4MI4A

Crystal structure of spermidine n-acetyltransferase from vibrio cholerae in complex with spermine
Total Genus 54
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
54
sequence length
170
structure length
170
Chain Sequence
NSQLTLRALERGDLRFIHNLNNNRNIMSYWFEEPYESFDELEELYNKHIHDNAERRFVVEDAQKNLIGLVELIEINYIHRSAEFQIIIAPEHQGKGFARTLINRALDYSFTILNLHKIYLHVAVENPKAVHLYEECGFVEEGHLVEEFFINGRYQDVKRMYILQSKYLNR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords Spermidine n1-acetyltransferase
publication title A Novel Polyamine Allosteric Site of SpeG from Vibrio cholerae Is Revealed by Its Dodecameric Structure.
pubmed doi rcsb
source organism Vibrio cholerae o1 biovar el tor
total genus 54
structure length 170
sequence length 170
chains with identical sequence B, C
ec nomenclature ec 2.3.1.57: Diamine N-acetyltransferase.
pdb deposition date 2013-08-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13302 Acetyltransf_3 Acetyltransferase (GNAT) domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.630.30 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Aminopeptidase 4mi4A00
3CXQA 2ARHA 3TFYA 4JWPA 1QSNA 4PK2A 1M4GA 1IIDA 2R1IA 4NEXA 1NMTA 1S7LA 3GYAA 2K5TA 3GY9A 4KOYA 1OZPA 2Z10A 4XNHB 2FIWA 3JVNA 3DSBA 1M4IA 3I9SA 5GCNA 3H4QA 2P0WA 4MI4A 5IX3A 5DWNA 1VKCA 1S3ZA 2OZGA 4XPDB 4AVAA 4AG9A 1XIXA 4ZBGA 4K30A 1N71A 2ZXVA 4RS2A 3P2HA 2ZW6A 2PSWA 5CNPA 1BO4A 1YK3A 1I21A 4KLVA 4FD4A 2EVNA 2QECA 1Z4RA 2VZZA 4R57A 2Z11A 4KUAA 3PGPA 2VEZA 2CNSA 2WPXA 2A4NA 2OZUA 2ZW5A 2B4DB 4EVYA 1S7KA 1XEBA 3MGDA 1B6BA 4B5OA 1LRZA 3TE4A 5C88A 5HMNA 4CAVA 2BEIA 1YLEA 4KUBA 3IGRA 3B8GA 2PRBA 1S7NA 3W91A 4JD6A 3QB8A 2Q4VA 2X7BA 3F5BA 4H89A 5F49A 4CRZB 4R87A 2CNTA 3FNCA 1XMTA 4KOVA 2CY2A 1XE4A 3DR8A 5E96A 2G3TA 3SXNA 4LUAA 2D4PA 2Q7BA 1Q2CA 2FS5A 4KOWA 2R98A 3F0AA 4J3GA 3S6KA 4H6UA 4Y49B 3S6GA 3G3SA 2RC4A 1YGHA 1K4JA 2PQ8A 1M4DA 2P6EA 1Z4EA 2HUZA 3D2MA 4PV6A 2HV2A 3D2PA 2AE6A 4R3KA 4UWIA 5IB0A 2FIAA 2JLMA 3BLNA 4PK3A 4NCZA 4M3SA 4R3LA 2J8MA 3CXPA 2PDOA 2PR8A 3S6FA 4CAWA 2FL4A 3TO6A 4AG7A 4FD7A 4HNWB 5JPHA 4KVME 4B5PA 4ORFA 2G3AA 3W6SA 3S6HA 4XPKA 1RXTA 3D3SA 1V0CA 4OAEA 2P6GA 3R95A 2Y0MA 3BJ7A 2F5IA 4DNCA 1ON0A 5H84A 3FRMA 3R1KA 3E0KA 4MBUA 4CAXA 2WPWA 3W6XA 1QSOA 2Z0ZA 2GANA 5F48A 5I0CA 2CNMA 3VWEA 1MJ9A 1VHSA 4HNYB 4IUSA 4QB9A 2PR1A 3SHPA 1WWZA 3GKRA 3RYOA 5KTDA 4E0AA 4R9MA 3DDDA 3TOAA 1PU9A 4X5KA 4CRYB 2BUEA 2FT0A 4F0YA 1S7FA 1IICA 2B5GA 4AB7A 2C27A 4KOXA 4JXQA 2OB0A 2Q04A 2ZW4A 2HQYA 4MHDA 5IV0A 2B3VA 4QUSA 5J8FA 4MY3A 4QVTA 4GS4A 5JQ4A 2H5MA 1BOBA 3T9YA 4KVXA 1I1DA 4YRHA 1Q2YA 5J8CA 2DXQA 3JUWA 1P4NA 3P2FA 2FCKA 3R9EA 2REEA 1TIQA 1KUVA 4II9A 2I79A 4KZTA 2B58A 4JJXA 1Z9UA 3DNSA 4NSQA 2P6FA 1U6MA 4KOSA 4M85A 3V8IA 4MY0A 2J8NA 4YGOA 4UA3A 2FSRA 2J8RA 1PUAA 3R96A 4OLLA 4KVOE 2QMLA 4U9ZA 5F46A 1I12A 2VBQA 1B87A 2O28A 3PZJA 4JLYA 2BSWA 4KOUA 1P0HA 4UWJA 3I3GA 2NMTA 2AJ6A 2BL1A 4AVBA 2JDCA 4L89A 3SXOA 4QBJA 1FY7A 2PC1A 4MJ8A 2IL4A 3FIXA 4QC6A 1IYKA 3EO4A 3EY5A 2B3UA 5C82A 2OH1A 3TO7A 1YX0A 2ATRA 2EUIA 1GHEA 1WK4A 2VI7A 4I49A 3NE7A 2Q44A 3G8WA 4CS0B 1L0CA 3WR7A 3EFAA 5ISVA 3LODA 4HKFA 2B4DA 1KZFA 1YR0A 3F8KA 5F47A 5KTCA 4PSXA 3VWDA 4HNXB 4YFJA 1UFHA 4XNHC 2ZPAA 1CJWA 1M44A 2GIVA 4L8AA 4F6AA 4B5PB 3FBUA 4XPDC 3TOBA 4NF1A 4BMHA 3TT2A 2R8VA 1YVKA 1KUYA 4H6ZA 4KOTA 4ONUA 3N7ZA 4IF5A 5DWMA 1MJBA 3D8PA 1XF8A 1NE9A 2OU2A 1Y7RA 5H86A 3LD2A 3OWCA 1CM0A 1IYLA 1MK4A 3PP9A 4PSWA 3UY5A 3T90A 4RI1A 4UBRA 3EC4A 3QAHA 3R9FA 5KTAA 1QSRA 2OZHA 4OADA 4E2AA 1KUXA 1J4JA 1YVOA 4FD5A 3IWGA 2D4OA 1QSMA 4NXYA 2Q0YA 4LX9A 3TCVA 1S5KA 3C26A 5EBVA 4AVCA 1QSTA 2B4BA 5HH1A 4KORA 1Q2DA 2JEVA 3TTHA 2QIRA 5FVJA 4FD6A 2B5GB 4XPLA 4E8OA 1IB1E 3BJ8A 2GE3A 2REFA 3DR6A 1NSLA 4U9YA 2FXFA 2KCWA 1Y9KA 2VQYA 2JDDA 3CXSA 4JXRA 3K9UA 3EXNA 3FYNA 2I00A 4U5YA 3KKWA 2VZYA 1S60A 1SQHA 4Y49C 2FE7A 1M1DA 1RO5A 3ZZIA 3TO9A 2Q4YA 1Y9WA 5EC4A 1MJAA 3FB3A 2R7HA 3FXTA 2G0BA 1R57A 2VXKA 3ZJ0A 1YREA 3R9GA 2ZW7A 4KLWA
chains in the Genus database with same CATH superfamily
3BI1A 3CXQA 2ARHA 3K2KA 2EK9A 3TFYA 4A95A 2WSAA 3ISZA 4OKOA 1CP7A 3WC5A 4JWPA 1QSNA 4PK2A 1M4GA 1IIDA 2R1IA 4NEXA 3WT4A 5G21A 1NMTA 5BWAB 1S7LA 3RO0A 3GYAA 2K5TA 3GY9A 4RN7A 2ZEDA 4CYNA 4KOYA 4MFQA 1OZPA 4PQAA 2Z10A 2F7VA 2IMOA 3FJUA 2GLFA 2ZEGA 3SI0A 3D4UA 4XNHB 1R43A 2FIWA 3JVNA 3DSBA 1M4IA 3FECA 3I9SA 1XMBA 4HPSA 5GCNA 3H4QA 2P0WA 1AMPA 2GFQA 4MI4A 2C6GA 1CPXA 1NSAA 2WYRA 1VKCA 5DWNA 5IX3A 1S3ZA 2OZGA 1TKHA 3L2NA 4BD9A 4XPDB 2AFOA 4M6GA 4AVAA 3JTKA 1IGBA 2CF4A 4AG9A 1XIXA 2ZEOA 4C2ZA 4ZBGA 3NE8A 4K30A 4OMEA 1N71A 4R8FA 2ZXVA 4RS2A 3BXMA 2OOTA 5LRJA 3P2HA 2ZW6A 5LYIA 2PSWA 3WABA 4ZYQA 3RBUA 1BAVA 2ANPA 5CNPA 1XFOA 1BO4A 1YK3A 1I21A 4MRIA 4GM5A 4KLVA 3PB8X 2PJCA 4FD4A 2EVNA 2QECA 1Z4RA 4ZI6A 2VZZA 3B3TA 1EE3P 1YSJA 4R57A 2Z11A 4KUAA 4P4BA 3PGPA 4UCPA 2VEZA 2CNSA 4IHMA 3BHXA 2PE3A 2WPXA 2A4NA 2OZUA 2ZW5A 1XBUA 2B4DB 3LWUA 4EVYA 1S7KA 5AG5A 1XEBA 3MGDA 3KR5A 1B6BA 1TF8A 4B5OA 2ZELA 1LRZA 3TE4A 5C88A 5HMNA 3H8FA 4ONWA 4FAIA 4NGQA 1IOIA 4CAVA 2BEIA 1ARMA 1M4LA 1YLEA 4CGOA 4MFPA 4KUBA 3IGRA 3B8GA 2PRBA 1S7NA 4MCSA 4X3RA 3W91A 4JD6A 3QB8A 2Q4VA 2X7BA 3F5BA 4NGRA 2GREA 4H89A 4KS9A 5F49A 3S9LA 2RFHA 4CRZB 4R87A 3NH8A 2CNTA 3SJXA 2BOAA 3FNCA 2F8HA 4NGMA 4FUUA 1XMTA 4KOVA 2PJ4A 2DPTA 1YW4A 2CIJA 2CY2A 3HUVA 1XE4A 3DR8A 2DPSA 4M6IA 4TNUA 3B3SA 5E96A 3VH9A 2G3TA 4R7MA 3SXNA 4A30A 4CGMA 3TX8A 4LUAA 2D4PA 3FEEA 1Q2CA 2Q43A 4MMOA 3QAYA 2Q7BA 2FS5A 3FH4A 1ZLIA 5A28A 1ZO0A 4KOWA 4R76A 4NGSA 4ZY1A 2O4HA 2R98A 3K9TA 4C7IA 5F09A 1ELLP 3F0AA 4J3GA 3S6KA 1XJOA 4H6UA 4UEFA 1VGYA 2PJ0A 3I1UA 3ISXA 4LQ6A 4Y49B 5G20A 3S6GA 2Q4ZA 2Q7SA 2EWBA 3G3SA 2RC4A 3SI1A 1YGHA 1K4JA 1X12A 2PJ7A 2PQ8A 5AGEA 4P4JA 1M4DA 6CPAA 3CT9A 1JWQA 1ZG7A 2P6EA 2BO9A 1Z4EA 2HUZA 1IY7A 3D2MA 3B35A 1QMUA 4PV6A 2HV2A 3D2PA 3PBBA 4CAFA 2AE6A 2AFUA 4R3KA 3B3CA 2GU2A 1Y0RA 4OIDA 4UWIA 4YU9A 5IB0A 5G1ZA 4OC3A 2FIAA 5I4MA 2JLMA 3D66A 1YMEA 3BLNA 4CYOA 4PK3A 4A39A 5ELYA 1YLOA 4NCZA 4M3SA 4R3LA 5LYFA 1R3NA 1VIXA 2WUUA 2J8MA 2OR4A 4ZX8A 2FVGA 2PJ5A 4BINA 3CZXA 2Z3MA 4B10A 4EMEA 3FX6A 3CXPA 4W9YA 4OC4A 5D8NA 5LYDA 2PDOA 1Z5RA 4MHNA 2PR8A 5HVFA 3PB6X 3S6FA 1RTQA 1F57A 1TKJA 2Z3OA 2NYQA 4CAWA 2FL4A 3TO6A 4B12A 1FNOA 4A37A 3PFEA 4AG7A 4FD7A 4HNWB 5G22A 1TF9A 4K3NA 5JPHA 2PJBA 4KVME 4B5PA 2V8HA 4ORFA 2G3AA 3H8GA 3W6SA 4OIWA 3S6HA 2Q51A 1PYTB 2CTCA 4P4IA 4XPKA 4ZY0A 4A32A 4P4DA 2YNEA 3SJFA 1RXTA 1Z8TA 3D3SA 3KL9A 4RUHA 1V0CA 4ZY2A 4OAEA 3H5ZA 2P6GA 5AG4A 3R95A 3JRUA 1LCPA 2PJAA 2Y0MA 3BJ7A 3IU2A 2IJZA 1F2OA 2F5IA 4DNCA 4DJLA 2QYVA 1HDUA 3BI0A 2PJ2A 2PJ1A 1ON0A 5D29A 5H84A 3FRMA 4M6HA 3CDXA 3R1KA 2PVWA 1BLLE 3E0KA 4MBUA 2QVPA 3LACA 4CAXA 2WPWA 3W6XA 5IB9A 1QSOA 4G1PA 2Z0ZA 3QNVA 3RAMA 2GANA 5F48A 4A38A 2CNMA 5I0CA 3VWEA 1MJ9A 1VHSA 3MN8A 4UEZA 4F0XA 4HNYB 2ZEEA 3V7ZA 4IUSA 2JBJA 3IIBA 4NGNA 3N5FA 5JGFA 4QB9A 4MCRA 2PR1A 3SHPA 4CGPA 1WWZA 2V8VA 1Z8WA 3GKRA 3RYOA 5KTDA 5LYLA 4P10A 4MFKA 4E0AA 4R9MA 3DDDA 1XRYA 1PU9A 1Z8XA 4X5KA 3TOAA 4C7HA 4DUKA 4CRYB 2ZENA 5LRKA 4CGNA 2BUEA 2FT0A 5AG6A 1S7FA 4F0YA 1IICA 2B5GA 3PFOA 2GLJA 4AB7A 3NFZA 4OC1A 4KSFA 4F9VA 2C27A 3FEDA 4F8ZA 4KOXA 4B14A 4JXQA 3PRTA 2OB0A 2AFSA 2Q04A 3D68A 3KHZA 2ZW4A 4OP4A 4LQGA 2HQYA 2JEWA 3KGQA 4WWVA 2WZNA 4MHDA 2C1CA 5IV0A 5JH9A 2B3VA 4PXEA 4QUSA 5J8FA 4MY3A 4QVTA 4GS4A 3PBEA 5JQ4A 2H5MA 2POKA 2ZOGA 4UCMA 1BOBA 3IC1A 3T9YA 4KVXA 1I1DA 1LANA 4YRHA 4WJBA 5H86A 1LFWA 1Z8LA 1IU8A 1Q2YA 3LMSA 5A27A 2DXQA 3DLJA 3GUXA 2V8GA 5J8CA 4PXDA 4A2ZA 3PB4X 2PVVA 3HLPA 2PJ6A 3JUWA 1P4NA 1JQGA 3P2FA 2FCKA 3R9EA 4IK2A 3FMCA 2REEA 1TIQA 3IWEA 4P6YA 1KUVA 4II9A 2I79A 4KZTA 2B58A 4JJXA 1Z9UA 3DNSA 4NSQA 2AFWA 2P6FA 4FWUA 3IU1A 1U6MA 2QJ8A 4KOSA 4M85A 4EFDA 1Z2LA 2EK8A 2HB6A 4MY0A 3V8IA 2DF5A 1CBXA 2J8NA 4YGOA 4UA3A 3KHXA 1CX8A 2FSRA 2J8RA 3KZWA 1YW6A 1CPSA 1XOVA 1PUAA 3R96A 2AFZA 4OLLA 3D7DA 4KVOE 2QMLA 4NGPA 4U9ZA 1I12A 5F46A 5K8MA 4MHYA 5CPAA 2VBQA 1B87A 2O28A 3PZJA 4JLYA 2BSWA 4KOUA 4PXCA 1P0HA 2PRQA 4UWJA 1AYEA 3B2YA 3VATA 3I3GA 1H8LA 2NMTA 2AJ6A 2BL1A 5J1QA 4AVBA 2JDCA 2XEFA 4L89A 4BBHA 3SXOA 2YGWA 4QBJA 1FY7A 1X10A 2PC1A 4IAVA 4MJ8A 3KQXA 3PB9X 2IL4A 3FIXA 4QC6A 1IYKA 3GIUA 3RZAA 3EO4A 3EY5A 1CG2A 4MXUA 3S9NA 4MFJA 4AXVA 2B3UA 4UIBA 2ABZA 4OC5A 5C82A 2OH1A 3S9MA 4Z65A 3IEHA 3TO7A 1YX0A 4NFRA 2ATRA 4JZ0A 1OBRA 2EUIA 3V38A 1Q7LA 3KI9A 1GHEA 1WK4A 4MFLA 4JYWA 2JBKA 3RNZA 2VI7A 4UFXA 3T8WA 5K8NA 4I49A 4C2YA 3NE7A 1LAPA 2Q44A 3D7GA 4UEEA 2XEJA 3G8WA 1Y0YA 4CS0B 2XEIA 2PJ3A 3IO1A 2O53A 1L0CA 2XEGA 3WR7A 4NGTA 3EFAA 4FBEA 4MCPA 3KR4A 5ISVA 3LODA 4HKFA 2B4DA 1KZFA 4MCQA 4C68A 1YR0A 3F8KA 4A94A 4ZGYB 2EBJA 5F47A 5LRGA 5KTCA 4PSXA 3VWDA 4PXBA 8CPAA 1FT7A 4B11A 7CPAA 4A33A 2PJ8A 2ZEMA 4HNXB 4YFJA 3KASA 1UFHA 4XNHC 1VHEA 3SI2A 2ZPAA 1CJWA 4CGLA 3NH5A 4TWEA 1M44A 2GIVA 4L8AA 1DE4C 4F6AA 4X8IA 1AUGA 5HVGA 5JM6A 3WC6A 4B5PB 1Y7EA 4UFVA 3FVLA 3FBUA 4OC0A 1ZLHA 4XPDC 3TOBA 4NF1A 4BMHA 2YNCA 1LOKA 3TT2A 2R8VA 1YVKA 1KUYA 4H6ZA 2Z3KA 2J9AA 4KOTA 4O23A 2ZEPA 2CTBA 3GB0A 4OC2A 3IJ3A 4ONUA 4EWTA 5K8OA 2Z3LA 4B6ZA 1HEEA 3N7ZA 2PIZA 2AFMA 4IF5A 1MJBA 3CPAA 3D8PA 4NJRA 5DWMA 1XF8A 3H8EA 1NE9A 4CPAA 3IWWA 2OU2A 3KQZA 1Y7RA 4P44A 3CPXA 1UWYA 3LD2A 3OWCA 1CM0A 1IYLA 1MK4A 3PP9A 4MHPA 4PSWA 3UY5A 4UF4A 3T90A 2PIYA 4RI1A 4MHZA 4UBRA 3VARA 3EC4A 3QAHA 3R9FA 5KTAA 1QSRA 2OZHA 1YQEA 3PEIA 4OADA 4E2AA 3B3WA 1KUXA 4A31A 1J4JA 3SJEA 4CAEA 1YVOA 4FD5A 3IWGA 1ZG9A 1QSMA 2D4OA 1KWMA 2Z3PA 4H2KA 4P45A 2PCUA 2Z3NA 4NXYA 1F2PA 4B13A 2ZEFA 2Q0YA 4LX9A 1IOFA 5EMIA 3TCVA 1S5KA 3C26A 5EBVA 4CYQA 3WC7A 4AVCA 4PPZA 4UCNA 4P4EA 1QSTA 4R6TA 3GLJA 2B4BA 4Q36A 3MRUA 2YNDA 1BPMA 2V77A 4KORA 5HH1A 1Q2DA 2BCOA 1DTDA 2ZEHA 2JEVA 1ZG8A 2CXAA 3TTHA 2QIRA 1GYTA 5FVJA 4FD6A 2B5GB 4Q7AA 5HXDA 4XPLA 2YNCC 1A2ZA 4E8OA 1IB1E 4UIAA 3BJ8A 2GE3A 4P4FA 2REFA 2ODFA 5HVHA 2AFXA 3B3VA 3DR6A 2V8DA 2EO8A 1NSLA 4F9UA 3TC8A 4U9YA 3SJGA 2FXFA 3DGVA 2KCWA 1Y9KA 2PJ9A 2VQYA 2JDDA 3CXSA 4JXRA 4UFWA 3K9UA 3EXNA 3FYNA 2I00A 4U5YA 5CBMA 3D67A 3KKWA 4CYPA 2VZYA 4YWYA 2I3CA 4C2XA 1CP6A 3D7FA 3IFEA 1PCAA 2C6CA 4GXHA 1S60A 1SQHA 2RB7A 2IQ6A 3NH4A 2ZOFA 4KSAA 4Y49C 1TXRA 1BPNA 2C6PA 4ZX9A 2FE7A 5AG7A 2G9DA 1M1DA 1RO5A 1TKFA 3ZZIA 3TO9A 2Q4YA 1ARLA 3NA6A 1ELMP 1Y9WA 3FF3A 3PB7X 5K8PA 5EC4A 1LAMA 3A9LA 4Q38A 1MJAA 3FB3A 3D7HA 2R7HA 3FXTA 2HC9A 4MFZA 4X2TA 1VHOA 4KSIA 2G0BA 5DS0A 5THWA 1QQ9A 1R57A 2VXKA 2NSMA 4NJQA 3ZJ0A 2VL1A 1YREA 3B7IA 3R9GA 2DEAA 2ZW7A 4DYOA 1HDQA 4KLWA
chains in the Genus database with same CATH topology
3CXQA 2ARHA 3TFYA 4A95A 2WSAA 4JWPA 1QSNA 4PK2A 1M4GA 1IIDA 2R1IA 4NEXA 5G21A 1NMTA 5BWAB 1S7LA 3GYAA 2K5TA 3GY9A 4CYNA 4KOYA 4MFQA 1OZPA 2Z10A 4XNHB 2FIWA 3JVNA 3DSBA 1M4IA 3I9SA 5GCNA 3H4QA 2P0WA 4MI4A 5IX3A 5DWNA 1VKCA 1S3ZA 2OZGA 4XPDB 4AVAA 3JTKA 4AG9A 1XIXA 4C2ZA 4ZBGA 4K30A 1N71A 2ZXVA 4RS2A 3P2HA 2ZW6A 2PSWA 5CNPA 1BO4A 1YK3A 1I21A 4KLVA 4FD4A 2EVNA 2QECA 1Z4RA 2VZZA 4R57A 2Z11A 4KUAA 3PGPA 4UCPA 2VEZA 2CNSA 2WPXA 2A4NA 2OZUA 2ZW5A 2B4DB 4EVYA 1S7KA 5AG5A 1XEBA 3MGDA 1B6BA 4B5OA 1LRZA 3TE4A 5C88A 5HMNA 4CAVA 2BEIA 1YLEA 4CGOA 4MFPA 4KUBA 3IGRA 3B8GA 2PRBA 1S7NA 3W91A 4JD6A 3QB8A 2Q4VA 2X7BA 3F5BA 4H89A 4KS9A 5F49A 4CRZB 4R87A 2CNTA 3FNCA 1XMTA 4KOVA 2DPTA 4CGMA 2CY2A 1XE4A 3DR8A 2DPSA 5E96A 4A30A 2G3TA 3SXNA 4LUAA 2D4PA 2Q7BA 1Q2CA 5A28A 2FS5A 1ZO0A 4KOWA 2R98A 4C7IA 3F0AA 4J3GA 3S6KA 4H6UA 5G20A 4Y49B 3S6GA 3G3SA 2RC4A 1YGHA 1K4JA 2PQ8A 5AGEA 1M4DA 2P6EA 1Z4EA 2HUZA 3D2MA 4PV6A 2HV2A 3D2PA 4CAFA 2AE6A 4R3KA 4UWIA 5IB0A 5G1ZA 2FIAA 2JLMA 3BLNA 4CYOA 4PK3A 4NCZA 4M3SA 4R3LA 2WUUA 2J8MA 2Z3MA 4B10A 3CXPA 2PDOA 2PR8A 3S6FA 2Z3OA 4CAWA 2FL4A 3TO6A 4B12A 4AG7A 4FD7A 4HNWB 5G22A 5JPHA 4KVME 4B5PA 4ORFA 2G3AA 3W6SA 3S6HA 4XPKA 4A32A 2YNEA 1RXTA 3D3SA 1V0CA 4OAEA 3H5ZA 2P6GA 5AG4A 3R95A 2Y0MA 3IU2A 3BJ7A 2F5IA 4DNCA 1ON0A 5H84A 3FRMA 3R1KA 3E0KA 4MBUA 4CAXA 2WPWA 3W6XA 1QSOA 2Z0ZA 2GANA 5F48A 5I0CA 2CNMA 3VWEA 1MJ9A 1VHSA 4F0XA 4HNYB 4IUSA 4QB9A 2PR1A 3SHPA 4CGPA 1WWZA 3GKRA 3RYOA 5KTDA 4E0AA 4MFKA 4R9MA 3DDDA 3TOAA 1PU9A 4X5KA 4C7HA 4CRYB 4CGNA 2BUEA 2FT0A 5AG6A 1S7FA 4F0YA 1IICA 2B5GA 4AB7A 4KSFA 2C27A 4KOXA 4B14A 4JXQA 2OB0A 2Q04A 2ZW4A 2HQYA 4MHDA 5IV0A 2B3VA 4QUSA 5J8FA 4MY3A 4QVTA 4GS4A 5JQ4A 2H5MA 4UCMA 1BOBA 3T9YA 4KVXA 1I1DA 4YRHA 5A27A 1Q2YA 5J8CA 2DXQA 4A2ZA 3JUWA 1P4NA 3P2FA 2FCKA 3R9EA 2REEA 1TIQA 3IWEA 1KUVA 4II9A 2I79A 4KZTA 2B58A 4JJXA 1Z9UA 3DNSA 4NSQA 2P6FA 3IU1A 1U6MA 4KOSA 4M85A 3V8IA 4MY0A 2J8NA 4YGOA 4UA3A 2FSRA 2J8RA 1PUAA 3R96A 4OLLA 4KVOE 2QMLA 4U9ZA 5F46A 1I12A 2VBQA 1B87A 2O28A 3PZJA 4JLYA 2BSWA 4KOUA 1P0HA 4UWJA 3I3GA 2NMTA 2AJ6A 2BL1A 4AVBA 2JDCA 4L89A 4BBHA 3SXOA 2YGWA 4QBJA 1FY7A 2PC1A 4MJ8A 2IL4A 3FIXA 4QC6A 1IYKA 3EO4A 3EY5A 4MFJA 2B3UA 5C82A 2OH1A 3TO7A 1YX0A 2ATRA 2EUIA 1GHEA 1WK4A 4MFLA 2VI7A 4UFXA 4I49A 4C2YA 3NE7A 2Q44A 3G8WA 4CS0B 1L0CA 3WR7A 3EFAA 5ISVA 3LODA 4HKFA 2B4DA 1KZFA 4ZGYB 4C68A 1YR0A 3F8KA 5F47A 5KTCA 4PSXA 3VWDA 4B11A 4A33A 4HNXB 4YFJA 1UFHA 4XNHC 2ZPAA 1CJWA 4CGLA 1M44A 2GIVA 4L8AA 4F6AA 4B5PB 4UFVA 3FBUA 4XPDC 3TOBA 4NF1A 4BMHA 2YNCA 3TT2A 2R8VA 1YVKA 1KUYA 4H6ZA 2Z3KA 4KOTA 4ONUA 2Z3LA 3N7ZA 4IF5A 5DWMA 1MJBA 3D8PA 1XF8A 1NE9A 2OU2A 1Y7RA 5H86A 3LD2A 3OWCA 1CM0A 1IYLA 1MK4A 3PP9A 4PSWA 3UY5A 3T90A 4RI1A 4UBRA 3EC4A 3QAHA 3R9FA 5KTAA 1QSRA 2OZHA 4OADA 4E2AA 1KUXA 4A31A 1J4JA 4CAEA 1YVOA 4FD5A 3IWGA 2D4OA 1QSMA 2Z3PA 2Z3NA 4NXYA 4B13A 2Q0YA 4LX9A 3TCVA 1S5KA 3C26A 5EBVA 4CYQA 4AVCA 4UCNA 1QSTA 2B4BA 4Q36A 2YNDA 5HH1A 4KORA 1Q2DA 2CXAA 2JEVA 3TTHA 2QIRA 5FVJA 4FD6A 2B5GB 4XPLA 2YNCC 4E8OA 1IB1E 3BJ8A 2GE3A 2REFA 3DR6A 1NSLA 4U9YA 2FXFA 2KCWA 1Y9KA 2VQYA 2JDDA 3CXSA 4JXRA 4UFWA 3K9UA 3EXNA 3FYNA 2I00A 4U5YA 3KKWA 4CYPA 2VZYA 4C2XA 1S60A 1SQHA 4KSAA 4Y49C 2FE7A 5AG7A 1M1DA 1RO5A 3ZZIA 3TO9A 2Q4YA 1Y9WA 5EC4A 3A9LA 4Q38A 1MJAA 3FB3A 2R7HA 3FXTA 4MFZA 2G0BA 1R57A 2VXKA 3ZJ0A 1YREA 3R9GA 2ZW7A 4KLWA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3CXQ A;  2ARH A;  3TFY A;  4JWP A;  1QSN A;  4PK2 A;  1M4G A;  1IID A;  2R1I A;  4NEX A;  1NMT A;  1S7L A;  3GYA A;  2K5T A;  3GY9 A;  4KOY A;  1OZP A;  2Z10 A;  4XNH B;  2FIW A;  3JVN A;  3DSB A;  1M4I A;  3I9S A;  5GCN A;  3H4Q A;  2P0W A;  4MI4 A;  5IX3 A;  5DWN A;  1VKC A;  1S3Z A;  2OZG A;  4XPD B;  4AVA A;  4AG9 A;  1XIX A;  4ZBG A;  4K30 A;  1N71 A;  2ZXV A;  4RS2 A;  3P2H A;  2ZW6 A;  2PSW A;  5CNP A;  1BO4 A;  1YK3 A;  1I21 A;  4KLV A;  4FD4 A;  2EVN A;  2QEC A;  1Z4R A;  2VZZ A;  4R57 A;  2Z11 A;  4KUA A;  3PGP A;  2VEZ A;  2CNS A;  2WPX A;  2A4N A;  2OZU A;  2ZW5 A;  2B4D B;  4EVY A;  1S7K A;  1XEB A;  3MGD A;  1B6B A;  4B5O A;  1LRZ A;  3TE4 A;  5C88 A;  5HMN A;  4CAV A;  2BEI A;  1YLE A;  4KUB A;  3IGR A;  3B8G A;  2PRB A;  1S7N A;  3W91 A;  4JD6 A;  3QB8 A;  2Q4V A;  2X7B A;  3F5B A;  4H89 A;  5F49 A;  4CRZ B;  4R87 A;  2CNT A;  3FNC A;  1XMT A;  4KOV A;  2CY2 A;  1XE4 A;  3DR8 A;  5E96 A;  2G3T A;  3SXN A;  4LUA A;  2D4P A;  2Q7B A;  1Q2C A;  2FS5 A;  4KOW A;  2R98 A;  3F0A A;  4J3G A;  3S6K A;  4H6U A;  4Y49 B;  3S6G A;  3G3S A;  2RC4 A;  1YGH A;  1K4J A;  2PQ8 A;  1M4D A;  2P6E A;  1Z4E A;  2HUZ A;  3D2M A;  4PV6 A;  2HV2 A;  3D2P A;  2AE6 A;  4R3K A;  4UWI A;  5IB0 A;  2FIA A;  2JLM A;  3BLN A;  4PK3 A;  4NCZ A;  4M3S A;  4R3L A;  2J8M A;  3CXP A;  2PDO A;  2PR8 A;  3S6F A;  4CAW A;  2FL4 A;  3TO6 A;  4AG7 A;  4FD7 A;  4HNW B;  5JPH A;  4KVM E;  4B5P A;  4ORF A;  2G3A A;  3W6S A;  3S6H A;  4XPK A;  1RXT A;  3D3S A;  1V0C A;  4OAE A;  2P6G A;  3R95 A;  2Y0M A;  3BJ7 A;  2F5I A;  4DNC A;  1ON0 A;  5H84 A;  3FRM A;  3R1K A;  3E0K A;  4MBU A;  4CAX A;  2WPW A;  3W6X A;  1QSO A;  2Z0Z A;  2GAN A;  5F48 A;  5I0C A;  2CNM A;  3VWE A;  1MJ9 A;  1VHS A;  4HNY B;  4IUS A;  4QB9 A;  2PR1 A;  3SHP A;  1WWZ A;  3GKR A;  3RYO A;  5KTD A;  4E0A A;  4R9M A;  3DDD A;  3TOA A;  1PU9 A;  4X5K A;  4CRY B;  2BUE A;  2FT0 A;  4F0Y A;  1S7F A;  1IIC A;  2B5G A;  4AB7 A;  2C27 A;  4KOX A;  4JXQ A;  2OB0 A;  2Q04 A;  2ZW4 A;  2HQY A;  4MHD A;  5IV0 A;  2B3V A;  4QUS A;  5J8F A;  4MY3 A;  4QVT A;  4GS4 A;  5JQ4 A;  2H5M A;  1BOB A;  3T9Y A;  4KVX A;  1I1D A;  4YRH A;  1Q2Y A;  5J8C A;  2DXQ A;  3JUW A;  1P4N A;  3P2F A;  2FCK A;  3R9E A;  2REE A;  1TIQ A;  1KUV A;  4II9 A;  2I79 A;  4KZT A;  2B58 A;  4JJX A;  1Z9U A;  3DNS A;  4NSQ A;  2P6F A;  1U6M A;  4KOS A;  4M85 A;  3V8I A;  4MY0 A;  2J8N A;  4YGO A;  4UA3 A;  2FSR A;  2J8R A;  1PUA A;  3R96 A;  4OLL A;  4KVO E;  2QML A;  4U9Z A;  5F46 A;  1I12 A;  2VBQ A;  1B87 A;  2O28 A;  3PZJ A;  4JLY A;  2BSW A;  4KOU A;  1P0H A;  4UWJ A;  3I3G A;  2NMT A;  2AJ6 A;  2BL1 A;  4AVB A;  2JDC A;  4L89 A;  3SXO A;  4QBJ A;  1FY7 A;  2PC1 A;  4MJ8 A;  2IL4 A;  3FIX A;  4QC6 A;  1IYK A;  3EO4 A;  3EY5 A;  2B3U A;  5C82 A;  2OH1 A;  3TO7 A;  1YX0 A;  2ATR A;  2EUI A;  1GHE A;  1WK4 A;  2VI7 A;  4I49 A;  3NE7 A;  2Q44 A;  3G8W A;  4CS0 B;  1L0C A;  3WR7 A;  3EFA A;  5ISV A;  3LOD A;  4HKF A;  2B4D A;  1KZF A;  1YR0 A;  3F8K A;  5F47 A;  5KTC A;  4PSX A;  3VWD A;  4HNX B;  4YFJ A;  1UFH A;  4XNH C;  2ZPA A;  1CJW A;  1M44 A;  2GIV A;  4L8A A;  4F6A A;  4B5P B;  3FBU A;  4XPD C;  3TOB A;  4NF1 A;  4BMH A;  3TT2 A;  2R8V A;  1YVK A;  1KUY A;  4H6Z A;  4KOT A;  4ONU A;  3N7Z A;  4IF5 A;  5DWM A;  1MJB A;  3D8P A;  1XF8 A;  1NE9 A;  2OU2 A;  1Y7R A;  5H86 A;  3LD2 A;  3OWC A;  1CM0 A;  1IYL A;  1MK4 A;  3PP9 A;  4PSW A;  3UY5 A;  3T90 A;  4RI1 A;  4UBR A;  3EC4 A;  3QAH A;  3R9F A;  5KTA A;  1QSR A;  2OZH A;  4OAD A;  4E2A A;  1KUX A;  1J4J A;  1YVO A;  4FD5 A;  3IWG A;  2D4O A;  1QSM A;  4NXY A;  2Q0Y A;  4LX9 A;  3TCV A;  1S5K A;  3C26 A;  5EBV A;  4AVC A;  1QST A;  2B4B A;  5HH1 A;  4KOR A;  1Q2D A;  2JEV A;  3TTH A;  2QIR A;  5FVJ A;  4FD6 A;  2B5G B;  4XPL A;  4E8O A;  1IB1 E;  3BJ8 A;  2GE3 A;  2REF A;  3DR6 A;  1NSL A;  4U9Y A;  2FXF A;  2KCW A;  1Y9K A;  2VQY A;  2JDD A;  3CXS A;  4JXR A;  3K9U A;  3EXN A;  3FYN A;  2I00 A;  4U5Y A;  3KKW A;  2VZY A;  1S60 A;  1SQH A;  4Y49 C;  2FE7 A;  1M1D A;  1RO5 A;  3ZZI A;  3TO9 A;  2Q4Y A;  1Y9W A;  5EC4 A;  1MJA A;  3FB3 A;  2R7H A;  3FXT A;  2G0B A;  1R57 A;  2VXK A;  3ZJ0 A;  1YRE A;  3R9G A;  2ZW7 A;  4KLW A; 
#chains in the Genus database with same CATH topology
 3BI1 A;  3CXQ A;  2ARH A;  3K2K A;  2EK9 A;  3TFY A;  4A95 A;  2WSA A;  3ISZ A;  4OKO A;  1CP7 A;  3WC5 A;  4JWP A;  1QSN A;  4PK2 A;  1M4G A;  1IID A;  2R1I A;  4NEX A;  3WT4 A;  5G21 A;  1NMT A;  5BWA B;  1S7L A;  3RO0 A;  3GYA A;  2K5T A;  3GY9 A;  4RN7 A;  2ZED A;  4CYN A;  4KOY A;  4MFQ A;  1OZP A;  4PQA A;  2Z10 A;  2F7V A;  2IMO A;  3FJU A;  2GLF A;  2ZEG A;  3SI0 A;  3D4U A;  4XNH B;  1R43 A;  2FIW A;  3JVN A;  3DSB A;  1M4I A;  3FEC A;  3I9S A;  1XMB A;  4HPS A;  5GCN A;  3H4Q A;  2P0W A;  1AMP A;  2GFQ A;  4MI4 A;  2C6G A;  1CPX A;  1NSA A;  2WYR A;  1VKC A;  5DWN A;  5IX3 A;  1S3Z A;  2OZG A;  1TKH A;  3L2N A;  4BD9 A;  4XPD B;  2AFO A;  4M6G A;  4AVA A;  3JTK A;  1IGB A;  2CF4 A;  4AG9 A;  1XIX A;  2ZEO A;  4C2Z A;  4ZBG A;  3NE8 A;  4K30 A;  4OME A;  1N71 A;  4R8F A;  2ZXV A;  4RS2 A;  3BXM A;  2OOT A;  5LRJ A;  3P2H A;  2ZW6 A;  5LYI A;  2PSW A;  3WAB A;  4ZYQ A;  3RBU A;  1BAV A;  2ANP A;  5CNP A;  1XFO A;  1BO4 A;  1YK3 A;  1I21 A;  4MRI A;  4GM5 A;  4KLV A;  3PB8 X;  2PJC A;  4FD4 A;  2EVN A;  2QEC A;  1Z4R A;  4ZI6 A;  2VZZ A;  3B3T A;  1EE3 P;  1YSJ A;  4R57 A;  2Z11 A;  4KUA A;  4P4B A;  3PGP A;  4UCP A;  2VEZ A;  2CNS A;  4IHM A;  3BHX A;  2PE3 A;  2WPX A;  2A4N A;  2OZU A;  2ZW5 A;  1XBU A;  2B4D B;  3LWU A;  4EVY A;  1S7K A;  5AG5 A;  1XEB A;  3MGD A;  3KR5 A;  1B6B A;  1TF8 A;  4B5O A;  2ZEL A;  1LRZ A;  3TE4 A;  5C88 A;  5HMN A;  3H8F A;  4ONW A;  4FAI A;  4NGQ A;  1IOI A;  4CAV A;  2BEI A;  1ARM A;  1M4L A;  1YLE A;  4CGO A;  4MFP A;  4KUB A;  3IGR A;  3B8G A;  2PRB A;  1S7N A;  4MCS A;  4X3R A;  3W91 A;  4JD6 A;  3QB8 A;  2Q4V A;  2X7B A;  3F5B A;  4NGR A;  2GRE A;  4H89 A;  4KS9 A;  5F49 A;  3S9L A;  2RFH A;  4CRZ B;  4R87 A;  3NH8 A;  2CNT A;  3SJX A;  2BOA A;  3FNC A;  2F8H A;  4NGM A;  4FUU A;  1XMT A;  4KOV A;  2PJ4 A;  2DPT A;  1YW4 A;  2CIJ A;  2CY2 A;  3HUV A;  1XE4 A;  3DR8 A;  2DPS A;  4M6I A;  4TNU A;  3B3S A;  5E96 A;  3VH9 A;  2G3T A;  4R7M A;  3SXN A;  4A30 A;  4CGM A;  3TX8 A;  4LUA A;  2D4P A;  3FEE A;  1Q2C A;  2Q43 A;  4MMO A;  3QAY A;  2Q7B A;  2FS5 A;  3FH4 A;  1ZLI A;  5A28 A;  1ZO0 A;  4KOW A;  4R76 A;  4NGS A;  4ZY1 A;  2O4H A;  2R98 A;  3K9T A;  4C7I A;  5F09 A;  1ELL P;  3F0A A;  4J3G A;  3S6K A;  1XJO A;  4H6U A;  4UEF A;  1VGY A;  2PJ0 A;  3I1U A;  3ISX A;  4LQ6 A;  4Y49 B;  5G20 A;  3S6G A;  2Q4Z A;  2Q7S A;  2EWB A;  3G3S A;  2RC4 A;  3SI1 A;  1YGH A;  1K4J A;  1X12 A;  2PJ7 A;  2PQ8 A;  5AGE A;  4P4J A;  1M4D A;  6CPA A;  3CT9 A;  1JWQ A;  1ZG7 A;  2P6E A;  2BO9 A;  1Z4E A;  2HUZ A;  1IY7 A;  3D2M A;  3B35 A;  1QMU A;  4PV6 A;  2HV2 A;  3D2P A;  3PBB A;  4CAF A;  2AE6 A;  2AFU A;  4R3K A;  3B3C A;  2GU2 A;  1Y0R A;  4OID A;  4UWI A;  4YU9 A;  5IB0 A;  5G1Z A;  4OC3 A;  2FIA A;  5I4M A;  2JLM A;  3D66 A;  1YME A;  3BLN A;  4CYO A;  4PK3 A;  4A39 A;  5ELY A;  1YLO A;  4NCZ A;  4M3S A;  4R3L A;  5LYF A;  1R3N A;  1VIX A;  2WUU A;  2J8M A;  2OR4 A;  4ZX8 A;  2FVG A;  2PJ5 A;  4BIN A;  3CZX A;  2Z3M A;  4B10 A;  4EME A;  3FX6 A;  3CXP A;  4W9Y A;  4OC4 A;  5D8N A;  5LYD A;  2PDO A;  1Z5R A;  4MHN A;  2PR8 A;  5HVF A;  3PB6 X;  3S6F A;  1RTQ A;  1F57 A;  1TKJ A;  2Z3O A;  2NYQ A;  4CAW A;  2FL4 A;  3TO6 A;  4B12 A;  1FNO A;  4A37 A;  3PFE A;  4AG7 A;  4FD7 A;  4HNW B;  5G22 A;  1TF9 A;  4K3N A;  5JPH A;  2PJB A;  4KVM E;  4B5P A;  2V8H A;  4ORF A;  2G3A A;  3H8G A;  3W6S A;  4OIW A;  3S6H A;  2Q51 A;  1PYT B;  2CTC A;  4P4I A;  4XPK A;  4ZY0 A;  4A32 A;  4P4D A;  2YNE A;  3SJF A;  1RXT A;  1Z8T A;  3D3S A;  3KL9 A;  4RUH A;  1V0C A;  4ZY2 A;  4OAE A;  3H5Z A;  2P6G A;  5AG4 A;  3R95 A;  3JRU A;  1LCP A;  2PJA A;  2Y0M A;  3BJ7 A;  3IU2 A;  2IJZ A;  1F2O A;  2F5I A;  4DNC A;  4DJL A;  2QYV A;  1HDU A;  3BI0 A;  2PJ2 A;  2PJ1 A;  1ON0 A;  5D29 A;  5H84 A;  3FRM A;  4M6H A;  3CDX A;  3R1K A;  2PVW A;  1BLL E;  3E0K A;  4MBU A;  2QVP A;  3LAC A;  4CAX A;  2WPW A;  3W6X A;  5IB9 A;  1QSO A;  4G1P A;  2Z0Z A;  3QNV A;  3RAM A;  2GAN A;  5F48 A;  4A38 A;  2CNM A;  5I0C A;  3VWE A;  1MJ9 A;  1VHS A;  3MN8 A;  4UEZ A;  4F0X A;  4HNY B;  2ZEE A;  3V7Z A;  4IUS A;  2JBJ A;  3IIB A;  4NGN A;  3N5F A;  5JGF A;  4QB9 A;  4MCR A;  2PR1 A;  3SHP A;  4CGP A;  1WWZ A;  2V8V A;  1Z8W A;  3GKR A;  3RYO A;  5KTD A;  5LYL A;  4P10 A;  4MFK A;  4E0A A;  4R9M A;  3DDD A;  1XRY A;  1PU9 A;  1Z8X A;  4X5K A;  3TOA A;  4C7H A;  4DUK A;  4CRY B;  2ZEN A;  5LRK A;  4CGN A;  2BUE A;  2FT0 A;  5AG6 A;  1S7F A;  4F0Y A;  1IIC A;  2B5G A;  3PFO A;  2GLJ A;  4AB7 A;  3NFZ A;  4OC1 A;  4KSF A;  4F9V A;  2C27 A;  3FED A;  4F8Z A;  4KOX A;  4B14 A;  4JXQ A;  3PRT A;  2OB0 A;  2AFS A;  2Q04 A;  3D68 A;  3KHZ A;  2ZW4 A;  4OP4 A;  4LQG A;  2HQY A;  2JEW A;  3KGQ A;  4WWV A;  2WZN A;  4MHD A;  2C1C A;  5IV0 A;  5JH9 A;  2B3V A;  4PXE A;  4QUS A;  5J8F A;  4MY3 A;  4QVT A;  4GS4 A;  3PBE A;  5JQ4 A;  2H5M A;  2POK A;  2ZOG A;  4UCM A;  1BOB A;  3IC1 A;  3T9Y A;  4KVX A;  1I1D A;  1LAN A;  4YRH A;  4WJB A;  5H86 A;  1LFW A;  1Z8L A;  1IU8 A;  1Q2Y A;  3LMS A;  5A27 A;  2DXQ A;  3DLJ A;  3GUX A;  2V8G A;  5J8C A;  4PXD A;  4A2Z A;  3PB4 X;  2PVV A;  3HLP A;  2PJ6 A;  3JUW A;  1P4N A;  1JQG A;  3P2F A;  2FCK A;  3R9E A;  4IK2 A;  3FMC A;  2REE A;  1TIQ A;  3IWE A;  4P6Y A;  1KUV A;  4II9 A;  2I79 A;  4KZT A;  2B58 A;  4JJX A;  1Z9U A;  3DNS A;  4NSQ A;  2AFW A;  2P6F A;  4FWU A;  3IU1 A;  1U6M A;  2QJ8 A;  4KOS A;  4M85 A;  4EFD A;  1Z2L A;  2EK8 A;  2HB6 A;  4MY0 A;  3V8I A;  2DF5 A;  1CBX A;  2J8N A;  4YGO A;  4UA3 A;  3KHX A;  1CX8 A;  2FSR A;  2J8R A;  3KZW A;  1YW6 A;  1CPS A;  1XOV A;  1PUA A;  3R96 A;  2AFZ A;  4OLL A;  3D7D A;  4KVO E;  2QML A;  4NGP A;  4U9Z A;  1I12 A;  5F46 A;  5K8M A;  4MHY A;  5CPA A;  2VBQ A;  1B87 A;  2O28 A;  3PZJ A;  4JLY A;  2BSW A;  4KOU A;  4PXC A;  1P0H A;  2PRQ A;  4UWJ A;  1AYE A;  3B2Y A;  3VAT A;  3I3G A;  1H8L A;  2NMT A;  2AJ6 A;  2BL1 A;  5J1Q A;  4AVB A;  2JDC A;  2XEF A;  4L89 A;  4BBH A;  3SXO A;  2YGW A;  4QBJ A;  1FY7 A;  1X10 A;  2PC1 A;  4IAV A;  4MJ8 A;  3KQX A;  3PB9 X;  2IL4 A;  3FIX A;  4QC6 A;  1IYK A;  3GIU A;  3RZA A;  3EO4 A;  3EY5 A;  1CG2 A;  4MXU A;  3S9N A;  4MFJ A;  4AXV A;  2B3U A;  4UIB A;  2ABZ A;  4OC5 A;  5C82 A;  2OH1 A;  3S9M A;  4Z65 A;  3IEH A;  3TO7 A;  1YX0 A;  4NFR A;  2ATR A;  4JZ0 A;  1OBR A;  2EUI A;  3V38 A;  1Q7L A;  3KI9 A;  1GHE A;  1WK4 A;  4MFL A;  4JYW A;  2JBK A;  3RNZ A;  2VI7 A;  4UFX A;  3T8W A;  5K8N A;  4I49 A;  4C2Y A;  3NE7 A;  1LAP A;  2Q44 A;  3D7G A;  4UEE A;  2XEJ A;  3G8W A;  1Y0Y A;  4CS0 B;  2XEI A;  2PJ3 A;  3IO1 A;  2O53 A;  1L0C A;  2XEG A;  3WR7 A;  4NGT A;  3EFA A;  4FBE A;  4MCP A;  3KR4 A;  5ISV A;  3LOD A;  4HKF A;  2B4D A;  1KZF A;  4MCQ A;  4C68 A;  1YR0 A;  3F8K A;  4A94 A;  4ZGY B;  2EBJ A;  5F47 A;  5LRG A;  5KTC A;  4PSX A;  3VWD A;  4PXB A;  8CPA A;  1FT7 A;  4B11 A;  7CPA A;  4A33 A;  2PJ8 A;  2ZEM A;  4HNX B;  4YFJ A;  3KAS A;  1UFH A;  4XNH C;  1VHE A;  3SI2 A;  2ZPA A;  1CJW A;  4CGL A;  3NH5 A;  4TWE A;  1M44 A;  2GIV A;  4L8A A;  1DE4 C;  4F6A A;  4X8I A;  1AUG A;  5HVG A;  5JM6 A;  3WC6 A;  4B5P B;  1Y7E A;  4UFV A;  3FVL A;  3FBU A;  4OC0 A;  1ZLH A;  4XPD C;  3TOB A;  4NF1 A;  4BMH A;  2YNC A;  1LOK A;  3TT2 A;  2R8V A;  1YVK A;  1KUY A;  4H6Z A;  2Z3K A;  2J9A A;  4KOT A;  4O23 A;  2ZEP A;  2CTB A;  3GB0 A;  4OC2 A;  3IJ3 A;  4ONU A;  4EWT A;  5K8O A;  2Z3L A;  4B6Z A;  1HEE A;  3N7Z A;  2PIZ A;  2AFM A;  4IF5 A;  1MJB A;  3CPA A;  3D8P A;  4NJR A;  5DWM A;  1XF8 A;  3H8E A;  1NE9 A;  4CPA A;  3IWW A;  2OU2 A;  3KQZ A;  1Y7R A;  4P44 A;  3CPX A;  1UWY A;  3LD2 A;  3OWC A;  1CM0 A;  1IYL A;  1MK4 A;  3PP9 A;  4MHP A;  4PSW A;  3UY5 A;  4UF4 A;  3T90 A;  2PIY A;  4RI1 A;  4MHZ A;  4UBR A;  3VAR A;  3EC4 A;  3QAH A;  3R9F A;  5KTA A;  1QSR A;  2OZH A;  1YQE A;  3PEI A;  4OAD A;  4E2A A;  3B3W A;  1KUX A;  4A31 A;  1J4J A;  3SJE A;  4CAE A;  1YVO A;  4FD5 A;  3IWG A;  1ZG9 A;  1QSM A;  2D4O A;  1KWM A;  2Z3P A;  4H2K A;  4P45 A;  2PCU A;  2Z3N A;  4NXY A;  1F2P A;  4B13 A;  2ZEF A;  2Q0Y A;  4LX9 A;  1IOF A;  5EMI A;  3TCV A;  1S5K A;  3C26 A;  5EBV A;  4CYQ A;  3WC7 A;  4AVC A;  4PPZ A;  4UCN A;  4P4E A;  1QST A;  4R6T A;  3GLJ A;  2B4B A;  4Q36 A;  3MRU A;  2YND A;  1BPM A;  2V77 A;  4KOR A;  5HH1 A;  1Q2D A;  2BCO A;  1DTD A;  2ZEH A;  2JEV A;  1ZG8 A;  2CXA A;  3TTH A;  2QIR A;  1GYT A;  5FVJ A;  4FD6 A;  2B5G B;  4Q7A A;  5HXD A;  4XPL A;  2YNC C;  1A2Z A;  4E8O A;  1IB1 E;  4UIA A;  3BJ8 A;  2GE3 A;  4P4F A;  2REF A;  2ODF A;  5HVH A;  2AFX A;  3B3V A;  3DR6 A;  2V8D A;  2EO8 A;  1NSL A;  4F9U A;  3TC8 A;  4U9Y A;  3SJG A;  2FXF A;  3DGV A;  2KCW A;  1Y9K A;  2PJ9 A;  2VQY A;  2JDD A;  3CXS A;  4JXR A;  4UFW A;  3K9U A;  3EXN A;  3FYN A;  2I00 A;  4U5Y A;  5CBM A;  3D67 A;  3KKW A;  4CYP A;  2VZY A;  4YWY A;  2I3C A;  4C2X A;  1CP6 A;  3D7F A;  3IFE A;  1PCA A;  2C6C A;  4GXH A;  1S60 A;  1SQH A;  2RB7 A;  2IQ6 A;  3NH4 A;  2ZOF A;  4KSA A;  4Y49 C;  1TXR A;  1BPN A;  2C6P A;  4ZX9 A;  2FE7 A;  5AG7 A;  2G9D A;  1M1D A;  1RO5 A;  1TKF A;  3ZZI A;  3TO9 A;  2Q4Y A;  1ARL A;  3NA6 A;  1ELM P;  1Y9W A;  3FF3 A;  3PB7 X;  5K8P A;  5EC4 A;  1LAM A;  3A9L A;  4Q38 A;  1MJA A;  3FB3 A;  3D7H A;  2R7H A;  3FXT A;  2HC9 A;  4MFZ A;  4X2T A;  1VHO A;  4KSI A;  2G0B A;  5DS0 A;  5THW A;  1QQ9 A;  1R57 A;  2VXK A;  2NSM A;  4NJQ A;  3ZJ0 A;  2VL1 A;  1YRE A;  3B7I A;  3R9G A;  2DEA A;  2ZW7 A;  4DYO A;  1HDQ A;  4KLW A; 
#chains in the Genus database with same CATH homology
 3CXQ A;  2ARH A;  3TFY A;  4A95 A;  2WSA A;  4JWP A;  1QSN A;  4PK2 A;  1M4G A;  1IID A;  2R1I A;  4NEX A;  5G21 A;  1NMT A;  5BWA B;  1S7L A;  3GYA A;  2K5T A;  3GY9 A;  4CYN A;  4KOY A;  4MFQ A;  1OZP A;  2Z10 A;  4XNH B;  2FIW A;  3JVN A;  3DSB A;  1M4I A;  3I9S A;  5GCN A;  3H4Q A;  2P0W A;  4MI4 A;  5IX3 A;  5DWN A;  1VKC A;  1S3Z A;  2OZG A;  4XPD B;  4AVA A;  3JTK A;  4AG9 A;  1XIX A;  4C2Z A;  4ZBG A;  4K30 A;  1N71 A;  2ZXV A;  4RS2 A;  3P2H A;  2ZW6 A;  2PSW A;  5CNP A;  1BO4 A;  1YK3 A;  1I21 A;  4KLV A;  4FD4 A;  2EVN A;  2QEC A;  1Z4R A;  2VZZ A;  4R57 A;  2Z11 A;  4KUA A;  3PGP A;  4UCP A;  2VEZ A;  2CNS A;  2WPX A;  2A4N A;  2OZU A;  2ZW5 A;  2B4D B;  4EVY A;  1S7K A;  5AG5 A;  1XEB A;  3MGD A;  1B6B A;  4B5O A;  1LRZ A;  3TE4 A;  5C88 A;  5HMN A;  4CAV A;  2BEI A;  1YLE A;  4CGO A;  4MFP A;  4KUB A;  3IGR A;  3B8G A;  2PRB A;  1S7N A;  3W91 A;  4JD6 A;  3QB8 A;  2Q4V A;  2X7B A;  3F5B A;  4H89 A;  4KS9 A;  5F49 A;  4CRZ B;  4R87 A;  2CNT A;  3FNC A;  1XMT A;  4KOV A;  2DPT A;  4CGM A;  2CY2 A;  1XE4 A;  3DR8 A;  2DPS A;  5E96 A;  4A30 A;  2G3T A;  3SXN A;  4LUA A;  2D4P A;  2Q7B A;  1Q2C A;  5A28 A;  2FS5 A;  1ZO0 A;  4KOW A;  2R98 A;  4C7I A;  3F0A A;  4J3G A;  3S6K A;  4H6U A;  5G20 A;  4Y49 B;  3S6G A;  3G3S A;  2RC4 A;  1YGH A;  1K4J A;  2PQ8 A;  5AGE A;  1M4D A;  2P6E A;  1Z4E A;  2HUZ A;  3D2M A;  4PV6 A;  2HV2 A;  3D2P A;  4CAF A;  2AE6 A;  4R3K A;  4UWI A;  5IB0 A;  5G1Z A;  2FIA A;  2JLM A;  3BLN A;  4CYO A;  4PK3 A;  4NCZ A;  4M3S A;  4R3L A;  2WUU A;  2J8M A;  2Z3M A;  4B10 A;  3CXP A;  2PDO A;  2PR8 A;  3S6F A;  2Z3O A;  4CAW A;  2FL4 A;  3TO6 A;  4B12 A;  4AG7 A;  4FD7 A;  4HNW B;  5G22 A;  5JPH A;  4KVM E;  4B5P A;  4ORF A;  2G3A A;  3W6S A;  3S6H A;  4XPK A;  4A32 A;  2YNE A;  1RXT A;  3D3S A;  1V0C A;  4OAE A;  3H5Z A;  2P6G A;  5AG4 A;  3R95 A;  2Y0M A;  3IU2 A;  3BJ7 A;  2F5I A;  4DNC A;  1ON0 A;  5H84 A;  3FRM A;  3R1K A;  3E0K A;  4MBU A;  4CAX A;  2WPW A;  3W6X A;  1QSO A;  2Z0Z A;  2GAN A;  5F48 A;  5I0C A;  2CNM A;  3VWE A;  1MJ9 A;  1VHS A;  4F0X A;  4HNY B;  4IUS A;  4QB9 A;  2PR1 A;  3SHP A;  4CGP A;  1WWZ A;  3GKR A;  3RYO A;  5KTD A;  4E0A A;  4MFK A;  4R9M A;  3DDD A;  3TOA A;  1PU9 A;  4X5K A;  4C7H A;  4CRY B;  4CGN A;  2BUE A;  2FT0 A;  5AG6 A;  1S7F A;  4F0Y A;  1IIC A;  2B5G A;  4AB7 A;  4KSF A;  2C27 A;  4KOX A;  4B14 A;  4JXQ A;  2OB0 A;  2Q04 A;  2ZW4 A;  2HQY A;  4MHD A;  5IV0 A;  2B3V A;  4QUS A;  5J8F A;  4MY3 A;  4QVT A;  4GS4 A;  5JQ4 A;  2H5M A;  4UCM A;  1BOB A;  3T9Y A;  4KVX A;  1I1D A;  4YRH A;  5A27 A;  1Q2Y A;  5J8C A;  2DXQ A;  4A2Z A;  3JUW A;  1P4N A;  3P2F A;  2FCK A;  3R9E A;  2REE A;  1TIQ A;  3IWE A;  1KUV A;  4II9 A;  2I79 A;  4KZT A;  2B58 A;  4JJX A;  1Z9U A;  3DNS A;  4NSQ A;  2P6F A;  3IU1 A;  1U6M A;  4KOS A;  4M85 A;  3V8I A;  4MY0 A;  2J8N A;  4YGO A;  4UA3 A;  2FSR A;  2J8R A;  1PUA A;  3R96 A;  4OLL A;  4KVO E;  2QML A;  4U9Z A;  5F46 A;  1I12 A;  2VBQ A;  1B87 A;  2O28 A;  3PZJ A;  4JLY A;  2BSW A;  4KOU A;  1P0H A;  4UWJ A;  3I3G A;  2NMT A;  2AJ6 A;  2BL1 A;  4AVB A;  2JDC A;  4L89 A;  4BBH A;  3SXO A;  2YGW A;  4QBJ A;  1FY7 A;  2PC1 A;  4MJ8 A;  2IL4 A;  3FIX A;  4QC6 A;  1IYK A;  3EO4 A;  3EY5 A;  4MFJ A;  2B3U A;  5C82 A;  2OH1 A;  3TO7 A;  1YX0 A;  2ATR A;  2EUI A;  1GHE A;  1WK4 A;  4MFL A;  2VI7 A;  4UFX A;  4I49 A;  4C2Y A;  3NE7 A;  2Q44 A;  3G8W A;  4CS0 B;  1L0C A;  3WR7 A;  3EFA A;  5ISV A;  3LOD A;  4HKF A;  2B4D A;  1KZF A;  4ZGY B;  4C68 A;  1YR0 A;  3F8K A;  5F47 A;  5KTC A;  4PSX A;  3VWD A;  4B11 A;  4A33 A;  4HNX B;  4YFJ A;  1UFH A;  4XNH C;  2ZPA A;  1CJW A;  4CGL A;  1M44 A;  2GIV A;  4L8A A;  4F6A A;  4B5P B;  4UFV A;  3FBU A;  4XPD C;  3TOB A;  4NF1 A;  4BMH A;  2YNC A;  3TT2 A;  2R8V A;  1YVK A;  1KUY A;  4H6Z A;  2Z3K A;  4KOT A;  4ONU A;  2Z3L A;  3N7Z A;  4IF5 A;  5DWM A;  1MJB A;  3D8P A;  1XF8 A;  1NE9 A;  2OU2 A;  1Y7R A;  5H86 A;  3LD2 A;  3OWC A;  1CM0 A;  1IYL A;  1MK4 A;  3PP9 A;  4PSW A;  3UY5 A;  3T90 A;  4RI1 A;  4UBR A;  3EC4 A;  3QAH A;  3R9F A;  5KTA A;  1QSR A;  2OZH A;  4OAD A;  4E2A A;  1KUX A;  4A31 A;  1J4J A;  4CAE A;  1YVO A;  4FD5 A;  3IWG A;  2D4O A;  1QSM A;  2Z3P A;  2Z3N A;  4NXY A;  4B13 A;  2Q0Y A;  4LX9 A;  3TCV A;  1S5K A;  3C26 A;  5EBV A;  4CYQ A;  4AVC A;  4UCN A;  1QST A;  2B4B A;  4Q36 A;  2YND A;  5HH1 A;  4KOR A;  1Q2D A;  2CXA A;  2JEV A;  3TTH A;  2QIR A;  5FVJ A;  4FD6 A;  2B5G B;  4XPL A;  2YNC C;  4E8O A;  1IB1 E;  3BJ8 A;  2GE3 A;  2REF A;  3DR6 A;  1NSL A;  4U9Y A;  2FXF A;  2KCW A;  1Y9K A;  2VQY A;  2JDD A;  3CXS A;  4JXR A;  4UFW A;  3K9U A;  3EXN A;  3FYN A;  2I00 A;  4U5Y A;  3KKW A;  4CYP A;  2VZY A;  4C2X A;  1S60 A;  1SQH A;  4KSA A;  4Y49 C;  2FE7 A;  5AG7 A;  1M1D A;  1RO5 A;  3ZZI A;  3TO9 A;  2Q4Y A;  1Y9W A;  5EC4 A;  3A9L A;  4Q38 A;  1MJA A;  3FB3 A;  2R7H A;  3FXT A;  4MFZ A;  2G0B A;  1R57 A;  2VXK A;  3ZJ0 A;  1YRE A;  3R9G A;  2ZW7 A;  4KLW A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...