3CXPA

Crystal structure of human glucosamine 6-phosphate n-acetyltransferase 1 mutant e156a
Total Genus 43
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
43
sequence length
184
structure length
184
Chain Sequence
MKPDETPMFDPSLLKEVDWSQNTATFSPAISPTHPGEGLVLRPLCTADLNRGFFKVLGQLTETGVVSPEQFMKSFEHMKKSGDYYVTVVEDVTLGQIVATATLIIEHKFIHSCAKRGRVEDVVVSDECRGKQLGKLLLSTLTLLSKKLNCYKITLACLPQNVGFYKKFGYTVSEENYMCRRFLK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Acceptor substrate binding revealed by crystal structure of human glucosamine-6-phosphate N-acetyltransferase 1
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
molecule keywords Glucosamine 6-phosphate N-acetyltransferase
total genus 43
structure length 184
sequence length 184
ec nomenclature ec 2.3.1.4: Glucosamine-phosphate N-acetyltransferase.
pdb deposition date 2008-04-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00583 Acetyltransf_1 Acetyltransferase (GNAT) family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.630.30 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Aminopeptidase 3cxpA01
2C27A 2OZUA 4Y49B 4CRYB 5DWNA 3EXNA 4KOSA 1J4JA 3EO4A 3D3SA 1Y7RA 3S6GA 2B58A 1QSMA 2HUZA 1BOBA 1L0CA 2PDOA 1Y9KA 4MY3A 3SXNA 2P6EA 4NSQA 1NE9A 4PK3A 1BO4A 5H84A 3P2FA 3TOBA 3D2MA 3S6KA 4OADA 1MJBA 2R98A 2Z11A 2PR1A 2FS5A 4KOYA 1QSTA 5IX3A 1M4GA 4ORFA 1IIDA 3NE7A 2Q4VA 3JUWA 2WPWA 3CXQA 5EBVA 5F49A 1U6MA 2Q7BA 2FIWA 4KLVA 2OH1A 2QMLA 4X5KA 4IUSA 2K5TA 3K9UA 2FIAA 5F46A 3PZJA 4MY0A 4R57A 2VXKA 2AE6A 2B4DB 4ONUA 4B5OA 2BUEA 4M3SA 1S7LA 2NMTA 4MI4A 3BJ8A 3S6HA 2BEIA 2JLMA 1M1DA 4F0YA 4QB9A 2CY2A 2Q44A 3F0AA 4UWJA 2GE3A 2JDDA 2VBQA 3H4QA 3LODA 4UA3A 4H6ZA 1QSOA 5CNPA 1QSNA 1IB1E 2Q4YA 1XF8A 1WWZA 4JJXA 1KUVA 3D2PA 2OZHA 3WR7A 3PP9A 4MBUA 3N7ZA 2PC1A 4B5PA 1I1DA 2A4NA 4FD7A 3LD2A 1M4DA 1M44A 2REFA 4QBJA 4R9MA 1MJAA 3GY9A 2D4OA 5FVJA 2G3TA 3R9FA 1S3ZA 2QIRA 4OLLA 1I12A 1M4IA 1V0CA 4KORA 3FNCA 2VEZA 4JWPA 3I9SA 4XPLA 3DNSA 4H6UA 1ON0A 2I00A 1OZPA 3CXSA 3W6XA 4CAXA 2ZW5A 3T9YA 4L8AA 5GCNA 3TOAA 5IB0A 1NMTA 2VZZA 4XPDC 1PU9A 2PQ8A 2VZYA 1Q2YA 2B3VA 2H5MA 3FB3A 3TTHA 1FY7A 1KUYA 3G3SA 1NSLA 3RYOA 3VWEA 4NXYA 1YVKA 2REEA 2WPXA 3IWGA 4KLWA 2DXQA 1IICA 1Q2DA 2R8VA 3W6SA 2ZXVA 3QB8A 2B4DA 4HNWB 1UFHA 4UBRA 4B5PB 1SQHA 3C26A 5C82A 4IF5A 4J3GA 2EUIA 4ZBGA 1YX0A 3GKRA 3V8IA 2FL4A 4KUAA 4PSWA 2B4BA 2EVNA 3TO6A 3CXPA 1XMTA 3SHPA 1VKCA 2CNTA 4AVBA 3F8KA 3EY5A 3E0KA 2OB0A 2X7BA 3W91A 4XPDB 3VWDA 1Z9UA 4Y49C 3S6FA 1Z4RA 1LRZA 2GIVA 3R96A 4XNHB 2J8NA 1YVOA 2IL4A 2VQYA 4M85A 4YRHA 2HQYA 3TO7A 4AB7A 4KVXA 4LUAA 4QC6A 1S7NA 3TCVA 2CNSA 3FRMA 1S60A 1S7KA 4CAVA 2HV2A 4KVME 3EC4A 3R9EA 1RXTA 4NF1A 2B5GB 2FSRA 5E96A 3BLNA 4LX9A 2JDCA 2ZW4A 1I21A 4FD6A 2G0BA 1Z4EA 1IYLA 1WK4A 4GS4A 4MJ8A 1CM0A 3B8GA 1KZFA 5KTDA 2OZGA 3KKWA 2PR8A 4NCZA 2J8MA 4NEXA 2O28A 3IGRA 4U9ZA 2AJ6A 2FT0A 5KTCA 4YGOA 1MK4A 1QSRA 2GANA 2RC4A 4CAWA 1YR0A 1S7FA 5I0CA 3UY5A 3F5BA 4KOXA 2QECA 4XPKA 4AVCA 2BL1A 3TT2A 2Q04A 2ZW7A 4E0AA 2P0WA 3GYAA 4PK2A 2Y0MA 1YREA 4DNCA 4RI1A 4PSXA 1XEBA 3DR8A 1TIQA 5DWMA 4JXQA 4UWIA 2ATRA 3D8PA 3BJ7A 4KUBA 2F5IA 3P2HA 1XIXA 4R3LA 2FE7A 2I79A 1R57A 1Y9WA 4OAEA 5ISVA 5HH1A 4QVTA 4CRZB 2FXFA 1K4JA 1KUXA 3JVNA 3DDDA 4HNXB 3TE4A 4L89A 1MJ9A 1S5KA 4F6AA 5J8FA 4FD4A 4AG9A 2G3AA 4AG7A 2R1IA 3T90A 3TFYA 3R1KA 2CNMA 2KCWA 4FD5A 4HNYB 4II9A 1B6BA 1YGHA 2ARHA 3TO9A 4KOUA 1B87A 4KOVA 5KTAA 4JLYA 4BMHA 4R87A 4JXRA 4MHDA 5C88A 2B5GA 4KOWA 3QAHA 3I3GA 5EC4A 3R9GA 4RS2A 4I49A 2Z10A 3OWCA 1YK3A 2JEVA 1CJWA 5JQ4A 2Q0YA 2ZPAA 4U9YA 3PGPA 1N71A 4E8OA 4K30A 2Z0ZA 3ZJ0A 2BSWA 4U5YA 1GHEA 2P6GA 4JD6A 3SXOA 3MGDA 1P4NA 4KVOE 5JPHA 4AVAA 2ZW6A 2R7HA 2VI7A 1VHSA 1RO5A 3FIXA 5F47A 2J8RA 3R95A 3DR6A 4YFJA 4KZTA 2P6FA 3FXTA 1IYKA 4XNHC 5H86A 2PRBA 4H89A 4QUSA 3ZZIA 2B3UA 4HKFA 3EFAA 3DSBA 1YLEA 1PUAA 5F48A 4KOTA 2OU2A 1P0HA 5HMNA 3FYNA 4PV6A 4EVYA 3G8WA 4E2AA 3FBUA 2FCKA 2D4PA 4R3KA 5IV0A 1Q2CA 4CS0B 5J8CA 1XE4A 2PSWA
chains in the Genus database with same CATH superfamily
2C27A 3PFOA 2OZUA 4Y49B 4CRYB 2AFZA 5DWNA 1YW4A 3EXNA 4KOSA 3IU2A 1J4JA 1YW6A 3EO4A 2C1CA 3QNVA 3S9LA 3D3SA 1Y7RA 4F9VA 1HDUA 3S6GA 2Q7SA 4A2ZA 2B58A 1ARMA 1QSMA 2HUZA 4NGRA 3VH9A 2GU2A 1BOBA 4C2XA 1L0CA 2PDOA 1Y9KA 3KI9A 4H2KA 1Z5RA 4MY3A 3B3SA 2Q43A 4FWUA 3SXNA 4ZGYB 3IIBA 2P6EA 1TF9A 2O4HA 5I4MA 3IO1A 2IMOA 4NSQA 4MFLA 1NE9A 4PK3A 1BO4A 5H84A 4C2YA 3P2FA 3TOBA 3VARA 2PJ5A 3D2MA 3S6KA 4OADA 1MJBA 2R98A 2Z11A 3MRUA 2PR1A 2Z3MA 2FS5A 4KOYA 1QSTA 5IX3A 1M4GA 3CZXA 3PB4X 1PCAA 2ZELA 5HVFA 3KHXA 4ORFA 4ZYQA 1IIDA 2PVVA 2Q4VA 3NE7A 5D29A 4CGMA 3JUWA 2WPWA 2Z3KA 3PB6X 4MFKA 3D7GA 1R43A 3CXQA 1CPSA 3SJGA 5EBVA 2WUUA 3GB0A 4CYQA 2C6GA 1TKJA 1TKHA 2V8HA 4M6IA 5F49A 2Z3NA 1U6MA 2JBKA 2Q7BA 1JQGA 2EK8A 2FIWA 1QQ9A 4OC3A 2DPTA 5JM6A 4Z65A 2AFWA 3WABA 5LYFA 4CYNA 5LYDA 4KLVA 3WC7A 4OIWA 4F8ZA 1PYTB 2JEWA 2GLJA 2OH1A 1VIXA 2QMLA 4X5KA 1X12A 2QYVA 4UFVA 3KR4A 4IUSA 4MFJA 4MRIA 2GFQA 2K5TA 4CAFA 3K9UA 2FIAA 3SI1A 3CDXA 3D66A 3H8FA 5F46A 2PJ1A 3PZJA 4MY0A 1TF8A 2ZOFA 3PBEA 3PEIA 4R57A 4B12A 2VXKA 2AE6A 1FT7A 2B4DB 4OP4A 3FX6A 4ONUA 4A37A 4B5OA 2BUEA 4M3SA 1DE4C 3SJXA 1S7LA 2NMTA 2RFHA 4MI4A 3BJ8A 4NGTA 4PPZA 3S6HA 2BEIA 2JLMA 1M1DA 4F0YA 2F8HA 4OMEA 2C6CA 1CP7A 4QB9A 2NSMA 1HEEA 2CY2A 2EO8A 2ZENA 1A2ZA 2ZEFA 3BI1A 4B13A 1RTQA 2Q44A 2Z3OA 3B7IA 3F0AA 3NH8A 4UWJA 2GE3A 5HXDA 4MHNA 2QJ8A 2PIZA 4A38A 1XRYA 2JDDA 2VBQA 3H4QA 5ELYA 3LODA 4UCMA 4UA3A 3KZWA 3IEHA 1XJOA 3S9NA 4H6ZA 1IY7A 3SI2A 1QSOA 4LQGA 5CNPA 4JYWA 1QSNA 5HVHA 3T8WA 3FECA 1IB1E 3KHZA 3V38A 1ZG8A 2BO9A 3IC1A 2Q4YA 3L2NA 5DS0A 1XF8A 1WWZA 4IHMA 4JJXA 1KUVA 3D2PA 5CPAA 2OZHA 3WR7A 2ABZA 3PP9A 4MBUA 3N7ZA 3B3TA 3FVLA 4P45A 4UCPA 2PC1A 3PRTA 1Z8XA 4B5PA 1I1DA 2CTBA 2A4NA 4FD7A 3LD2A 1M4DA 2XEIA 1M44A 4OC4A 4P4JA 2REFA 4QBJA 4ZY0A 4R9MA 2F7VA 1MJAA 3GY9A 2IQ6A 4K3NA 3RYOA 5A27A 2D4OA 3JTKA 5FVJA 2G3TA 3R9FA 1S3ZA 4MCSA 2QIRA 1BLLE 1I12A 1XFOA 4OLLA 1M4IA 4FBEA 1XMBA 1V0CA 4KORA 2V8DA 4C7IA 4R76A 3FNCA 1H8LA 2YNDA 1YMEA 4UEZA 2VEZA 2VL1A 4MHPA 2PIYA 4JWPA 3I9SA 4OC2A 4XPLA 5JGFA 3DNSA 4H6UA 1ON0A 2ZEPA 2I00A 4G1PA 1OZPA 2CXAA 3CXSA 3W6XA 4GM5A 4CAXA 4OC0A 2ZEOA 2ZW5A 3T9YA 4L8AA 5GCNA 4MMOA 4OC5A 3TOAA 5IB0A 3FJUA 4C68A 5JH9A 2WZNA 3S9MA 1NMTA 3I1UA 4MHZA 2VZZA 4XPDC 4M6HA 4AXVA 1LAMA 1PU9A 2PQ8A 3PB9X 2VZYA 1Q2YA 1XOVA 3B3CA 2B3VA 2H5MA 3FB3A 3TTHA 5AGEA 1M4LA 1AUGA 1FY7A 1KUYA 3G3SA 3IU1A 1NSLA 4DJLA 3D7FA 1BPMA 3IFEA 4HPSA 4NXYA 4WJBA 5AG7A 1YVKA 1ZG7A 2ZEEA 3LACA 4YU9A 2REEA 2WPXA 3ISZA 3IWGA 2CIJA 2XEFA 4KLWA 4P4FA 4X3RA 2DXQA 1IICA 1ELMP 1Q2DA 2R8VA 4NGNA 4PQAA 3W6SA 2ZXVA 3FMCA 4UIBA 3QB8A 2CTCA 2B4DA 4NGSA 4EFDA 4FAIA 3GIUA 2PJ0A 3RO0A 3TC8A 3SJFA 4HNWB 1UFHA 4UBRA 4B5PB 4EWTA 1SQHA 3C26A 5C82A 4O23A 2EBJA 4WWVA 4IF5A 4J3GA 2EUIA 4ZBGA 1YX0A 4A95A 3GKRA 5AG6A 3V8IA 3KGQA 4Q36A 2FL4A 4KUAA 4PSWA 2B4BA 3CPXA 2EVNA 2GLFA 3CXPA 3ISXA 3TO6A 4R8FA 1YSJA 1KWMA 4NJRA 1XMTA 2ZEMA 3SHPA 1VKCA 2CNTA 4AVBA 1X10A 4ZX8A 3F8KA 3H8GA 4CAEA 1IOIA 2ZOGA 3EY5A 3E0KA 3GUXA 4P4DA 2OB0A 1Z8WA 1CG2A 5LRJA 2X7BA 4ONWA 2V77A 3W91A 4XPDB 3VWDA 1Z9UA 4Y49C 3S6FA 1Z8TA 5K8OA 1CPXA 1Z4RA 2DEAA 1LRZA 2GIVA 4B6ZA 3R96A 4XNHB 4MFQA 2J8NA 1YVOA 2DPSA 2IL4A 2VQYA 4X2TA 4M85A 2J9AA 5BWAB 6CPAA 5K8MA 4YRHA 2HQYA 3TO7A 3WC5A 1VGYA 3SJEA 4AB7A 5EMIA 2C6PA 2PVWA 4KVXA 4LUAA 4DYOA 5D8NA 4QC6A 3D67A 1S7NA 2ZEDA 3TCVA 2YNCA 2CNSA 3BXMA 3NH4A 1F57A 1Z8LA 3FRMA 1S60A 1S7KA 3DLJA 4UEFA 4FUUA 4CAVA 4TWEA 4B14A 5LYIA 1Y0YA 2HV2A 4KVME 3NFZA 2Q4ZA 3EC4A 2EWBA 4Q38A 4ZI6A 3R9EA 1RXTA 3LWUA 4NF1A 3BHXA 3DGVA 1BPNA 2B5GB 2FSRA 5E96A 3BLNA 4LX9A 3FEEA 4CPAA 4ZY1A 2JDCA 2ZW4A 3D7HA 5AG4A 2PJ4A 1I21A 4FD6A 1AYEA 4KS9A 2G0BA 1Z4EA 1IYLA 4OIDA 3HLPA 1WK4A 4GS4A 8CPAA 4MJ8A 1CM0A 2AFUA 2PJCA 3KL9A 4KSFA 3B8GA 1KZFA 3NE8A 5IB9A 5KTDA 2OZGA 3KKWA 2FVGA 2PR8A 4NCZA 2J8MA 4NEXA 4NGPA 3RNZA 2BOAA 3MN8A 1VHEA 2O28A 3IGRA 4U9ZA 4LQ6A 5THWA 1Y7EA 2ZEHA 1LAPA 4A39A 2AJ6A 3H8EA 2HB6A 2EK9A 2FT0A 4ZY2A 5KTCA 4YGOA 1MK4A 3KQZA 2PJ9A 1BAVA 1QSRA 4P44A 1LOKA 2GANA 4CGOA 2RC4A 3B3VA 3D68A 3PBBA 4CAWA 2AFXA 1YR0A 1VHOA 2I3CA 1S7FA 5J1QA 5I0CA 2ZEGA 4CYPA 3UY5A 3F5BA 3PFEA 3TX8A 4KOXA 3K9TA 1LCPA 5G1ZA 2QECA 4XPKA 4AVCA 2BL1A 3TT2A 2Q04A 2ZW7A 4E0AA 4F0XA 4A33A 2P0WA 4EMEA 3GYAA 4PK2A 3GLJA 2Y0MA 4P4EA 4CGLA 4A32A 1YREA 2YNCC 1JWQA 4KSAA 4CYOA 4DNCA 4RI1A 4MCPA 4MXUA 3SI0A 4PSXA 1XEBA 2PJ7A 3DR8A 5G22A 3NH5A 1TIQA 4W9YA 3FF3A 5DWMA 1Q7LA 2QVPA 3JRUA 4JXQA 4UWIA 2V8GA 2ATRA 3D8PA 1ZO0A 3BJ7A 4KUBA 1CBXA 1R3NA 1TXRA 4P4BA 4UFWA 4UEEA 2POKA 2PJBA 2XEJA 2F5IA 3P2HA 1XBUA 1XIXA 2IJZA 2NYQA 3QAYA 4R3LA 1DTDA 4UIAA 2FE7A 3BI0A 4OC1A 2I79A 1R57A 2PJ6A 2PJ3A 1Y9WA 4OAEA 3N5FA 2DF5A 2PJAA 5G20A 3KR5A 5ISVA 4C2ZA 4TNUA 4NGQA 2XEGA 4QVTA 5HH1A 4CRZB 2FXFA 5LYLA 2AFOA 4A94A 1K4JA 3RBUA 3VWEA 1KUXA 1ELLP 3FEDA 3JVNA 2PRQA 3B35A 3DDDA 4HNXB 4MFZA 3TE4A 4L89A 1MJ9A 1Z2LA 4P6YA 3A9LA 3HUVA 4RN7A 1S5KA 4F6AA 3RZAA 5J8FA 1CP6A 1LANA 4FD4A 2YNEA 4AG9A 2G3AA 4M6GA 4R6TA 4MCRA 1QMUA 4Q7AA 4AG7A 1Y0RA 2WSAA 2R1IA 2PJ2A 3T90A 3CPAA 3IWWA 3TFYA 3R1KA 2CNMA 4C7HA 4F9UA 3D7DA 2KCWA 1YQEA 3PB7X 4FD5A 4PXCA 2YGWA 4HNYB 4R7MA 3VATA 4II9A 1B6BA 3RAMA 1AMPA 1YGHA 1IGBA 2ARHA 4NGMA 4KOUA 3TO9A 4BBHA 1B87A 4P4IA 3V7ZA 4B11A 4KOVA 3KASA 3NA6A 5KTAA 2PE3A 3IWEA 4JLYA 4BMHA 1GYTA 3PB8X 4NFRA 4R87A 1ZLIA 2GREA 1LFWA 4JXRA 5G21A 4MHDA 5C88A 5F09A 2B5GA 1EE3P 4IK2A 3QAHA 4KOWA 4A31A 2V8VA 3I3GA 3KQXA 4IAVA 4P10A 5EC4A 3R9GA 4RS2A 1NSAA 4I49A 4MHYA 1IOFA 3LMSA 4BD9A 2Z10A 2Z3LA 2CF4A 5HVGA 2RB7A 3OWCA 4X8IA 5K8NA 4GXHA 1YK3A 2JEVA 1CJWA 2O53A 5JQ4A 5K8PA 2Q0YA 4RUHA 2ZPAA 4U9YA 4UF4A 5A28A 2BCOA 2HC9A 1N71A 3PGPA 4E8OA 1IU8A 4K30A 2Z0ZA 3ZJ0A 2BSWA 3IJ3A 4U5YA 4BINA 1GHEA 2P6GA 1OBRA 3FH4A 1F2OA 3B3WA 4JD6A 3MGDA 3SXOA 1ARLA 1P4NA 4YWYA 4B10A 4KVOE 5JPHA 1UWYA 3B2YA 4UFXA 4AVAA 2Q51A 2ZW6A 4DUKA 2PJ8A 1HDQA 2R7HA 4NJQA 2VI7A 3H5ZA 3CT9A 3WC6A 1VHSA 2ODFA 2PCUA 4PXDA 1RO5A 2G9DA 3FIXA 2J8RA 5F47A 2Z3PA 4ZX9A 2WYRA 5LRGA 3R95A 3DR6A 4CGPA 4YFJA 1ZLHA 4KZTA 2P6FA 4KSIA 4MFPA 3FXTA 1IYKA 1F2PA 1YLOA 4XNHC 3K2KA 4PXEA 2AFSA 5H86A 2JBJA 2AFMA 2OR4A 2PRBA 4MCQA 4H89A 4QUSA 3ZZIA 2B3UA 4HKFA 3WT4A 3D4UA 3EFAA 3DSBA 2ANPA 2OOTA 1YLEA 1PUAA 5F48A 1TKFA 4KOTA 4PXBA 2OU2A 5LRKA 1P0HA 4OKOA 1ZG9A 5HMNA 5AG5A 3FYNA 4PV6A 4JZ0A 4EVYA 4UCNA 5CBMA 3G8WA 4E2AA 1CX8A 3FBUA 2FCKA 1FNOA 2D4PA 4A30A 4CGNA 4R3KA 7CPAA 5IV0A 1Q2CA 4CS0B 5J8CA 1XE4A 2PSWA
chains in the Genus database with same CATH topology
2C27A 2OZUA 4Y49B 4CRYB 5DWNA 3EXNA 4KOSA 3IU2A 1J4JA 3EO4A 3D3SA 1Y7RA 3S6GA 4A2ZA 2B58A 1QSMA 2HUZA 1BOBA 4C2XA 1L0CA 2PDOA 1Y9KA 4MY3A 3SXNA 4ZGYB 5BWAB 2P6EA 4NSQA 4MFLA 1NE9A 4PK3A 1BO4A 5H84A 4C2YA 3P2FA 3TOBA 3D2MA 3S6KA 4OADA 1MJBA 2R98A 2Z11A 2PR1A 2Z3MA 2FS5A 4KOYA 1QSTA 5IX3A 1M4GA 4ORFA 1IIDA 3NE7A 2Q4VA 4CGMA 3JUWA 2WPWA 2Z3KA 4MFKA 3CXQA 5EBVA 2WUUA 4CYQA 5F49A 2Z3NA 1U6MA 2Q7BA 2FIWA 2DPTA 4CYNA 4KLVA 2OH1A 2QMLA 4X5KA 4UFVA 4IUSA 4MFJA 2K5TA 4CAFA 3K9UA 2FIAA 5F46A 3PZJA 4MY0A 4B12A 4R57A 2VXKA 2AE6A 2B4DB 4ONUA 4B5OA 2BUEA 4M3SA 1S7LA 2NMTA 4MI4A 3BJ8A 3S6HA 2BEIA 2JLMA 1M1DA 4F0YA 4QB9A 2CY2A 4B13A 2Q44A 2Z3OA 3F0AA 4UWJA 2GE3A 2JDDA 2VBQA 3H4QA 3LODA 4UCMA 4UA3A 4H6ZA 1QSOA 5CNPA 1QSNA 1IB1E 2Q4YA 1XF8A 1WWZA 4JJXA 1KUVA 3D2PA 2OZHA 3WR7A 3PP9A 4MBUA 3N7ZA 4UCPA 2PC1A 4B5PA 1I1DA 2A4NA 4FD7A 3LD2A 1M4DA 1M44A 2REFA 4QBJA 4R9MA 1MJAA 3GY9A 5A27A 2D4OA 3JTKA 5FVJA 2G3TA 3R9FA 1S3ZA 2QIRA 4OLLA 1I12A 1M4IA 1V0CA 4KORA 4C7IA 3FNCA 2YNDA 2VEZA 4JWPA 3I9SA 4XPLA 3DNSA 4H6UA 1ON0A 2I00A 1OZPA 2CXAA 3CXSA 3W6XA 4CAXA 2ZW5A 3T9YA 4L8AA 5GCNA 3TOAA 5IB0A 4C68A 1NMTA 2VZZA 4XPDC 1PU9A 2PQ8A 2VZYA 1Q2YA 2B3VA 2H5MA 3FB3A 3TTHA 5AGEA 1FY7A 1KUYA 3G3SA 3IU1A 1NSLA 5AG7A 3RYOA 4NXYA 3VWEA 1YVKA 2REEA 2WPXA 3IWGA 4KLWA 2DXQA 1IICA 1Q2DA 2R8VA 3W6SA 2ZXVA 3QB8A 2B4DA 4HNWB 1UFHA 4UBRA 4B5PB 1SQHA 3C26A 5C82A 4IF5A 4J3GA 2EUIA 4ZBGA 1YX0A 4A95A 3GKRA 5AG6A 3V8IA 4Q36A 2FL4A 4KUAA 4PSWA 2B4BA 2EVNA 3TO6A 3CXPA 1XMTA 3SHPA 1VKCA 2CNTA 4AVBA 3F8KA 4CAEA 3EY5A 3E0KA 2OB0A 2X7BA 3W91A 4XPDB 3VWDA 1Z9UA 4Y49C 3S6FA 1Z4RA 1LRZA 2GIVA 3R96A 4XNHB 4MFQA 2J8NA 1YVOA 2DPSA 2IL4A 2VQYA 4M85A 4YRHA 2HQYA 3TO7A 4AB7A 4KVXA 4LUAA 4QC6A 1S7NA 3TCVA 2YNCA 2CNSA 3FRMA 1S60A 1S7KA 4CAVA 4B14A 2HV2A 4KVME 3EC4A 4Q38A 3R9EA 1RXTA 4NF1A 2B5GB 2FSRA 5E96A 3BLNA 4LX9A 2JDCA 2ZW4A 5AG4A 1I21A 4FD6A 4KS9A 2G0BA 1Z4EA 1IYLA 1WK4A 4GS4A 4MJ8A 1CM0A 4KSFA 3B8GA 1KZFA 5KTDA 2OZGA 3KKWA 2PR8A 4NCZA 2J8MA 4NEXA 2O28A 3IGRA 4U9ZA 2AJ6A 2FT0A 5KTCA 4YGOA 1MK4A 1QSRA 2GANA 4CGOA 2RC4A 4CAWA 1YR0A 1S7FA 5I0CA 4CYPA 3UY5A 3F5BA 4KOXA 5G1ZA 2QECA 4XPKA 4AVCA 2BL1A 3TT2A 2Q04A 2ZW7A 4E0AA 4F0XA 4A33A 2P0WA 3GYAA 4PK2A 2Y0MA 4CGLA 4A32A 1YREA 2YNCC 4KSAA 4CYOA 4DNCA 4RI1A 4PSXA 1XEBA 5G22A 3DR8A 1TIQA 5DWMA 4JXQA 4UWIA 2ATRA 3D8PA 1ZO0A 3BJ7A 4KUBA 4UFWA 2F5IA 3P2HA 1XIXA 4R3LA 2FE7A 2I79A 1R57A 1Y9WA 4OAEA 5G20A 5ISVA 4C2ZA 5HH1A 4QVTA 4CRZB 2FXFA 1K4JA 1KUXA 3JVNA 3DDDA 4HNXB 4MFZA 3TE4A 4L89A 1MJ9A 3A9LA 1S5KA 4F6AA 5J8FA 4FD4A 2YNEA 4AG9A 2G3AA 4AG7A 2WSAA 2R1IA 3T90A 3TFYA 3R1KA 2CNMA 4C7HA 2KCWA 4FD5A 2YGWA 4HNYB 4II9A 1B6BA 1YGHA 2ARHA 3TO9A 4KOUA 4BBHA 1B87A 4B11A 4KOVA 5KTAA 3IWEA 4JLYA 4BMHA 4R87A 5G21A 4JXRA 4MHDA 5C88A 2B5GA 4KOWA 3QAHA 4A31A 3I3GA 5EC4A 3R9GA 4RS2A 4I49A 2Z10A 2Z3LA 3OWCA 1YK3A 2JEVA 1CJWA 5JQ4A 2Q0YA 2ZPAA 4U9YA 5A28A 3PGPA 1N71A 4E8OA 4K30A 2Z0ZA 3ZJ0A 2BSWA 4U5YA 1GHEA 2P6GA 4JD6A 3SXOA 3MGDA 1P4NA 4B10A 4KVOE 5JPHA 4UFXA 4AVAA 2ZW6A 2R7HA 2VI7A 3H5ZA 1VHSA 1RO5A 3FIXA 5F47A 2J8RA 3R95A 2Z3PA 4CGPA 3DR6A 4YFJA 4KZTA 2P6FA 4MFPA 3FXTA 1IYKA 4XNHC 5H86A 2PRBA 4H89A 4QUSA 3ZZIA 2B3UA 4HKFA 3EFAA 3DSBA 1YLEA 1PUAA 5F48A 4KOTA 2OU2A 1P0HA 5HMNA 5AG5A 3FYNA 4PV6A 4EVYA 4UCNA 3G8WA 4E2AA 3FBUA 2FCKA 2D4PA 4A30A 4CGNA 4R3KA 5IV0A 1Q2CA 4CS0B 5J8CA 1XE4A 2PSWA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2C27 A;  2OZU A;  4Y49 B;  4CRY B;  5DWN A;  3EXN A;  4KOS A;  1J4J A;  3EO4 A;  3D3S A;  1Y7R A;  3S6G A;  2B58 A;  1QSM A;  2HUZ A;  1BOB A;  1L0C A;  2PDO A;  1Y9K A;  4MY3 A;  3SXN A;  2P6E A;  4NSQ A;  1NE9 A;  4PK3 A;  1BO4 A;  5H84 A;  3P2F A;  3TOB A;  3D2M A;  3S6K A;  4OAD A;  1MJB A;  2R98 A;  2Z11 A;  2PR1 A;  2FS5 A;  4KOY A;  1QST A;  5IX3 A;  1M4G A;  4ORF A;  1IID A;  3NE7 A;  2Q4V A;  3JUW A;  2WPW A;  3CXQ A;  5EBV A;  5F49 A;  1U6M A;  2Q7B A;  2FIW A;  4KLV A;  2OH1 A;  2QML A;  4X5K A;  4IUS A;  2K5T A;  3K9U A;  2FIA A;  5F46 A;  3PZJ A;  4MY0 A;  4R57 A;  2VXK A;  2AE6 A;  2B4D B;  4ONU A;  4B5O A;  2BUE A;  4M3S A;  1S7L A;  2NMT A;  4MI4 A;  3BJ8 A;  3S6H A;  2BEI A;  2JLM A;  1M1D A;  4F0Y A;  4QB9 A;  2CY2 A;  2Q44 A;  3F0A A;  4UWJ A;  2GE3 A;  2JDD A;  2VBQ A;  3H4Q A;  3LOD A;  4UA3 A;  4H6Z A;  1QSO A;  5CNP A;  1QSN A;  1IB1 E;  2Q4Y A;  1XF8 A;  1WWZ A;  4JJX A;  1KUV A;  3D2P A;  2OZH A;  3WR7 A;  3PP9 A;  4MBU A;  3N7Z A;  2PC1 A;  4B5P A;  1I1D A;  2A4N A;  4FD7 A;  3LD2 A;  1M4D A;  1M44 A;  2REF A;  4QBJ A;  4R9M A;  1MJA A;  3GY9 A;  2D4O A;  5FVJ A;  2G3T A;  3R9F A;  1S3Z A;  2QIR A;  4OLL A;  1I12 A;  1M4I A;  1V0C A;  4KOR A;  3FNC A;  2VEZ A;  4JWP A;  3I9S A;  4XPL A;  3DNS A;  4H6U A;  1ON0 A;  2I00 A;  1OZP A;  3CXS A;  3W6X A;  4CAX A;  2ZW5 A;  3T9Y A;  4L8A A;  5GCN A;  3TOA A;  5IB0 A;  1NMT A;  2VZZ A;  4XPD C;  1PU9 A;  2PQ8 A;  2VZY A;  1Q2Y A;  2B3V A;  2H5M A;  3FB3 A;  3TTH A;  1FY7 A;  1KUY A;  3G3S A;  1NSL A;  3RYO A;  3VWE A;  4NXY A;  1YVK A;  2REE A;  2WPX A;  3IWG A;  4KLW A;  2DXQ A;  1IIC A;  1Q2D A;  2R8V A;  3W6S A;  2ZXV A;  3QB8 A;  2B4D A;  4HNW B;  1UFH A;  4UBR A;  4B5P B;  1SQH A;  3C26 A;  5C82 A;  4IF5 A;  4J3G A;  2EUI A;  4ZBG A;  1YX0 A;  3GKR A;  3V8I A;  2FL4 A;  4KUA A;  4PSW A;  2B4B A;  2EVN A;  3TO6 A;  3CXP A;  1XMT A;  3SHP A;  1VKC A;  2CNT A;  4AVB A;  3F8K A;  3EY5 A;  3E0K A;  2OB0 A;  2X7B A;  3W91 A;  4XPD B;  3VWD A;  1Z9U A;  4Y49 C;  3S6F A;  1Z4R A;  1LRZ A;  2GIV A;  3R96 A;  4XNH B;  2J8N A;  1YVO A;  2IL4 A;  2VQY A;  4M85 A;  4YRH A;  2HQY A;  3TO7 A;  4AB7 A;  4KVX A;  4LUA A;  4QC6 A;  1S7N A;  3TCV A;  2CNS A;  3FRM A;  1S60 A;  1S7K A;  4CAV A;  2HV2 A;  4KVM E;  3EC4 A;  3R9E A;  1RXT A;  4NF1 A;  2B5G B;  2FSR A;  5E96 A;  3BLN A;  4LX9 A;  2JDC A;  2ZW4 A;  1I21 A;  4FD6 A;  2G0B A;  1Z4E A;  1IYL A;  1WK4 A;  4GS4 A;  4MJ8 A;  1CM0 A;  3B8G A;  1KZF A;  5KTD A;  2OZG A;  3KKW A;  2PR8 A;  4NCZ A;  2J8M A;  4NEX A;  2O28 A;  3IGR A;  4U9Z A;  2AJ6 A;  2FT0 A;  5KTC A;  4YGO A;  1MK4 A;  1QSR A;  2GAN A;  2RC4 A;  4CAW A;  1YR0 A;  1S7F A;  5I0C A;  3UY5 A;  3F5B A;  4KOX A;  2QEC A;  4XPK A;  4AVC A;  2BL1 A;  3TT2 A;  2Q04 A;  2ZW7 A;  4E0A A;  2P0W A;  3GYA A;  4PK2 A;  2Y0M A;  1YRE A;  4DNC A;  4RI1 A;  4PSX A;  1XEB A;  3DR8 A;  1TIQ A;  5DWM A;  4JXQ A;  4UWI A;  2ATR A;  3D8P A;  3BJ7 A;  4KUB A;  2F5I A;  3P2H A;  1XIX A;  4R3L A;  2FE7 A;  2I79 A;  1R57 A;  1Y9W A;  4OAE A;  5ISV A;  5HH1 A;  4QVT A;  4CRZ B;  2FXF A;  1K4J A;  1KUX A;  3JVN A;  3DDD A;  4HNX B;  3TE4 A;  4L89 A;  1MJ9 A;  1S5K A;  4F6A A;  5J8F A;  4FD4 A;  4AG9 A;  2G3A A;  4AG7 A;  2R1I A;  3T90 A;  3TFY A;  3R1K A;  2CNM A;  2KCW A;  4FD5 A;  4HNY B;  4II9 A;  1B6B A;  1YGH A;  2ARH A;  3TO9 A;  4KOU A;  1B87 A;  4KOV A;  5KTA A;  4JLY A;  4BMH A;  4R87 A;  4JXR A;  4MHD A;  5C88 A;  2B5G A;  4KOW A;  3QAH A;  3I3G A;  5EC4 A;  3R9G A;  4RS2 A;  4I49 A;  2Z10 A;  3OWC A;  1YK3 A;  2JEV A;  1CJW A;  5JQ4 A;  2Q0Y A;  2ZPA A;  4U9Y A;  3PGP A;  1N71 A;  4E8O A;  4K30 A;  2Z0Z A;  3ZJ0 A;  2BSW A;  4U5Y A;  1GHE A;  2P6G A;  4JD6 A;  3SXO A;  3MGD A;  1P4N A;  4KVO E;  5JPH A;  4AVA A;  2ZW6 A;  2R7H A;  2VI7 A;  1VHS A;  1RO5 A;  3FIX A;  5F47 A;  2J8R A;  3R95 A;  3DR6 A;  4YFJ A;  4KZT A;  2P6F A;  3FXT A;  1IYK A;  4XNH C;  5H86 A;  2PRB A;  4H89 A;  4QUS A;  3ZZI A;  2B3U A;  4HKF A;  3EFA A;  3DSB A;  1YLE A;  1PUA A;  5F48 A;  4KOT A;  2OU2 A;  1P0H A;  5HMN A;  3FYN A;  4PV6 A;  4EVY A;  3G8W A;  4E2A A;  3FBU A;  2FCK A;  2D4P A;  4R3K A;  5IV0 A;  1Q2C A;  4CS0 B;  5J8C A;  1XE4 A;  2PSW A; 
#chains in the Genus database with same CATH topology
 2C27 A;  3PFO A;  2OZU A;  4Y49 B;  4CRY B;  2AFZ A;  5DWN A;  1YW4 A;  3EXN A;  4KOS A;  3IU2 A;  1J4J A;  1YW6 A;  3EO4 A;  2C1C A;  3QNV A;  3S9L A;  3D3S A;  1Y7R A;  4F9V A;  1HDU A;  3S6G A;  2Q7S A;  4A2Z A;  2B58 A;  1ARM A;  1QSM A;  2HUZ A;  4NGR A;  3VH9 A;  2GU2 A;  1BOB A;  4C2X A;  1L0C A;  2PDO A;  1Y9K A;  3KI9 A;  4H2K A;  1Z5R A;  4MY3 A;  3B3S A;  2Q43 A;  4FWU A;  3SXN A;  4ZGY B;  3IIB A;  2P6E A;  1TF9 A;  2O4H A;  5I4M A;  3IO1 A;  2IMO A;  4NSQ A;  4MFL A;  1NE9 A;  4PK3 A;  1BO4 A;  5H84 A;  4C2Y A;  3P2F A;  3TOB A;  3VAR A;  2PJ5 A;  3D2M A;  3S6K A;  4OAD A;  1MJB A;  2R98 A;  2Z11 A;  3MRU A;  2PR1 A;  2Z3M A;  2FS5 A;  4KOY A;  1QST A;  5IX3 A;  1M4G A;  3CZX A;  3PB4 X;  1PCA A;  2ZEL A;  5HVF A;  3KHX A;  4ORF A;  4ZYQ A;  1IID A;  2PVV A;  2Q4V A;  3NE7 A;  5D29 A;  4CGM A;  3JUW A;  2WPW A;  2Z3K A;  3PB6 X;  4MFK A;  3D7G A;  1R43 A;  3CXQ A;  1CPS A;  3SJG A;  5EBV A;  2WUU A;  3GB0 A;  4CYQ A;  2C6G A;  1TKJ A;  1TKH A;  2V8H A;  4M6I A;  5F49 A;  2Z3N A;  1U6M A;  2JBK A;  2Q7B A;  1JQG A;  2EK8 A;  2FIW A;  1QQ9 A;  4OC3 A;  2DPT A;  5JM6 A;  4Z65 A;  2AFW A;  3WAB A;  5LYF A;  4CYN A;  5LYD A;  4KLV A;  3WC7 A;  4OIW A;  4F8Z A;  1PYT B;  2JEW A;  2GLJ A;  2OH1 A;  1VIX A;  2QML A;  4X5K A;  1X12 A;  2QYV A;  4UFV A;  3KR4 A;  4IUS A;  4MFJ A;  4MRI A;  2GFQ A;  2K5T A;  4CAF A;  3K9U A;  2FIA A;  3SI1 A;  3CDX A;  3D66 A;  3H8F A;  5F46 A;  2PJ1 A;  3PZJ A;  4MY0 A;  1TF8 A;  2ZOF A;  3PBE A;  3PEI A;  4R57 A;  4B12 A;  2VXK A;  2AE6 A;  1FT7 A;  2B4D B;  4OP4 A;  3FX6 A;  4ONU A;  4A37 A;  4B5O A;  2BUE A;  4M3S A;  1DE4 C;  3SJX A;  1S7L A;  2NMT A;  2RFH A;  4MI4 A;  3BJ8 A;  4NGT A;  4PPZ A;  3S6H A;  2BEI A;  2JLM A;  1M1D A;  4F0Y A;  2F8H A;  4OME A;  2C6C A;  1CP7 A;  4QB9 A;  2NSM A;  1HEE A;  2CY2 A;  2EO8 A;  2ZEN A;  1A2Z A;  2ZEF A;  3BI1 A;  4B13 A;  1RTQ A;  2Q44 A;  2Z3O A;  3B7I A;  3F0A A;  3NH8 A;  4UWJ A;  2GE3 A;  5HXD A;  4MHN A;  2QJ8 A;  2PIZ A;  4A38 A;  1XRY A;  2JDD A;  2VBQ A;  3H4Q A;  5ELY A;  3LOD A;  4UCM A;  4UA3 A;  3KZW A;  3IEH A;  1XJO A;  3S9N A;  4H6Z A;  1IY7 A;  3SI2 A;  1QSO A;  4LQG A;  5CNP A;  4JYW A;  1QSN A;  5HVH A;  3T8W A;  3FEC A;  1IB1 E;  3KHZ A;  3V38 A;  1ZG8 A;  2BO9 A;  3IC1 A;  2Q4Y A;  3L2N A;  5DS0 A;  1XF8 A;  1WWZ A;  4IHM A;  4JJX A;  1KUV A;  3D2P A;  5CPA A;  2OZH A;  3WR7 A;  2ABZ A;  3PP9 A;  4MBU A;  3N7Z A;  3B3T A;  3FVL A;  4P45 A;  4UCP A;  2PC1 A;  3PRT A;  1Z8X A;  4B5P A;  1I1D A;  2CTB A;  2A4N A;  4FD7 A;  3LD2 A;  1M4D A;  2XEI A;  1M44 A;  4OC4 A;  4P4J A;  2REF A;  4QBJ A;  4ZY0 A;  4R9M A;  2F7V A;  1MJA A;  3GY9 A;  2IQ6 A;  4K3N A;  3RYO A;  5A27 A;  2D4O A;  3JTK A;  5FVJ A;  2G3T A;  3R9F A;  1S3Z A;  4MCS A;  2QIR A;  1BLL E;  1I12 A;  1XFO A;  4OLL A;  1M4I A;  4FBE A;  1XMB A;  1V0C A;  4KOR A;  2V8D A;  4C7I A;  4R76 A;  3FNC A;  1H8L A;  2YND A;  1YME A;  4UEZ A;  2VEZ A;  2VL1 A;  4MHP A;  2PIY A;  4JWP A;  3I9S A;  4OC2 A;  4XPL A;  5JGF A;  3DNS A;  4H6U A;  1ON0 A;  2ZEP A;  2I00 A;  4G1P A;  1OZP A;  2CXA A;  3CXS A;  3W6X A;  4GM5 A;  4CAX A;  4OC0 A;  2ZEO A;  2ZW5 A;  3T9Y A;  4L8A A;  5GCN A;  4MMO A;  4OC5 A;  3TOA A;  5IB0 A;  3FJU A;  4C68 A;  5JH9 A;  2WZN A;  3S9M A;  1NMT A;  3I1U A;  4MHZ A;  2VZZ A;  4XPD C;  4M6H A;  4AXV A;  1LAM A;  1PU9 A;  2PQ8 A;  3PB9 X;  2VZY A;  1Q2Y A;  1XOV A;  3B3C A;  2B3V A;  2H5M A;  3FB3 A;  3TTH A;  5AGE A;  1M4L A;  1AUG A;  1FY7 A;  1KUY A;  3G3S A;  3IU1 A;  1NSL A;  4DJL A;  3D7F A;  1BPM A;  3IFE A;  4HPS A;  4NXY A;  4WJB A;  5AG7 A;  1YVK A;  1ZG7 A;  2ZEE A;  3LAC A;  4YU9 A;  2REE A;  2WPX A;  3ISZ A;  3IWG A;  2CIJ A;  2XEF A;  4KLW A;  4P4F A;  4X3R A;  2DXQ A;  1IIC A;  1ELM P;  1Q2D A;  2R8V A;  4NGN A;  4PQA A;  3W6S A;  2ZXV A;  3FMC A;  4UIB A;  3QB8 A;  2CTC A;  2B4D A;  4NGS A;  4EFD A;  4FAI A;  3GIU A;  2PJ0 A;  3RO0 A;  3TC8 A;  3SJF A;  4HNW B;  1UFH A;  4UBR A;  4B5P B;  4EWT A;  1SQH A;  3C26 A;  5C82 A;  4O23 A;  2EBJ A;  4WWV A;  4IF5 A;  4J3G A;  2EUI A;  4ZBG A;  1YX0 A;  4A95 A;  3GKR A;  5AG6 A;  3V8I A;  3KGQ A;  4Q36 A;  2FL4 A;  4KUA A;  4PSW A;  2B4B A;  3CPX A;  2EVN A;  2GLF A;  3CXP A;  3ISX A;  3TO6 A;  4R8F A;  1YSJ A;  1KWM A;  4NJR A;  1XMT A;  2ZEM A;  3SHP A;  1VKC A;  2CNT A;  4AVB A;  1X10 A;  4ZX8 A;  3F8K A;  3H8G A;  4CAE A;  1IOI A;  2ZOG A;  3EY5 A;  3E0K A;  3GUX A;  4P4D A;  2OB0 A;  1Z8W A;  1CG2 A;  5LRJ A;  2X7B A;  4ONW A;  2V77 A;  3W91 A;  4XPD B;  3VWD A;  1Z9U A;  4Y49 C;  3S6F A;  1Z8T A;  5K8O A;  1CPX A;  1Z4R A;  2DEA A;  1LRZ A;  2GIV A;  4B6Z A;  3R96 A;  4XNH B;  4MFQ A;  2J8N A;  1YVO A;  2DPS A;  2IL4 A;  2VQY A;  4X2T A;  4M85 A;  2J9A A;  5BWA B;  6CPA A;  5K8M A;  4YRH A;  2HQY A;  3TO7 A;  3WC5 A;  1VGY A;  3SJE A;  4AB7 A;  5EMI A;  2C6P A;  2PVW A;  4KVX A;  4LUA A;  4DYO A;  5D8N A;  4QC6 A;  3D67 A;  1S7N A;  2ZED A;  3TCV A;  2YNC A;  2CNS A;  3BXM A;  3NH4 A;  1F57 A;  1Z8L A;  3FRM A;  1S60 A;  1S7K A;  3DLJ A;  4UEF A;  4FUU A;  4CAV A;  4TWE A;  4B14 A;  5LYI A;  1Y0Y A;  2HV2 A;  4KVM E;  3NFZ A;  2Q4Z A;  3EC4 A;  2EWB A;  4Q38 A;  4ZI6 A;  3R9E A;  1RXT A;  3LWU A;  4NF1 A;  3BHX A;  3DGV A;  1BPN A;  2B5G B;  2FSR A;  5E96 A;  3BLN A;  4LX9 A;  3FEE A;  4CPA A;  4ZY1 A;  2JDC A;  2ZW4 A;  3D7H A;  5AG4 A;  2PJ4 A;  1I21 A;  4FD6 A;  1AYE A;  4KS9 A;  2G0B A;  1Z4E A;  1IYL A;  4OID A;  3HLP A;  1WK4 A;  4GS4 A;  8CPA A;  4MJ8 A;  1CM0 A;  2AFU A;  2PJC A;  3KL9 A;  4KSF A;  3B8G A;  1KZF A;  3NE8 A;  5IB9 A;  5KTD A;  2OZG A;  3KKW A;  2FVG A;  2PR8 A;  4NCZ A;  2J8M A;  4NEX A;  4NGP A;  3RNZ A;  2BOA A;  3MN8 A;  1VHE A;  2O28 A;  3IGR A;  4U9Z A;  4LQ6 A;  5THW A;  1Y7E A;  2ZEH A;  1LAP A;  4A39 A;  2AJ6 A;  3H8E A;  2HB6 A;  2EK9 A;  2FT0 A;  4ZY2 A;  5KTC A;  4YGO A;  1MK4 A;  3KQZ A;  2PJ9 A;  1BAV A;  1QSR A;  4P44 A;  1LOK A;  2GAN A;  4CGO A;  2RC4 A;  3B3V A;  3D68 A;  3PBB A;  4CAW A;  2AFX A;  1YR0 A;  1VHO A;  2I3C A;  1S7F A;  5J1Q A;  5I0C A;  2ZEG A;  4CYP A;  3UY5 A;  3F5B A;  3PFE A;  3TX8 A;  4KOX A;  3K9T A;  1LCP A;  5G1Z A;  2QEC A;  4XPK A;  4AVC A;  2BL1 A;  3TT2 A;  2Q04 A;  2ZW7 A;  4E0A A;  4F0X A;  4A33 A;  2P0W A;  4EME A;  3GYA A;  4PK2 A;  3GLJ A;  2Y0M A;  4P4E A;  4CGL A;  4A32 A;  1YRE A;  2YNC C;  1JWQ A;  4KSA A;  4CYO A;  4DNC A;  4RI1 A;  4MCP A;  4MXU A;  3SI0 A;  4PSX A;  1XEB A;  2PJ7 A;  3DR8 A;  5G22 A;  3NH5 A;  1TIQ A;  4W9Y A;  3FF3 A;  5DWM A;  1Q7L A;  2QVP A;  3JRU A;  4JXQ A;  4UWI A;  2V8G A;  2ATR A;  3D8P A;  1ZO0 A;  3BJ7 A;  4KUB A;  1CBX A;  1R3N A;  1TXR A;  4P4B A;  4UFW A;  4UEE A;  2POK A;  2PJB A;  2XEJ A;  2F5I A;  3P2H A;  1XBU A;  1XIX A;  2IJZ A;  2NYQ A;  3QAY A;  4R3L A;  1DTD A;  4UIA A;  2FE7 A;  3BI0 A;  4OC1 A;  2I79 A;  1R57 A;  2PJ6 A;  2PJ3 A;  1Y9W A;  4OAE A;  3N5F A;  2DF5 A;  2PJA A;  5G20 A;  3KR5 A;  5ISV A;  4C2Z A;  4TNU A;  4NGQ A;  2XEG A;  4QVT A;  5HH1 A;  4CRZ B;  2FXF A;  5LYL A;  2AFO A;  4A94 A;  1K4J A;  3RBU A;  3VWE A;  1KUX A;  1ELL P;  3FED A;  3JVN A;  2PRQ A;  3B35 A;  3DDD A;  4HNX B;  4MFZ A;  3TE4 A;  4L89 A;  1MJ9 A;  1Z2L A;  4P6Y A;  3A9L A;  3HUV A;  4RN7 A;  1S5K A;  4F6A A;  3RZA A;  5J8F A;  1CP6 A;  1LAN A;  4FD4 A;  2YNE A;  4AG9 A;  2G3A A;  4M6G A;  4R6T A;  4MCR A;  1QMU A;  4Q7A A;  4AG7 A;  1Y0R A;  2WSA A;  2R1I A;  2PJ2 A;  3T90 A;  3CPA A;  3IWW A;  3TFY A;  3R1K A;  2CNM A;  4C7H A;  4F9U A;  3D7D A;  2KCW A;  1YQE A;  3PB7 X;  4FD5 A;  4PXC A;  2YGW A;  4HNY B;  4R7M A;  3VAT A;  4II9 A;  1B6B A;  3RAM A;  1AMP A;  1YGH A;  1IGB A;  2ARH A;  4NGM A;  4KOU A;  3TO9 A;  4BBH A;  1B87 A;  4P4I A;  3V7Z A;  4B11 A;  4KOV A;  3KAS A;  3NA6 A;  5KTA A;  2PE3 A;  3IWE A;  4JLY A;  4BMH A;  1GYT A;  3PB8 X;  4NFR A;  4R87 A;  1ZLI A;  2GRE A;  1LFW A;  4JXR A;  5G21 A;  4MHD A;  5C88 A;  5F09 A;  2B5G A;  1EE3 P;  4IK2 A;  3QAH A;  4KOW A;  4A31 A;  2V8V A;  3I3G A;  3KQX A;  4IAV A;  4P10 A;  5EC4 A;  3R9G A;  4RS2 A;  1NSA A;  4I49 A;  4MHY A;  1IOF A;  3LMS A;  4BD9 A;  2Z10 A;  2Z3L A;  2CF4 A;  5HVG A;  2RB7 A;  3OWC A;  4X8I A;  5K8N A;  4GXH A;  1YK3 A;  2JEV A;  1CJW A;  2O53 A;  5JQ4 A;  5K8P A;  2Q0Y A;  4RUH A;  2ZPA A;  4U9Y A;  4UF4 A;  5A28 A;  2BCO A;  2HC9 A;  1N71 A;  3PGP A;  4E8O A;  1IU8 A;  4K30 A;  2Z0Z A;  3ZJ0 A;  2BSW A;  3IJ3 A;  4U5Y A;  4BIN A;  1GHE A;  2P6G A;  1OBR A;  3FH4 A;  1F2O A;  3B3W A;  4JD6 A;  3MGD A;  3SXO A;  1ARL A;  1P4N A;  4YWY A;  4B10 A;  4KVO E;  5JPH A;  1UWY A;  3B2Y A;  4UFX A;  4AVA A;  2Q51 A;  2ZW6 A;  4DUK A;  2PJ8 A;  1HDQ A;  2R7H A;  4NJQ A;  2VI7 A;  3H5Z A;  3CT9 A;  3WC6 A;  1VHS A;  2ODF A;  2PCU A;  4PXD A;  1RO5 A;  2G9D A;  3FIX A;  2J8R A;  5F47 A;  2Z3P A;  4ZX9 A;  2WYR A;  5LRG A;  3R95 A;  3DR6 A;  4CGP A;  4YFJ A;  1ZLH A;  4KZT A;  2P6F A;  4KSI A;  4MFP A;  3FXT A;  1IYK A;  1F2P A;  1YLO A;  4XNH C;  3K2K A;  4PXE A;  2AFS A;  5H86 A;  2JBJ A;  2AFM A;  2OR4 A;  2PRB A;  4MCQ A;  4H89 A;  4QUS A;  3ZZI A;  2B3U A;  4HKF A;  3WT4 A;  3D4U A;  3EFA A;  3DSB A;  2ANP A;  2OOT A;  1YLE A;  1PUA A;  5F48 A;  1TKF A;  4KOT A;  4PXB A;  2OU2 A;  5LRK A;  1P0H A;  4OKO A;  1ZG9 A;  5HMN A;  5AG5 A;  3FYN A;  4PV6 A;  4JZ0 A;  4EVY A;  4UCN A;  5CBM A;  3G8W A;  4E2A A;  1CX8 A;  3FBU A;  2FCK A;  1FNO A;  2D4P A;  4A30 A;  4CGN A;  4R3K A;  7CPA A;  5IV0 A;  1Q2C A;  4CS0 B;  5J8C A;  1XE4 A;  2PSW A; 
#chains in the Genus database with same CATH homology
 2C27 A;  2OZU A;  4Y49 B;  4CRY B;  5DWN A;  3EXN A;  4KOS A;  3IU2 A;  1J4J A;  3EO4 A;  3D3S A;  1Y7R A;  3S6G A;  4A2Z A;  2B58 A;  1QSM A;  2HUZ A;  1BOB A;  4C2X A;  1L0C A;  2PDO A;  1Y9K A;  4MY3 A;  3SXN A;  4ZGY B;  5BWA B;  2P6E A;  4NSQ A;  4MFL A;  1NE9 A;  4PK3 A;  1BO4 A;  5H84 A;  4C2Y A;  3P2F A;  3TOB A;  3D2M A;  3S6K A;  4OAD A;  1MJB A;  2R98 A;  2Z11 A;  2PR1 A;  2Z3M A;  2FS5 A;  4KOY A;  1QST A;  5IX3 A;  1M4G A;  4ORF A;  1IID A;  3NE7 A;  2Q4V A;  4CGM A;  3JUW A;  2WPW A;  2Z3K A;  4MFK A;  3CXQ A;  5EBV A;  2WUU A;  4CYQ A;  5F49 A;  2Z3N A;  1U6M A;  2Q7B A;  2FIW A;  2DPT A;  4CYN A;  4KLV A;  2OH1 A;  2QML A;  4X5K A;  4UFV A;  4IUS A;  4MFJ A;  2K5T A;  4CAF A;  3K9U A;  2FIA A;  5F46 A;  3PZJ A;  4MY0 A;  4B12 A;  4R57 A;  2VXK A;  2AE6 A;  2B4D B;  4ONU A;  4B5O A;  2BUE A;  4M3S A;  1S7L A;  2NMT A;  4MI4 A;  3BJ8 A;  3S6H A;  2BEI A;  2JLM A;  1M1D A;  4F0Y A;  4QB9 A;  2CY2 A;  4B13 A;  2Q44 A;  2Z3O A;  3F0A A;  4UWJ A;  2GE3 A;  2JDD A;  2VBQ A;  3H4Q A;  3LOD A;  4UCM A;  4UA3 A;  4H6Z A;  1QSO A;  5CNP A;  1QSN A;  1IB1 E;  2Q4Y A;  1XF8 A;  1WWZ A;  4JJX A;  1KUV A;  3D2P A;  2OZH A;  3WR7 A;  3PP9 A;  4MBU A;  3N7Z A;  4UCP A;  2PC1 A;  4B5P A;  1I1D A;  2A4N A;  4FD7 A;  3LD2 A;  1M4D A;  1M44 A;  2REF A;  4QBJ A;  4R9M A;  1MJA A;  3GY9 A;  5A27 A;  2D4O A;  3JTK A;  5FVJ A;  2G3T A;  3R9F A;  1S3Z A;  2QIR A;  4OLL A;  1I12 A;  1M4I A;  1V0C A;  4KOR A;  4C7I A;  3FNC A;  2YND A;  2VEZ A;  4JWP A;  3I9S A;  4XPL A;  3DNS A;  4H6U A;  1ON0 A;  2I00 A;  1OZP A;  2CXA A;  3CXS A;  3W6X A;  4CAX A;  2ZW5 A;  3T9Y A;  4L8A A;  5GCN A;  3TOA A;  5IB0 A;  4C68 A;  1NMT A;  2VZZ A;  4XPD C;  1PU9 A;  2PQ8 A;  2VZY A;  1Q2Y A;  2B3V A;  2H5M A;  3FB3 A;  3TTH A;  5AGE A;  1FY7 A;  1KUY A;  3G3S A;  3IU1 A;  1NSL A;  5AG7 A;  3RYO A;  4NXY A;  3VWE A;  1YVK A;  2REE A;  2WPX A;  3IWG A;  4KLW A;  2DXQ A;  1IIC A;  1Q2D A;  2R8V A;  3W6S A;  2ZXV A;  3QB8 A;  2B4D A;  4HNW B;  1UFH A;  4UBR A;  4B5P B;  1SQH A;  3C26 A;  5C82 A;  4IF5 A;  4J3G A;  2EUI A;  4ZBG A;  1YX0 A;  4A95 A;  3GKR A;  5AG6 A;  3V8I A;  4Q36 A;  2FL4 A;  4KUA A;  4PSW A;  2B4B A;  2EVN A;  3TO6 A;  3CXP A;  1XMT A;  3SHP A;  1VKC A;  2CNT A;  4AVB A;  3F8K A;  4CAE A;  3EY5 A;  3E0K A;  2OB0 A;  2X7B A;  3W91 A;  4XPD B;  3VWD A;  1Z9U A;  4Y49 C;  3S6F A;  1Z4R A;  1LRZ A;  2GIV A;  3R96 A;  4XNH B;  4MFQ A;  2J8N A;  1YVO A;  2DPS A;  2IL4 A;  2VQY A;  4M85 A;  4YRH A;  2HQY A;  3TO7 A;  4AB7 A;  4KVX A;  4LUA A;  4QC6 A;  1S7N A;  3TCV A;  2YNC A;  2CNS A;  3FRM A;  1S60 A;  1S7K A;  4CAV A;  4B14 A;  2HV2 A;  4KVM E;  3EC4 A;  4Q38 A;  3R9E A;  1RXT A;  4NF1 A;  2B5G B;  2FSR A;  5E96 A;  3BLN A;  4LX9 A;  2JDC A;  2ZW4 A;  5AG4 A;  1I21 A;  4FD6 A;  4KS9 A;  2G0B A;  1Z4E A;  1IYL A;  1WK4 A;  4GS4 A;  4MJ8 A;  1CM0 A;  4KSF A;  3B8G A;  1KZF A;  5KTD A;  2OZG A;  3KKW A;  2PR8 A;  4NCZ A;  2J8M A;  4NEX A;  2O28 A;  3IGR A;  4U9Z A;  2AJ6 A;  2FT0 A;  5KTC A;  4YGO A;  1MK4 A;  1QSR A;  2GAN A;  4CGO A;  2RC4 A;  4CAW A;  1YR0 A;  1S7F A;  5I0C A;  4CYP A;  3UY5 A;  3F5B A;  4KOX A;  5G1Z A;  2QEC A;  4XPK A;  4AVC A;  2BL1 A;  3TT2 A;  2Q04 A;  2ZW7 A;  4E0A A;  4F0X A;  4A33 A;  2P0W A;  3GYA A;  4PK2 A;  2Y0M A;  4CGL A;  4A32 A;  1YRE A;  2YNC C;  4KSA A;  4CYO A;  4DNC A;  4RI1 A;  4PSX A;  1XEB A;  5G22 A;  3DR8 A;  1TIQ A;  5DWM A;  4JXQ A;  4UWI A;  2ATR A;  3D8P A;  1ZO0 A;  3BJ7 A;  4KUB A;  4UFW A;  2F5I A;  3P2H A;  1XIX A;  4R3L A;  2FE7 A;  2I79 A;  1R57 A;  1Y9W A;  4OAE A;  5G20 A;  5ISV A;  4C2Z A;  5HH1 A;  4QVT A;  4CRZ B;  2FXF A;  1K4J A;  1KUX A;  3JVN A;  3DDD A;  4HNX B;  4MFZ A;  3TE4 A;  4L89 A;  1MJ9 A;  3A9L A;  1S5K A;  4F6A A;  5J8F A;  4FD4 A;  2YNE A;  4AG9 A;  2G3A A;  4AG7 A;  2WSA A;  2R1I A;  3T90 A;  3TFY A;  3R1K A;  2CNM A;  4C7H A;  2KCW A;  4FD5 A;  2YGW A;  4HNY B;  4II9 A;  1B6B A;  1YGH A;  2ARH A;  3TO9 A;  4KOU A;  4BBH A;  1B87 A;  4B11 A;  4KOV A;  5KTA A;  3IWE A;  4JLY A;  4BMH A;  4R87 A;  5G21 A;  4JXR A;  4MHD A;  5C88 A;  2B5G A;  4KOW A;  3QAH A;  4A31 A;  3I3G A;  5EC4 A;  3R9G A;  4RS2 A;  4I49 A;  2Z10 A;  2Z3L A;  3OWC A;  1YK3 A;  2JEV A;  1CJW A;  5JQ4 A;  2Q0Y A;  2ZPA A;  4U9Y A;  5A28 A;  3PGP A;  1N71 A;  4E8O A;  4K30 A;  2Z0Z A;  3ZJ0 A;  2BSW A;  4U5Y A;  1GHE A;  2P6G A;  4JD6 A;  3SXO A;  3MGD A;  1P4N A;  4B10 A;  4KVO E;  5JPH A;  4UFX A;  4AVA A;  2ZW6 A;  2R7H A;  2VI7 A;  3H5Z A;  1VHS A;  1RO5 A;  3FIX A;  5F47 A;  2J8R A;  3R95 A;  2Z3P A;  4CGP A;  3DR6 A;  4YFJ A;  4KZT A;  2P6F A;  4MFP A;  3FXT A;  1IYK A;  4XNH C;  5H86 A;  2PRB A;  4H89 A;  4QUS A;  3ZZI A;  2B3U A;  4HKF A;  3EFA A;  3DSB A;  1YLE A;  1PUA A;  5F48 A;  4KOT A;  2OU2 A;  1P0H A;  5HMN A;  5AG5 A;  3FYN A;  4PV6 A;  4EVY A;  4UCN A;  3G8W A;  4E2A A;  3FBU A;  2FCK A;  2D4P A;  4A30 A;  4CGN A;  4R3K A;  5IV0 A;  1Q2C A;  4CS0 B;  5J8C A;  1XE4 A;  2PSW A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...