4MI4A

Crystal structure of spermidine n-acetyltransferase from vibrio cholerae in complex with spermine
Total Genus 54
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
54
sequence length
170
structure length
170
Chain Sequence
NSQLTLRALERGDLRFIHNLNNNRNIMSYWFEEPYESFDELEELYNKHIHDNAERRFVVEDAQKNLIGLVELIEINYIHRSAEFQIIIAPEHQGKGFARTLINRALDYSFTILNLHKIYLHVAVENPKAVHLYEECGFVEEGHLVEEFFINGRYQDVKRMYILQSKYLNR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title A Novel Polyamine Allosteric Site of SpeG from Vibrio cholerae Is Revealed by Its Dodecameric Structure.
pubmed doi rcsb
source organism Vibrio cholerae o1 biovar el tor
molecule tags Transferase
molecule keywords Spermidine n1-acetyltransferase
total genus 54
structure length 170
sequence length 170
chains with identical sequence B, C
ec nomenclature ec 2.3.1.57: Diamine N-acetyltransferase.
pdb deposition date 2013-08-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13302 Acetyltransf_3 Acetyltransferase (GNAT) domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.630.30 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Aminopeptidase 4mi4A00
5IV0A 3FIXA 2OZUA 3EY5A 4R3LA 1Y9WA 4R57A 4CAWA 3I3GA 4KVME 1M4DA 3QB8A 4PSWA 1KUVA 1B87A 2BUEA 4NXYA 1I1DA 2VI7A 5E96A 1XF8A 2FS5A 4NF1A 4AVAA 3FB3A 4QBJA 3E0KA 2FCKA 3LD2A 1XIXA 3C26A 1P0HA 1OZPA 2J8MA 4KOVA 5GCNA 3S6KA 3LODA 4L89A 4M3SA 3SXOA 3EXNA 2Q44A 3FRMA 5J8CA 3R9EA 2REFA 3WR7A 5CNPA 3FXTA 4KUAA 2B4BA 4KOXA 2FXFA 1PU9A 2D4PA 3S6GA 1S7KA 2R98A 2GANA 4CAXA 3R95A 4QC6A 4F0YA 1S5KA 3TFYA 2OZGA 2J8NA 1M44A 3NE7A 3PZJA 3D2MA 3F5BA 2H5MA 5C82A 1QSNA 4XPLA 2WPXA 2JDDA 4KZTA 5FVJA 5HMNA 2ZW6A 3DR8A 2EVNA 4B5PA 4JLYA 2PR8A 4CRZB 3IGRA 5F46A 1Y7RA 5HH1A 1GHEA 3SXNA 3R9FA 2REEA 1J4JA 5I0CA 2B4DA 4LUAA 3MGDA 4CS0B 3G3SA 3TO7A 4ZBGA 5J8FA 3UY5A 4XNHB 5KTAA 1S7LA 4QUSA 3F8KA 3R96A 4MY0A 3SHPA 2Q7BA 1NE9A 2FE7A 3TOBA 4H6ZA 5F47A 1PUAA 2PQ8A 4MBUA 1B6BA 1I21A 4UA3A 4AVCA 4DNCA 4KOWA 4L8AA 2Y0MA 5H84A 4YFJA 4U9ZA 5EBVA 1L0CA 1YVOA 2P0WA 3S6HA 4YGOA 4CRYB 2FSRA 1XEBA 4R3KA 1M4IA 3P2HA 3I9SA 2PDOA 1P4NA 4MY3A 2O28A 3TTHA 4H6UA 4OLLA 4QB9A 2CNSA 2P6FA 5IB0A 3V8IA 2ZW7A 4HNWB 4ONUA 1WWZA 3IWGA 1IB1E 5DWMA 4FD6A 3T9YA 4JD6A 4U5YA 4KOTA 3RYOA 4F6AA 3FBUA 2DXQA 1IYLA 2BSWA 3DNSA 5KTCA 2NMTA 2ATRA 4KOYA 5ISVA 1V0CA 1IIDA 2OU2A 3EO4A 1Z9UA 2VZZA 4KOUA 1QSMA 2Q04A 4XPDC 1IICA 3EC4A 4KLWA 3D3SA 1M4GA 4E2AA 4PV6A 4K30A 1CJWA 1YGHA 2VXKA 2R8VA 3GY9A 4PK2A 2VZYA 2PRBA 4MJ8A 1MJAA 1KUXA 2VQYA 2G0BA 4GS4A 3W6SA 4JXQA 4RI1A 1S60A 2AE6A 1MK4A 1M1DA 2Z0ZA 2Z11A 5C88A 2ARHA 2Q4VA 3F0AA 2HV2A 2CNTA 2R7HA 1NSLA 1MJ9A 3VWEA 3EFAA 4Y49B 2G3TA 3OWCA 1TIQA 4OAEA 3TOAA 4NSQA 4E0AA 5EC4A 4KVOE 4OADA 2EUIA 1QSRA 4B5OA 3ZZIA 2D4OA 1YVKA 3BJ7A 2F5IA 4HNYB 4UBRA 2B58A 2QIRA 2FT0A 4KUBA 2B3UA 2OZHA 4R9MA 2B5GA 3JUWA 2VBQA 4IF5A 4R87A 3GKRA 3H4QA 4AG7A 3CXSA 1S7FA 3S6FA 1UFHA 4I49A 5JQ4A 2QMLA 4XPKA 2K5TA 2C27A 4UWJA 2KCWA 3TE4A 2X7BA 2AJ6A 4H89A 4QVTA 1N71A 1U6MA 2JDCA 1Z4RA 1WK4A 2QECA 2P6GA 1VHSA 3GYAA 3CXPA 1K4JA 4U9YA 5F49A 4YRHA 3TO6A 5H86A 4BMHA 3CXQA 4KOSA 1RO5A 1BOBA 1Z4EA 1SQHA 3T90A 3W6XA 4AG9A 2IL4A 4FD4A 3W91A 2ZPAA 4ORFA 4RS2A 4LX9A 4JXRA 1KUYA 2A4NA 3N7ZA 4J3GA 3ZJ0A 2ZXVA 1Y9KA 3QAHA 2PC1A 1MJBA 4AB7A 1ON0A 4AVBA 2Z10A 1Q2DA 4KLVA 4PK3A 2Q4YA 3DR6A 3TT2A 3BLNA 3PGPA 1IYKA 4CAVA 2J8RA 1I12A 4FD5A 4PSXA 4Y49C 2FIWA 1LRZA 3PP9A 1FY7A 3KKWA 3DDDA 3VWDA 3FYNA 1QSTA 2VEZA 4M85A 4II9A 2PR1A 2FIAA 1BO4A 2FL4A 4UWIA 2I79A 4IUSA 1YLEA 1CM0A 2CNMA 4XNHC 3TO9A 3TCVA 3G8WA 3D8PA 1S7NA 3D2PA 2P6EA 4X5KA 3K9UA 2HUZA 2WPWA 3R1KA 2OH1A 3FNCA 4NCZA 1VKCA 1YX0A 4XPDB 3B8GA 1Q2YA 1YR0A 1Q2CA 2B4DB 1QSOA 5JPHA 2B5GB 1XMTA 2ZW4A 1YREA 1R57A 2HQYA 4KORA 2GE3A 2I00A 2Q0YA 4HKFA 2CY2A 2JEVA 2ZW5A 1YK3A 1XE4A 2BEIA 4MHDA 4KVXA 1S3ZA 4B5PB 2R1IA 4MI4A 3R9GA 4JWPA 4JJXA 1NMTA 2PSWA 1RXTA 4FD7A 2BL1A 4EVYA 2JLMA 2B3VA 4HNXB 2OB0A 2GIVA 5IX3A 3JVNA 1KZFA 2G3AA 4E8OA 4NEXA 5DWNA 5F48A 3P2FA 3BJ8A 5KTDA 3DSBA 2RC4A
chains in the Genus database with same CATH superfamily
5IV0A 4A32A 3V7ZA 4UEZA 4A30A 3FIXA 2OZUA 3EY5A 4R3LA 1Y9WA 2ZEGA 4R57A 3I3GA 4KVME 4CAWA 3VH9A 1M4DA 3QB8A 4BD9A 4PSWA 1KUVA 1Z8LA 2EK9A 1Q7LA 1B87A 5K8NA 2BUEA 2PJ0A 2CTCA 1I1DA 4NXYA 2PRQA 4UCNA 3SJGA 2VI7A 5E96A 1AYEA 2DPTA 1XF8A 2IQ6A 2FS5A 3B3SA 2PJ7A 2ZEMA 4NF1A 4MHPA 4AVAA 1TKHA 1VHEA 2PE3A 3FB3A 4QBJA 3A9LA 3E0KA 4CYNA 4IHMA 4CGLA 2FCKA 4NGRA 3LD2A 1XIXA 4KS9A 3C26A 1FT7A 5DS0A 1YMEA 2FVGA 3KL9A 3BI0A 1P0HA 2J8MA 1OZPA 4KOVA 2PJ5A 5GCNA 3S6KA 3SI1A 1ZLHA 4IAVA 2AFUA 3PB8X 3GUXA 3LODA 2GREA 4L89A 4M3SA 3SXOA 3CPXA 2PJ6A 3EXNA 3RZAA 2QYVA 4UFXA 1YW4A 2PIZA 2Q44A 2RFHA 3FRMA 2AFMA 1HEEA 2REFA 2Q51A 3R9EA 3WR7A 5J8CA 5K8MA 5CNPA 3FXTA 4OC4A 4KUAA 3GLJA 1ELLP 3K2KA 2HB6A 1YQEA 2B4BA 4KOXA 4P44A 2FXFA 3D67A 4EWTA 1PU9A 4NJRA 2D4PA 7CPAA 1ARMA 4A94A 5THWA 3S6GA 1S7KA 2R98A 3SI2A 2GANA 4CAXA 3R95A 2C6CA 4MHZA 4QC6A 2EK8A 3KGQA 1PYTB 1Z2LA 4F0YA 1S5KA 2PJ1A 3H8FA 1LOKA 2Q43A 4PXBA 4X8IA 3RBUA 4OC2A 2OZGA 2YNDA 1YW6A 3PB4X 3WC7A 5I4MA 3TFYA 4MFJA 2VL1A 2J8NA 1M44A 3DLJA 4UFWA 3NE7A 3PZJA 3D2MA 4TNUA 3F5BA 3KASA 3PEIA 2H5MA 2Z3LA 4B14A 1UWYA 2WSAA 5C82A 1VIXA 2YNEA 1QSNA 4XPLA 4FAIA 3RNZA 2AFOA 3LACA 2WPXA 5JH9A 2PJ2A 2JDDA 3FMCA 4KZTA 5FVJA 2PCUA 4GXHA 2BCOA 5HMNA 3VATA 2O4HA 2BOAA 2ZW6A 2EVNA 1IOIA 3DR8A 4JLYA 5G1ZA 1CPSA 4B5PA 2PR8A 3V38A 4CRZB 4M6GA 3IGRA 1IU8A 5F46A 1Y7RA 5HH1A 1GHEA 3SXNA 2EWBA 3R9FA 1TKJA 1VHOA 1J4JA 2REEA 5I0CA 4UEFA 2B4DA 4LUAA 1Z8WA 3GIUA 3MGDA 1ZLIA 4PXEA 4CS0B 2GU2A 4P4FA 3G3SA 4F8ZA 3TO7A 4ZBGA 1X12A 5J8FA 4OC3A 4XNHB 3UY5A 5KTAA 5LYLA 1S7LA 4QUSA 2XEGA 4P4DA 2XEFA 4WWVA 1R43A 3F8KA 2QVPA 5LYDA 3R96A 5AG7A 4DJLA 4MY0A 3SHPA 1XRYA 3IO1A 2Z3MA 1HDUA 4P10A 2RB7A 2Q7BA 4MCSA 1NE9A 2FE7A 3SI0A 1CP7A 4IK2A 3QAYA 3TOBA 3NH5A 3ISXA 3KZWA 4H6ZA 4NGQA 5F47A 4FUUA 2PJBA 1CBXA 3BXMA 4LQGA 1PUAA 2PQ8A 4MBUA 1B6BA 4MCPA 3TX8A 4BBHA 1I21A 4CAFA 4UA3A 4LQ6A 4GM5A 5D8NA 2Q4ZA 4AVCA 2IMOA 4JZ0A 5A28A 4DNCA 4KOWA 4L8AA 1RTQA 2Y0MA 2AFZA 5H84A 4CGPA 4U9ZA 2IJZA 4YFJA 2V8VA 5EBVA 3D7FA 4NJQA 1L0CA 1JQGA 4ZGYB 5CBMA 1YVOA 2P0WA 4OC1A 3S6HA 4F9UA 4CGNA 4CYOA 3B35A 3JRUA 4YGOA 4CRYB 1Z5RA 1Y7EA 3ISZA 2FSRA 1XEBA 4R3KA 1CG2A 1M4IA 3P2HA 3I9SA 2PDOA 2WYRA 1P4NA 4MY3A 2O28A 3TTHA 4MFZA 4H6UA 4OLLA 1DTDA 4QB9A 2CNSA 1TKFA 2P6FA 3D7GA 5IB0A 3S9NA 3V8IA 2PIYA 2ZW7A 3D4UA 2CTBA 3FEDA 4HNWB 5G22A 4C7HA 4ONUA 1IY7A 1WWZA 2OOTA 1TF8A 2HC9A 1IB1E 3IWGA 4DYOA 2I3CA 5DWMA 4B11A 4FWUA 4FD6A 3T9YA 4B10A 4JD6A 4U5YA 5D29A 4OP4A 2ZENA 4KOTA 2J9AA 3RYOA 3LWUA 4F6AA 2ZEFA 3FBUA 1F57A 2DXQA 1IYLA 2BSWA 3DNSA 5KTCA 2PJCA 4PQAA 4B12A 1XMBA 1ZO0A 2NMTA 3JTKA 1H8LA 5LYIA 4CYQA 3IWWA 2ATRA 2V8HA 4KOYA 5ISVA 1V0CA 1X10A 1IIDA 5K8PA 5F09A 2PVVA 1BPMA 2OU2A 4P45A 3EO4A 1YSJA 4PXDA 3KHXA 4C2XA 3IJ3A 4NGNA 1Z9UA 2YGWA 3WC5A 2C6PA 2VZZA 5AG5A 3B7IA 4KOUA 2Q04A 1QSMA 4R7MA 1BLLE 5EMIA 4XPDC 1IICA 4CGOA 4P4IA 1A2ZA 2EO8A 3EC4A 4FBEA 1TF9A 4KLWA 3D3SA 3CT9A 3NA6A 1M4GA 3BHXA 4MHNA 2V8GA 5HVFA 4E2AA 4RN7A 4PV6A 1TXRA 4PXCA 3KQZA 3IU2A 4Q7AA 4ZY1A 2F8HA 4K30A 1CJWA 4P6YA 5BWAB 1YGHA 2VXKA 2R8VA 3CDXA 3GY9A 1F2PA 4MRIA 4PK2A 2VZYA 2PJ4A 2PRBA 4MFPA 4JYWA 3VARA 1BPNA 1NSAA 4A95A 4MJ8A 5HXDA 1MJAA 1KUXA 2VQYA 2G0BA 5G20A 4GS4A 4R76A 3W6SA 2PJ9A 4JXQA 1S60A 4RI1A 2AE6A 1MK4A 3NFZA 2ZEHA 1M1DA 2Z0ZA 2Z11A 2ZEOA 3FH4A 3I1UA 4CPAA 4CYPA 5C88A 1LAPA 3LMSA 4A33A 2EBJA 2ARHA 2Q4VA 3F0AA 3HUVA 3PFEA 4TWEA 2HV2A 2CNTA 1Z8XA 3B2YA 2R7HA 3FEEA 1BAVA 4NGTA 1NSLA 1CPXA 1MJ9A 3VWEA 3EFAA 3KI9A 3B3VA 2G3TA 4Y49B 2C1CA 3OWCA 4NGMA 1Y0RA 1TIQA 4KSFA 4OAEA 2PJ3A 4M6IA 3TOAA 4A2ZA 4NSQA 3PB7X 3IEHA 4E0AA 1ZG9A 4MMOA 2ZELA 5EC4A 4KVOE 4OADA 2EUIA 4UF4A 4KSAA 1QSRA 2ZOFA 2ZOGA 4BINA 1AUGA 4OKOA 3ZZIA 4B5OA 3GB0A 1Y0YA 2D4OA 4ZX8A 2ABZA 1YVKA 2ODFA 3B3TA 3BJ7A 4Q38A 1F2OA 2F5IA 4HNYB 4NFRA 4UBRA 4HPSA 2B58A 1ELMP 3FVLA 1HDQA 2QIRA 4O23A 2FT0A 4KUBA 2CXAA 2B3UA 4H2KA 2OZHA 4R9MA 2B5GA 3JUWA 2VBQA 2GLJA 4A31A 5LRJA 4IF5A 1XBUA 5JGFA 4R87A 3IIBA 3GKRA 4UCPA 1CX8A 2XEJA 2ANPA 3H4QA 4AG7A 3MN8A 1FNOA 3B3CA 1QQ9A 3CXSA 1S7FA 3D7DA 4P4BA 3S6FA 1UFHA 3KQXA 4I49A 3SJXA 3CZXA 5JQ4A 4A39A 2QMLA 2ZEPA 4XPKA 4ZI6A 2K5TA 4NGSA 2C27A 4UWJA 4ZX9A 2KCWA 3TE4A 4Q36A 4AXVA 2X7BA 1EE3P 4G1PA 2AJ6A 2NSMA 4ZY2A 4H89A 4QVTA 1N71A 1U6MA 2JDCA 5CPAA 1ZG8A 4OMEA 1Z4RA 2Q7SA 1WK4A 3L2NA 4A38A 2QECA 2P6GA 1VHSA 3GYAA 3CXPA 1IOFA 1K4JA 3H5ZA 4U9YA 5F49A 4YRHA 2JBKA 1LANA 3TO6A 5H86A 2POKA 4BMHA 1LAMA 2OR4A 1M4LA 3CXQA 3WABA 4KOSA 4EFDA 4M6HA 1RO5A 1BOBA 2WUUA 4KSIA 1Z4EA 4MCRA 4OIWA 1SQHA 2XEIA 3PBBA 3T8WA 2GFQA 3T90A 4C2ZA 3W6XA 4AG9A 2IL4A 4FD4A 1JWQA 3W91A 2ZPAA 4ONWA 5ELYA 3KR5A 4ORFA 3S9LA 1XFOA 4RS2A 4LX9A 4C68A 4JXRA 1KUYA 4MFKA 2A4NA 3N7ZA 4J3GA 3ZJ0A 2V77A 2ZXVA 1Y9KA 3QAHA 2PC1A 4RUHA 1MJBA 1VGYA 4AB7A 1ON0A 4AVBA 2Z10A 1Q2DA 2NYQA 2YNCC 3PB9X 3SJFA 4KLVA 4PK3A 4MXUA 2Q4YA 3DR6A 4UIBA 3KR4A 8CPAA 3TT2A 3WT4A 2F7VA 3BLNA 4MHYA 3PGPA 3FX6A 3FECA 5K8OA 4CGMA 1IYKA 4CAVA 2J8RA 4PPZA 1I12A 1Z8TA 4FD5A 2DF5A 4B13A 1IGBA 3CPAA 4PSXA 5LYFA 2Z3NA 4Y49C 3MRUA 2FIWA 1LRZA 3PP9A 3RAMA 3TC8A 1FY7A 3KKWA 3DDDA 4ZY0A 3VWDA 3FYNA 1QSTA 2VEZA 4M85A 4II9A 2PR1A 2BO9A 2Z3KA 1DE4C 2FIAA 3D68A 1BO4A 5KTDA 3PB6X 2WZNA 2AFSA 2PJ8A 4ZYQA 4EMEA 2FL4A 2O53A 4OC0A 4NGPA 4YU9A 4MCQA 4UWIA 2I79A 3NH4A 4W9YA 4IUSA 5LRGA 3PBEA 1YLEA 1CM0A 2CNMA 2YNCA 3NH8A 4XNHC 1GYTA 2PVWA 3TO9A 3TCVA 3G8WA 4MFLA 3D8PA 1S7NA 1LFWA 1YLOA 4R6TA 1KWMA 3D2PA 1QMUA 4UFVA 2Z3OA 3RO0A 2P6EA 3IFEA 3K9UA 2HUZA 4X5KA 5AG6A 2WPWA 3R1KA 2OH1A 1R3NA 3FNCA 5G21A 3H8EA 4B6ZA 4DUKA 3SJEA 4NCZA 3FF3A 4CAEA 1VKCA 4C7IA 1YX0A 2JBJA 4XPDB 3D7HA 3B8GA 4UIAA 3PFOA 1Q2YA 1YR0A 4WJBA 1Q2CA 2B4DB 1QSOA 2QJ8A 4F9VA 5JPHA 5AGEA 2B5GB 5J1QA 1XMTA 2CF4A 1LCPA 2DPSA 5A27A 2C6GA 2ZW4A 3QNVA 2V8DA 2AFXA 5JM6A 5HVHA 1YREA 5HVGA 2ZEEA 1CP6A 1R57A 2HQYA 4KORA 4YWYA 2GE3A 2I00A 3B3WA 1ZG7A 1PCAA 2Q0YA 4P4JA 1AMPA 4P4EA 3IU1A 3K9TA 2CY2A 4HKFA 2DEAA 2JEVA 1YK3A 2GLFA 2PJAA 2ZW5A 4F0XA 4OIDA 6CPAA 1XE4A 4X3RA 1XOVA 5IB9A 2BEIA 4MHDA 4KVXA 3DGVA 3NE8A 4X2TA 2G9DA 5LRKA 2Z3PA 1S3ZA 4B5PB 3WC6A 3D66A 2R1IA 4MI4A 3BI1A 3KHZA 3N5FA 3IC1A 3R9GA 3S9MA 3FJUA 2JEWA 1OBRA 4JWPA 4JJXA 1NMTA 4R8FA 2CIJA 4UCMA 2PSWA 3HLPA 1RXTA 4FD7A 4UEEA 4A37A 2BL1A 4EVYA 4Z65A 1XJOA 2JLMA 2B3VA 4HNXB 3H8GA 2OB0A 2GIVA 5IX3A 3JVNA 3PRTA 1KZFA 4C2YA 4K3NA 2G3AA 4E8OA 4NEXA 5DWNA 4MFQA 2ZEDA 5F48A 5AG4A 3P2FA 1ARLA 3IWEA 3BJ8A 2AFWA 3DSBA 4OC5A 2RC4A
chains in the Genus database with same CATH topology
5IV0A 4A32A 4A30A 3FIXA 2OZUA 3EY5A 4R3LA 1Y9WA 4R57A 4CAWA 3I3GA 4KVME 1M4DA 3QB8A 4PSWA 1KUVA 1B87A 2BUEA 4NXYA 1I1DA 4UCNA 2VI7A 5E96A 2DPTA 1XF8A 2FS5A 4NF1A 4AVAA 3FB3A 4QBJA 3A9LA 3E0KA 4CYNA 4CGLA 2FCKA 3LD2A 1XIXA 4KS9A 3C26A 1P0HA 1OZPA 2J8MA 4KOVA 5GCNA 3S6KA 3LODA 4L89A 4M3SA 3SXOA 3EXNA 4UFXA 2Q44A 3FRMA 5J8CA 3R9EA 2REFA 3WR7A 5CNPA 3FXTA 4KUAA 2B4BA 4KOXA 2FXFA 1PU9A 2D4PA 3S6GA 1S7KA 2R98A 2GANA 4CAXA 3R95A 4QC6A 4F0YA 1S5KA 3TFYA 2OZGA 2YNDA 4MFJA 2J8NA 1M44A 4UFWA 3NE7A 3PZJA 3D2MA 3F5BA 2H5MA 2Z3LA 4B14A 2WSAA 5C82A 2YNEA 1QSNA 4XPLA 2WPXA 2JDDA 4KZTA 5FVJA 5HMNA 2ZW6A 3DR8A 2EVNA 5G1ZA 4B5PA 4JLYA 2PR8A 4CRZB 3IGRA 5F46A 1Y7RA 5HH1A 1GHEA 3SXNA 3R9FA 2REEA 1J4JA 5I0CA 2B4DA 4LUAA 3MGDA 4CS0B 3G3SA 3TO7A 4ZBGA 5J8FA 3UY5A 4XNHB 5KTAA 1S7LA 4QUSA 3F8KA 3R96A 5AG7A 4MY0A 3SHPA 2Z3MA 2Q7BA 1NE9A 2FE7A 3TOBA 4H6ZA 5F47A 1PUAA 2PQ8A 4MBUA 1B6BA 4BBHA 1I21A 4CAFA 4UA3A 4AVCA 5A28A 4DNCA 4KOWA 4L8AA 2Y0MA 5H84A 4CGPA 4YFJA 4U9ZA 5EBVA 1L0CA 4ZGYB 1YVOA 2P0WA 3S6HA 4CGNA 4CYOA 4YGOA 4CRYB 2FSRA 1XEBA 4R3KA 1M4IA 3P2HA 3I9SA 2PDOA 1P4NA 4MY3A 2O28A 3TTHA 4MFZA 4H6UA 4OLLA 4QB9A 2CNSA 2P6FA 5IB0A 3V8IA 2ZW7A 5G22A 4HNWB 4C7HA 4ONUA 1WWZA 3IWGA 1IB1E 5DWMA 4B11A 4FD6A 3T9YA 4B10A 4JD6A 4U5YA 4KOTA 3RYOA 4F6AA 3FBUA 2DXQA 1IYLA 2BSWA 3DNSA 5KTCA 4B12A 1ZO0A 2NMTA 3JTKA 4CYQA 2ATRA 4KOYA 5ISVA 1V0CA 1IIDA 2OU2A 3EO4A 4C2XA 1Z9UA 2YGWA 2VZZA 5AG5A 4KOUA 1QSMA 2Q04A 4XPDC 1IICA 4CGOA 3EC4A 4KLWA 3D3SA 1M4GA 4E2AA 4PV6A 3IU2A 4K30A 1CJWA 5BWAB 1YGHA 2VXKA 2R8VA 3GY9A 4PK2A 2VZYA 2PRBA 4MFPA 4A95A 4MJ8A 1MJAA 1KUXA 2VQYA 2G0BA 5G20A 4GS4A 3W6SA 4JXQA 4RI1A 1S60A 2AE6A 1MK4A 1M1DA 2Z0ZA 2Z11A 4CYPA 5C88A 4A33A 2ARHA 2Q4VA 3F0AA 2HV2A 2CNTA 2R7HA 1NSLA 1MJ9A 3VWEA 3EFAA 4Y49B 2G3TA 3OWCA 4KSFA 1TIQA 4OAEA 3TOAA 4A2ZA 4NSQA 4E0AA 5EC4A 4KVOE 4OADA 2EUIA 4KSAA 1QSRA 4B5OA 3ZZIA 2D4OA 1YVKA 4Q38A 3BJ7A 2F5IA 4HNYB 4UBRA 2B58A 2QIRA 2FT0A 4KUBA 2CXAA 2B3UA 2OZHA 4R9MA 2B5GA 3JUWA 2VBQA 4A31A 4IF5A 4R87A 3GKRA 4UCPA 3H4QA 4AG7A 3CXSA 1S7FA 3S6FA 1UFHA 4I49A 5JQ4A 2QMLA 4XPKA 2K5TA 2C27A 4UWJA 2KCWA 3TE4A 4Q36A 2X7BA 2AJ6A 4H89A 4QVTA 1N71A 1U6MA 2JDCA 1Z4RA 1WK4A 2QECA 2P6GA 1VHSA 3GYAA 3CXPA 1K4JA 4U9YA 3H5ZA 5F49A 4YRHA 3TO6A 5H86A 4BMHA 3CXQA 4KOSA 1RO5A 1BOBA 2WUUA 1Z4EA 1SQHA 3T90A 4C2ZA 3W6XA 4AG9A 2IL4A 4FD4A 3W91A 2ZPAA 4ORFA 4RS2A 4LX9A 4C68A 4JXRA 1KUYA 4MFKA 2A4NA 3N7ZA 4J3GA 3ZJ0A 2ZXVA 1Y9KA 3QAHA 2PC1A 1MJBA 4AB7A 1ON0A 4AVBA 2Z10A 1Q2DA 2YNCC 4KLVA 4PK3A 2Q4YA 3DR6A 3TT2A 3BLNA 3PGPA 4CGMA 1IYKA 4CAVA 2J8RA 1I12A 4FD5A 4B13A 4PSXA 2Z3NA 4Y49C 2FIWA 1LRZA 3PP9A 1FY7A 3KKWA 3DDDA 3VWDA 3FYNA 1QSTA 2VEZA 4M85A 4II9A 2PR1A 2Z3KA 2FIAA 1BO4A 2FL4A 4UWIA 2I79A 4IUSA 1YLEA 1CM0A 2CNMA 2YNCA 4XNHC 3TO9A 3TCVA 3G8WA 4MFLA 3D8PA 1S7NA 4UFVA 3D2PA 2Z3OA 2P6EA 4X5KA 3K9UA 2HUZA 5AG6A 2WPWA 3R1KA 2OH1A 3FNCA 5G21A 4NCZA 4CAEA 1VKCA 4C7IA 1YX0A 4XPDB 3B8GA 1Q2YA 1YR0A 1Q2CA 2B4DB 1QSOA 5JPHA 5AGEA 2B5GB 1XMTA 5A27A 2DPSA 2ZW4A 1YREA 1R57A 2HQYA 4KORA 2GE3A 2I00A 2Q0YA 3IU1A 4HKFA 2CY2A 2JEVA 2ZW5A 1YK3A 4F0XA 1XE4A 2BEIA 4MHDA 4KVXA 2Z3PA 1S3ZA 4B5PB 2R1IA 4MI4A 3R9GA 4JWPA 4JJXA 1NMTA 4UCMA 2PSWA 1RXTA 4FD7A 2BL1A 4EVYA 2JLMA 2B3VA 4HNXB 2OB0A 2GIVA 5IX3A 3JVNA 1KZFA 4C2YA 2G3AA 4E8OA 4NEXA 5DWNA 4MFQA 5F48A 5AG4A 3P2FA 3IWEA 3BJ8A 5KTDA 3DSBA 2RC4A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5IV0 A;  3FIX A;  2OZU A;  3EY5 A;  4R3L A;  1Y9W A;  4R57 A;  4CAW A;  3I3G A;  4KVM E;  1M4D A;  3QB8 A;  4PSW A;  1KUV A;  1B87 A;  2BUE A;  4NXY A;  1I1D A;  2VI7 A;  5E96 A;  1XF8 A;  2FS5 A;  4NF1 A;  4AVA A;  3FB3 A;  4QBJ A;  3E0K A;  2FCK A;  3LD2 A;  1XIX A;  3C26 A;  1P0H A;  1OZP A;  2J8M A;  4KOV A;  5GCN A;  3S6K A;  3LOD A;  4L89 A;  4M3S A;  3SXO A;  3EXN A;  2Q44 A;  3FRM A;  5J8C A;  3R9E A;  2REF A;  3WR7 A;  5CNP A;  3FXT A;  4KUA A;  2B4B A;  4KOX A;  2FXF A;  1PU9 A;  2D4P A;  3S6G A;  1S7K A;  2R98 A;  2GAN A;  4CAX A;  3R95 A;  4QC6 A;  4F0Y A;  1S5K A;  3TFY A;  2OZG A;  2J8N A;  1M44 A;  3NE7 A;  3PZJ A;  3D2M A;  3F5B A;  2H5M A;  5C82 A;  1QSN A;  4XPL A;  2WPX A;  2JDD A;  4KZT A;  5FVJ A;  5HMN A;  2ZW6 A;  3DR8 A;  2EVN A;  4B5P A;  4JLY A;  2PR8 A;  4CRZ B;  3IGR A;  5F46 A;  1Y7R A;  5HH1 A;  1GHE A;  3SXN A;  3R9F A;  2REE A;  1J4J A;  5I0C A;  2B4D A;  4LUA A;  3MGD A;  4CS0 B;  3G3S A;  3TO7 A;  4ZBG A;  5J8F A;  3UY5 A;  4XNH B;  5KTA A;  1S7L A;  4QUS A;  3F8K A;  3R96 A;  4MY0 A;  3SHP A;  2Q7B A;  1NE9 A;  2FE7 A;  3TOB A;  4H6Z A;  5F47 A;  1PUA A;  2PQ8 A;  4MBU A;  1B6B A;  1I21 A;  4UA3 A;  4AVC A;  4DNC A;  4KOW A;  4L8A A;  2Y0M A;  5H84 A;  4YFJ A;  4U9Z A;  5EBV A;  1L0C A;  1YVO A;  2P0W A;  3S6H A;  4YGO A;  4CRY B;  2FSR A;  1XEB A;  4R3K A;  1M4I A;  3P2H A;  3I9S A;  2PDO A;  1P4N A;  4MY3 A;  2O28 A;  3TTH A;  4H6U A;  4OLL A;  4QB9 A;  2CNS A;  2P6F A;  5IB0 A;  3V8I A;  2ZW7 A;  4HNW B;  4ONU A;  1WWZ A;  3IWG A;  1IB1 E;  5DWM A;  4FD6 A;  3T9Y A;  4JD6 A;  4U5Y A;  4KOT A;  3RYO A;  4F6A A;  3FBU A;  2DXQ A;  1IYL A;  2BSW A;  3DNS A;  5KTC A;  2NMT A;  2ATR A;  4KOY A;  5ISV A;  1V0C A;  1IID A;  2OU2 A;  3EO4 A;  1Z9U A;  2VZZ A;  4KOU A;  1QSM A;  2Q04 A;  4XPD C;  1IIC A;  3EC4 A;  4KLW A;  3D3S A;  1M4G A;  4E2A A;  4PV6 A;  4K30 A;  1CJW A;  1YGH A;  2VXK A;  2R8V A;  3GY9 A;  4PK2 A;  2VZY A;  2PRB A;  4MJ8 A;  1MJA A;  1KUX A;  2VQY A;  2G0B A;  4GS4 A;  3W6S A;  4JXQ A;  4RI1 A;  1S60 A;  2AE6 A;  1MK4 A;  1M1D A;  2Z0Z A;  2Z11 A;  5C88 A;  2ARH A;  2Q4V A;  3F0A A;  2HV2 A;  2CNT A;  2R7H A;  1NSL A;  1MJ9 A;  3VWE A;  3EFA A;  4Y49 B;  2G3T A;  3OWC A;  1TIQ A;  4OAE A;  3TOA A;  4NSQ A;  4E0A A;  5EC4 A;  4KVO E;  4OAD A;  2EUI A;  1QSR A;  4B5O A;  3ZZI A;  2D4O A;  1YVK A;  3BJ7 A;  2F5I A;  4HNY B;  4UBR A;  2B58 A;  2QIR A;  2FT0 A;  4KUB A;  2B3U A;  2OZH A;  4R9M A;  2B5G A;  3JUW A;  2VBQ A;  4IF5 A;  4R87 A;  3GKR A;  3H4Q A;  4AG7 A;  3CXS A;  1S7F A;  3S6F A;  1UFH A;  4I49 A;  5JQ4 A;  2QML A;  4XPK A;  2K5T A;  2C27 A;  4UWJ A;  2KCW A;  3TE4 A;  2X7B A;  2AJ6 A;  4H89 A;  4QVT A;  1N71 A;  1U6M A;  2JDC A;  1Z4R A;  1WK4 A;  2QEC A;  2P6G A;  1VHS A;  3GYA A;  3CXP A;  1K4J A;  4U9Y A;  5F49 A;  4YRH A;  3TO6 A;  5H86 A;  4BMH A;  3CXQ A;  4KOS A;  1RO5 A;  1BOB A;  1Z4E A;  1SQH A;  3T90 A;  3W6X A;  4AG9 A;  2IL4 A;  4FD4 A;  3W91 A;  2ZPA A;  4ORF A;  4RS2 A;  4LX9 A;  4JXR A;  1KUY A;  2A4N A;  3N7Z A;  4J3G A;  3ZJ0 A;  2ZXV A;  1Y9K A;  3QAH A;  2PC1 A;  1MJB A;  4AB7 A;  1ON0 A;  4AVB A;  2Z10 A;  1Q2D A;  4KLV A;  4PK3 A;  2Q4Y A;  3DR6 A;  3TT2 A;  3BLN A;  3PGP A;  1IYK A;  4CAV A;  2J8R A;  1I12 A;  4FD5 A;  4PSX A;  4Y49 C;  2FIW A;  1LRZ A;  3PP9 A;  1FY7 A;  3KKW A;  3DDD A;  3VWD A;  3FYN A;  1QST A;  2VEZ A;  4M85 A;  4II9 A;  2PR1 A;  2FIA A;  1BO4 A;  2FL4 A;  4UWI A;  2I79 A;  4IUS A;  1YLE A;  1CM0 A;  2CNM A;  4XNH C;  3TO9 A;  3TCV A;  3G8W A;  3D8P A;  1S7N A;  3D2P A;  2P6E A;  4X5K A;  3K9U A;  2HUZ A;  2WPW A;  3R1K A;  2OH1 A;  3FNC A;  4NCZ A;  1VKC A;  1YX0 A;  4XPD B;  3B8G A;  1Q2Y A;  1YR0 A;  1Q2C A;  2B4D B;  1QSO A;  5JPH A;  2B5G B;  1XMT A;  2ZW4 A;  1YRE A;  1R57 A;  2HQY A;  4KOR A;  2GE3 A;  2I00 A;  2Q0Y A;  4HKF A;  2CY2 A;  2JEV A;  2ZW5 A;  1YK3 A;  1XE4 A;  2BEI A;  4MHD A;  4KVX A;  1S3Z A;  4B5P B;  2R1I A;  4MI4 A;  3R9G A;  4JWP A;  4JJX A;  1NMT A;  2PSW A;  1RXT A;  4FD7 A;  2BL1 A;  4EVY A;  2JLM A;  2B3V A;  4HNX B;  2OB0 A;  2GIV A;  5IX3 A;  3JVN A;  1KZF A;  2G3A A;  4E8O A;  4NEX A;  5DWN A;  5F48 A;  3P2F A;  3BJ8 A;  5KTD A;  3DSB A;  2RC4 A; 
#chains in the Genus database with same CATH topology
 5IV0 A;  4A32 A;  3V7Z A;  4UEZ A;  4A30 A;  3FIX A;  2OZU A;  3EY5 A;  4R3L A;  1Y9W A;  2ZEG A;  4R57 A;  3I3G A;  4KVM E;  4CAW A;  3VH9 A;  1M4D A;  3QB8 A;  4BD9 A;  4PSW A;  1KUV A;  1Z8L A;  2EK9 A;  1Q7L A;  1B87 A;  5K8N A;  2BUE A;  2PJ0 A;  2CTC A;  1I1D A;  4NXY A;  2PRQ A;  4UCN A;  3SJG A;  2VI7 A;  5E96 A;  1AYE A;  2DPT A;  1XF8 A;  2IQ6 A;  2FS5 A;  3B3S A;  2PJ7 A;  2ZEM A;  4NF1 A;  4MHP A;  4AVA A;  1TKH A;  1VHE A;  2PE3 A;  3FB3 A;  4QBJ A;  3A9L A;  3E0K A;  4CYN A;  4IHM A;  4CGL A;  2FCK A;  4NGR A;  3LD2 A;  1XIX A;  4KS9 A;  3C26 A;  1FT7 A;  5DS0 A;  1YME A;  2FVG A;  3KL9 A;  3BI0 A;  1P0H A;  2J8M A;  1OZP A;  4KOV A;  2PJ5 A;  5GCN A;  3S6K A;  3SI1 A;  1ZLH A;  4IAV A;  2AFU A;  3PB8 X;  3GUX A;  3LOD A;  2GRE A;  4L89 A;  4M3S A;  3SXO A;  3CPX A;  2PJ6 A;  3EXN A;  3RZA A;  2QYV A;  4UFX A;  1YW4 A;  2PIZ A;  2Q44 A;  2RFH A;  3FRM A;  2AFM A;  1HEE A;  2REF A;  2Q51 A;  3R9E A;  3WR7 A;  5J8C A;  5K8M A;  5CNP A;  3FXT A;  4OC4 A;  4KUA A;  3GLJ A;  1ELL P;  3K2K A;  2HB6 A;  1YQE A;  2B4B A;  4KOX A;  4P44 A;  2FXF A;  3D67 A;  4EWT A;  1PU9 A;  4NJR A;  2D4P A;  7CPA A;  1ARM A;  4A94 A;  5THW A;  3S6G A;  1S7K A;  2R98 A;  3SI2 A;  2GAN A;  4CAX A;  3R95 A;  2C6C A;  4MHZ A;  4QC6 A;  2EK8 A;  3KGQ A;  1PYT B;  1Z2L A;  4F0Y A;  1S5K A;  2PJ1 A;  3H8F A;  1LOK A;  2Q43 A;  4PXB A;  4X8I A;  3RBU A;  4OC2 A;  2OZG A;  2YND A;  1YW6 A;  3PB4 X;  3WC7 A;  5I4M A;  3TFY A;  4MFJ A;  2VL1 A;  2J8N A;  1M44 A;  3DLJ A;  4UFW A;  3NE7 A;  3PZJ A;  3D2M A;  4TNU A;  3F5B A;  3KAS A;  3PEI A;  2H5M A;  2Z3L A;  4B14 A;  1UWY A;  2WSA A;  5C82 A;  1VIX A;  2YNE A;  1QSN A;  4XPL A;  4FAI A;  3RNZ A;  2AFO A;  3LAC A;  2WPX A;  5JH9 A;  2PJ2 A;  2JDD A;  3FMC A;  4KZT A;  5FVJ A;  2PCU A;  4GXH A;  2BCO A;  5HMN A;  3VAT A;  2O4H A;  2BOA A;  2ZW6 A;  2EVN A;  1IOI A;  3DR8 A;  4JLY A;  5G1Z A;  1CPS A;  4B5P A;  2PR8 A;  3V38 A;  4CRZ B;  4M6G A;  3IGR A;  1IU8 A;  5F46 A;  1Y7R A;  5HH1 A;  1GHE A;  3SXN A;  2EWB A;  3R9F A;  1TKJ A;  1VHO A;  1J4J A;  2REE A;  5I0C A;  4UEF A;  2B4D A;  4LUA A;  1Z8W A;  3GIU A;  3MGD A;  1ZLI A;  4PXE A;  4CS0 B;  2GU2 A;  4P4F A;  3G3S A;  4F8Z A;  3TO7 A;  4ZBG A;  1X12 A;  5J8F A;  4OC3 A;  4XNH B;  3UY5 A;  5KTA A;  5LYL A;  1S7L A;  4QUS A;  2XEG A;  4P4D A;  2XEF A;  4WWV A;  1R43 A;  3F8K A;  2QVP A;  5LYD A;  3R96 A;  5AG7 A;  4DJL A;  4MY0 A;  3SHP A;  1XRY A;  3IO1 A;  2Z3M A;  1HDU A;  4P10 A;  2RB7 A;  2Q7B A;  4MCS A;  1NE9 A;  2FE7 A;  3SI0 A;  1CP7 A;  4IK2 A;  3QAY A;  3TOB A;  3NH5 A;  3ISX A;  3KZW A;  4H6Z A;  4NGQ A;  5F47 A;  4FUU A;  2PJB A;  1CBX A;  3BXM A;  4LQG A;  1PUA A;  2PQ8 A;  4MBU A;  1B6B A;  4MCP A;  3TX8 A;  4BBH A;  1I21 A;  4CAF A;  4UA3 A;  4LQ6 A;  4GM5 A;  5D8N A;  2Q4Z A;  4AVC A;  2IMO A;  4JZ0 A;  5A28 A;  4DNC A;  4KOW A;  4L8A A;  1RTQ A;  2Y0M A;  2AFZ A;  5H84 A;  4CGP A;  4U9Z A;  2IJZ A;  4YFJ A;  2V8V A;  5EBV A;  3D7F A;  4NJQ A;  1L0C A;  1JQG A;  4ZGY B;  5CBM A;  1YVO A;  2P0W A;  4OC1 A;  3S6H A;  4F9U A;  4CGN A;  4CYO A;  3B35 A;  3JRU A;  4YGO A;  4CRY B;  1Z5R A;  1Y7E A;  3ISZ A;  2FSR A;  1XEB A;  4R3K A;  1CG2 A;  1M4I A;  3P2H A;  3I9S A;  2PDO A;  2WYR A;  1P4N A;  4MY3 A;  2O28 A;  3TTH A;  4MFZ A;  4H6U A;  4OLL A;  1DTD A;  4QB9 A;  2CNS A;  1TKF A;  2P6F A;  3D7G A;  5IB0 A;  3S9N A;  3V8I A;  2PIY A;  2ZW7 A;  3D4U A;  2CTB A;  3FED A;  4HNW B;  5G22 A;  4C7H A;  4ONU A;  1IY7 A;  1WWZ A;  2OOT A;  1TF8 A;  2HC9 A;  1IB1 E;  3IWG A;  4DYO A;  2I3C A;  5DWM A;  4B11 A;  4FWU A;  4FD6 A;  3T9Y A;  4B10 A;  4JD6 A;  4U5Y A;  5D29 A;  4OP4 A;  2ZEN A;  4KOT A;  2J9A A;  3RYO A;  3LWU A;  4F6A A;  2ZEF A;  3FBU A;  1F57 A;  2DXQ A;  1IYL A;  2BSW A;  3DNS A;  5KTC A;  2PJC A;  4PQA A;  4B12 A;  1XMB A;  1ZO0 A;  2NMT A;  3JTK A;  1H8L A;  5LYI A;  4CYQ A;  3IWW A;  2ATR A;  2V8H A;  4KOY A;  5ISV A;  1V0C A;  1X10 A;  1IID A;  5K8P A;  5F09 A;  2PVV A;  1BPM A;  2OU2 A;  4P45 A;  3EO4 A;  1YSJ A;  4PXD A;  3KHX A;  4C2X A;  3IJ3 A;  4NGN A;  1Z9U A;  2YGW A;  3WC5 A;  2C6P A;  2VZZ A;  5AG5 A;  3B7I A;  4KOU A;  2Q04 A;  1QSM A;  4R7M A;  1BLL E;  5EMI A;  4XPD C;  1IIC A;  4CGO A;  4P4I A;  1A2Z A;  2EO8 A;  3EC4 A;  4FBE A;  1TF9 A;  4KLW A;  3D3S A;  3CT9 A;  3NA6 A;  1M4G A;  3BHX A;  4MHN A;  2V8G A;  5HVF A;  4E2A A;  4RN7 A;  4PV6 A;  1TXR A;  4PXC A;  3KQZ A;  3IU2 A;  4Q7A A;  4ZY1 A;  2F8H A;  4K30 A;  1CJW A;  4P6Y A;  5BWA B;  1YGH A;  2VXK A;  2R8V A;  3CDX A;  3GY9 A;  1F2P A;  4MRI A;  4PK2 A;  2VZY A;  2PJ4 A;  2PRB A;  4MFP A;  4JYW A;  3VAR A;  1BPN A;  1NSA A;  4A95 A;  4MJ8 A;  5HXD A;  1MJA A;  1KUX A;  2VQY A;  2G0B A;  5G20 A;  4GS4 A;  4R76 A;  3W6S A;  2PJ9 A;  4JXQ A;  1S60 A;  4RI1 A;  2AE6 A;  1MK4 A;  3NFZ A;  2ZEH A;  1M1D A;  2Z0Z A;  2Z11 A;  2ZEO A;  3FH4 A;  3I1U A;  4CPA A;  4CYP A;  5C88 A;  1LAP A;  3LMS A;  4A33 A;  2EBJ A;  2ARH A;  2Q4V A;  3F0A A;  3HUV A;  3PFE A;  4TWE A;  2HV2 A;  2CNT A;  1Z8X A;  3B2Y A;  2R7H A;  3FEE A;  1BAV A;  4NGT A;  1NSL A;  1CPX A;  1MJ9 A;  3VWE A;  3EFA A;  3KI9 A;  3B3V A;  2G3T A;  4Y49 B;  2C1C A;  3OWC A;  4NGM A;  1Y0R A;  1TIQ A;  4KSF A;  4OAE A;  2PJ3 A;  4M6I A;  3TOA A;  4A2Z A;  4NSQ A;  3PB7 X;  3IEH A;  4E0A A;  1ZG9 A;  4MMO A;  2ZEL A;  5EC4 A;  4KVO E;  4OAD A;  2EUI A;  4UF4 A;  4KSA A;  1QSR A;  2ZOF A;  2ZOG A;  4BIN A;  1AUG A;  4OKO A;  3ZZI A;  4B5O A;  3GB0 A;  1Y0Y A;  2D4O A;  4ZX8 A;  2ABZ A;  1YVK A;  2ODF A;  3B3T A;  3BJ7 A;  4Q38 A;  1F2O A;  2F5I A;  4HNY B;  4NFR A;  4UBR A;  4HPS A;  2B58 A;  1ELM P;  3FVL A;  1HDQ A;  2QIR A;  4O23 A;  2FT0 A;  4KUB A;  2CXA A;  2B3U A;  4H2K A;  2OZH A;  4R9M A;  2B5G A;  3JUW A;  2VBQ A;  2GLJ A;  4A31 A;  5LRJ A;  4IF5 A;  1XBU A;  5JGF A;  4R87 A;  3IIB A;  3GKR A;  4UCP A;  1CX8 A;  2XEJ A;  2ANP A;  3H4Q A;  4AG7 A;  3MN8 A;  1FNO A;  3B3C A;  1QQ9 A;  3CXS A;  1S7F A;  3D7D A;  4P4B A;  3S6F A;  1UFH A;  3KQX A;  4I49 A;  3SJX A;  3CZX A;  5JQ4 A;  4A39 A;  2QML A;  2ZEP A;  4XPK A;  4ZI6 A;  2K5T A;  4NGS A;  2C27 A;  4UWJ A;  4ZX9 A;  2KCW A;  3TE4 A;  4Q36 A;  4AXV A;  2X7B A;  1EE3 P;  4G1P A;  2AJ6 A;  2NSM A;  4ZY2 A;  4H89 A;  4QVT A;  1N71 A;  1U6M A;  2JDC A;  5CPA A;  1ZG8 A;  4OME A;  1Z4R A;  2Q7S A;  1WK4 A;  3L2N A;  4A38 A;  2QEC A;  2P6G A;  1VHS A;  3GYA A;  3CXP A;  1IOF A;  1K4J A;  3H5Z A;  4U9Y A;  5F49 A;  4YRH A;  2JBK A;  1LAN A;  3TO6 A;  5H86 A;  2POK A;  4BMH A;  1LAM A;  2OR4 A;  1M4L A;  3CXQ A;  3WAB A;  4KOS A;  4EFD A;  4M6H A;  1RO5 A;  1BOB A;  2WUU A;  4KSI A;  1Z4E A;  4MCR A;  4OIW A;  1SQH A;  2XEI A;  3PBB A;  3T8W A;  2GFQ A;  3T90 A;  4C2Z A;  3W6X A;  4AG9 A;  2IL4 A;  4FD4 A;  1JWQ A;  3W91 A;  2ZPA A;  4ONW A;  5ELY A;  3KR5 A;  4ORF A;  3S9L A;  1XFO A;  4RS2 A;  4LX9 A;  4C68 A;  4JXR A;  1KUY A;  4MFK A;  2A4N A;  3N7Z A;  4J3G A;  3ZJ0 A;  2V77 A;  2ZXV A;  1Y9K A;  3QAH A;  2PC1 A;  4RUH A;  1MJB A;  1VGY A;  4AB7 A;  1ON0 A;  4AVB A;  2Z10 A;  1Q2D A;  2NYQ A;  2YNC C;  3PB9 X;  3SJF A;  4KLV A;  4PK3 A;  4MXU A;  2Q4Y A;  3DR6 A;  4UIB A;  3KR4 A;  8CPA A;  3TT2 A;  3WT4 A;  2F7V A;  3BLN A;  4MHY A;  3PGP A;  3FX6 A;  3FEC A;  5K8O A;  4CGM A;  1IYK A;  4CAV A;  2J8R A;  4PPZ A;  1I12 A;  1Z8T A;  4FD5 A;  2DF5 A;  4B13 A;  1IGB A;  3CPA A;  4PSX A;  5LYF A;  2Z3N A;  4Y49 C;  3MRU A;  2FIW A;  1LRZ A;  3PP9 A;  3RAM A;  3TC8 A;  1FY7 A;  3KKW A;  3DDD A;  4ZY0 A;  3VWD A;  3FYN A;  1QST A;  2VEZ A;  4M85 A;  4II9 A;  2PR1 A;  2BO9 A;  2Z3K A;  1DE4 C;  2FIA A;  3D68 A;  1BO4 A;  5KTD A;  3PB6 X;  2WZN A;  2AFS A;  2PJ8 A;  4ZYQ A;  4EME A;  2FL4 A;  2O53 A;  4OC0 A;  4NGP A;  4YU9 A;  4MCQ A;  4UWI A;  2I79 A;  3NH4 A;  4W9Y A;  4IUS A;  5LRG A;  3PBE A;  1YLE A;  1CM0 A;  2CNM A;  2YNC A;  3NH8 A;  4XNH C;  1GYT A;  2PVW A;  3TO9 A;  3TCV A;  3G8W A;  4MFL A;  3D8P A;  1S7N A;  1LFW A;  1YLO A;  4R6T A;  1KWM A;  3D2P A;  1QMU A;  4UFV A;  2Z3O A;  3RO0 A;  2P6E A;  3IFE A;  3K9U A;  2HUZ A;  4X5K A;  5AG6 A;  2WPW A;  3R1K A;  2OH1 A;  1R3N A;  3FNC A;  5G21 A;  3H8E A;  4B6Z A;  4DUK A;  3SJE A;  4NCZ A;  3FF3 A;  4CAE A;  1VKC A;  4C7I A;  1YX0 A;  2JBJ A;  4XPD B;  3D7H A;  3B8G A;  4UIA A;  3PFO A;  1Q2Y A;  1YR0 A;  4WJB A;  1Q2C A;  2B4D B;  1QSO A;  2QJ8 A;  4F9V A;  5JPH A;  5AGE A;  2B5G B;  5J1Q A;  1XMT A;  2CF4 A;  1LCP A;  2DPS A;  5A27 A;  2C6G A;  2ZW4 A;  3QNV A;  2V8D A;  2AFX A;  5JM6 A;  5HVH A;  1YRE A;  5HVG A;  2ZEE A;  1CP6 A;  1R57 A;  2HQY A;  4KOR A;  4YWY A;  2GE3 A;  2I00 A;  3B3W A;  1ZG7 A;  1PCA A;  2Q0Y A;  4P4J A;  1AMP A;  4P4E A;  3IU1 A;  3K9T A;  2CY2 A;  4HKF A;  2DEA A;  2JEV A;  1YK3 A;  2GLF A;  2PJA A;  2ZW5 A;  4F0X A;  4OID A;  6CPA A;  1XE4 A;  4X3R A;  1XOV A;  5IB9 A;  2BEI A;  4MHD A;  4KVX A;  3DGV A;  3NE8 A;  4X2T A;  2G9D A;  5LRK A;  2Z3P A;  1S3Z A;  4B5P B;  3WC6 A;  3D66 A;  2R1I A;  4MI4 A;  3BI1 A;  3KHZ A;  3N5F A;  3IC1 A;  3R9G A;  3S9M A;  3FJU A;  2JEW A;  1OBR A;  4JWP A;  4JJX A;  1NMT A;  4R8F A;  2CIJ A;  4UCM A;  2PSW A;  3HLP A;  1RXT A;  4FD7 A;  4UEE A;  4A37 A;  2BL1 A;  4EVY A;  4Z65 A;  1XJO A;  2JLM A;  2B3V A;  4HNX B;  3H8G A;  2OB0 A;  2GIV A;  5IX3 A;  3JVN A;  3PRT A;  1KZF A;  4C2Y A;  4K3N A;  2G3A A;  4E8O A;  4NEX A;  5DWN A;  4MFQ A;  2ZED A;  5F48 A;  5AG4 A;  3P2F A;  1ARL A;  3IWE A;  3BJ8 A;  2AFW A;  3DSB A;  4OC5 A;  2RC4 A; 
#chains in the Genus database with same CATH homology
 5IV0 A;  4A32 A;  4A30 A;  3FIX A;  2OZU A;  3EY5 A;  4R3L A;  1Y9W A;  4R57 A;  4CAW A;  3I3G A;  4KVM E;  1M4D A;  3QB8 A;  4PSW A;  1KUV A;  1B87 A;  2BUE A;  4NXY A;  1I1D A;  4UCN A;  2VI7 A;  5E96 A;  2DPT A;  1XF8 A;  2FS5 A;  4NF1 A;  4AVA A;  3FB3 A;  4QBJ A;  3A9L A;  3E0K A;  4CYN A;  4CGL A;  2FCK A;  3LD2 A;  1XIX A;  4KS9 A;  3C26 A;  1P0H A;  1OZP A;  2J8M A;  4KOV A;  5GCN A;  3S6K A;  3LOD A;  4L89 A;  4M3S A;  3SXO A;  3EXN A;  4UFX A;  2Q44 A;  3FRM A;  5J8C A;  3R9E A;  2REF A;  3WR7 A;  5CNP A;  3FXT A;  4KUA A;  2B4B A;  4KOX A;  2FXF A;  1PU9 A;  2D4P A;  3S6G A;  1S7K A;  2R98 A;  2GAN A;  4CAX A;  3R95 A;  4QC6 A;  4F0Y A;  1S5K A;  3TFY A;  2OZG A;  2YND A;  4MFJ A;  2J8N A;  1M44 A;  4UFW A;  3NE7 A;  3PZJ A;  3D2M A;  3F5B A;  2H5M A;  2Z3L A;  4B14 A;  2WSA A;  5C82 A;  2YNE A;  1QSN A;  4XPL A;  2WPX A;  2JDD A;  4KZT A;  5FVJ A;  5HMN A;  2ZW6 A;  3DR8 A;  2EVN A;  5G1Z A;  4B5P A;  4JLY A;  2PR8 A;  4CRZ B;  3IGR A;  5F46 A;  1Y7R A;  5HH1 A;  1GHE A;  3SXN A;  3R9F A;  2REE A;  1J4J A;  5I0C A;  2B4D A;  4LUA A;  3MGD A;  4CS0 B;  3G3S A;  3TO7 A;  4ZBG A;  5J8F A;  3UY5 A;  4XNH B;  5KTA A;  1S7L A;  4QUS A;  3F8K A;  3R96 A;  5AG7 A;  4MY0 A;  3SHP A;  2Z3M A;  2Q7B A;  1NE9 A;  2FE7 A;  3TOB A;  4H6Z A;  5F47 A;  1PUA A;  2PQ8 A;  4MBU A;  1B6B A;  4BBH A;  1I21 A;  4CAF A;  4UA3 A;  4AVC A;  5A28 A;  4DNC A;  4KOW A;  4L8A A;  2Y0M A;  5H84 A;  4CGP A;  4YFJ A;  4U9Z A;  5EBV A;  1L0C A;  4ZGY B;  1YVO A;  2P0W A;  3S6H A;  4CGN A;  4CYO A;  4YGO A;  4CRY B;  2FSR A;  1XEB A;  4R3K A;  1M4I A;  3P2H A;  3I9S A;  2PDO A;  1P4N A;  4MY3 A;  2O28 A;  3TTH A;  4MFZ A;  4H6U A;  4OLL A;  4QB9 A;  2CNS A;  2P6F A;  5IB0 A;  3V8I A;  2ZW7 A;  5G22 A;  4HNW B;  4C7H A;  4ONU A;  1WWZ A;  3IWG A;  1IB1 E;  5DWM A;  4B11 A;  4FD6 A;  3T9Y A;  4B10 A;  4JD6 A;  4U5Y A;  4KOT A;  3RYO A;  4F6A A;  3FBU A;  2DXQ A;  1IYL A;  2BSW A;  3DNS A;  5KTC A;  4B12 A;  1ZO0 A;  2NMT A;  3JTK A;  4CYQ A;  2ATR A;  4KOY A;  5ISV A;  1V0C A;  1IID A;  2OU2 A;  3EO4 A;  4C2X A;  1Z9U A;  2YGW A;  2VZZ A;  5AG5 A;  4KOU A;  1QSM A;  2Q04 A;  4XPD C;  1IIC A;  4CGO A;  3EC4 A;  4KLW A;  3D3S A;  1M4G A;  4E2A A;  4PV6 A;  3IU2 A;  4K30 A;  1CJW A;  5BWA B;  1YGH A;  2VXK A;  2R8V A;  3GY9 A;  4PK2 A;  2VZY A;  2PRB A;  4MFP A;  4A95 A;  4MJ8 A;  1MJA A;  1KUX A;  2VQY A;  2G0B A;  5G20 A;  4GS4 A;  3W6S A;  4JXQ A;  4RI1 A;  1S60 A;  2AE6 A;  1MK4 A;  1M1D A;  2Z0Z A;  2Z11 A;  4CYP A;  5C88 A;  4A33 A;  2ARH A;  2Q4V A;  3F0A A;  2HV2 A;  2CNT A;  2R7H A;  1NSL A;  1MJ9 A;  3VWE A;  3EFA A;  4Y49 B;  2G3T A;  3OWC A;  4KSF A;  1TIQ A;  4OAE A;  3TOA A;  4A2Z A;  4NSQ A;  4E0A A;  5EC4 A;  4KVO E;  4OAD A;  2EUI A;  4KSA A;  1QSR A;  4B5O A;  3ZZI A;  2D4O A;  1YVK A;  4Q38 A;  3BJ7 A;  2F5I A;  4HNY B;  4UBR A;  2B58 A;  2QIR A;  2FT0 A;  4KUB A;  2CXA A;  2B3U A;  2OZH A;  4R9M A;  2B5G A;  3JUW A;  2VBQ A;  4A31 A;  4IF5 A;  4R87 A;  3GKR A;  4UCP A;  3H4Q A;  4AG7 A;  3CXS A;  1S7F A;  3S6F A;  1UFH A;  4I49 A;  5JQ4 A;  2QML A;  4XPK A;  2K5T A;  2C27 A;  4UWJ A;  2KCW A;  3TE4 A;  4Q36 A;  2X7B A;  2AJ6 A;  4H89 A;  4QVT A;  1N71 A;  1U6M A;  2JDC A;  1Z4R A;  1WK4 A;  2QEC A;  2P6G A;  1VHS A;  3GYA A;  3CXP A;  1K4J A;  4U9Y A;  3H5Z A;  5F49 A;  4YRH A;  3TO6 A;  5H86 A;  4BMH A;  3CXQ A;  4KOS A;  1RO5 A;  1BOB A;  2WUU A;  1Z4E A;  1SQH A;  3T90 A;  4C2Z A;  3W6X A;  4AG9 A;  2IL4 A;  4FD4 A;  3W91 A;  2ZPA A;  4ORF A;  4RS2 A;  4LX9 A;  4C68 A;  4JXR A;  1KUY A;  4MFK A;  2A4N A;  3N7Z A;  4J3G A;  3ZJ0 A;  2ZXV A;  1Y9K A;  3QAH A;  2PC1 A;  1MJB A;  4AB7 A;  1ON0 A;  4AVB A;  2Z10 A;  1Q2D A;  2YNC C;  4KLV A;  4PK3 A;  2Q4Y A;  3DR6 A;  3TT2 A;  3BLN A;  3PGP A;  4CGM A;  1IYK A;  4CAV A;  2J8R A;  1I12 A;  4FD5 A;  4B13 A;  4PSX A;  2Z3N A;  4Y49 C;  2FIW A;  1LRZ A;  3PP9 A;  1FY7 A;  3KKW A;  3DDD A;  3VWD A;  3FYN A;  1QST A;  2VEZ A;  4M85 A;  4II9 A;  2PR1 A;  2Z3K A;  2FIA A;  1BO4 A;  2FL4 A;  4UWI A;  2I79 A;  4IUS A;  1YLE A;  1CM0 A;  2CNM A;  2YNC A;  4XNH C;  3TO9 A;  3TCV A;  3G8W A;  4MFL A;  3D8P A;  1S7N A;  4UFV A;  3D2P A;  2Z3O A;  2P6E A;  4X5K A;  3K9U A;  2HUZ A;  5AG6 A;  2WPW A;  3R1K A;  2OH1 A;  3FNC A;  5G21 A;  4NCZ A;  4CAE A;  1VKC A;  4C7I A;  1YX0 A;  4XPD B;  3B8G A;  1Q2Y A;  1YR0 A;  1Q2C A;  2B4D B;  1QSO A;  5JPH A;  5AGE A;  2B5G B;  1XMT A;  5A27 A;  2DPS A;  2ZW4 A;  1YRE A;  1R57 A;  2HQY A;  4KOR A;  2GE3 A;  2I00 A;  2Q0Y A;  3IU1 A;  4HKF A;  2CY2 A;  2JEV A;  2ZW5 A;  1YK3 A;  4F0X A;  1XE4 A;  2BEI A;  4MHD A;  4KVX A;  2Z3P A;  1S3Z A;  4B5P B;  2R1I A;  4MI4 A;  3R9G A;  4JWP A;  4JJX A;  1NMT A;  4UCM A;  2PSW A;  1RXT A;  4FD7 A;  2BL1 A;  4EVY A;  2JLM A;  2B3V A;  4HNX B;  2OB0 A;  2GIV A;  5IX3 A;  3JVN A;  1KZF A;  4C2Y A;  2G3A A;  4E8O A;  4NEX A;  5DWN A;  4MFQ A;  5F48 A;  5AG4 A;  3P2F A;  3IWE A;  3BJ8 A;  5KTD A;  3DSB A;  2RC4 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...