3CXPA

Crystal structure of human glucosamine 6-phosphate n-acetyltransferase 1 mutant e156a
Total Genus 43
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
43
sequence length
184
structure length
184
Chain Sequence
MKPDETPMFDPSLLKEVDWSQNTATFSPAISPTHPGEGLVLRPLCTADLNRGFFKVLGQLTETGVVSPEQFMKSFEHMKKSGDYYVTVVEDVTLGQIVATATLIIEHKFIHSCAKRGRVEDVVVSDECRGKQLGKLLLSTLTLLSKKLNCYKITLACLPQNVGFYKKFGYTVSEENYMCRRFLK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Glucosamine 6-phosphate N-acetyltransferase
publication title Acceptor substrate binding revealed by crystal structure of human glucosamine-6-phosphate N-acetyltransferase 1
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
total genus 43
structure length 184
sequence length 184
ec nomenclature ec 2.3.1.4: Glucosamine-phosphate N-acetyltransferase.
pdb deposition date 2008-04-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00583 Acetyltransf_1 Acetyltransferase (GNAT) family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.630.30 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Aminopeptidase 3cxpA01
1KUXA 1VKCA 1BO4A 2HV2A 2P6FA 2FSRA 4I49A 3EFAA 4EVYA 2FE7A 2ARHA 3UY5A 4CAVA 4NXYA 4FD7A 4R57A 4UBRA 3EXNA 1BOBA 3IWGA 3TCVA 3R9FA 1I1DA 3P2HA 4JD6A 1KZFA 1YX0A 3TO7A 3W6SA 5IV0A 2AJ6A 4ORFA 4M3SA 4FD4A 1Q2YA 1MK4A 3BJ7A 3W91A 2CNMA 3PZJA 1M44A 2OZHA 4UA3A 2B3UA 2Q4VA 3SXNA 5F49A 3R9GA 5DWNA 4DNCA 3TE4A 4M85A 2ZXVA 2FXFA 3FNCA 4MHDA 1S5KA 3P2FA 3S6FA 1J4JA 3D3SA 1QSNA 2PR8A 2CY2A 3TOAA 5DWMA 2PR1A 3F8KA 2ZPAA 4II9A 2JLMA 2OU2A 2O28A 3T9YA 1XMTA 2FIAA 3TTHA 4KVXA 3GKRA 1V0CA 4R87A 4LUAA 1UFHA 3I3GA 4KOWA 4U9YA 4L8AA 4QBJA 4KVME 1WWZA 2PC1A 3CXPA 1L0CA 1TIQA 2F5IA 4KUBA 2A4NA 2EVNA 4JLYA 2PSWA 5JPHA 4PSWA 4ZBGA 3TO6A 1I21A 4B5OA 2FIWA 2QECA 3FB3A 2J8MA 4Y49B 2VI7A 1XIXA 3JVNA 2BSWA 3H4QA 4AG9A 2R98A 1IB1E 2GE3A 2JDCA 2R1IA 4PV6A 2PQ8A 5JQ4A 1YLEA 2B5GB 3WR7A 2BUEA 1ON0A 3EY5A 4J3GA 4KOXA 3F0AA 4CRZB 2I79A 1S7LA 3G3SA 4JWPA 4KOYA 4F6AA 1NMTA 1CM0A 3GY9A 1S60A 4HNYB 1U6MA 1Z4RA 5GCNA 1QSTA 4JXQA 3PP9A 3DDDA 3DSBA 4LX9A 4BMHA 4NSQA 4L89A 4F0YA 3R95A 3MGDA 1Q2DA 5J8FA 3E0KA 3FRMA 4H89A 2OH1A 2VZZA 4GS4A 2JDDA 4MJ8A 4HNXB 2PRBA 1M4IA 3D8PA 2Z0ZA 3QAHA 5IX3A 4HKFA 3KKWA 4E0AA 1RXTA 2G3AA 1QSRA 2B3VA 5H84A 3TOBA 4PK3A 4CAXA 1B6BA 4MY0A 1VHSA 3B8GA 3GYAA 1S7KA 1XEBA 4PK2A 2R8VA 3ZZIA 3ZJ0A 1PU9A 4NEXA 4K30A 3FIXA 2VBQA 4JJXA 1R57A 2REEA 3R9EA 4E8OA 2HUZA 3IGRA 3DR8A 4KOUA 2ZW6A 4OAEA 5CNPA 4YGOA 2P0WA 1SQHA 1NE9A 5HH1A 2IL4A 4PSXA 4QVTA 4R3KA 1N71A 1Y7RA 2AE6A 3F5BA 3CXSA 2NMTA 2FS5A 3V8IA 1Z9UA 1XE4A 3NE7A 1M4DA 5KTCA 4RS2A 4U5YA 3JUWA 4B5PB 2HQYA 2RC4A 3TT2A 1IICA 1M1DA 3S6HA 1M4GA 4R9MA 4XPLA 3VWEA 2JEVA 4MBUA 1KUYA 1QSMA 3K9UA 2B4DB 2CNSA 1YR0A 2OB0A 4B5PA 4KZTA 4E2AA 4AVAA 4RI1A 4MY3A 2D4PA 4CS0B 2Q4YA 1YK3A 4QB9A 2VXKA 5KTAA 3EC4A 4U9ZA 2B4DA 2B4BA 2ZW4A 5H86A 1RO5A 2B5GA 2ATRA 2CNTA 3G8WA 4Y49C 1OZPA 2Z11A 5C88A 4XPDB 3TO9A 5C82A 2Q04A 4OLLA 4KLVA 3FXTA 3S6GA 3R1KA 5F47A 1MJBA 5HMNA 1IYKA 1P4NA 3FBUA 1YGHA 5IB0A 1S7FA 2OZGA 4KOSA 2GANA 4AVBA 5F48A 2J8NA 5EC4A 1Q2CA 1Z4EA 2QIRA 5EBVA 2ZW7A 2VZYA 2K5TA 2DXQA 2GIVA 1Y9WA 2OZUA 3CXQA 1PUAA 1YVOA 1MJAA 2X7BA 2KCWA 5J8CA 2VQYA 3BLNA 2Q44A 2P6EA 4H6UA 4CRYB 4XNHB 4XPDC 1YVKA 3RYOA 2D4OA 4AG7A 3FYNA 1Y9KA 4JXRA 3OWCA 3C26A 2VEZA 4KLWA 2Q7BA 2WPXA 2Z10A 5I0CA 2B58A 3SXOA 1K4JA 1IYLA 4UWIA 2FT0A 2EUIA 4XPKA 4KOTA 4MI4A 4YFJA 2BL1A 3QB8A 4CAWA 1KUVA 3BJ8A 2FL4A 3T90A 5E96A 3R96A 4IF5A 5KTDA 3DR6A 1P0HA 2J8RA 2G0BA 1QSOA 4XNHC 1B87A 3DNSA 5FVJA 4KUAA 4KOVA 1WK4A 2REFA 4X5KA 1CJWA 4HNWB 3EO4A 4ONUA 3LODA 1YREA 1MJ9A 1XF8A 3SHPA 2WPWA 4NCZA 3N7ZA 4H6ZA 1FY7A 4IUSA 3D2MA 2I00A 2Y0MA 4NF1A 4QC6A 2BEIA 3PGPA 4KORA 4FD5A 3D2PA 3TFYA 2ZW5A 2PDOA 2FCKA 4UWJA 4YRHA 1LRZA 2P6GA 1I12A 3S6KA 4R3LA 3VWDA 4AB7A 2H5MA 1S7NA 1S3ZA 5ISVA 1IIDA 2R7HA 2C27A 3W6XA 1NSLA 4QUSA 4KVOE 4FD6A 2G3TA 4AVCA 3I9SA 2QMLA 5F46A 1GHEA 4OADA 2Q0YA 3LD2A
chains in the Genus database with same CATH superfamily
1KUXA 1VKCA 4KSFA 4B10A 1BO4A 2HV2A 4F8ZA 2NYQA 3GUXA 8CPAA 3QNVA 2QVPA 1YW4A 2P6FA 2FSRA 3LMSA 4M6HA 4P6YA 4I49A 4X3RA 3EFAA 4EVYA 2FE7A 5J1QA 3QAYA 7CPAA 2ARHA 3UY5A 4CAVA 4ZY1A 4NXYA 4FD7A 4R57A 2PRQA 4UBRA 3EXNA 1BOBA 3IWGA 3TCVA 4A31A 3FF3A 1I1DA 4MFKA 4TNUA 3R9FA 2CXAA 1IOIA 3P2HA 4JD6A 3T8WA 1KZFA 4LQ6A 3IWEA 4HPSA 1TF9A 1YX0A 1ZLIA 3KL9A 4EFDA 3TO7A 1XBUA 3W6SA 4BBHA 5IV0A 2AJ6A 4ORFA 4M3SA 4FD4A 1AYEA 3D67A 1Q2YA 2YNCA 3D4UA 4O23A 1BPMA 1MK4A 2BCOA 2O4HA 3CDXA 3BJ7A 4BD9A 4F9VA 3IFEA 4OC2A 3W91A 3HUVA 2CNMA 3PZJA 1YW6A 1M44A 2OZHA 4UA3A 2B3UA 2Q4VA 2CF4A 3H8EA 5IB9A 1LCPA 4EWTA 3SXNA 2PJ4A 4TWEA 5F49A 3R9GA 5DWNA 4DNCA 3TE4A 4M85A 2ZXVA 5K8NA 2FXFA 3FNCA 4MHDA 5K8MA 2EK9A 4NGSA 1S5KA 3P2FA 3S6FA 1J4JA 3RZAA 1HDUA 4CAEA 4MHYA 3D3SA 2Q51A 2PJAA 4OC3A 2YNCC 4R76A 1QSNA 2PR8A 3RBUA 1FT7A 2CY2A 4NGMA 3TOAA 3WC5A 5DWMA 1TXRA 1CP6A 4UEEA 3IWWA 3WC7A 4C2ZA 3B3TA 2WZNA 2PR1A 3F8KA 2ZPAA 4UFWA 4II9A 2JLMA 2OU2A 4P4JA 2O28A 3T9YA 1XMTA 1ARLA 2FIAA 3TTHA 4FUUA 4KVXA 2V77A 1V0CA 3GKRA 1HEEA 2DEAA 1UFHA 3I1UA 3PB6X 1CG2A 2PIZA 4LUAA 4R87A 2VL1A 3I3GA 4JZ0A 4KOWA 5ELYA 5JM6A 1ZLHA 4U9YA 4UEZA 1RTQA 4L8AA 2JEWA 3N5FA 4A94A 4QBJA 4KVME 5LYIA 1XOVA 3KASA 1WWZA 3FX6A 2PC1A 3CXPA 1L0CA 1Z8LA 1TIQA 2F5IA 3NFZA 3JRUA 4KUBA 2Z3OA 1BLLE 2A4NA 2EVNA 1R43A 4JLYA 2PSWA 5JPHA 2F8HA 4OC4A 4PSWA 4ZBGA 3TO6A 1I21A 3VH9A 4B5OA 2FIWA 4CYNA 5F09A 2QECA 3FB3A 2J8MA 4Y49B 2VI7A 1XIXA 4GXHA 1Y0RA 2WUUA 2BSWA 3JVNA 3H4QA 4A30A 4MFZA 2BOAA 2ZEFA 3BXMA 4P44A 4AG9A 2R98A 2XEGA 1IB1E 2GE3A 2JDCA 4P4BA 3RNZA 2R1IA 4PV6A 2OOTA 1Z8WA 1M4LA 3GB0A 1IOFA 2PQ8A 4IAVA 2AFWA 5JQ4A 1YLEA 2B5GB 2XEFA 2ZOGA 3TX8A 4NJQA 2BUEA 3WR7A 1ON0A 3EY5A 2PJ7A 4R6TA 4RUHA 3VARA 2Z3KA 4NGQA 3SI1A 3GLJA 4J3GA 3F0AA 3PB9X 4KOXA 3V38A 2I79A 4CRZB 1S7LA 3G3SA 4JWPA 4KOYA 4OC5A 1IU8A 4F6AA 2PJBA 1NMTA 1CM0A 4YWYA 3DLJA 2GLJA 3GY9A 4ZX8A 4C7HA 4MCPA 1S60A 5LRKA 4HNYB 1U6MA 4NJRA 1Z4RA 1NSAA 4UIBA 2V8GA 5GCNA 5HVFA 1QSTA 4JXQA 3LD2A 3PP9A 3DDDA 3DSBA 1TF8A 4LX9A 3NH4A 3CPXA 4BMHA 4NSQA 4L89A 3SJXA 4F0YA 3R95A 1YQEA 5AG6A 2CTBA 4P4IA 3FEEA 2DPTA 3MGDA 2RFHA 1Q2DA 3D7FA 4NGPA 1CPSA 3LWUA 4A39A 4B11A 5J8FA 2GU2A 4RN7A 5HXDA 1F57A 3RO0A 3E0KA 3FRMA 4H89A 2OH1A 4PXCA 4R7MA 2VZZA 3D66A 2JDDA 4GS4A 4MJ8A 2AFSA 3KI9A 4NGNA 4A95A 4NFRA 4HNXB 3SJFA 3PB8X 2PRBA 1M4IA 1XMBA 3D8PA 2Z0ZA 3QAHA 3B2YA 2AFMA 4CYOA 3IJ3A 5CBMA 5IX3A 2IMOA 2Z3LA 4HKFA 1UWYA 2C1CA 3V7ZA 1ZG8A 4DUKA 1VGYA 3KKWA 1RXTA 4E0AA 4DYOA 1Y7EA 2G3AA 4PQAA 1A2ZA 3PFOA 4P10A 1QSRA 2B3VA 3LACA 5H84A 3TOBA 5K8OA 2HB6A 3BI0A 4PK3A 4CAXA 1B6BA 4MY0A 1VHSA 2AFZA 2PE3A 3B8GA 1ZG9A 5LRJA 6CPAA 2JBJA 1X10A 3GYAA 4MHPA 3WC6A 4CGOA 1JWQA 1S7KA 1XEBA 2AFUA 4Q38A 1AMPA 4OMEA 4PK2A 1LFWA 2ZENA 2R8VA 4UCMA 3ZJ0A 3SJEA 1PU9A 4NEXA 3ZZIA 4K30A 5AG7A 4MHZA 3FIXA 2VBQA 5HVGA 3BHXA 5AG5A 3GIUA 2EO8A 4JJXA 1R57A 4MFJA 1ELMP 5THWA 4WJBA 2REEA 3KZWA 3R9EA 3NH5A 1TKJA 4CGMA 3BI1A 2EK8A 4E8OA 2HUZA 2IJZA 3IGRA 3DR8A 4MFPA 4KOUA 3IU2A 3D7GA 4FBEA 2ZW6A 4OAEA 5CNPA 4UFXA 3WABA 3FJUA 2GFQA 4YGOA 2P0WA 1SQHA 1TKHA 1NE9A 3NA6A 4OC0A 5HH1A 4CPAA 1Z8TA 2IL4A 3DGVA 4G1PA 2DF5A 4PSXA 3H8GA 4PXDA 4A33A 4QVTA 4P4EA 2CIJA 4R3KA 1N71A 1Y7RA 2AE6A 3D7DA 3F5BA 5A27A 3CXSA 2NMTA 2FS5A 3IC1A 1Z5RA 3V8IA 1Z9UA 5DS0A 1XE4A 3NE7A 1M4DA 5KTCA 4RS2A 4R8FA 3D7HA 4U5YA 2NSMA 2PJ6A 1Q7LA 3PBEA 3JUWA 4B5PB 3S9NA 1VIXA 2PJ5A 2HQYA 2RC4A 1PYTB 1LANA 2IQ6A 2V8VA 4X8IA 1QMUA 3IU1A 1VHOA 3TT2A 5K8PA 3FMCA 3NE8A 5AGEA 1IICA 1M1DA 3FH4A 4F9UA 3S6HA 1M4GA 3ISZA 4R9MA 4XPLA 1X12A 2YNDA 4M6IA 3VWEA 2AFOA 3B3SA 2JEVA 1YSJA 5G20A 4MBUA 5HVHA 2ANPA 4ZGYB 1KUYA 1QSMA 3K9UA 4P4FA 2B4DB 2CNSA 1YR0A 2OB0A 4CGPA 4B5PA 4KZTA 4PPZA 4E2AA 4AVAA 2PCUA 4RI1A 4MY3A 3IO1A 1PCAA 4ZY2A 1ELLP 4UCPA 5I4MA 4A38A 2D4PA 4CS0B 1QQ9A 2XEIA 3SI0A 4UIAA 4MXUA 2Q4YA 4KSAA 1YK3A 4QB9A 2VXKA 4FWUA 5KTAA 1ZO0A 3FEDA 3EC4A 4OIDA 4EMEA 5BWAB 2WSAA 4U9ZA 3VATA 2B4DA 2B4BA 2GLFA 2ZW4A 4M6GA 5H86A 1RO5A 2F7VA 2B5GA 2ATRA 2V8HA 4MCQA 3SJGA 3WT4A 1DE4C 3SI2A 3MRUA 4OKOA 2CNTA 3G8WA 4ZYQA 2C6GA 2ZEDA 4Y49C 1OZPA 2Z11A 3KHXA 4GM5A 4XPDB 5C88A 4X2TA 3TO9A 2PJCA 2BO9A 5C82A 2Q04A 2PJ0A 4OLLA 4KLVA 1LAPA 4MCRA 3B3WA 3FXTA 4P4DA 3R1KA 4MRIA 3S6GA 5F47A 1MJBA 3JTKA 4BINA 5HMNA 1IYKA 4UFVA 1P4NA 3FBUA 1YGHA 3B3CA 5IB0A 2FVGA 1OBRA 4ZX9A 1S7FA 2OZGA 3HLPA 1H8LA 2GREA 4KOSA 5LYLA 5D29A 2GANA 4AVBA 5F48A 2J8NA 4F0XA 5EC4A 1HDQA 1Q2CA 2Z3PA 2C6PA 2JBKA 1Z4EA 2QIRA 3CT9A 5EBVA 1XFOA 4NGRA 2ZW7A 2VZYA 2CTCA 2K5TA 2PJ9A 1GYTA 1CPXA 2DXQA 2GIVA 3S9MA 4AXVA 3B7IA 1Y9WA 2OZUA 3CXQA 3FVLA 1PUAA 2Q4ZA 4WWVA 1YVOA 1MJAA 2X7BA 5CPAA 2KCWA 5JGFA 1F2OA 4ZI6A 5J8CA 2VQYA 1XRYA 3BLNA 1LAMA 4W9YA 4B12A 2Q44A 2EWBA 2P6EA 1AUGA 2XEJA 4H6UA 4XNHB 4XPDC 4CRYB 1FNOA 3FECA 4MHNA 1YVKA 1CBXA 3RYOA 4A37A 3S9LA 4C2YA 1LOKA 2D4OA 4AG7A 3FYNA 1Y9KA 4JXRA 3OWCA 4PXEA 3C26A 5G1ZA 2VEZA 4KLWA 2PIYA 2Q7BA 1DTDA 3KQXA 2WPXA 2EBJA 2POKA 2Z10A 1BPNA 3IEHA 4UEFA 2B58A 4ZY0A 3SXOA 5I0CA 1XJOA 1K4JA 4JYWA 4Q36A 4LQGA 1IYLA 3PFEA 4UWIA 1BAVA 3KHZA 3L2NA 3MN8A 2PVWA 2FT0A 2ZEOA 2EUIA 3KR5A 4XPKA 4KOTA 4MI4A 4YFJA 2YNEA 2BL1A 2PJ2A 2PVVA 1KUVA 3BJ8A 3QB8A 2DPSA 4CAWA 2FL4A 4H2KA 2PJ3A 4IHMA 1TKFA 2ZEHA 5E96A 3T90A 4CGNA 4OIWA 3R96A 2QYVA 4IF5A 5KTDA 3DR6A 5D8NA 1P0HA 2YGWA 2J8RA 2O53A 2G0BA 1Y0YA 3PB7X 1QSOA 1R3NA 2ZELA 4CGLA 5G22A 3B35A 4XNHC 4OC1A 1B87A 2I3CA 3DNSA 2ZEMA 4K3NA 4KUAA 5FVJA 2ZEPA 4KOVA 1WK4A 4C2XA 2REFA 2PJ1A 4X5KA 5JH9A 4C7IA 4Q7AA 5EMIA 1VHEA 3PBBA 4MMOA 4DJLA 3CPAA 3PB4X 4C68A 1CJWA 4UF4A 4HNWB 3EO4A 1CP7A 4ONUA 2G9DA 2Q7SA 3RAMA 1ARMA 3LODA 1YREA 5G21A 3K2KA 1MJ9A 1XF8A 3SHPA 3H8FA 3NH8A 2WYRA 3A9LA 2WPWA 1YLOA 4NCZA 3N7ZA 4CYPA 4H6ZA 2RB7A 2J9AA 4IK2A 4UCNA 5LRGA 1IY7A 1FY7A 2C6CA 2Z3MA 4B6ZA 4IUSA 4A2ZA 1YMEA 1Z8XA 2QJ8A 3D2MA 2I00A 4B13A 2Y0MA 2ZOFA 4MFQA 4NF1A 2BEIA 3KR4A 2OR4A 3CZXA 4QC6A 4CYQA 2Q43A 3PGPA 2ZEEA 4KORA 1Z2LA 3D68A 5A28A 4FD5A 4CAFA 3D2PA 3K9TA 3TFYA 2ZW5A 2PDOA 1CX8A 2ABZA 2FCKA 4UWJA 4YRHA 4P45A 1LRZA 2P6GA 4YU9A 1I12A 3KGQA 3S6KA 4R3LA 3VWDA 4AB7A 2H5MA 1S7NA 1S3ZA 3B3VA 3TC8A 5ISVA 3ISXA 1F2PA 3IIBA 2Z3NA 5LYDA 4KSIA 1JQGA 2HC9A 2R7HA 2C27A 4FAIA 1IGBA 5AG4A 1EE3P 3W6XA 1NSLA 3H5ZA 4NGTA 2ODFA 4QUSA 5LYFA 4KVOE 4FD6A 3PEIA 2G3TA 4AVCA 4A32A 3KQZA 3I9SA 2QMLA 5F46A 1GHEA 4B14A 4OADA 4KS9A 4MFLA 2V8DA 2Q0YA 4MCSA 4Z65A 2PJ8A 2ZEGA 2AFXA 4OP4A 4ONWA 1KWMA 4PXBA 3PRTA 1IIDA 1ZG7A
chains in the Genus database with same CATH topology
1KUXA 1VKCA 4KSFA 4B10A 1BO4A 2HV2A 2P6FA 2FSRA 4I49A 3EFAA 4EVYA 2FE7A 2ARHA 3UY5A 4CAVA 4NXYA 4FD7A 4R57A 4UBRA 3EXNA 1BOBA 3IWGA 3TCVA 4A31A 3R9FA 1I1DA 4MFKA 2CXAA 3P2HA 4JD6A 1KZFA 3IWEA 1YX0A 3TO7A 3W6SA 4BBHA 5IV0A 2AJ6A 4ORFA 4M3SA 4FD4A 1Q2YA 2YNCA 1MK4A 3BJ7A 3W91A 2CNMA 3PZJA 1M44A 2OZHA 4UA3A 2B3UA 2Q4VA 3SXNA 5F49A 3R9GA 5DWNA 4DNCA 3TE4A 4M85A 2ZXVA 2FXFA 3FNCA 4MHDA 1S5KA 3P2FA 3S6FA 1J4JA 4CAEA 3D3SA 2YNCC 1QSNA 2PR8A 2CY2A 3TOAA 5DWMA 4C2ZA 2PR1A 3F8KA 2ZPAA 4UFWA 4II9A 2JLMA 2OU2A 2O28A 3T9YA 1XMTA 2FIAA 3TTHA 4KVXA 3GKRA 1V0CA 4R87A 5A27A 4LUAA 1UFHA 3I3GA 4KOWA 4U9YA 4L8AA 4QBJA 4KVME 1WWZA 2PC1A 3CXPA 1L0CA 1TIQA 2F5IA 4KUBA 2Z3OA 2A4NA 2EVNA 4JLYA 2PSWA 5JPHA 4PSWA 4ZBGA 3TO6A 1I21A 4B5OA 2FIWA 4CYNA 2QECA 3FB3A 2J8MA 4Y49B 2VI7A 1XIXA 2WUUA 2BSWA 3JVNA 3H4QA 4A30A 4MFZA 4AG9A 2R98A 1IB1E 2GE3A 2JDCA 2R1IA 4PV6A 2PQ8A 5JQ4A 1YLEA 2B5GB 3WR7A 2BUEA 1ON0A 3EY5A 2Z3KA 4J3GA 4KOXA 3F0AA 4CRZB 2I79A 1S7LA 3G3SA 4JWPA 4KOYA 4F6AA 1NMTA 1CM0A 3GY9A 4C7HA 1S60A 4HNYB 1U6MA 1Z4RA 5GCNA 1QSTA 4JXQA 3PP9A 3DDDA 3DSBA 4LX9A 4BMHA 4NSQA 4L89A 4F0YA 3R95A 5AG6A 2DPTA 3MGDA 1Q2DA 4B11A 5J8FA 3E0KA 3FRMA 4H89A 2OH1A 4A95A 2VZZA 4GS4A 2JDDA 4MJ8A 4HNXB 2PRBA 1M4IA 3D8PA 2Z0ZA 3QAHA 4CYOA 5IX3A 2Z3LA 4HKFA 3KKWA 4E0AA 1RXTA 2G3AA 1QSRA 2B3VA 5H84A 3TOBA 4PK3A 4CAXA 1B6BA 4MY0A 1VHSA 3B8GA 3GYAA 4CGOA 1S7KA 1XEBA 4Q38A 4PK2A 2R8VA 4UCMA 3ZJ0A 3ZZIA 1PU9A 4NEXA 4K30A 5AG7A 3FIXA 2VBQA 5AG5A 4JJXA 1R57A 4MFJA 2REEA 3R9EA 4CGMA 4E8OA 2HUZA 3IGRA 3DR8A 4MFPA 4KOUA 3IU2A 2ZW6A 4OAEA 5CNPA 4UFXA 4YGOA 2P0WA 1SQHA 1NE9A 5HH1A 2IL4A 4PSXA 4A33A 4QVTA 4R3KA 1N71A 1Y7RA 2AE6A 3F5BA 3CXSA 2NMTA 2FS5A 3V8IA 1Z9UA 1XE4A 3NE7A 1M4DA 5KTCA 4RS2A 4U5YA 3JUWA 4B5PB 2HQYA 2RC4A 3IU1A 3TT2A 5AGEA 1IICA 1M1DA 3S6HA 1M4GA 4R9MA 4XPLA 2YNDA 3VWEA 2JEVA 5G20A 4MBUA 4ZGYB 1KUYA 1QSMA 3K9UA 2B4DB 2CNSA 1YR0A 2OB0A 4CGPA 4B5PA 4KZTA 4E2AA 4AVAA 4RI1A 4MY3A 4UCPA 2D4PA 4CS0B 2Q4YA 4KSAA 1YK3A 4QB9A 2VXKA 5KTAA 1ZO0A 3EC4A 5BWAB 2WSAA 4U9ZA 2B4DA 2B4BA 2ZW4A 5H86A 1RO5A 2B5GA 2ATRA 2CNTA 3G8WA 4Y49C 1OZPA 2Z11A 5C88A 4XPDB 3TO9A 5C82A 2Q04A 4OLLA 4KLVA 3FXTA 3S6GA 3R1KA 5F47A 1MJBA 3JTKA 5HMNA 1IYKA 4UFVA 1P4NA 3FBUA 1YGHA 5IB0A 1S7FA 2OZGA 4KOSA 2GANA 4AVBA 5F48A 2J8NA 4F0XA 5EC4A 2Z3PA 1Q2CA 1Z4EA 2QIRA 5EBVA 2ZW7A 2VZYA 2K5TA 2DXQA 2GIVA 1Y9WA 2OZUA 3CXQA 1PUAA 1YVOA 1MJAA 2X7BA 2KCWA 5J8CA 2VQYA 3BLNA 4B12A 2Q44A 2P6EA 4H6UA 4CRYB 4XNHB 4XPDC 1YVKA 3RYOA 4C2YA 2D4OA 4AG7A 3FYNA 1Y9KA 4JXRA 3OWCA 3C26A 5G1ZA 2VEZA 4KLWA 2Q7BA 2WPXA 2Z10A 5I0CA 2B58A 3SXOA 1K4JA 4Q36A 1IYLA 4UWIA 2FT0A 2EUIA 4XPKA 4KOTA 4MI4A 4YFJA 2YNEA 2BL1A 3QB8A 4CAWA 1KUVA 3BJ8A 2DPSA 2FL4A 3T90A 5E96A 4CGNA 3R96A 4IF5A 5KTDA 3DR6A 1P0HA 2YGWA 2J8RA 2G0BA 1QSOA 4CGLA 5G22A 4XNHC 1B87A 3DNSA 5FVJA 4KUAA 4KOVA 1WK4A 4C2XA 2REFA 4X5KA 4C7IA 4C68A 1CJWA 4HNWB 3EO4A 4ONUA 3LODA 1YREA 5G21A 1MJ9A 1XF8A 3SHPA 3A9LA 2WPWA 4NCZA 3N7ZA 4CYPA 4H6ZA 4UCNA 1FY7A 2Z3MA 4IUSA 4A2ZA 3D2MA 4B13A 2I00A 2Y0MA 4MFQA 4NF1A 2BEIA 4QC6A 4CYQA 3PGPA 4KORA 5A28A 4FD5A 4CAFA 3D2PA 3TFYA 2ZW5A 2PDOA 2FCKA 4UWJA 4YRHA 1LRZA 2P6GA 1I12A 3S6KA 4R3LA 3VWDA 4AB7A 2H5MA 1S7NA 1S3ZA 5ISVA 1IIDA 2Z3NA 2R7HA 2C27A 5AG4A 3W6XA 1NSLA 3H5ZA 4QUSA 4KVOE 4FD6A 2G3TA 4AVCA 4A32A 3I9SA 2QMLA 5F46A 1GHEA 4B14A 4OADA 4KS9A 4MFLA 2Q0YA 3LD2A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1KUX A;  1VKC A;  1BO4 A;  2HV2 A;  2P6F A;  2FSR A;  4I49 A;  3EFA A;  4EVY A;  2FE7 A;  2ARH A;  3UY5 A;  4CAV A;  4NXY A;  4FD7 A;  4R57 A;  4UBR A;  3EXN A;  1BOB A;  3IWG A;  3TCV A;  3R9F A;  1I1D A;  3P2H A;  4JD6 A;  1KZF A;  1YX0 A;  3TO7 A;  3W6S A;  5IV0 A;  2AJ6 A;  4ORF A;  4M3S A;  4FD4 A;  1Q2Y A;  1MK4 A;  3BJ7 A;  3W91 A;  2CNM A;  3PZJ A;  1M44 A;  2OZH A;  4UA3 A;  2B3U A;  2Q4V A;  3SXN A;  5F49 A;  3R9G A;  5DWN A;  4DNC A;  3TE4 A;  4M85 A;  2ZXV A;  2FXF A;  3FNC A;  4MHD A;  1S5K A;  3P2F A;  3S6F A;  1J4J A;  3D3S A;  1QSN A;  2PR8 A;  2CY2 A;  3TOA A;  5DWM A;  2PR1 A;  3F8K A;  2ZPA A;  4II9 A;  2JLM A;  2OU2 A;  2O28 A;  3T9Y A;  1XMT A;  2FIA A;  3TTH A;  4KVX A;  3GKR A;  1V0C A;  4R87 A;  4LUA A;  1UFH A;  3I3G A;  4KOW A;  4U9Y A;  4L8A A;  4QBJ A;  4KVM E;  1WWZ A;  2PC1 A;  3CXP A;  1L0C A;  1TIQ A;  2F5I A;  4KUB A;  2A4N A;  2EVN A;  4JLY A;  2PSW A;  5JPH A;  4PSW A;  4ZBG A;  3TO6 A;  1I21 A;  4B5O A;  2FIW A;  2QEC A;  3FB3 A;  2J8M A;  4Y49 B;  2VI7 A;  1XIX A;  3JVN A;  2BSW A;  3H4Q A;  4AG9 A;  2R98 A;  1IB1 E;  2GE3 A;  2JDC A;  2R1I A;  4PV6 A;  2PQ8 A;  5JQ4 A;  1YLE A;  2B5G B;  3WR7 A;  2BUE A;  1ON0 A;  3EY5 A;  4J3G A;  4KOX A;  3F0A A;  4CRZ B;  2I79 A;  1S7L A;  3G3S A;  4JWP A;  4KOY A;  4F6A A;  1NMT A;  1CM0 A;  3GY9 A;  1S60 A;  4HNY B;  1U6M A;  1Z4R A;  5GCN A;  1QST A;  4JXQ A;  3PP9 A;  3DDD A;  3DSB A;  4LX9 A;  4BMH A;  4NSQ A;  4L89 A;  4F0Y A;  3R95 A;  3MGD A;  1Q2D A;  5J8F A;  3E0K A;  3FRM A;  4H89 A;  2OH1 A;  2VZZ A;  4GS4 A;  2JDD A;  4MJ8 A;  4HNX B;  2PRB A;  1M4I A;  3D8P A;  2Z0Z A;  3QAH A;  5IX3 A;  4HKF A;  3KKW A;  4E0A A;  1RXT A;  2G3A A;  1QSR A;  2B3V A;  5H84 A;  3TOB A;  4PK3 A;  4CAX A;  1B6B A;  4MY0 A;  1VHS A;  3B8G A;  3GYA A;  1S7K A;  1XEB A;  4PK2 A;  2R8V A;  3ZZI A;  3ZJ0 A;  1PU9 A;  4NEX A;  4K30 A;  3FIX A;  2VBQ A;  4JJX A;  1R57 A;  2REE A;  3R9E A;  4E8O A;  2HUZ A;  3IGR A;  3DR8 A;  4KOU A;  2ZW6 A;  4OAE A;  5CNP A;  4YGO A;  2P0W A;  1SQH A;  1NE9 A;  5HH1 A;  2IL4 A;  4PSX A;  4QVT A;  4R3K A;  1N71 A;  1Y7R A;  2AE6 A;  3F5B A;  3CXS A;  2NMT A;  2FS5 A;  3V8I A;  1Z9U A;  1XE4 A;  3NE7 A;  1M4D A;  5KTC A;  4RS2 A;  4U5Y A;  3JUW A;  4B5P B;  2HQY A;  2RC4 A;  3TT2 A;  1IIC A;  1M1D A;  3S6H A;  1M4G A;  4R9M A;  4XPL A;  3VWE A;  2JEV A;  4MBU A;  1KUY A;  1QSM A;  3K9U A;  2B4D B;  2CNS A;  1YR0 A;  2OB0 A;  4B5P A;  4KZT A;  4E2A A;  4AVA A;  4RI1 A;  4MY3 A;  2D4P A;  4CS0 B;  2Q4Y A;  1YK3 A;  4QB9 A;  2VXK A;  5KTA A;  3EC4 A;  4U9Z A;  2B4D A;  2B4B A;  2ZW4 A;  5H86 A;  1RO5 A;  2B5G A;  2ATR A;  2CNT A;  3G8W A;  4Y49 C;  1OZP A;  2Z11 A;  5C88 A;  4XPD B;  3TO9 A;  5C82 A;  2Q04 A;  4OLL A;  4KLV A;  3FXT A;  3S6G A;  3R1K A;  5F47 A;  1MJB A;  5HMN A;  1IYK A;  1P4N A;  3FBU A;  1YGH A;  5IB0 A;  1S7F A;  2OZG A;  4KOS A;  2GAN A;  4AVB A;  5F48 A;  2J8N A;  5EC4 A;  1Q2C A;  1Z4E A;  2QIR A;  5EBV A;  2ZW7 A;  2VZY A;  2K5T A;  2DXQ A;  2GIV A;  1Y9W A;  2OZU A;  3CXQ A;  1PUA A;  1YVO A;  1MJA A;  2X7B A;  2KCW A;  5J8C A;  2VQY A;  3BLN A;  2Q44 A;  2P6E A;  4H6U A;  4CRY B;  4XNH B;  4XPD C;  1YVK A;  3RYO A;  2D4O A;  4AG7 A;  3FYN A;  1Y9K A;  4JXR A;  3OWC A;  3C26 A;  2VEZ A;  4KLW A;  2Q7B A;  2WPX A;  2Z10 A;  5I0C A;  2B58 A;  3SXO A;  1K4J A;  1IYL A;  4UWI A;  2FT0 A;  2EUI A;  4XPK A;  4KOT A;  4MI4 A;  4YFJ A;  2BL1 A;  3QB8 A;  4CAW A;  1KUV A;  3BJ8 A;  2FL4 A;  3T90 A;  5E96 A;  3R96 A;  4IF5 A;  5KTD A;  3DR6 A;  1P0H A;  2J8R A;  2G0B A;  1QSO A;  4XNH C;  1B87 A;  3DNS A;  5FVJ A;  4KUA A;  4KOV A;  1WK4 A;  2REF A;  4X5K A;  1CJW A;  4HNW B;  3EO4 A;  4ONU A;  3LOD A;  1YRE A;  1MJ9 A;  1XF8 A;  3SHP A;  2WPW A;  4NCZ A;  3N7Z A;  4H6Z A;  1FY7 A;  4IUS A;  3D2M A;  2I00 A;  2Y0M A;  4NF1 A;  4QC6 A;  2BEI A;  3PGP A;  4KOR A;  4FD5 A;  3D2P A;  3TFY A;  2ZW5 A;  2PDO A;  2FCK A;  4UWJ A;  4YRH A;  1LRZ A;  2P6G A;  1I12 A;  3S6K A;  4R3L A;  3VWD A;  4AB7 A;  2H5M A;  1S7N A;  1S3Z A;  5ISV A;  1IID A;  2R7H A;  2C27 A;  3W6X A;  1NSL A;  4QUS A;  4KVO E;  4FD6 A;  2G3T A;  4AVC A;  3I9S A;  2QML A;  5F46 A;  1GHE A;  4OAD A;  2Q0Y A;  3LD2 A; 
#chains in the Genus database with same CATH topology
 1KUX A;  1VKC A;  4KSF A;  4B10 A;  1BO4 A;  2HV2 A;  4F8Z A;  2NYQ A;  3GUX A;  8CPA A;  3QNV A;  2QVP A;  1YW4 A;  2P6F A;  2FSR A;  3LMS A;  4M6H A;  4P6Y A;  4I49 A;  4X3R A;  3EFA A;  4EVY A;  2FE7 A;  5J1Q A;  3QAY A;  7CPA A;  2ARH A;  3UY5 A;  4CAV A;  4ZY1 A;  4NXY A;  4FD7 A;  4R57 A;  2PRQ A;  4UBR A;  3EXN A;  1BOB A;  3IWG A;  3TCV A;  4A31 A;  3FF3 A;  1I1D A;  4MFK A;  4TNU A;  3R9F A;  2CXA A;  1IOI A;  3P2H A;  4JD6 A;  3T8W A;  1KZF A;  4LQ6 A;  3IWE A;  4HPS A;  1TF9 A;  1YX0 A;  1ZLI A;  3KL9 A;  4EFD A;  3TO7 A;  1XBU A;  3W6S A;  4BBH A;  5IV0 A;  2AJ6 A;  4ORF A;  4M3S A;  4FD4 A;  1AYE A;  3D67 A;  1Q2Y A;  2YNC A;  3D4U A;  4O23 A;  1BPM A;  1MK4 A;  2BCO A;  2O4H A;  3CDX A;  3BJ7 A;  4BD9 A;  4F9V A;  3IFE A;  4OC2 A;  3W91 A;  3HUV A;  2CNM A;  3PZJ A;  1YW6 A;  1M44 A;  2OZH A;  4UA3 A;  2B3U A;  2Q4V A;  2CF4 A;  3H8E A;  5IB9 A;  1LCP A;  4EWT A;  3SXN A;  2PJ4 A;  4TWE A;  5F49 A;  3R9G A;  5DWN A;  4DNC A;  3TE4 A;  4M85 A;  2ZXV A;  5K8N A;  2FXF A;  3FNC A;  4MHD A;  5K8M A;  2EK9 A;  4NGS A;  1S5K A;  3P2F A;  3S6F A;  1J4J A;  3RZA A;  1HDU A;  4CAE A;  4MHY A;  3D3S A;  2Q51 A;  2PJA A;  4OC3 A;  2YNC C;  4R76 A;  1QSN A;  2PR8 A;  3RBU A;  1FT7 A;  2CY2 A;  4NGM A;  3TOA A;  3WC5 A;  5DWM A;  1TXR A;  1CP6 A;  4UEE A;  3IWW A;  3WC7 A;  4C2Z A;  3B3T A;  2WZN A;  2PR1 A;  3F8K A;  2ZPA A;  4UFW A;  4II9 A;  2JLM A;  2OU2 A;  4P4J A;  2O28 A;  3T9Y A;  1XMT A;  1ARL A;  2FIA A;  3TTH A;  4FUU A;  4KVX A;  2V77 A;  1V0C A;  3GKR A;  1HEE A;  2DEA A;  1UFH A;  3I1U A;  3PB6 X;  1CG2 A;  2PIZ A;  4LUA A;  4R87 A;  2VL1 A;  3I3G A;  4JZ0 A;  4KOW A;  5ELY A;  5JM6 A;  1ZLH A;  4U9Y A;  4UEZ A;  1RTQ A;  4L8A A;  2JEW A;  3N5F A;  4A94 A;  4QBJ A;  4KVM E;  5LYI A;  1XOV A;  3KAS A;  1WWZ A;  3FX6 A;  2PC1 A;  3CXP A;  1L0C A;  1Z8L A;  1TIQ A;  2F5I A;  3NFZ A;  3JRU A;  4KUB A;  2Z3O A;  1BLL E;  2A4N A;  2EVN A;  1R43 A;  4JLY A;  2PSW A;  5JPH A;  2F8H A;  4OC4 A;  4PSW A;  4ZBG A;  3TO6 A;  1I21 A;  3VH9 A;  4B5O A;  2FIW A;  4CYN A;  5F09 A;  2QEC A;  3FB3 A;  2J8M A;  4Y49 B;  2VI7 A;  1XIX A;  4GXH A;  1Y0R A;  2WUU A;  2BSW A;  3JVN A;  3H4Q A;  4A30 A;  4MFZ A;  2BOA A;  2ZEF A;  3BXM A;  4P44 A;  4AG9 A;  2R98 A;  2XEG A;  1IB1 E;  2GE3 A;  2JDC A;  4P4B A;  3RNZ A;  2R1I A;  4PV6 A;  2OOT A;  1Z8W A;  1M4L A;  3GB0 A;  1IOF A;  2PQ8 A;  4IAV A;  2AFW A;  5JQ4 A;  1YLE A;  2B5G B;  2XEF A;  2ZOG A;  3TX8 A;  4NJQ A;  2BUE A;  3WR7 A;  1ON0 A;  3EY5 A;  2PJ7 A;  4R6T A;  4RUH A;  3VAR A;  2Z3K A;  4NGQ A;  3SI1 A;  3GLJ A;  4J3G A;  3F0A A;  3PB9 X;  4KOX A;  3V38 A;  2I79 A;  4CRZ B;  1S7L A;  3G3S A;  4JWP A;  4KOY A;  4OC5 A;  1IU8 A;  4F6A A;  2PJB A;  1NMT A;  1CM0 A;  4YWY A;  3DLJ A;  2GLJ A;  3GY9 A;  4ZX8 A;  4C7H A;  4MCP A;  1S60 A;  5LRK A;  4HNY B;  1U6M A;  4NJR A;  1Z4R A;  1NSA A;  4UIB A;  2V8G A;  5GCN A;  5HVF A;  1QST A;  4JXQ A;  3LD2 A;  3PP9 A;  3DDD A;  3DSB A;  1TF8 A;  4LX9 A;  3NH4 A;  3CPX A;  4BMH A;  4NSQ A;  4L89 A;  3SJX A;  4F0Y A;  3R95 A;  1YQE A;  5AG6 A;  2CTB A;  4P4I A;  3FEE A;  2DPT A;  3MGD A;  2RFH A;  1Q2D A;  3D7F A;  4NGP A;  1CPS A;  3LWU A;  4A39 A;  4B11 A;  5J8F A;  2GU2 A;  4RN7 A;  5HXD A;  1F57 A;  3RO0 A;  3E0K A;  3FRM A;  4H89 A;  2OH1 A;  4PXC A;  4R7M A;  2VZZ A;  3D66 A;  2JDD A;  4GS4 A;  4MJ8 A;  2AFS A;  3KI9 A;  4NGN A;  4A95 A;  4NFR A;  4HNX B;  3SJF A;  3PB8 X;  2PRB A;  1M4I A;  1XMB A;  3D8P A;  2Z0Z A;  3QAH A;  3B2Y A;  2AFM A;  4CYO A;  3IJ3 A;  5CBM A;  5IX3 A;  2IMO A;  2Z3L A;  4HKF A;  1UWY A;  2C1C A;  3V7Z A;  1ZG8 A;  4DUK A;  1VGY A;  3KKW A;  1RXT A;  4E0A A;  4DYO A;  1Y7E A;  2G3A A;  4PQA A;  1A2Z A;  3PFO A;  4P10 A;  1QSR A;  2B3V A;  3LAC A;  5H84 A;  3TOB A;  5K8O A;  2HB6 A;  3BI0 A;  4PK3 A;  4CAX A;  1B6B A;  4MY0 A;  1VHS A;  2AFZ A;  2PE3 A;  3B8G A;  1ZG9 A;  5LRJ A;  6CPA A;  2JBJ A;  1X10 A;  3GYA A;  4MHP A;  3WC6 A;  4CGO A;  1JWQ A;  1S7K A;  1XEB A;  2AFU A;  4Q38 A;  1AMP A;  4OME A;  4PK2 A;  1LFW A;  2ZEN A;  2R8V A;  4UCM A;  3ZJ0 A;  3SJE A;  1PU9 A;  4NEX A;  3ZZI A;  4K30 A;  5AG7 A;  4MHZ A;  3FIX A;  2VBQ A;  5HVG A;  3BHX A;  5AG5 A;  3GIU A;  2EO8 A;  4JJX A;  1R57 A;  4MFJ A;  1ELM P;  5THW A;  4WJB A;  2REE A;  3KZW A;  3R9E A;  3NH5 A;  1TKJ A;  4CGM A;  3BI1 A;  2EK8 A;  4E8O A;  2HUZ A;  2IJZ A;  3IGR A;  3DR8 A;  4MFP A;  4KOU A;  3IU2 A;  3D7G A;  4FBE A;  2ZW6 A;  4OAE A;  5CNP A;  4UFX A;  3WAB A;  3FJU A;  2GFQ A;  4YGO A;  2P0W A;  1SQH A;  1TKH A;  1NE9 A;  3NA6 A;  4OC0 A;  5HH1 A;  4CPA A;  1Z8T A;  2IL4 A;  3DGV A;  4G1P A;  2DF5 A;  4PSX A;  3H8G A;  4PXD A;  4A33 A;  4QVT A;  4P4E A;  2CIJ A;  4R3K A;  1N71 A;  1Y7R A;  2AE6 A;  3D7D A;  3F5B A;  5A27 A;  3CXS A;  2NMT A;  2FS5 A;  3IC1 A;  1Z5R A;  3V8I A;  1Z9U A;  5DS0 A;  1XE4 A;  3NE7 A;  1M4D A;  5KTC A;  4RS2 A;  4R8F A;  3D7H A;  4U5Y A;  2NSM A;  2PJ6 A;  1Q7L A;  3PBE A;  3JUW A;  4B5P B;  3S9N A;  1VIX A;  2PJ5 A;  2HQY A;  2RC4 A;  1PYT B;  1LAN A;  2IQ6 A;  2V8V A;  4X8I A;  1QMU A;  3IU1 A;  1VHO A;  3TT2 A;  5K8P A;  3FMC A;  3NE8 A;  5AGE A;  1IIC A;  1M1D A;  3FH4 A;  4F9U A;  3S6H A;  1M4G A;  3ISZ A;  4R9M A;  4XPL A;  1X12 A;  2YND A;  4M6I A;  3VWE A;  2AFO A;  3B3S A;  2JEV A;  1YSJ A;  5G20 A;  4MBU A;  5HVH A;  2ANP A;  4ZGY B;  1KUY A;  1QSM A;  3K9U A;  4P4F A;  2B4D B;  2CNS A;  1YR0 A;  2OB0 A;  4CGP A;  4B5P A;  4KZT A;  4PPZ A;  4E2A A;  4AVA A;  2PCU A;  4RI1 A;  4MY3 A;  3IO1 A;  1PCA A;  4ZY2 A;  1ELL P;  4UCP A;  5I4M A;  4A38 A;  2D4P A;  4CS0 B;  1QQ9 A;  2XEI A;  3SI0 A;  4UIA A;  4MXU A;  2Q4Y A;  4KSA A;  1YK3 A;  4QB9 A;  2VXK A;  4FWU A;  5KTA A;  1ZO0 A;  3FED A;  3EC4 A;  4OID A;  4EME A;  5BWA B;  2WSA A;  4U9Z A;  3VAT A;  2B4D A;  2B4B A;  2GLF A;  2ZW4 A;  4M6G A;  5H86 A;  1RO5 A;  2F7V A;  2B5G A;  2ATR A;  2V8H A;  4MCQ A;  3SJG A;  3WT4 A;  1DE4 C;  3SI2 A;  3MRU A;  4OKO A;  2CNT A;  3G8W A;  4ZYQ A;  2C6G A;  2ZED A;  4Y49 C;  1OZP A;  2Z11 A;  3KHX A;  4GM5 A;  4XPD B;  5C88 A;  4X2T A;  3TO9 A;  2PJC A;  2BO9 A;  5C82 A;  2Q04 A;  2PJ0 A;  4OLL A;  4KLV A;  1LAP A;  4MCR A;  3B3W A;  3FXT A;  4P4D A;  3R1K A;  4MRI A;  3S6G A;  5F47 A;  1MJB A;  3JTK A;  4BIN A;  5HMN A;  1IYK A;  4UFV A;  1P4N A;  3FBU A;  1YGH A;  3B3C A;  5IB0 A;  2FVG A;  1OBR A;  4ZX9 A;  1S7F A;  2OZG A;  3HLP A;  1H8L A;  2GRE A;  4KOS A;  5LYL A;  5D29 A;  2GAN A;  4AVB A;  5F48 A;  2J8N A;  4F0X A;  5EC4 A;  1HDQ A;  1Q2C A;  2Z3P A;  2C6P A;  2JBK A;  1Z4E A;  2QIR A;  3CT9 A;  5EBV A;  1XFO A;  4NGR A;  2ZW7 A;  2VZY A;  2CTC A;  2K5T A;  2PJ9 A;  1GYT A;  1CPX A;  2DXQ A;  2GIV A;  3S9M A;  4AXV A;  3B7I A;  1Y9W A;  2OZU A;  3CXQ A;  3FVL A;  1PUA A;  2Q4Z A;  4WWV A;  1YVO A;  1MJA A;  2X7B A;  5CPA A;  2KCW A;  5JGF A;  1F2O A;  4ZI6 A;  5J8C A;  2VQY A;  1XRY A;  3BLN A;  1LAM A;  4W9Y A;  4B12 A;  2Q44 A;  2EWB A;  2P6E A;  1AUG A;  2XEJ A;  4H6U A;  4XNH B;  4XPD C;  4CRY B;  1FNO A;  3FEC A;  4MHN A;  1YVK A;  1CBX A;  3RYO A;  4A37 A;  3S9L A;  4C2Y A;  1LOK A;  2D4O A;  4AG7 A;  3FYN A;  1Y9K A;  4JXR A;  3OWC A;  4PXE A;  3C26 A;  5G1Z A;  2VEZ A;  4KLW A;  2PIY A;  2Q7B A;  1DTD A;  3KQX A;  2WPX A;  2EBJ A;  2POK A;  2Z10 A;  1BPN A;  3IEH A;  4UEF A;  2B58 A;  4ZY0 A;  3SXO A;  5I0C A;  1XJO A;  1K4J A;  4JYW A;  4Q36 A;  4LQG A;  1IYL A;  3PFE A;  4UWI A;  1BAV A;  3KHZ A;  3L2N A;  3MN8 A;  2PVW A;  2FT0 A;  2ZEO A;  2EUI A;  3KR5 A;  4XPK A;  4KOT A;  4MI4 A;  4YFJ A;  2YNE A;  2BL1 A;  2PJ2 A;  2PVV A;  1KUV A;  3BJ8 A;  3QB8 A;  2DPS A;  4CAW A;  2FL4 A;  4H2K A;  2PJ3 A;  4IHM A;  1TKF A;  2ZEH A;  5E96 A;  3T90 A;  4CGN A;  4OIW A;  3R96 A;  2QYV A;  4IF5 A;  5KTD A;  3DR6 A;  5D8N A;  1P0H A;  2YGW A;  2J8R A;  2O53 A;  2G0B A;  1Y0Y A;  3PB7 X;  1QSO A;  1R3N A;  2ZEL A;  4CGL A;  5G22 A;  3B35 A;  4XNH C;  4OC1 A;  1B87 A;  2I3C A;  3DNS A;  2ZEM A;  4K3N A;  4KUA A;  5FVJ A;  2ZEP A;  4KOV A;  1WK4 A;  4C2X A;  2REF A;  2PJ1 A;  4X5K A;  5JH9 A;  4C7I A;  4Q7A A;  5EMI A;  1VHE A;  3PBB A;  4MMO A;  4DJL A;  3CPA A;  3PB4 X;  4C68 A;  1CJW A;  4UF4 A;  4HNW B;  3EO4 A;  1CP7 A;  4ONU A;  2G9D A;  2Q7S A;  3RAM A;  1ARM A;  3LOD A;  1YRE A;  5G21 A;  3K2K A;  1MJ9 A;  1XF8 A;  3SHP A;  3H8F A;  3NH8 A;  2WYR A;  3A9L A;  2WPW A;  1YLO A;  4NCZ A;  3N7Z A;  4CYP A;  4H6Z A;  2RB7 A;  2J9A A;  4IK2 A;  4UCN A;  5LRG A;  1IY7 A;  1FY7 A;  2C6C A;  2Z3M A;  4B6Z A;  4IUS A;  4A2Z A;  1YME A;  1Z8X A;  2QJ8 A;  3D2M A;  2I00 A;  4B13 A;  2Y0M A;  2ZOF A;  4MFQ A;  4NF1 A;  2BEI A;  3KR4 A;  2OR4 A;  3CZX A;  4QC6 A;  4CYQ A;  2Q43 A;  3PGP A;  2ZEE A;  4KOR A;  1Z2L A;  3D68 A;  5A28 A;  4FD5 A;  4CAF A;  3D2P A;  3K9T A;  3TFY A;  2ZW5 A;  2PDO A;  1CX8 A;  2ABZ A;  2FCK A;  4UWJ A;  4YRH A;  4P45 A;  1LRZ A;  2P6G A;  4YU9 A;  1I12 A;  3KGQ A;  3S6K A;  4R3L A;  3VWD A;  4AB7 A;  2H5M A;  1S7N A;  1S3Z A;  3B3V A;  3TC8 A;  5ISV A;  3ISX A;  1F2P A;  3IIB A;  2Z3N A;  5LYD A;  4KSI A;  1JQG A;  2HC9 A;  2R7H A;  2C27 A;  4FAI A;  1IGB A;  5AG4 A;  1EE3 P;  3W6X A;  1NSL A;  3H5Z A;  4NGT A;  2ODF A;  4QUS A;  5LYF A;  4KVO E;  4FD6 A;  3PEI A;  2G3T A;  4AVC A;  4A32 A;  3KQZ A;  3I9S A;  2QML A;  5F46 A;  1GHE A;  4B14 A;  4OAD A;  4KS9 A;  4MFL A;  2V8D A;  2Q0Y A;  4MCS A;  4Z65 A;  2PJ8 A;  2ZEG A;  2AFX A;  4OP4 A;  4ONW A;  1KWM A;  4PXB A;  3PRT A;  1IID A;  1ZG7 A; 
#chains in the Genus database with same CATH homology
 1KUX A;  1VKC A;  4KSF A;  4B10 A;  1BO4 A;  2HV2 A;  2P6F A;  2FSR A;  4I49 A;  3EFA A;  4EVY A;  2FE7 A;  2ARH A;  3UY5 A;  4CAV A;  4NXY A;  4FD7 A;  4R57 A;  4UBR A;  3EXN A;  1BOB A;  3IWG A;  3TCV A;  4A31 A;  3R9F A;  1I1D A;  4MFK A;  2CXA A;  3P2H A;  4JD6 A;  1KZF A;  3IWE A;  1YX0 A;  3TO7 A;  3W6S A;  4BBH A;  5IV0 A;  2AJ6 A;  4ORF A;  4M3S A;  4FD4 A;  1Q2Y A;  2YNC A;  1MK4 A;  3BJ7 A;  3W91 A;  2CNM A;  3PZJ A;  1M44 A;  2OZH A;  4UA3 A;  2B3U A;  2Q4V A;  3SXN A;  5F49 A;  3R9G A;  5DWN A;  4DNC A;  3TE4 A;  4M85 A;  2ZXV A;  2FXF A;  3FNC A;  4MHD A;  1S5K A;  3P2F A;  3S6F A;  1J4J A;  4CAE A;  3D3S A;  2YNC C;  1QSN A;  2PR8 A;  2CY2 A;  3TOA A;  5DWM A;  4C2Z A;  2PR1 A;  3F8K A;  2ZPA A;  4UFW A;  4II9 A;  2JLM A;  2OU2 A;  2O28 A;  3T9Y A;  1XMT A;  2FIA A;  3TTH A;  4KVX A;  3GKR A;  1V0C A;  4R87 A;  5A27 A;  4LUA A;  1UFH A;  3I3G A;  4KOW A;  4U9Y A;  4L8A A;  4QBJ A;  4KVM E;  1WWZ A;  2PC1 A;  3CXP A;  1L0C A;  1TIQ A;  2F5I A;  4KUB A;  2Z3O A;  2A4N A;  2EVN A;  4JLY A;  2PSW A;  5JPH A;  4PSW A;  4ZBG A;  3TO6 A;  1I21 A;  4B5O A;  2FIW A;  4CYN A;  2QEC A;  3FB3 A;  2J8M A;  4Y49 B;  2VI7 A;  1XIX A;  2WUU A;  2BSW A;  3JVN A;  3H4Q A;  4A30 A;  4MFZ A;  4AG9 A;  2R98 A;  1IB1 E;  2GE3 A;  2JDC A;  2R1I A;  4PV6 A;  2PQ8 A;  5JQ4 A;  1YLE A;  2B5G B;  3WR7 A;  2BUE A;  1ON0 A;  3EY5 A;  2Z3K A;  4J3G A;  4KOX A;  3F0A A;  4CRZ B;  2I79 A;  1S7L A;  3G3S A;  4JWP A;  4KOY A;  4F6A A;  1NMT A;  1CM0 A;  3GY9 A;  4C7H A;  1S60 A;  4HNY B;  1U6M A;  1Z4R A;  5GCN A;  1QST A;  4JXQ A;  3PP9 A;  3DDD A;  3DSB A;  4LX9 A;  4BMH A;  4NSQ A;  4L89 A;  4F0Y A;  3R95 A;  5AG6 A;  2DPT A;  3MGD A;  1Q2D A;  4B11 A;  5J8F A;  3E0K A;  3FRM A;  4H89 A;  2OH1 A;  4A95 A;  2VZZ A;  4GS4 A;  2JDD A;  4MJ8 A;  4HNX B;  2PRB A;  1M4I A;  3D8P A;  2Z0Z A;  3QAH A;  4CYO A;  5IX3 A;  2Z3L A;  4HKF A;  3KKW A;  4E0A A;  1RXT A;  2G3A A;  1QSR A;  2B3V A;  5H84 A;  3TOB A;  4PK3 A;  4CAX A;  1B6B A;  4MY0 A;  1VHS A;  3B8G A;  3GYA A;  4CGO A;  1S7K A;  1XEB A;  4Q38 A;  4PK2 A;  2R8V A;  4UCM A;  3ZJ0 A;  3ZZI A;  1PU9 A;  4NEX A;  4K30 A;  5AG7 A;  3FIX A;  2VBQ A;  5AG5 A;  4JJX A;  1R57 A;  4MFJ A;  2REE A;  3R9E A;  4CGM A;  4E8O A;  2HUZ A;  3IGR A;  3DR8 A;  4MFP A;  4KOU A;  3IU2 A;  2ZW6 A;  4OAE A;  5CNP A;  4UFX A;  4YGO A;  2P0W A;  1SQH A;  1NE9 A;  5HH1 A;  2IL4 A;  4PSX A;  4A33 A;  4QVT A;  4R3K A;  1N71 A;  1Y7R A;  2AE6 A;  3F5B A;  3CXS A;  2NMT A;  2FS5 A;  3V8I A;  1Z9U A;  1XE4 A;  3NE7 A;  1M4D A;  5KTC A;  4RS2 A;  4U5Y A;  3JUW A;  4B5P B;  2HQY A;  2RC4 A;  3IU1 A;  3TT2 A;  5AGE A;  1IIC A;  1M1D A;  3S6H A;  1M4G A;  4R9M A;  4XPL A;  2YND A;  3VWE A;  2JEV A;  5G20 A;  4MBU A;  4ZGY B;  1KUY A;  1QSM A;  3K9U A;  2B4D B;  2CNS A;  1YR0 A;  2OB0 A;  4CGP A;  4B5P A;  4KZT A;  4E2A A;  4AVA A;  4RI1 A;  4MY3 A;  4UCP A;  2D4P A;  4CS0 B;  2Q4Y A;  4KSA A;  1YK3 A;  4QB9 A;  2VXK A;  5KTA A;  1ZO0 A;  3EC4 A;  5BWA B;  2WSA A;  4U9Z A;  2B4D A;  2B4B A;  2ZW4 A;  5H86 A;  1RO5 A;  2B5G A;  2ATR A;  2CNT A;  3G8W A;  4Y49 C;  1OZP A;  2Z11 A;  5C88 A;  4XPD B;  3TO9 A;  5C82 A;  2Q04 A;  4OLL A;  4KLV A;  3FXT A;  3S6G A;  3R1K A;  5F47 A;  1MJB A;  3JTK A;  5HMN A;  1IYK A;  4UFV A;  1P4N A;  3FBU A;  1YGH A;  5IB0 A;  1S7F A;  2OZG A;  4KOS A;  2GAN A;  4AVB A;  5F48 A;  2J8N A;  4F0X A;  5EC4 A;  2Z3P A;  1Q2C A;  1Z4E A;  2QIR A;  5EBV A;  2ZW7 A;  2VZY A;  2K5T A;  2DXQ A;  2GIV A;  1Y9W A;  2OZU A;  3CXQ A;  1PUA A;  1YVO A;  1MJA A;  2X7B A;  2KCW A;  5J8C A;  2VQY A;  3BLN A;  4B12 A;  2Q44 A;  2P6E A;  4H6U A;  4CRY B;  4XNH B;  4XPD C;  1YVK A;  3RYO A;  4C2Y A;  2D4O A;  4AG7 A;  3FYN A;  1Y9K A;  4JXR A;  3OWC A;  3C26 A;  5G1Z A;  2VEZ A;  4KLW A;  2Q7B A;  2WPX A;  2Z10 A;  5I0C A;  2B58 A;  3SXO A;  1K4J A;  4Q36 A;  1IYL A;  4UWI A;  2FT0 A;  2EUI A;  4XPK A;  4KOT A;  4MI4 A;  4YFJ A;  2YNE A;  2BL1 A;  3QB8 A;  4CAW A;  1KUV A;  3BJ8 A;  2DPS A;  2FL4 A;  3T90 A;  5E96 A;  4CGN A;  3R96 A;  4IF5 A;  5KTD A;  3DR6 A;  1P0H A;  2YGW A;  2J8R A;  2G0B A;  1QSO A;  4CGL A;  5G22 A;  4XNH C;  1B87 A;  3DNS A;  5FVJ A;  4KUA A;  4KOV A;  1WK4 A;  4C2X A;  2REF A;  4X5K A;  4C7I A;  4C68 A;  1CJW A;  4HNW B;  3EO4 A;  4ONU A;  3LOD A;  1YRE A;  5G21 A;  1MJ9 A;  1XF8 A;  3SHP A;  3A9L A;  2WPW A;  4NCZ A;  3N7Z A;  4CYP A;  4H6Z A;  4UCN A;  1FY7 A;  2Z3M A;  4IUS A;  4A2Z A;  3D2M A;  4B13 A;  2I00 A;  2Y0M A;  4MFQ A;  4NF1 A;  2BEI A;  4QC6 A;  4CYQ A;  3PGP A;  4KOR A;  5A28 A;  4FD5 A;  4CAF A;  3D2P A;  3TFY A;  2ZW5 A;  2PDO A;  2FCK A;  4UWJ A;  4YRH A;  1LRZ A;  2P6G A;  1I12 A;  3S6K A;  4R3L A;  3VWD A;  4AB7 A;  2H5M A;  1S7N A;  1S3Z A;  5ISV A;  1IID A;  2Z3N A;  2R7H A;  2C27 A;  5AG4 A;  3W6X A;  1NSL A;  3H5Z A;  4QUS A;  4KVO E;  4FD6 A;  2G3T A;  4AVC A;  4A32 A;  3I9S A;  2QML A;  5F46 A;  1GHE A;  4B14 A;  4OAD A;  4KS9 A;  4MFL A;  2Q0Y A;  3LD2 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...