3CXPA

Crystal structure of human glucosamine 6-phosphate n-acetyltransferase 1 mutant e156a
Total Genus 43
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
43
sequence length
184
structure length
184
Chain Sequence
b'MKPDETPMFDPSLLKEVDWSQNTATFSPAISPTHPGEGLVLRPLCTADLNRGFFKVLGQLTETGVVSPEQFMKSFEHMKKSGDYYVTVVEDVTLGQIVATATLIIEHKFIHSCAKRGRVEDVVVSDECRGKQLGKLLLSTLTLLSKKLNCYKITLACLPQNVGFYKKFGYTVSEENYMCRRFLK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Glucosamine 6-phosphate N-acetyltransferase
publication title Acceptor substrate binding revealed by crystal structure of human glucosamine-6-phosphate N-acetyltransferase 1
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
total genus 43
structure length 184
sequence length 184
ec nomenclature ec 2.3.1.4: Glucosamine-phosphate N-acetyltransferase.
pdb deposition date 2008-04-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00583 Acetyltransf_1 Acetyltransferase (GNAT) family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.630.30 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Aminopeptidase 3cxpA01
4KVOE 4NEXA 3DR6A 3FIXA 4KOYA 2X7BA 2FCKA 2VZZA 5EC4A 2B3VA 4H89A 1IYLA 4RS2A 4OAEA 4L89A 3TCVA 1NE9A 3DNSA 4KUBA 1BOBA 1Z4EA 2HQYA 1IB1E 2VQYA 3TO9A 1I1DA 5KTCA 3TO6A 4IF5A 4CAWA 1IYKA 1YX0A 4KOVA 5H84A 3P2HA 4E8OA 3B8GA 3BLNA 4CRZB 4KOXA 2ZW5A 1KUYA 5IV0A 3LODA 1OZPA 4HNWB 5F49A 2OB0A 1R57A 4U9YA 3TOAA 4PK2A 4CAVA 1VHSA 1Q2DA 3JVNA 4XNHB 2F5IA 5KTAA 1YREA 2JDDA 3FXTA 3EO4A 5C88A 4UA3A 4F6AA 3W6SA 3EFAA 5E96A 4IUSA 2FSRA 1SQHA 5CNPA 1YLEA 1M4GA 1QSRA 5I0CA 3OWCA 3W91A 4CS0B 2O28A 3FRMA 1Y7RA 3DSBA 2CNTA 2R98A 5IX3A 4R57A 2AJ6A 4U9ZA 1WWZA 1QSTA 2K5TA 3RYOA 4U5YA 4PSWA 1S60A 2ZW6A 4JJXA 3F0AA 4AVAA 3EY5A 2Q0YA 2P0WA 4X5KA 2G0BA 4CRYB 1KUXA 2DXQA 2R1IA 4XPDC 4AB7A 4PV6A 4MHDA 2FT0A 3R9EA 1LRZA 2Q4YA 1PU9A 1L0CA 1Y9KA 2IL4A 2I00A 4H6UA 2FE7A 5J8FA 3S6HA 4KOTA 2AE6A 2B5GB 3TO7A 4YFJA 1I21A 4UWJA 4FD5A 4K30A 2FL4A 2PRBA 4E0AA 2C27A 1YVKA 1FY7A 2B4DA 3CXPA 2BL1A 3KKWA 4KOSA 3FNCA 3SXOA 1UFHA 5H86A 1U6MA 2OH1A 2JLMA 3SHPA 4DNCA 2OZUA 1K4JA 4KUAA 1M44A 1QSNA 2REFA 2Z11A 1KZFA 1B87A 4F0YA 2WPWA 4NXYA 2QIRA 1S7NA 4AG7A 2R8VA 2PR8A 4JLYA 4ONUA 1NMTA 2VZYA 2Z0ZA 3EC4A 4B5OA 3E0KA 4KOWA 2QMLA 2Y0MA 3I3GA 2B4BA 1Q2CA 2FIWA 3P2FA 3IWGA 2VEZA 3QAHA 1BO4A 1MK4A 4PSXA 2Q7BA 1M4IA 3TT2A 4QUSA 3EXNA 2G3TA 2VBQA 1QSOA 1XMTA 3GYAA 1YR0A 5DWMA 4B5PA 1YVOA 2PR1A 2VXKA 3D2MA 4L8AA 2WPXA 2P6EA 2CNSA 1MJAA 4ORFA 5GCNA 4KZTA 4I49A 1MJ9A 4HKFA 4II9A 2QECA 5DWNA 4AVBA 4NCZA 3FYNA 4NSQA 2P6GA 4M3SA 2ZW7A 1IICA 4R87A 1NSLA 3QB8A 2D4OA 4XPLA 3T9YA 2Q4VA 3WR7A 4MJ8A 3MGDA 1Y9WA 4OLLA 3G8WA 1V0CA 1XE4A 2CNMA 4GS4A 3G3SA 4XPDB 5C82A 4OADA 2Q44A 1XEBA 4KLWA 4PK3A 5JPHA 1RXTA 4MI4A 2OZGA 3T90A 4LX9A 4EVYA 4RI1A 5F46A 3VWEA 4YRHA 2B58A 1J4JA 3PZJA 2OU2A 4UBRA 3ZJ0A 1QSMA 3DR8A 3C26A 2JDCA 3H4QA 4FD7A 3PGPA 4HNXB 3ZZIA 1Z9UA 4R9MA 3TE4A 4BMHA 4QB9A 5HH1A 4H6ZA 3FB3A 3SXNA 4XPKA 3I9SA 4Y49B 5F48A 3TTHA 4JD6A 4Y49C 1Z4RA 3R96A 2ATRA 2ZXVA 3TOBA 2P6FA 3PP9A 1S7FA 1MJBA 2PSWA 1XIXA 3CXQA 4M85A 2RC4A 4CAXA 2PC1A 4JXRA 4MY3A 1IIDA 4J3GA 4B5PB 1Q2YA 2FS5A 2B3UA 2PDOA 1S7LA 4ZBGA 4KOUA 1M4DA 1B6BA 2EVNA 4JWPA 2A4NA 3NE7A 4QC6A 2J8MA 1VKCA 4KVME 2EUIA 3R95A 3K9UA 3TFYA 3D8PA 2REEA 5IB0A 1S7KA 3GKRA 5HMNA 4KORA 2Q04A 3D3SA 3VWDA 3R1KA 5JQ4A 2GIVA 4AVCA 1YGHA 2GE3A 1TIQA 2H5MA 2J8NA 3IGRA 3D2PA 3S6GA 4XNHC 2ZPAA 4MBUA 3S6KA 3W6XA 3BJ7A 1XF8A 2D4PA 1GHEA 2NMTA 5FVJA 4E2AA 2FXFA 3S6FA 2ARHA 4R3LA 2I79A 2FIAA 4QVTA 1CJWA 4YGOA 2ZW4A 5ISVA 1N71A 1S5KA 4LUAA 5J8CA 4HNYB 3V8IA 3DDDA 2J8RA 1P0HA 2B4DB 1YK3A 1CM0A 3FBUA 2PQ8A 4R3KA 3F8KA 2R7HA 2JEVA 5EBVA 2KCWA 3JUWA 2Z10A 3R9GA 4KLVA 3GY9A 1P4NA 2HUZA 3UY5A 2BEIA 4FD4A 2VI7A 5KTDA 3R9FA 4FD6A 4JXQA 4QBJA 1RO5A 1KUVA 3N7ZA 5F47A 4UWIA 2BSWA 4AG9A 2G3AA 2BUEA 2OZHA 4MY0A 4KVXA 4NF1A 2B5GA 3CXSA 2CY2A 2HV2A 1M1DA 1PUAA 1S3ZA 1WK4A 3LD2A 3F5BA 2GANA 3BJ8A 1ON0A 1I12A
chains in the Genus database with same CATH superfamily
4KVOE 4BD9A 1YMEA 4NEXA 3DR6A 5G21A 7CPAA 3B3CA 3FIXA 4KOYA 2X7BA 2HB6A 2ZEEA 2CTCA 2FCKA 2VZZA 5EC4A 3D66A 2B3VA 1YW4A 4H89A 1IYLA 1FT7A 2QVPA 4MHZA 3FEEA 2XEJA 4L89A 4NJRA 4OAEA 3TCVA 4A94A 1NE9A 2AFOA 3DNSA 2FVGA 5LRGA 1KWMA 4KUBA 3WT4A 3VATA 1BOBA 3RAMA 1Z4EA 1TKJA 2HQYA 4JZ0A 4OC5A 3PB7X 1Q7LA 1IB1E 2VQYA 3TO9A 4DYOA 5LRKA 1I1DA 2PIYA 3D7DA 3IO1A 1YQEA 4R7MA 4X8IA 2Z3NA 3D7GA 4FUUA 2YNEA 3SJEA 4CGOA 2G9DA 5AG4A 3TO6A 1CP6A 5KTCA 5G22A 4IF5A 4NGSA 4CAWA 1IYKA 2V8GA 3H8EA 3PB8X 1YX0A 1IY7A 2RB7A 4KOVA 4ONWA 2ZEOA 5H84A 5D29A 3P2HA 2Q4ZA 4E8OA 3B8GA 2ABZA 1XRYA 2ZELA 3BLNA 4CRZB 4KOXA 2ZW5A 3PFEA 1KUYA 4MCQA 4UEFA 4ZY2A 3LODA 1OZPA 4HNWB 4LQGA 5D8NA 5IV0A 1HDQA 3LACA 5F49A 2OB0A 5JGFA 1R57A 4U9YA 2BO9A 3TOAA 2GREA 4MFJA 4PK2A 4CAVA 1VHSA 1Q2DA 3V38A 3JVNA 3IFEA 4XNHB 2OR4A 2F5IA 4X3RA 2Z3LA 3RZAA 2F8HA 5KTAA 1YREA 2JDDA 4PXCA 3FXTA 3EO4A 5C88A 4UA3A 4UEZA 5AG6A 3EFAA 3W6SA 4A37A 4F6AA 5E96A 4IUSA 2FSRA 2IJZA 2Z3MA 3BXMA 1SQHA 4MFPA 4NFRA 1CP7A 1YLEA 1M4GA 4R6TA 5CNPA 1QSRA 2F7VA 5I0CA 1AYEA 2J9AA 2EO8A 3OWCA 4OIWA 3W91A 1PYTB 4A38A 4KSIA 4CS0B 2O28A 4ZY1A 3FRMA 1Y7RA 1AUGA 3DSBA 3PBEA 4M6GA 2CNTA 2R98A 2DPSA 2ODFA 5IX3A 4IK2A 2Q43A 4R57A 2AJ6A 1R3NA 4U9ZA 1WWZA 1QSTA 2AFMA 2K5TA 2V8DA 3RYOA 4U5YA 3PB6X 2XEFA 3DGVA 4OC2A 4PSWA 4EWTA 1S60A 2EWBA 2ZW6A 1ELLP 4JJXA 4MCPA 3F0AA 3NH4A 4AVAA 3D7HA 3EY5A 3B3WA 4LQ6A 1XBUA 2ZENA 2Q0YA 2P0WA 3D67A 4X5KA 3SJFA 2G0BA 2PE3A 1XOVA 4CRYB 1KUXA 1YSJA 2DXQA 4OC3A 2R1IA 4XPDC 3PRTA 4M6IA 4AB7A 4PV6A 4MHDA 4UF4A 2FT0A 1CBXA 4K3NA 3B3SA 4ZX8A 3R9EA 1Z8XA 4F0XA 1LRZA 2Q4YA 5HVFA 1I12A 1PU9A 1L0CA 1Y9KA 4Q38A 3KHZA 2IL4A 3PBBA 2I00A 2ZEGA 4H6UA 2FE7A 5J8FA 3S6HA 5LYIA 4B6ZA 4KOTA 2AE6A 2B5GB 4MFKA 2O4HA 3TO7A 4YFJA 1I21A 4UWJA 3KQZA 4FD5A 4K30A 2FL4A 2RFHA 2ZOFA 2PRBA 4E0AA 2C27A 1YVKA 1FY7A 2PJBA 3H8FA 4PXEA 5K8MA 2B4DA 2C6PA 3CXPA 3FVLA 2BL1A 2XEIA 3KKWA 4KOSA 4CGLA 5HVHA 3FNCA 3SXOA 4ZY0A 1UFHA 3KGQA 5H86A 3MN8A 4MHPA 3KHXA 3S9MA 1U6MA 4B11A 4B14A 2OH1A 3CT9A 2JLMA 3SHPA 4A31A 4DNCA 2OZUA 2XEGA 1K4JA 4KUAA 1M44A 1QSNA 2REFA 2YNDA 4A33A 2Z11A 1KZFA 1VHOA 1YW6A 1B87A 4C7HA 2NSMA 4OC1A 4P44A 4F0YA 3NA6A 4Z65A 2PJ3A 2Q51A 2WPWA 4NXYA 3IJ3A 2QIRA 1S7NA 4AG7A 2AFUA 2Z3OA 2R8VA 4OKOA 2PR8A 4JLYA 4ONUA 3L2NA 2PCUA 3IWEA 1NMTA 4FWUA 2VZYA 4PPZA 2Z0ZA 3EC4A 1RTQA 4B5OA 3E0KA 4KOWA 5LRJA 2QMLA 2Y0MA 3I3GA 3MRUA 3WC5A 4CYOA 2B4BA 4TWEA 1Q2CA 2FIWA 2PJ7A 3P2FA 3IWGA 2VEZA 4KSAA 1CPSA 3QAHA 4B13A 3IU2A 5I4MA 5LYLA 1LAPA 1BO4A 5G1ZA 1MK4A 4PSXA 2Q7BA 1M4IA 5A28A 3TT2A 4QUSA 3EXNA 2G3TA 3FEDA 2VBQA 2V8HA 4R76A 1QSOA 1XMTA 3GYAA 1IGBA 4PQAA 3FMCA 3ISXA 2ZEDA 3CPAA 1AMPA 4MFQA 2C6CA 1YR0A 1DTDA 3D7FA 5DWMA 4B5PA 3H5ZA 3SJXA 1YVOA 4MFLA 4CGMA 2PR1A 2VXKA 3D2MA 4FAIA 2GU2A 4L8AA 2WPXA 4IAVA 1F2OA 2P6EA 2CNSA 2PJ6A 4TNUA 5DS0A 1MJAA 4ORFA 2DPTA 4DUKA 5GCNA 4CGPA 4KZTA 5JM6A 4I49A 1MJ9A 4HKFA 4CGNA 5AGEA 5LYDA 2PJAA 8CPAA 5HXDA 3S9NA 4II9A 3CPXA 2PJCA 3RBUA 4OC0A 1DE4C 1ZG9A 2QECA 4M6HA 4A32A 5DWNA 4AVBA 3NE8A 3FYNA 3H8GA 4NCZA 2P6GA 4NSQA 4M3SA 3FX6A 2ZW7A 1R43A 2PJ0A 1IICA 3JRUA 4CYQA 4P45A 4R87A 2BCOA 1NSLA 2DEAA 4JYWA 1HEEA 3QB8A 4YWYA 3TX8A 2D4OA 1X12A 4XPLA 3T9YA 4C2YA 2Q4VA 3SI1A 1TKHA 1Y0RA 4NGTA 3WR7A 4MJ8A 4CPAA 3HLPA 3MGDA 4MCSA 1Y9WA 1JQGA 2VL1A 4OLLA 1QQ9A 3G8WA 1V0CA 1XE4A 1BPMA 4B12A 2CNMA 1IOFA 4GS4A 2Z3PA 4AXVA 3IU1A 3G3SA 3RO0A 4XPDB 5CBMA 5C82A 4HPSA 1HDUA 3WABA 1YLOA 4A30A 4OADA 2Q44A 4MMOA 1XEBA 4KLWA 3TC8A 2C1CA 4PK3A 4ZYQA 5JPHA 1RXTA 2ANPA 4MI4A 1VIXA 3PB4X 4KSFA 4WWVA 1CPXA 5THWA 2OZGA 3FJUA 3SJGA 1Z5RA 3PEIA 3T90A 2GLJA 2CIJA 4LX9A 4EVYA 4RI1A 5F46A 3FH4A 3VWEA 4YRHA 4NGRA 4MFZA 1Z8WA 3WC6A 4MRIA 2B58A 4X2TA 1VHEA 2AFXA 1J4JA 3PZJA 4F9VA 3LWUA 1LANA 2OU2A 4UBRA 1LOKA 3PB9X 3ZJ0A 1QSMA 1CG2A 2NYQA 4ZGYB 4H2KA 3DR8A 2C6GA 3C26A 2PJ2A 2JDCA 4WJBA 3H4QA 4UFXA 4FD7A 3PGPA 5F09A 4HNXB 4A95A 2I3CA 4A2ZA 3ZZIA 1Z9UA 2IQ6A 4R9MA 2YNCA 2ZEFA 2PIZA 3TE4A 1ZG7A 2EBJA 4BMHA 4NJQA 4QB9A 5HH1A 1H8LA 4H6ZA 4C2ZA 3FB3A 3SXNA 4XPKA 3KR5A 4C68A 4MHNA 2CF4A 5A27A 4A39A 4UFVA 1TKFA 3I9SA 2BOAA 4Y49B 5F48A 4P4FA 3TTHA 4JD6A 1IOIA 4Y49C 3N5FA 3BI0A 2ZEHA 1Z4RA 3R96A 3QNVA 3A9LA 2ATRA 2ZXVA 4RUHA 3TOBA 2P6FA 2PJ8A 1PCAA 2WZNA 2V8VA 3PP9A 4RN7A 1S7FA 2V77A 5K8PA 3HUVA 1MJBA 2PSWA 1XIXA 3CXQA 4M85A 2PJ4A 4NGPA 5K8OA 1Z8LA 1ARLA 2RC4A 3SI0A 3B7IA 3IIBA 4CAXA 2PC1A 4OP4A 2PJ1A 4JXRA 4MY3A 6CPAA 1IIDA 4ZX9A 4J3GA 4B5PB 1Q2YA 5G20A 2FS5A 4NGNA 3NFZA 1EE3P 3B3VA 3QAYA 3IWWA 2JEWA 2B3UA 1ZLIA 4CYNA 2PDOA 4ZBGA 4KOUA 4YU9A 4B10A 1M4DA 5LYFA 2IMOA 3B35A 1B6BA 2EVNA 4JWPA 2A4NA 1Z8TA 4EMEA 3NE7A 4QC6A 2J8MA 3GB0A 2O53A 2GLFA 1VKCA 3FF3A 1LCPA 3D4UA 3NH5A 4KVME 5AG7A 2EUIA 1ARMA 3R95A 3RNZA 3K9UA 3TFYA 5K8NA 4F8ZA 3D8PA 1JWQA 1BLLE 2QYVA 4IHMA 2REEA 2ZOGA 3GUXA 3KZWA 3LMSA 2WUUA 3KASA 3NH8A 3B3TA 5IB0A 1S7KA 3GKRA 5HMNA 4KORA 5HVGA 2PJ9A 3CDXA 5IB9A 2Q04A 3D3SA 3WC7A 3VWDA 3R1KA 5JQ4A 2GIVA 3SI2A 4EFDA 3JTKA 4AVCA 4UIBA 2Q7SA 1NSAA 1YGHA 2GE3A 4OIDA 1TIQA 4FBEA 2H5MA 1XFOA 5CPAA 2J8NA 3CZXA 2PRQA 3IGRA 3D2PA 3S6GA 4XNHC 2ZPAA 1LFWA 2OOTA 4DJLA 4MBUA 3BI1A 5BWAB 3KR4A 4P4EA 1TF8A 4P4IA 3S6KA 4UFWA 3W6XA 3BJ7A 1Y0YA 1LAMA 1XF8A 2D4PA 2HC9A 4P10A 4F9UA 1GHEA 4UEEA 5AG5A 3V7ZA 3IEHA 3I1UA 2NMTA 4ZI6A 2CXAA 4MXUA 5FVJA 4E2AA 1Z2LA 4G1PA 2PVVA 1ZG8A 2FXFA 2Z3KA 3D68A 1VGYA 2ARHA 2I79A 3K2KA 2FIAA 4QVTA 4R3LA 3S6FA 2YGWA 1ZLHA 3PFOA 1CJWA 4YGOA 2ZW4A 5ISVA 1N71A 3DLJA 1S5KA 1QMUA 2EK9A 3GIUA 4PXBA 4Q36A 4LUAA 3KL9A 4NGMA 5J8CA 4P4JA 2GFQA 4HNYB 4BBHA 3V8IA 3DDDA 2J8RA 1P0HA 2B4DB 4GXHA 1YK3A 3KQXA 1CM0A 4Q7AA 4BINA 3FBUA 2PQ8A 4CAEA 4R3KA 3F8KA 5JH9A 1F2PA 2JBJA 2AFSA 2R7HA 2JEVA 5EBVA 2YNCC 3B2YA 2KCWA 4OMEA 3JUWA 4P6YA 4OC4A 2Z10A 3R9GA 5EMIA 1TXRA 1BAVA 1IU8A 4KLVA 3GY9A 1P4NA 1X10A 3IC1A 3FECA 2HUZA 2ZEPA 3UY5A 2BEIA 4FD4A 2VI7A 2WSAA 5KTDA 4C7IA 4NGQA 4UCMA 3R9FA 3T8WA 4FD6A 4P4DA 4UIAA 2POKA 3BHXA 4JXQA 4QBJA 1RO5A 1KUVA 3KI9A 4KS9A 4UCNA 2DF5A 2PVWA 3N7ZA 3VARA 2AFZA 4C2XA 3S9LA 3K9TA 5F47A 4CAFA 1ELMP 4R8FA 1XJOA 4UWIA 1ZO0A 2BSWA 4W9YA 1OBRA 1A2ZA 4AG9A 2G3AA 2AFWA 4P4BA 3ISZA 4RS2A 4MCRA 2BUEA 2OZHA 1CX8A 3VH9A 4GM5A 2PJ5A 4MY0A 4CYPA 4PXDA 2QJ8A 1GYTA 4KVXA 4NF1A 4UCPA 1F57A 2WYRA 1UWYA 1M4LA 2B5GA 1FNOA 1Y7EA 1TF9A 2EK8A 2JBKA 2HV2A 2CY2A 1M1DA 2CTBA 1PUAA 3CXSA 1S3ZA 1WK4A 3LD2A 4MHYA 3F5BA 5ELYA 5J1QA 2GANA 3GLJA 3BJ8A 4O23A 1ON0A 1XMBA 1S7LA 2ZEMA 1BPNA
chains in the Genus database with same CATH topology
4KVOE 4NEXA 3DR6A 5G21A 3FIXA 4KOYA 2X7BA 2FCKA 2VZZA 5EC4A 2B3VA 4H89A 1IYLA 4RS2A 4OAEA 4L89A 3TCVA 1NE9A 3DNSA 4KUBA 1BOBA 1Z4EA 2HQYA 1IB1E 2VQYA 3TO9A 1I1DA 2Z3NA 5KTCA 2YNEA 4CGOA 5AG4A 3TO6A 5G22A 4IF5A 4CAWA 1IYKA 1YX0A 4KOVA 5H84A 3P2HA 4E8OA 3B8GA 3BLNA 4CRZB 4KOXA 2ZW5A 1KUYA 5IV0A 4HNWB 1OZPA 3LODA 5F49A 2OB0A 1R57A 4U9YA 3TOAA 4MFJA 4PK2A 4CAVA 1VHSA 1Q2DA 3JVNA 4XNHB 2F5IA 2Z3LA 5KTAA 1YREA 2JDDA 3FXTA 3EO4A 5C88A 4UA3A 4F6AA 5AG6A 3EFAA 3W6SA 5E96A 4IUSA 2FSRA 2Z3MA 4MFPA 1SQHA 5CNPA 1YLEA 1M4GA 1QSRA 5I0CA 3OWCA 3W91A 4CS0B 2O28A 3FRMA 1Y7RA 3DSBA 2CNTA 2R98A 2DPSA 5IX3A 4R57A 2AJ6A 4U9ZA 1WWZA 1QSTA 2K5TA 3RYOA 4U5YA 4PSWA 1S60A 2ZW6A 4JJXA 3F0AA 4AVAA 3EY5A 2Q0YA 2P0WA 4X5KA 2G0BA 4CRYB 1KUXA 2DXQA 2R1IA 4XPDC 4AB7A 4PV6A 4MHDA 2FT0A 3R9EA 4F0XA 1LRZA 2Q4YA 1PU9A 1L0CA 1Y9KA 4Q38A 2IL4A 2I00A 4H6UA 2FE7A 5J8FA 3S6HA 4KOTA 2AE6A 2B5GB 4MFKA 3TO7A 4YFJA 1I21A 4UWJA 4FD5A 4K30A 2FL4A 2PRBA 4E0AA 2C27A 1YVKA 1FY7A 2B4DA 3CXPA 2BL1A 3KKWA 4KOSA 4CGLA 3FNCA 3SXOA 1UFHA 5H86A 1U6MA 4B11A 4B14A 2OH1A 2JLMA 3SHPA 4A31A 4DNCA 2OZUA 1K4JA 4KUAA 1M44A 1QSNA 2REFA 2YNDA 4A33A 2Z11A 1KZFA 1B87A 4C7HA 4F0YA 2WPWA 4NXYA 2QIRA 1S7NA 4AG7A 2Z3OA 2R8VA 2PR8A 4JLYA 4ONUA 3IWEA 1NMTA 2VZYA 2Z0ZA 3EC4A 4B5OA 3E0KA 4KOWA 2QMLA 2Y0MA 3I3GA 4CYOA 2B4BA 1Q2CA 2FIWA 3P2FA 3IWGA 2VEZA 4KSAA 4B13A 3QAHA 3IU2A 1BO4A 5G1ZA 1MK4A 4PSXA 2Q7BA 1M4IA 5A28A 3TT2A 4QUSA 3EXNA 2G3TA 2VBQA 1QSOA 1XMTA 3GYAA 4MFQA 1YR0A 5DWMA 4B5PA 3H5ZA 1YVOA 4MFLA 4CGMA 2PR1A 2VXKA 3D2MA 4L8AA 2WPXA 2P6EA 2CNSA 1MJAA 4ORFA 2DPTA 5GCNA 4CGPA 4KZTA 4I49A 1MJ9A 4HKFA 4CGNA 5AGEA 4II9A 2QECA 4A32A 5DWNA 4AVBA 4NCZA 3FYNA 4NSQA 2P6GA 4M3SA 2ZW7A 1IICA 4CYQA 4R87A 1NSLA 3QB8A 2D4OA 4XPLA 3T9YA 4C2YA 2Q4VA 3WR7A 4MJ8A 3MGDA 1Y9WA 4OLLA 3G8WA 1V0CA 1XE4A 4B12A 2CNMA 4GS4A 2Z3PA 3IU1A 3G3SA 4XPDB 5C82A 4A30A 4OADA 2Q44A 1XEBA 4KLWA 4PK3A 5JPHA 1RXTA 4MI4A 4KSFA 2OZGA 3T90A 4LX9A 4EVYA 4RI1A 5F46A 3VWEA 4YRHA 4MFZA 2B58A 1J4JA 3PZJA 2OU2A 4UBRA 3ZJ0A 1QSMA 4ZGYB 3DR8A 3C26A 2JDCA 3H4QA 4UFXA 4FD7A 3PGPA 4HNXB 4A95A 4A2ZA 3ZZIA 1Z9UA 4R9MA 2YNCA 3TE4A 4BMHA 4QB9A 5HH1A 4H6ZA 4C2ZA 3FB3A 3SXNA 4XPKA 4C68A 5A27A 4UFVA 3I9SA 4Y49B 5F48A 3TTHA 4JD6A 4Y49C 1Z4RA 3R96A 3A9LA 2ATRA 2ZXVA 3TOBA 2P6FA 3PP9A 1S7FA 1MJBA 2PSWA 1XIXA 3CXQA 4M85A 2RC4A 4CAXA 2PC1A 4JXRA 4MY3A 1IIDA 4J3GA 4B5PB 1Q2YA 5G20A 2FS5A 2B3UA 4CYNA 2PDOA 1S7LA 4ZBGA 4KOUA 4B10A 1M4DA 1B6BA 2EVNA 4JWPA 2A4NA 3NE7A 4QC6A 2J8MA 1VKCA 4KVME 5AG7A 2EUIA 3R95A 3K9UA 3TFYA 3D8PA 2REEA 2WUUA 5IB0A 1S7KA 3GKRA 5HMNA 4KORA 2Q04A 3D3SA 3VWDA 3R1KA 5JQ4A 2GIVA 3JTKA 4AVCA 1YGHA 2GE3A 1TIQA 2H5MA 2J8NA 3IGRA 3D2PA 3S6GA 4XNHC 2ZPAA 4MBUA 5BWAB 3S6KA 4UFWA 3W6XA 3BJ7A 1XF8A 2D4PA 1GHEA 5AG5A 2NMTA 2CXAA 5FVJA 4E2AA 2FXFA 2Z3KA 3S6FA 2ARHA 4R3LA 2I79A 2FIAA 4QVTA 2YGWA 1CJWA 4YGOA 2ZW4A 5ISVA 1N71A 1S5KA 4Q36A 4LUAA 5J8CA 4BBHA 4HNYB 3V8IA 3DDDA 2J8RA 1P0HA 2B4DB 1YK3A 1CM0A 3FBUA 2PQ8A 4CAEA 4R3KA 3F8KA 2R7HA 2JEVA 5EBVA 2YNCC 2KCWA 3JUWA 2Z10A 3R9GA 4KLVA 3GY9A 1P4NA 2HUZA 3UY5A 2BEIA 4FD4A 2VI7A 2WSAA 5KTDA 4C7IA 4UCMA 3R9FA 4FD6A 4JXQA 4QBJA 1RO5A 1KUVA 4KS9A 4UCNA 3N7ZA 4C2XA 5F47A 4CAFA 4UWIA 1ZO0A 2BSWA 4AG9A 2G3AA 2BUEA 2OZHA 4MY0A 4CYPA 4KVXA 4NF1A 4UCPA 2B5GA 3CXSA 2CY2A 2HV2A 1M1DA 1PUAA 1S3ZA 1WK4A 3LD2A 3F5BA 2GANA 3BJ8A 1ON0A 1I12A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4KVO E;  4NEX A;  3DR6 A;  3FIX A;  4KOY A;  2X7B A;  2FCK A;  2VZZ A;  5EC4 A;  2B3V A;  4H89 A;  1IYL A;  4RS2 A;  4OAE A;  4L89 A;  3TCV A;  1NE9 A;  3DNS A;  4KUB A;  1BOB A;  1Z4E A;  2HQY A;  1IB1 E;  2VQY A;  3TO9 A;  1I1D A;  5KTC A;  3TO6 A;  4IF5 A;  4CAW A;  1IYK A;  1YX0 A;  4KOV A;  5H84 A;  3P2H A;  4E8O A;  3B8G A;  3BLN A;  4CRZ B;  4KOX A;  2ZW5 A;  1KUY A;  5IV0 A;  3LOD A;  1OZP A;  4HNW B;  5F49 A;  2OB0 A;  1R57 A;  4U9Y A;  3TOA A;  4PK2 A;  4CAV A;  1VHS A;  1Q2D A;  3JVN A;  4XNH B;  2F5I A;  5KTA A;  1YRE A;  2JDD A;  3FXT A;  3EO4 A;  5C88 A;  4UA3 A;  4F6A A;  3W6S A;  3EFA A;  5E96 A;  4IUS A;  2FSR A;  1SQH A;  5CNP A;  1YLE A;  1M4G A;  1QSR A;  5I0C A;  3OWC A;  3W91 A;  4CS0 B;  2O28 A;  3FRM A;  1Y7R A;  3DSB A;  2CNT A;  2R98 A;  5IX3 A;  4R57 A;  2AJ6 A;  4U9Z A;  1WWZ A;  1QST A;  2K5T A;  3RYO A;  4U5Y A;  4PSW A;  1S60 A;  2ZW6 A;  4JJX A;  3F0A A;  4AVA A;  3EY5 A;  2Q0Y A;  2P0W A;  4X5K A;  2G0B A;  4CRY B;  1KUX A;  2DXQ A;  2R1I A;  4XPD C;  4AB7 A;  4PV6 A;  4MHD A;  2FT0 A;  3R9E A;  1LRZ A;  2Q4Y A;  1PU9 A;  1L0C A;  1Y9K A;  2IL4 A;  2I00 A;  4H6U A;  2FE7 A;  5J8F A;  3S6H A;  4KOT A;  2AE6 A;  2B5G B;  3TO7 A;  4YFJ A;  1I21 A;  4UWJ A;  4FD5 A;  4K30 A;  2FL4 A;  2PRB A;  4E0A A;  2C27 A;  1YVK A;  1FY7 A;  2B4D A;  3CXP A;  2BL1 A;  3KKW A;  4KOS A;  3FNC A;  3SXO A;  1UFH A;  5H86 A;  1U6M A;  2OH1 A;  2JLM A;  3SHP A;  4DNC A;  2OZU A;  1K4J A;  4KUA A;  1M44 A;  1QSN A;  2REF A;  2Z11 A;  1KZF A;  1B87 A;  4F0Y A;  2WPW A;  4NXY A;  2QIR A;  1S7N A;  4AG7 A;  2R8V A;  2PR8 A;  4JLY A;  4ONU A;  1NMT A;  2VZY A;  2Z0Z A;  3EC4 A;  4B5O A;  3E0K A;  4KOW A;  2QML A;  2Y0M A;  3I3G A;  2B4B A;  1Q2C A;  2FIW A;  3P2F A;  3IWG A;  2VEZ A;  3QAH A;  1BO4 A;  1MK4 A;  4PSX A;  2Q7B A;  1M4I A;  3TT2 A;  4QUS A;  3EXN A;  2G3T A;  2VBQ A;  1QSO A;  1XMT A;  3GYA A;  1YR0 A;  5DWM A;  4B5P A;  1YVO A;  2PR1 A;  2VXK A;  3D2M A;  4L8A A;  2WPX A;  2P6E A;  2CNS A;  1MJA A;  4ORF A;  5GCN A;  4KZT A;  4I49 A;  1MJ9 A;  4HKF A;  4II9 A;  2QEC A;  5DWN A;  4AVB A;  4NCZ A;  3FYN A;  4NSQ A;  2P6G A;  4M3S A;  2ZW7 A;  1IIC A;  4R87 A;  1NSL A;  3QB8 A;  2D4O A;  4XPL A;  3T9Y A;  2Q4V A;  3WR7 A;  4MJ8 A;  3MGD A;  1Y9W A;  4OLL A;  3G8W A;  1V0C A;  1XE4 A;  2CNM A;  4GS4 A;  3G3S A;  4XPD B;  5C82 A;  4OAD A;  2Q44 A;  1XEB A;  4KLW A;  4PK3 A;  5JPH A;  1RXT A;  4MI4 A;  2OZG A;  3T90 A;  4LX9 A;  4EVY A;  4RI1 A;  5F46 A;  3VWE A;  4YRH A;  2B58 A;  1J4J A;  3PZJ A;  2OU2 A;  4UBR A;  3ZJ0 A;  1QSM A;  3DR8 A;  3C26 A;  2JDC A;  3H4Q A;  4FD7 A;  3PGP A;  4HNX B;  3ZZI A;  1Z9U A;  4R9M A;  3TE4 A;  4BMH A;  4QB9 A;  5HH1 A;  4H6Z A;  3FB3 A;  3SXN A;  4XPK A;  3I9S A;  4Y49 B;  5F48 A;  3TTH A;  4JD6 A;  4Y49 C;  1Z4R A;  3R96 A;  2ATR A;  2ZXV A;  3TOB A;  2P6F A;  3PP9 A;  1S7F A;  1MJB A;  2PSW A;  1XIX A;  3CXQ A;  4M85 A;  2RC4 A;  4CAX A;  2PC1 A;  4JXR A;  4MY3 A;  1IID A;  4J3G A;  4B5P B;  1Q2Y A;  2FS5 A;  2B3U A;  2PDO A;  1S7L A;  4ZBG A;  4KOU A;  1M4D A;  1B6B A;  2EVN A;  4JWP A;  2A4N A;  3NE7 A;  4QC6 A;  2J8M A;  1VKC A;  4KVM E;  2EUI A;  3R95 A;  3K9U A;  3TFY A;  3D8P A;  2REE A;  5IB0 A;  1S7K A;  3GKR A;  5HMN A;  4KOR A;  2Q04 A;  3D3S A;  3VWD A;  3R1K A;  5JQ4 A;  2GIV A;  4AVC A;  1YGH A;  2GE3 A;  1TIQ A;  2H5M A;  2J8N A;  3IGR A;  3D2P A;  3S6G A;  4XNH C;  2ZPA A;  4MBU A;  3S6K A;  3W6X A;  3BJ7 A;  1XF8 A;  2D4P A;  1GHE A;  2NMT A;  5FVJ A;  4E2A A;  2FXF A;  3S6F A;  2ARH A;  4R3L A;  2I79 A;  2FIA A;  4QVT A;  1CJW A;  4YGO A;  2ZW4 A;  5ISV A;  1N71 A;  1S5K A;  4LUA A;  5J8C A;  4HNY B;  3V8I A;  3DDD A;  2J8R A;  1P0H A;  2B4D B;  1YK3 A;  1CM0 A;  3FBU A;  2PQ8 A;  4R3K A;  3F8K A;  2R7H A;  2JEV A;  5EBV A;  2KCW A;  3JUW A;  2Z10 A;  3R9G A;  4KLV A;  3GY9 A;  1P4N A;  2HUZ A;  3UY5 A;  2BEI A;  4FD4 A;  2VI7 A;  5KTD A;  3R9F A;  4FD6 A;  4JXQ A;  4QBJ A;  1RO5 A;  1KUV A;  3N7Z A;  5F47 A;  4UWI A;  2BSW A;  4AG9 A;  2G3A A;  2BUE A;  2OZH A;  4MY0 A;  4KVX A;  4NF1 A;  2B5G A;  3CXS A;  2CY2 A;  2HV2 A;  1M1D A;  1PUA A;  1S3Z A;  1WK4 A;  3LD2 A;  3F5B A;  2GAN A;  3BJ8 A;  1ON0 A;  1I12 A; 
#chains in the Genus database with same CATH topology
 4KVO E;  4BD9 A;  1YME A;  4NEX A;  3DR6 A;  5G21 A;  7CPA A;  3B3C A;  3FIX A;  4KOY A;  2X7B A;  2HB6 A;  2ZEE A;  2CTC A;  2FCK A;  2VZZ A;  5EC4 A;  3D66 A;  2B3V A;  1YW4 A;  4H89 A;  1IYL A;  1FT7 A;  2QVP A;  4MHZ A;  3FEE A;  2XEJ A;  4L89 A;  4NJR A;  4OAE A;  3TCV A;  4A94 A;  1NE9 A;  2AFO A;  3DNS A;  2FVG A;  5LRG A;  1KWM A;  4KUB A;  3WT4 A;  3VAT A;  1BOB A;  3RAM A;  1Z4E A;  1TKJ A;  2HQY A;  4JZ0 A;  4OC5 A;  3PB7 X;  1Q7L A;  1IB1 E;  2VQY A;  3TO9 A;  4DYO A;  5LRK A;  1I1D A;  2PIY A;  3D7D A;  3IO1 A;  1YQE A;  4R7M A;  4X8I A;  2Z3N A;  3D7G A;  4FUU A;  2YNE A;  3SJE A;  4CGO A;  2G9D A;  5AG4 A;  3TO6 A;  1CP6 A;  5KTC A;  5G22 A;  4IF5 A;  4NGS A;  4CAW A;  1IYK A;  2V8G A;  3H8E A;  3PB8 X;  1YX0 A;  1IY7 A;  2RB7 A;  4KOV A;  4ONW A;  2ZEO A;  5H84 A;  5D29 A;  3P2H A;  2Q4Z A;  4E8O A;  3B8G A;  2ABZ A;  1XRY A;  2ZEL A;  3BLN A;  4CRZ B;  4KOX A;  2ZW5 A;  3PFE A;  1KUY A;  4MCQ A;  4UEF A;  4ZY2 A;  3LOD A;  1OZP A;  4HNW B;  4LQG A;  5D8N A;  5IV0 A;  1HDQ A;  3LAC A;  5F49 A;  2OB0 A;  5JGF A;  1R57 A;  4U9Y A;  2BO9 A;  3TOA A;  2GRE A;  4MFJ A;  4PK2 A;  4CAV A;  1VHS A;  1Q2D A;  3V38 A;  3JVN A;  3IFE A;  4XNH B;  2OR4 A;  2F5I A;  4X3R A;  2Z3L A;  3RZA A;  2F8H A;  5KTA A;  1YRE A;  2JDD A;  4PXC A;  3FXT A;  3EO4 A;  5C88 A;  4UA3 A;  4UEZ A;  5AG6 A;  3EFA A;  3W6S A;  4A37 A;  4F6A A;  5E96 A;  4IUS A;  2FSR A;  2IJZ A;  2Z3M A;  3BXM A;  1SQH A;  4MFP A;  4NFR A;  1CP7 A;  1YLE A;  1M4G A;  4R6T A;  5CNP A;  1QSR A;  2F7V A;  5I0C A;  1AYE A;  2J9A A;  2EO8 A;  3OWC A;  4OIW A;  3W91 A;  1PYT B;  4A38 A;  4KSI A;  4CS0 B;  2O28 A;  4ZY1 A;  3FRM A;  1Y7R A;  1AUG A;  3DSB A;  3PBE A;  4M6G A;  2CNT A;  2R98 A;  2DPS A;  2ODF A;  5IX3 A;  4IK2 A;  2Q43 A;  4R57 A;  2AJ6 A;  1R3N A;  4U9Z A;  1WWZ A;  1QST A;  2AFM A;  2K5T A;  2V8D A;  3RYO A;  4U5Y A;  3PB6 X;  2XEF A;  3DGV A;  4OC2 A;  4PSW A;  4EWT A;  1S60 A;  2EWB A;  2ZW6 A;  1ELL P;  4JJX A;  4MCP A;  3F0A A;  3NH4 A;  4AVA A;  3D7H A;  3EY5 A;  3B3W A;  4LQ6 A;  1XBU A;  2ZEN A;  2Q0Y A;  2P0W A;  3D67 A;  4X5K A;  3SJF A;  2G0B A;  2PE3 A;  1XOV A;  4CRY B;  1KUX A;  1YSJ A;  2DXQ A;  4OC3 A;  2R1I A;  4XPD C;  3PRT A;  4M6I A;  4AB7 A;  4PV6 A;  4MHD A;  4UF4 A;  2FT0 A;  1CBX A;  4K3N A;  3B3S A;  4ZX8 A;  3R9E A;  1Z8X A;  4F0X A;  1LRZ A;  2Q4Y A;  5HVF A;  1I12 A;  1PU9 A;  1L0C A;  1Y9K A;  4Q38 A;  3KHZ A;  2IL4 A;  3PBB A;  2I00 A;  2ZEG A;  4H6U A;  2FE7 A;  5J8F A;  3S6H A;  5LYI A;  4B6Z A;  4KOT A;  2AE6 A;  2B5G B;  4MFK A;  2O4H A;  3TO7 A;  4YFJ A;  1I21 A;  4UWJ A;  3KQZ A;  4FD5 A;  4K30 A;  2FL4 A;  2RFH A;  2ZOF A;  2PRB A;  4E0A A;  2C27 A;  1YVK A;  1FY7 A;  2PJB A;  3H8F A;  4PXE A;  5K8M A;  2B4D A;  2C6P A;  3CXP A;  3FVL A;  2BL1 A;  2XEI A;  3KKW A;  4KOS A;  4CGL A;  5HVH A;  3FNC A;  3SXO A;  4ZY0 A;  1UFH A;  3KGQ A;  5H86 A;  3MN8 A;  4MHP A;  3KHX A;  3S9M A;  1U6M A;  4B11 A;  4B14 A;  2OH1 A;  3CT9 A;  2JLM A;  3SHP A;  4A31 A;  4DNC A;  2OZU A;  2XEG A;  1K4J A;  4KUA A;  1M44 A;  1QSN A;  2REF A;  2YND A;  4A33 A;  2Z11 A;  1KZF A;  1VHO A;  1YW6 A;  1B87 A;  4C7H A;  2NSM A;  4OC1 A;  4P44 A;  4F0Y A;  3NA6 A;  4Z65 A;  2PJ3 A;  2Q51 A;  2WPW A;  4NXY A;  3IJ3 A;  2QIR A;  1S7N A;  4AG7 A;  2AFU A;  2Z3O A;  2R8V A;  4OKO A;  2PR8 A;  4JLY A;  4ONU A;  3L2N A;  2PCU A;  3IWE A;  1NMT A;  4FWU A;  2VZY A;  4PPZ A;  2Z0Z A;  3EC4 A;  1RTQ A;  4B5O A;  3E0K A;  4KOW A;  5LRJ A;  2QML A;  2Y0M A;  3I3G A;  3MRU A;  3WC5 A;  4CYO A;  2B4B A;  4TWE A;  1Q2C A;  2FIW A;  2PJ7 A;  3P2F A;  3IWG A;  2VEZ A;  4KSA A;  1CPS A;  3QAH A;  4B13 A;  3IU2 A;  5I4M A;  5LYL A;  1LAP A;  1BO4 A;  5G1Z A;  1MK4 A;  4PSX A;  2Q7B A;  1M4I A;  5A28 A;  3TT2 A;  4QUS A;  3EXN A;  2G3T A;  3FED A;  2VBQ A;  2V8H A;  4R76 A;  1QSO A;  1XMT A;  3GYA A;  1IGB A;  4PQA A;  3FMC A;  3ISX A;  2ZED A;  3CPA A;  1AMP A;  4MFQ A;  2C6C A;  1YR0 A;  1DTD A;  3D7F A;  5DWM A;  4B5P A;  3H5Z A;  3SJX A;  1YVO A;  4MFL A;  4CGM A;  2PR1 A;  2VXK A;  3D2M A;  4FAI A;  2GU2 A;  4L8A A;  2WPX A;  4IAV A;  1F2O A;  2P6E A;  2CNS A;  2PJ6 A;  4TNU A;  5DS0 A;  1MJA A;  4ORF A;  2DPT A;  4DUK A;  5GCN A;  4CGP A;  4KZT A;  5JM6 A;  4I49 A;  1MJ9 A;  4HKF A;  4CGN A;  5AGE A;  5LYD A;  2PJA A;  8CPA A;  5HXD A;  3S9N A;  4II9 A;  3CPX A;  2PJC A;  3RBU A;  4OC0 A;  1DE4 C;  1ZG9 A;  2QEC A;  4M6H A;  4A32 A;  5DWN A;  4AVB A;  3NE8 A;  3FYN A;  3H8G A;  4NCZ A;  2P6G A;  4NSQ A;  4M3S A;  3FX6 A;  2ZW7 A;  1R43 A;  2PJ0 A;  1IIC A;  3JRU A;  4CYQ A;  4P45 A;  4R87 A;  2BCO A;  1NSL A;  2DEA A;  4JYW A;  1HEE A;  3QB8 A;  4YWY A;  3TX8 A;  2D4O A;  1X12 A;  4XPL A;  3T9Y A;  4C2Y A;  2Q4V A;  3SI1 A;  1TKH A;  1Y0R A;  4NGT A;  3WR7 A;  4MJ8 A;  4CPA A;  3HLP A;  3MGD A;  4MCS A;  1Y9W A;  1JQG A;  2VL1 A;  4OLL A;  1QQ9 A;  3G8W A;  1V0C A;  1XE4 A;  1BPM A;  4B12 A;  2CNM A;  1IOF A;  4GS4 A;  2Z3P A;  4AXV A;  3IU1 A;  3G3S A;  3RO0 A;  4XPD B;  5CBM A;  5C82 A;  4HPS A;  1HDU A;  3WAB A;  1YLO A;  4A30 A;  4OAD A;  2Q44 A;  4MMO A;  1XEB A;  4KLW A;  3TC8 A;  2C1C A;  4PK3 A;  4ZYQ A;  5JPH A;  1RXT A;  2ANP A;  4MI4 A;  1VIX A;  3PB4 X;  4KSF A;  4WWV A;  1CPX A;  5THW A;  2OZG A;  3FJU A;  3SJG A;  1Z5R A;  3PEI A;  3T90 A;  2GLJ A;  2CIJ A;  4LX9 A;  4EVY A;  4RI1 A;  5F46 A;  3FH4 A;  3VWE A;  4YRH A;  4NGR A;  4MFZ A;  1Z8W A;  3WC6 A;  4MRI A;  2B58 A;  4X2T A;  1VHE A;  2AFX A;  1J4J A;  3PZJ A;  4F9V A;  3LWU A;  1LAN A;  2OU2 A;  4UBR A;  1LOK A;  3PB9 X;  3ZJ0 A;  1QSM A;  1CG2 A;  2NYQ A;  4ZGY B;  4H2K A;  3DR8 A;  2C6G A;  3C26 A;  2PJ2 A;  2JDC A;  4WJB A;  3H4Q A;  4UFX A;  4FD7 A;  3PGP A;  5F09 A;  4HNX B;  4A95 A;  2I3C A;  4A2Z A;  3ZZI A;  1Z9U A;  2IQ6 A;  4R9M A;  2YNC A;  2ZEF A;  2PIZ A;  3TE4 A;  1ZG7 A;  2EBJ A;  4BMH A;  4NJQ A;  4QB9 A;  5HH1 A;  1H8L A;  4H6Z A;  4C2Z A;  3FB3 A;  3SXN A;  4XPK A;  3KR5 A;  4C68 A;  4MHN A;  2CF4 A;  5A27 A;  4A39 A;  4UFV A;  1TKF A;  3I9S A;  2BOA A;  4Y49 B;  5F48 A;  4P4F A;  3TTH A;  4JD6 A;  1IOI A;  4Y49 C;  3N5F A;  3BI0 A;  2ZEH A;  1Z4R A;  3R96 A;  3QNV A;  3A9L A;  2ATR A;  2ZXV A;  4RUH A;  3TOB A;  2P6F A;  2PJ8 A;  1PCA A;  2WZN A;  2V8V A;  3PP9 A;  4RN7 A;  1S7F A;  2V77 A;  5K8P A;  3HUV A;  1MJB A;  2PSW A;  1XIX A;  3CXQ A;  4M85 A;  2PJ4 A;  4NGP A;  5K8O A;  1Z8L A;  1ARL A;  2RC4 A;  3SI0 A;  3B7I A;  3IIB A;  4CAX A;  2PC1 A;  4OP4 A;  2PJ1 A;  4JXR A;  4MY3 A;  6CPA A;  1IID A;  4ZX9 A;  4J3G A;  4B5P B;  1Q2Y A;  5G20 A;  2FS5 A;  4NGN A;  3NFZ A;  1EE3 P;  3B3V A;  3QAY A;  3IWW A;  2JEW A;  2B3U A;  1ZLI A;  4CYN A;  2PDO A;  4ZBG A;  4KOU A;  4YU9 A;  4B10 A;  1M4D A;  5LYF A;  2IMO A;  3B35 A;  1B6B A;  2EVN A;  4JWP A;  2A4N A;  1Z8T A;  4EME A;  3NE7 A;  4QC6 A;  2J8M A;  3GB0 A;  2O53 A;  2GLF A;  1VKC A;  3FF3 A;  1LCP A;  3D4U A;  3NH5 A;  4KVM E;  5AG7 A;  2EUI A;  1ARM A;  3R95 A;  3RNZ A;  3K9U A;  3TFY A;  5K8N A;  4F8Z A;  3D8P A;  1JWQ A;  1BLL E;  2QYV A;  4IHM A;  2REE A;  2ZOG A;  3GUX A;  3KZW A;  3LMS A;  2WUU A;  3KAS A;  3NH8 A;  3B3T A;  5IB0 A;  1S7K A;  3GKR A;  5HMN A;  4KOR A;  5HVG A;  2PJ9 A;  3CDX A;  5IB9 A;  2Q04 A;  3D3S A;  3WC7 A;  3VWD A;  3R1K A;  5JQ4 A;  2GIV A;  3SI2 A;  4EFD A;  3JTK A;  4AVC A;  4UIB A;  2Q7S A;  1NSA A;  1YGH A;  2GE3 A;  4OID A;  1TIQ A;  4FBE A;  2H5M A;  1XFO A;  5CPA A;  2J8N A;  3CZX A;  2PRQ A;  3IGR A;  3D2P A;  3S6G A;  4XNH C;  2ZPA A;  1LFW A;  2OOT A;  4DJL A;  4MBU A;  3BI1 A;  5BWA B;  3KR4 A;  4P4E A;  1TF8 A;  4P4I A;  3S6K A;  4UFW A;  3W6X A;  3BJ7 A;  1Y0Y A;  1LAM A;  1XF8 A;  2D4P A;  2HC9 A;  4P10 A;  4F9U A;  1GHE A;  4UEE A;  5AG5 A;  3V7Z A;  3IEH A;  3I1U A;  2NMT A;  4ZI6 A;  2CXA A;  4MXU A;  5FVJ A;  4E2A A;  1Z2L A;  4G1P A;  2PVV A;  1ZG8 A;  2FXF A;  2Z3K A;  3D68 A;  1VGY A;  2ARH A;  2I79 A;  3K2K A;  2FIA A;  4QVT A;  4R3L A;  3S6F A;  2YGW A;  1ZLH A;  3PFO A;  1CJW A;  4YGO A;  2ZW4 A;  5ISV A;  1N71 A;  3DLJ A;  1S5K A;  1QMU A;  2EK9 A;  3GIU A;  4PXB A;  4Q36 A;  4LUA A;  3KL9 A;  4NGM A;  5J8C A;  4P4J A;  2GFQ A;  4HNY B;  4BBH A;  3V8I A;  3DDD A;  2J8R A;  1P0H A;  2B4D B;  4GXH A;  1YK3 A;  3KQX A;  1CM0 A;  4Q7A A;  4BIN A;  3FBU A;  2PQ8 A;  4CAE A;  4R3K A;  3F8K A;  5JH9 A;  1F2P A;  2JBJ A;  2AFS A;  2R7H A;  2JEV A;  5EBV A;  2YNC C;  3B2Y A;  2KCW A;  4OME A;  3JUW A;  4P6Y A;  4OC4 A;  2Z10 A;  3R9G A;  5EMI A;  1TXR A;  1BAV A;  1IU8 A;  4KLV A;  3GY9 A;  1P4N A;  1X10 A;  3IC1 A;  3FEC A;  2HUZ A;  2ZEP A;  3UY5 A;  2BEI A;  4FD4 A;  2VI7 A;  2WSA A;  5KTD A;  4C7I A;  4NGQ A;  4UCM A;  3R9F A;  3T8W A;  4FD6 A;  4P4D A;  4UIA A;  2POK A;  3BHX A;  4JXQ A;  4QBJ A;  1RO5 A;  1KUV A;  3KI9 A;  4KS9 A;  4UCN A;  2DF5 A;  2PVW A;  3N7Z A;  3VAR A;  2AFZ A;  4C2X A;  3S9L A;  3K9T A;  5F47 A;  4CAF A;  1ELM P;  4R8F A;  1XJO A;  4UWI A;  1ZO0 A;  2BSW A;  4W9Y A;  1OBR A;  1A2Z A;  4AG9 A;  2G3A A;  2AFW A;  4P4B A;  3ISZ A;  4RS2 A;  4MCR A;  2BUE A;  2OZH A;  1CX8 A;  3VH9 A;  4GM5 A;  2PJ5 A;  4MY0 A;  4CYP A;  4PXD A;  2QJ8 A;  1GYT A;  4KVX A;  4NF1 A;  4UCP A;  1F57 A;  2WYR A;  1UWY A;  1M4L A;  2B5G A;  1FNO A;  1Y7E A;  1TF9 A;  2EK8 A;  2JBK A;  2HV2 A;  2CY2 A;  1M1D A;  2CTB A;  1PUA A;  3CXS A;  1S3Z A;  1WK4 A;  3LD2 A;  4MHY A;  3F5B A;  5ELY A;  5J1Q A;  2GAN A;  3GLJ A;  3BJ8 A;  4O23 A;  1ON0 A;  1XMB A;  1S7L A;  2ZEM A;  1BPN A; 
#chains in the Genus database with same CATH homology
 4KVO E;  4NEX A;  3DR6 A;  5G21 A;  3FIX A;  4KOY A;  2X7B A;  2FCK A;  2VZZ A;  5EC4 A;  2B3V A;  4H89 A;  1IYL A;  4RS2 A;  4OAE A;  4L89 A;  3TCV A;  1NE9 A;  3DNS A;  4KUB A;  1BOB A;  1Z4E A;  2HQY A;  1IB1 E;  2VQY A;  3TO9 A;  1I1D A;  2Z3N A;  5KTC A;  2YNE A;  4CGO A;  5AG4 A;  3TO6 A;  5G22 A;  4IF5 A;  4CAW A;  1IYK A;  1YX0 A;  4KOV A;  5H84 A;  3P2H A;  4E8O A;  3B8G A;  3BLN A;  4CRZ B;  4KOX A;  2ZW5 A;  1KUY A;  5IV0 A;  4HNW B;  1OZP A;  3LOD A;  5F49 A;  2OB0 A;  1R57 A;  4U9Y A;  3TOA A;  4MFJ A;  4PK2 A;  4CAV A;  1VHS A;  1Q2D A;  3JVN A;  4XNH B;  2F5I A;  2Z3L A;  5KTA A;  1YRE A;  2JDD A;  3FXT A;  3EO4 A;  5C88 A;  4UA3 A;  4F6A A;  5AG6 A;  3EFA A;  3W6S A;  5E96 A;  4IUS A;  2FSR A;  2Z3M A;  4MFP A;  1SQH A;  5CNP A;  1YLE A;  1M4G A;  1QSR A;  5I0C A;  3OWC A;  3W91 A;  4CS0 B;  2O28 A;  3FRM A;  1Y7R A;  3DSB A;  2CNT A;  2R98 A;  2DPS A;  5IX3 A;  4R57 A;  2AJ6 A;  4U9Z A;  1WWZ A;  1QST A;  2K5T A;  3RYO A;  4U5Y A;  4PSW A;  1S60 A;  2ZW6 A;  4JJX A;  3F0A A;  4AVA A;  3EY5 A;  2Q0Y A;  2P0W A;  4X5K A;  2G0B A;  4CRY B;  1KUX A;  2DXQ A;  2R1I A;  4XPD C;  4AB7 A;  4PV6 A;  4MHD A;  2FT0 A;  3R9E A;  4F0X A;  1LRZ A;  2Q4Y A;  1PU9 A;  1L0C A;  1Y9K A;  4Q38 A;  2IL4 A;  2I00 A;  4H6U A;  2FE7 A;  5J8F A;  3S6H A;  4KOT A;  2AE6 A;  2B5G B;  4MFK A;  3TO7 A;  4YFJ A;  1I21 A;  4UWJ A;  4FD5 A;  4K30 A;  2FL4 A;  2PRB A;  4E0A A;  2C27 A;  1YVK A;  1FY7 A;  2B4D A;  3CXP A;  2BL1 A;  3KKW A;  4KOS A;  4CGL A;  3FNC A;  3SXO A;  1UFH A;  5H86 A;  1U6M A;  4B11 A;  4B14 A;  2OH1 A;  2JLM A;  3SHP A;  4A31 A;  4DNC A;  2OZU A;  1K4J A;  4KUA A;  1M44 A;  1QSN A;  2REF A;  2YND A;  4A33 A;  2Z11 A;  1KZF A;  1B87 A;  4C7H A;  4F0Y A;  2WPW A;  4NXY A;  2QIR A;  1S7N A;  4AG7 A;  2Z3O A;  2R8V A;  2PR8 A;  4JLY A;  4ONU A;  3IWE A;  1NMT A;  2VZY A;  2Z0Z A;  3EC4 A;  4B5O A;  3E0K A;  4KOW A;  2QML A;  2Y0M A;  3I3G A;  4CYO A;  2B4B A;  1Q2C A;  2FIW A;  3P2F A;  3IWG A;  2VEZ A;  4KSA A;  4B13 A;  3QAH A;  3IU2 A;  1BO4 A;  5G1Z A;  1MK4 A;  4PSX A;  2Q7B A;  1M4I A;  5A28 A;  3TT2 A;  4QUS A;  3EXN A;  2G3T A;  2VBQ A;  1QSO A;  1XMT A;  3GYA A;  4MFQ A;  1YR0 A;  5DWM A;  4B5P A;  3H5Z A;  1YVO A;  4MFL A;  4CGM A;  2PR1 A;  2VXK A;  3D2M A;  4L8A A;  2WPX A;  2P6E A;  2CNS A;  1MJA A;  4ORF A;  2DPT A;  5GCN A;  4CGP A;  4KZT A;  4I49 A;  1MJ9 A;  4HKF A;  4CGN A;  5AGE A;  4II9 A;  2QEC A;  4A32 A;  5DWN A;  4AVB A;  4NCZ A;  3FYN A;  4NSQ A;  2P6G A;  4M3S A;  2ZW7 A;  1IIC A;  4CYQ A;  4R87 A;  1NSL A;  3QB8 A;  2D4O A;  4XPL A;  3T9Y A;  4C2Y A;  2Q4V A;  3WR7 A;  4MJ8 A;  3MGD A;  1Y9W A;  4OLL A;  3G8W A;  1V0C A;  1XE4 A;  4B12 A;  2CNM A;  4GS4 A;  2Z3P A;  3IU1 A;  3G3S A;  4XPD B;  5C82 A;  4A30 A;  4OAD A;  2Q44 A;  1XEB A;  4KLW A;  4PK3 A;  5JPH A;  1RXT A;  4MI4 A;  4KSF A;  2OZG A;  3T90 A;  4LX9 A;  4EVY A;  4RI1 A;  5F46 A;  3VWE A;  4YRH A;  4MFZ A;  2B58 A;  1J4J A;  3PZJ A;  2OU2 A;  4UBR A;  3ZJ0 A;  1QSM A;  4ZGY B;  3DR8 A;  3C26 A;  2JDC A;  3H4Q A;  4UFX A;  4FD7 A;  3PGP A;  4HNX B;  4A95 A;  4A2Z A;  3ZZI A;  1Z9U A;  4R9M A;  2YNC A;  3TE4 A;  4BMH A;  4QB9 A;  5HH1 A;  4H6Z A;  4C2Z A;  3FB3 A;  3SXN A;  4XPK A;  4C68 A;  5A27 A;  4UFV A;  3I9S A;  4Y49 B;  5F48 A;  3TTH A;  4JD6 A;  4Y49 C;  1Z4R A;  3R96 A;  3A9L A;  2ATR A;  2ZXV A;  3TOB A;  2P6F A;  3PP9 A;  1S7F A;  1MJB A;  2PSW A;  1XIX A;  3CXQ A;  4M85 A;  2RC4 A;  4CAX A;  2PC1 A;  4JXR A;  4MY3 A;  1IID A;  4J3G A;  4B5P B;  1Q2Y A;  5G20 A;  2FS5 A;  2B3U A;  4CYN A;  2PDO A;  1S7L A;  4ZBG A;  4KOU A;  4B10 A;  1M4D A;  1B6B A;  2EVN A;  4JWP A;  2A4N A;  3NE7 A;  4QC6 A;  2J8M A;  1VKC A;  4KVM E;  5AG7 A;  2EUI A;  3R95 A;  3K9U A;  3TFY A;  3D8P A;  2REE A;  2WUU A;  5IB0 A;  1S7K A;  3GKR A;  5HMN A;  4KOR A;  2Q04 A;  3D3S A;  3VWD A;  3R1K A;  5JQ4 A;  2GIV A;  3JTK A;  4AVC A;  1YGH A;  2GE3 A;  1TIQ A;  2H5M A;  2J8N A;  3IGR A;  3D2P A;  3S6G A;  4XNH C;  2ZPA A;  4MBU A;  5BWA B;  3S6K A;  4UFW A;  3W6X A;  3BJ7 A;  1XF8 A;  2D4P A;  1GHE A;  5AG5 A;  2NMT A;  2CXA A;  5FVJ A;  4E2A A;  2FXF A;  2Z3K A;  3S6F A;  2ARH A;  4R3L A;  2I79 A;  2FIA A;  4QVT A;  2YGW A;  1CJW A;  4YGO A;  2ZW4 A;  5ISV A;  1N71 A;  1S5K A;  4Q36 A;  4LUA A;  5J8C A;  4BBH A;  4HNY B;  3V8I A;  3DDD A;  2J8R A;  1P0H A;  2B4D B;  1YK3 A;  1CM0 A;  3FBU A;  2PQ8 A;  4CAE A;  4R3K A;  3F8K A;  2R7H A;  2JEV A;  5EBV A;  2YNC C;  2KCW A;  3JUW A;  2Z10 A;  3R9G A;  4KLV A;  3GY9 A;  1P4N A;  2HUZ A;  3UY5 A;  2BEI A;  4FD4 A;  2VI7 A;  2WSA A;  5KTD A;  4C7I A;  4UCM A;  3R9F A;  4FD6 A;  4JXQ A;  4QBJ A;  1RO5 A;  1KUV A;  4KS9 A;  4UCN A;  3N7Z A;  4C2X A;  5F47 A;  4CAF A;  4UWI A;  1ZO0 A;  2BSW A;  4AG9 A;  2G3A A;  2BUE A;  2OZH A;  4MY0 A;  4CYP A;  4KVX A;  4NF1 A;  4UCP A;  2B5G A;  3CXS A;  2CY2 A;  2HV2 A;  1M1D A;  1PUA A;  1S3Z A;  1WK4 A;  3LD2 A;  3F5B A;  2GAN A;  3BJ8 A;  1ON0 A;  1I12 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...