2UWAA 5A6ZA 2YY1A 3VN4A 3UL2A 4KSIA 1CD3G 3FLTA 2FS5A 1NXD1 2PRBA 4XJ9A 4BISA 2ARBA 1XU1A 4HSLA 4NWWA 2Q43A 3TEXA 5F49A 1XJAA 4Y4RA 3R9GA 1OT5A 2YZ4A 1MS9A 3D7DA 3L9JT 3WG4A 4LQGA 4BWOA 2CAVA 2ZGKA 1XQNA 1CP6A 1OXCA 1HV0A 1RUJ2 3WP3A 1RVF3 2OPWA 4KUBA 3OPZA 3ZM8A 5JPMB 4OC0A 4KWJA 4Z2WA 4MGYE 1RUC2 4AVBA 5HBAA 2VMEA 2ZOFA 4N53C 5JI9A 5A3PA 4QPIA 1XNCA 3S57A 1TF8A 4Y5Z0 1RGSA 4K3UA 3O5SA 1PM4A 5GLWA 5B4NA 1MS4A 3OGGA 5HCBA 3D7HA 1RUH3 1GLHA 3N9QA 3A0NA 3HQUA 2BV4A 2JIGA 4D3WA 1J59A 5KR7A 1V0CA 2VO5A 3CF6E 2R1DA 4Q0VA 1JS9A
chains in the Genus database with same CATH topology
1KS4A 3V0BB 2XJPA 3EQEA 4QGLA 4PSWA 2ZPAA 3TYJA 5KHKA 3KT1A 2YV8A 2Z3OA 2WT1A 1W6MA 4CGMA 2WLPA 5DDJ3 1J4JA 2FL4A 4ES9A 2R0HA 2QKDA 4YRHA 4PV6A 5I0SA 4XFGA 3VDDB 1C8M2 1PIV2 3V8IA 2C9AA 3CXSA 4B5OA 4CAVA 3IIAA 4KOXA 4KOUA 1HXS3 1X50A 1MEC3 2SLIA 2PN5A 4FOWA 4AHXA 1LGCA 3H1YA 5J7MA 1C8M3 4AFAA 1BCXA 2Z3MA 2JE9A 3G7DA 1LENA 4XNHB 5J96B 1QDOA 5DDJ2 1DZQA 1CAXA 4LA2A 4MFPA 2OU2A 2YNCA 4CDUB 2Y38A 4Q26A 2IXLA 1S0EA 2Y0IA 4QPGA 4U5YA 1HRV1 1K5MA 1U0AA 3VBSA 4JTOA 2BBVA 2BVVA 4LO8A 5ABJB 4COVA 2AE6A 2E9QA 1SDWA 3JB8A 4RQPA 4AVVA 4MLOA 2R16A 4CRYB 1A3KA 2CNMA 1ULDA 1Q8VA 3DSBA 4UW5A 1RITA 5T5PA 1FPN2 4KU7A 2WZR2 5JIUA 3DN7A 3MEPA 3VZMA 3GHNA 1HKDA 4M3CA 4XFFA 2GANA 2XHKA 3BCWA 2ZMKA 3LA3A 4QGNA 2YPJA 1BBT1 3HBZA 1AYM1 3JQWA 4DZGA 4U9ZA 4A32A 4BBHA 3TO7A 4M00A 2ZHKA 4N9HA 1FOD2 3RSJA 2B39A 4C1XA 1UU4A 1NYWA 2RS13 2C0ZA 1RUD2 1YLLA 3AYDA