1RO5A

Crystal structure of the ahl synthase lasi
Total Genus 56
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
56
sequence length
197
structure length
197
Chain Sequence
GSHMIVQIGRREEFDKKLLGEMHKLRAQVFKERKGWDVSVIDEMEIDGYDALSPYYMLIQEDGQVFGCWRILDTTGPYMLKNTFPELLHGKEAPCSPHIWELSRFAINSGQKGSLGFSDCTLEAMRALARYSLQNDIQTLVTVTTVGVEKMMIRAGLDVSRFGPHLKIGIERAVALRIELNAKTQIALYGGVLVEQR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Autoinducer synthesis protein lasI
publication title Structure of the Pseudomonas aeruginosa acyl-homoserinelactone synthase LasI.
pubmed doi rcsb
source organism Pseudomonas aeruginosa
molecule tags Signaling protein
total genus 56
structure length 197
sequence length 197
ec nomenclature ec 2.3.1.184: Acyl-homoserine-lactone synthase.
pdb deposition date 2003-12-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00765 Autoind_synth Autoinducer synthase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.630.30 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Aminopeptidase 1ro5A01
3R95A 4R9MA 1K4JA 3FYNA 4B5PB 2PQ8A 5I0CA 1Z4RA 1YVOA 4MI4A 4AVBA 1KUVA 2Z0ZA 5GCNA 4MJ8A 1MJAA 2ZW4A 4AVAA 4LX9A 2G3AA 4FD5A 3WR7A 4JLYA 4Y49C 3W6XA 2ZPAA 4XPKA 1KUXA 4KOVA 5JPHA 1L0CA 2REFA 2FXFA 3TO6A 2HUZA 4R3KA 4U9ZA 2O28A 1YLEA 5EC4A 3CXPA 3OWCA 4AVCA 2ATRA 3DSBA 2KCWA 4B5OA 2CNMA 1B6BA 4PV6A 2P0WA 4KLVA 4RS2A 1J4JA 3LODA 4NSQA 1S7KA 4KORA 2Q04A 2QIRA 3TO9A 3JUWA 3MGDA 3EY5A 4J3GA 3R96A 4XNHB 3TOAA 4JXRA 3FBUA 1BOBA 5J8CA 2QECA 3TCVA 1I12A 3EFAA 5DWNA 4HNWB 4KVXA 4K30A 4ORFA 4AG9A 2GANA 2B5GA 2FSRA 2RC4A 4IF5A 2D4OA 1KZFA 2EVNA 2Q4YA 3N7ZA 3T90A 1YX0A 1S60A 3S6FA 3GYAA 4L89A 2FL4A 1UFHA 3I3GA 2FCKA 4ZBGA 4B5PA 2K5TA 3DR6A 1Y7RA 4CAWA 3BJ8A 2F5IA 3SXNA 2G0BA 2Q0YA 4H6ZA 4QC6A 1QSMA 2FE7A 5KTDA 2AE6A 2OZUA 4KOSA 1WWZA 2X7BA 4KOTA 3DNSA 3F5BA 5F46A 1N71A 2GIVA 1RXTA 2B5GB 5C88A 1I21A 4LUAA 1QSRA 1IYKA 4QVTA 4KZTA 2VI7A 1Y9KA 1NSLA 2B3VA 2HQYA 1CM0A 4AG7A 4CAVA 4FD4A 3R9GA 4QB9A 1BO4A 2B4DB 4KOYA 4R3LA 2I00A 4MBUA 2H5MA 1XE4A 5FVJA 1M4IA 3P2FA 3H4QA 2NMTA 2BSWA 4OLLA 2R8VA 1S5KA 5J8FA 4H6UA 3TTHA 4XPDB 3TFYA 3W6SA 4XNHC 2CY2A 1YR0A 1Q2YA 3TOBA 4R57A 2OB0A 3GY9A 2ZW5A 3F8KA 1SQHA 5F48A 1IICA 1LRZA 3D8PA 2FIAA 3RYOA 1CJWA 4QUSA 1Z9UA 3LD2A 2VQYA 3D3SA 1S7LA 1Y9WA 4HNXB 3GKRA 3IGRA 1XMTA 3K9UA 3ZZIA 1Q2CA 4UWJA 4KUBA 1YREA 1V0CA 1S7FA 3CXQA 4CRYB 5KTAA 1S7NA 3TO7A 4JJXA 3F0AA 2CNSA 3KKWA 4F0YA 3CXSA 2PDOA 3S6HA 1MJBA 3NE7A 4YGOA 5H86A 2OU2A 2J8RA 2OZGA 5DWMA 2DXQA 2EUIA 3S6GA 4Y49B 2PRBA 1Z4EA 4DNCA 2OH1A 3PP9A 3B8GA 2OZHA 2IL4A 4YFJA 4KUAA 1QSNA 2P6GA 2Q44A 3BLNA 1M4GA 3D2PA 4KOWA 4AB7A 3JVNA 4MY0A 2FT0A 4EVYA 2A4NA 4E0AA 4HKFA 4H89A 2B4DA 2R1IA 4KOXA 2Z11A 4F6AA 1NE9A 4KVOE 4IUSA 4UWIA 2QMLA 3FNCA 3DDDA 5KTCA 1RO5A 4GS4A 1YVKA 2Q7BA 5HH1A 4PK3A 4BMHA 3TE4A 4ONUA 3P2HA 1TIQA 1OZPA 3C26A 4NXYA 4OADA 1S3ZA 3SXOA 1VKCA 4U5YA 1GHEA 2PSWA 4E2AA 2GE3A 2Q4VA 4JWPA 2I79A 3EO4A 4L8AA 2B58A 2P6FA 2PR1A 1QSOA 2J8MA 2VEZA 4NEXA 3FB3A 2AJ6A 1R57A 2ZW7A 5EBVA 3I9SA 5F49A 1FY7A 4NCZA 2HV2A 4JXQA 2JDCA 1B87A 3QB8A 1KUYA 2REEA 5H84A 4I49A 5IV0A 5E96A 5IX3A 2FIWA 3TT2A 5ISVA 3UY5A 3PZJA 3SHPA 1I1DA 3PGPA 2VBQA 1M44A 2D4PA 1XF8A 5JQ4A 4YRHA 1U6MA 4KVME 2WPWA 4JD6A 1NMTA 2Z10A 2ZW6A 4CAXA 1Q2DA 4OAEA 5IB0A 2R7HA 2PR8A 2JLMA 1QSTA 4NF1A 1MJ9A 2C27A 2Y0MA 1P0HA 3IWGA 3S6KA 2CNTA 1MK4A 2B4BA 2PC1A 2VXKA 1XEBA 2R98A 1YGHA 4R87A 1VHSA 4MY3A 2FS5A 4RI1A 4E8OA 2J8NA 1IYLA 1XIXA 1PU9A 3R1KA 1WK4A 2ZXVA 4CS0B 1IB1E 4U9YA 2ARHA 2JEVA 4PSWA 2BL1A 3VWEA 2WPXA 1PUAA 3BJ7A 3V8IA 3VWDA 3E0KA 4FD7A 2BUEA 4XPDC 4KLWA 4UA3A 1ON0A 4MHDA 4M85A 5F47A 3ZJ0A 3T9YA 4PSXA 4KOUA 1IIDA 3G3SA 4II9A 3FRMA 1P4NA 4HNYB 3D2MA 2VZZA 5CNPA 2G3TA 2JDDA 1M4DA 3EXNA 4FD6A 3G8WA 5HMNA 4PK2A 4XPLA 1M1DA 4UBRA 4X5KA 3EC4A 3FXTA 3R9FA 3QAHA 4M3SA 5C82A 3FIXA 4CRZB 3R9EA 1YK3A 2B3UA 3W91A 2VZYA 2BEIA 4QBJA 2P6EA 3DR8A
chains in the Genus database with same CATH superfamily
3R95A 4R9MA 2AFOA 1K4JA 2ZOFA 6CPAA 2JEWA 3FYNA 4B5PB 1YW6A 5G21A 3K9TA 2PQ8A 5I0CA 1Z4RA 1YVOA 3IIBA 2QYVA 4MI4A 4AVBA 2EO8A 2ZEEA 1KUVA 1CP6A 4IK2A 2Z0ZA 3GLJA 5GCNA 4MFZA 2VL1A 4MJ8A 1MJAA 2ZW4A 4AVAA 4LX9A 2G3AA 4FD5A 1A2ZA 3WR7A 4JLYA 2CXAA 3IU1A 3SJFA 4Y49C 3QNVA 4NGQA 4ZY0A 4OC5A 3W6XA 2ZPAA 3B3SA 1XJOA 4XPKA 4EFDA 3D7FA 1KUXA 4KOVA 4LQ6A 4MHNA 4ZX8A 3WC6A 4RUHA 5JPHA 3D7HA 1L0CA 4MFJA 4UCMA 4UFWA 1Z2LA 3BHXA 2REFA 2NYQA 3H8GA 3NH4A 1LANA 1XOVA 2FXFA 2QVPA 2HUZA 3TO6A 2BOAA 4R3KA 1YSJA 1ZLHA 4ZGYB 2XEFA 1IGBA 2WSAA 4U9ZA 2O28A 1YW4A 4C2XA 4NJQA 1YLEA 5EC4A 3CXPA 3OWCA 4AVCA 4FAIA 2PVVA 2ATRA 3DSBA 2KCWA 3FX6A 1AUGA 3TC8A 4B10A 2QJ8A 4B5OA 5AG5A 3IU2A 4CYPA 4W9YA 4F0XA 1BLLE 3NH8A 2CNMA 3SJXA 1B6BA 4PV6A 2AFWA 4P4FA 4B14A 2P0WA 4KLVA 4EMEA 4RS2A 1J4JA 2C6PA 3ISXA 5LRGA 1JWQA 3LODA 3B35A 4NGTA 4NSQA 3PRTA 1S7KA 4NGNA 4UCPA 4UEEA 4KORA 4A32A 4WWVA 4RN7A 2Q04A 4YU9A 2QIRA 3PB8X 5CPAA 2AFUA 3TO9A 2PVWA 3JUWA 1YQEA 3MGDA 3EY5A 4J3GA 4UIBA 3D66A 4BBHA 3R96A 4OC3A 4XNHB 3TOAA 1BAVA 2PCUA 5G20A 4R6TA 1AMPA 4JXRA 3FBUA 4P4DA 1BOBA 2ZOGA 1ZO0A 1M4LA 5J8CA 4B6ZA 3VH9A 2QECA 3IFEA 1Q7LA 2DEAA 4NGPA 3TCVA 1I12A 3IWWA 4A30A 4B13A 4B11A 2GLFA 3EFAA 4MFKA 4NJRA 5DWNA 4CGOA 4HNWB 4KVXA 5JGFA 3CPXA 3PBBA 1TKHA 4K30A 5IB9A 4ORFA 2OR4A 3H8EA 4MCQA 5J1QA 4AG9A 5HVGA 2DPSA 2GANA 4HPSA 2B5GA 4P6YA 2FSRA 1AYEA 1XFOA 2RC4A 3IJ3A 4MRIA 4UF4A 4IF5A 3PB6X 5HXDA 2D4OA 1KZFA 2EVNA 2Q4YA 1JQGA 3N7ZA 1CX8A 3SI0A 4P4JA 3T90A 1YX0A 1S60A 1X12A 4NGMA 3S6FA 3GYAA 4L89A 4GM5A 3S9LA 2FL4A 1UFHA 2XEGA 4OIDA 1BPMA 5LRJA 3I3GA 2FCKA 4ZBGA 3KR5A 4WJBA 4CYNA 3GIUA 4B5PA 2EBJA 3QAYA 2K5TA 3DR6A 4CAFA 1Y7RA 4CAWA 3BJ8A 2F5IA 3SXNA 2G0BA 2Q0YA 4H6ZA 2IMOA 2PJ2A 1FT7A 1QSMA 2PIZA 4QC6A 2FE7A 5KTDA 2AE6A 2OZUA 3SI1A 4KOSA 1WWZA 2X7BA 4KOTA 3DNSA 2ZENA 3F5BA 5F46A 1N71A 2GIVA 4UFVA 5K8NA 1RXTA 1XBUA 2B5GB 5C88A 1I21A 4LUAA 1QSRA 5AGEA 1IYKA 2XEIA 4QVTA 4OIWA 2EK9A 4KZTA 4CPAA 1GYTA 2VI7A 4F8ZA 1Y9KA 1NSLA 1Z8TA 2IQ6A 2DPTA 3N5FA 2B3VA 2C6CA 2HQYA 1CM0A 1Z8LA 3PB7X 4X2TA 4AG7A 4CAVA 2PJ5A 3RZAA 4FD4A 3R9GA 4A94A 4TWEA 1Z8XA 4PXEA 4QB9A 3B7IA 1BO4A 4P44A 2B4DB 4KOYA 4R3LA 2I00A 3IO1A 2ZEOA 2AFZA 4MBUA 2H5MA 4F9UA 1CPSA 4BD9A 4KSFA 1XE4A 3RAMA 1LFWA 5FVJA 4NGSA 5G22A 1M4IA 3CPAA 4GXHA 4MXUA 4F9VA 3P2FA 3H4QA 4FUUA 2NMTA 2BSWA 4IAVA 2PE3A 4OLLA 2V8VA 4ZY1A 2R8VA 1S5KA 5J8FA 3ISZA 2J9AA 3H8FA 4H6UA 3TTHA 3B3TA 4XPDB 3TFYA 3W6SA 4XNHC 1ELLP 2CY2A 4MMOA 1YR0A 2BCOA 2BO9A 2PIYA 5LRKA 3RO0A 1Q2YA 5HVHA 3TOBA 4R57A 1Y0YA 2OB0A 3GY9A 2ZW5A 3F8KA 1ELMP 1SQHA 1ZG9A 2AFMA 2CTBA 3FJUA 5F48A 4DUKA 1IICA 1LRZA 3D8PA 3WABA 4C2YA 2FIAA 3RYOA 4R8FA 1CJWA 4CGPA 2C1CA 4QUSA 4YWYA 5D29A 3KGQA 4C68A 1Z9UA 1R43A 3PB4X 2V8HA 3D68A 3LD2A 2VQYA 3KHXA 2CIJA 4X3RA 3D3SA 1S7LA 1Y9WA 2AFSA 2GFQA 4FBEA 4HNXB 3GKRA 2CF4A 3IGRA 1XMTA 2Q4ZA 3K9UA 5DS0A 4NFRA 3ZZIA 1IOFA 4CGNA 1Q2CA 4UWJA 4ZY2A 3BXMA 4OC4A 4KUBA 4OC0A 1YREA 4PPZA 1V0CA 4OMEA 2PJ0A 1S7FA 3CXQA 4Q7AA 3FVLA 2PJAA 4CRYB 5KTAA 1OBRA 3CDXA 1Z8WA 3K2KA 4MCPA 1S7NA 3TO7A 2HB6A 2ANPA 3F0AA 4JJXA 4ONWA 2CNSA 3KKWA 4F0YA 4P4BA 1KWMA 4Q36A 3CXSA 3GB0A 4MHYA 2C6GA 2PDOA 3S6HA 3I1UA 5F09A 1EE3P 2PRQA 1MJBA 3NE7A 2GREA 4YGOA 4MFPA 5H86A 4C2ZA 2OU2A 2J8RA 2OZGA 4JYWA 5DWMA 4KS9A 2DXQA 4UEFA 2EUIA 3S6GA 5AG4A 3PB9X 4PXBA 4R7MA 4Y49B 2PRBA 1Z4EA 3VATA 4DNCA 4M6HA 5AG7A 3MN8A 4MFQA 4P4EA 4CYQA 5LYIA 4PQAA 2OH1A 3PP9A 3B8GA 5HVFA 2OZHA 2IL4A 4OC2A 4BINA 4YFJA 3BI0A 4KUAA 4O23A 1QSNA 3KL9A 2P6GA 4UEZA 2Q44A 5THWA 3FH4A 1VHEA 2RFHA 1LAPA 3BLNA 1M4GA 2ZEGA 3D2PA 4KOWA 4JZ0A 3JVNA 4AB7A 4MY0A 2FT0A 4DJLA 2YNEA 1NSAA 4EVYA 2NSMA 3LMSA 1ZLIA 2Z3LA 2Z3KA 4P4IA 2A4NA 4E0AA 4HKFA 3B3CA 4H89A 2B4DA 5LYFA 4Z65A 2R1IA 4KOXA 2Z11A 3BI1A 3D4UA 3IC1A 4F6AA 1NE9A 5G1ZA 2YGWA 3LWUA 3KHZA 4M6IA 4CGMA 4KVOE 4G1PA 2EWBA 2F8HA 4IUSA 4A31A 5EMIA 3FMCA 4UWIA 2QMLA 3IWEA 1H8LA 3B3WA 3KQZA 3DLJA 4OKOA 3L2NA 3FNCA 3DDDA 5KTCA 1RO5A 5LYDA 4GS4A 4CYOA 2V8DA 1YVKA 1DTDA 2Q7BA 5HH1A 1HDQA 4PK3A 3HLPA 4UCNA 4P10A 4BMHA 3TE4A 4ONUA 3P2HA 1RTQA 2FVGA 4UFXA 4KSIA 4MHPA 1TIQA 1OZPA 3C26A 4NXYA 4OADA 1S3ZA 3SXOA 4UIAA 2AFXA 5AG6A 1R3NA 3FEDA 5K8MA 2PJ8A 2XEJA 1VKCA 4FWUA 4U5YA 2Z3PA 4A33A 1GHEA 3CT9A 4DYOA 2PSWA 3H5ZA 2ZEPA 4OC1A 4A2ZA 4MHZA 4LQGA 1LOKA 4E2AA 4ZX9A 5CBMA 4C7IA 4KSAA 2GE3A 5JH9A 2Q4VA 4JWPA 3SI2A 2I79A 3MRUA 3EO4A 4L8AA 2B58A 2P6FA 4A38A 2PR1A 1QSOA 2J8MA 4PXCA 1IY7A 3S9MA 2VEZA 5A27A 5A28A 1VGYA 3CZXA 4PXDA 1LAMA 2GLJA 4NEXA 1X10A 3FB3A 2AJ6A 2ZEFA 1R57A 2PJ7A 2ZW7A 4MFLA 5BWAB 3PFOA 3V7ZA 3PBEA 5EBVA 2PJBA 2DF5A 2Q51A 2ZELA 3RNZA 1CP7A 2PJ3A 1HEEA 3I9SA 5F49A 1FY7A 4M6GA 4NCZA 1Y0RA 2HV2A 4AXVA 4JXQA 5LYLA 1QQ9A 2JDCA 2WYRA 1B87A 1CG2A 3QB8A 3D7DA 1KUYA 2IJZA 1XRYA 4R76A 5JM6A 2REEA 2O53A 4TNUA 1VHOA 2F7VA 5H84A 4I49A 2Z3MA 5IV0A 5E96A 2RB7A 3VARA 5IX3A 1F2OA 2FIWA 3TT2A 5ISVA 2Z3NA 3UY5A 3PFEA 2V8GA 3PZJA 1UWYA 4EWTA 4H2KA 3SHPA 1I1DA 3PGPA 2VBQA 1M44A 2D4PA 4MCRA 1XF8A 1ZG7A 5JQ4A 4YRHA 2HC9A 2V77A 3GUXA 3T8WA 1U6MA 4KVME 4CGLA 2WPWA 3D7GA 3NA6A 2WZNA 2ODFA 2POKA 2PJ1A 4JD6A 4MCSA 2Q43A 1NMTA 1DE4C 1FNOA 2Z10A 3WC5A 2ZW6A 3SJEA 4CAXA 5K8OA 1Q2DA 4OP4A 5I4MA 4OAEA 5IB0A 2R7HA 2PR8A 2EK8A 2JLMA 3FF3A 1QSTA 2Q7SA 4NF1A 4A95A 3B3VA 1MJ9A 2C27A 2Y0MA 2ZEDA 1P0HA 1YMEA 1HDUA 3KI9A 3IWGA 3S6KA 1ZG8A 5ELYA 2CNTA 1TKJA 1MK4A 3KQXA 2B4BA 2PC1A 1Y7EA 3SJGA 1F57A 1IU8A 2VXKA 3FEEA 2GU2A 1CPXA 8CPAA 7CPAA 1XEBA 2R98A 1YGHA 4Q38A 4R87A 1VHSA 4MY3A 2ABZA 3LACA 2FS5A 4RI1A 4E8OA 4X8IA 3IEHA 2Z3OA 4CAEA 2J8NA 2JBJA 3B2YA 1IYLA 1XIXA 1PU9A 3R1KA 1WK4A 2ZXVA 1IOIA 4CS0B 1IB1E 1ARLA 4U9YA 2ARHA 2JEVA 4PSWA 2OOTA 4A39A 2BL1A 3VWEA 2WPXA 2ZEHA 1PUAA 2PJ9A 3BJ7A 5D8NA 1F2PA 3V8IA 3E0KA 3VWDA 4FD7A 2ZEMA 2WUUA 1XMBA 1TXRA 4P45A 2BUEA 3JRUA 1QMUA 2PJ4A 4KLWA 4UA3A 4XPDC 4NGRA 1PCAA 1ON0A 2G9DA 4MHDA 3NH5A 4ZI6A 4M85A 5F47A 3ZJ0A 3T9YA 4A37A 4PSXA 1BPNA 1TF9A 2PJCA 3KR4A 1IIDA 4KOUA 2PJ6A 3G3SA 1TKFA 3WC7A 3FRMA 1P4NA 4HNYB 4II9A 3D2MA 2VZZA 5CNPA 2G3TA 3RBUA 2JDDA 1M4DA 3EXNA 4K3NA 3V38A 1CBXA 4FD6A 3S9NA 3KZWA 3NFZA 3G8WA 3TX8A 3NE8A 5HMNA 3PEIA 3JTKA 2CTCA 3HUVA 4IHMA 4PK2A 3D67A 4XPLA 2JBKA 2I3CA 1Z5RA 1M1DA 2YNDA 1VIXA 2YNCC 1TF8A 4UBRA 3EC4A 4X5KA 3FXTA 3R9FA 3QAHA 4M3SA 3WT4A 5C82A 3FIXA 2YNCA 3FECA 1LCPA 4CRZB 3R9EA 4B12A 1PYTB 1YK3A 2B3UA 4C7HA 3KASA 3DGVA 3A9LA 1ARMA 2O4HA 2VZYA 3W91A 2BEIA 1YLOA 4QBJA 2P6EA 4ZYQA 5K8PA 3DR8A
chains in the Genus database with same CATH topology
3R95A 4R9MA 1K4JA 3FYNA 4B5PB 5G21A 2PQ8A 5I0CA 1Z4RA 1YVOA 4MI4A 4AVBA 1KUVA 2Z0ZA 5GCNA 4MFZA 4MJ8A 1MJAA 2ZW4A 4AVAA 4LX9A 2G3AA 4FD5A 3WR7A 4JLYA 2CXAA 3IU1A 4Y49C 3W6XA 2ZPAA 4XPKA 1KUXA 4KOVA 5JPHA 1L0CA 4MFJA 4UCMA 4UFWA 2REFA 2FXFA 3TO6A 2HUZA 4R3KA 4ZGYB 2WSAA 4U9ZA 2O28A 4C2XA 1YLEA 5EC4A 3CXPA 3OWCA 4AVCA 2ATRA 3DSBA 2KCWA 4B10A 4B5OA 5AG5A 3IU2A 4CYPA 4F0XA 2CNMA 1B6BA 4PV6A 4B14A 2P0WA 4KLVA 4RS2A 1J4JA 3LODA 4UCPA 4A31A 4NSQA 1S7KA 4KORA 4A32A 2Q04A 2QIRA 3TO9A 3JUWA 3MGDA 3EY5A 4J3GA 4BBHA 3R96A 4XNHB 3TOAA 5G20A 4JXRA 3FBUA 1BOBA 1ZO0A 5J8CA 2QECA 3TCVA 4A30A 1I12A 4B13A 4B11A 3EFAA 4MFKA 5DWNA 4CGOA 4HNWB 4KVXA 4K30A 4ORFA 4AG9A 2DPSA 2GANA 2B5GA 2FSRA 2RC4A 4IF5A 2D4OA 1KZFA 2EVNA 2Q4YA 3N7ZA 3T90A 1YX0A 1S60A 3S6FA 3GYAA 4L89A 2FL4A 1UFHA 3I3GA 2FCKA 4ZBGA 4CYNA 4B5PA 2K5TA 3DR6A 4CAFA 1Y7RA 4CAWA 3BJ8A 2F5IA 3SXNA 2G0BA 2Q0YA 4H6ZA 4QC6A 1QSMA 2FE7A 5KTDA 2AE6A 2OZUA 4KOSA 1WWZA 2X7BA 4KOTA 3DNSA 3F5BA 5F46A 1N71A 2GIVA 4UFVA 1RXTA 2B5GB 5C88A 1I21A 4LUAA 1QSRA 5AGEA 1IYKA 4QVTA 4KZTA 2VI7A 1Y9KA 1NSLA 2DPTA 2B3VA 2HQYA 1CM0A 4AG7A 4CAVA 4FD4A 3R9GA 4QB9A 1BO4A 2B4DB 4KOYA 4R3LA 2I00A 4MBUA 2H5MA 4KSFA 1XE4A 5FVJA 5G22A 1M4IA 3P2FA 3H4QA 2NMTA 2BSWA 4OLLA 2R8VA 1S5KA 5J8FA 4H6UA 3TTHA 4XPDB 3TFYA 3W6SA 4XNHC 2CY2A 1YR0A 1Q2YA 3TOBA 4R57A 2OB0A 3GY9A 2ZW5A 3F8KA 1SQHA 5F48A 1IICA 1LRZA 3D8PA 4C2YA 2FIAA 3RYOA 1CJWA 4CGPA 4QUSA 4C68A 1Z9UA 3LD2A 2VQYA 3D3SA 1S7LA 1Y9WA 4HNXB 3GKRA 3IGRA 1XMTA 3K9UA 3ZZIA 4CGNA 1Q2CA 4UWJA 4KUBA 1YREA 1V0CA 1S7FA 3CXQA 4CRYB 5KTAA 1S7NA 3TO7A 4JJXA 3F0AA 2CNSA 3KKWA 4F0YA 4Q36A 3CXSA 2PDOA 3S6HA 1MJBA 3NE7A 4YGOA 4MFPA 5H86A 4C2ZA 2OU2A 2J8RA 2OZGA 5DWMA 4KS9A 2DXQA 2EUIA 3S6GA 5AG4A 4Y49B 2PRBA 1Z4EA 4DNCA 5AG7A 4MFQA 4CYQA 2OH1A 3PP9A 3B8GA 2OZHA 2IL4A 4YFJA 4KUAA 1QSNA 2P6GA 2Q44A 3BLNA 1M4GA 3D2PA 4KOWA 4AB7A 3JVNA 4MY0A 2FT0A 2YNEA 4EVYA 2Z3LA 2Z3KA 2A4NA 4E0AA 4HKFA 4H89A 2B4DA 2R1IA 4KOXA 2Z11A 4F6AA 1NE9A 5G1ZA 2YGWA 4CGMA 4KVOE 4IUSA 4UWIA 2QMLA 3IWEA 3FNCA 3DDDA 5KTCA 1RO5A 4GS4A 4CYOA 1YVKA 2Q7BA 5HH1A 4PK3A 4UCNA 4BMHA 3TE4A 4ONUA 3P2HA 4UFXA 1TIQA 1OZPA 3C26A 4NXYA 4OADA 1S3ZA 3SXOA 5AG6A 1VKCA 4U5YA 2Z3PA 4A33A 1GHEA 2PSWA 3H5ZA 4A2ZA 4E2AA 4C7IA 4KSAA 2GE3A 2Q4VA 4JWPA 2I79A 3EO4A 4L8AA 2B58A 2P6FA 2PR1A 1QSOA 2J8MA 2VEZA 5A27A 5A28A 4NEXA 3FB3A 4MFLA 2AJ6A 1R57A 2ZW7A 5BWAB 5EBVA 3I9SA 5F49A 1FY7A 4NCZA 2HV2A 4JXQA 2JDCA 1B87A 3QB8A 1KUYA 2REEA 5H84A 4I49A 2Z3MA 5IV0A 5E96A 5IX3A 2FIWA 3TT2A 5ISVA 2Z3NA 3UY5A 3PZJA 3SHPA 1I1DA 3PGPA 2VBQA 1M44A 2D4PA 1XF8A 5JQ4A 4YRHA 1U6MA 4KVME 4CGLA 2WPWA 4JD6A 1NMTA 2Z10A 2ZW6A 4CAXA 1Q2DA 4OAEA 5IB0A 2R7HA 2PR8A 2JLMA 1QSTA 4NF1A 4A95A 1MJ9A 2C27A 2Y0MA 1P0HA 3IWGA 3S6KA 2CNTA 1MK4A 2B4BA 2PC1A 2VXKA 1XEBA 2R98A 1YGHA 4Q38A 4R87A 1VHSA 4MY3A 2FS5A 4RI1A 4E8OA 2Z3OA 4CAEA 2J8NA 1IYLA 1XIXA 1PU9A 3R1KA 1WK4A 2ZXVA 4CS0B 1IB1E 4U9YA 2ARHA 2JEVA 4PSWA 2BL1A 3VWEA 2WPXA 1PUAA 3BJ7A 3V8IA 3VWDA 3E0KA 4FD7A 2WUUA 2BUEA 4XPDC 4KLWA 4UA3A 1ON0A 4MHDA 4M85A 5F47A 3ZJ0A 3T9YA 4PSXA 1IIDA 4KOUA 3G3SA 4II9A 3FRMA 1P4NA 4HNYB 3D2MA 2VZZA 5CNPA 2G3TA 2JDDA 1M4DA 3EXNA 4FD6A 3G8WA 5HMNA 3JTKA 4PK2A 4XPLA 1M1DA 2YNDA 2YNCC 4UBRA 4X5KA 3EC4A 3FXTA 3R9FA 3QAHA 4M3SA 5C82A 3FIXA 2YNCA 4CRZB 3R9EA 4B12A 1YK3A 2B3UA 4C7HA 3A9LA 3W91A 2VZYA 2BEIA 4QBJA 2P6EA 3DR8A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3R95 A;  4R9M A;  1K4J A;  3FYN A;  4B5P B;  2PQ8 A;  5I0C A;  1Z4R A;  1YVO A;  4MI4 A;  4AVB A;  1KUV A;  2Z0Z A;  5GCN A;  4MJ8 A;  1MJA A;  2ZW4 A;  4AVA A;  4LX9 A;  2G3A A;  4FD5 A;  3WR7 A;  4JLY A;  4Y49 C;  3W6X A;  2ZPA A;  4XPK A;  1KUX A;  4KOV A;  5JPH A;  1L0C A;  2REF A;  2FXF A;  3TO6 A;  2HUZ A;  4R3K A;  4U9Z A;  2O28 A;  1YLE A;  5EC4 A;  3CXP A;  3OWC A;  4AVC A;  2ATR A;  3DSB A;  2KCW A;  4B5O A;  2CNM A;  1B6B A;  4PV6 A;  2P0W A;  4KLV A;  4RS2 A;  1J4J A;  3LOD A;  4NSQ A;  1S7K A;  4KOR A;  2Q04 A;  2QIR A;  3TO9 A;  3JUW A;  3MGD A;  3EY5 A;  4J3G A;  3R96 A;  4XNH B;  3TOA A;  4JXR A;  3FBU A;  1BOB A;  5J8C A;  2QEC A;  3TCV A;  1I12 A;  3EFA A;  5DWN A;  4HNW B;  4KVX A;  4K30 A;  4ORF A;  4AG9 A;  2GAN A;  2B5G A;  2FSR A;  2RC4 A;  4IF5 A;  2D4O A;  1KZF A;  2EVN A;  2Q4Y A;  3N7Z A;  3T90 A;  1YX0 A;  1S60 A;  3S6F A;  3GYA A;  4L89 A;  2FL4 A;  1UFH A;  3I3G A;  2FCK A;  4ZBG A;  4B5P A;  2K5T A;  3DR6 A;  1Y7R A;  4CAW A;  3BJ8 A;  2F5I A;  3SXN A;  2G0B A;  2Q0Y A;  4H6Z A;  4QC6 A;  1QSM A;  2FE7 A;  5KTD A;  2AE6 A;  2OZU A;  4KOS A;  1WWZ A;  2X7B A;  4KOT A;  3DNS A;  3F5B A;  5F46 A;  1N71 A;  2GIV A;  1RXT A;  2B5G B;  5C88 A;  1I21 A;  4LUA A;  1QSR A;  1IYK A;  4QVT A;  4KZT A;  2VI7 A;  1Y9K A;  1NSL A;  2B3V A;  2HQY A;  1CM0 A;  4AG7 A;  4CAV A;  4FD4 A;  3R9G A;  4QB9 A;  1BO4 A;  2B4D B;  4KOY A;  4R3L A;  2I00 A;  4MBU A;  2H5M A;  1XE4 A;  5FVJ A;  1M4I A;  3P2F A;  3H4Q A;  2NMT A;  2BSW A;  4OLL A;  2R8V A;  1S5K A;  5J8F A;  4H6U A;  3TTH A;  4XPD B;  3TFY A;  3W6S A;  4XNH C;  2CY2 A;  1YR0 A;  1Q2Y A;  3TOB A;  4R57 A;  2OB0 A;  3GY9 A;  2ZW5 A;  3F8K A;  1SQH A;  5F48 A;  1IIC A;  1LRZ A;  3D8P A;  2FIA A;  3RYO A;  1CJW A;  4QUS A;  1Z9U A;  3LD2 A;  2VQY A;  3D3S A;  1S7L A;  1Y9W A;  4HNX B;  3GKR A;  3IGR A;  1XMT A;  3K9U A;  3ZZI A;  1Q2C A;  4UWJ A;  4KUB A;  1YRE A;  1V0C A;  1S7F A;  3CXQ A;  4CRY B;  5KTA A;  1S7N A;  3TO7 A;  4JJX A;  3F0A A;  2CNS A;  3KKW A;  4F0Y A;  3CXS A;  2PDO A;  3S6H A;  1MJB A;  3NE7 A;  4YGO A;  5H86 A;  2OU2 A;  2J8R A;  2OZG A;  5DWM A;  2DXQ A;  2EUI A;  3S6G A;  4Y49 B;  2PRB A;  1Z4E A;  4DNC A;  2OH1 A;  3PP9 A;  3B8G A;  2OZH A;  2IL4 A;  4YFJ A;  4KUA A;  1QSN A;  2P6G A;  2Q44 A;  3BLN A;  1M4G A;  3D2P A;  4KOW A;  4AB7 A;  3JVN A;  4MY0 A;  2FT0 A;  4EVY A;  2A4N A;  4E0A A;  4HKF A;  4H89 A;  2B4D A;  2R1I A;  4KOX A;  2Z11 A;  4F6A A;  1NE9 A;  4KVO E;  4IUS A;  4UWI A;  2QML A;  3FNC A;  3DDD A;  5KTC A;  1RO5 A;  4GS4 A;  1YVK A;  2Q7B A;  5HH1 A;  4PK3 A;  4BMH A;  3TE4 A;  4ONU A;  3P2H A;  1TIQ A;  1OZP A;  3C26 A;  4NXY A;  4OAD A;  1S3Z A;  3SXO A;  1VKC A;  4U5Y A;  1GHE A;  2PSW A;  4E2A A;  2GE3 A;  2Q4V A;  4JWP A;  2I79 A;  3EO4 A;  4L8A A;  2B58 A;  2P6F A;  2PR1 A;  1QSO A;  2J8M A;  2VEZ A;  4NEX A;  3FB3 A;  2AJ6 A;  1R57 A;  2ZW7 A;  5EBV A;  3I9S A;  5F49 A;  1FY7 A;  4NCZ A;  2HV2 A;  4JXQ A;  2JDC A;  1B87 A;  3QB8 A;  1KUY A;  2REE A;  5H84 A;  4I49 A;  5IV0 A;  5E96 A;  5IX3 A;  2FIW A;  3TT2 A;  5ISV A;  3UY5 A;  3PZJ A;  3SHP A;  1I1D A;  3PGP A;  2VBQ A;  1M44 A;  2D4P A;  1XF8 A;  5JQ4 A;  4YRH A;  1U6M A;  4KVM E;  2WPW A;  4JD6 A;  1NMT A;  2Z10 A;  2ZW6 A;  4CAX A;  1Q2D A;  4OAE A;  5IB0 A;  2R7H A;  2PR8 A;  2JLM A;  1QST A;  4NF1 A;  1MJ9 A;  2C27 A;  2Y0M A;  1P0H A;  3IWG A;  3S6K A;  2CNT A;  1MK4 A;  2B4B A;  2PC1 A;  2VXK A;  1XEB A;  2R98 A;  1YGH A;  4R87 A;  1VHS A;  4MY3 A;  2FS5 A;  4RI1 A;  4E8O A;  2J8N A;  1IYL A;  1XIX A;  1PU9 A;  3R1K A;  1WK4 A;  2ZXV A;  4CS0 B;  1IB1 E;  4U9Y A;  2ARH A;  2JEV A;  4PSW A;  2BL1 A;  3VWE A;  2WPX A;  1PUA A;  3BJ7 A;  3V8I A;  3VWD A;  3E0K A;  4FD7 A;  2BUE A;  4XPD C;  4KLW A;  4UA3 A;  1ON0 A;  4MHD A;  4M85 A;  5F47 A;  3ZJ0 A;  3T9Y A;  4PSX A;  4KOU A;  1IID A;  3G3S A;  4II9 A;  3FRM A;  1P4N A;  4HNY B;  3D2M A;  2VZZ A;  5CNP A;  2G3T A;  2JDD A;  1M4D A;  3EXN A;  4FD6 A;  3G8W A;  5HMN A;  4PK2 A;  4XPL A;  1M1D A;  4UBR A;  4X5K A;  3EC4 A;  3FXT A;  3R9F A;  3QAH A;  4M3S A;  5C82 A;  3FIX A;  4CRZ B;  3R9E A;  1YK3 A;  2B3U A;  3W91 A;  2VZY A;  2BEI A;  4QBJ A;  2P6E A;  3DR8 A; 
#chains in the Genus database with same CATH topology
 3R95 A;  4R9M A;  2AFO A;  1K4J A;  2ZOF A;  6CPA A;  2JEW A;  3FYN A;  4B5P B;  1YW6 A;  5G21 A;  3K9T A;  2PQ8 A;  5I0C A;  1Z4R A;  1YVO A;  3IIB A;  2QYV A;  4MI4 A;  4AVB A;  2EO8 A;  2ZEE A;  1KUV A;  1CP6 A;  4IK2 A;  2Z0Z A;  3GLJ A;  5GCN A;  4MFZ A;  2VL1 A;  4MJ8 A;  1MJA A;  2ZW4 A;  4AVA A;  4LX9 A;  2G3A A;  4FD5 A;  1A2Z A;  3WR7 A;  4JLY A;  2CXA A;  3IU1 A;  3SJF A;  4Y49 C;  3QNV A;  4NGQ A;  4ZY0 A;  4OC5 A;  3W6X A;  2ZPA A;  3B3S A;  1XJO A;  4XPK A;  4EFD A;  3D7F A;  1KUX A;  4KOV A;  4LQ6 A;  4MHN A;  4ZX8 A;  3WC6 A;  4RUH A;  5JPH A;  3D7H A;  1L0C A;  4MFJ A;  4UCM A;  4UFW A;  1Z2L A;  3BHX A;  2REF A;  2NYQ A;  3H8G A;  3NH4 A;  1LAN A;  1XOV A;  2FXF A;  2QVP A;  2HUZ A;  3TO6 A;  2BOA A;  4R3K A;  1YSJ A;  1ZLH A;  4ZGY B;  2XEF A;  1IGB A;  2WSA A;  4U9Z A;  2O28 A;  1YW4 A;  4C2X A;  4NJQ A;  1YLE A;  5EC4 A;  3CXP A;  3OWC A;  4AVC A;  4FAI A;  2PVV A;  2ATR A;  3DSB A;  2KCW A;  3FX6 A;  1AUG A;  3TC8 A;  4B10 A;  2QJ8 A;  4B5O A;  5AG5 A;  3IU2 A;  4CYP A;  4W9Y A;  4F0X A;  1BLL E;  3NH8 A;  2CNM A;  3SJX A;  1B6B A;  4PV6 A;  2AFW A;  4P4F A;  4B14 A;  2P0W A;  4KLV A;  4EME A;  4RS2 A;  1J4J A;  2C6P A;  3ISX A;  5LRG A;  1JWQ A;  3LOD A;  3B35 A;  4NGT A;  4NSQ A;  3PRT A;  1S7K A;  4NGN A;  4UCP A;  4UEE A;  4KOR A;  4A32 A;  4WWV A;  4RN7 A;  2Q04 A;  4YU9 A;  2QIR A;  3PB8 X;  5CPA A;  2AFU A;  3TO9 A;  2PVW A;  3JUW A;  1YQE A;  3MGD A;  3EY5 A;  4J3G A;  4UIB A;  3D66 A;  4BBH A;  3R96 A;  4OC3 A;  4XNH B;  3TOA A;  1BAV A;  2PCU A;  5G20 A;  4R6T A;  1AMP A;  4JXR A;  3FBU A;  4P4D A;  1BOB A;  2ZOG A;  1ZO0 A;  1M4L A;  5J8C A;  4B6Z A;  3VH9 A;  2QEC A;  3IFE A;  1Q7L A;  2DEA A;  4NGP A;  3TCV A;  1I12 A;  3IWW A;  4A30 A;  4B13 A;  4B11 A;  2GLF A;  3EFA A;  4MFK A;  4NJR A;  5DWN A;  4CGO A;  4HNW B;  4KVX A;  5JGF A;  3CPX A;  3PBB A;  1TKH A;  4K30 A;  5IB9 A;  4ORF A;  2OR4 A;  3H8E A;  4MCQ A;  5J1Q A;  4AG9 A;  5HVG A;  2DPS A;  2GAN A;  4HPS A;  2B5G A;  4P6Y A;  2FSR A;  1AYE A;  1XFO A;  2RC4 A;  3IJ3 A;  4MRI A;  4UF4 A;  4IF5 A;  3PB6 X;  5HXD A;  2D4O A;  1KZF A;  2EVN A;  2Q4Y A;  1JQG A;  3N7Z A;  1CX8 A;  3SI0 A;  4P4J A;  3T90 A;  1YX0 A;  1S60 A;  1X12 A;  4NGM A;  3S6F A;  3GYA A;  4L89 A;  4GM5 A;  3S9L A;  2FL4 A;  1UFH A;  2XEG A;  4OID A;  1BPM A;  5LRJ A;  3I3G A;  2FCK A;  4ZBG A;  3KR5 A;  4WJB A;  4CYN A;  3GIU A;  4B5P A;  2EBJ A;  3QAY A;  2K5T A;  3DR6 A;  4CAF A;  1Y7R A;  4CAW A;  3BJ8 A;  2F5I A;  3SXN A;  2G0B A;  2Q0Y A;  4H6Z A;  2IMO A;  2PJ2 A;  1FT7 A;  1QSM A;  2PIZ A;  4QC6 A;  2FE7 A;  5KTD A;  2AE6 A;  2OZU A;  3SI1 A;  4KOS A;  1WWZ A;  2X7B A;  4KOT A;  3DNS A;  2ZEN A;  3F5B A;  5F46 A;  1N71 A;  2GIV A;  4UFV A;  5K8N A;  1RXT A;  1XBU A;  2B5G B;  5C88 A;  1I21 A;  4LUA A;  1QSR A;  5AGE A;  1IYK A;  2XEI A;  4QVT A;  4OIW A;  2EK9 A;  4KZT A;  4CPA A;  1GYT A;  2VI7 A;  4F8Z A;  1Y9K A;  1NSL A;  1Z8T A;  2IQ6 A;  2DPT A;  3N5F A;  2B3V A;  2C6C A;  2HQY A;  1CM0 A;  1Z8L A;  3PB7 X;  4X2T A;  4AG7 A;  4CAV A;  2PJ5 A;  3RZA A;  4FD4 A;  3R9G A;  4A94 A;  4TWE A;  1Z8X A;  4PXE A;  4QB9 A;  3B7I A;  1BO4 A;  4P44 A;  2B4D B;  4KOY A;  4R3L A;  2I00 A;  3IO1 A;  2ZEO A;  2AFZ A;  4MBU A;  2H5M A;  4F9U A;  1CPS A;  4BD9 A;  4KSF A;  1XE4 A;  3RAM A;  1LFW A;  5FVJ A;  4NGS A;  5G22 A;  1M4I A;  3CPA A;  4GXH A;  4MXU A;  4F9V A;  3P2F A;  3H4Q A;  4FUU A;  2NMT A;  2BSW A;  4IAV A;  2PE3 A;  4OLL A;  2V8V A;  4ZY1 A;  2R8V A;  1S5K A;  5J8F A;  3ISZ A;  2J9A A;  3H8F A;  4H6U A;  3TTH A;  3B3T A;  4XPD B;  3TFY A;  3W6S A;  4XNH C;  1ELL P;  2CY2 A;  4MMO A;  1YR0 A;  2BCO A;  2BO9 A;  2PIY A;  5LRK A;  3RO0 A;  1Q2Y A;  5HVH A;  3TOB A;  4R57 A;  1Y0Y A;  2OB0 A;  3GY9 A;  2ZW5 A;  3F8K A;  1ELM P;  1SQH A;  1ZG9 A;  2AFM A;  2CTB A;  3FJU A;  5F48 A;  4DUK A;  1IIC A;  1LRZ A;  3D8P A;  3WAB A;  4C2Y A;  2FIA A;  3RYO A;  4R8F A;  1CJW A;  4CGP A;  2C1C A;  4QUS A;  4YWY A;  5D29 A;  3KGQ A;  4C68 A;  1Z9U A;  1R43 A;  3PB4 X;  2V8H A;  3D68 A;  3LD2 A;  2VQY A;  3KHX A;  2CIJ A;  4X3R A;  3D3S A;  1S7L A;  1Y9W A;  2AFS A;  2GFQ A;  4FBE A;  4HNX B;  3GKR A;  2CF4 A;  3IGR A;  1XMT A;  2Q4Z A;  3K9U A;  5DS0 A;  4NFR A;  3ZZI A;  1IOF A;  4CGN A;  1Q2C A;  4UWJ A;  4ZY2 A;  3BXM A;  4OC4 A;  4KUB A;  4OC0 A;  1YRE A;  4PPZ A;  1V0C A;  4OME A;  2PJ0 A;  1S7F A;  3CXQ A;  4Q7A A;  3FVL A;  2PJA A;  4CRY B;  5KTA A;  1OBR A;  3CDX A;  1Z8W A;  3K2K A;  4MCP A;  1S7N A;  3TO7 A;  2HB6 A;  2ANP A;  3F0A A;  4JJX A;  4ONW A;  2CNS A;  3KKW A;  4F0Y A;  4P4B A;  1KWM A;  4Q36 A;  3CXS A;  3GB0 A;  4MHY A;  2C6G A;  2PDO A;  3S6H A;  3I1U A;  5F09 A;  1EE3 P;  2PRQ A;  1MJB A;  3NE7 A;  2GRE A;  4YGO A;  4MFP A;  5H86 A;  4C2Z A;  2OU2 A;  2J8R A;  2OZG A;  4JYW A;  5DWM A;  4KS9 A;  2DXQ A;  4UEF A;  2EUI A;  3S6G A;  5AG4 A;  3PB9 X;  4PXB A;  4R7M A;  4Y49 B;  2PRB A;  1Z4E A;  3VAT A;  4DNC A;  4M6H A;  5AG7 A;  3MN8 A;  4MFQ A;  4P4E A;  4CYQ A;  5LYI A;  4PQA A;  2OH1 A;  3PP9 A;  3B8G A;  5HVF A;  2OZH A;  2IL4 A;  4OC2 A;  4BIN A;  4YFJ A;  3BI0 A;  4KUA A;  4O23 A;  1QSN A;  3KL9 A;  2P6G A;  4UEZ A;  2Q44 A;  5THW A;  3FH4 A;  1VHE A;  2RFH A;  1LAP A;  3BLN A;  1M4G A;  2ZEG A;  3D2P A;  4KOW A;  4JZ0 A;  3JVN A;  4AB7 A;  4MY0 A;  2FT0 A;  4DJL A;  2YNE A;  1NSA A;  4EVY A;  2NSM A;  3LMS A;  1ZLI A;  2Z3L A;  2Z3K A;  4P4I A;  2A4N A;  4E0A A;  4HKF A;  3B3C A;  4H89 A;  2B4D A;  5LYF A;  4Z65 A;  2R1I A;  4KOX A;  2Z11 A;  3BI1 A;  3D4U A;  3IC1 A;  4F6A A;  1NE9 A;  5G1Z A;  2YGW A;  3LWU A;  3KHZ A;  4M6I A;  4CGM A;  4KVO E;  4G1P A;  2EWB A;  2F8H A;  4IUS A;  4A31 A;  5EMI A;  3FMC A;  4UWI A;  2QML A;  3IWE A;  1H8L A;  3B3W A;  3KQZ A;  3DLJ A;  4OKO A;  3L2N A;  3FNC A;  3DDD A;  5KTC A;  1RO5 A;  5LYD A;  4GS4 A;  4CYO A;  2V8D A;  1YVK A;  1DTD A;  2Q7B A;  5HH1 A;  1HDQ A;  4PK3 A;  3HLP A;  4UCN A;  4P10 A;  4BMH A;  3TE4 A;  4ONU A;  3P2H A;  1RTQ A;  2FVG A;  4UFX A;  4KSI A;  4MHP A;  1TIQ A;  1OZP A;  3C26 A;  4NXY A;  4OAD A;  1S3Z A;  3SXO A;  4UIA A;  2AFX A;  5AG6 A;  1R3N A;  3FED A;  5K8M A;  2PJ8 A;  2XEJ A;  1VKC A;  4FWU A;  4U5Y A;  2Z3P A;  4A33 A;  1GHE A;  3CT9 A;  4DYO A;  2PSW A;  3H5Z A;  2ZEP A;  4OC1 A;  4A2Z A;  4MHZ A;  4LQG A;  1LOK A;  4E2A A;  4ZX9 A;  5CBM A;  4C7I A;  4KSA A;  2GE3 A;  5JH9 A;  2Q4V A;  4JWP A;  3SI2 A;  2I79 A;  3MRU A;  3EO4 A;  4L8A A;  2B58 A;  2P6F A;  4A38 A;  2PR1 A;  1QSO A;  2J8M A;  4PXC A;  1IY7 A;  3S9M A;  2VEZ A;  5A27 A;  5A28 A;  1VGY A;  3CZX A;  4PXD A;  1LAM A;  2GLJ A;  4NEX A;  1X10 A;  3FB3 A;  2AJ6 A;  2ZEF A;  1R57 A;  2PJ7 A;  2ZW7 A;  4MFL A;  5BWA B;  3PFO A;  3V7Z A;  3PBE A;  5EBV A;  2PJB A;  2DF5 A;  2Q51 A;  2ZEL A;  3RNZ A;  1CP7 A;  2PJ3 A;  1HEE A;  3I9S A;  5F49 A;  1FY7 A;  4M6G A;  4NCZ A;  1Y0R A;  2HV2 A;  4AXV A;  4JXQ A;  5LYL A;  1QQ9 A;  2JDC A;  2WYR A;  1B87 A;  1CG2 A;  3QB8 A;  3D7D A;  1KUY A;  2IJZ A;  1XRY A;  4R76 A;  5JM6 A;  2REE A;  2O53 A;  4TNU A;  1VHO A;  2F7V A;  5H84 A;  4I49 A;  2Z3M A;  5IV0 A;  5E96 A;  2RB7 A;  3VAR A;  5IX3 A;  1F2O A;  2FIW A;  3TT2 A;  5ISV A;  2Z3N A;  3UY5 A;  3PFE A;  2V8G A;  3PZJ A;  1UWY A;  4EWT A;  4H2K A;  3SHP A;  1I1D A;  3PGP A;  2VBQ A;  1M44 A;  2D4P A;  4MCR A;  1XF8 A;  1ZG7 A;  5JQ4 A;  4YRH A;  2HC9 A;  2V77 A;  3GUX A;  3T8W A;  1U6M A;  4KVM E;  4CGL A;  2WPW A;  3D7G A;  3NA6 A;  2WZN A;  2ODF A;  2POK A;  2PJ1 A;  4JD6 A;  4MCS A;  2Q43 A;  1NMT A;  1DE4 C;  1FNO A;  2Z10 A;  3WC5 A;  2ZW6 A;  3SJE A;  4CAX A;  5K8O A;  1Q2D A;  4OP4 A;  5I4M A;  4OAE A;  5IB0 A;  2R7H A;  2PR8 A;  2EK8 A;  2JLM A;  3FF3 A;  1QST A;  2Q7S A;  4NF1 A;  4A95 A;  3B3V A;  1MJ9 A;  2C27 A;  2Y0M A;  2ZED A;  1P0H A;  1YME A;  1HDU A;  3KI9 A;  3IWG A;  3S6K A;  1ZG8 A;  5ELY A;  2CNT A;  1TKJ A;  1MK4 A;  3KQX A;  2B4B A;  2PC1 A;  1Y7E A;  3SJG A;  1F57 A;  1IU8 A;  2VXK A;  3FEE A;  2GU2 A;  1CPX A;  8CPA A;  7CPA A;  1XEB A;  2R98 A;  1YGH A;  4Q38 A;  4R87 A;  1VHS A;  4MY3 A;  2ABZ A;  3LAC A;  2FS5 A;  4RI1 A;  4E8O A;  4X8I A;  3IEH A;  2Z3O A;  4CAE A;  2J8N A;  2JBJ A;  3B2Y A;  1IYL A;  1XIX A;  1PU9 A;  3R1K A;  1WK4 A;  2ZXV A;  1IOI A;  4CS0 B;  1IB1 E;  1ARL A;  4U9Y A;  2ARH A;  2JEV A;  4PSW A;  2OOT A;  4A39 A;  2BL1 A;  3VWE A;  2WPX A;  2ZEH A;  1PUA A;  2PJ9 A;  3BJ7 A;  5D8N A;  1F2P A;  3V8I A;  3E0K A;  3VWD A;  4FD7 A;  2ZEM A;  2WUU A;  1XMB A;  1TXR A;  4P45 A;  2BUE A;  3JRU A;  1QMU A;  2PJ4 A;  4KLW A;  4UA3 A;  4XPD C;  4NGR A;  1PCA A;  1ON0 A;  2G9D A;  4MHD A;  3NH5 A;  4ZI6 A;  4M85 A;  5F47 A;  3ZJ0 A;  3T9Y A;  4A37 A;  4PSX A;  1BPN A;  1TF9 A;  2PJC A;  3KR4 A;  1IID A;  4KOU A;  2PJ6 A;  3G3S A;  1TKF A;  3WC7 A;  3FRM A;  1P4N A;  4HNY B;  4II9 A;  3D2M A;  2VZZ A;  5CNP A;  2G3T A;  3RBU A;  2JDD A;  1M4D A;  3EXN A;  4K3N A;  3V38 A;  1CBX A;  4FD6 A;  3S9N A;  3KZW A;  3NFZ A;  3G8W A;  3TX8 A;  3NE8 A;  5HMN A;  3PEI A;  3JTK A;  2CTC A;  3HUV A;  4IHM A;  4PK2 A;  3D67 A;  4XPL A;  2JBK A;  2I3C A;  1Z5R A;  1M1D A;  2YND A;  1VIX A;  2YNC C;  1TF8 A;  4UBR A;  3EC4 A;  4X5K A;  3FXT A;  3R9F A;  3QAH A;  4M3S A;  3WT4 A;  5C82 A;  3FIX A;  2YNC A;  3FEC A;  1LCP A;  4CRZ B;  3R9E A;  4B12 A;  1PYT B;  1YK3 A;  2B3U A;  4C7H A;  3KAS A;  3DGV A;  3A9L A;  1ARM A;  2O4H A;  2VZY A;  3W91 A;  2BEI A;  1YLO A;  4QBJ A;  2P6E A;  4ZYQ A;  5K8P A;  3DR8 A; 
#chains in the Genus database with same CATH homology
 3R95 A;  4R9M A;  1K4J A;  3FYN A;  4B5P B;  5G21 A;  2PQ8 A;  5I0C A;  1Z4R A;  1YVO A;  4MI4 A;  4AVB A;  1KUV A;  2Z0Z A;  5GCN A;  4MFZ A;  4MJ8 A;  1MJA A;  2ZW4 A;  4AVA A;  4LX9 A;  2G3A A;  4FD5 A;  3WR7 A;  4JLY A;  2CXA A;  3IU1 A;  4Y49 C;  3W6X A;  2ZPA A;  4XPK A;  1KUX A;  4KOV A;  5JPH A;  1L0C A;  4MFJ A;  4UCM A;  4UFW A;  2REF A;  2FXF A;  3TO6 A;  2HUZ A;  4R3K A;  4ZGY B;  2WSA A;  4U9Z A;  2O28 A;  4C2X A;  1YLE A;  5EC4 A;  3CXP A;  3OWC A;  4AVC A;  2ATR A;  3DSB A;  2KCW A;  4B10 A;  4B5O A;  5AG5 A;  3IU2 A;  4CYP A;  4F0X A;  2CNM A;  1B6B A;  4PV6 A;  4B14 A;  2P0W A;  4KLV A;  4RS2 A;  1J4J A;  3LOD A;  4UCP A;  4A31 A;  4NSQ A;  1S7K A;  4KOR A;  4A32 A;  2Q04 A;  2QIR A;  3TO9 A;  3JUW A;  3MGD A;  3EY5 A;  4J3G A;  4BBH A;  3R96 A;  4XNH B;  3TOA A;  5G20 A;  4JXR A;  3FBU A;  1BOB A;  1ZO0 A;  5J8C A;  2QEC A;  3TCV A;  4A30 A;  1I12 A;  4B13 A;  4B11 A;  3EFA A;  4MFK A;  5DWN A;  4CGO A;  4HNW B;  4KVX A;  4K30 A;  4ORF A;  4AG9 A;  2DPS A;  2GAN A;  2B5G A;  2FSR A;  2RC4 A;  4IF5 A;  2D4O A;  1KZF A;  2EVN A;  2Q4Y A;  3N7Z A;  3T90 A;  1YX0 A;  1S60 A;  3S6F A;  3GYA A;  4L89 A;  2FL4 A;  1UFH A;  3I3G A;  2FCK A;  4ZBG A;  4CYN A;  4B5P A;  2K5T A;  3DR6 A;  4CAF A;  1Y7R A;  4CAW A;  3BJ8 A;  2F5I A;  3SXN A;  2G0B A;  2Q0Y A;  4H6Z A;  4QC6 A;  1QSM A;  2FE7 A;  5KTD A;  2AE6 A;  2OZU A;  4KOS A;  1WWZ A;  2X7B A;  4KOT A;  3DNS A;  3F5B A;  5F46 A;  1N71 A;  2GIV A;  4UFV A;  1RXT A;  2B5G B;  5C88 A;  1I21 A;  4LUA A;  1QSR A;  5AGE A;  1IYK A;  4QVT A;  4KZT A;  2VI7 A;  1Y9K A;  1NSL A;  2DPT A;  2B3V A;  2HQY A;  1CM0 A;  4AG7 A;  4CAV A;  4FD4 A;  3R9G A;  4QB9 A;  1BO4 A;  2B4D B;  4KOY A;  4R3L A;  2I00 A;  4MBU A;  2H5M A;  4KSF A;  1XE4 A;  5FVJ A;  5G22 A;  1M4I A;  3P2F A;  3H4Q A;  2NMT A;  2BSW A;  4OLL A;  2R8V A;  1S5K A;  5J8F A;  4H6U A;  3TTH A;  4XPD B;  3TFY A;  3W6S A;  4XNH C;  2CY2 A;  1YR0 A;  1Q2Y A;  3TOB A;  4R57 A;  2OB0 A;  3GY9 A;  2ZW5 A;  3F8K A;  1SQH A;  5F48 A;  1IIC A;  1LRZ A;  3D8P A;  4C2Y A;  2FIA A;  3RYO A;  1CJW A;  4CGP A;  4QUS A;  4C68 A;  1Z9U A;  3LD2 A;  2VQY A;  3D3S A;  1S7L A;  1Y9W A;  4HNX B;  3GKR A;  3IGR A;  1XMT A;  3K9U A;  3ZZI A;  4CGN A;  1Q2C A;  4UWJ A;  4KUB A;  1YRE A;  1V0C A;  1S7F A;  3CXQ A;  4CRY B;  5KTA A;  1S7N A;  3TO7 A;  4JJX A;  3F0A A;  2CNS A;  3KKW A;  4F0Y A;  4Q36 A;  3CXS A;  2PDO A;  3S6H A;  1MJB A;  3NE7 A;  4YGO A;  4MFP A;  5H86 A;  4C2Z A;  2OU2 A;  2J8R A;  2OZG A;  5DWM A;  4KS9 A;  2DXQ A;  2EUI A;  3S6G A;  5AG4 A;  4Y49 B;  2PRB A;  1Z4E A;  4DNC A;  5AG7 A;  4MFQ A;  4CYQ A;  2OH1 A;  3PP9 A;  3B8G A;  2OZH A;  2IL4 A;  4YFJ A;  4KUA A;  1QSN A;  2P6G A;  2Q44 A;  3BLN A;  1M4G A;  3D2P A;  4KOW A;  4AB7 A;  3JVN A;  4MY0 A;  2FT0 A;  2YNE A;  4EVY A;  2Z3L A;  2Z3K A;  2A4N A;  4E0A A;  4HKF A;  4H89 A;  2B4D A;  2R1I A;  4KOX A;  2Z11 A;  4F6A A;  1NE9 A;  5G1Z A;  2YGW A;  4CGM A;  4KVO E;  4IUS A;  4UWI A;  2QML A;  3IWE A;  3FNC A;  3DDD A;  5KTC A;  1RO5 A;  4GS4 A;  4CYO A;  1YVK A;  2Q7B A;  5HH1 A;  4PK3 A;  4UCN A;  4BMH A;  3TE4 A;  4ONU A;  3P2H A;  4UFX A;  1TIQ A;  1OZP A;  3C26 A;  4NXY A;  4OAD A;  1S3Z A;  3SXO A;  5AG6 A;  1VKC A;  4U5Y A;  2Z3P A;  4A33 A;  1GHE A;  2PSW A;  3H5Z A;  4A2Z A;  4E2A A;  4C7I A;  4KSA A;  2GE3 A;  2Q4V A;  4JWP A;  2I79 A;  3EO4 A;  4L8A A;  2B58 A;  2P6F A;  2PR1 A;  1QSO A;  2J8M A;  2VEZ A;  5A27 A;  5A28 A;  4NEX A;  3FB3 A;  4MFL A;  2AJ6 A;  1R57 A;  2ZW7 A;  5BWA B;  5EBV A;  3I9S A;  5F49 A;  1FY7 A;  4NCZ A;  2HV2 A;  4JXQ A;  2JDC A;  1B87 A;  3QB8 A;  1KUY A;  2REE A;  5H84 A;  4I49 A;  2Z3M A;  5IV0 A;  5E96 A;  5IX3 A;  2FIW A;  3TT2 A;  5ISV A;  2Z3N A;  3UY5 A;  3PZJ A;  3SHP A;  1I1D A;  3PGP A;  2VBQ A;  1M44 A;  2D4P A;  1XF8 A;  5JQ4 A;  4YRH A;  1U6M A;  4KVM E;  4CGL A;  2WPW A;  4JD6 A;  1NMT A;  2Z10 A;  2ZW6 A;  4CAX A;  1Q2D A;  4OAE A;  5IB0 A;  2R7H A;  2PR8 A;  2JLM A;  1QST A;  4NF1 A;  4A95 A;  1MJ9 A;  2C27 A;  2Y0M A;  1P0H A;  3IWG A;  3S6K A;  2CNT A;  1MK4 A;  2B4B A;  2PC1 A;  2VXK A;  1XEB A;  2R98 A;  1YGH A;  4Q38 A;  4R87 A;  1VHS A;  4MY3 A;  2FS5 A;  4RI1 A;  4E8O A;  2Z3O A;  4CAE A;  2J8N A;  1IYL A;  1XIX A;  1PU9 A;  3R1K A;  1WK4 A;  2ZXV A;  4CS0 B;  1IB1 E;  4U9Y A;  2ARH A;  2JEV A;  4PSW A;  2BL1 A;  3VWE A;  2WPX A;  1PUA A;  3BJ7 A;  3V8I A;  3VWD A;  3E0K A;  4FD7 A;  2WUU A;  2BUE A;  4XPD C;  4KLW A;  4UA3 A;  1ON0 A;  4MHD A;  4M85 A;  5F47 A;  3ZJ0 A;  3T9Y A;  4PSX A;  1IID A;  4KOU A;  3G3S A;  4II9 A;  3FRM A;  1P4N A;  4HNY B;  3D2M A;  2VZZ A;  5CNP A;  2G3T A;  2JDD A;  1M4D A;  3EXN A;  4FD6 A;  3G8W A;  5HMN A;  3JTK A;  4PK2 A;  4XPL A;  1M1D A;  2YND A;  2YNC C;  4UBR A;  4X5K A;  3EC4 A;  3FXT A;  3R9F A;  3QAH A;  4M3S A;  5C82 A;  3FIX A;  2YNC A;  4CRZ B;  3R9E A;  4B12 A;  1YK3 A;  2B3U A;  4C7H A;  3A9L A;  3W91 A;  2VZY A;  2BEI A;  4QBJ A;  2P6E A;  3DR8 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...