4MI4A

Crystal structure of spermidine n-acetyltransferase from vibrio cholerae in complex with spermine
Total Genus 54
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
54
sequence length
170
structure length
170
Chain Sequence
NSQLTLRALERGDLRFIHNLNNNRNIMSYWFEEPYESFDELEELYNKHIHDNAERRFVVEDAQKNLIGLVELIEINYIHRSAEFQIIIAPEHQGKGFARTLINRALDYSFTILNLHKIYLHVAVENPKAVHLYEECGFVEEGHLVEEFFINGRYQDVKRMYILQSKYLNR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Spermidine n1-acetyltransferase
publication title A Novel Polyamine Allosteric Site of SpeG from Vibrio cholerae Is Revealed by Its Dodecameric Structure.
pubmed doi rcsb
source organism Vibrio cholerae o1 biovar el tor
molecule tags Transferase
total genus 54
structure length 170
sequence length 170
chains with identical sequence B, C
ec nomenclature ec 2.3.1.57: Diamine N-acetyltransferase.
pdb deposition date 2013-08-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13302 Acetyltransf_3 Acetyltransferase (GNAT) domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.630.30 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Aminopeptidase 4mi4A00
4F0YA 4NCZA 2DXQA 4MY3A 3F0AA 3TO9A 4II9A 4PK2A 2FCKA 1Z9UA 3UY5A 2J8RA 1IYKA 2REEA 3JUWA 4AG7A 3W6SA 2GE3A 1OZPA 2QIRA 2Z0ZA 4JJXA 3ZJ0A 4R57A 4AB7A 1YVKA 1M4GA 2G3AA 2CY2A 4RI1A 2OH1A 3T90A 2VBQA 5FVJA 3IWGA 4HKFA 1YGHA 3G3SA 5ISVA 2ZW6A 4Y49B 4R3LA 3S6KA 3SHPA 2HUZA 1IYLA 1Y9WA 2CNSA 1N71A 2R8VA 1P0HA 4NXYA 2PRBA 4XPKA 3TE4A 1XE4A 2IL4A 2OZUA 2Q44A 3WR7A 3FB3A 2VXKA 2AE6A 1MJ9A 2J8NA 5F48A 1Q2CA 4FD5A 1CJWA 5EBVA 4Y49C 1KUVA 1FY7A 2Q7BA 1KUYA 2X7BA 2CNTA 4L89A 1I12A 4IUSA 4H6UA 3V8IA 4KOYA 4QB9A 1XIXA 5F49A 4KVME 1Q2DA 1NE9A 4M3SA 3EO4A 2KCWA 2R1IA 1NMTA 3W6XA 5JPHA 4FD4A 2HQYA 2PC1A 3R9GA 3DSBA 3R95A 3I9SA 1IICA 2PR1A 1BOBA 1YK3A 2PQ8A 2B4BA 2O28A 1Z4RA 4NF1A 4IF5A 2P0WA 1V0CA 3D3SA 5I0CA 5JQ4A 4HNYB 4XNHC 2BEIA 3G8WA 4E0AA 4KORA 4KOUA 4NSQA 2P6GA 4KZTA 3TFYA 2ZXVA 4NEXA 5IV0A 4UWJA 4AVCA 3FIXA 5J8FA 4YRHA 2B3UA 4CAXA 4MY0A 2JLMA 3BJ7A 2FIAA 1U6MA 2VI7A 3RYOA 4KUAA 3QAHA 2Z10A 3D2MA 1S7FA 3N7ZA 4CAVA 4OADA 4EVYA 1TIQA 4YGOA 5KTAA 3OWCA 3F8KA 4LUAA 3P2HA 2A4NA 1YR0A 1S60A 1VKCA 4F6AA 2B5GB 3IGRA 4KOVA 2HV2A 2J8MA 4AVBA 1S7KA 2D4OA 3CXPA 2RC4A 3EC4A 2GIVA 4MHDA 2JDDA 3I3GA 2F5IA 3S6GA 2P6EA 4JXQA 2ATRA 2OZHA 4KOXA 2EUIA 3K9UA 3T9YA 2ZW4A 5J8CA 1QSOA 4JLYA 4PK3A 1L0CA 4FD6A 3S6FA 3R96A 2FT0A 4PSWA 1CM0A 2I79A 4QC6A 2H5MA 1KZFA 2B3VA 5HH1A 4B5PB 1Y7RA 2FE7A 4KUBA 4LX9A 3GYAA 2Q04A 1SQHA 3TT2A 4QUSA 3ZZIA 1QSTA 2OU2A 4L8AA 2VZYA 2BSWA 3R9FA 1PU9A 4XNHB 5H84A 1I1DA 4GS4A 4R3KA 4KLVA 4E2AA 3F5BA 4MI4A 4XPDC 4KVXA 3FRMA 3P2FA 2B58A 2BL1A 2R98A 4YFJA 1VHSA 1B6BA 4B5OA 3KKWA 4KOWA 2VEZA 2PDOA 3VWEA 3R9EA 1S5KA 3FYNA 4I49A 3NE7A 3VWDA 4QVTA 5E96A 4HNXB 3C26A 4K30A 2ZW7A 2R7HA 4RS2A 5DWNA 3PZJA 1XMTA 1ON0A 3PGPA 1I21A 1KUXA 5IX3A 2Y0MA 4PV6A 1XF8A 2EVNA 2Q4VA 4DNCA 4E8OA 3FNCA 5C88A 3D2PA 2AJ6A 4PSXA 1LRZA 4ZBGA 4X5KA 5CNPA 1MJBA 4JXRA 4CRZB 5HMNA 4UWIA 4U9ZA 2D4PA 4CS0B 4U9YA 2I00A 4KOSA 1WWZA 3BJ8A 3BLNA 2C27A 4BMHA 2WPXA 4ONUA 2K5TA 3TOAA 5C82A 4AG9A 2B4DA 4R9MA 5F46A 3JVNA 2Z11A 4FD7A 2P6FA 4AVAA 5EC4A 5H86A 4H89A 2QMLA 2OB0A 4M85A 4HNWB 1R57A 1YREA 4KLWA 1Q2YA 2BUEA 2CNMA 2ZW5A 1YVOA 3TTHA 3TO7A 4H6ZA 1IIDA 2ARHA 2FS5A 2FIWA 3CXQA 2ZPAA 1YX0A 4XPDB 3TO6A 1S7NA 1M44A 2G3TA 5F47A 4UA3A 3FBUA 1WK4A 1J4JA 2Q4YA 4J3GA 2QECA 3EXNA 4MJ8A 4UBRA 4CAWA 1QSNA 1BO4A 2G0BA 3DR6A 3CXSA 3DDDA 1M4IA 5KTCA 1GHEA 5IB0A 1RO5A 3LODA 4JD6A 3S6HA 3TCVA 4KVOE 3SXOA 1P4NA 2JDCA 2FSRA 2VZZA 1RXTA 2B5GA 3LD2A 1PUAA 1M4DA 3DR8A 5GCNA 1XEBA 1IB1E 1MJAA 4OLLA 2NMTA 4JWPA 1QSRA 4ORFA 1QSMA 4KOTA 1K4JA 2REFA 4R87A 1M1DA 4OAEA 2PSWA 4XPLA 3W91A 3MGDA 4MBUA 3B8GA 1Z4EA 2B4DB 3QB8A 5KTDA 4CRYB 3FXTA 2Q0YA 3GKRA 3GY9A 3EFAA 3DNSA 2GANA 4B5PA 4QBJA 1B87A 3H4QA 2WPWA 3PP9A 3TOBA 4U5YA 2JEVA 3SXNA 1Y9KA 2PR8A 1UFHA 1S7LA 2OZGA 5DWMA 2VQYA 1NSLA 3D8PA 3EY5A 1MK4A 1S3ZA 2FL4A 2FXFA 3E0KA 3R1KA 1YLEA
chains in the Genus database with same CATH superfamily
4F0YA 3GLJA 4NCZA 2DXQA 4MY3A 4JYWA 3F0AA 4R7MA 4MFKA 3TO9A 5LYLA 4MFZA 4P4EA 2ZEHA 4FUUA 4PK2A 2FCKA 4II9A 1Z9UA 2I3CA 3D68A 4PXBA 3UY5A 2J8RA 2C6GA 1IYKA 4C68A 2NSMA 2XEJA 2DPSA 3NH4A 5CBMA 4LQGA 3IWWA 2REEA 1QMUA 3FVLA 1CPXA 3JUWA 4AG7A 4X8IA 2BCOA 2PJCA 3W6SA 3PRTA 1YLOA 2EK8A 1OZPA 2GE3A 2QIRA 2F8HA 2Z0ZA 2ZEGA 3CPXA 1CPSA 1ELLP 2ZOGA 2ZOFA 4JJXA 3ZJ0A 4R57A 4B14A 1BPNA 4AB7A 1YVKA 4F9UA 5ELYA 4A2ZA 1M4GA 2F7VA 2CY2A 2CTBA 2G3AA 2OH1A 4M6IA 4MRIA 4RI1A 2YNDA 5AG7A 3T90A 4CPAA 4P45A 1KWMA 2C1CA 4P44A 2VBQA 5FVJA 3IWGA 1TXRA 1Z2LA 4HKFA 2YNCA 4ZI6A 2IMOA 1YGHA 3BHXA 2PRQA 5K8PA 3G3SA 5ISVA 2ZW6A 2Z3MA 4Y49B 4B10A 4R3LA 2EK9A 3KL9A 3S6KA 3SHPA 4O23A 4NGNA 8CPAA 2HUZA 4FBEA 3JTKA 4MFQA 4F0XA 2ZEDA 1IYLA 1Y9WA 3IO1A 3WC6A 2CNSA 1N71A 4Q38A 2OOTA 1PYTB 2R8VA 1ZG9A 1P0HA 1QQ9A 2GFQA 4NXYA 4CYNA 2ANPA 3S9MA 1GYTA 2PRBA 4XPKA 3TE4A 1AUGA 4B11A 1XE4A 2IL4A 2OZUA 1Z5RA 3CT9A 2Q44A 3WR7A 7CPAA 1YW4A 2Q4ZA 3FB3A 1VHEA 2VXKA 3KI9A 4NGPA 3GUXA 1UWYA 2CTCA 4A94A 5LRJA 2AE6A 4CAFA 5D29A 3SJGA 3NH5A 4ZX8A 2JBKA 1MJ9A 2J8NA 5F48A 1Q2CA 4FD5A 1CJWA 4UEEA 2O4HA 1CBXA 4Y49C 1KUVA 4NGQA 5EBVA 1FY7A 2Z3OA 3D7HA 4IHMA 1KUYA 4OC0A 2Q7BA 3KHZA 4Q36A 2X7BA 1OBRA 4CGNA 2RFHA 3FEDA 4OC1A 2CNTA 4L89A 4MHNA 1I12A 3WABA 4OC2A 4OC3A 1YW6A 3IU2A 4IUSA 4H6UA 1A2ZA 2PIYA 3V8IA 1DTDA 4KOYA 1XFOA 2ZEMA 4MHPA 4QB9A 1XIXA 3TX8A 5K8NA 5F49A 2AFSA 4KVME 1ZLIA 4KS9A 1Q2DA 1NE9A 4M6HA 4R8FA 4M3SA 3EO4A 2KCWA 1BPMA 2R1IA 1NMTA 3W6XA 3MN8A 3H8FA 4FD4A 2HQYA 2PC1A 3RNZA 5F09A 5JPHA 1JQGA 2EWBA 3R9GA 3DSBA 3R95A 1LFWA 3I9SA 1IICA 2PR1A 4P4DA 1BOBA 1EE3P 1YK3A 1YMEA 2HC9A 2B4BA 2PJ9A 2O28A 2PQ8A 2PVWA 2RB7A 1DE4C 1Z4RA 3BXMA 4BBHA 4NF1A 1IGBA 4HPSA 3FEEA 4IF5A 2P0WA 3KQZA 1V0CA 3D3SA 3LMSA 5AG5A 3K9TA 3N5FA 5I0CA 4KSIA 3CZXA 5JQ4A 4HNYB 4XNHC 4P4FA 2BEIA 3G8WA 4E0AA 4F9VA 2IJZA 1Y7EA 2Z3PA 3KHXA 1AMPA 4KORA 4MCSA 4KOUA 3FF3A 4NSQA 4OC5A 4GXHA 2IQ6A 2P6GA 1LAMA 3VATA 3PB4X 4MHZA 2XEFA 4Z65A 4KZTA 5G20A 3TFYA 2ZXVA 4NEXA 1XJOA 5IV0A 5JGFA 5EMIA 4UWJA 4IAVA 1F2OA 4AVCA 3FIXA 1CP7A 4UIBA 5J8FA 1IU8A 1IOIA 4A39A 1Y0YA 2V8GA 2B3UA 4OP4A 4YRHA 4CAXA 4MY0A 2PJ7A 4MCRA 5J1QA 3CPAA 5HXDA 3KR4A 2JLMA 3BJ7A 2FIAA 5HVFA 1U6MA 2VI7A 3RYOA 1CP6A 3D7DA 4KUAA 2PJ4A 2PVVA 1Y0RA 3KGQA 1R43A 2Z10A 3D2MA 3QAHA 3B7IA 2AFZA 4P10A 4CGLA 5AG4A 1S7FA 3KASA 3N7ZA 4CAVA 1NSAA 4NGTA 4OADA 2C6CA 4B6ZA 2DF5A 4EVYA 1TIQA 4ZY0A 4CYQA 4YGOA 2AFUA 3S9LA 5KTAA 3IIBA 3OWCA 4H2KA 3F8KA 2YNCC 3FX6A 3IFEA 3P2HA 4KSAA 4LUAA 4OC4A 2A4NA 4PPZA 2ZEOA 1TKHA 1YR0A 1S60A 4UCMA 1VKCA 4FAIA 4F6AA 4FWUA 2B5GB 4KSFA 4CGMA 1RTQA 3IGRA 4KOVA 2PE3A 4OKOA 2JEWA 2HV2A 2J8MA 3LACA 4AVBA 2PCUA 2V77A 1S7KA 4C2YA 2D4OA 3CXPA 2RC4A 1BAVA 3EC4A 4RUHA 5A28A 2PJ5A 3DGVA 2GIVA 4MHDA 2JDDA 3GB0A 3I3GA 3WC5A 2F5IA 3S6GA 1LOKA 2C6PA 2P6EA 4JXQA 2ATRA 2OZHA 3IC1A 4KOXA 2EUIA 3K9UA 3T9YA 3B3CA 2ZW4A 3D66A 5J8CA 1H8LA 3B3SA 4P6YA 4P4JA 3SI2A 5AG6A 4A33A 1QSOA 4P4IA 4JLYA 4PK3A 1AYEA 4DYOA 1L0CA 4FD6A 3S6FA 3R96A 2FT0A 4PSWA 1CM0A 1F57A 2I79A 2DPTA 4QC6A 3D7FA 4X3RA 2H5MA 4UF4A 4A37A 3B3VA 3WC7A 1KZFA 2B3VA 1VGYA 3NH8A 5HH1A 4YWYA 5LRGA 1Y7RA 4B5PB 5D8NA 2FE7A 4KUBA 4LX9A 4NGMA 3GYAA 2Q04A 1XBUA 3H8EA 1SQHA 3TT2A 4QUSA 3ZZIA 3GIUA 1QSTA 2OU2A 2PJ8A 4L8AA 2CF4A 2VZYA 2BSWA 4F8ZA 3R9FA 1X10A 3B2YA 1IOFA 3SI1A 4A38A 1PU9A 4W9YA 4JZ0A 4MFJA 2Z3KA 4NJRA 4XNHB 5LYFA 5H84A 1I1DA 4GS4A 4RN7A 4R3KA 4KLVA 4E2AA 2Q7SA 3A9LA 3F5BA 2ZEPA 2ZELA 3IWEA 3KR5A 4MI4A 3FH4A 4XPDC 1HEEA 2PJ6A 4EFDA 4KVXA 3FRMA 3P2FA 2POKA 3PBBA 1TKJA 2B58A 1TKFA 2BL1A 2EO8A 3PBEA 2R98A 4CGPA 2YNEA 4YFJA 1VHSA 1B6BA 4PXDA 4B5OA 3IU1A 3KKWA 2G9DA 1YQEA 2O53A 4KOWA 2VEZA 3MRUA 4LQ6A 4C2ZA 2PDOA 3VWEA 3R9EA 1S5KA 3FYNA 4I49A 3NE7A 3PB7X 1FNOA 4UEZA 3VWDA 4NJQA 2AFWA 4A30A 1IY7A 4QVTA 5E96A 3SJEA 4HNXB 4CYPA 1PCAA 3C26A 4K30A 2ZW7A 2R7HA 4RS2A 4UFXA 5DWNA 5A27A 2QJ8A 3K2KA 3PZJA 3IJ3A 3KQXA 2CXAA 2CIJA 4Q7AA 2ABZA 5IB9A 3BI1A 1XMTA 1ON0A 3PGPA 5JM6A 5K8OA 1I21A 1KUXA 3T8WA 3HUVA 2Y0MA 4PV6A 5IX3A 1XF8A 2AFMA 2EVNA 5LRKA 2Q51A 3IEHA 4BINA 3DLJA 2Q4VA 4DNCA 1FT7A 4E8OA 3FNCA 5C88A 4ZY2A 4C2XA 1XOVA 1TF8A 3B35A 3D2PA 2AJ6A 1X12A 4PSXA 1LRZA 1ZG8A 4PXCA 3V38A 4ZBGA 4X5KA 5CNPA 1MJBA 2V8DA 3QAYA 3TC8A 4A32A 4JXRA 4CRZB 5HVHA 5CPAA 3PB9X 5HMNA 4UWIA 4U9ZA 2D4PA 4CS0B 4U9YA 2I00A 1ZG7A 4KOSA 3ISZA 1WWZA 2WYRA 2ODFA 3BJ8A 3NA6A 3V7ZA 3BLNA 3HLPA 3NE8A 2C27A 4BMHA 5BWAB 4A95A 1BLLE 3S9NA 2V8VA 2FVGA 2WPXA 4ONUA 2K5TA 3SJXA 3TOAA 1XRYA 4CGOA 3RAMA 2GLJA 5C82A 4AG9A 1TF9A 4IK2A 3RBUA 2B4DA 4MXUA 4R9MA 5F46A 3JVNA 2Z11A 3PFEA 4FD7A 2P6FA 4AVAA 5EC4A 4NFRA 2PJBA 6CPAA 3L2NA 4M6GA 2WSAA 5H86A 5K8MA 5DS0A 4H89A 1LAPA 5LYDA 2QMLA 2EBJA 4R76A 2OB0A 2Q43A 4M85A 2BO9A 4TWEA 5G22A 2AFOA 4HNWB 3D7GA 3SI0A 1R57A 4C7HA 2JBJA 1YREA 4UIAA 1HDUA 4KLWA 4PQAA 3RZAA 2PJ3A 1Q2YA 2CNMA 2BUEA 2BOAA 2ZW5A 5JH9A 1YVOA 3TTHA 2AFXA 3B3TA 4UCNA 3PEIA 3TO7A 4MMOA 4H6ZA 1IIDA 2QVPA 4R6TA 2ARHA 1CX8A 2FS5A 2XEGA 2FIWA 3CXQA 2ZPAA 1YX0A 3PB8X 4XPDB 3TO6A 4MFPA 2NYQA 4PXEA 1S7NA 1M44A 2G3TA 5F47A 2PJ2A 1VHOA 2GU2A 1F2PA 2DEAA 4UA3A 3FBUA 2GLFA 1WK4A 1J4JA 2Q4YA 4J3GA 2QECA 3EXNA 1XMBA 4MJ8A 4UBRA 3PB6X 4CAWA 5G1ZA 4NGRA 1QSNA 1ELMP 2PIZA 1BO4A 2G0BA 1LCPA 1VIXA 4UEFA 3BI0A 4CAEA 3DR6A 1ARLA 3CXSA 3DDDA 2Z3LA 1M4IA 5KTCA 1GHEA 3D67A 5IB0A 4K3NA 4BD9A 3B3WA 3H8GA 1RO5A 4MCPA 1LANA 1YSJA 3LODA 4MHYA 4JD6A 3S6HA 3TCVA 4YU9A 1Z8LA 4KVOE 4TNUA 2PJ1A 3SXOA 4DUKA 4EWTA 1P4NA 2JDCA 4DJLA 2FSRA 2VZZA 2WUUA 1RXTA 2B5GA 2XEIA 3LD2A 3RO0A 4C7IA 1HDQA 1Z8TA 4B13A 1PUAA 1M4DA 3DR8A 5GCNA 1XEBA 1M4LA 3CDXA 1IB1E 4GM5A 2V8HA 1MJAA 4X2TA 2HB6A 1R3NA 4OLLA 2NMTA 3SJFA 1Z8WA 4JWPA 1QSRA 1JWQA 4OIWA 4ORFA 4WWVA 1QSMA 3I1UA 4KOTA 4ONWA 4CYOA 4ZY1A 1K4JA 2REFA 4AXVA 4R87A 2VL1A 1M1DA 2WZNA 4OAEA 3QNVA 2PSWA 5I4MA 1CG2A 4MFLA 4UFWA 4XPLA 3W91A 3MGDA 2PJ0A 4MBUA 4P4BA 4MCQA 2ZEEA 4ZX9A 3B8GA 3ISXA 3JRUA 1Z4EA 2B4DB 1ZO0A 2GREA 3QB8A 4UCPA 4WJBA 5KTDA 1ZLHA 4CRYB 2Z3NA 2YGWA 2ZENA 3FXTA 5AGEA 2Q0YA 3GKRA 3GY9A 3EFAA 4UFVA 5HVGA 3DNSA 3FECA 3VH9A 2GANA 3D4UA 3VARA 3WT4A 4B5PA 4OIDA 4QBJA 1B87A 3H4QA 2WPWA 1Z8XA 2ZEFA 3FMCA 3H5ZA 3NFZA 4A31A 4G1PA 1ARMA 3FJUA 3PP9A 3TOBA 4U5YA 2JEVA 3SXNA 1Y9KA 2PR8A 1UFHA 5G21A 1Q7LA 4NGSA 3KZWA 4ZYQA 4B12A 1S7LA 2OZGA 5THWA 4EMEA 4ZGYB 5DWMA 2VQYA 1NSLA 3D8PA 2PJAA 1MK4A 3EY5A 3PFOA 1S3ZA 2J9AA 2FL4A 2FXFA 3E0KA 2QYVA 2OR4A 3R1KA 1YLEA 5LYIA 3LWUA 4OMEA
chains in the Genus database with same CATH topology
4F0YA 4NCZA 2DXQA 4MY3A 3F0AA 4MFKA 3TO9A 4MFZA 4II9A 4PK2A 2FCKA 1Z9UA 3UY5A 2J8RA 1IYKA 4C68A 2DPSA 2REEA 3JUWA 4AG7A 3W6SA 2GE3A 1OZPA 2QIRA 2Z0ZA 4JJXA 3ZJ0A 4R57A 4B14A 4AB7A 1YVKA 4A2ZA 1M4GA 2G3AA 2CY2A 4RI1A 2OH1A 3T90A 5AG7A 2YNDA 2VBQA 5FVJA 3IWGA 4HKFA 2YNCA 1YGHA 3G3SA 5ISVA 2ZW6A 2Z3MA 4Y49B 4B10A 4R3LA 3S6KA 3SHPA 2HUZA 3JTKA 4MFQA 4F0XA 1IYLA 1Y9WA 2CNSA 1N71A 4Q38A 2R8VA 1P0HA 4NXYA 4CYNA 2PRBA 4XPKA 3TE4A 4B11A 1XE4A 2IL4A 2OZUA 2Q44A 3WR7A 3FB3A 2VXKA 4CAFA 2AE6A 1MJ9A 2J8NA 5F48A 1Q2CA 4FD5A 1CJWA 5EBVA 4Y49C 1KUVA 1FY7A 2Z3OA 2Q7BA 1KUYA 4Q36A 2X7BA 4CGNA 2CNTA 4L89A 1I12A 3IU2A 4IUSA 4H6UA 3V8IA 4KOYA 4QB9A 1XIXA 5F49A 4KVME 4KS9A 1Q2DA 1NE9A 4M3SA 3EO4A 2KCWA 2R1IA 1NMTA 3W6XA 5JPHA 4FD4A 2HQYA 2PC1A 3R9GA 3DSBA 3R95A 3I9SA 1IICA 2PR1A 1BOBA 1YK3A 2PQ8A 2B4BA 2O28A 4BBHA 1Z4RA 4NF1A 4IF5A 2P0WA 5AG5A 1V0CA 3D3SA 5I0CA 5JQ4A 4HNYB 4XNHC 2BEIA 3G8WA 4E0AA 2Z3PA 4KORA 4KOUA 4NSQA 2P6GA 4KZTA 5G20A 3TFYA 2ZXVA 4NEXA 5IV0A 4UWJA 4AVCA 3FIXA 5J8FA 4YRHA 2B3UA 4CAXA 4MY0A 2JLMA 3BJ7A 2FIAA 1U6MA 2VI7A 3RYOA 4KUAA 3QAHA 2Z10A 3D2MA 5AG4A 4CGLA 1S7FA 3N7ZA 4CAVA 4OADA 4EVYA 1TIQA 4CYQA 4YGOA 5KTAA 3OWCA 3F8KA 2YNCC 4LUAA 4KSAA 3P2HA 2A4NA 1YR0A 1S60A 4UCMA 1VKCA 4F6AA 4KSFA 2B5GB 4CGMA 3IGRA 4KOVA 2HV2A 2J8MA 4AVBA 4C2YA 1S7KA 2D4OA 3CXPA 2RC4A 3EC4A 5A28A 2GIVA 4MHDA 2JDDA 3I3GA 2F5IA 3S6GA 2P6EA 4JXQA 2ATRA 2OZHA 4KOXA 2EUIA 3K9UA 3T9YA 2ZW4A 5J8CA 4A33A 5AG6A 1QSOA 4JLYA 4PK3A 1L0CA 4FD6A 3S6FA 3R96A 2FT0A 4PSWA 1CM0A 2I79A 2DPTA 4QC6A 2H5MA 1KZFA 2B3VA 5HH1A 4B5PB 1Y7RA 2FE7A 4KUBA 4LX9A 3GYAA 2Q04A 1SQHA 3TT2A 4QUSA 3ZZIA 1QSTA 2OU2A 4L8AA 2VZYA 2BSWA 3R9FA 1PU9A 4MFJA 2Z3KA 4XNHB 5H84A 1I1DA 4GS4A 4R3KA 4KLVA 4E2AA 3A9LA 3F5BA 3IWEA 4MI4A 4XPDC 4KVXA 3FRMA 3P2FA 2B58A 2BL1A 2R98A 4CGPA 2YNEA 4YFJA 1VHSA 1B6BA 4B5OA 3IU1A 3KKWA 4KOWA 2VEZA 4C2ZA 2PDOA 3VWEA 3R9EA 1S5KA 3FYNA 4I49A 3NE7A 3VWDA 4A30A 4QVTA 5E96A 4HNXB 4CYPA 3C26A 4K30A 2ZW7A 2R7HA 4RS2A 4UFXA 5DWNA 5A27A 3PZJA 2CXAA 1XMTA 1ON0A 3PGPA 1I21A 1KUXA 5IX3A 2Y0MA 4PV6A 1XF8A 2EVNA 2Q4VA 4DNCA 4E8OA 3FNCA 5C88A 4C2XA 3D2PA 2AJ6A 4PSXA 1LRZA 4ZBGA 4X5KA 5CNPA 1MJBA 4A32A 4JXRA 4CRZB 5HMNA 4UWIA 4U9ZA 2D4PA 4CS0B 4U9YA 2I00A 4KOSA 1WWZA 3BJ8A 3BLNA 2C27A 4BMHA 5BWAB 4A95A 2WPXA 4ONUA 2K5TA 3TOAA 4CGOA 5C82A 4AG9A 2B4DA 4R9MA 5F46A 3JVNA 2Z11A 4FD7A 2P6FA 4AVAA 5EC4A 2WSAA 5H86A 4H89A 2QMLA 2OB0A 4M85A 5G22A 4HNWB 1R57A 4C7HA 1YREA 4KLWA 1Q2YA 2BUEA 2CNMA 2ZW5A 1YVOA 3TTHA 4UCNA 3TO7A 4H6ZA 1IIDA 2ARHA 2FS5A 2FIWA 3CXQA 2ZPAA 1YX0A 4XPDB 3TO6A 4MFPA 1S7NA 1M44A 2G3TA 5F47A 4UA3A 3FBUA 1WK4A 1J4JA 2Q4YA 4J3GA 2QECA 3EXNA 4MJ8A 4UBRA 4CAWA 5G1ZA 1QSNA 1BO4A 2G0BA 4CAEA 3DR6A 3CXSA 3DDDA 2Z3LA 1M4IA 5KTCA 1GHEA 5IB0A 1RO5A 3LODA 4JD6A 3S6HA 3TCVA 4KVOE 3SXOA 1P4NA 2JDCA 2FSRA 2VZZA 2WUUA 1RXTA 2B5GA 3LD2A 4C7IA 4B13A 1PUAA 1M4DA 3DR8A 5GCNA 1XEBA 1IB1E 1MJAA 4OLLA 2NMTA 4JWPA 1QSRA 4ORFA 1QSMA 4KOTA 4CYOA 1K4JA 2REFA 4R87A 1M1DA 4OAEA 2PSWA 4UFWA 4MFLA 4XPLA 3W91A 3MGDA 4MBUA 3B8GA 1Z4EA 2B4DB 1ZO0A 4UCPA 3QB8A 5KTDA 4CRYB 2Z3NA 2YGWA 3FXTA 5AGEA 2Q0YA 3GKRA 3GY9A 3EFAA 4UFVA 3DNSA 2GANA 4B5PA 4QBJA 1B87A 3H4QA 2WPWA 4A31A 3H5ZA 3PP9A 3TOBA 4U5YA 2JEVA 3SXNA 1Y9KA 2PR8A 1UFHA 5G21A 4B12A 1S7LA 2OZGA 4ZGYB 5DWMA 2VQYA 1NSLA 3D8PA 3EY5A 1MK4A 1S3ZA 2FL4A 2FXFA 3E0KA 3R1KA 1YLEA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4F0Y A;  4NCZ A;  2DXQ A;  4MY3 A;  3F0A A;  3TO9 A;  4II9 A;  4PK2 A;  2FCK A;  1Z9U A;  3UY5 A;  2J8R A;  1IYK A;  2REE A;  3JUW A;  4AG7 A;  3W6S A;  2GE3 A;  1OZP A;  2QIR A;  2Z0Z A;  4JJX A;  3ZJ0 A;  4R57 A;  4AB7 A;  1YVK A;  1M4G A;  2G3A A;  2CY2 A;  4RI1 A;  2OH1 A;  3T90 A;  2VBQ A;  5FVJ A;  3IWG A;  4HKF A;  1YGH A;  3G3S A;  5ISV A;  2ZW6 A;  4Y49 B;  4R3L A;  3S6K A;  3SHP A;  2HUZ A;  1IYL A;  1Y9W A;  2CNS A;  1N71 A;  2R8V A;  1P0H A;  4NXY A;  2PRB A;  4XPK A;  3TE4 A;  1XE4 A;  2IL4 A;  2OZU A;  2Q44 A;  3WR7 A;  3FB3 A;  2VXK A;  2AE6 A;  1MJ9 A;  2J8N A;  5F48 A;  1Q2C A;  4FD5 A;  1CJW A;  5EBV A;  4Y49 C;  1KUV A;  1FY7 A;  2Q7B A;  1KUY A;  2X7B A;  2CNT A;  4L89 A;  1I12 A;  4IUS A;  4H6U A;  3V8I A;  4KOY A;  4QB9 A;  1XIX A;  5F49 A;  4KVM E;  1Q2D A;  1NE9 A;  4M3S A;  3EO4 A;  2KCW A;  2R1I A;  1NMT A;  3W6X A;  5JPH A;  4FD4 A;  2HQY A;  2PC1 A;  3R9G A;  3DSB A;  3R95 A;  3I9S A;  1IIC A;  2PR1 A;  1BOB A;  1YK3 A;  2PQ8 A;  2B4B A;  2O28 A;  1Z4R A;  4NF1 A;  4IF5 A;  2P0W A;  1V0C A;  3D3S A;  5I0C A;  5JQ4 A;  4HNY B;  4XNH C;  2BEI A;  3G8W A;  4E0A A;  4KOR A;  4KOU A;  4NSQ A;  2P6G A;  4KZT A;  3TFY A;  2ZXV A;  4NEX A;  5IV0 A;  4UWJ A;  4AVC A;  3FIX A;  5J8F A;  4YRH A;  2B3U A;  4CAX A;  4MY0 A;  2JLM A;  3BJ7 A;  2FIA A;  1U6M A;  2VI7 A;  3RYO A;  4KUA A;  3QAH A;  2Z10 A;  3D2M A;  1S7F A;  3N7Z A;  4CAV A;  4OAD A;  4EVY A;  1TIQ A;  4YGO A;  5KTA A;  3OWC A;  3F8K A;  4LUA A;  3P2H A;  2A4N A;  1YR0 A;  1S60 A;  1VKC A;  4F6A A;  2B5G B;  3IGR A;  4KOV A;  2HV2 A;  2J8M A;  4AVB A;  1S7K A;  2D4O A;  3CXP A;  2RC4 A;  3EC4 A;  2GIV A;  4MHD A;  2JDD A;  3I3G A;  2F5I A;  3S6G A;  2P6E A;  4JXQ A;  2ATR A;  2OZH A;  4KOX A;  2EUI A;  3K9U A;  3T9Y A;  2ZW4 A;  5J8C A;  1QSO A;  4JLY A;  4PK3 A;  1L0C A;  4FD6 A;  3S6F A;  3R96 A;  2FT0 A;  4PSW A;  1CM0 A;  2I79 A;  4QC6 A;  2H5M A;  1KZF A;  2B3V A;  5HH1 A;  4B5P B;  1Y7R A;  2FE7 A;  4KUB A;  4LX9 A;  3GYA A;  2Q04 A;  1SQH A;  3TT2 A;  4QUS A;  3ZZI A;  1QST A;  2OU2 A;  4L8A A;  2VZY A;  2BSW A;  3R9F A;  1PU9 A;  4XNH B;  5H84 A;  1I1D A;  4GS4 A;  4R3K A;  4KLV A;  4E2A A;  3F5B A;  4MI4 A;  4XPD C;  4KVX A;  3FRM A;  3P2F A;  2B58 A;  2BL1 A;  2R98 A;  4YFJ A;  1VHS A;  1B6B A;  4B5O A;  3KKW A;  4KOW A;  2VEZ A;  2PDO A;  3VWE A;  3R9E A;  1S5K A;  3FYN A;  4I49 A;  3NE7 A;  3VWD A;  4QVT A;  5E96 A;  4HNX B;  3C26 A;  4K30 A;  2ZW7 A;  2R7H A;  4RS2 A;  5DWN A;  3PZJ A;  1XMT A;  1ON0 A;  3PGP A;  1I21 A;  1KUX A;  5IX3 A;  2Y0M A;  4PV6 A;  1XF8 A;  2EVN A;  2Q4V A;  4DNC A;  4E8O A;  3FNC A;  5C88 A;  3D2P A;  2AJ6 A;  4PSX A;  1LRZ A;  4ZBG A;  4X5K A;  5CNP A;  1MJB A;  4JXR A;  4CRZ B;  5HMN A;  4UWI A;  4U9Z A;  2D4P A;  4CS0 B;  4U9Y A;  2I00 A;  4KOS A;  1WWZ A;  3BJ8 A;  3BLN A;  2C27 A;  4BMH A;  2WPX A;  4ONU A;  2K5T A;  3TOA A;  5C82 A;  4AG9 A;  2B4D A;  4R9M A;  5F46 A;  3JVN A;  2Z11 A;  4FD7 A;  2P6F A;  4AVA A;  5EC4 A;  5H86 A;  4H89 A;  2QML A;  2OB0 A;  4M85 A;  4HNW B;  1R57 A;  1YRE A;  4KLW A;  1Q2Y A;  2BUE A;  2CNM A;  2ZW5 A;  1YVO A;  3TTH A;  3TO7 A;  4H6Z A;  1IID A;  2ARH A;  2FS5 A;  2FIW A;  3CXQ A;  2ZPA A;  1YX0 A;  4XPD B;  3TO6 A;  1S7N A;  1M44 A;  2G3T A;  5F47 A;  4UA3 A;  3FBU A;  1WK4 A;  1J4J A;  2Q4Y A;  4J3G A;  2QEC A;  3EXN A;  4MJ8 A;  4UBR A;  4CAW A;  1QSN A;  1BO4 A;  2G0B A;  3DR6 A;  3CXS A;  3DDD A;  1M4I A;  5KTC A;  1GHE A;  5IB0 A;  1RO5 A;  3LOD A;  4JD6 A;  3S6H A;  3TCV A;  4KVO E;  3SXO A;  1P4N A;  2JDC A;  2FSR A;  2VZZ A;  1RXT A;  2B5G A;  3LD2 A;  1PUA A;  1M4D A;  3DR8 A;  5GCN A;  1XEB A;  1IB1 E;  1MJA A;  4OLL A;  2NMT A;  4JWP A;  1QSR A;  4ORF A;  1QSM A;  4KOT A;  1K4J A;  2REF A;  4R87 A;  1M1D A;  4OAE A;  2PSW A;  4XPL A;  3W91 A;  3MGD A;  4MBU A;  3B8G A;  1Z4E A;  2B4D B;  3QB8 A;  5KTD A;  4CRY B;  3FXT A;  2Q0Y A;  3GKR A;  3GY9 A;  3EFA A;  3DNS A;  2GAN A;  4B5P A;  4QBJ A;  1B87 A;  3H4Q A;  2WPW A;  3PP9 A;  3TOB A;  4U5Y A;  2JEV A;  3SXN A;  1Y9K A;  2PR8 A;  1UFH A;  1S7L A;  2OZG A;  5DWM A;  2VQY A;  1NSL A;  3D8P A;  3EY5 A;  1MK4 A;  1S3Z A;  2FL4 A;  2FXF A;  3E0K A;  3R1K A;  1YLE A; 
#chains in the Genus database with same CATH topology
 4F0Y A;  3GLJ A;  4NCZ A;  2DXQ A;  4MY3 A;  4JYW A;  3F0A A;  4R7M A;  4MFK A;  3TO9 A;  5LYL A;  4MFZ A;  4P4E A;  2ZEH A;  4FUU A;  4PK2 A;  2FCK A;  4II9 A;  1Z9U A;  2I3C A;  3D68 A;  4PXB A;  3UY5 A;  2J8R A;  2C6G A;  1IYK A;  4C68 A;  2NSM A;  2XEJ A;  2DPS A;  3NH4 A;  5CBM A;  4LQG A;  3IWW A;  2REE A;  1QMU A;  3FVL A;  1CPX A;  3JUW A;  4AG7 A;  4X8I A;  2BCO A;  2PJC A;  3W6S A;  3PRT A;  1YLO A;  2EK8 A;  1OZP A;  2GE3 A;  2QIR A;  2F8H A;  2Z0Z A;  2ZEG A;  3CPX A;  1CPS A;  1ELL P;  2ZOG A;  2ZOF A;  4JJX A;  3ZJ0 A;  4R57 A;  4B14 A;  1BPN A;  4AB7 A;  1YVK A;  4F9U A;  5ELY A;  4A2Z A;  1M4G A;  2F7V A;  2CY2 A;  2CTB A;  2G3A A;  2OH1 A;  4M6I A;  4MRI A;  4RI1 A;  2YND A;  5AG7 A;  3T90 A;  4CPA A;  4P45 A;  1KWM A;  2C1C A;  4P44 A;  2VBQ A;  5FVJ A;  3IWG A;  1TXR A;  1Z2L A;  4HKF A;  2YNC A;  4ZI6 A;  2IMO A;  1YGH A;  3BHX A;  2PRQ A;  5K8P A;  3G3S A;  5ISV A;  2ZW6 A;  2Z3M A;  4Y49 B;  4B10 A;  4R3L A;  2EK9 A;  3KL9 A;  3S6K A;  3SHP A;  4O23 A;  4NGN A;  8CPA A;  2HUZ A;  4FBE A;  3JTK A;  4MFQ A;  4F0X A;  2ZED A;  1IYL A;  1Y9W A;  3IO1 A;  3WC6 A;  2CNS A;  1N71 A;  4Q38 A;  2OOT A;  1PYT B;  2R8V A;  1ZG9 A;  1P0H A;  1QQ9 A;  2GFQ A;  4NXY A;  4CYN A;  2ANP A;  3S9M A;  1GYT A;  2PRB A;  4XPK A;  3TE4 A;  1AUG A;  4B11 A;  1XE4 A;  2IL4 A;  2OZU A;  1Z5R A;  3CT9 A;  2Q44 A;  3WR7 A;  7CPA A;  1YW4 A;  2Q4Z A;  3FB3 A;  1VHE A;  2VXK A;  3KI9 A;  4NGP A;  3GUX A;  1UWY A;  2CTC A;  4A94 A;  5LRJ A;  2AE6 A;  4CAF A;  5D29 A;  3SJG A;  3NH5 A;  4ZX8 A;  2JBK A;  1MJ9 A;  2J8N A;  5F48 A;  1Q2C A;  4FD5 A;  1CJW A;  4UEE A;  2O4H A;  1CBX A;  4Y49 C;  1KUV A;  4NGQ A;  5EBV A;  1FY7 A;  2Z3O A;  3D7H A;  4IHM A;  1KUY A;  4OC0 A;  2Q7B A;  3KHZ A;  4Q36 A;  2X7B A;  1OBR A;  4CGN A;  2RFH A;  3FED A;  4OC1 A;  2CNT A;  4L89 A;  4MHN A;  1I12 A;  3WAB A;  4OC2 A;  4OC3 A;  1YW6 A;  3IU2 A;  4IUS A;  4H6U A;  1A2Z A;  2PIY A;  3V8I A;  1DTD A;  4KOY A;  1XFO A;  2ZEM A;  4MHP A;  4QB9 A;  1XIX A;  3TX8 A;  5K8N A;  5F49 A;  2AFS A;  4KVM E;  1ZLI A;  4KS9 A;  1Q2D A;  1NE9 A;  4M6H A;  4R8F A;  4M3S A;  3EO4 A;  2KCW A;  1BPM A;  2R1I A;  1NMT A;  3W6X A;  3MN8 A;  3H8F A;  4FD4 A;  2HQY A;  2PC1 A;  3RNZ A;  5F09 A;  5JPH A;  1JQG A;  2EWB A;  3R9G A;  3DSB A;  3R95 A;  1LFW A;  3I9S A;  1IIC A;  2PR1 A;  4P4D A;  1BOB A;  1EE3 P;  1YK3 A;  1YME A;  2HC9 A;  2B4B A;  2PJ9 A;  2O28 A;  2PQ8 A;  2PVW A;  2RB7 A;  1DE4 C;  1Z4R A;  3BXM A;  4BBH A;  4NF1 A;  1IGB A;  4HPS A;  3FEE A;  4IF5 A;  2P0W A;  3KQZ A;  1V0C A;  3D3S A;  3LMS A;  5AG5 A;  3K9T A;  3N5F A;  5I0C A;  4KSI A;  3CZX A;  5JQ4 A;  4HNY B;  4XNH C;  4P4F A;  2BEI A;  3G8W A;  4E0A A;  4F9V A;  2IJZ A;  1Y7E A;  2Z3P A;  3KHX A;  1AMP A;  4KOR A;  4MCS A;  4KOU A;  3FF3 A;  4NSQ A;  4OC5 A;  4GXH A;  2IQ6 A;  2P6G A;  1LAM A;  3VAT A;  3PB4 X;  4MHZ A;  2XEF A;  4Z65 A;  4KZT A;  5G20 A;  3TFY A;  2ZXV A;  4NEX A;  1XJO A;  5IV0 A;  5JGF A;  5EMI A;  4UWJ A;  4IAV A;  1F2O A;  4AVC A;  3FIX A;  1CP7 A;  4UIB A;  5J8F A;  1IU8 A;  1IOI A;  4A39 A;  1Y0Y A;  2V8G A;  2B3U A;  4OP4 A;  4YRH A;  4CAX A;  4MY0 A;  2PJ7 A;  4MCR A;  5J1Q A;  3CPA A;  5HXD A;  3KR4 A;  2JLM A;  3BJ7 A;  2FIA A;  5HVF A;  1U6M A;  2VI7 A;  3RYO A;  1CP6 A;  3D7D A;  4KUA A;  2PJ4 A;  2PVV A;  1Y0R A;  3KGQ A;  1R43 A;  2Z10 A;  3D2M A;  3QAH A;  3B7I A;  2AFZ A;  4P10 A;  4CGL A;  5AG4 A;  1S7F A;  3KAS A;  3N7Z A;  4CAV A;  1NSA A;  4NGT A;  4OAD A;  2C6C A;  4B6Z A;  2DF5 A;  4EVY A;  1TIQ A;  4ZY0 A;  4CYQ A;  4YGO A;  2AFU A;  3S9L A;  5KTA A;  3IIB A;  3OWC A;  4H2K A;  3F8K A;  2YNC C;  3FX6 A;  3IFE A;  3P2H A;  4KSA A;  4LUA A;  4OC4 A;  2A4N A;  4PPZ A;  2ZEO A;  1TKH A;  1YR0 A;  1S60 A;  4UCM A;  1VKC A;  4FAI A;  4F6A A;  4FWU A;  2B5G B;  4KSF A;  4CGM A;  1RTQ A;  3IGR A;  4KOV A;  2PE3 A;  4OKO A;  2JEW A;  2HV2 A;  2J8M A;  3LAC A;  4AVB A;  2PCU A;  2V77 A;  1S7K A;  4C2Y A;  2D4O A;  3CXP A;  2RC4 A;  1BAV A;  3EC4 A;  4RUH A;  5A28 A;  2PJ5 A;  3DGV A;  2GIV A;  4MHD A;  2JDD A;  3GB0 A;  3I3G A;  3WC5 A;  2F5I A;  3S6G A;  1LOK A;  2C6P A;  2P6E A;  4JXQ A;  2ATR A;  2OZH A;  3IC1 A;  4KOX A;  2EUI A;  3K9U A;  3T9Y A;  3B3C A;  2ZW4 A;  3D66 A;  5J8C A;  1H8L A;  3B3S A;  4P6Y A;  4P4J A;  3SI2 A;  5AG6 A;  4A33 A;  1QSO A;  4P4I A;  4JLY A;  4PK3 A;  1AYE A;  4DYO A;  1L0C A;  4FD6 A;  3S6F A;  3R96 A;  2FT0 A;  4PSW A;  1CM0 A;  1F57 A;  2I79 A;  2DPT A;  4QC6 A;  3D7F A;  4X3R A;  2H5M A;  4UF4 A;  4A37 A;  3B3V A;  3WC7 A;  1KZF A;  2B3V A;  1VGY A;  3NH8 A;  5HH1 A;  4YWY A;  5LRG A;  1Y7R A;  4B5P B;  5D8N A;  2FE7 A;  4KUB A;  4LX9 A;  4NGM A;  3GYA A;  2Q04 A;  1XBU A;  3H8E A;  1SQH A;  3TT2 A;  4QUS A;  3ZZI A;  3GIU A;  1QST A;  2OU2 A;  2PJ8 A;  4L8A A;  2CF4 A;  2VZY A;  2BSW A;  4F8Z A;  3R9F A;  1X10 A;  3B2Y A;  1IOF A;  3SI1 A;  4A38 A;  1PU9 A;  4W9Y A;  4JZ0 A;  4MFJ A;  2Z3K A;  4NJR A;  4XNH B;  5LYF A;  5H84 A;  1I1D A;  4GS4 A;  4RN7 A;  4R3K A;  4KLV A;  4E2A A;  2Q7S A;  3A9L A;  3F5B A;  2ZEP A;  2ZEL A;  3IWE A;  3KR5 A;  4MI4 A;  3FH4 A;  4XPD C;  1HEE A;  2PJ6 A;  4EFD A;  4KVX A;  3FRM A;  3P2F A;  2POK A;  3PBB A;  1TKJ A;  2B58 A;  1TKF A;  2BL1 A;  2EO8 A;  3PBE A;  2R98 A;  4CGP A;  2YNE A;  4YFJ A;  1VHS A;  1B6B A;  4PXD A;  4B5O A;  3IU1 A;  3KKW A;  2G9D A;  1YQE A;  2O53 A;  4KOW A;  2VEZ A;  3MRU A;  4LQ6 A;  4C2Z A;  2PDO A;  3VWE A;  3R9E A;  1S5K A;  3FYN A;  4I49 A;  3NE7 A;  3PB7 X;  1FNO A;  4UEZ A;  3VWD A;  4NJQ A;  2AFW A;  4A30 A;  1IY7 A;  4QVT A;  5E96 A;  3SJE A;  4HNX B;  4CYP A;  1PCA A;  3C26 A;  4K30 A;  2ZW7 A;  2R7H A;  4RS2 A;  4UFX A;  5DWN A;  5A27 A;  2QJ8 A;  3K2K A;  3PZJ A;  3IJ3 A;  3KQX A;  2CXA A;  2CIJ A;  4Q7A A;  2ABZ A;  5IB9 A;  3BI1 A;  1XMT A;  1ON0 A;  3PGP A;  5JM6 A;  5K8O A;  1I21 A;  1KUX A;  3T8W A;  3HUV A;  2Y0M A;  4PV6 A;  5IX3 A;  1XF8 A;  2AFM A;  2EVN A;  5LRK A;  2Q51 A;  3IEH A;  4BIN A;  3DLJ A;  2Q4V A;  4DNC A;  1FT7 A;  4E8O A;  3FNC A;  5C88 A;  4ZY2 A;  4C2X A;  1XOV A;  1TF8 A;  3B35 A;  3D2P A;  2AJ6 A;  1X12 A;  4PSX A;  1LRZ A;  1ZG8 A;  4PXC A;  3V38 A;  4ZBG A;  4X5K A;  5CNP A;  1MJB A;  2V8D A;  3QAY A;  3TC8 A;  4A32 A;  4JXR A;  4CRZ B;  5HVH A;  5CPA A;  3PB9 X;  5HMN A;  4UWI A;  4U9Z A;  2D4P A;  4CS0 B;  4U9Y A;  2I00 A;  1ZG7 A;  4KOS A;  3ISZ A;  1WWZ A;  2WYR A;  2ODF A;  3BJ8 A;  3NA6 A;  3V7Z A;  3BLN A;  3HLP A;  3NE8 A;  2C27 A;  4BMH A;  5BWA B;  4A95 A;  1BLL E;  3S9N A;  2V8V A;  2FVG A;  2WPX A;  4ONU A;  2K5T A;  3SJX A;  3TOA A;  1XRY A;  4CGO A;  3RAM A;  2GLJ A;  5C82 A;  4AG9 A;  1TF9 A;  4IK2 A;  3RBU A;  2B4D A;  4MXU A;  4R9M A;  5F46 A;  3JVN A;  2Z11 A;  3PFE A;  4FD7 A;  2P6F A;  4AVA A;  5EC4 A;  4NFR A;  2PJB A;  6CPA A;  3L2N A;  4M6G A;  2WSA A;  5H86 A;  5K8M A;  5DS0 A;  4H89 A;  1LAP A;  5LYD A;  2QML A;  2EBJ A;  4R76 A;  2OB0 A;  2Q43 A;  4M85 A;  2BO9 A;  4TWE A;  5G22 A;  2AFO A;  4HNW B;  3D7G A;  3SI0 A;  1R57 A;  4C7H A;  2JBJ A;  1YRE A;  4UIA A;  1HDU A;  4KLW A;  4PQA A;  3RZA A;  2PJ3 A;  1Q2Y A;  2CNM A;  2BUE A;  2BOA A;  2ZW5 A;  5JH9 A;  1YVO A;  3TTH A;  2AFX A;  3B3T A;  4UCN A;  3PEI A;  3TO7 A;  4MMO A;  4H6Z A;  1IID A;  2QVP A;  4R6T A;  2ARH A;  1CX8 A;  2FS5 A;  2XEG A;  2FIW A;  3CXQ A;  2ZPA A;  1YX0 A;  3PB8 X;  4XPD B;  3TO6 A;  4MFP A;  2NYQ A;  4PXE A;  1S7N A;  1M44 A;  2G3T A;  5F47 A;  2PJ2 A;  1VHO A;  2GU2 A;  1F2P A;  2DEA A;  4UA3 A;  3FBU A;  2GLF A;  1WK4 A;  1J4J A;  2Q4Y A;  4J3G A;  2QEC A;  3EXN A;  1XMB A;  4MJ8 A;  4UBR A;  3PB6 X;  4CAW A;  5G1Z A;  4NGR A;  1QSN A;  1ELM P;  2PIZ A;  1BO4 A;  2G0B A;  1LCP A;  1VIX A;  4UEF A;  3BI0 A;  4CAE A;  3DR6 A;  1ARL A;  3CXS A;  3DDD A;  2Z3L A;  1M4I A;  5KTC A;  1GHE A;  3D67 A;  5IB0 A;  4K3N A;  4BD9 A;  3B3W A;  3H8G A;  1RO5 A;  4MCP A;  1LAN A;  1YSJ A;  3LOD A;  4MHY A;  4JD6 A;  3S6H A;  3TCV A;  4YU9 A;  1Z8L A;  4KVO E;  4TNU A;  2PJ1 A;  3SXO A;  4DUK A;  4EWT A;  1P4N A;  2JDC A;  4DJL A;  2FSR A;  2VZZ A;  2WUU A;  1RXT A;  2B5G A;  2XEI A;  3LD2 A;  3RO0 A;  4C7I A;  1HDQ A;  1Z8T A;  4B13 A;  1PUA A;  1M4D A;  3DR8 A;  5GCN A;  1XEB A;  1M4L A;  3CDX A;  1IB1 E;  4GM5 A;  2V8H A;  1MJA A;  4X2T A;  2HB6 A;  1R3N A;  4OLL A;  2NMT A;  3SJF A;  1Z8W A;  4JWP A;  1QSR A;  1JWQ A;  4OIW A;  4ORF A;  4WWV A;  1QSM A;  3I1U A;  4KOT A;  4ONW A;  4CYO A;  4ZY1 A;  1K4J A;  2REF A;  4AXV A;  4R87 A;  2VL1 A;  1M1D A;  2WZN A;  4OAE A;  3QNV A;  2PSW A;  5I4M A;  1CG2 A;  4MFL A;  4UFW A;  4XPL A;  3W91 A;  3MGD A;  2PJ0 A;  4MBU A;  4P4B A;  4MCQ A;  2ZEE A;  4ZX9 A;  3B8G A;  3ISX A;  3JRU A;  1Z4E A;  2B4D B;  1ZO0 A;  2GRE A;  3QB8 A;  4UCP A;  4WJB A;  5KTD A;  1ZLH A;  4CRY B;  2Z3N A;  2YGW A;  2ZEN A;  3FXT A;  5AGE A;  2Q0Y A;  3GKR A;  3GY9 A;  3EFA A;  4UFV A;  5HVG A;  3DNS A;  3FEC A;  3VH9 A;  2GAN A;  3D4U A;  3VAR A;  3WT4 A;  4B5P A;  4OID A;  4QBJ A;  1B87 A;  3H4Q A;  2WPW A;  1Z8X A;  2ZEF A;  3FMC A;  3H5Z A;  3NFZ A;  4A31 A;  4G1P A;  1ARM A;  3FJU A;  3PP9 A;  3TOB A;  4U5Y A;  2JEV A;  3SXN A;  1Y9K A;  2PR8 A;  1UFH A;  5G21 A;  1Q7L A;  4NGS A;  3KZW A;  4ZYQ A;  4B12 A;  1S7L A;  2OZG A;  5THW A;  4EME A;  4ZGY B;  5DWM A;  2VQY A;  1NSL A;  3D8P A;  2PJA A;  1MK4 A;  3EY5 A;  3PFO A;  1S3Z A;  2J9A A;  2FL4 A;  2FXF A;  3E0K A;  2QYV A;  2OR4 A;  3R1K A;  1YLE A;  5LYI A;  3LWU A;  4OME A; 
#chains in the Genus database with same CATH homology
 4F0Y A;  4NCZ A;  2DXQ A;  4MY3 A;  3F0A A;  4MFK A;  3TO9 A;  4MFZ A;  4II9 A;  4PK2 A;  2FCK A;  1Z9U A;  3UY5 A;  2J8R A;  1IYK A;  4C68 A;  2DPS A;  2REE A;  3JUW A;  4AG7 A;  3W6S A;  2GE3 A;  1OZP A;  2QIR A;  2Z0Z A;  4JJX A;  3ZJ0 A;  4R57 A;  4B14 A;  4AB7 A;  1YVK A;  4A2Z A;  1M4G A;  2G3A A;  2CY2 A;  4RI1 A;  2OH1 A;  3T90 A;  5AG7 A;  2YND A;  2VBQ A;  5FVJ A;  3IWG A;  4HKF A;  2YNC A;  1YGH A;  3G3S A;  5ISV A;  2ZW6 A;  2Z3M A;  4Y49 B;  4B10 A;  4R3L A;  3S6K A;  3SHP A;  2HUZ A;  3JTK A;  4MFQ A;  4F0X A;  1IYL A;  1Y9W A;  2CNS A;  1N71 A;  4Q38 A;  2R8V A;  1P0H A;  4NXY A;  4CYN A;  2PRB A;  4XPK A;  3TE4 A;  4B11 A;  1XE4 A;  2IL4 A;  2OZU A;  2Q44 A;  3WR7 A;  3FB3 A;  2VXK A;  4CAF A;  2AE6 A;  1MJ9 A;  2J8N A;  5F48 A;  1Q2C A;  4FD5 A;  1CJW A;  5EBV A;  4Y49 C;  1KUV A;  1FY7 A;  2Z3O A;  2Q7B A;  1KUY A;  4Q36 A;  2X7B A;  4CGN A;  2CNT A;  4L89 A;  1I12 A;  3IU2 A;  4IUS A;  4H6U A;  3V8I A;  4KOY A;  4QB9 A;  1XIX A;  5F49 A;  4KVM E;  4KS9 A;  1Q2D A;  1NE9 A;  4M3S A;  3EO4 A;  2KCW A;  2R1I A;  1NMT A;  3W6X A;  5JPH A;  4FD4 A;  2HQY A;  2PC1 A;  3R9G A;  3DSB A;  3R95 A;  3I9S A;  1IIC A;  2PR1 A;  1BOB A;  1YK3 A;  2PQ8 A;  2B4B A;  2O28 A;  4BBH A;  1Z4R A;  4NF1 A;  4IF5 A;  2P0W A;  5AG5 A;  1V0C A;  3D3S A;  5I0C A;  5JQ4 A;  4HNY B;  4XNH C;  2BEI A;  3G8W A;  4E0A A;  2Z3P A;  4KOR A;  4KOU A;  4NSQ A;  2P6G A;  4KZT A;  5G20 A;  3TFY A;  2ZXV A;  4NEX A;  5IV0 A;  4UWJ A;  4AVC A;  3FIX A;  5J8F A;  4YRH A;  2B3U A;  4CAX A;  4MY0 A;  2JLM A;  3BJ7 A;  2FIA A;  1U6M A;  2VI7 A;  3RYO A;  4KUA A;  3QAH A;  2Z10 A;  3D2M A;  5AG4 A;  4CGL A;  1S7F A;  3N7Z A;  4CAV A;  4OAD A;  4EVY A;  1TIQ A;  4CYQ A;  4YGO A;  5KTA A;  3OWC A;  3F8K A;  2YNC C;  4LUA A;  4KSA A;  3P2H A;  2A4N A;  1YR0 A;  1S60 A;  4UCM A;  1VKC A;  4F6A A;  4KSF A;  2B5G B;  4CGM A;  3IGR A;  4KOV A;  2HV2 A;  2J8M A;  4AVB A;  4C2Y A;  1S7K A;  2D4O A;  3CXP A;  2RC4 A;  3EC4 A;  5A28 A;  2GIV A;  4MHD A;  2JDD A;  3I3G A;  2F5I A;  3S6G A;  2P6E A;  4JXQ A;  2ATR A;  2OZH A;  4KOX A;  2EUI A;  3K9U A;  3T9Y A;  2ZW4 A;  5J8C A;  4A33 A;  5AG6 A;  1QSO A;  4JLY A;  4PK3 A;  1L0C A;  4FD6 A;  3S6F A;  3R96 A;  2FT0 A;  4PSW A;  1CM0 A;  2I79 A;  2DPT A;  4QC6 A;  2H5M A;  1KZF A;  2B3V A;  5HH1 A;  4B5P B;  1Y7R A;  2FE7 A;  4KUB A;  4LX9 A;  3GYA A;  2Q04 A;  1SQH A;  3TT2 A;  4QUS A;  3ZZI A;  1QST A;  2OU2 A;  4L8A A;  2VZY A;  2BSW A;  3R9F A;  1PU9 A;  4MFJ A;  2Z3K A;  4XNH B;  5H84 A;  1I1D A;  4GS4 A;  4R3K A;  4KLV A;  4E2A A;  3A9L A;  3F5B A;  3IWE A;  4MI4 A;  4XPD C;  4KVX A;  3FRM A;  3P2F A;  2B58 A;  2BL1 A;  2R98 A;  4CGP A;  2YNE A;  4YFJ A;  1VHS A;  1B6B A;  4B5O A;  3IU1 A;  3KKW A;  4KOW A;  2VEZ A;  4C2Z A;  2PDO A;  3VWE A;  3R9E A;  1S5K A;  3FYN A;  4I49 A;  3NE7 A;  3VWD A;  4A30 A;  4QVT A;  5E96 A;  4HNX B;  4CYP A;  3C26 A;  4K30 A;  2ZW7 A;  2R7H A;  4RS2 A;  4UFX A;  5DWN A;  5A27 A;  3PZJ A;  2CXA A;  1XMT A;  1ON0 A;  3PGP A;  1I21 A;  1KUX A;  5IX3 A;  2Y0M A;  4PV6 A;  1XF8 A;  2EVN A;  2Q4V A;  4DNC A;  4E8O A;  3FNC A;  5C88 A;  4C2X A;  3D2P A;  2AJ6 A;  4PSX A;  1LRZ A;  4ZBG A;  4X5K A;  5CNP A;  1MJB A;  4A32 A;  4JXR A;  4CRZ B;  5HMN A;  4UWI A;  4U9Z A;  2D4P A;  4CS0 B;  4U9Y A;  2I00 A;  4KOS A;  1WWZ A;  3BJ8 A;  3BLN A;  2C27 A;  4BMH A;  5BWA B;  4A95 A;  2WPX A;  4ONU A;  2K5T A;  3TOA A;  4CGO A;  5C82 A;  4AG9 A;  2B4D A;  4R9M A;  5F46 A;  3JVN A;  2Z11 A;  4FD7 A;  2P6F A;  4AVA A;  5EC4 A;  2WSA A;  5H86 A;  4H89 A;  2QML A;  2OB0 A;  4M85 A;  5G22 A;  4HNW B;  1R57 A;  4C7H A;  1YRE A;  4KLW A;  1Q2Y A;  2BUE A;  2CNM A;  2ZW5 A;  1YVO A;  3TTH A;  4UCN A;  3TO7 A;  4H6Z A;  1IID A;  2ARH A;  2FS5 A;  2FIW A;  3CXQ A;  2ZPA A;  1YX0 A;  4XPD B;  3TO6 A;  4MFP A;  1S7N A;  1M44 A;  2G3T A;  5F47 A;  4UA3 A;  3FBU A;  1WK4 A;  1J4J A;  2Q4Y A;  4J3G A;  2QEC A;  3EXN A;  4MJ8 A;  4UBR A;  4CAW A;  5G1Z A;  1QSN A;  1BO4 A;  2G0B A;  4CAE A;  3DR6 A;  3CXS A;  3DDD A;  2Z3L A;  1M4I A;  5KTC A;  1GHE A;  5IB0 A;  1RO5 A;  3LOD A;  4JD6 A;  3S6H A;  3TCV A;  4KVO E;  3SXO A;  1P4N A;  2JDC A;  2FSR A;  2VZZ A;  2WUU A;  1RXT A;  2B5G A;  3LD2 A;  4C7I A;  4B13 A;  1PUA A;  1M4D A;  3DR8 A;  5GCN A;  1XEB A;  1IB1 E;  1MJA A;  4OLL A;  2NMT A;  4JWP A;  1QSR A;  4ORF A;  1QSM A;  4KOT A;  4CYO A;  1K4J A;  2REF A;  4R87 A;  1M1D A;  4OAE A;  2PSW A;  4UFW A;  4MFL A;  4XPL A;  3W91 A;  3MGD A;  4MBU A;  3B8G A;  1Z4E A;  2B4D B;  1ZO0 A;  4UCP A;  3QB8 A;  5KTD A;  4CRY B;  2Z3N A;  2YGW A;  3FXT A;  5AGE A;  2Q0Y A;  3GKR A;  3GY9 A;  3EFA A;  4UFV A;  3DNS A;  2GAN A;  4B5P A;  4QBJ A;  1B87 A;  3H4Q A;  2WPW A;  4A31 A;  3H5Z A;  3PP9 A;  3TOB A;  4U5Y A;  2JEV A;  3SXN A;  1Y9K A;  2PR8 A;  1UFH A;  5G21 A;  4B12 A;  1S7L A;  2OZG A;  4ZGY B;  5DWM A;  2VQY A;  1NSL A;  3D8P A;  3EY5 A;  1MK4 A;  1S3Z A;  2FL4 A;  2FXF A;  3E0K A;  3R1K A;  1YLE A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...