4OLLA

Camp-binding acyltransferase from mycobacterium smegmatis
Total Genus 86
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
86
sequence length
333
structure length
316
Chain Sequence
VAELTEVRAADLAALEFFTGCRPSALEPLATQLRPLKAEPGQVLIRQGDPALTFMLIESGRVQVSHAVADGPPIVLDIELIIGEIALLRDAPRTATVVAAEPVIGWVGDRDAFDTILHLPGMFDRLVRIARQRLAAFITPIPVQVRTGEWFYLRPVLPGDVERTYRRFQSVRKPTRALLEYLFEVDYADHFVWVMTEGALGPVIADARFVREGHNATMAEVAFTVGDDYQGRGIGSFLMGALIVSANYVGVQRFNARVLTDNMAMRKIMDRLGAVWVREVVMTEVDVPPVDTVPFEPELIDQIRDATRKVIRAVSQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Acetyltransferase Pat
publication title Allostery and Conformational Dynamics in cAMP-binding Acyltransferases.
pubmed doi rcsb
source organism Mycobacterium smegmatis
molecule tags Transferase
total genus 86
structure length 316
sequence length 333
ec nomenclature ec 2.3.1.-:
pdb deposition date 2014-01-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00027 cNMP_binding Cyclic nucleotide-binding domain
A PF13302 Acetyltransf_3 Acetyltransferase (GNAT) domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.10 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 4ollA01
3.40.630.30 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Aminopeptidase 4ollA02
3H8UA 2N7GA 4QM9A 3ZDSA 1M4DA 3EFAA 3RYOA 2I79A 5KHJA 1XE4A 3B02A 2K9ZA 1CAUB 3E6DA 4KOSA 5JPHA 2ZCWA 3U0ZA 2WFPA 1J58A 3EJKA 3D0JA 4B29A 4PIYA 4K30A 5JSRA 2F5IA 3CJXA 3FHIB 5C6CA 4HNWB 3S6KA 3GY9A 4FD6A 3OF1A 2HUZA 4KUBA 2CV6A 4AVAA 2Q4SA 4KORA 4BYYA 4KOWA 5EZWA 2P6EA 2QCSB 3KGLA 4I3PA 1PM7A 2XL9A 2Y0MA 5F46A 1QSTA 3QACA 1FI2A 1KZFA 2XGXA 4IEZA 2Q0YA 3IBMA 1CAVB 2P0WA 2PYTA 2WPXA 4N9HA 4LA2A 5KBFA 2AE6A 2OZUA 2ARHA 2F4PA 4PIXA 2PAEA 4HZFA 5C8WA 4PV6A 2VI7A 1EY2A 4XF3A 2XL7A 2ET7A 3E6BA 3V8IA 4JVAA 4XFFA 2REFA 3JVNA 3FBUA 5I8SA 3R1KA 2PHLA 1YR0A 2OU2A 2VBQA 4L11A 1SFNA 3TNPB 2FCKA 3NL1A 3CO2A 4HLTA 5I0SA 1Z4RA 2VPVA 2ATFA 3ROUA 2BGCA 3NKTA 3FRMA 4HKFA 3ST7A 4KOUA 4CRYB 1XE7A 2BNNA 3DDDA 2IXIA 5F48A 4MY0A 4MGIE 3BLNA 1BOBA 3LA7A 2EA7A 3SXWA 2Z10A 5H86A 1CAVA 3CLPA 3HIFA 4QGMA 1TIQA 2OH1A 3N7ZA 5I0UA 5J7MA 1FT9A 4MGYE 4PJYA 5KHKA 2BEIA 1YVOA 3FXTA 5CNPA 2HQYA 3NSTA 2GC3A 2GH2A 3LA2A 1IPJA 4MI4A 1EP0A 2OZHA 2PDOA 4LUMA 3VWEA 1YLLA 1MJAA 3NJZA 1DGRA 4UBGA 2QJVA 1XRUA 1O3QA 3G3SA 5AVPA 1M4IA 1IB1E 2J8NA 3OWCA 4B5PB 3OD0A 4X6QB 2KCWA 4TLFA 4KVXA 4E2AA 2P17A 5JAXA 4JTNA 3BJ7A 3C26A 1Z4EA 4R3LA 3CL1A 4JXRA 3IIAA 2XLAA 5BY5A 1ZRRA 4YNIA 5BUVA 4HVQA 2FL4A 4IERA 4YSFA 1GQHA 2QMLA 3FX3A 3LAGA 2GAUA 1N71A 5HI0A 4YYOA 2D5HA 2HV2A 1WA4A 4MHDA 1MK4A 2HJIA 3R96A 2DCTA 2DXQA 2J8RA 4I01A 3FWEA 3H1WA 4XF1A 3UKNA 4RD7A 4IUSA 2B5HA 4XPKA 3IWGA 1IIDA 4U9ZA 1XIXA 1VJ2A 2R98A 4B5PA 2HKXA 3IDBB 4H7LA 4J1WA 3F0AA 4QVTA 4RS2A 3MPBA 4UBRA 4AG7A 2UY9A 5J3UA 3S7EA 2XLGA 1J1LA 5LEJA 4AG9A 3W6XA 1X8MA 5JSOA 4HN1A 2Q44A 1NMTA 2FQPA 3HT2A 1ZZ7A 1NE9A 2IXJA 1WWZA 2ZW4A 3B8GA 4JD6A 5ISVA 2PA7A 1CX4A 5J48A 2AJ6A 2JLMA 4QB9A 3ETQA 1ZZCA 4AQ2A 5I0CA 4AVCA 1ZNPA 1O5UA 2OZ6A 3TNQA 2PSWA 3NE7A 2EVNA 2GC1A 4EWEA 2PQ8A 2JDCA 2ZW6A 1DZTA 3EXNA 3BU7A 3SCFA 4NSQA 4U5YA 3MGDA 4AVBA 1RC6A 2BYVE 4R9MA 1O3RA 2D93A 3WW1A 1ZRFA 2B58A 5T3NA 4KWLA 4H89A 1EYBA 1NXMA 2XLFA 1NE4A 3P2FA 2UY8A 1SQ4A 4O9GA 1M4GA 4QMAA 4KU8A 4XPDC 3CXSA 4QBJA 2PC1A 1L3JA 4J3GA 1O5LA 5DWNA 3WW2A 5CADA 4CS0B 3PP9A 5CU1A 4R57A 3H9AA 5EC4A 4ONUA 4XFAA 3G7DA 1QWRA 1CAXB 4UXAA 3TT2A 3DSBA 1UD1A 5HMNA 3CEWA 5LRSA 3GBFA 4CAXA 4I2OA 3UKVA 2C0ZA 4LUKA 2CAVA 4D7SA 3QAHA 3OCPA 5CVRA 2BNMA 1KUVA 3IGRA 3DNSA 2I45A 1K4JA 2VECA 1XF8A 5I0RA 3RPQA 2Q30A 3GYDA 5KHIA 4LLOA 4Z07A 1ZZBA 2EAAA 1I12A 4KOXA 2Z69A 4MH0E 3ZZIA 3M3IA 4IEQA 2ETEA 5F47A 5C88A 2CNMA 5GCNA 2Q7BA 4XFIA 3EO4A 4Y49C 1CAXA 3I3GA 4X5KA 4OFGA 4EVYA 4BMHA 3RYRA 1S7FA 1ZRCA 5EBVA 4I09A 4MX3A 4FBFA 2C27A 3TO9A 5I91A 1WK4A 3ELNA 3DR8A 1M1DA 4QGLA 2BNOA 1QY4A 2KXLA 4CAVA 1WLTA 4K8FA 2ZW7A 5KTAA 1S3ZA 1S60A 3BJ8A 5I8YA 3SHPA 3UY5A 1V70A 1V0CA 3H1MA 3WR7A 1RTVA 3BCWA 4LTAA 4KOTA 1YX0A 4HN0A 3MDPA 4IEVA 2B5GB 3LD2A 3TFYA 5BXXA 1MJ9A 3SXNA 3W6SA 4XFCA 4XFHA 2WC2A 3E5QA 1GQGA 1YFWA 4EROA 2RC4A 2Z11A 1G6NA 3SCGA 1I5ZA 4XPDB 4YGOA 1LR5A 4GULA 2R1IA 4D7TA 1J59A 4Q29A 2Q4VA 4Q0QA 3FFQA 3UKTA 3PLQA 3FYNA 4JWPA 3H50A 4IEWA 4X6RB 5K8SA 1DGWA 1Q2DA 4XF9A 4KOYA 3QOPA 2EUIA 4GS4A 5J8CA 3E97A 2G0BA 3BPZA 4R87A 3TE4A 3F5BA 2FS5A 3R6SA 2B5GA 2REEA 2BL1A 1UW8A 3K9UA 3CXPA 1S7LA 2BEOA 1Y3TA 1CM0A 4JLYA 2UYAA 1EPZA 5EFUA 1CGPA 3R95A 4NXYA 2R7HA 3EC4A 4FD5A 1YREA 1NYWA 4XF4A 4BH9A 1NE6A 1LKNA 3CXQA 4MJ8A 3N4MA 1YFXA 2MPFA 2QECA 4XEZA 2FMYA 2B8MA 4I49A 4Y49B 1ZZ6A 4XFBA 5E1RA 1MJBA 3BALA 4ZU4A 1B87A 4A2UA 3ES1A 3SCHA 2ZW5A 3D0SA 5FPXA 5J8FA 1ON0A 2VQAA 1S5KA 2ZPAA 1J4JA 2QVSB 1OI6A 4KWJA 4AXOA 5I8TA 2WPWA 4J1XA 3ACLA 4LA3A 1RO5A 1SQHA 3FB3A 4E0AA 3RYKA 2GZWA 4Q0SA 3M70A 4WZCA 5FQ0B 3RNSA 4YARA 1LB2A 1Y9KA 4E2QA 2OZGA 2Q04A 1RL3A 1XEBA 5F1RA 4JJXA 4EV0A 5FCCA 4UWJA 3L2HA 4RI1A 4E2SA 1S7KA 4HSJA 4DNCA 2PTMA 2E9QA 1KUYA 4QM8A 5KHGA 3G8WA 2V09A 4META 3WW4A 4IEUA 1U12A 4R8HA 4YRHA 4HVOA 1M44A 1CAWA 3PNAA 4KLWA 3LWCA 3T90A 1QSMA 2XKPA 2VQYA 2VZYA 4OAEA 5FVJA 4E8OA 5JQ4A 2PRBA 2Y0OA 3I7DA 4Q0UA 1S7NA 2UYBA 1X8EA 4FT8A 3S7IA 1FXZA 2H5MA 1PU9A 4EWDA 2PQQA 1RUOA 3U11A 4WBBA 5FQ0A 1OD5A 4PSWA 1VKCA 1YHFA 2GIVA 1H1IA 2CAUA 3D2PA 1B6BA 3FE5A 2GE3A 1X82A 1PUAA 1LRZA 1RGSA 3EY5A 5KTDA 4JTOA 2IXLA 5I0TA 4MGZE 3PGPA 2Z0ZA 2OZJA 3DL3A 3E0KA 3KCCA 1L0CA 3TCVA 2JDDA 3S0MA 1XMTA 4MBUA 3RDIA 4HNXB 2D4OA 3EQEA 4AB7A 3BB6A 2PR1A 1VP6A 3H1YA 4IEOA 4OADA 4O9EA 3LODA 3ZJ0A 5BPXA 1ZREA 1X7NA 1Y9QA 5FLHA 1Q5OA 1OMIA 4XNHC 3H3UA 4Q0VA 1RUNA 1QSRA 2B9UA 3KSCA 2XKOA 3FZ3A 3S6FA 4MGKE 3NVCA 1XE8A 3RZZA 2ATRA 4FD7A 1UCXA 2K0GA 1YUDA 4F0YA 2G3TA 4N9IA 2J8MA 4KZTA 2FIWA 4I0BA 2CNSA 2R8VA 4JV4A 1HW5A 5IV0A 4NVPA 4Q0PA 4JXQA 1ZX5A 1UPIA 4HMZA 3C3VA 3HT1A 1CJWA 1YLEA 5FPZA 2P6GA 2X7BA 1LRHA 3D3SA 1I6XA 5LRRA 3SMHA 3E5UA 3D82A 3I9SA 4L8AA 1GHEA 1O7FA 4LULA 4MUVA 1J3RA 5BV6A 1ZRDA 4HSLA 3S6HA 1H1MA 3DV8A 3D8PA 3I59A 4B5OA 4CYDA 1ZZ8A 1JUHA 3D2MA 3W91A 3E6CC 3ES4A 4KWKA 4KU7A 4XETA 2PAMA 4FAGA 3DR6A 3NW4A 2FXFA 1P0HA 2FE7A 1WGPA 3OGJA 2O1QA 4IEPA 3DKWA 2GC0A 4IEXA 3GYAA 4HNYB 3H7JA 2OPKA 5IX3A 1ZVFA 4ORFA 4YRDA 4E2GA 2B4BA 1IPKA 2IXKA 4U9YA 1J3QA 5FLIA 3EBRA 5D1IA 3HQXA 4II9A 1CAUA 2IXCA 4M85A 1UIKA 2Q0AA 4PIZA 2BUEA 4UA3A 3LA3A 1IYLA 2H6BA 3QB8A 1UIJA 2FT0A 4OLLA 4BIFA 1BO4A 2P6FA 1TQ5A 3VHRA 1NSLA 3T9YA 4PK2A 4L89A 4XNHB 4NEXA 3WW3A 5KHHA 2QIRA 2D5FA 2JEVA 2OA2A 3DN7A 1SEFA 1RXTA 4KVOE 2G3AA 2H6CA 1YWKA 4EWAA 1YVKA 4I02A 2A4NA 1YFYA 4NCZA 4FAHA 4XF0A 2GANA 2B4DB 2CNTA 3IDCB 2IC1A 1PMIA 3MZHA 1Y9WA 4IF5A 5E16A 4DINB 1U6MA 4R3KA 3O14A 5I93A 2XHKA 4YFJA 1CAWB 4H6ZA 2ZXVA 2OB0A 4Z82A 4F6AA 1QSNA 4KVME 4QGNA 5H84A 3TTHA 2Q1ZB 3IWZA 4CRZB 2B3VA 4P9GA 4LUAA 4KLVA 3TOBA 2FSRA 4MZUA 4PK3A 4QUSA 3H3ZA 1IICA 4LEJA 3FIXA 4FD4A 3R9FA 2VEZA 1DZRA 3LZZA 3TOAA 3EHKA 2H0VA 2FIAA 2PHDA 2K5TA 2B4DA 3LOIA 3KKWA 2IXHA 4H6UA 4ZU7A 4MV2A 4BHPA 3TO6A 1ZZ9A 1VR3A 1I21A 2Z2SB 2PR8A 3P2HA 5C82A 4QC6A 1O3SA 1IYKA 2B3UA 4MY3A 1Q2CA 3I54A 5HH1A 3SXOA 3MYXA 5IB0A 1OZPA 1Q3EA 2BSWA 1R57A 1VHSA 4HBNA 4KUAA 5JSPA 3GKRA 1QSOA 2GU9A 3PVBB 4R52A 4IESA 4XFGA 2CY2A 3VWDA 3KGZA 3F8KA 1O3TA 3PZJA 1YFUA 2EVXA 4L2NA 5FDBA 1Q2YA 5LEKA 1UFHA 3TO7A 4KL1A 1I1DA 2IL4A 3S6GA 3KMHA 4UWIA 4WVZA 3E5XA 2D40A 4F8AA 1P4NA 1YK3A 3SHRA 2QDRA 4ZBGA 2QNKA 4LX9A 4AQ6A 2ET1A 3JZVA 4IEYA 2VZZA 3H7YA 2I00A 4M3SA 4I0AA 3USSA 3R9GA 5JCTA 1KUXA 1FY7A 1QXRA 2PFWA 3OTFA 4XPLA 4KOVA 1YGHA 3U10A 5E96A 3FNCA 2OYZA 3H4QA 5DWMA 2CGPA 5F49A 4HVRA 3FJSA 3RYPA 2Q4YA 2VXKA 4NF1A 5KTCA 4QXKA 4UBHA 1Y7RA 1QXJA 3CF6E 4IETA 1Z9UA 3I59B 1J3PA 3R9EA 4F7ZA 1O4TA 1NZCA 2PAKA 1Q43A 5FLJA 3JUWA 2O8QA 2MNGA 4ZU5A 4PSXA 2NMTA 2D4PA 4CAWA 2GC2A 3EO6A 1OFNA 2O28A 4QX5A 2ZKLA 5JR7B 2MHFA
chains in the Genus database with same CATH superfamily
4QM9A 3KQXA 1UU5A 2WNEA 3GY9A 2AENA 3POEA 4NUBA 3KGLA 3SEPA 2R071 3QH7A 1JOPA 2BP6A 5FP4A 1ENQA 3WP6A 4KSIA 4Q4W1 1CAVB 1S2KA 1JZ4A 4EN6B 1HN1A 2XL7A 3J9SA 2VBQA 1DQ2A 4OHVA 3ZN4A 3T09A 4UFJA 3WR0A 5F48A 2YV8A 3ZVXA 4PXCA 2YFUA 1CAVA 1XBUA 2VE1A 4AWDA 2YGWA 1J84A 2RS51 3EYPA 4B5PB 2V73A 4CGOA 1FT7A 3OD0A 2KCWA 2FZ1A 1PVC3 1F35A 2Q7SA 1NSAA 3UETA 4PCRA 3PFEA 4YYOA 2D5HA 2HV2A 1H2KA 3Q8AA 4XABA 2E6VA 5JOWA 3PIGA 2WS92 1CWPA 4B5PA 4A33A 3IDBB 4KSFA 1ZBA1 4CAFA 1JU4A 4MXUA 1W9WA 2WFF2 1NE9A 2P37A 3AKSA 1G9AA 1TXRA 3GHNA 1GP5A 1D2SA 1DQ6A 3PU8A 1DZTA 3IWEA 3PBBA 5GLTA 2KR2A 1EYBA 1Q8PA 4BM8A 3B93A 4A38A 3NH4A 2R072 1M4GA 2BOIA 5A6XA 4Q4W2 1O5LA 5JZGB 4FOWA 2XBO3 2E7TA 3K3OA 3IMNA 2JDUA 1A8DA 1S0IA 4KMQA 4AVVA 4M0NA 5LRKA 4LPLA 2HEYF 5FJHA 2Y6GA 3R4SA 5F47A 4CEWB 5GZFA 4IE0A 3EO4A 1SBDA 4FP3A 4NWWA 1YO8A 5L7OB 4JGYB 3H3LA 5GZGA 2C27A 2A5ZA 2J7MA 1CPNA 3ELNA 3OGGA 5FO7B 2ZW7A 1GWMA 1SFPA 4MG2A 4CEWA 1UN1A 1W0OA 3RS6A 2Z11A 1L7QA 4JGYA 4XAEA 1XSRA 4JKLA 5F7UA 2WO1A 1ZBA2 2YBKA 1Q2DA 4KOYA 3DLJA 2HEVF 4GS4A 4HK8A 2QQWA 3K9UA 5F9TA 3R95A 2W08A 3VBFB 3RWKX 3HQRA 2V8HA 2FMYA 2B8MA 1MJBA 5J8FA 1RHI3 4CCKA 2VQAA 3WINE 1US2A 1GFF2 4OHYA 4EE2A 3T2TA 5FCCA 1CP7A 1MVQA 3RJRA 3VUOA 1MQTB 1A3KA 5T5OA 1SLAA 4RHV1 4IEUA 4Y1VA 3OOXA 4YW1A 1OBRA 3WOGA 5F37A 2VQYA 1VGYA 5HV4A 3THTA 2Z3KA 3ZXDA 3U11A 1RITA 3D2PA 3RZGA 1YSJA 1MQTA 3ZR5A 4EN0A 2IXLA 3I2FA 1NA1C 2AH2A 4XUTA 4IEOA 1AL23 1GWKA 2IWGB 3VZJA 5GZEA 2JIGA 3TEWA 1R1A3 2ATRA 1ULCA 1F4HA 1VBD1 1YI7A 3S6PA 4NVPA 3KGQA 1ZX5A 3C3VA 3WQ7A 1LRHA 4GH4C 4L8AA 1O7FA 1ZRDA 4CYDA 2AFMA 1QDCA 3CPXA 4KU7A 2PJ3A 3FUOA 2LRPA 3LDKA 4FPHA 4M3CE 2FXFA 2YGLA 2DBIA 1HQNA 1PK6B 3KCYA 3WZ1A 4ZY9A 4QHBA 4YLZA 4PIZA 2JD9A 3IT8A 2WO7A 5I4MA 2YNCA 2ZHMA 5FYUA 2P3KA 1PK6A 4V2WA 3CZXA 4I02A 4NCZA 3CQOA 5FAXA 4PT6A 5FZHA 1M4LA 1TEIA 4QX2A 2P1BA 2WRAA 3TTHA 2A73B 3TOBA 5FZ4A 1OT5A 5DZGA 1LHWA 1LODA 2EIGA 1OZPA 3K4DA 2G9GA 3ZM8A 3ZXFA 3KGZA 5FYHA 3F8KA 4CDWA 2ZELA 3KHZA 3B00A 4UWIA 1VBD2 4HXCA 4Y20B 3H7YA 3BPSA 1JZ6A 3USSA 5FPVA 1QXPA 4QU1A 2CGPA 1AL0G 4N43B 1CVNA 5BYNA 4AYUA 2Y38A 5CZKA 1ONAA 4KGQA 2VCCA 2MNGA 2GC2A 4CDQB 1W8WA 2EF6A 2ZKLA 3U1XA 2B9VA 2GNMA 5KHJA 1X12A 4N43A 1AXYA 2VUJA 4XBLA 3Q8CA 5IK7A 3C7GA 5L19A 1NUKA 3PUHA 2BWCA 4OUSA 3I3BA 1ZM1A 3N7MA 4CDQA 3ILNA 3U07A 5FZDA 3ZYIB 4N9HA 4W6XA 1KJRA 1GZCA 2FDJA 2JECA 2VM9A 3I8TA 4L11A 4QQLA 3GJAA 1BOBA 4MHNA 2D3SA 2Z10A 1D4VB 1EPWA 1O4ZA 1RMU1 3ETPA 1FT9A 3FXTA 4NGPA 2HB6A 5GLZA 2WZ8A 3G3SA 2WKKA 1YC61 4AVSA 2RS13 3OUHA 1XNDA 3PUQA 3CJIB 1W8NA 2J9AA 4YM2A 1W04A 2VH9A 4XPKA 3KASA 3H8RA 4ZZ5A 4E4ZA 1OD3A 3CKHA 2HWC1 4Y4RA 3CJIA 3HT2A 4E4SA 2PA7A 1CX4A 1RXFA 5F3GA 4FO9A 4AFAA 1W0PA 5HVFA 1JYIA 2CSGA 4YW2A 1WCUA 1SQ4A 1NCQB 2E26A 3DGTA 4RUHA 3I2OA 3CXSA 3U78A 3WW2A 1MS9A 2DWRA 2HWD1 1CAXB 3I3DA 5FMDA 3DYMA 1G9FA 2PIZA 3GZAA 4BQYA 4LUKA 3ZYFA 4YZ1A 1JOJA 1KUVA 3ZX7A 2CNAA 4P14A 3WNXA 3KQZA 1RMU2 3MW2A 1CAXA 4QWNA 3RSJA 3WQBA 4WWVA 2ZGPA 2JG8B 4RL7A 3DR8A 4KSAA 1Y43B 1OC1A 3W21A 4XDQA 1YX0A 3K2OA 3IAQA 3IU2A 1BXHA 4C90A 2WC2A 4EROA 3SCGA 1QJZA 4CP9B 3ON7A 4NJRA 4PQ9A 2RR13 4YWAA 5CA6A 1Y0RA 4MRIA 5J8CA 2HWC2 3FVLA 1S0CA 2REEA 5AGEA 3IDAA 5DZEA 3U37A 1VBB1 3EC4A 3KR4A 1LKNA 2ZENA 5HCBA 4QPGB 3HLPA 2VG9A 4KWJA 1RO5A 2WQZC 4Q0SA 4E2QA 2RDRA 4BB3A 1X9TA 2HWD2 1ND3B 4FFHA 3T90A 5AFEA 1AYM1 1VMJA 2PRBA 4HKOA 4QPGA 3IWWA 2Y33A 4LNVA 5K0UB 1YQ8A 4WBBA 4UFLA 3J8F1 1SZBA 2W1UA 4B6ZA 5KTDA 3DL3A 5CG9A 2D4OA 4W4ZA 5K0UA 3LODA 2GMMA 1X7NA 3N7KA 5FBJA 1AX0A 4A3XA 1ZYBA 1YUDA 2HLEA 4RN7A 2JDHA 3FX6A 1V6IA 3HT1A 3MI8A 5K8PA 4KWUA 3UGFA 2VMHA 4UWDA 3SJEA 2V72A 4EZ4A 3H42B 2VMDA 1RUH3 1PMHX 2D6MA 1IS5A 1OPMA 2VL4A 1VBB2 4JQTA 3VZMA 4IEPA 3NFZA 4K21A 4WM8B 1XB9A 2WYRA 1QQP1 5F6LB 1IYLA 4YGCA 3WCRA 4C1WA 1NSLA 2E51A 5FZ9A 4FVVA 1UXXX 1UYXA 5F6KA 2Q1FA 2LUWA 3WDVA 4EQVA 4GMP3 4WM8A 4OZOA 2IC1A 1AYM2 1HLCA 4Z82A 1PMJX 3J8F2 1SLCA 4FD4A 4LHKA 1EUTA 2QUOA 4BE3A 2PR8A 1I21A 2J1EA 3JBG3 1PGL2 2GREA 1OH3A 1QSOA 4AEMA 4PBOA 2CWMA 3ZIWA 4RQPA 3PVOA 2YNCC 3E5XA 3AP7A 4ZS3A 4AQ6A 3A21A 1FOD3 4A30A 4XPLA 1XNAA 4QPWA 3EMRA 2CL2A 4IETA 2ZX3A 2J1SA 2AGSA 1AX2A 2HC9A 3R0RA 4PSXA 1W99A 1WCQA 2DPTA 2BZDA 2X05A 3TEYA 4CDWC 4OI4A 4OC4A 1FPN3 1A6CA 4NGNA 2J1VA 2HUZA 1PIV1 5FP7A 4MGTA 4NGSA 3GIUA 3NRUA 4XOGA 3H5ZA 4BD9A 2PYTA 4CYNA 3LSDA 4P4DA 4HZFA 4XFFA 4GXHA 5FY9A 1SFNA 3TNPB 2FCKA 4NHLA 2ZGTA 4QX1A 1Z4RA 3ST7A 1TME3 4CU9A 2D44A 4AG4A 2YC0A 6CPAA 4N90A 2DUPA 3IB3A 3UJOA 4UFIA 3NJZA 1VLNA 1IB1E 2XQRA 1M4WA 1K5JA 4JTNA 3MIDA 3IIAA 4XACA 5IVCA 2VW1A 1GQHA 4XDPA 3VBRB 4B4PA 2XR4A 2FDHA 1SDDB 3R96A 1ENXA 2BJSA 2ZEFA 3PHMA 1Y7BA 2FBEA 4NIGA 1UZYA 5A3MA 2P3JA 3RI9A 4HN1A 1WLCA 1ZBE1 3O0XA 1DF0A 1NCRB 1GMMA 1H8VA 3R4DB 1IS3A 4OCTA 3SCFA 1F31A 5FYSA 1MR5A 3WW1A 1ZRFA 3ILFA 1VBA3 3VH9A 2PC1A 4D6SA 1H6XA 2BCOA 1NCRA 5F09A 4MHPA 5HMNA 3CEWA 2A6ZA 4HONA 1AX1A 1EAH3 3VDAA 3AX4A 5CVRA 2I45A 4PQAA 1AYEA 4N8MA 1JYNA 4ASKA 1YIFA 3ACFA 1KS5A 1XFOA 2Z4FA 4WVWA 4X5KA 4IE6A 1OKOA 4NMIA 5A3NA 1BEV3 1DGRN 1CONA 3F2ZA 2PCUA 1ULGA 2TEPA 3LE0A 4PLNA 4A6SA 1MZ5A 2XJTA 4OMEA 5FOJB 1YFWA 5FYTA 3I3QA 2PMWB 1ZRIA 3GUXA 3FFQA 1SCSA 3WG3A 3H8EA 1DG6A 1POV3 3AP9A 3VV1A 3ZO0B 4WZFA 4Q4Y1 1GOFA 2VZRA 4CUGA 4KS9A 2XJPA 1CM0A 1ZBE2 5EFUA 3LFIA 2QQJA 1D7PM 4B3NA 3N4MA 5IW0A 4ATFA 3KM5A 3O1PA 2R32A 2L9LA 1W6MB 1ZA7A 2GZWA 5FQ0B 2XJSA 1WMEA 4CEYB 5AG6A 3WNLA 1XEBA 1S7KA 4IV1C 4ZHNA 1LOKA 5JR2A 4YG3A 4A7ZA 2XKPA 3RZHA 4AGRA 3VL8A 2ZHNA 3S7IA 3SC7X 1W6MA 4LKDA 5FQ0A 4CEYA 1G8WA 3KZ4C 1HB4A 2CAUA 2GE3A 3OBAA 1PUAA 1PVC1 1LHVA 3ZMOA 4H14A 2IVIB 3HOBA 4AB7A 3LQCA 2PLV1 3ZJ0A 4BINA 5F3CA 4MGSA 3KSCA 5G21A 5IWFA 3B35A 4XIOA 5JOZA 1MS5A 3POYA 3ACGA 1HW5A 4FBEA 4MCRA 5FPZA 3WT4A 1I6XA 2ZGRA 1RUI3 3UT0A 4Q4Y2 5IVJA 3E6CC 3AJZA 1NZIA 2VOKA 2PAMA 4OUMA 3PB4X 2IMOA 1HDUA 3V64A 4BU2A 4M6HA 3IU1A 2IQ6A 5HPOA 2XBO1 2VMFA 1S0GA 2Q0AA 5K0UC 3QB8A 1UZZA 2XJRA 4HANA 4OLLA 4YVSB 4ARXA 1W2NA 3D67A 3WQ1A 5EYXA 4WJBA 4COUA 1Q7LA 4M01A 2GANA 4R3KA 4I3GA 5C3OA 5K8NA 4YVSA 4CGNA 3N5FA 5FBZA 2B46X 4R6TA 2FSRA 1XQNA 2AREA 4XJWA 3D7GA 4BK5A 3C7FA 1PVC2 4MXWB 5FZAA 4KH9A 1A2ZA 5C82A 1VR3A 3PUSA 1M06G 5G1ZA 1Q3EA 4KUAA 3GKRA 1T6BX 4XFGA 3ZYPA 2ZA9A 4AEJA 1PO13 5FJKA 3JU9A 4XTMA 4MXWA 1ND2B 4BXFA 4AI3A 2JENA 2PFWA 3FLTA 4FCAA 2VUAA 3ITQA 1KDKA 2XUMA 4XCAA 4KNCA 2PVWA 1ND2A 2VZSA 3DYOA 1DYOA 2XBO2 3D6EA 1PZ8A 3RYOA 3B02A 3MLLA 4JZRA 2Y6JA 3U0ZA 2WAAA 4CXXA 1DYKA 4B29A 4K30A 4RQPC 5FK8A 5CG8A 1GWLA 3PMSA 4IEZA 2BGPA 4DNYA 2ZEDA 2WPXA 1T2XA 1BK0A 1YNAA 2AE6A 2ARHA 1AL21 4LORA 2PHLA 3TWIA 4R8FA 3CO2A 5I0SA 4LJHA 5JMCA 1R1A1 2OUHA 5ANQA 3ZSJA 5IVVA 3LA7A 1YLOA 1V0AA 3GCWA 4QGMA 4CGPA 3OGSA 1WCKA 3LA2A 4NO4A 2EXHA 2OZHA 3M2MA 1QNWA 1DGRA 1AR93 5AVPA 3OWCA 1YMEA 4C0BA 1OA2A 1HKDA 3KZWA 4JXRA 2QQNA 4YNIA 4HVQA 4B11A 3LAGA 1W9SA 3OYWB 2HJIA 1RHI2 3D7DA 1V6LA 1JW6A 4G1PA 5A6YA 1H2LA 3S7EA 5H9SA 1K5MA 3LPGA 3OYWA 4QB1A 5KWRA 5I0CA 2WZEA 3MO4A 3MGDA 1RC6A 4P10A 1S2EA 3I3MA 4UEEA 5HVGA 4ZXEA 5CU1A 2W46A 3DSBA 1AL22 5LRSA 1SLIA 4I2OA 5IJRA 1R1A2 3GYDA 1S2BA 4AI9A 2PELA 5CKMA 2BVBA 4AZZA 2VUDA 3MHZA 4AK3A 1MS4A 1M1DA 2XVKA 3BODA 1RTVA 3BCWA 4GIQA 2W52A 2Y6KA 4YVWC 3SXNA 4XFHA 2YGMA 1NCRC 4YGOA 2Q4VA 2WQ8A 1ENRA 1KQRA 5E8AA 5BNQA 3BPZA 3Q8FA 4XUPA 3OPWA 3B01A 1UXZA 2A70A 1Y3TA 4BH9A 2WZR1 1YFXA 3SCHA 4XHXA 3CPAA 1WKYA 4AFCA 1BAVA 4C2YA 3L9JT 1IS6A 2P34A 2Q04A 4Q5OA 5C4WC 3LEKA 4NGTA 3SH3A 3A4UA 4CCLA 4IQPA 1CAWA 1MACA 1F15A 2Z79A 4E8OA 4LBMA 1KEXA 1Z8LA 2GLJA 2RS11 2R1DA 1SG3A 2ZGKA 3VKMA 4N53B 4JTOA 5I0TA 2DFCA 2WAOA 3KCCA 1RVF3 4GB33 3AMMA 4XNHC 4AR2A 1UO9A 3TBDA 1UOFA 4K1ZA 1CPMA 1WCDJ 4N53A 4NHXA 2J8MA 1CJWA 1YLEA 3D3SA 3SMHA 4QPYA 1GHEA 4LULA 1KGYA 1UMIA 2E32A 3WUCA 1CR7A 1JYTA 4MXVA 3NW4A 4P9XA 3FF3A 3C7OA 2YROA 2B4BA 1IPKA 3EBRA 1DHKB 5EMIA 2HH9A 1W39A 4TTGA 4GWNA 1Z5RA 2IXCA 4M85A 1UIKA 4UA3A 3POBA 3MV01 2Y6HA 4QDSA 2RDNA 5FYBA 4PXDA 3GGLA 4JDNA 1SEFA 3T08A 5A32B 1W05A 1YFYA 3AMHA 4FAHA 5LZ6A 3WC5A 3ZFFC 4LMFA 4R4XA 4CPBA 1IQDC 2RS12 4P9GA 2G4IA 2P3YA 3R9FA 5A32A 2VEZA 4F9VA 2LM3A 1ZZ9A 2DU0A 1DCSA 4XBQA 4AQSA 4MY3A 5IK8A 2VNOA 1RUC1 3NV1A 1SBFA 4R52A 4RSUA 4UI9L 2ARCA 5IYYA 5F2SA 1LHNA 2G19A 4M3CB 4R9CA 2GNBA 4GXLA 3IZOA 1JZ7A 3BN6A 1LOFC 3ZSLA 3FJSA 3VB9A 3SNMA 4UBHA 5BNPC 2I74A 4M3CA 3NV4A 4CA9A 1Q43A 2Z42A 1XNBA 2VNRA 3VBUC 1UY0A 1XJAA 2GNDA 2QE3A 5T55A 4XJUA 2MHFA 2DPSA 1W9TA 2N7GA 2BBAA 1S1AA 2ZEXA 3KB5A 3S6KA 2OXBA 2ZAHA 3TEZA 5J09A 2PAEA 4NGRA 4FWUA 1WMFA 1ZG7A 1LGCA 1QF3A 2BGCA 2ZZJA 4RGGA 1H6YA 5EWSA 4P02B 1TMF1 2J22A 2XVLA 1RUC2 1QIQA 2W94A 2RR12 1POQA 3NMBA 4MI4A 5T54A 4UBGA 3B94A 3IIIA 1BZWA 3JQXA 4KVXA 2YBPA 2JEWA 3VKLA 1SFYA 4BDVB 2QMLA 2A3YA 3P1IA 1JXNA 1WA4A 1MK4A 2IJZA 1IPSA 3IWGA 4D0QA 4AG7A 2RB7A 1X8MA 2WFF3 4XYXA 3ZYGA 3HEIA 3I2IA 1D2QA 1MVEA 1N47A 3ORJA 3WNNA 3MF9A 3B3CA 2XPJA 4L99A 2PSWA 1O5UA 3O0VA 2EVNA 2R041 2PJBA 4U5YA 1DQ4A 5DUUA 3IFEA 1X33A 3AMQA 3VKFC 4O9GA 1N3PA 3THDA 4HFSA 4Q4W3 1QWRA 1S0DA 4YWYA 3VDDC 4NJ4A 3ZFEC 2K46A 2PHXA 2Q30A 3ME2A 2FCVA 3HVDA 3ZYBA 3ZZIA 4IEQA 3LIGA 1FOD1 5DPNA 3T1LA 1K5MC 4PI0A 1WW5A 4BMHA 2CDPA 1RUH2 2RS53 3THPA 1NQJA 3VLBB 1V0CA 2GNTA 3IIBA 4OKOA 2NMNA 3VBSC 2UWBA 3N3HA 4Q0QA 3N9LA 3AVRA 4BJ0A 1ZBA3 2ORZA 3M3OA 1QQ9A 3NAPC 1FPN1 2G0BA 5FZ1A 3R6SA 1TF8A 4BQWA 3CXPA 4XDOA 4NOTA 2HYXA 5A1FA 4DXTA 2VVEA 3TAYA 2YPJA 3DCQA 3M1HA 4I49A 2ZMKA 2W92A 1AVBA 1OHFA 2R042 4ZU4A 1B87A 2QJ8A 3NH5A 3ES1A 4AI8A 2ZPAA 2X5IC 2W9XA 2OPWA 3ZMNA 3M70A 4LHNA 1QKQA 4LO4B 4EV0A 2WYSA 3LDBA 1REFA 4META 1U12A 4NIAA 1IOIA 2W95A 2XJUA 4OAEA 4AEKA 5BNOB 4Q0UA 4TLGA 4A39A 3ZSMA 3AZZA 3POGA 1GNZA 5CFCC 5BNNB 1FOD2 3MRUA 2VMGA 4L92A 4CCOA 3GALA 1XMTA 3WNOA 5BNOA 1VP6A 1RUG3 1W6NB 5K8MA 1OVSA 2AEZA 5BNNA 5I0DA 2WA3A 4UEZA 4B10A 3U4SA 4N9IA 4KZTA 3RZAA 4G4FA 4BMBA 1WMDA 3ZLIA 4MHUA 2ADDA 1XRYA 1FPN2 1W6NA 3I2JA 1JUHA 3HN3A 5FZ6A 4SBVA 4FAGA 1ZLIA 1AJOA 1VBA1 1BK1A 5C9AA 4R9AA 1CAUA 1EAH1 2ZGQA 1WLDA 1DP0A 2Q4ZA 1UY3A 2TNFA 1IOFA 3KVBA 1W6OB 1Y9MA 3FHAA 2GH8A 1HV0A 1TME2 2NSMA 1AR71 4JGZB 2LROA 3WG2A 4RHV3 2PJ0A 3BI3A 2XHKA 1BEV1 4H6ZA 3DKQA 1MEC1 5SV8A 1W6OA 3HNBM 3DXUA 4MZUA 3FIXA 2BW8A 4LO7A 2H0VA 3B3WA 5LBFA 2JBKA 1YI9A 4MV2A 2WO3A 2B3UA 1VHSA 4HBNA 5DXDA 1O3TA 2Q8CA 5IVBA 4B12A 2V77A 2OVUA 1IKPA 3BI1A 5FMBA 1UOJA 4IEYA 4YW3A 1VBC3 2BDRA 4O23A 4Q1RA 2O4HA 1GZTA 2BWAA 1Y0YA 5A7WA 4F7ZA 1VBA2 3AMNA 4XW3A 4GM5A 3IM0A 2TBVA 2D4PA 3VZOA 2HYKA 1EAH2 1PGW1 1Z8WA 1NQDA 2ZCWA 2C5DA 2WFPA 3D0JA 4Z92B 4X8NA 3VKNA 3CJXA 5C70A 1AR72 1I9RA 5FZBA 4AQTA 1IZ3A 3VZLA 2V5DA 3LPFA 1BEV2 1DE4C 1K42A 1MEC2 4PV6A 1EY2A 4GKXA 3E6BA 3I1UA 5JWPA 2REFA 2Y6FA 4OVEA 4NWVA 3UGGA 5FK7A 4URTA 2BBVA 1YVOA 5CNPA 3UGHA 1V6NA 1IPJA 3VWEA 4K9SA 2QJVA 2EBJA 2A3WA 2V8VA 2XLAA 1C5IA 1N71A 1ARLA 2ES3A 3K51A 4IUSA 4RD7A 1URXA 1VJ2A 1OXCA 3LD8A 3F0AA 5GM0A 5J3UA 1CPSA 4MADA 1ULFA 2WL1A 4PBPA 2C9AA 2GC1A 4QKBA 3VBOB 5F3IA 4EWEA 2OUJA 2WWJA 1KS4A 2BFUL 2A3XA 4LBJA 3GBGA 2A6WA 1NE4A 2NLRA 3HR9A 3BXMA 2FHRA 4JZ0A 1ST8A 4J3GA 3PP9A 4NIIA 4BQ2A 4XTPA 5JIAA 1Q8VA 4FXGB 2ZZQA 1JHNA 5GLUA 3IEHA 3OCPA 5FWJA 3IGRA 4DXSA 1XF8A 2RDSA 1I12A 5GCNA 4Y49C 5DAWA 1RUI2 4C8DA 3GZUC 5ISLA 3FN9A 3VZNA 4TXWA 1LU2A 3UY5A 1A78A 4QQOA 5L9VA 4MMOA 2WO2A 1VBE1 2JXAA 3HBKA 3V56A 1H8LA 5K8SA 2BVVA 4UFWA 1PM4A 3KCXA 4R87A 4GMP0 2R063 2BL1A 1OOPA 2HWE1 2R6QA 3D0SA 4JAAA 3T1MA 1B35B 1EE3P 4E0AA 1LB2A 1VALA 4CCCA 5LWBA 1KUYA 3SKVA 4LKEA 1JODA 4RYDA 1U5XA 2V09A 2BRTA 1O59A 2DVAA 4QXCA 2AUYA 2Q8OA 1AR91 2IUWA 2JG9B 1OD5A 3B3SA 1IHMA 1N1TA 3VKOA 4CRQA 4FSJA 3VHOA 3PGPA 1FATA 3S57A 1VIXA 2B4KA 4GKYA 1OPOA 3H1YA 1QEXA 4O9EA 4RGAA 2P6HA 2JG9A 1AZDA 4YZ5A 5CPAA 3D4KA 3T3YA 5DUXA 4ZYQA 3KD4A 5JI7A 3IDEA 1CIWA 3NNLA 4F0YA 1JZ3A 1K12A 2CNSA 1OSGA 5DAXA 5LRRA 1UKGA 2XDVA 4JX0A 4MUVA 4XUNA 3K4AA 1WMXA 1CZTA 2YY1A 2VBBA 3W91A 4TN7A 2FE7A 4JKMA 1VBB3 3GYAA 1MZEA 4E2GA 1NXD1 1DQ1A 3RZMA 1HRI1 4RS5B 2W68A 2RS31 2FT0A 4TWEA 1REEA 3VD7A 2P6FA 2VULA 2JEVA 4KVOE 2C6SA 4RS5A 2J42A 2CNTA 3MZHA 1AYM3 5I93A 4KG0A 4LBKA 4F6AA 1AR92 3FJUA 5EJ3A 2ENRA 3D5OA 1QHDA 4NROA 4QQHA 3TOAA 1HQLA 3LOIA 5C9AC 1O91A 1Q2CA 3I2GA 5GLWA 2IL4A 1I1DA 4BLJA 5CFDB 4F8AA 4UT5A 1YYNA 4XMIA 3JCIA 1VAVA 1YGHA 1LGBA 5F49A 4HVRA 4ZY0A 4NHKA 5FIXA 4AFBA 5C3SA 5CFDA 1H8TB 4ZU5A 2D7FA 3EO6A 2WBKA 5FTTC 2Y34A 2PN5A 3LDRA 1QQP3 3OGRA 1JH5A 3KVAA 2XQXA 4A94A 2YC4A 1EUUA 3KHXA 3FHIB 1H8TA 2RE9A 2Q4SA 2Y0MA 2Q0YA 3IBMA 3O5SA 1NKGA 3NNGA 5A70A 4NIHA 4NHMA 2ET7A 1SLTA 4GB31 4S2FA 2D6KA 4XVHA 1Q8OA 1PX3A 2EO8A 3PURA 5FR3A 1AYN1 3KV6A 2EICA 1BPMA 1POV0 1JYCA 2HQYA 3D3AA 2A75A 5EV7A 2J8NA 3WNKA 4AEDB 5HVHA 4X6QB 4TLFA 3PVNA 2P17A 2NYQA 3MIHA 4IERA 1C28A 1Q56A 3ZXLA 1JZ2A 4XF1A 3QH6A 4ITCA 3EXUA 4OIDA 5LEJA 4CDXB 2QBXA 3ILRA 4A95A 1ODNA 4OC2A 4QB9A 3WX5A 4UYBA 2O8OA 3EXNA 3BU7A 3FC0A 1GQPA 2W47A 1XYPA 3DGVA 4MVTA 4X3RA 2B58A 4CUBA 3ALQA 4KWLA 1NXMA 4ES8A 4CDXA 3NKGA 1PIV3 2W87A 4GD4A 5HCAA 4QMAA 3WG4A 2EAKA 5A28A 4R57A 1RVF2 4UXAA 2PJ5A 1LCPA 4GB32 4PDWC 4QDQA 1QGLA 4O61A 1VAMA 2VNVA 4Y1UA 1AYN2 4XXPA 4BMEA 2VZOA 1W6PB 4I09A 1C8NA 1WA6X 3PDQA 4XJAA 4QGLA 1Z7S1 4RR3B 3T0DA 2C26A 3WABA 2B5GB 1UX6A 4XFCA 2BPA2 3V65A 3PMEA 2VTFA 5B2GB 1W6PA 1CBXA 3UKTA 3MFAA 5FPBA 2AEYA 2PHRA 4RR3A 3K48A 4ATEA 4H55A 4KQ7A 4FPGA 2FS5A 2B5GA 2PXJA 5C5UA 2VR4A 3I49A 4NPLA 1L7RA 1LOBA 1CIYA 4Y5Z0 4OULA 1ZBE3 5F5CA 4FD5A 3OB8A 3FBMA 3LOBA 1VB2A 2AR6A 4G3YC 1ZZ6A 1PZ7A 5E1RA 3FBYA 4YFWA 2YFZA 4TSVA 4J1XA 4Y22B 4E27A 5IFTA 1LJ7A 4QPIB 4DNCA 4FOQA 2I07B 4QQPA 3TEXA 3OUIA 2OR4A 2LS6A 4QPIA 4ZX9A 1H1IA 5A3PA 4MCSA 1C1FA 2P6CA 4A37A 4XPVA 3GF6A 1UMZA 1OOPC 5FY4A 4P44A 2PJ1A 2PJ8A 4CXYA 5ACA1 3INAA 4U2AA 1VMFA 2P4EA 1LECA 2POKA 1PYTB 3HWJA 3JQWA 1H1MA 2EK8A 3I59A 4R4ZA 4B5OA 4Q4Y3 4DY5A 2SBAA 4BQ1A 3VD3A 2Y8KA 4IEXA 4FFFA 5FO8B 2Y64A 5FLIA 5J96B 3ZN6B 4AOCA 3SEEA 3JD73 5DDJ3 5A80A 2EXJA 2ODFA 4BIFA 1NLQA 5KHHA 3ZYJB 5JIUA 3NJXA 2W5FA 4EWAA 2R0HA 3POWA 3ZN6A 4P4IA 2XOMA 2QVPA 1SMVA 4CGLA 4IF5A 4GA9A 1HJFA 2WABA 4L9BA 4RN5A 2OB0A 1ENSA 3PBEA 1XXNA 3MICA 2Q5TA 2QZ3A 3LWUA 5FYMA 5FZ3A 3FEEA 2IXHA 2PRQA 4XJZA 3I54A 4X2TA 2PLV3 4PQQA 3IKWA 1HRV3 2YXSA 2ZOGA 2OKXA 4YGDA 3TO7A 3FH4A 3PVEA 1YK3A 3VBHC 5FZ0A 4LE3A 1N1VA 3J7LA 5C8CB 4C7HA 3MLKA 3U10A 4DEQA 3FNCA 1KITA 5A7SA 1QXJA 3CF6E 4K20A 2PE3A 3AYDA 1W8FA 3ACHA 1IG0A 1XBFA 2JKXA 5C8CA 3MUZ1 3X29B 3AC0A 1F8VA 5FY8A 4KOSA 1LHUA 2VD7A 1UU4A 4NJQA 4UW3A 2OT7A 4KORA 3OPZA 4I3PA 5JXHA 1OF4A 1W8TA 4Q2FA 5JZGA 2YYOA 2XGXA 2I3CA 1Q8QA 2P0WA 4LA2A 1KWMA 2F4PA 2RS52 3IPVB 1W8ZA 1RUG1 4NGQA 2R30A 4MCQA 4XQ4A 1SLBA 2Z5WA 2FDIA 4DUXA 2D3PA 4IE4A 4MY0A 2EA7A 5H86A 5L7OA 1GANA 4OZXA 2QKDA 3BOWA 1H8TC 1VAKA 1SLLA 1CX1A 4Z1VA 1ZRRA 1AJKA 4CE8A 4I01A 1H2MA 2VAUA 1ZG9A 5HCFA 3H0OA 4E8DA 2WSAA 1OKQA 4JHTA 4CPBD 3GJBA 1VMHA 4OMDA 2PVVA 4WM7B 5EJ1B 3VBFA 3ZN5A 1WWZA 4QDRA 2JLMA 4ZKTB 3ETQA 4C7IA 1W8UA 1E57A 5AG4A 2JDCA 4UOJA 1W2TA 4L97A 1O3RA 4TNUA 5JMOA 4WM7A 1Z78A 3LFMA 1TKFA 4XUOA 4FTSA 4KU8A 4XPDC 2C1FA 1AXZA 1QJU1 3NA6A 3CZJA 1RUG2 3URFA 3HPNA 3KV4A 3RWNA 3ZKYA 3SLIA 1Y9GA 3VD9A 1NY71 4FPJA 5DN2A 2VECA 2AFUA 3RPQA 3JB4C 3UL2A 2C6PA 2OOTA 2AFWA 3M3IA 5C88A 3OY8B 1VBC1 2E31A 4P9YA 4MLOA 1KJLA 1E5HA 5FKBA 1WK4A 2ANPA 5IK4A 4IV3C 1WLTA 3IC1A 3DYPA 5D8AC 3KF5A 2RM21 2YZ4A 3OY8A 4ASMB 2W3JA 4BQXA 1J59A 4D7TA 2NQYA 5FYVA 4K6BA 7CPAA 1WW7A 2XB6C 4XF9A 4Y3OA 2EWBA 3E97A 5L36A 3F5BA 3AYEA 2BEOA 4RHV2 4Q8KA 1NYWA 2DTYA 3P5BA 3WT3A 4UCPA 2VUCA 1XNKA 4A2UA 2PJ9A 3AMPA 5JOXA 2QVSB 4ARYA 5JXJA 2VL1A 5FXZA 1QJY1 3PUAA 2WNVC 4EZHA 2OZGA 1MPXA 1OQ1A 3L2HA 3ZOIA 1QJU2 2WSUA 2EIBA 4QX7A 5A3UA 2RMU1 4AAXA 1NY72 1X8EA 1YRZA 4FTEA 4EWDA 5JI9A 1IU8A 5DAQA 1UPSA 1VBC2 5J1QA 2A6VA 5JGFA 1OQDA 4BK4A 4Z65A 4A31A 1LCLA 2VC9A 3M3CA 1XE8A 4Y20A 2BV4A 4YGEA 5LW9A 2X53S 4QU2A 2R8VA 4Q36A 5FZ7A 1OURA 2VCBA 4W50A 1AMPA 1JYXA 2GFQA 3D2MA 1WUVA 3ES4A 4QPIC 1QNYA 3O1VA 3OGJA 4IE7A 4A44A 2OPKA 4MFKA 5IX3A 3DPRC 1UY1A 2WZR3 3KHCA 3P6BA 1GZWB 5HBAA 1HXS1 1QJY2 2VU9A 3VHNA 2VBPA 4NEXA 3IN9A 3I2DA 3PB9X 2PHTA 1V6MA 1U5IA 1JU3A 3WVJA 1GZWA 1U6MA 5CB7A 5A7NA 2D6PA 1YXWA 1QSNA 4DYOA 2YUEA 4KLVA 1IICA 1IGBA 1JI6A 1G7YA 3O1SA 2XEJA 3TO6A 4Q8LA 1S4CA 4ZONA 5HH1A 4BQ5A 1PHMA 2XXZA 2C24A 3OBZA 3TRSB 4C2ZA 2ZX2A 4ZS2A 1LULA 3L2YA 2B39A 3KMHA 3TC8A 2R061 3SHRA 2O53A 5JCTA 5CIRA 3KQ4B 4IE5A 4Q4X1 2LW8A 3Q8EA 4Y26A 4BQ3A 3KI9A 4QXKA 1Y7RA 3T0BA 4JYWA 4C68A 1O4TA 1NZCA 2WYFA 1GLHA 1RUE1 5A3OA 1M4DA 2IZWA 5JPHA 2JDNA 2WWUA 4TYSA 1NCQA 5CEHA 1SDWA 2BGOA 3C7EA 3MIEA 1NT0A 5G04L 1SCRA 1FI2A 1KZFA 2GU2A 3PU3A 4MHZA 3ZKUA 4JVAA 1YR0A 4BPZA 2JB8A 3NL1A 4KBBA 4QKNA 4EWTA 2VPVA 2YB7A 1DTDA 2Z3OA 1D4M1 3U75A 1D0GA 2BNNA 3PB8X 2R7EB 5I0UA 5KHKA 4G9SB 4YM0A 2JG8A 3RZJA 1RUC3 4Y1YA 1UZVA 3NSTA 2D6NA 4IAVA 2DUOA 2PDOA 4NN0A 4WV8A 3VL9A 2R062 1XMBA 3SI0A 5JVVA 4LQ6A 1UY4A 1HEEA 4BISA 5BY5A 5JZGC 4CP9A 3LEIA 4Q4X2 3OJBA 4CP0A 5F3EA 4IK2A 1QJX1 1ULPA 3ZSKA 3GBWA 3KT7A 3RRDA 3MW4A 2XLGA 4CEWC 2ZGNA 3DUIA 3VZKA 3I97A 1RUE2 1VE0A 5A6ZA 4DXZA 2K2SA 4YM1A 2ZXQA 3MBWA 5L7OC 4JGYC 4Y1ZA 4HPKB 1GNHA 2NMOA 4UFXA 2UU8A 4GALA 5KXCA 4AVBA 4NFRA 1P8JA 4OI1A 3WF4A 1ND3A 4QBJA 4CGMA 4HPKA 4ONUA 5KXEA 3G7DA 5A27A 3WDWA 1UY2A 3LB9A 4RFT0 1BMV1 4CAXA 3SJFA 2CAVA 1DIWA 2PHUA 4C0HA 1E5RA 1W3VA 3TB0A 5LA1A 5KHIA 2EAAA 5D8NA 4NGMA 3VBFC 2HBUA 2D6LX 1TMF3 4YGBA 5LRGA 5APAA 1H9PA 3CBNA 4QXBA 3TO9A 5FY1A 1CN1A 1JMUB 1W2AX 1S3ZA 4XUQA 3K46A 1G9DA 3QNVA 4LTAA 4Q1PA 1MQTC 3O1UA 1GQGA 1LR5A 5EP9A 5CISA 2VZUA 5LYIA 1QJX2 3GCXA 5K8OA 1DGWA 4W8JA 3E1F1 3AKPA 1ALYA 5DMYA 4INDA 1C3HA 4A4AA 2JWPA 1QH7A 1X36A 3AFKA 1GUIA 4HL0A 1ASJ1 1R093 2R043 2NM1A 1PO23 4LA3A 2J1RA 5BWAB 4KOVA 1V9U3 5E96A 4P45A 3I3EA 4E2SA 3MW3A 2BFUS 2VZQA 2PTMA 1GYTA 4QM8A 1H0BA 4ZI6A 5DUVA 3LWCA 1QSMA 5JQ4A 4NRQA 1W90A 4I30A 2Q8DA 5A7PA 2AFXA 3RNZA 1YHFA 2GIVA 2W91A 1WW4A 1PK6C 5FY0A 1YJKA 2RFHA 3E0KA 1L0CA 4FPFA 2JDDA 1O6UA 3SI1A 1MS1A 4F9UA 3WEZA 5FLHA 3VD4A 2Z3MA 4WVVA 3R05A 2ZJCA 2BQPA 3F95A 3LMSA 1BKZA 1HB2A 2G3TA 4I0BA 4JV4A 5GALA 1UPIA 1Q8SA 1GP4A 2KM2A 1QQP2 2JE8A 2WUHA 4P4BA 1JWQA 3D82A 1XE0A 5BV6A 4HSLA 4FPOB 2FVGA 4KWKA 4XETA 1BCXA 4UW4A 3J26N 1P0HA 1DQ5A 3C7HA 4YRDA 1Z8XA 4U9YA 5JLVA 2JBJA 4KG8A 2BO9A 1HDKA 3HQXA 1NA1B 4CCJA 1UIJA 2YC2A 4K7JA 3HD8B 2CY6A 3WDUA 2OA2A 2G3AA 2H6CA 1YWKA 1YVKA 4K40A 5K7PA 3GXUA 1AR83 5A3LA 4XF0A 4TZDA 3B9CA 4K3NA 1NA1A 4N43C 3O14A 4GH4B 5LBCA 5H84A 3IWZA 1WBFA 1BBT3 4FI9A 4H7MA 5AVAA 4CDQC 3SJGA 2K5TA 1UOGA 4H6UA 4ZU7A 3RGBA 1STMA 3AZXA 4GH4A 1JUIA 5CAZA 3POIA 3VN4A 5LASA 1V6OA 1UFHA 2PJ6A 2YMZA 4MGQA 2VQUA 5FZMA 3JZVA 4M3SA 3R4UA 3VBRA 4XJ8A 5LY1A 3ZPYA 2F4LA 5DWMA 1X50A 1C4RA 4OC0A 3A0KA 3KHBA 3LGRA 1LANA 2ADEA 5A6QA 1PIV2 1ULOA 4C91A 1J3PA 3K9TA 3CZUA 2ZEMA 2ZABA 5CBMA 2ZHKA 1UU6A 1R43A 4UF4A 2ZEWA 1F2OA 3N9MA 3M3QA 1UZWA 3CHXA 4Q4V1 1HX6A 5FP9A 1RINA 5H9RA 2PHWA 5LY2A 3WP5A 2JIJA 3S30A 3JUUA 5C6CA 3CJIC 2ZTNA 2C4XA 4KOWA 4BYYA 1IKQA 1AR73 2XL9A 1QSTA 3PJYA 3BKZA 1JYVA 1MEC3 5C8WA 1S0FA 3ATGA 3SISA 3GZTB 5F5AA 4NAOA 2IXIA 1G86A 4MGIE 4CYPA 1OBNA 5KC6A 3CLPA 2OH1A 3N7ZA 4D3WA 3P3NA 5B4NA 2GH2A 5C3RA 1EP0A 5FUNA 1NCQC 4OC1A 2PJ4A 4COVA 4R3LA 3CL1A 1COV3 2CU5A 2X10A 2ZS6B 4YFZA 4CYQA 1BLZA 2WIIB 5LBBA 4XXAA 2GAUA 1V6KA 5DG2A 1N1YA 3JD71 3FWEA 1N3OA 5DDJ1 4SLIA 5FZOB 1IIDA 1EV13 3ZDVA 3ASIA 2XUEA 3GM8A 4QD2A 3V38A 3N9PA 1NMTA 3B8GA 5ISVA 4S2DA 4W6YA 3WC7A 2VOTA 4Q4V2 5D2AA 4CCDA 2JG8C 4X8IA 4NSQA 3KWVA 3D8CA 1REDA 3FEDA 2A6YA 4CAEA 2UY8A 3NNFA 1GR3A 5DWNA 4DUVA 1GU3A 1Y7EA 3AYAA 3S9MA 1UD1A 2DVDA 1YQ2A 1HRV1 1H9WA 1RTQA 3MFCA 5T5LA 1LAMA 1K4JA 2PQSA 4IUGA 2Z69A 2ETEA 2ZPXA 2GLFA 1KDMA 3TYJA 1DZQA 3GDBA 4QPGC 4JCKA 1QY4A 5I8YA 3SHPA 1V70A 1ULEA 3O1TA 1ND3C 3KS7A 4MSVA 3W6SA 1DU3D 3E5QA 4OHZA 2SLIA 4UIBA 3WLUA 3JD72 3IJ3A 5DDJ2 3B5LB 5LCWL 4UFVA 3FUQA 3OBRA 4HT1T 4J25A 8CPAA 4GAZA 1CGPA 2R7HA 2ZMNA 5IUQA 1YREA 1S0BA 5ANNA 2MPFA 2QECA 3BALA 4MOAA 3AK0A 2RJKA 5KXBA 4QAWA 4PPZA 2E9QA 4P9JA 3SJXA 2F6BA 2PLV2 2QQLA 2YHJA 3U4XA 1ELLP 1HDQA 4KLWA 1IOAA 2W1SA 2Y0OA 1HRV2 2E63A 2Q43A 1ZO0A 1H4HA 4QKFA 2JE7A 1Z0HA 1W6QB 5C7GA 2G1MA 4MHRA 3NV3A 4WM8C 4LXLA 3ZR6A 1PZ9A 3EQEA 4DMIA 1TKJA 3AYCA 5FZKA 2ZKNA 4JDOA 3H3UA 4Q0VA 3FZ3A 1LOAA 2WLQA 3C2UA 3A22A 1W6QA 5IV0A 2JD4A 4NRMA 2RDQA 1VBE3 2QQIA 1CJDA 5FPLA 1J3RA 3S6HA 3MIBA 2B7YA 1LFWA 3ISZA 3J7NA 2O1QA 3DKWA 4HNYB 3H7JA 4ORFA 1J3QA 2HWE3 1WD4A 4NAMA 4LITA 4LIUA 3I2KA 1TQ5A 4L89A 3WW3A 2D5FA 3DN7A 2P5BA 2GMPA 3Q8BA 3AB0A 1DLCA 1HQWA 2W2IA 5C71A 2J1AA 3POJA 3N36A 2LALA 1ODMA 3W9AA 4CRZB 4F0XA 1FMD3 4F83A 4LUAA 3ZFGB 3H3ZA 4LEJA 4H2KA 1DZRA 1BVVA 1H1AA 5FP3A 1CX8A 1FV2A 4BHPA 3BTZA 4YW5A 3OPTA 2ZEOA 2ZGOA 1LGNA 2BSWA 1R57A 1JTZX 3ZFGA 3ZXKA 1HB3A 2EVXA 4CCNA 4FQZA 1NLRA 1UQXA 2QDRA 4LX9A 1GBGA 1R083 3RQ0A 4I0AA 5A1LA 2GSYA 1VB4A 2VCMA 4NF1A 4IGQA 5EYYA 2HWF1 3ACIA 1XJOA 3R9EA 2XG3A 2YNDA 2D6OX 1HRI3 3I4IA 3ZDSA 3EFAA 1XE4A 2RS33 3E6DA 3JB8A 2VOWA 5F2WA 1XU1A 3EJKA 5DZFA 4DXRA 5IK5A 4P08A 2F5IA 5ELYA 4LQGA 2VTXA 4KUBA 4N7IA 5FZ8A 2JE9A 3VBRC 3O7OA 1PVXA 1CESA 4P9WA 5KBFA 2BTVC 4XF3A 2HWB1 2C1CA 2OU2A 3PFOA 4IW3A 3IAPA 3VD5A 3DDDA 5DS0A 3JRUA 3SXWA 5GZCA 2JX9A 2ZGLA 2VTXJ 2BEIA 4Y5TA 2GC3A 1JZ8A 3C8XA 2LTNA 4YW6A 2DEAA 1XRUA 4CXWA 2DVFA 4CDWB 1LOGA 1W9FA 5T52A 2OIIA 2R49A 4YG0A 4UW6A 2YBSA 4MHDA 4CP1A 5H9QA 1CJPA 2HWF2 1XIXA 3BIWE 2VJXA 4H7LA 2VVDA 2IVJA 1XYOA 3I2HA 3VGIA 4LK6A 4D94A 5ABJB 4OMCA 4DFSA 1ZZ7A 5FRAA 2ZW4A 2AJ6A 3P3PA 1UZ0A 1ZNPA 3NE7A 3NNJA 4EFDA 2ZW6A 4AHYA 1E5IA 3M8LA 2DV9A 4AFMA 3HBZA 5FZGA 4COZA 5ABJA 3P2FA 1US3A 4PI2A 3KV9A 2DCKA 3ZSEA 4FPKA 1F5FA 5EC4A 3D66A 5DG1A 2HWB2 3GBFA 2QQUA 5EPAA 3DNSA 3T30A 4QX3A 4LLOA 5CKQA 1AYN3 5FXWA 3BI0A 4Q26A 1AUYA 3T2OA 4LO5B 3RYRA 4MO3M 3O12A 4D6RA 4CEYC 5KTAA 4NHYA 3WR7A 2V5YA 5E88A 4ZGYB 2WZR2 2RC4A 4IL7A 3A0NA 4MFPA 3FYNA 1CG2A 1F5JA 5F8PA 3WHTA 3WSOA 4HK9A 1NG0A 4FQ4A 1UW8A 2VOVA 1WLWA 3NQHA 5JDBA 4DEVA 4JC1A 4H3WA 4XFBA 1NOVA 4AHZA 2R1BA 4B1MA 4YARA 5DAVA 4RI1A 1VHOA 5LYDA 4LIVA 2KA3A 4R8HA 3BVCA 1QOOA 1M44A 1LTEA 1RUF3 5F32A 4RA0A 2B45X 2PJAA 3CDZB 2DVBA 1O8SA 4FOYA 3EY5A 5GKAC 1C8M3 3ECQA 2OZJA 4YVSC 4HETA 2BUKA 1Q5OA 1Z7S3 4AI2A 2B9UA 2ZX0A 3NVCA 1MS8A 1OA4A 1LESA 3WXPA 5L9BA 2V8GA 4Q0PA 3M4FA 4COYA 4IV1B 5EHDA 2E7AA 3DV8A 1ZZ8A 1KFUL 1WGPA 2GC0A 3GB0A 4AF9A 4IV1A 2ZGMA 1GP6A 1NX9A 1F2NA 1MS3A 4ZY2A 2BUEA 5DQ0A 3LA3A 2H6BA 3TN91 2Q1MA 4AGVA 4XQDA 1HIXA 5JXGA 2BOAA 3VHRA 4P00B 1ND2C 3NE8A 5FUIA 5FUPA 1H4GA 2XVGA 1FNYA 4LHLA 3USUB 4NIDA 4XZPA 4AHXA 4QUSA 2ZX4A 2B42B 5FYCA 2R0FA 2FIAA 4MFZA 3KKWA 1F2PA 3A9LA 4ZX8A 2Z2SB 2JDYA 3SXOA 3USUA 3CDXA 3VWDA 4F3JA 5THWA 3RI8A 5M0TA 5LEKA 5F39A 5ACA3 4WVZA 2QNKA 1RUJ3 3R9GA 3OTFA 1R091 4ONWA 1PGL1 1PO21 1ZG8A 5GJ6A 1V9U1 2O8QA 3HUVA 3H8GA 3NJYA 4ES9A 4CAWA 5FZLA 4YW7A 3H8UA 4QB2A 2WR9A 1AF9A 4S2GA 3PEIA 4A7YA 3GLJA 3TN92 1K45A 2WA4A 4MFLA 4FPCA 3ZFGC 4IGPA 4PXBA 1H30A 2DTWA 4AVAA 4E9KA 5FMOL 1TMF2 3AP4A 1PCAA 2FCUA 4QX8A 2OZUA 4OC5A 3NNMA 4FXKB 3V8IA 1SACA 3AKRA 2G9ZA 3R1KA 1SBEA 2ATFA 3ROUA 4HKFA 2JKBA 3BLNA 4A42A 2QDNA 2ARAA 4B7KA 2DURA 5TSWA 2VGDA 4YG6A 4A32A 3HNYM 2WNUB 5T50A 4RQPB 1AXKA 2VZ3A 1R092 2XJQA 3UKNA 3CNAA 2NN8A 1Z2LA 1PO22 2Y60A 3AL6A 4CU7A 1V9U2 2WNUA 3WDTA 3HAGA 2BU9A 4XHBA 4HPSA 3S9NA 1AR81 4Q7AA 1Y4WA 4AFDA 3TNQA 1WW6A 3B9IA 3OGVA 2PQ8A 2I2SA 2XH6A 2PJCA 4GJYA 4ZPIA 1VRH3 1XNCA 2PJ7A 1BBT1 5E89A 4DUWA 1LEMA 3WF3A 2XONA 3RMYA 3W59A 1L3JA 5FZIA 2ZACA 4AAPA 3H9AA 2RG4A 4QHOA 4U36A 3OEBA 1VPHA 3UKVA 1TNRA 2C0ZA 3G6JB 2XWJB 4FPYA 2VQTA 5DABA 5I0RA 4P5YA 1R1ZA 4YZ4A 4UFKA 5FFOC 2CNMA 3VDBA 2NP0A 4OFGA 2UWAA 1S7FA 1ZRCA 5I91A 5A3WA 1GZ9A 5FP8A 1MZFA 5ABJC 1QDOA 5G20A 5FO9B 2VCAA 2F7VA 1MJ9A 4OI2A 5IT6A 1F9KA 3ISXA 3OEAA 3ABZA 4YPJA 4A2ZA 3PLQA 4IHMA 4E4DX 2WWSA 5L9RA 3QD6A 4W6WA 4EN8B 3AJYA 4N53C 4S2HA 4JQRA 4JLYA 1AR82 4N7UA 5IVEA 5A1AA 2Y6LA 2NZ9A 2DU1A 4IGOA 1AUGA 4AXOA 5I8TA 1BBT2 1BYHA 3FB3A 4WZCA 2EIEA 4LKFA 5F1RA 4JGZA 5FXVA 3RJ2X 1X9PA 4YVWB 1QJU3 3NH8A 2FDFA 1S7NA 3AZVA 2UYBA 2OX0A 4FT8A 1FXZA 2H5MA 4PSWA 2ABZA 2ZMLA 2ZEYA 2MEV3 5A7QA 1RGSA 1COV1 2Q51A 1YQ5A 1RYYA 4YVWA 4DRVA 4MGZE 1HJGA 4CCEA 1AR63 3S0MA 2DF7A 3N9NA 1QMJA 4A41A 3M7AA 4OADA 5BPXA 1EV11 1ZREA 4M6GA 5FY7A 1RUNA 1QSRA 5DUWA 4DB5A 2RM23 4D7YA 3HMYA 5C4WB 4LBNA 2RV9A 2X7BA 4CP2A 3WF2A 4UCMA 4LLFA 3WNPA 3HJRA 2J1UA 3W5MA 1VIWB 3K2KA 5C4WA 2AC1A 5FYIA 5IVFA 2WINB 4XAAA 1UL9A 1GYKA 5GLVA 4UEFA 2R16A 4MFQA 2H0BA 1QJY3 4XURA 4XNHB 1ZA4A 1YCIA 1PX4A 2B4DB 4NPMA 1Y9WA 2RMU3 4EYUA 2D98A 1UYYA 2ILMA 2C6CA 4KVME 2Q1ZB 3MUY1 5HV0A 4P4JA 1GV9A 1S0EA 4CU6A 1VHEA 4YZ3A 1COV2 4LKSA 4UFMA 3D68A 3POFA 3DF0A 1DFQA 2B4DA 1W28A 4UW5A 2ZHLA 4AGGA 1EV12 2JDMA 2GU9A 4IESA 1PGSA 1IS4A 5FDBA 4JRLA 5C3PA 3S6GA 5AG5A 3ZPOA 2AFZA 1P4NA 4GJZA 4OP4A 1CP6A 1E5SA 4E4HA 1PGW2 4AL9A 4LQRA 1DBNA 3RG0A 3ZFFB 4NR1A 1JBCA 4NE9A 2UWCA 4EMEA 1UKRA 3AZWA 4PF1A 1T6GC 4L0PA 3ENRA 2PHFA 5LATA 3VBOA 3AKTA 3ZFFA 1HXS3 4LBQB 1LENA 3CMGA 2DBNA 5JSRA 4FD6A 2CV6A 5EZWA 2E53A 4QQ2A 1PM7A 5G22A 5F46A 3NO8A 1WD3A 2EXIA 4ET7A 3CU7A 2ZGSA 1FV3A 1GNYA 3WP3A 4LBQA 5FYZA 2VI7A 5LK7B 3IO1A 1BPNA 5BNPB 2DVGA 1UMHA 3A23A 3B69A 2RHPA 1LAJA 2EXKA 4LBOA 5LK5A 3HIFA 1OLME 1TIQA 1FAYA 3VBUB 1WBLA 4PJYA 1LOFA 2VZPA 2DUQA 5BNPA 1LOCA 3PTYA 1V6JA 3SKJE 4COWA 1F4AA 2D97A 3VBUA 5KXDA 1F57A 4Q4X3 3THCA 4K8RB 3BIEA 2DXQA 2J8RA 2B5HA 2VOXA 4FFIA 4LE4A 2WN2A 1JZ5A 1UAIA 3WG1A 1OQEA 2HKXA 1W0NA 3MPPG 4XIKA 1XNTA 5LB6A 4AG9A 5JSOA 2FQPA 5A7OA 1RUE3 2CGNA 1ZZCA 4AVCA 2OZ6A 3FMGA 4D6QA 2VXRA 5J37A 3FFZA 1RHI1 1B35A 1FX5A 1FMD1 1C5HA 3CT9A 2XLFA 3U14A 4QX0A 4CS0B 1IQAA 3WDXA 3K3NA 3TT2A 4LO6B 2BOJA 4XCBA 4OQ8A 1WCSA 4GWJA 3QAHA 2WNUC 1JYWA 2O0OA 3KQRA 3LSEA 1D4M3 1APNA 1R081 1VBE2 1HN0A 4EN9B 3AZYA 4YU9A 4K8FA 3BJ8A 4HN0A 3LD2A 1S0JA 4BIOA 2HWE2 1I5ZA 4IXLA 5BNOC 3B7MA 1QJX3 2HEWF 4X6RB 3PIJA 3VDDB 3ZFEB 2EUIA 3QBQA 5KR7A 4DUKA 5BNNC 3TE4A 1J83A 1XOYA 3QAYA 3Q9OA 3K4ZA 4Z2AA 5LA0A 2ZEZA 5IAXA 4XF4A 4MJ8A 1ZLHA 1K5MB 1BHGA 3VDDA 3ZFEA 1FMD2 1GKBA 3LEMA 5HXMA 2Z3PA 3RYKA 4JJXA 4Q27A 4YZ2A 4HSJA 1DGWX 5FZFA 2A7AA 2OQ6A 4B8EA 3J7MA 5SV5A 4K1YA 1GOHA 4GZ9A 3VBSB 4OHWA 3HNMA 2W1QA 2XJVA 3SH4A 5FOBB 3NAPB 5JXIA 1R082 2ZOEB 1X82A 3FE5A 1LRZA 3AP5A 2W0XA 5JPMB 3WV6A 2Z0ZA 1H2NA 2RJLA 3VBSA 1V00A 4HNXB 2PJ2A 2P2KA 2FCTA 4BLIA 2XKOA 5E6HA 2X5IB 3AKQA 3NAPA 2ZEPA 4I0WB 3RZZA 2DCYA 4JGZC 1R3NA 1BVP1 1IG3A 4JXQA 1HRI2 1U0AA 4LT5A 2RS32 2DYCA 5A33B 2Z3LA 2WLPA 3D8PA 2X5IA 4W65A 3OD4A 3PJQA 3SH5A 5CFCB 4NRPA 4R9DA 2IXKA 4GQ7A 3ZIXA 5A33A 1ASJ3 3MEPA 3UESA 5CKNA 3KT1A 2F8HA 2QZ2A 1BO4A 1RUD3 3BU0A 4Y24A 4PK2A 5CFCA 2QQPA 2QIRA 3OBTA 4P6YA 2WQ4A 2EALA 1PMIA 1UYPA 3AP6A 3KLSA 1CAWB 2ZXVA 4AVTA 1OUXA 4B7EA 2B3VA 3PB7X 4FAIA 1N3QA 4PK3A 3APBA 4IDZA 1LAPA 2AACA 4CVUA 3D7FA 1W8OA 2PHDA 4CDUB 1X10A 4EJRA 1O3SA 1L7LA 5JSPA 5FXXA 4AEDA 3UV9A 4LOSA 4KL1A 4DOUA 3D4UA 1JN2P 2D40A 4CDUA 2ORXA 2CWSA 1FY7A 2OW4A 2ZEGA 1XPWA 2OYZA 1FYUA 2YU2A 1MZ6A 3W20A 2W1WA 3JTKA 4UAPA 3RFRA 3DEMA 3VATA 1W2OA 2C9KA 2XWBB 3FECA 1RUF1 4M4PA 3LCPA 3FL7A 5JUVA 2OQ7A 4QB6A 2QCSB 3LKJA 1C8M1 3BTXA 3QACA 1R64A 4K3UA 4XBNA 2FDGA 4PIXA 1BLLE 5T5JA 3WUDA 3JVNA 4UIAA 3FBUA 5I8SA 2Q8EA 4HLTA 3IMMA 3VHPA 2V4AA 3KV5A 5C5TA 4DY3A 1DQ0A 2XEIA 3VBOC 4OC3A 3WD5A 1FNZA 1TKHA 2X8KA 3QCWA 1YLLA 5IVYA 1G9CA 1O3QA 4AE2A 4EN7B 5JPNB 4E2AA 3UJQA 3BJ7A 3C26A 4CPAA 1TNFA 3WY6A 2FL4A 3FX3A 1HB1A 4XE9A 4BWOA 5T5PA 2UURA 3H1WA 4P9IA 4PLMA 5AC93 2RR11 3T2QA 2PIYA 5F5QA 3W6XA 2VW2A 4AI1A 4BOWA 2Q44A 2IXJA 4LBLA 1RUF2 2JJ6A 4Q4V3 4KBZA 1W03A 4Y22A 2BYVE 1SPPB 2HBTA 3LIHA 5T3NA 1DDLA 1C8M2 3GZEA 3PTRB 4PHZA 4Q38A 5CADA 4C2XA 5IATA 1Z7S2 4OYUA 1YJLA 1SPPA 4D7SA 4HKWA 3BTAA 4DIQA 3WC6A 4OHXA 2CGOA 1RUJ1 2ZAAA 2Q7BA 2CHHA 1LHOA 5LYLA 1UWWA 5HXDA 2GN3A 5EBVA 4MX3A 4BBHA 3VDCA 3N35A 3A7QA 1B35C 1QU0A 1IY7A 3PL0A 2A71A 1RXGA 3ZXAC 3TFYA 5BXXA 4DJLA 1OUSA 4GULA 4MYEA 1TZOA 1CQ9A 5IHRA 1O8PA 2JG9C 3H50A 4IEWA 2WJSA 1RUH1 3PB6X 4LO8A 1EPZA 2GMEA 2GDFA 2QQMA 3CXQA 1NE6A 2RJ2A 2VZ1A 5EXOA 2IFWA 4V2VA 4Y49B 1B09A 2ID4A 2JDZA 4A45A 1S5KA 2NPIA 2WS93 1SQHA 1W8HA 1Y9KA 3LF7A 3GHMA 1XU2A 3KR5A 3WQ0A 4A3ZA 4C1XA 1TE1B 4JRAA 1YW6A 3WW4A 4GMP1 4Y4YA 4OQ9A 3I7DA 4W9YA 4HG6B 2PQQA 5GZDA 5ACA2 3ZYHA 3BGAA 1RUJ2 1XC6A 1YQEA 2R073 2JEMA 4LK7A 2CDOA 4RS5C 4UFHA 2GN7A 4MBUA 3RDIA 3JBG1 3BB6A 2D43A 1MS0A 1Y9QA 1OMIA 1BQPA 4P4EA 4MGKE 4FOVA 1TF9A 2W39A 2EIDA 5FPAA 3POSA 5HCHA 3DXTA 2VZVA 3O1OA 4JHZA 4M4RA 1VRH1 4WVMB 5FREA 5EIYB 3AXEA 1ZVFA 4II9A 3UYJA 5AG7A 2F17A 4WVMA 3T4VA 5CFDC 3T9YA 4RGKA 2A1XA 1DLLA 4DINB 3IPVA 4QGNA 2CXAA 2DF5A 2QQKA 1TME1 2NYYA 3JBG2 3P2HA 2BERA 1RJ7A 2CTCA 2CY2A 4HOOA 3TX8A 2DCJA 4HKLA 5ERLA 1KXGA 1C57A 1YQCA 2VMIA 4ZY1A 1HV1A 4B13A 3AVSA 2ARBA 1VRH2 1OA3A 4KI5M 1N1SA 2WDBA 2NMTA 1C1LA 1OFNA 4QX5A 5JR7B 3J4UH 2I79A 1ACCA 2FDKA 5C9AB 1CAUB 1UNBA 3RBUA 4BA6A 4AEDC 4NPRA 1I5PA 1NLSA 4HNWB 2MEV1 3OF1A 4CDUC 2JICA 2P6EA 4A6OA 4P5HA 4FUUA 1AR61 5LBEA 4JKKA 4OI0A 2VMCA 3L2NA 4CDXC 1XOVA 5JOYA 3NKTA 3FRMA 4CRYB 4KOUA 4YM3A 5CNAA 1I3HA 3V0AB 4MGYE 2QQOA 1JS9A 5J36A 1QH6A 4LUMA 2G9DA 3UK9A 3H8XA 3RZKA 5JAXA 3RO0A 5K4LA 5BUVA 1VRBA 4YSFA 3MV11 3V0AA 4CTEA 5HI0A 3FLPA 4GWMA 2YPDA 4U9ZA 2HWF3 3WNMA 2R98A 4AHWA 1POV1 3MPBA 4YW4A 5A7WB 1VBD3 4AQ2A 3ZXGA 2AYHA 1KD7A 2FMDA 4RR3C 4R9MA 3K77A 2OS2A 2MEV2 4TWTA 5C3QA 4URAA 1AR62 1A34A 4LHSA 4LOTA 2DCZA 2XMLA 3N7LA 3FMCA 2D3RA 2HWB3 2TUNA 5FZCA 5FMOS 5IB9A 3D7HA 1YQ6A 4DPNA 4DS0A 3B3QE 5B4XA 2RM22 3SITA 2P3IA 1ZZBA 4KOXA 5A3TA 3PRTA 1PNGA 2VY0A 1UOBA 2VQ0A 4RFRB 4FBFA 3WHUA 4MHYA 3H1MA 4CUAA 3W5NA 3O1MA 4IEVA 1I1EA 5EQUA 4BCUA 4ISQA 3MIFA 3KT4A 2E33A 1G6NA 5F5IA 3OUJA 5CBLA 3S5QA 2R1IA 4O7XA 1RUI1 5FWEA 4PDWB 3AXDA 2GP3A 4OIWA 3QLQA 4NXYA 2VNGA 2RMU2 2Z3NA 3EB7A 2XEFA 5LA2A 2ZW5A 5FPXA 1ON0A 1UYZA 1IGOA 4PDWA 2XHNA 2WPWA 1OI6A 2ZX1A 1W3XA 3NV2A 3RNSA 1RL3A 1U5YA 4UWJA 3SQOA 4FFGA 5FPUA 3G8WA 3MLJA 3TOJA 4XJ9A 3FLRA 4HVOA 3PNAA 1OF3A 2VZYA 5FVJA 4O65A 1PU9A 1DGLA 3W58A 1D0HA 3ZXEA 1B6BA 5D29A 3B7IA 4Z8BA 4QT6A 3NJVA 4BXSV 2WNOA 2PR1A 3PUIA 3HN1A 1PO11 3S6FA 1UCXA 1AHSA 2FIWA 4HMZA 1RMU3 1S55A 2CTVA 2P6GA 3LACA 3I9SA 5K9YA 1HXS2 1KFXL 3OG2A 5JH9A 2KD7A 4UF0B 4XZUG 2QTWB 4J6GA 1DYPA 3J7HA 1FNOA 2QFEA 1YW4A 4UCNA 5FYYA 2JDKA 1K3IA 3B3TA 4CCMA 5D1IA 4R76A 3N7JA 2XEGA 3RVHA 1NAEA 1OOPB 4UF0A 2WT2A 1Z8TA 2HWC3 2ZEHA 3B2YA 3T0AA 1U5ZA 5C8CC 3MN8A 2A4NA 4CU8A 3KL9A 3IDCB 5E16A 4XQWA 4D8MA 4YFJA 1XYNA 4F8ZA 5FMCA 4B14A 5J98B 3MIGA 3LZZA 4PXEA 3EHKA 2CF4A 4DQAA 5FZEA 3H8FA 2HWD3 1IYKA 5IB0A 3MYXA 3RMXA 1ULDA 1TG7A 3PVBB 1PO12 4FPEA 3PZJA 3N9QA 1QOSA 4B4QA 1Q2YA 3DECA 1WWYA 1OFSA 4ZBGA 4MFJA 1UF2C 2ET1A 2VZZA 2I00A 1LU1A 2ARXA 4M00A 3BOPA 3GNEA 3O1RA 2PAKA 4H2AA 1A8MA 4E8CA 5AFBA 2WN3A 2C6GA 3BTYA 1SHWB 2K9ZA 3TN93 4V1PA 1J58A 4PIYA 4CYOA 1D4M2 1CPXA 1ELMP 4ZZ8A 5G05L 4A7KA 3VBHB 1JOBA 3T8WA 1YEWA 4X8PA 4ISRA 1UWYA 2QYVA 4WM7C 1LNSA 1RB8G 1XE7A 3VBHA 3CIHA 1J1TA 5J1XA 3S9LA 5J7MA 4ZXKA 2WZNA 1MJAA 1RJ8A 4M0HA 4Y33A 1M4IA 1UX7A 3J8F3 1G9BA 1Z4EA 3WCSA 3M3EA 2G9FA 1PNFA 3KF3A 1W2UA 5LRJA 2DCTA 2IFRA 3S5AA 2A6XA 2CIJA 1RUD1 2RVAA 1ARMA 2ZBJA 4J1WA 4QVTA 4RS2A 1GOGA 4KGGA 4UBRA 2UY9A 3V7ZA 1J1LA 4JD6A 3FHQA 5J48A 4M3CF 4XILA 1LOEA 1BMV2 4D69A 1QJEA 1QJFA 2QQVA 3VARA 1XSQA 3B3VA 2VW0A 2D93A 4H89A 2Y0IA 3WP4A 4M6IA 2AFOA 2V8DA 3AM2A 5HXVA 5LYFA 4R9BA 3T2PA 2ZGUA 1GICA 4XFAA 3ZXJA 4PLOA 2YNEA 1OLRA 2BNMA 1JHJA 4Z07A 2X29A 1CD3G 4MH0E 1OLMA 1CZSA 4XFIA 3MGUA 3I3GA 4CSWA 4EVYA 4B4RA 1RVF1 2VO5A 1OVPA 2BNOA 2KXLA 4CAVA 1S60A 1KRIA 4KOTA 4QXHA 2JB4A 5FY5A 3MDPA 2YG0A 3AL5A 5D21A 3AFGA 2VXJA 3RZLA 4XPDB 1ASJ2 4BZ4A 3H8OA 4Q29A 4Y1XA 4JWPA 1RUD2 4LBQD 2ZEEA 3QOPA 3WF0A 2GALA 4FPLA 2VMEA 1S7LA 2UYAA 2FZ2A 4Z2WA 3HQUA 4XEZA 4B1LA 4LR4A 1OH4A 5DAPA 3K75B 4R7MA 1J4JA 4L8QA 1WZXA 3ACLA 4IV3B 1W06A 2ZOFA 4CZSA 4QKDA 2VZTA 1GSLA 4BQ4A 5D8AB 2VBDA 5KHGA 2WT1A 4YRHA 2V4VA 4ASLA 1O4YA 1RUOA 3V0BB 4IV3A 1JQGA 1VKCA 1OLQA 5D8AA 4PF5A 3TCVA 2EK9A 2WSVA 2WT0A 1YIPA 5AC91 2FD8A 4FTBA 3V0BA 5FV3A 2CTBA 4QHZA 3BHXA 3O0WA 4FD7A 4XMAA 2WNVB 2K0GA 1CZVA 3E5UA 1BJQA 4Y5SA 2YDEA 2GP5A 4P9LA 1W9YA 3N9OA 2X09A 3BUCA 2WNVA 5IFPA 3DR6A 5C33A 1QMUA 5EJZB 3UNPA 3OSDA 4AW7A 4JDMA 3RAMA 2AFSA 3WF1A 4MCPA 2AZ5A 1RXTA 2JDPA 4AXVA 4AI0A 1LEDA 2DFBA 4DRRA 4DO0A 2WZPP 5FKCA 4GWIA 4OUEA 2DDUA 1QOTA 3WDYA 5JM6A 5CYYA 2JDAA 5IAVA 1TVGA 3JXSA 1RIRA 2Y26A 2J1TA 5L73A 2O14A 3DPRB 2VVFA 3MF6A 2CYFA 4QC6A 5AC92 3SI2A 4P4FA 1YFUA 4L2NA 2ERFA 3ZYRA 3DPRA 3LEGA 1KUXA 1QXRA 4XC9A 2E7QA 3H4QA 5FZOA 2WUUA 5KC5A 3RYPA 3NWKA 2Q4YA 2VXKA 4DZGA 5KTCA 4CUCA 3T4HB 2WS91 1Z9UA 5H9PA 3I59B 4FP2A 3BYWA 5FLJA 3JUWA 2WFF1 5LA9A 2YU1A 2O28A
chains in the Genus database with same CATH topology
3AKTA 2DPSA 2N7GA 4QM9A 1M4DA 3ZFFA 1UU5A 1HXS3 1S1AA 4LBQB 2IZWA 5JPHA 1LENA 4TYSA 5JSRA 2WNEA 3KB5A 1NCQA 3S6KA 3GY9A 2AENA 4FD6A 1SDWA 2CV6A 5EZWA 2ZAHA 2E53A 3MIEA 4QQ2A 3KGLA 2R071 1PM7A 3QH7A 5G22A 5F46A 3NO8A 1ENQA 1SCRA 1WD3A 2EXIA 1FI2A 1KZFA 3WP6A 3CU7A 4Q4W1 2ZGSA 1FV3A 1CAVB 1S2KA 3WP3A 2PAEA 5J09A 4EN6B 4LBQA 2VI7A 2XL7A 3J9SA 4JVAA 5LK7B 1YR0A 2VBQA 1WMFA 1DQ2A 3NL1A 4KBBA 4OHVA 3ZN4A 4BPZA 5BNPB 2VPVA 1LGCA 1QF3A 2DVGA 2BGCA 2ZZJA 3B69A 2Z3OA 4RGGA 2RHPA 1D4M1 3WR0A 1D0GA 2BNNA 5F48A 2YV8A 2EXKA 5EWSA 3ZVXA 1TMF1 4LBOA 5LK5A 1CAVA 3HIFA 2XVLA 1TIQA 5I0UA 1FAYA 3VBUB 1WBLA 5KHKA 4G9SB 1RUC2 4PJYA 2JG8A 4YM0A 1RUC3 1LOFA 2RR12 4Y1YA 3NSTA 4AWDA 2D6NA 4MI4A 2YGWA 2DUQA 2DUOA 2PDOA 5T54A 4NN0A 2RS51 4WV8A 4UBGA 3B94A 5BNPA 3VL9A 4B5PB 2V73A 1BZWA 1LOCA 2R062 3PTYA 4CGOA 1V6JA 3OD0A 3JQXA 2KCWA 4COWA 4KVXA 5JVVA 2FZ1A