4OLLA

Camp-binding acyltransferase from mycobacterium smegmatis
Total Genus 86
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
86
sequence length
333
structure length
316
Chain Sequence
b'VAELTEVRAADLAALEFFTGCRPSALEPLATQLRPLKAEPGQVLIRQGDPALTFMLIESGRVQVSHAVADGPPIVLDIELIIGEIALLRDAPRTATVVAAEPVIGWVGDRDAFDTILHLPGMFDRLVRIARQRLAAFITPIPVQVRTGEWFYLRPVLPGDVERTYRRFQSVRKPTRALLEYLFEVDYADHFVWVMTEGALGPVIADARFVREGHNATMAEVAFTVGDDYQGRGIGSFLMGALIVSANYVGVQRFNARVLTDNMAMRKIMDRLGAVWVREVVMTEVDVPPVDTVPFEPELIDQIRDATRKVIRAVSQ'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Acetyltransferase Pat
publication title Allostery and Conformational Dynamics in cAMP-binding Acyltransferases.
pubmed doi rcsb
source organism Mycobacterium smegmatis
molecule tags Transferase
total genus 86
structure length 316
sequence length 333
ec nomenclature ec 2.3.1.-:
pdb deposition date 2014-01-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00027 cNMP_binding Cyclic nucleotide-binding domain
A PF13302 Acetyltransf_3 Acetyltransferase (GNAT) domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.10 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 4ollA01
3.40.630.30 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Aminopeptidase 4ollA02
5KTAA 2Z0ZA 3OGJA 4Q0PA 2UY8A 3NKTA 3PVBB 4LTAA 4AXOA 2QJVA 3TOAA 1RC6A 2D4OA 2Z10A 5K8SA 2KCWA 4PSXA 1LR5A 4CRZB 1RUNA 4QGLA 3S6KA 2CNMA 2D5FA 1X8EA 4BH9A 1ZRFA 4LUMA 4IEQA 3DKWA 2Q0YA 2Q4YA 1CAUA 3RYPA 4JD6A 4XFHA 2H5MA 3R95A 4NEXA 4CYDA 2MPFA 1X82A 4NVPA 1YVOA 4BYYA 1P4NA 3H7JA 1Q43A 2GE3A 4MV2A 3E5XA 4OFGA 1XEBA 4UXAA 1M1DA 1KUYA 4QXKA 4L8AA 1DZTA 2VECA 1WWZA 3H1WA 2WC2A 5E96A 1YFXA 5F47A 4B29A 2Z11A 3SCHA 3ETQA 3WW3A 3NL1A 3CL1A 5FLIA 2O8QA 4JXRA 4KVOE 1O3TA 4JXQA 1CAXA 4XNHC 2HKXA 3BCWA 4E2GA 3B8GA 2ZCWA 5LEJA 3R9GA 4EVYA 3I59A 2EVXA 2QECA 4IEPA 3QB8A 3I3GA 4KOTA 3UKNA 2IXKA 4YSFA 4XPDC 2B5GA 3U11A 4HSJA 1ON0A 2C0ZA 2FE7A 1YX0A 3SCFA 4MY0A 3CLPA 4WVZA 2C27A 2FS5A 4PV6A 1M4DA 4MUVA 1QWRA 1YR0A 1YLLA 4ONUA 4ZU5A 1Y9WA 2ZW5A 2AJ6A 3TO7A 4R3KA 4HZFA 3LA7A 4IEVA 4HNXB 5AVPA 2G3TA 4YYOA 3SXNA 5JSRA 1UCXA 2CAVA 4H6ZA 4JV4A 3ES4A 5CVRA 3QOPA 3SHRA 2CNSA 4B5PA 4ZU7A 3VWDA 1RTVA 4BIFA 3EC4A 4O9GA 2CY2A 5BY5A 4XEZA 4HNWB 4Z82A 2Q04A 4IERA 4X6RB 3RYKA 3TTHA 1ZVFA 1CM0A 2R8VA 4XFAA 4GS4A 1M4GA 2BEIA 2GIVA 4KUAA 3LA2A 5KHKA 3JZVA 3G3SA 4R87A 2BGCA 5JSPA 1ZZ6A 3RDIA 3OTFA 4AVCA 4U9YA 4XF1A 3S6GA 1O4TA 1CAUB 2Q30A 2XLAA 4EWDA 5ISVA 4AB7A 5HMNA 2VEZA 4I0AA 1SQHA 3FNCA 2DCTA 5JPHA 4PSWA 3CO2A 3PLQA 4LA2A 3SHPA 3D2MA 3PGPA 4I3PA 3DV8A 1XE4A 3E6BA 3RZZA 1J4JA 3FFQA 3NJZA 1XIXA 2OZGA 4H89A 3OD0A 3P2HA 4JJXA 5DWMA 3DN7A 1VR3A 1ZZBA 4IEXA 5LRSA 1EP0A 1Y7RA 2FL4A 2IXLA 4F8AA 1XMTA 1YUDA 2XL7A 3R96A 3NVCA 1O3RA 2PQQA 1O5UA 2JDDA 1CAXB 3SXOA 2GAUA 1NXMA 3I59B 4TLFA 1S3ZA 1UIJA 1QSOA 1Q2CA 2F5IA 2HUZA 1FXZA 2PR1A 4FD5A 2P6GA 5FLJA 1S60A 3T90A 1H1MA 4IEZA 5E1RA 5KHIA 3HT2A 1I12A 2B5GB 2REEA 4K30A 1I21A 2GZWA 4KU8A 1X8MA 1Z9UA 2G0BA 4CRYB 2K5TA 1NSLA 2EA7A 5HI0A 3E97A 3TNPB 2PA7A 3CXPA 2BYVE 4R52A 3D82A 5E16A 2PQ8A 4JLYA 4R3LA 2GC0A 5J48A 3BPZA 4XNHB 2Q7BA 3PNAA 1OFNA 2E9QA 2ZPAA 2CV6A 2PDOA 4LLOA 5I0UA 2BNNA 3EY5A 3H4QA 5CNPA 3I7DA 3I9SA 4B5PB 2VPVA 4HSLA 4KVME 2OZJA 2PAEA 4HVRA 4F7ZA 1O5LA 4HNYB 2R98A 5KTCA 4XF9A 4L11A 2Q0AA 4X6QB 4QX5A 1J3PA 4WBBA 3RYRA 4D7TA 3CXQA 4E2SA 3FBUA 4UWIA 4CS0B 3C3VA 1ZZ9A 5I0RA 4MI4A 4YGOA 2FSRA 3R9EA 3FE5A 3ZJ0A 1IYKA 4KZTA 1QY4A 1ZX5A 4KVXA 2MHFA 5FPXA 1EYBA 3UKVA 4QM8A 2JEVA 2PR8A 2VXKA 1BOBA 2Q4SA 1ZNPA 3TT2A 1QSMA 4AVBA 1KUXA 1V0CA 1VHSA 1M4IA 5FVJA 1QXRA 2OA2A 4QVTA 1UW8A 2XKOA 4MZUA 4LEJA 2QMLA 1NYWA 1RGSA 3HIFA 2PHDA 1B87A 4I0BA 4XFCA 4A2UA 2IXCA 4JTOA 4B5OA 5KHJA 5BXXA 3EBRA 1RXTA 2Y0OA 1U12A 4YNIA 3HT1A 4AQ6A 5DWNA 1MK4A 3H3ZA 3DDDA 3CXSA 3G7DA 2BNMA 1Y9KA 2B3UA 4NCZA 1WGPA 3M70A 3FB3A 3TO6A 2WFPA 3CJXA 3KSCA 4Q0UA 2VQAA 4IF5A 2BUEA 2PYTA 5F46A 3BB6A 3EHKA 1YHFA 1O3SA 4E8OA 2Y0MA 1YVKA 3KMHA 5J3UA 1S7NA 1S5KA 3QAHA 1JUHA 1CAWB 4HN0A 1R57A 5I91A 3EJKA 2EVNA 3SMHA 1IPJA 1EPZA 4WZCA 4U5YA 3JUWA 1DGWA 2FQPA 2ZW7A 4FAGA 2NMTA 4L2NA 3K9UA 3EQEA 1I1DA 4RD7A 1S7LA 4KOYA 3ACLA 1VKCA 4XPKA 2EAAA 4MGIE 1B6BA 1U6MA 1YFUA 3BU7A 1J3QA 5FLHA 3QACA 1CJWA 3RPQA 2B4DB 1Q3EA 2BL1A 2I79A 4H6UA 3W6XA 2VQYA 4UWJA 4Z07A 3TCVA 3B02A 4E2AA 1YGHA 3UKTA 3MPBA 2REFA 4QB9A 4JVAA 4KL1A 4HMZA 4I2OA 2MNGA 2OU2A 1Q2DA 4IEOA 2Z69A 1N71A 1RUOA 1OI6A 4CAVA 3E5QA 5LRRA 1QSRA 2ARHA 3LZZA 4R8HA 1ZZCA 3E6DA 4FAHA 5FCCA 4F0YA 3WW1A 2OB0A 1IYLA 4RS2A 4KWKA 2J8MA 3R9FA 1Z4EA 2FIWA 4XFBA 2B8MA 3USSA 1UPIA 2EUIA 4JWPA 1J3RA 2GANA 1OZPA 4KLWA 3UY5A 5KBFA 2FXFA 1PMIA 4FT8A 4KU7A 2FCKA 1Y3TA 3NE7A 4QGNA 2D40A 2IL4A 3FWEA 1BO4A 3ZDSA 1L0CA 4J3GA 4L89A 4EV0A 3TFYA 3E6CC 2IXHA 4YFJA 2VZYA 2ZKLA 4IEUA 2PAKA 4R57A 1GQHA 2ZW4A 2ATRA 1XE8A 1SFNA 4Q0QA 4Q0SA 2XLGA 1WA4A 4JTNA 2P6FA 3S7EA 3H3UA 3OF1A 1UFHA 3EFAA 4PK2A 5I0SA 2ET7A 1ZREA 1LRHA 2J8NA 2BEOA 2J8RA 3H50A 5C8WA 4MJ8A 4I49A 2H0VA 4MH0E 4N9IA 3LODA 3E0KA 2K9ZA 2F4PA 4XFFA 1J59A 3H9AA 4UBHA 2BSWA 3S0MA 4LUAA 1NZCA 1WLTA 4CAWA 3CEWA 5EFUA 4KWLA 2VBQA 1P0HA 4MHDA 1UIKA 3FIXA 5T3NA 3H1MA 1YFYA 5FDBA 3D0JA 2VI7A 2K0GA 4KWJA 1LRZA 1KUVA 1J58A 2PTMA 3IDBB 3DL3A 4FD6A 4CAXA 5J8CA 3TE4A 3RNSA 4NXYA 3D0SA 1J1LA 4FBFA 1EY2A 2A4NA 3D2PA 3PP9A 2P0WA 4XPDB 2PFWA 1NE9A 1IICA 3LAGA 1YLEA 3FHIB 1CX4A 1QSNA 5FQ0A 2ZW6A 2ETEA 1HW5A 3KGLA 4UBRA 5JAXA 1RL3A 2KXLA 3IBMA 2ZXVA 3O14A 3F8KA 4O9EA 3LOIA 1FT9A 1IB1E 4I09A 3BJ7A 3H7YA 4KOXA 1SQ4A 3IGRA 3LA3A 5BV6A 2ET1A 5IV0A 3KCCA 4Y49C 4HBNA 4PIYA 3BJ8A 4EROA 3D3SA 3JVNA 4PJYA 2PC1A 1I5ZA 4MY3A 2Z2SB 2UYBA 3VWEA 2O1QA 3W6SA 2V09A 2OZ6A 4Q29A 3N4MA 4Q0VA 1RO5A 5GCNA 5I8SA 4UA3A 2XL9A 1I6XA 4OLLA 5FPZA 5LEKA 2Q44A 5J8FA 3MZHA 3G8WA 3I54A 3GYAA 5IX3A 2QDRA 3TOBA 1KZFA 4IESA 2OPKA 4MBUA 5JQ4A 3NSTA 2N7GA 3ST7A 1SEFA 3GYDA 2G3AA 4KORA 4XETA 2OZUA 2UY9A 1ZRRA 4QMAA 4E2QA 4AG7A 1DGRA 4RI1A 5F48A 4QUSA 5BUVA 2OYZA 4UBGA 1IIDA 2R7HA 4XFIA 2QCSB 4KOWA 4M3SA 1CAVA 4H7LA 4KUBA 2QIRA 3NW4A 5F49A 4II9A 1S7KA 5KHHA 1DZRA 1MJBA 5I8YA 3W91A 1XRUA 3U0ZA 4HKFA 2XKPA 3S6FA 1UD1A 1ZZ8A 3H8UA 3LWCA 2AE6A 3P2FA 2IXIA 1PUAA 2WPWA 1LKNA 2I45A 4I02A 3CF6E 3GY9A 2XHKA 3IIAA 4XF0A 4LA3A 4K8FA 5EC4A 1L3JA 4IEWA 2HJIA 3L2HA 2GC1A 1QXJA 5FQ0B 1XF8A 2D5HA 4MX3A 1VJ2A 5KHGA 4KOUA 4XFGA 4OADA 3WW2A 4OAEA 5C82A 1TIQA 3VHRA 1XE7A 1NMTA 2Q4VA 4QC6A 3T9YA 4IUSA 1NE6A 3GKRA 4GULA 2H6BA 3DR8A 2WPXA 4HLTA 2FMYA 2I00A 3E5UA 3KGZA 3SCGA 2GU9A 4AG9A 5F1RA 4QBJA 4MGKE 3MDPA 5H84A 4QM9A 4QGMA 1M44A 3TNQA 1FY7A 3M3IA 2HV2A 4KOVA 2RC4A 3BALA 2ATFA 2B9UA 3ES1A 2B4BA 4XF3A 1S7FA 4NSQA 4YRHA 2IXJA 3OCPA 4J1XA 3DNSA 3BLNA 1MJAA 3EO6A 5JCTA 2PRBA 4Y49B 1WK4A 3R6SA 5I8TA 5I93A 3F0AA 1O7FA 3V8IA 2B58A 1Z4RA 4AVAA 4HVOA 4KLVA 4YARA 4XF4A 5CU1A 3WW4A 4D7SA 3DR6A 3TO9A 1ZRDA 4ORFA 2CAUA 4X5KA 2JDCA 2P17A 1Y9QA 4P9GA 4DINB 1CAVB 1CGPA 2JLMA 4LULA 2O28A 1X7NA 2GC3A 1QSTA 4IEYA 1G6NA 4E0AA 5C88A 1TQ5A 1V70A 4MGZE 3SXWA 2FT0A 2QVSB 3H1YA 3EXNA 5D1IA 4LX9A 2FIAA 4LUKA 3FZ3A 3FRMA 1NE4A 3FX3A 1PM7A 3ROUA 2BNOA 1GHEA 1YK3A 3IDCB 4PIZA 5JSOA 4YRDA 3HQXA 2X7BA 3RYOA 4U9ZA 4ZU4A 2UYAA 2GH2A 3DSBA 4PIXA 3IWGA 4KOSA 3ZZIA 2H6CA 2R1IA 4NF1A 5I0TA 3LD2A 3FXTA 5JR7B 4AQ2A 3R1KA 5EZWA 1H1IA 1O3QA 2QNKA 3IWZA 2PSWA 4M85A 1YWKA 2HQYA 3KKWA 4EWEA 3U10A 4PK3A 2XGXA 2PAMA 3MGDA 1K4JA 1GQGA 2B3VA 4DNCA 4F6AA 1CAWA 2CNTA 4FD7A 2OH1A 4MGYE 1FI2A 5KTDA 2OZHA 5BPXA 2Q1ZB 4J1WA 3WR7A 2D4PA 3N7ZA 1OD5A 3S7IA 4BHPA 4FD4A 4HN1A 2VZZA 4N9HA 2GC2A 1ZRCA 3PZJA 4R9MA 2P6EA 3F5BA 3OWCA 5EBVA 3FYNA 3ELNA 5C6CA 4EWAA 2B4DA 2DXQA 3D8PA 5H86A 1YREA 3C26A 5IB0A 2IC1A 3GBFA 4BMHA 1VP6A 4HVQA 1MJ9A 4XPLA 1Q5OA 2B5HA 2CGPA 3FJSA 1LB2A 4ZBGA 1OMIA 3S6HA 2PHLA 1YFWA 1Q2YA 5J7MA 2D93A 4META 1ZZ7A 2XLFA 1IPKA 3EO4A 4I01A 1PU9A 3MYXA 4IETA 5CADA 5HH1A 5I0CA
chains in the Genus database with same CATH superfamily
5F3CA 5KTAA 3X29B 4RS5A 1UXXX 1R1A3 1PYTB 1RC6A 3WQ1A 3MV11 2A1XA 4XTPA 4NEXA 3BKZA 4CYDA 1NKGA 2NP0A 1TF8A 1SFPA 4OFGA 1YRZA 3ABZA 2PE3A 4ZS2A 1GZ9A 4B4PA 2JDZA 1PK6C 2VQ0A 3BTZA 4P5HA 2EIGA 4JXQA 2DVAA 3DXUA 3Q8CA 4IEPA 5DDJ3 3I3GA 2GN7A 1QWRA 4XZPA 1JTZX 1RHI2 4IEVA 4HNXB 1Z78A 3ETPA 1K5JA 1QJFA 2NMOA 3N9LA 3ZYJB 5AVAA 4GS4A 4CE8A 2WR9A 2DF5A 1EV12 2LW8A 4CCLA 1SQHA 4N43A 1HV0A 3CDXA 3OSDA 3PMEA 5IVJA 3A9LA 1B35A 4Y4YA 4TWTA 5HXDA 2JDPA 1SBDA 1OFSA 3WNPA 4LKFA 5K9YA 2QBXA 4OC1A 3HNBM 1GOHA 2ZGQA 1X8MA 5FZBA 4YZ1A 2QDNA 2FHRA 4Q4Y2 5FZDA 4R52A 5E16A 1JMUB 3OGVA 3QLQA 4W50A 1C3HA 1YSJA 1O5LA 4A45A 3WNXA 5FZ1A 1KXGA 4YGOA 3JB8A 3I2OA 2LTNA 5FPXA 4CCJA 2VO5A 3DLJA 2PHDA 4DFSA 4FFFA 2RM23 3I2HA 1OSGA 5J37A 3PVEA 3G7DA 3CIHA 4I3GA 3OBRA 2GNDA 4RQPB 3KV9A 2JDNA 3QAHA 2ZEDA 4L2NA 3MIFA 4HOOA 1V6IA 1D7PM 5CAZA 5H9RA 4LLFA 2A75A 1RHI1 3SC7X 4YWYA 4HMZA 1Q2DA 1N71A 5FYVA 4UFJA 3T1MA 5DAVA 1HJFA 2JE7A 5G1ZA 1FPN2 1Z4EA 1N1TA 4KLWA 1SZBA 4LBJA 2FXFA 5FWEA 1Y3TA 3FWEA 1EV11 3TB0A 5T55A 3WNLA 1XE8A 4GJZA 4QXHA 2QKDA 4CPBD 5CBLA 5C8WA 4MH0E 2V73A 4HPKA 4UBHA 3CEWA 3FIXA 3OUHA 3WP4A 3BUCA 1WUVA 3LB9A 4UW4A 3TE4A 3DPRC 3PB9X 3RNSA 4Q4Y1 1S0DA 4V2WA 4Q8KA 1LHVA 4UIAA 3WDUA 2X5IA 4XPDB 2PFWA 5CG8A 3TRSB 1SLAA 2DDUA 4FOQA 5C71A 4JKMA 3KLSA 2E6VA 3BJ7A 3FUQA 5BV6A 4Y49C 4WJBA 4PDWA 3BJ8A 1C1FA 1RMU2 4GM5A 1X12A 5JWPA 4WVWA 3H8GA 1W3XA 2VCMA 5ANNA 4GB33 1UF2C 3ZFEA 2O14A 4MXWA 2Q8EA 4BPZA 1UQXA 2EWBA 1KDKA 3LWCA 4MHPA 4N53C 2C1FA 3GF6A 5A3MA 3GY9A 1RXGA 2FD8A 2BWCA 2CGNA 1V6NA 3GM8A 5JLVA 3NNMA 2Z5WA 4RR3B 5F39A 1FPN1 3BI1A 4KOVA 3KS7A 3S6PA 4QQLA 3AJZA 2YBPA 3DNSA 3AP7A 4W65A 5A7NA 3KCXA 1ELMP 4JGYB 3Q8AA 3MHZA 1C28A 4N43C 4CSWA 4Q4X3 3TEXA 2W87A 4PXEA 5AFEA 3M3EA 4P4EA 3T8WA 2ZGRA 2VZUA 2KD7A 2XEFA 5IVBA 3ILRA 4P44A 1ND2C 2O53A 4YRDA 3FH4A 4U9ZA 1W8ZA 2P5BA 3FFZA 3ZXKA 2WO7A 2UWCA 1GFF2 4NF1A 2R1IA 3R1KA 1UMZA 4M85A 1COV3 4C91A 1CAWA 5FOJB 5BPXA 1MEC2 5F37A 4IV3A 2YPDA 4A44A 4BHPA 1BAVA 4XJUA 1ZRCA 1YREA 1UY3A 2ZMNA 3S6HA 4Q1RA 1H4GA 3EO4A 2Z3MA 2E7TA 2VMIA 4LTAA 4S2DA 2V8VA 5FUIA 2QJVA 4NJRA 2Z10A 1RUNA 1A8DA 3NRUA 2WZR3 4Y5SA 3HQRA 2D6NA 4LHSA 4D6QA 1AX1A 1BPNA 1QEXA 1QJU2 4WM8B 3PUHA 1LGCA 4QXKA 3SJFA 4K7JA 3H1WA 3I4IA 2Z11A 1VBD2 3WW3A 3B35A 3VKLA 1LCLA 3N9PA 1JW6A 2BZDA 2X8KA 2VMDA 4ZY9A 1K12A 3O1SA 3ZIXA 2VJXA 4COYA 2YC2A 1NCQA 3OBAA 4CYOA 1LHNA 3TO7A 4AZZA 1GWLA 1UCXA 2B42B 5J98B 4HNWB 4H55A 4DUWA 2XG3A 3FECA 1W9FA 3S6GA 3PU8A 4F0XA 5FYMA 3OEBA 4YW1A 2XXZA 2WABA 2DV9A 4HT1T 4LBLA 4XYXA 5GZDA 4JJXA 5EV7A 3K51A 4A4AA 4QT6A 4CDUA 1R093 4BBHA 3R96A 3VBHC 1STMA 2HUZA 3SITA 1XC6A 1H9WA 1O91A 1PK6B 5E1RA 4AEJA 2XH6A 2G0BA 3KZWA 3NNLA 2G9FA 3B00A 2OOTA 2BCOA 1UY0A 3I9SA 2Z3PA 5KTCA 5FYCA 4QX5A 3ZFFA 3C3VA 4MI4A 5AC92 4K3NA 1DBNA 1UZVA 4AVTA 2JEVA 1BOBA 3OPTA 3QD6A 4DB5A 4UYBA 3DGVA 4QB2A 4ITCA 3O1VA 4XE9A 4YNIA 4Q4V2 2VC9A 1QJU1 1UYPA 2OUJA 2B3UA 3CJXA 1YHFA 4PQ9A 3RZGA 3PTYA 2B4DB 2Y33A 2QJ8A 3TEWA 3TCVA 2HWD1 1T2XA 1YGHA 4BU2A 3MPBA 3S9NA 1Q8OA 4BOWA 1VRBA 1RUOA 5LRRA 4L8QA 4NROA 4RS2A 1US3A 2B8MA 5IAXA 1QMUA 1YQ2A 3ZDSA 1BKZA 3J9SA 3BPSA 2ATRA 4CP1A 3THPA 1YI7A 3IKWA 4A3ZA 2DUOA 3ALQA 4BZ4A 3IPVB 3LFIA 1RVF3 2YV8A 4GMP0 2RJLA 4F9VA 1MS1A 1BXHA 4KWJA 1E5RA 5J8CA 5JMCA 2DPSA 1W0PA 3K48A 1QJZA 2WRAA 4Q26A 3IN9A 5DS0A 1FNYA 2B46X 3IBMA 5FZ3A 4KOXA 5HPOA 5AC91 4Q4W1 1NXD1 2RDRA 1AR83 2WN2A 1X9TA 4DXSA 1LEMA 4BQ4A 3RMXA 5IX3A 2QDRA 1IHMA 4QB1A 5CA6A 4Q4V1 3UT0A 5A7PA 2DURA 4QMAA 4E2QA 3Q8BA 4QUSA 1IIDA 1GQPA 5IK5A 2PHUA 4II9A 4P9WA 2XKPA 1RTQA 1C8M2 1ZZ8A 1XSQA 7CPAA 2G9GA 5FMDA 2WQ8A 5BNNC 4MX3A 3TN92 4OADA 3DPRB 3ZSMA 2WPXA 3V7ZA 5CB7A 2DBIA 5A1FA 2Y38A 1MVEA 4LOSA 4MGKE 1S0GA 4Y49B 5KWRA 1DZQA 1ONAA 2YXSA 4ISQA 4YARA 1HRI3 5B2GB 2DVFA 1LAMA 4B10A 2O28A 1RUJ2 4GH4A 1DGRN 4YFZA 4BE3A 2QVSB 3BI0A 2HWB1 3FZ3A 4OHWA 3VN4A 3FX3A 4K9SA 1H1AA 1W6MB 1UMHA 4YM0A 2RB7A 4ZZ8A 5FOBB 3ZZIA 1NY72 1XFOA 4N53B 2OVUA 2BOIA 2YU2A 5KTDA 5F5AA 4NAMA 4R9MA 5FRAA 5H86A 3C26A 1AL0G 5FJHA 1YFWA 4UFWA 4GD4A 1F2NA 3UJQA 1DQ1A 5CADA 2Z0ZA 1VRH1 4NAOA 4UI9L 3NKTA 4AXOA 2ZEOA 3I2IA 4PSXA 4A7ZA 2G4IA 2GNTA 1CAUA 1HB4A 4Y26A 1HDQA 1C8M1 2MEV1 1YQCA 4QPGC 5A7SA 2CXAA 3LE0A 1W2UA 2A3YA 1AR72 1D2QA 3SCHA 1ND2B 1RUH3 2GH8A 1O3TA 3TN91 2HKXA 3A0NA 3AFKA 1ASJ2 3UKNA 2DCYA 5FBZA 1WMFA 4NJQA 1GANA 4YW3A 4HZFA 3LGRA 3OYWA 5FZHA 5LW9A 4LBQD 1SCSA 4CGNA 1OD3A 2GDFA 4K3UA 4YW4A 1ZZ6A 3LMSA 1RUJ1 4EWDA 2YROA 5A32B 4I0AA 1V6KA 4IL7A 4ZX8A 4QQ2A 4UFVA 2JG8C 3DV8A 1XE4A 3WF3A 1ULGA 5J09A 3P6BA 2BV4A 3ZXAC 1ZZBA 1Y7RA 2PQQA 2JDDA 1P8JA 3N9OA 1NY71 3T90A 1PMJX 2VR4A 4KU8A 2VD7A 2K5TA 1X50A 2PA7A 3UGHA 2XUMA 1VAVA 2ZGSA 2YBSA 4CRQA 5FY7A 2C6PA 2CNAA 3WOGA 2GNBA 4D7TA 2Q8CA 1CJPA 1MS0A 4KZTA 1QY4A 4R76A 2Q4SA 4BQ2A 4WVMB 5I4MA 4QVTA 2QMLA 1NYWA 2KR2A 3HIFA 2JG9B 5KHJA 3VBRA 3HT1A 4JGZA 3BODA 3CXSA 1F4AA 4YVWC 3T09A 2R043 3ZXEA 1OLQA 3VBSC 1AR71 2XONA 4E8OA 1ZA4A 1V6MA 2Q7SA 2CWSA 4DY5A 3GALA 3KF3A 1LJ7A 3VBHB 3O1MA 2O4HA 2YYOA 1ENSA 2BTVC 3TBDA 4UCMA 2VZVA 1W6PB 1AZDA 2FIWA 1J3RA 3SH3A 2GANA 4R8FA 1QOSA 2QQMA 4XPVA 4A2ZA 2BW8A 4KU7A 4OIWA 2OT7A 2WUUA 4B14A 4GH4C 2ZW4A 2FMDA 4XQDA 3EFAA 3HPNA 3SXOA 1LRHA 3A0KA 2BSWA 2ZX2A 5FZ8A 1LRZA 3HJRA 4FQ4A 4K1ZA 1GP4A 4FOYA 1DHKB 1UOGA 1XSRA 5EXOA 4BQ3A 1ACCA 1NE9A 2XBO2 1QH6A 1D0GA 4CDQB 1WD4A 1IB1E 3AZZA 3WY6A 4A42A 3RNZA 2HWF2 3ZLIA 3Q8FA 1I5ZA 1S4CA 3AYDA 4Q0VA 2YBKA 2RS33 2WFF3 4QPWA 3WUCA 2X53S 2OPKA 3CDZB 3ZMOA 3WNMA 3VBOC 5JQ4A 2N7GA 2OYZA 5LB6A 4XFIA 3USUA 3IJ3A 5AFBA 1MJBA 3K77A 4BLIA 1DQ2A 2WO2A 4BCUA 4XFGA 4TYSA 2ADEA 1DQ6A 3ORJA 4FPYA 2I00A 4R9CA 1M44A 2DU1A 4B13A 5IYYA 5BNOC 3NH8A 3BALA 3ZN6A 4XF3A 4UF0B 1K42A 2XJUA 2XHNA 1F9KA 1ZLHA 3JU9A 4KLVA 4XF4A 3A4UA 4F9UA 2YNDA 4FO9A 2P17A 4PF5A 2ILMA 4GIQA 1FX5A 3ZSKA 5F7UA 4XMIA 3VDDA 3H1YA 4P4JA 4NIDA 2LROA 4XURA 1YK3A 2YNCC 4QU1A 4B8EA 3S9LA 1JOJA 5E89A 1K5MC 5HVFA 1LOGA 1WCUA 4CVUA 2XBO1 4FD7A 2Q1ZB 4G1PA 4YZ3A 4CPBA 4HN1A 2P6CA 1XNBA 2HWF1 5F2WA 3OWCA 2YGWA 2VZQA 2DXQA 3PJYA 4CEYA 4Q8LA 1W90A 1GR3A 3HR9A 2UY8A 1IQDC 5A6XA 4CRZB 1X8EA 5BNPA 2CTVA 3O1TA 3GZTB 3FHQA 1NCRA 2QQNA 1GUIA 2Q5TA 3ACHA 5LBFA 3NO8A 3ETQA 1F5JA 1R3NA 3CL1A 3CT9A 1JHJA 4IXLA 3BCWA 5A70A 3VKNA 1S0EA 1G9BA 4ATFA 1YX0A 1NOVA 2C27A 4MFZA 1PVC3 3HNMA 1MZ5A 4CGPA 4H6ZA 2F17A 5DUUA 2CY2A 1LTEA 3WNKA 2NQYA 2WKKA 2HB6A 4WM7C 4OHXA 1M4GA 3JZVA 4B7EA 1ARMA 4Y20B 2R0FA 3AK0A 1XIXA 4H89A 3P2HA 3W59A 1JI6A 2FL4A 3GDBA 1Z8TA 4QPGB 2Z4FA 3I59B 1HIXA 1FXZA 4OI2A 1S60A 4QU2A 3TNPB 2BYVE 4MMOA 4XIKA 2PQ8A 4BMBA 2VTFA 1U5ZA 3POBA 5KC5A 4TSVA 3LSEA 4FTBA 2PAEA 1W28A 5F3GA 5F09A 3FL7A 1I5PA 3U37A 4WBBA 4E2SA 2E63A 5D8AA 2ARXA 5HBAA 1IYKA 1UNBA 4NMIA 3JBG2 4A6SA 2PR8A 3AZVA 5T5PA 2FDFA 1M4IA 1VALA 4DO0A 4G4FA 5FPUA 4MZUA 2ZACA 4ZI6A 1LOFA 4K6BA 3EBRA 8CPAA 2VOTA 1MK4A 1IS3A 1HXS3 2GALA 3FB3A 2AFOA 1DLCA 2JG8B 3FHAA 1YVKA 1YXWA 1JUHA 1OQDA 2W1SA 3U1XA 3SNMA 2VZSA 4KGGA 2ZELA 2VVEA 1UO9A 4IE4A 4HONA 3ATGA 5FO8B 3N7LA 1DIWA 1U6MA 2ZHLA 2B45X 3SISA 3B01A 4H6UA 4FWUA 3B02A 5JZGA 4Z1VA 1D4M2 4QB6A 3T3YA 4NPLA 3POYA 4R9AA 4W6WA 3HN3A 3QH7A 3GLJA 3KVAA 3IIBA 2IL4A 1LULA 2PAKA 4Y3OA 5FYYA 1A78A 1Z7S3 3S7EA 4NPRA 4YZ2A 4BQYA 3LODA 3JD72 2WT1A 2ZGTA 5LA9A 1RUI2 3S0MA 1OBRA 3WF1A 4YVWB 3SH5A 4FPEA 3VBSB 3KHCA 4FD6A 2POKA 5FMBA 3T2QA 1YC61 3N7JA 4BXSV 1AYN1 3LAGA 1HB3A 2AEZA 5FQ0A 2ZXVA 3O14A 3B93A 2W92A 4GZ9A 4A37A 5EIYB 1Q8VA 3JBG1 3CQOA 3PVNA 3JCIA 1ZBA2 2BP6A 5GCNA 4HKOA 5FPZA 4LQ6A 4CXYA 3I54A 1AR92 1L7RA 4UFHA 2GSYA 2DF7A 4UCPA 4B1LA 4RI1A 3VD4A 4A33A 2J1RA 4MHRA 3VL9A 4HL0A 1AYEA 2A3WA 1EE3P 4DXTA 1PUAA 4K21A 3H8RA 1RUC2 2HJIA 2GC1A 4KH9A 3LDBA 4KWUA 3QBQA 2OKXA 1WCKA 1D4M1 3CMGA 1RUF2 1O4YA 3KGZA 1TME3 1XBFA 4ET7A 4AG9A 1Z5RA 1LHUA 2WT2A 3PUIA 1QH7A 3L2YA 3PU3A 3V0BA 5FK8A 4FPJA 5CU1A 1ZRDA 4ORFA 3N9MA 5FZ4A 1RUD3 4OZXA 4M6GA 2HWD3 4AEDA 2JDCA 3WC5A 3RJ2X 2G19A 1LHOA 4AGVA 3JD71 1V70A 3ZM8A 3VBOB 1RUI1 3EXNA 4M6HA 1KFUL 1NA1B 1PM7A 1D0HA 3IDCB 4FAIA 4JYWA 2P3IA 2GH2A 3DSBA 4NRMA 4CCCA 4P5YA 3FF3A 3HWJA 1MS4A 4FXKB 3MGDA 3LEIA 3UETA 2JB4A 2OH1A 1G86A 1FI2A 2PJ6A 3WD5A 3ITQA 1JYWA 4N9HA 3PBEA 2WDBA 4X8PA 5D8AC 3ELNA 4EWAA 1R1A2 3UGFA 5C9AA 3MIDA 5A3LA 3CHXA 2XVLA 3T2PA 3KI9A 1W9SA 1ZBA1 1Q2YA 5BNOB 3MYXA 3AMNA 1X10A 1PX4A 1AR91 3S5AA 2HYKA 2JXAA 3VKOA 3MIEA 4J6GA 4C2XA 5K8SA 2CNMA 2ANPA 3MLJA 1VIXA 2Q4YA 3WG4A 2EIBA 5K8MA 3H7JA 4Q4W3 1XEBA 1H8TC 1KUYA 4YGEA 1GZWA 1TNRA 4OHYA 2VL1A 4BB3A 4R9DA 2OIIA 4U2AA 2JIJA 3MICA 3VBUC 2P1BA 1W9YA 4DIQA 3QB8A 4KOTA 3FLPA 4YSFA 1K5MB 2B5GA 2TEPA 5KXCA 3I2GA 4PBOA 3AVSA 3J7MA 2BOAA 1GP5A 5DMYA 1JH5A 5CVRA 2EF6A 5FY5A 1QJEA 2AFSA 4AYUA 4WV8A 2NSMA 4CGLA 1DYOA 1I3HA 4R87A 5GZCA 5IW0A 1G8WA 1S55A 2VEZA 2A6WA 4FXGB 4LA2A 1DGLA 1TKHA 3E6BA 2ZGOA 2WNUA 1VBB3 4F83A 1W03A 2O8OA 2AFUA 2HYXA 3HAGA 1Q2CA 1XRYA 4AEMA 1ZG7A 1XU2A 3POEA 2EA7A 5FK7A 2D6KA 2GC0A 2P34A 4AI8A 1SPPB 3AP6A 2W47A 2HWB3 2IVJA 2BNNA 4R9BA 3ZXDA 1R1A1 4KVME 2OZJA 2V5DA 4DOUA 5FYBA 4NFRA 5T52A 4C7IA 3H8FA 5GZFA 2RM22 4UWIA 2BJSA 4AHYA 3WG2A 2EALA 1QXRA 3ZSJA 1REDA 5A27A 4LBMA 2XKOA 4WM7B 1DYKA 1PGW2 1B09A 1S7NA 3MFAA 1HDKA 4HN0A 4JZRA 1WLDA 3WF0A 4C7HA 1VRH3 2VVFA 4XIOA 3EQEA 1SBFA 4GWJA 3C8XA 4PXBA 2BL1A 4XUQA 5GALA 1C8M3 2MEV3 1YIPA 2OU2A 1PGL1 1OI6A 3BI3A 2EUIA 1UPIA 2E26A 3B7MA 5FZKA 3H5ZA 1SACA 4QGNA 2NZ9A 2XVKA 4YFJA 4IEUA 4QPIA 2F8HA 2A71A 1WA4A 4DEQA 4DXZA 4K1YA 5FP4A 4HK9A 1J59A 5FREA 4MCPA 1JBCA 3ZOIA 2VZ3A 5T3NA 1POQA 4LBQA 1XNTA 5FDBA 2VI7A 5IUQA 5F9TA 3NNJA 4YU9A 4PQQA 1WCQA 1JZ6A 3SI1A 3MEPA 2X05A 2A4NA 3VZMA 3POJA 3BTYA 2W52A 2UU8A 5D8NA 1SLCA 5DAQA 2ZGUA 1HW5A 4LK7A 2R061 5ELYA 1TVGA 3BVCA 1CWPA 1UY4A 2RM21 4GB32 5JIUA 4PJYA 3ACFA 1PO12 2UYBA 3VWEA 5DUVA 2ZX4A 5JXGA 4RSUA 4BQXA 4A30A 2YUEA 4B7KA 1POV3 1QQP3 2I74A 4OI4A 4YVSC 1PGW1 3RZHA 1SEFA 5F8PA 5LK7B 3I3DA 5BUVA 3GGLA 4NRQA 1XMBA 1UD1A 1FAYA 4W8JA 2IXIA 5JUVA 1ZG9A 4M6IA 4TWEA 4XF0A 3L2HA 4MCRA 3AKPA 2WQZC 3WXPA 1GZTA 4CCNA 4MFKA 2G9ZA 5FY1A 1TIQA 3VHRA 1OHFA 3KR4A 4HLTA 2FMYA 3E5UA 2BOJA 3G6JB 4CUGA 3PFOA 2Q8OA 4Q4X2 4XJ8A 3RZAA 2ARAA 4JHTA 1HDUA 3EO6A 5FPLA 1X36A 1JYNA 1O7FA 4Y22A 4D7SA 1VHEA 3TO9A 2F4LA 3K46A 2VW1A 4EMEA 4S2FA 2VH9A 1AUYA 2JD9A 3SQOA 2PVWA 2GMMA 2Z3OA 4LE4A 1QJX3 2ARBA 3KHZA 1COV2 2FVGA 3RYOA 4AEKA 3EMRA 4I30A 4KOSA 1V00A 1H6YA 1H8LA 3LPFA 3FMGA 5JOWA 4AE2A 5LBEA 4A32A 2YFZA 1IOIA 4MGYE 5CYYA 2OZHA 3NV2A 3N7ZA 1FYUA 1XB9A 2VTXJ 2OS2A 2CTCA 3OY8B 5IB0A 3GBWA 1PO11 2PJAA 1OXCA 1Q5OA 2B5HA 2WZR2 4XUTA 4ZY1A 2Q4ZA 4NN0A 4TZDA 4HPKB 3DF0A 1LODA 2ZEPA 3ZVXA 3WT3A 3RYPA 4GXHA 3VZJA 5F6LB 3FX6A 3JUUA 3QNVA 1XXNA 1ZG8A 4L8AA 3I2DA 1PZ9A 3BN6A 5KXEA 3I2KA 2QECA 5D29A 5APAA 4UOJA 2RS53 2J9AA 2W39A 3L2NA 5FZLA 4R3KA 4MHNA 2Z3KA 3HUVA 3SEPA 4O61A 4BQWA 3RSJA 4QPIC 2IWGB 3OTFA 4U9YA 3F95A 5BWAB 4E27A 1R092 2Y6KA 5IWFA 3SHPA 1COV1 1BHGA 2I07B 5DWMA 2VW0A 5LRSA 2IXLA 2ZEMA 3WHTA 2XL7A 2Z79A 4RQPA 1H8TB 2P6GA 4UW5A 1I21A 3TEZA 4JLYA 2J42A 3VBUB 2YG0A 2CIJA 3MIGA 1QNYA 3O7OA 3AXEA 1MZFA 1DE4C 3KD4A 3ZKYA 4FPOB 2WZR1 4H7MA 4CS0B 3JRUA 2FDIA 1TE1B 3K75B 4OYUA 4QKBA 2VXKA 3O0WA 5D2AA 1V0CA 1VHSA 1JN2P 1U12A 4HKLA 4A31A 4CTEA 4WZFA 2RDNA 2DCJA 1LOEA 2Y34A 1CAWB 1W8OA 1WCDJ 4FAGA 1WW5A 4RD7A 5FP8A 4QDRA 3PHMA 3QACA 3RPQA 2XJTA 2RMU3 3VBFC 2D6MA 2Y6GA 5A3PA 1XNKA 1Z2LA 4I2OA 4CZSA 2ZEGA 1N3PA 3E5QA 1CONA 1OH3A 3E6DA 3A22A 1OZPA 3UY5A 1OOPC 2AACA 2E51A 1TEIA 4B3NA 4RN5A 2FCKA 1RVF2 1R091 3TFYA 2BO9A 1NSAA 4Z65A 1W8HA 2UWBA 2B39A 4Q27A 3CJIA 5IB9A 1OUSA 4LUAA 1P0HA 1GOGA 4MLOA 3DL3A 1EUUA 3LPGA 4YGBA 4B6ZA 3VHNA 3LWUA 1AR82 5E88A 4H3WA 4XUNA 1CPXA 4RR3A 3F8KA 4ARXA 1FT9A 3I49A 4I09A 4XJAA 1XE0A 3LA3A 3DKQA 5C3QA 5FP9A 3IWWA 3W6SA 5LRJA 4JGYA 3TOBA 5LA1A 4IESA 3VD9A 1QDOA 4YW2A 2G3AA 1ODMA 1ZRRA 1SLLA 4AG7A 1UYXA 5AG5A 3WHUA 4UEFA 5KHHA 3PURA 3S6FA 4BJ0A 1DQ5A 2ZGKA 1BK0A 5EJ1B 1LKNA 3CZXA 4CEWC 4XQ4A 5FZFA 2XHKA 4LHNA 5CFCC 1L3JA 1WMDA 1JYTA 3GB0A 5HCHA 4OQ8A 4OP4A 1G9FA 4Y1YA 3PTRB 1NMTA 1A2ZA 5LK5A 4B4RA 1NE6A 2ZJCA 3WINE 4I0WB 1HRI2 3WSOA 1WW7A 5E8AA 5C8CC 1F2OA 4CYQA 3JB4C 3ES1A 2B4BA 2BFUL 1GMMA 1XYOA 5I93A 1BCXA 1RVF1 2GN3A 1W0NA 4TLGA 4Y1UA 4AHZA 2C5DA 5A7WB 4S2HA 1NT0A 4YVSB 1C1LA 4D6SA 4CUAA 2Z3NA 4A7KA 3V65A 3HMYA 1K45A 3NE8A 4WM8A 4PIXA 3IWGA 4AQ2A 4OC3A 1O3QA 4LIUA 2PAMA 1AR81 2DCZA 1UY2A 5ERLA 3C7GA 4UFKA 4FD4A 4YFWA 1EPWA 1F8VA 4XJWA 1LB2A 4UFLA 5FZGA 3OBTA 1LAJA 1IPKA 1UN1A 1AYN3 3NH5A 3MIHA 4LUMA 4M0HA 1RUH2 3ZO0B 2R49A 2MPFA 3ZYPA 2HWE3 3E5XA 3IDAA 1DYPA 3DYMA 5LBCA 2WC2A 2QZ3A 3WQBA 4MSVA 3KGQA 4KVOE 2ZABA 3D5OA 2DUPA 2IXKA 1PK6A 4XPDC 3CLPA 5DZEA 5JPMB 1XYNA 4ZHNA 1HRI1 1UOFA 2FS5A 5FUPA 1YLLA 4MG2A 4KG0A 5AVPA 4E8DA 3VDCA 4KQ7A 4JV4A 1RTVA 3PUQA 4XEZA 2JWPA 2R8VA 2VMGA 1UZ0A 2A70A 4KUAA 3G3SA 1PNFA 1CP7A 5K8PA 1H2LA 2PHFA 2C9AA 2QQPA 3PGPA 4KGQA 3OD0A 2W1WA 3LDKA 1O3RA 1CAXB 2GAUA 5G20A 4TLFA 1S3ZA 3AKRA 1TG7A 1UZWA 4IEZA 1OLRA 3WABA 1W6QB 4AAXA 3E97A 4Z2AA 1HB2A 2Q7BA 1WW6A 2W95A 1TMF1 5F5CA 4LLOA 3H4QA 1ND3C 3I7DA 3WP5A 1AJKA 4X6QB 3CXQA 2GP3A 3FBUA 5T5LA 4NIAA 3FE5A 2WZNA 4KVXA 2D6LX 1EYBA 2R042 3T0BA 3TT2A 3EB7A 4DMIA 1UKRA 1KUXA 2YC4A 2PJ8A 1W3VA 1AXYA 3PUAA 2IJZA 4XFCA 4FP3A 3CZUA 2ERFA 2CDOA 3BXMA 1Y9KA 4K40A 1V9U2 5F46A 5IT6A 5EJ3A 3KMHA 4G9SB 1MVQA 3IPVA 1VBE3 4KSAA 3EJKA 3SMHA 1EPZA 5HVHA 1U5XA 1I1DA 4BMEA 2A73B 3AM2A 5FLHA 1ENRA 4JCKA 2Y60A 4LQGA 3OGSA 3WVJA 4Q38A 5IVFA 1ZZCA 3ZPYA 4P4IA 3D8CA 5FY4A 3WX5A 3W58A 2BGOA 2XEIA 2IXHA 2RS13 2R073 1Q8SA 2HWC3 1JZ5A 3OF1A 5B4XA 3H50A 4C2YA 2JKBA 1X33A 3D0JA 1KUVA 2V8GA 2W68A 4QHZA 1N1YA 2OXBA 2EXJA 1FOD3 3DPRA 5JAXA 1RL3A 2PJBA 3VBFB 2RS32 2WFF2 4A95A 3IGRA 5A3WA 5IFPA 1KEXA 2EK8A 3JVNA 2R041 5ABJC 4YG0A 2XL9A 1OOPB 4DZGA 1PZ7A 4H14A 3S9MA 3QH6A 3IIIA 2JE9A 3GYDA 4KORA 3ZYBA 5L73A 1AF9A 1V9U1 5FYIA 1YEWA 3ZXFA 1YQ5A 4M3SA 3U4XA 1DZRA 2JDHA 4MVTA 2BWAA 1FMD3 4I02A 2FZ1A 2RDSA 1W6MA 4LA3A 1SLTA 4IEWA 1AHSA 4MHYA 3M1HA 2VOKA 4N53A 1MPXA 4CCOA 1URXA 1QKQA 2RJKA 3W9AA 5HCAA 1W6NB 3POIA 2XQXA 2BFUS 3MDPA 3TNQA 4Y5Z0 5LY2A 1OF3A 3IDEA 5CPAA 2R1DA 3F0AA 4QWNA 2B58A 4OQ9A 1NLRA 1CZTA 2P4EA 3MIBA 1SLIA 4P9GA 1I9RA 4DINB 1CGPA 1ZA7A 1QSTA 2VAUA 1AL23 1OC1A 2QQJA 2ZHMA 4PIZA 2PJ3A 4QQPA 2UYAA 2WUHA 3LKJA 3FXTA 2WJSA 1SHWB 1CBXA 3HBKA 4CEWB 4V2VA 1ND2A 4UWDA 5CFCB 1GQGA 2B3VA 2ZEHA 4LBOA 1MS8A 3M4FA 2RS31 2WFF1 2ORXA 4IV1C 5C4WC 2ZX1A 1LU1A 3T0DA 1W8FA 4PPZA 5C8CB 4YM2A 4MCQA 3S57A 5F6KA 2W46A 1LR5A 1TZOA 4QGLA 2R063 1Q56A 3FMCA 5A32A 5FKBA 4QXCA 2SLIA 1Q43A 3DGTA 4UXAA 5KXDA 4AGRA 4CDXC 1S1AA 4X8NA 5G22A 3VLBB 5IJRA 1PVC2 2DBNA 4CP0A 4CU6A 4FFGA 4XCAA 2QYVA 2DPTA 3RG0A 3LSDA 1R64A 4XQWA 2G3TA 4YZ4A 4DPNA 1V6LA 2B4KA 5CBMA 2VZ1A 4KNCA 1CM0A 1W06A 3RFRA 5HXMA 1G7YA 2BGCA 4GKYA 1YIFA 1QQ9A 2PHTA 2Q30A 3ISZA 1E5SA 4WVMA 2JECA 2BVVA 3CO2A 2FDGA 5FMCA 4IGOA 4XBNA 2PHXA 4I3PA 4LIVA 2JG9A 4FOWA 4OHZA 1NLSA 2Z3LA 1OPMA 1O5UA 5CIRA 3M3QA 4FD5A 2PR1A 4WVVA 3PB4X 2G1MA 1I12A 2REEA 2VVDA 4ZXEA 5JI9A 2AYHA 5EPAA 2Q1MA 5A3UA 3ZN6B 3VBHA 1QJY3 3I3MA 4QXBA 3J8F1 4AI1A 4ZYQA 2ORZA 4O7XA 4HANA 1W6PA 3LFMA 1UXZA 1ZX5A 2VZPA 1HXS2 4UFXA 5HCFA 2IMOA 5JOZA 2IXCA 3O5SA 4JTOA 1HKDA 1CZVA 4ATEA 3IC1A 2OQ6A 1PO13 4IF5A 5TSWA 3IM0A 4A3XA 3AYAA 4WZCA 1DFQA 1PVC1 5JMOA 4AL9A 4NOTA 1VKCA 3PMSA 1YFUA 3NMBA 1Q3EA 1IQAA 4CEYB 1HQWA 4EE2A 3B7IA 4JVAA 3F2ZA 4J25A 4R8HA 4FAHA 1ND3B 3WW1A 1ULOA 1Q8PA 1Z7S2 4XFBA 4E4SA 1KFXL 4O65A 4FT8A 5HV4A 5LYDA 4P9LA 4Q2FA 3PL0A 1MZ6A 2ZS6B 2V8HA 3KM5A 1WZXA 4R57A 2VUJA 1SFNA 1WMXA 3TEYA 2J8NA 2J8RA 1Z8LA 3E0KA 2SBAA 2K0GA 4U36A 2AENA 1R083 3LEGA 4CAXA 4FBFA 5B4NA 1LOCA 1PMHX 3ZDVA 4OUSA 2VZRA 1CX4A 3H42B 2ETEA 1WD3A 4JDMA 3WDWA 3FEEA 2E31A 1AXKA 1SQ4A 5IV0A 2PC1A 4MY3A 2AZ5A 4GA9A 1HXS1 1IY7A 2NPIA 3N4MA 4Q29A 4MFJA 4UF0A 3AP4A 5LEKA 3AL5A 3KASA 1DGRA 3JQWA 3O1PA 4AR2A 2AFXA 2QCSB 2PVVA 5IK8A 1V6OA 1BPMA 1H2NA 4KMQA 2Q1FA 4CAEA 5GKAC 3PVOA 2FDHA 2QTWB 5K4LA 1IGOA 2JDAA 4RGAA 1AYM3 1TME2 4BA6A 5GZGA 2W3JA 3AX4A 1XNCA 1VJ2A 3SH4A 5A3TA 1XE7A 4DUVA 5GJ6A 3SKVA 2VUDA 3B3TA 2XJRA 3PB8X 3RQ0A 5BNNA 2JDYA 3UESA 4QGMA 1RUD2 1Z7S1 2RC4A 2HWD2 3J7NA 1BBT3 1MJAA 2PRBA 4C68A 3OD4A 4AVAA 2PELA 1JZ4A 3ZFGC 5ABJB 2JG9C 4FI9A 5JH9A 1BQPA 1OA3A 2VL4A 4FTSA 1HEEA 4LX9A 1SDDB 4LUKA 3FRMA 1NE4A 4OUEA 3KCYA 2X7BA 2C6CA 5L7OC 3AYEA 2H6CA 5A33B 1GICA 5EZWA 4LORA 2C1CA 3RBUA 4QDQA 1N1VA 2R16A 3FBMA 5FIXA 3AMQA 3T08A 3WR7A 2AR6A 1LGNA 1ENXA 1PVXA 1E57A 2C4XA 2IC1A 1G9CA 1VP6A 2QQLA 2NYYA 2D93A 4CDWC 4I01A 5I0CA 1UX6A 4Q4W2 4FCAA 4BH9A 3TC8A 1GWKA 3KT1A 4Y20A 2VOXA 1A8MA 4AI3A 1TME1 3NFZA 1Z8XA 1W8WA 1VMHA 4CU8A 3NL1A 4CP9B 4QPGA 2FDJA 3B8GA 1W39A 2A6ZA 3KHXA 3I59A 3VARA 4JKKA 5JIAA 4HSJA 2FE7A 1T6GC 2WNVB 4ZU5A 4CDQC 1RUD1 3MV01 3D7GA 1CN1A 3NV1A 3SXNA 4IV1B 5C4WB 4PLOA 3EC4A 4O9GA 4UW3A 3C7OA 4Z82A 2Q04A 4IERA 2W1UA 3NAPC 2BEIA 1VBB2 5G04L 3OB8A 2ES3A 1LESA 1DDLA 1O4TA 4HKWA 1UU6A 2DCTA 4E8CA 1O8SA 2AH2A 4F8AA 3ZXLA 2JG8A 3VATA 2HWB2 4OMDA 3BIEA 3ZXJA 2PJ2A 3ZYIB 2GZWA 4CRYB 4CDXB 2ZHKA 3T1LA 3CXPA 2E33A 4P08A 2PHWA 4AI2A 4E4DX 1IGBA 2XWBB 3A23A 3D66A 4RFT0 5FZ0A 2R98A 1J3PA 2K2SA 3BU0A 2WO1A 1BEV3 2ZEWA 4QM8A 3B3CA 3MF6A 4OIDA 5JXHA 2OA2A 4S2GA 1UW8A 2JEWA 4ZONA 5IVEA 2Y0OA 1VRH2 1A34A 2WFPA 4MFLA 2PYTA 2Y0MA 4NGMA 4AOCA 3THCA 2WL1A 4KBBA 2MEV2 4YVWA 3JUWA 5HCBA 4LKDA 1W8TA 3K9UA 1UU4A 3VBSA 1WLWA 4UAPA 3MUZ1 1OLMA 1PNGA 2PJ0A 1AR63 1S0BA 4UWJA 5F5QA 5K8NA 3UKTA 4INDA 2RDQA 4IEOA 3IAPA 3KWVA 5L9VA 1WW4A 2IVIB 1UAIA 3R9FA 4IW3A 3WDYA 2X29A 1VBB1 1UYZA 4MFQA 5F3IA 2HEVF 1GQHA 5DABA 2Y64A 2ET7A 3N36A 3K2KA 4I49A 1DGWX 2QQKA 2R1BA 1F2PA 4KWLA 3O0XA 4PI0A 2XJSA 4YLZA 5JR2A 4CPAA 3NWKA 4EJRA 3GNEA 4HXCA 3WC7A 2VCAA 2VGDA 1IICA 4OCTA 3FHIB 2X10A 4PHZA 2PQSA 1QSNA 4X2TA 1MQTC 1ZRIA 3RWKX 1VBA3 2OQ7A 1QQP2 4XHBA 2ZEXA 4CCMA 4M0NA 5GM0A 1CESA 2CL2A 4OHVA 3GYAA 1RINA 4G3YC 1KZFA 3LIGA 2W0XA 2TBVA 1TMF3 4YW6A 2FCTA 1RIRA 5F48A 3EXUA 2R7HA 1Y0YA 3IEHA 4ARYA 2PXJA 1XRUA 2ZEZA 3MI8A 3VBOA 1Z0HA 3ZSEA 3P2FA 3H8OA 2WLPA 2I45A 3CF6E 4HG6B 5EC4A 2ZEFA 5KHGA 5C82A 4QC6A 2EK9A 3IAQA 3DR8A 1Q7LA 5C3OA 3IMNA 2RJ2A 2ZZQA 4BD9A 4IE7A 1ULEA 5FZIA 1QJX2 4EN8B 3R05A 3FBYA 3DR6A 5BNOA 1YCIA 1UU5A 2C6GA 5FY9A 1CVNA 4BM8A 1SDWA 5DPNA 4AVVA 1RXFA 2PJ1A 5FUNA 4UF4A 1Y43B 2W9XA 4YZ5A 1OLME 3HQXA 4AQSA 4DXRA 1GSLA 2QNKA 2WZPP 1K4JA 2YNCA 4LNVA 3INAA 3I8TA 2RR13 1GU3A 3I2FA 1U5YA 4MHUA 1K5MA 1ULCA 1POV1 1QQP1 3TOJA 3S30A 5EBVA 3LF7A 5A6YA 3D8PA 4D69A 5EMIA 1UL9A 1MJ9A 5IK7A 3WG1A 1GYTA 1M4WA 4PBPA 2WYRA 3W5MA 1RUE3 1DU3D 1OT5A 2BUKA 4GWNA 3ZFGB 2HLEA 4DJLA 2D6PA 1M1DA 2ODFA 4BQ5A 2RS52 5JPNB 2A3XA 1KJRA 4JXRA 5LEJA 5L7OB 4HFSA 1XJOA 1ZO0A 1W9TA 2KM2A 1DLLA 1V9U3 2VOWA 1QOOA 4NHXA 4ONUA 3M7AA 5FV3A 1Y9WA 1SPPA 4CYNA 3SHRA 1VBC3 4PCRA 1QJX1 4FBEA 2VNGA 1ZVFA 3HVDA 1JOBA 3ECQA 2VXJA 3B94A 3WDTA 4CDWB 2VBPA 4XF1A 3E1F1 4DRRA 2GU2A 4Y1XA 4WM7A 3AMMA 3THDA 2QQWA 2HH9A 3HBZA 1YUDA 1EUTA 5FYHA 5GLZA 3RJRA 3VZKA 2VQUA 4URAA 4OI1A 3RS6A 3LEMA 3K2OA 1C5HA 3HT2A 3KQZA 4R3LA 3GZEA 3BPZA 3B3VA 2W94A 3OEAA 4NPMA 3ZN4A 1APNA 1OA2A 2EXIA 4HSLA 5J1XA 4F7ZA 2ZAHA 2Q0AA 5C70A 2D3PA 4R6TA 4ZS3A 3RWNA 2VY0A 2AC1A 2Y6JA 1BJQA 5FYTA 3PFEA 3NAPB 1U0AA 2LALA 5BXXA 1RXTA 2RV9A 5J1QA 4Y1ZA 3DDDA 1PGSA 3FLTA 2R30A 1PO23 3TO6A 2VQAA 1NA1C 4FP2A 1O3SA 2RS51 2RMU2 1Y0RA 1DF0A 3AKTA 4NGTA 3NJYA 1L7LA 2ZW7A 3P5BA 3THTA 4EN9B 1EAH3 4LBNA 3ACLA 3NNGA 4CU9A 2EAAA 2GNMA 1VHOA 4E2AA 4Y4RA 4KL1A 5CNAA 2Z69A 1W6OB 3J26N 1QSRA 2WT0A 5FY8A 2Y26A 3USSA 3PB7X 1QXPA 2QQVA 1JUIA 1VMFA 5EYXA 4QX0A 1KGYA 3ZXGA 4FOVA 3URFA 1REEA 3IMMA 2XLGA 3H3UA 4PK2A 4QKDA 5LYFA 5CZKA 3KL9A 4LHLA 3H1MA 4B11A 5A1LA 4RGGA 1J58A 4IDZA 4AFDA 1C5IA 3WP6A 2I2SA 1ODNA 2WWJA 3VZNA 4AI9A 3H7YA 4HBNA 4Z8BA 3WT4A 1OVPA 5FJKA 3AZYA 4MHZA 5FMOS 3BOWA 2WZ8A 4A38A 4ASMB 1I1EA 2XDVA 5A6QA 4CP2A 5J8FA 3ZYHA 3CBNA 1NX9A 5DQ0A 5H9QA 1YJKA 3J8F3 4FFIA 4B4QA 3BGAA 3QAYA 1GNYA 1H9PA 3W91A 2RMU1 5I8YA 3U0ZA 1PIV3 2GMEA 1D4VB 2PJ9A 2XJQA 1YNAA 4X3RA 1H2MA 1F15A 3HD8B 2D5HA 4R4ZA 1SFYA 2CY6A 4IUSA 4EN6B 1ZYBA 1IPSA 1OQ1A 5FAXA 2HV2A 1MQTB 3AFGA 2IXJA 4J1XA 3OY8A 3JQXA 1YO8A 1Y7BA 3V8IA 2QUOA 4HVOA 1CPMA 4N7UA 1Z8WA 1PCAA 1NZIA 2JLMA 1CAVB 2ZOGA 4LULA 2JIGA 2PJ4A 4LO8A 5H9PA 1TQ5A 3VB9A 1W2TA 5D1IA 4L99A 1MACA 1HN1A 2QFEA 1H8VA 5LWBA 2PJ5A 4COUA 4RN7A 5K0UC 2ENRA 2NMNA 2ZMLA 1LGBA 2D4PA 1SLBA 3IWEA 5FXWA 2BQPA 1W8UA 3UK9A 1AYN2 4RS5C 1GBGA 4AAPA 4JC1A 2CGPA 1OMIA 1IOFA 4UEEA 5A7OA 2HWE2 3CJIB 3PVBB 5SV8A 2KCWA 2VCBA 3GZAA 3I2JA 1WCSA 4CCDA 1HB1A 4KG8A 2JJ6A 3SLIA 2ZTNA 3I3EA 1CG2A 4NVPA 2YMZA 4BYYA 1PX3A 4KBZA 4MV2A 3MFCA 4TXWA 3UNPA 3HN1A 5FPAA 3R9GA 4IGPA 4EYUA 4KS9A 3VKMA 1H8TA 4K8RB 4PXDA 4UEZA 4AXVA 1RUG3 3AVRA 4QX1A 2WLQA 4L92A 5IAVA 4WVZA 3WQ7A 3VBUA 1D2SA 2WS93 4Q7AA 3N35A 4XXPA 4MFPA 5JSRA 2CAVA 2CNSA 3QOPA 4BIFA 2NLRA 3LA2A 4AG4A 1B35C 3D7FA 5FYSA 1XPWA 2XMLA 3C7FA 5FP3A 3FNCA 2BPA2 2IQ6A 1ULDA 2RHPA 2HBTA 4UCNA 5ACA3 1JYXA 3RZZA 3FFQA 3OPWA 4P9JA 4RUHA 1DCSA 1VR3A 4D0QA 2WA3A 4FPKA 5CFDB 1QSOA 1N1SA 2XEJA 1VPHA 2YGMA 2PIYA 5K8OA 5C33A 3GIUA 3OPZA 1HRV2 1RMU1 1IS5A 1PHMA 4N8MA 4B5PB 1LOKA 4HVRA 2G9DA 4CUCA 1YYNA 2DCKA 5J96B 1KDMA 1QGLA 3PJQA 2HWE1 4KI5M 5FVJA 3M3OA 1NG0A 3PUSA 2NM1A 5AGEA 2JDKA 4A39A 4M01A 1VBE2 2OW4A 3H3ZA 1CIYA 3IU2A 2DVDA 4OC0A 4MRIA 1HJGA 3FVLA 1IPJA 4XZUG 3V0AB 4U5YA 5FPVA 3WDVA 2HEYF 3PRTA 1V0AA 1S7LA 4UFIA 4MXUA 5C5UA 4FVVA 4Z07A 2XJVA 3IU1A 4N90A 1W99A 4P4DA 2YHJA 5GZEA 1JYVA 3NQHA 2JDUA 1CR7A 3B2YA 2RS12 3LZZA 4MOAA 2R072 2HWC2 1OQEA 4KWKA 1CX8A 3AKQA 1RYYA 2D97A 4L97A 1YQEA 5FO7B 1L0CA 3BTXA 2P6FA 3VD7A 3ZR5A 5HV0A 4M3CB 1ZREA 4N9IA 4RHV3 1FOD2 1IG3A 2VCCA 4EWTA 5DAPA 1NZCA 1WLTA 1NAEA 2X5IC 1YFYA 3O1OA 2PTMA 1MEC1 2WWSA 3MPPG 3D7HA 5FZCA 2DYCA 3D2PA 4PDWC 1HRV1 3GXUA 2C6SA 4UBRA 3AP9A 3P1IA 4O9EA 3VGIA 4ISRA 4PIYA 3MF9A 2E7QA 2PJ7A 4CGMA 3ZFEC 1K3IA 1R43A 1VBE1 3NV4A 4OC5A 1FMD2 4UBGA 2XQRA 3C7HA 1DTDA 1VBD1 2CF4A 5A7WA 5F49A 4FUUA 1UPSA 4XAEA 4YVSA 4XBQA 3L9JT 3H8UA 1T6BX 2RG4A 1XNDA 1H2KA 1S2KA 2YC0A 2Q51A 4K8FA 5T54A 1W8NA 4OC4A 4FPGA 2YPJA 4CXXA 2ZA9A 2XR4A 3POFA 2RS11 3ZSLA 2R071 2HWC1 4QM9A 3RZLA 2PIZA 3R4UA 1DQ0A 5F5IA 5FZOB 2ATFA 1ZBE3 3HNYM 1AL22 3CZJA 3C2UA 4IE0A 5JCTA 1PGL2 1FOD1 2ZEEA 5JDBA 1JS9A 3W5NA 2FT0A 3KHBA 1OKQA 4EFDA 2BNOA 3WV6A 3D68A 4DY3A 1LENA 4BXFA 4IV3C 5JR7B 2XB6C 1GWMA 3VV1A 1BVVA 5EJZB 3ZYFA 1HV1A 3S7IA 4CGOA 1LFWA 2GC2A 2J1TA 3PZJA 3ENRA 2XWJB 2Y8KA 2OR4A 4HVQA 4XPLA 2R062 5J7MA 4META 1UY1A 5L9RA 3OGJA 1OKOA 1FMD1 1OURA 4DUXA 4DNYA 3KV4A 4IEQA 5LCWL 4YPJA 2D6OX 2NYQA 3SEEA 3AZXA 2VQTA 2GE3A 3BIWE 2D7FA 1N3QA 5DUWA 1YFXA 5EP9A 2PLV3 1CAXA 4XNHC 1NCQC 2ZZJA 5FZMA 5K0UB 1W6QA 3SCFA 4TN7A 1HQNA 4XTMA 1M4DA 2B7YA 3AL6A 5SV5A 4JQRA 5IVYA 3SJXA 1AL21 2IUWA 3ES4A 2UURA 4RA0A 2DVBA 4RS5B 3AP5A 4FPCA 3RYKA 3VHPA 3TTHA 3U78A 2GIVA 1LHWA 3WP3A 4CDUC 4NIHA 4PSWA 3PLQA 4IQPA 3T4VA 5C7GA 1EP0A 2EAKA 3IFEA 4NO4A 4XC9A 3TAYA 1QJY2 2Y0IA 2JX9A 2LS6A 1UIJA 2F5IA 4LQRA 5KHIA 2DTWA 1LOBA 4QHOA 1NSLA 5HI0A 5F2SA 4XACA 3ZFFC 4NUBA 1HX6A 3ZN5A 2YY1A 1C57A 3JXSA 2EXKA 2JICA 3M8LA 5IVCA 2VUAA 1YMEA 3PEIA 5CG9A 4N43B 3NNFA 1W2AX 3WR0A 1S2EA 3M3CA 1B35B 4A7YA 4AQ6A 2DWRA 4W6XA 4YGCA 2BNMA 2BVBA 4NCZA 4M4RA 3KSCA 4Q0UA 1XOYA 3LEKA 5J3UA 4QAWA 1S5KA 5LA0A 1GYKA 5J36A 2EVNA 3VDBA 2FQPA 2Y6HA 1JYIA 4AFBA 3BU7A 3K4DA 2PN5A 5KXBA 3W6XA 3HLPA 1CIWA 4ZKTB 3MRUA 4ZZ5A 4UW6A 2PRQA 2BERA 4E4HA 2ZX0A 4JQTA 2W5FA 4RL7A 4F0YA 2P6HA 3AXDA 4SBVA 3VBFA 4RFRB 3SI2A 2AREA 3PDQA 4F8ZA 3E6CC 2VZYA 1OOPA 1R082 1VAMA 5I0SA 2VG9A 3LACA 3VZOA 1ULPA 1MS9A 4CAFA 4CAWA 1QJY1 3KT4A 1A6CA 3B69A 4QD2A 1S0CA 3IDBB 1GP6A 2A6VA 1IU8A 2ABZA 3WZ1A 1L7QA 3VHOA 2DTYA 4M00A 2AFWA 2VM9A 3PIGA 2GMPA 4CCEA 2VW2A 5BYNA 3ZX7A 1W6NA 1BMV2 3D3SA 2Z2SB 1UOJA 2O1QA 3K4ZA 3CU7A 5I8SA 2J22A 4MXVA 2VZOA 3VUOA 4C0HA 4MBUA 1UWYA 1AYM2 4C1XA 5DUXA 3D4KA 4KOWA 1QHDA 3KQXA 2W1QA 4W9YA 2D3SA 1OVSA 4GMP1 5LZ6A 2WAOA 5ISLA 1ASJ1 4P9XA 3RVHA 3NH4A 1Q8QA 2X5IB 4C8DA 5JI7A 4MGSA 1S2BA 4P00B 1JXNA 2YFUA 1G9DA 2WWUA 2D3RA 2ZAAA 4CEWA 1BBT2 3RI8A 1REFA 5CFCA 4PDWB 2A7AA 2VMEA 4PT6A 4QBJA 3I97A 5JXJA 1S0IA 4Y5TA 2VXRA 1TKJA 2ZKNA 4AFMA 3BTAA 4P02B 5IK4A 5C8CA 4ZX9A 1BYHA 2RFHA 3MUY1 3ZFEB 5FZ6A 4MXWB 2JBJA 1R081 1X7NA 1G6NA 3VH9A 4K20A 3VKFC 4E4ZA 3SXWA 2R7EB 4XUOA 2C26A 5C5TA 1NQDA 3WG3A 2CGOA 4ZU4A 5FZ9A 1IKPA 3RO0A 2J1SA 3LD2A 4FQZA 5EYYA 3MN8A 3HEIA 4Y24A 4R4XA 4D94A 4NGSA 2ID4A 4J1WA 3P3PA 3IZOA 1SG3A 2J1UA 2VZZA 4E9KA 4P14A 1BMV1 3F5BA 3GBFA 4BMHA 3GCXA 4LPLA 1ULFA 2FBEA 1WA6X 1PU9A 2FDKA 5DN2A 3WLUA 4Q5OA 1AYM1 3WF2A 1ZRFA 1RJ8A 1LNSA 3NJXA 2ADDA 4LITA 2H5MA 4XDPA 5C3RA 3SJGA 5LA2A 2QVPA 2YZ4A 3MBWA 3I3BA 5CKMA 4AFAA 1MS3A 5F47A 1JZ2A 1GOFA 4LKEA 2O8QA 2V4AA 1LEDA 1UMIA 1BBT1 1ALYA 4IV3B 2FCUA 2C0ZA 4MY0A 3IB3A 4GJYA 4ASLA 5L19A 2EO8A 1S0JA 1WBFA 1F5FA 1W2OA 4YYOA 4ZXKA 2R32A 4ZU7A 1JU4A 4JZ0A 5BY5A 5JVVA 4X6RB 5AG4A 1RHI3 2A6XA 5JSPA 4AVCA 3Q8EA 3PIJA 3KZ4C 2XLAA 1WBLA 5LRKA 4CA9A 4UFMA 3APBA 2KA3A 4ES8A 4H2KA 3LIHA 1EV13 1UOBA 3POWA 1NXMA 5FXZA 2YU1A 4X8IA 2XOMA 5BNNB 1YLOA 4QX3A 3GUXA 3D82A 2Q43A 5J48A 4XNHB 4JDOA 1NCQB 3MW4A 3R0RA 1BEV2 1OFNA 2QZ2A 1YW4A 3SI0A 5A3OA 3HOBA 5FP7A 1KWMA 2XVGA 4Q4Y3 4LE3A 2AGSA 4IK2A 2PCUA 1ZZ9A 1GV9A 1ND3A 3VBRC 3FLRA 4JGZC 3B3WA 1N3OA 2W91A 3H8XA 5LY1A 3B9CA 4L9BA 1JODA 5DAWA 4QHBA 1QOTA 1MS5A 2Y6LA 3UYJA 5DWNA 2IFWA 4XVHA 3N5FA 4CDUB 3QCWA 3M70A 2BRTA 4JX0A 1AR62 2O0OA 3SKJE 1RITA 1R57A 1W2NA 2JD4A 3AJYA 3N9NA 2YNEA 2AFMA 4OULA 4D6RA 1TKFA 2W2IA 1VAKA 2I79A 2VQYA 2JE8A 2V8DA 4BIOA 2GLFA 2MNGA 3MW3A 3ZFFB 2BDRA 3S5QA 2WIIB 5FCCA 1H4HA 2F6BA 2OB0A 1IYLA 2J8MA 4TTGA 5DZFA 4JWPA 5FTTC 1V6JA 5DAXA 1PMIA 4JRAA 3FUOA 2A6YA 4L89A 4EV0A 2TUNA 5JOYA 4TNUA 1FPN3 1QU0A 3D7DA 1UFHA 2WNEA 1DQ4A 2K9ZA 2F4PA 4XFFA 1Y7EA 5EFUA 2VBQA 5JXIA 2ZXQA 4QX7A 2ZGNA 3SJEA 1VBA2 3GCWA 1J1LA 1EY2A 1SBEA 2ZBJA 1BEV1 5FZ7A 3KGLA 4A94A 4MCSA 4LJHA 3U07A 2B9VA 4N7IA 4EROA 1TMF2 3RZJA 4LOTA 2R0HA 4D7YA 2PJCA 2WNOA 3O12A 3U4SA 1HN0A 4GXLA 3PBBA 4UA3A 3MZHA 1KJLA 3ST7A 1RMU3 4NHYA 3ZYRA 4MO3M 4BLJA 5ABJA 1F35A 3M2MA 2ZX3A 2QIRA 1AR61 1VE0A 1ELLP 2EICA 2DU0A 1XQNA 2I3CA 3ME2A 4PI2A 3R4SA 1W05A 3UJOA 5A33A 2GP5A 4GULA 3SCGA 2GU9A 1AX2A 2AEYA 4NSQA 4XAAA 3BLNA 1YQ8A 4Z2WA 5JM6A 1BZWA 4AHWA 1UWWA 3VDDC 3DXTA 4C2ZA 2JENA 3OG2A 4EN7B 5T5JA 2J1VA 4XMAA 3DYPA 4DEVA 2YB7A 3N7MA 4MGZE 1F31A 1XJAA 2CWMA 2RR12 3ZR6A 1OPOA 5A6ZA 1VBA1 5I0TA 2HC9A 4EQVA 2HQYA 2LUWA 4D3WA 5C3SA 5IFTA 4DNCA 1OUXA 4CP9A 2CNTA 4CEYC 2VMHA 2BGPA 2P3YA 4IHMA 4ONWA 4OC2A 2LM3A 2WNVA 2B4DA 3ILNA 4EZ4A 1RUE2 1MEC3 4NE9A 1HQLA 4IV1A 5BNPC 5C4WA 5HH1A 5CKNA 4JHZA 1HRV3 4GH4B 3VL8A 1NCRC 3S6KA 3FEDA 2D5FA 4ZY2A 2Q0YA 4QX2A 3K4AA 3T2OA 5FWJA 1P4NA 2JDMA 2WO3A 2D98A 4GQ7A 4Q1PA 1DZTA 5FBJA 1H0BA 4NHMA 4B29A 5JGFA 4E2GA 2ZCWA 1QJU3 4AVSA 4PXCA 1VBC2 3H0OA 4NHKA 4CDXA 5LBBA 1VBD3 1A3KA 3CKHA 1JWQA 4CYPA 2OX0A 2ZW5A 4FPFA 1JZ8A 4QQHA 5GLTA 3VWDA 2XUEA 3GHMA 4XOGA 5FKCA 4XFAA 4GWMA 5KHKA 1O4ZA 1CAUB 4QPYA 5JPHA 1FV2A 2OZGA 2RR11 4IEXA 4A6OA 1XMTA 5G21A 4KSFA 1W0OA 1H1MA 4W6YA 5CISA 4D8MA 2JKXA 4FPHA 3AMPA 4LO5B 3PNAA 3VZLA 1S0FA 3OYWB 4JDNA 2E9QA 2CV6A 2PDOA 5CNPA 3WC6A 4OVEA 3LCPA 4L11A 1RUE1 2ZGMA 2HEWF 1LOFC 2FSRA 3T30A 3ZJ0A 3N7KA 3T0AA 5G05L 1ZNPA 1QSMA 1PO22 4DQAA 4AFCA 1VLNA 4LEJA 3GBGA 1RGSA 2ARCA 4A2UA 2QE3A 5AC93 5DDJ2 4YWAA 4LO6B 1EAH2 1WGPA 1RUC1 2EBJA 4AK3A 2BBAA 3EHKA 3AKSA 3CNAA 1FNZA 4COZA 5I91A 4Q4V3 5T50A 5JZGC 2NMTA 4NGQA 4GALA 1LU2A 1RUF1 4DUKA 1VMJA 1VBC1 2YDEA 1RJ7A 2CU5A 4QB9A 3R4DB 3WCSA 3ZIWA 2X09A 4CAVA 2WYFA 3KR5A 4WWVA 4P4BA 1QNWA 3NE7A 4NHLA 2D40A 4IE5A 2WAAA 1BO4A 3TX8A 3VBRB 2ZKLA 4JGZB 3ACIA 3U14A 3I1UA 4MJ8A 3B5LB 4CUBA 5DG1A 2ZMKA 3H9AA 4LMFA 1UIKA 3ILFA 3H8EA 5K7PA 1UKGA 4XABA 3POSA 3FC0A 1BK1A 3CPAA 2P0WA 2WNVC 2L9LA 1XNAA 1XYPA 1UX7A 3U75A 5CKQA 5THWA 3ASIA 3J8F2 3ZPOA 1PO21 5FZEA 2V09A 3V56A 4OLLA 2Q44A 1PIV2 1U5IA 3NSTA 5DDJ1 2DUQA 3GZUC 2UY9A 1EAH1 1E5HA 1ST8A 4AWDA 4BK5A 3N9QA 3RMYA 2QQOA 3KF5A 2VU9A 1YJLA 2WPWA 2ZGLA 4XDOA 3W20A 1XF8A 4LK6A 3D6EA 3WW2A 3OUIA 2P2KA 3GKRA 1VB4A 1CP6A 3RZKA 4NWWA 5F1RA 5H84A 1KS5A 3TN93 3OBZA 4PQAA 4AEDC 4YRHA 1VB2A 3D3AA 3OCPA 1QF3A 2AFZA 5IATA 1Z4RA 3KT7A 2GLJA 3WW4A 1UZZA 2CAUA 5LRGA 3USUB 2GC3A 2PHRA 4IEYA 3I3QA 4NIIA 1BLLE 1AMPA 4YW7A 2FIAA 3ZFGA 3ROUA 4C0BA 3OUJA 4B12A 2VOVA 1RUJ3 1KRIA 3IWZA 1XU1A 3KKWA 3U10A 3V38A 2J7MA 4DRVA 5C9AC 3GJAA 2C24A 5L7OA 5HVGA 2VNOA 2VMFA 1F4HA 2P6EA 2OUHA 5IHRA 4LHKA 1J83A 4M4PA 5EWSA 4BISA 1CPSA 1MZEA 2XLFA 4XBLA 1PIV1 2D4OA 3VDDB 4HK8A 2JBKA 3LDRA 1QMJA 5FYUA 3DKWA 4CDWA 3R95A 1X82A 3OOXA 5F32A 1RUG2 3O0VA 2VECA 5ANQA 5E96A 2E32A 3FJUA 5FLIA 2WS92 4EVYA 5LATA 3U11A 3EYPA 1ON0A 1AR73 4P45A 5GLWA 4XUPA 3RI9A 2R6QA 2AJ6A 2WSAA 3UV9A 4EZHA 4P10A 1C4RA 4GMP3 1ASJ3 1AUGA 4MGTA 4CDQA 5ACA2 2XPJA 1BVP1 4ZGYB 3RDIA 2WNUC 5BNPB 5ISVA 4AB7A 4UT5A 1GKBA 5JOXA 4GKXA 1NCRB 3NAPA 4AGGA 3UGGA 1W04A 4IGQA 3NJZA 3RZMA 3DN7A 2D44A 3J7LA 2ZHNA 2VE1A 1WLCA 6CPAA 3WQ0A 5FLJA 1VIWB 1JU3A 1QDCA 5A28A 5LYIA 1LCPA 4LXLA 1TF9A 4MGQA 4GB31 5DZGA 5I0UA 1OA4A 3EY5A 1GZCA 5AG6A 4HNYB 4IUGA 4XF9A 4NIGA 3RYRA 4ASKA 1W6OA 2MHFA 3WF4A 3UKVA 2IZWA 5F3EA 3HQUA 4HPSA 3WDXA 3MO4A 2IFRA 1GNZA 4Y33A 5I0DA 4I0BA 3JTKA 3KV6A 4B5OA 3B3QE 2VNVA 1R1ZA 4EN0A 2C9KA 4C90A 2H0BA 3TWIA 1RUG1 4F3JA 3BB6A 4XJ9A 1JZ3A 1IKQA 3K9TA 1AXZA 5DG2A 2WS91 1M06G 5BNQA 4COVA 4HETA 4XPKA 1CPNA 1B6BA 4R7MA 3C7EA 1RB8G 1CJWA 3KQRA 1DP0A 4Q4X1 1TXRA 1KD7A 3RRDA 2V77A 5D8AB 4PLNA 1Y4WA 3DEMA 5AG7A 1HLCA 5ACA1 1FV3A 2CHHA 3TYJA 5KBFA 3Q9OA 1W9WA 4RHV2 3OGGA 5L9BA 3J4UH 4P4FA 1NLQA 1KITA 1YW6A 2RVAA 1JZ7A 4Q0SA 4OMCA 1PZ8A 2BEOA 4QKFA 2H0VA 5L36A 3ACGA 2WINB 3VD3A 1AVBA 4W4ZA 2VNRA 5JZGB 2Y6FA 3PP9A 2JB8A 2J1EA 4AF9A 3UL2A 1IG0A 3OGRA 2ZW6A 3T4HB 3LOIA 2WSVA 3A21A 2AUYA 2ET1A 3B9IA 3KCCA 5E6HA 1O59A 3WEZA 2A5ZA 4CCKA 4NGPA 4NGRA 2WN3A 1MQTA 2XBO3 2V5YA 1JOPA 1RO5A 2QQIA 1I6XA 1WWYA 4GAZA 3G8WA 4FFHA 4P9IA 2WZEA 1OBNA 2HWF3 4MYEA 5M0TA 2CSGA 2OZUA 4QX8A 1CAVA 3WNNA 4KUBA 3NW4A 3NJVA 1VGYA 2K46A 3NA6A 4OZOA 2BBVA 4O23A 1CD3G 3IIAA 1UZYA 1QXJA 5FQ0B 4AQTA 2CTBA 1ZBE2 4OAEA 2DFBA 2VTXA 1O8PA 4AHXA 3T9YA 5LYLA 2D43A 1POV0 1PM4A 1FY7A 3BOPA 2Q8DA 3M3IA 3O1UA 3FN9A 5FY0A 4LKSA 4RHV1 1F57A 2P3KA 1XBUA 5I8TA 4LR4A 5C3PA 4NWVA 3V64A 2BU9A 1IS6A 4X5KA 5KC6A 1IS4A 1Y9QA 4P9YA 2YGLA 4PLMA 5T5OA 2CYFA 4XW3A 4BINA 4YG6A 2VBBA 1LECA 3LOBA 3ZKUA 1Y9MA 1FT7A 1H1IA 4EWEA 4YG3A 3GJBA 3DUIA 5FR3A 3RGBA 3V0BB 3A7QA 4NR1A 2RE9A 4ZBGA 1ZZ7A 4BDVB 3KV5A 4IETA 4AEDB 4Q0PA 4COWA 4V1PA 4P6YA 3TOAA 4XCBA 3LQCA 2VBDA 5A1AA 1X9PA 2PLV2 4BQ1A 4PF1A 4JD6A 4NGNA 4XFHA 2ZGPA 4NJ4A 4LO4B 1YVOA 4Z92B 1H30A 1ENQA 1WWZA 5IVVA 1GLHA 3MLLA 1ZBE1 5CFDA 2EVXA 4IE6A 1H6XA 1SCRA 1KQRA 4OMEA 4H2AA 4AI0A 2XEGA 5C9AB 4PV6A 4MUVA 1YR0A 1BLZA 4YM1A 3LD8A 3LA7A 4XXAA 1YQ6A 2EIDA 4B5PA 1J1TA 3N3HA 3B3SA 2EIEA 3T2TA 1E5IA 3W21A 4L0PA 4ES9A 1C8NA 5HMNA 2HBUA 3D2MA 1CX1A 1UYYA 5FXVA 4RQPC 3D67A 1J4JA 1GZWB 3K3NA 2JEMA 3NVCA 3WNOA 2GFQA 3GHNA 4C1WA 3K3OA 3AZWA 4K30A 3NKGA 2B5GB 3NV3A 1Z9UA 3V0AA 2FZ2A 3AYCA 4YW5A 2VULA 5KR7A 1DG6A 2ZPAA 2VPVA 2LRPA 4LO7A 1ZM1A 4Y1VA 1CJDA 5I0RA 3R9EA 2Z42A 3OJBA 4KSIA 2E53A 4AW7A 2VMCA 4AVBA 1JQGA 4DYOA 1XOVA 1B87A 2DEAA 4LBKA 2PLV1 5FMOL 4NRPA 2DVGA 3O1RA 1LANA 2WNUB 1OF4A 3MW2A 1JHNA 3MLKA 1CZSA 3JBG3 4CXWA 1Y9GA 4QDSA 4B1MA 3PB6X 3IT8A 1GNHA 2BUEA 4M3CA 3RAMA 1M4LA 1DGWA 1LAPA 1KS4A 4UIBA 1ARLA 2F7VA 1NA1A 4KOYA 1US2A 5FZAA 4MGIE 1J3QA 1IOAA 5FO9B 3AB0A 2REFA 4QQOA 2ARHA 3AC0A 2OPWA 5A80A 3ON7A 3ISXA 1D4M3 1WKYA 4YGDA 5GLVA 4J3GA 2EXHA 3CJIC 5EHDA 5A7QA 5FFOC 4LT5A 3WUDA 4Q0QA 4JTNA 2TNFA 2V72A 4JAAA 1YI9A 2VUCA 1SMVA 2VZTA 4CU7A 4BWOA 2XJPA 5H9SA 4MHDA 3ZYGA 5CEHA 3P3NA 3J7HA 5LASA 1QIQA 2FCVA 1J84A 3DECA 4RR3C 3JD73 3DCQA 4DS0A 4NXYA 1JYCA 3D0SA 1RUI3 4MADA 1G9AA 5DXDA 4BK4A 2V4VA 1YLEA 3KB5A 3MGUA 4JKLA 2KXLA 2ZENA 3H3LA 4XILA 2ZPXA 4OKOA 4JGYC 3POGA 4YM3A 4FTEA 1CQ9A 5FZOA 2ZEYA 2DFCA 2OZ6A 4QPIB 2UWAA 4ZPIA 1RUH1 2CDPA 4FSJA 2WA4A 2W08A 4XETA 4IAVA 2WQ4A 1FATA 1NUKA 1ZBA3 3VD5A 4LBQB 4H7LA 4QKNA 5HXVA 5D21A 1S7KA 4HKFA 5FPBA 2GREA 1AR93 2AE6A 5CFDC 4OI0A 4SLIA 3KQ4B 4M3CF 4XJZA 1MR5A 1AX0A 4KOUA 4Q36A 4FPLA 2WYSA 3BHXA 2P3JA 4GWIA 2WBKA 2Q4VA 2ZOFA 3CPXA 3AMHA 1IZ3A 2H6BA 1RUC3 5EQUA 5GLUA 2QQUA 2B9UA 3DYOA 1S7FA 1WK4A 1RUF3 3R6SA 2J1AA 3WCRA 4OUMA 2WSUA 1NQJA 1FNOA 5C88A 4M3CE 4E0AA 4WM8C 4XDQA 3ZMNA 3BYWA 2P37A 1GHEA 1WMEA 5JSOA 1TNFA 2E7AA 5FYZA 1LOAA 4RGKA 1O6UA 2ZOEB 5FXXA 2PSWA 1YWKA 4PK3A 2XGXA 3IO1A 1ZLIA 5A3NA 4F6AA 1OH4A 4XHXA 3KVBA 1OD5A 5K0UA 1AJOA 4A41A 4ZY0A 3FYNA 1N47A 5C6CA 2PMWB 3VDAA 4JRLA 4Y22B 3FJSA 2NN8A 2PHLA 4URTA 3D4UA 4RYDA
chains in the Genus database with same CATH topology
5KTAA 1AR91 1UX6A 4RS5A 3X29B 2HYKA 2JXAA 4Q4W2 3WLUA 3VKOA 1R1A3 3MIEA 1RC6A 4J6GA 4C2XA 3WQ1A 5K8SA 1AYM1 4FCAA 2CNMA 4BH9A 1ZRFA 1RJ8A 3MLJA 2Q4YA 4XTPA 3WG4A 2H5MA 4NEXA 3KT1A 4CYDA 4Y20A 2NP0A 2VOXA 3H7JA 4Q4W3 1A8MA 2YZ4A 4OFGA 1YRZA 1XEBA 4AI3A 1H8TC 1KUYA 1GZ9A 4YGEA 4AFAA 1TME1 2JDZA 4B4PA 1PK6C 1GZWA 1MS3A 5F47A 1TNRA 4OHYA 2VQ0A 2WSAA 3NL1A 4P5HA 2EIGA 2O8QA 4R9DA 2OIIA 4U2AA 4JXQA 1LEDA 4QPGA 2DVAA 3MICA 3B8GA 3VBUC 1W39A 2A6ZA 3I59A 4IEPA 5DDJ3 3QB8A 1BBT1 1ALYA 4IV3B 3FLPA 3I3GA 4KOTA 4YSFA 1K5MB 5JIAA 2B5GA 2TEPA 4HSJA 2C0ZA 2FE7A 1T6GC 4MY0A 2GN7A 5KXCA 2WNVB 1QWRA 4ASLA 5L19A 4XZPA 4ZU5A 4CDQC 1RUD1 1JTZX 1RHI2 4PBOA 4IEVA 1S0JA 4HNXB 1WBFA 1CN1A 1F5FA 3NV1A 4YYOA 1Z78A 3SXNA 4IV1B 4ZXKA 5C4WB 1JH5A 2R32A 4PLOA 5CVRA 2EF6A 4ZU7A 3EC4A 4O9GA 5BY5A 4UW3A 4AYUA 4WV8A 4Z82A 2Q04A 4IERA 5JVVA 2NMOA 4X6RB 3ZYJB 4CGLA