1RO5A

Crystal structure of the ahl synthase lasi
Total Genus 56
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
56
sequence length
197
structure length
197
Chain Sequence
b'GSHMIVQIGRREEFDKKLLGEMHKLRAQVFKERKGWDVSVIDEMEIDGYDALSPYYMLIQEDGQVFGCWRILDTTGPYMLKNTFPELLHGKEAPCSPHIWELSRFAINSGQKGSLGFSDCTLEAMRALARYSLQNDIQTLVTVTTVGVEKMMIRAGLDVSRFGPHLKIGIERAVALRIELNAKTQIALYGGVLVEQR'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Autoinducer synthesis protein lasI
molecule tags Signaling protein
source organism Pseudomonas aeruginosa
publication title Structure of the Pseudomonas aeruginosa acyl-homoserinelactone synthase LasI.
pubmed doi rcsb
total genus 56
structure length 197
sequence length 197
ec nomenclature ec 2.3.1.184: Acyl-homoserine-lactone synthase.
pdb deposition date 2003-12-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00765 Autoind_synth Autoinducer synthase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.630.30 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Aminopeptidase 1ro5A01
3DDDA 3FNCA 3TCVA 2Q0YA 4F6AA 4XNHB 1MJ9A 2OZGA 2EUIA 1V0CA 4ONUA 2B4BA 4R3KA 2VQYA 3IWGA 2EVNA 4AVAA 4PK3A 2REFA 3CXSA 4XNHC 3TOAA 1MJAA 4KUBA 4NXYA 3OWCA 4U9ZA 2ZW4A 4H6ZA 4JLYA 2FCKA 3TO7A 3ZZIA 1M1DA 1BOBA 2PR8A 1I12A 2A4NA 1PU9A 1L0CA 1MJBA 2B5GB 2BUEA 1NE9A 1WWZA 5HMNA 2HUZA 2F5IA 4B5PA 4E2AA 5HH1A 3RYOA 3FRMA 4YFJA 4MBUA 2WPXA 4QBJA 1CJWA 1IYKA 3TE4A 3T9YA 1SQHA 2PQ8A 1YK3A 2GE3A 2JLMA 4J3GA 4KORA 3R95A 4HNWB 3D2MA 5EBVA 4FD5A 4NF1A 1Q2YA 1XEBA 4YGOA 3H4QA 4CAXA 3EO4A 3LODA 3FBUA 4AG9A 3DR8A 4QUSA 4R57A 2Z10A 2FSRA 3C26A 3S6FA 4RS2A 1XE4A 3GYAA 2G3AA 1RO5A 1KZFA 3GY9A 2AE6A 1CM0A 4X5KA 1I21A 3FB3A 2PRBA 2CNMA 2Q44A 4KOSA 1YVOA 3FYNA 4JWPA 1OZPA 3QAHA 3EY5A 5F47A 2ZW7A 3FXTA 4KVME 1M4IA 4IF5A 3D3SA 4JJXA 2FT0A 5IV0A 2KCWA 2C27A 4MJ8A 5IX3A 2G0BA 1KUVA 1NSLA 2OU2A 2WPWA 4AVCA 3F5BA 1Z4EA 2FE7A 1XMTA 2ATRA 1LRZA 4MY3A 5IB0A 4NSQA 2P6GA 1S7KA 2Y0MA 4NEXA 2GIVA 2FIWA 3IGRA 4KLWA 2R98A 3EFAA 4ZBGA 3V8IA 5I0CA 1S60A 1Z4RA 3S6HA 2VXKA 2HV2A 3G3SA 3DR6A 4OADA 4MHDA 1S7LA 4KOWA 4PSWA 3QB8A 3UY5A 4MI4A 3R96A 4DNCA 4M3SA 4XPDB 3VWDA 4PV6A 4KOVA 3F8KA 5KTDA 4B5OA 2OB0A 1P0HA 4KLVA 3MGDA 4L8AA 3SHPA 2J8RA 2D4OA 1NMTA 1YGHA 2OZUA 5J8FA 2JEVA 4MY0A 5KTCA 1I1DA 2K5TA 2P0WA 2B5GA 2FL4A 4KOUA 4KUAA 2B4DA 3R1KA 1IB1E 5F49A 1ON0A 2PC1A 4OLLA 1YX0A 4U5YA 4PK2A 3I9SA 3N7ZA 3D2PA 3F0AA 5H84A 1S3ZA 5EC4A 1BO4A 2ZW6A 2Q04A 3ZJ0A 4KVOE 4PSXA 3W6SA 3CXPA 2VEZA 4IUSA 3JUWA 3D8PA 5FVJA 1IICA 2FIAA 1YR0A 4XPKA 4RI1A 1B87A 4HKFA 1Q2DA 2GANA 4YRHA 3S6GA 3R9GA 4QB9A 1VHSA 2IL4A 2R1IA 3TO6A 3KKWA 2B58A 2O28A 1QSOA 2G3TA 3PZJA 2ZPAA 4AB7A 3G8WA 1YVKA 2JDCA 4KZTA 1QSMA 4FD6A 3TO9A 1UFHA 3TT2A 2DXQA 3R9FA 4L89A 3EC4A 5H86A 5DWNA 1IYLA 4I49A 1QSTA 1S5KA 1GHEA 2AJ6A 2PR1A 4HNYB 2R7HA 5C88A 1WK4A 2CY2A 4CS0B 3BJ8A 4KOYA 2Q7BA 4HNXB 4NCZA 5F46A 4E0AA 4UA3A 4AVBA 3PGPA 4CRYB 2FS5A 2REEA 3B8GA 3FIXA 4K30A 5GCNA 4JXQA 3BLNA 4B5PB 1M44A 2H5MA 4H89A 3WR7A 3K9UA 2VZYA 1KUYA 2B4DB 3W91A 1N71A 4EVYA 4E8OA 2Z0ZA 2X7BA 1Y9WA 5JQ4A 3PP9A 5C82A 4KOXA 1PUAA 2Q4YA 4XPDC 3DSBA 2BSWA 1VKCA 5CNPA 3VWEA 4UWJA 2I00A 3P2HA 2OZHA 2QMLA 5JPHA 4QVTA 2HQYA 2FXFA 1M4DA 4XPLA 2ZW5A 2Z11A 5DWMA 2CNSA 1S7FA 1FY7A 1S7NA 3P2FA 4R87A 4BMHA 1XIXA 4M85A 1QSNA 3NE7A 4R9MA 5ISVA 5F48A 4LUAA 3TTHA 3TFYA 3SXOA 2BL1A 2Q4VA 3CXQA 4R3LA 4CRZB 4JD6A 5E96A 3W6XA 1Q2CA 4UBRA 2JDDA 4F0YA 4U9YA 2J8NA 2QIRA 1RXTA 1J4JA 3I3GA 2BEIA 2NMTA 3T90A 1QSRA 1Y9KA 4AG7A 4JXRA 3BJ7A 1Y7RA 1XF8A 3R9EA 2P6FA 2QECA 2ZXVA 1YREA 2P6EA 1Z9UA 4II9A 4H6UA 4CAVA 4UWIA 4FD7A 2ARHA 4FD4A 4KVXA 2OH1A 2B3UA 4Y49B 2J8MA 3S6KA 1U6MA 4QC6A 1TIQA 1YLEA 1M4GA 2VZZA 3GKRA 2I79A 4LX9A 1B6BA 1IIDA 2R8VA 1P4NA 4GS4A 2VBQA 2CNTA 2PDOA 1R57A 1MK4A 2VI7A 3EXNA 5J8CA 2PSWA 3E0KA 2RC4A 3TOBA 4ORFA 5KTAA 4CAWA 2B3VA 3LD2A 3SXNA 4Y49C 1K4JA 3JVNA 1KUXA 4KOTA 2D4PA 4OAEA 3DNSA
chains in the Genus database with same CATH superfamily
4Z65A 3DDDA 3FNCA 3IEHA 4MRIA 1LOKA 3VATA 3TCVA 2Q0YA 4F6AA 1GYTA 4XNHB 1MJ9A 2OZGA 3KQZA 4FUUA 2EUIA 1V0CA 4ONUA 2B4BA 4R3KA 2AFUA 3SI0A 2HC9A 1CP7A 2VQYA 4GXHA 3IWGA 2EVNA 4NGQA 4AVAA 3H5ZA 2REFA 4PK3A 1CPXA 3CXSA 4ZI6A 1TKFA 3D7FA 1NSAA 1ZO0A 2ODFA 4XNHC 3TOAA 1MJAA 4UEEA 3WC7A 4KUBA 3CZXA 1BPNA 2I3CA 2F8HA 4NXYA 3RAMA 2V8HA 4C7IA 3OWCA 4U9ZA 3PB8X 3DGVA 1QMUA 2ZW4A 4H6ZA 4JLYA 2FCKA 2F7VA 3TO7A 1ZG7A 2J9AA 2DF5A 4Q7AA 1R3NA 3ZZIA 1M1DA 3RNZA 2CTBA 1BOBA 5LRKA 2PR8A 1BAVA 3NH8A 6CPAA 1I12A 3IU2A 2A4NA 2DEAA 2EO8A 1PU9A 3PB7X 1L0CA 3K9TA 1MJBA 2B5GB 4P4IA 3CT9A 2PJ7A 2BUEA 1LCPA 3NH5A 1NE9A 3VARA 4DJLA 1WWZA 3K2KA 3SI2A 4FBEA 5HMNA 3B7IA 4C2YA 3CDXA 2HUZA 2F5IA 4B5PA 4E2AA 1IOIA 5HH1A 3FH4A 3RYOA 3B35A 3FRMA 1ARMA 2EWBA 4MBUA 4YFJA 2WPXA 4QBJA 1CJWA 3PFOA 3SJGA 2JEWA 1CP6A 2CXAA 1IYKA 2PJCA 3SJXA 4R8FA 3T9YA 3TE4A 1SQHA 1YMEA 2PQ8A 1YK3A 4MFJA 3WC5A 2GE3A 5AG6A 1JWQA 3B3VA 1CG2A 2JLMA 3GUXA 2O53A 4A95A 4ZX8A 1ELLP 4J3GA 4KORA 4YWYA 5A28A 3R95A 4HNWB 4TNUA 3D2MA 4P45A 5HVGA 4MFZA 2QJ8A 5EBVA 4FD5A 4IK2A 1FT7A 4NF1A 1Q2YA 4B11A 4H2KA 4UF4A 4A37A 4TWEA 4JZ0A 1XEBA 4CYPA 1LAMA 4YGOA 2ZOGA 3H4QA 4CAXA 1Y0YA 1XOVA 3EO4A 4GM5A 2IJZA 2V8DA 4P4DA 4C2ZA 2AFMA 3WC6A 3LODA 3FBUA 2IQ6A 4AG9A 3NE8A 3NA6A 3WT4A 4AXVA 2Q43A 2PIZA 3DR8A 4QUSA 4R57A 3S9NA 5AG5A 2Z10A 2FSRA 1ZG8A 3C26A 4UEZA 4B13A 3S6FA 4RS2A 1XE4A 2YNCA 2G3AA 3GYAA 1CPSA 1RO5A 3ISXA 3TC8A 2GLFA 3DLJA 3B3WA 1KZFA 3GY9A 2AE6A 5THWA 1AYEA 2PJAA 3VH9A 3NH4A 3KR4A 1FNOA 1CM0A 1CBXA 3KHZA 4X5KA 1I21A 3FB3A 2PRBA 2CNMA 2Q44A 2WYRA 2XEGA 2PVVA 4M6HA 4KOSA 1YVOA 2PJ3A 3FYNA 4JWPA 4CYQA 3FX6A 1OZPA 5LRGA 4CAEA 4MHZA 3QAHA 4MHPA 3SJEA 3EY5A 4OP4A 2PJ8A 1XMBA 5F47A 2ZW7A 4A94A 3FXTA 4B6ZA 4UCNA 4KVME 4PXDA 1M4IA 4CYOA 1LANA 3RZAA 2CF4A 4IF5A 3D3SA 4JJXA 2CTCA 2FT0A 3V38A 5IV0A 2KCWA 2C27A 4MJ8A 2PIYA 1TKHA 4KS9A 4R6TA 5IX3A 3IIBA 2G0BA 4MCRA 4UIAA 1KUVA 1NSLA 2OU2A 2WPWA 3KGQA 4AVCA 3F5BA 2YNCC 1JQGA 5K8MA 1Z4EA 1VIXA 2FE7A 1XMTA 2ATRA 2JBJA 1LRZA 4MY3A 1KWMA 1VHEA 3IC1A 5IB0A 4NSQA 2P6GA 1S7KA 4CGMA 1F2PA 2Y0MA 2Z3KA 2GIVA 4NEXA 2FIWA 3IGRA 4KLWA 3CPAA 1RTQA 4RUHA 2R98A 1Z5RA 3EFAA 4UEFA 4ZBGA 4X2TA 2PJ6A 3V8IA 4G1PA 5I0CA 4UFVA 2XEIA 1S60A 2V8VA 1Z4RA 3S6HA 5J1QA 2AFWA 2VXKA 1XRYA 2HV2A 3G3SA 1EE3P 3DR6A 4ZY0A 3SI1A 2ABZA 3GB0A 4NGPA 2AFOA 4OADA 2XEJA 4MHDA 1S7LA 4KOWA 4B12A 4PSWA 2Z3LA 1TXRA 4Q36A 4X3RA 1ZLHA 3IJ3A 3QB8A 4MI4A 3R96A 3UY5A 4A30A 4DNCA 4M3SA 4MMOA 4XPDB 3VWDA 4M6GA 4PV6A 4KOVA 3F8KA 5AG7A 5KTDA 4B5OA 4FAIA 4MHNA 4C68A 5JH9A 2OB0A 1P0HA 3D68A 4KLVA 1AMPA 3MGDA 1XBUA 2AFXA 4L8AA 3SHPA 2HB6A 1PYTB 4ZY1A 4M6IA 2J8RA 2D4OA 4W9YA 4ZX9A 1NMTA 1YGHA 1Z8TA 2OZUA 3FECA 4KSFA 8CPAA 5J8FA 2JEVA 2WUUA 4MY0A 5A27A 5KTCA 1I1DA 2K5TA 2P0WA 4A33A 1YW4A 4OC4A 2B5GA 2FL4A 1X12A 2ZEFA 4KOUA 4KUAA 1UWYA 2B4DA 3R1KA 4A32A 4B14A 1VHOA 1IB1E 5F49A 3D67A 3PBEA 1ON0A 4UFWA 4PXCA 2PC1A 1TF8A 4OLLA 1YX0A 4BINA 4U5YA 5K8PA 3FMCA 3PRTA 5IB9A 4PK2A 3FJUA 3I9SA 3N7ZA 3D2PA 3BI1A 3D7GA 3F0AA 4NGNA 4MFQA 2PCUA 5H84A 2Z3MA 1S3ZA 5EC4A 1BO4A 2ANPA 2RFHA 4LQGA 2ZW6A 4ZGYB 4NGTA 2Q04A 2PJ5A 3L2NA 2GREA 2VL1A 3ZJ0A 3LMSA 5K8OA 1LAPA 1H8LA 4KVOE 3IO1A 4PSXA 3W6SA 3CXPA 3IU1A 2VEZA 4IUSA 4A38A 3H8GA 4RN7A 3B3SA 3JUWA 3D66A 1HDQA 3D8PA 4R7MA 1VGYA 5FVJA 1IICA 3D7DA 3BI0A 2FIAA 4P4FA 1YR0A 1TKJA 4XPKA 4F9VA 4RI1A 4NGSA 5HVHA 1B87A 2NYQA 5I4MA 3FEEA 3LACA 2GU2A 1Q2DA 2GANA 4HKFA 4UIBA 3KQXA 4YRHA 2Z3OA 2AFZA 3S6GA 3R9GA 5DS0A 5LYFA 5BWAB 4QB9A 2YNEA 1VHSA 4MCQA 2IL4A 2R1IA 3TO6A 2C6CA 3KKWA 2B58A 5LYLA 4PPZA 2O28A 1QSOA 5CPAA 2BCOA 3PB6X 4CGNA 2G3TA 2V8GA 3PZJA 2ZPAA 3GIUA 4OC5A 4CAFA 4AB7A 4KSAA 3G8WA 3H8EA 1YVKA 1IU8A 4A39A 2JDCA 2PJBA 3PFEA 2QVPA 4B10A 4KZTA 4HPSA 1QSMA 4FD6A 3TO9A 3S9LA 4NJRA 1UFHA 1OBRA 2WSAA 3B3CA 4Q38A 3TT2A 2DXQA 2ZEMA 3KHXA 1Z2LA 5LRJA 3R9FA 3I1UA 4L89A 5K8NA 1Z8XA 1Y0RA 3EC4A 5H86A 5DWNA 3ISZA 1IYLA 2DPTA 4I49A 5G1ZA 1QSTA 1S5KA 2PJ1A 4P4BA 2Q7SA 1GHEA 2AJ6A 2PR1A 4HNYB 2R7HA 5C88A 1WK4A 2CY2A 2PJ2A 3KASA 4CS0B 3BJ8A 5G20A 4KOYA 1IY7A 1DTDA 4X8IA 2Q7BA 1Z8LA 4HNXB 4NCZA 4WWVA 5F46A 4E0AA 4MCPA 3BXMA 4UA3A 4AVBA 3PGPA 2Q51A 4CRYB 1BLLE 2FS5A 2PE3A 4CGPA 2REEA 4NFRA 4IAVA 3B8GA 3FIXA 2C6PA 2Z3PA 4C7HA 4K30A 5GCNA 4JXQA 4F0XA 5JM6A 3BLNA 4EWTA 5EMIA 3WABA 4B5PB 3LWUA 1M44A 1YLOA 1X10A 2H5MA 2ZEPA 4CPAA 3KR5A 4H89A 2OR4A 4MCSA 4F9UA 3WR7A 3KI9A 4P6YA 4P4EA 2QYVA 2VZYA 1KUYA 3K9UA 4FWUA 2PJ0A 4R76A 2B4DB 4MFPA 3TX8A 3W91A 1N71A 4EVYA 5AGEA 5D8NA 4NJQA 3D4UA 3IFEA 4E8OA 4ZYQA 4A31A 2Z0ZA 2X7BA 1Y9WA 1M4LA 3B2YA 3T8WA 3PB4X 5JQ4A 3PP9A 4PXBA 4UCMA 5C82A 4IHMA 4KOXA 1PUAA 3FVLA 2Q4YA 5ELYA 4XPDC 1F2OA 2JBKA 3DSBA 2BSWA 1VKCA 3H8FA 1TF9A 5CNPA 2EBJA 3VWEA 2PVWA 2ZEGA 4UWJA 1XJOA 2I00A 3P2HA 2OZHA 2QMLA 2RB7A 5JPHA 4QVTA 4MFLA 4C2XA 5JGFA 2HQYA 1ZLIA 2OOTA 5CBMA 2YNDA 4NGMA 2ZEEA 2FXFA 3FEDA 2PJ9A 2EK8A 2BOAA 1M4DA 5G22A 4EMEA 1DE4C 4XPLA 2ZW5A 2Z11A 5LYDA 5LYIA 3SJFA 1IOFA 4BD9A 2ZENA 5DWMA 1HDUA 1Q7LA 1CX8A 4OC1A 2CNSA 3RO0A 4PXEA 1S7FA 1FY7A 1S7NA 2POKA 3P2FA 4R87A 4YU9A 4BMHA 2O4HA 3RBUA 1XIXA 4M85A 1QSNA 3NE7A 3BHXA 4R9MA 3IWEA 1IGBA 3KZWA 5F48A 4LUAA 5ISVA 3TTHA 2Z3NA 3TFYA 4MHYA 2ZOFA 4ONWA 2C6GA 3SXOA 2BL1A 2Q4VA 3CXQA 4R3LA 3PBBA 4CRZB 1HEEA 4PQAA 4JD6A 4UFXA 5E96A 1ZG9A 4CYNA 3W6XA 2ZELA 3D7HA 5F09A 5HVFA 1Q2CA 3MRUA 4UBRA 2JDDA 4NGRA 4U9YA 4F0YA 2J8NA 5G21A 2Q4ZA 2QIRA 2YGWA 1RXTA 1J4JA 3MN8A 3I3GA 3NFZA 1Y7EA 2BEIA 2NSMA 2NMTA 3T90A 1QSRA 1Y9KA 4AG7A 4JXRA 3QNVA 2ZEHA 2C1CA 3BJ7A 1Y7RA 4OC0A 2BO9A 2XEFA 1XF8A 2ZEDA 4OMEA 3R9EA 3GLJA 2P6FA 4CGOA 2QECA 2ZXVA 1YREA 2P6EA 1Z9UA 4A2ZA 2PRQA 4H6UA 4II9A 4CAVA 4OC2A 3JRUA 4UWIA 4P44A 4FD7A 2DPSA 1BPMA 2ARHA 4FD4A 4KVXA 2OH1A 2GFQA 2B3UA 4Y49B 3FF3A 1YSJA 7CPAA 2J8MA 3PEIA 2GLJA 3S6KA 1U6MA 3IWWA 1TIQA 1YLEA 4QC6A 1M4GA 3N5FA 2ZEOA 4O23A 2VZZA 3GKRA 2I79A 4LX9A 4OC3A 4BBHA 4EFDA 2G9DA 1B6BA 4LQ6A 1AUGA 1A2ZA 1ELMP 3HUVA 1IIDA 1ARLA 4P4JA 2IMOA 2R8VA 1PCAA 4DYOA 4OIWA 2AFSA 3KL9A 1XFOA 2EK9A 1P4NA 3PB9X 3A9LA 4GS4A 2VBQA 3S9MA 2CNTA 2PDOA 5HXDA 2FVGA 4OKOA 1R57A 2WZNA 1MK4A 2VI7A 1F57A 2V77A 1Z8WA 4KSIA 3V7ZA 3EXNA 3HLPA 5J8CA 2PSWA 3E0KA 4MFKA 4F8ZA 4JYWA 4CGLA 4K3NA 2CIJA 2RC4A 1QQ9A 4ZY2A 3QAYA 5D29A 5AG4A 4UCPA 1YQEA 3TOBA 4ORFA 5KTAA 4CAWA 4OIDA 4MXUA 3CPXA 2B3VA 3LD2A 1YW6A 1R43A 4P10A 1LFWA 3SXNA 4WJBA 4Y49C 1K4JA 3JVNA 3B3TA 1KUXA 2PJ4A 2D4PA 3JTKA 4KOTA 4DUKA 4OAEA 3DNSA
chains in the Genus database with same CATH topology
3DDDA 3FNCA 3TCVA 2Q0YA 4F6AA 4XNHB 1MJ9A 2OZGA 2EUIA 1V0CA 4ONUA 2B4BA 4R3KA 2VQYA 3IWGA 2EVNA 4AVAA 3H5ZA 2REFA 4PK3A 3CXSA 1ZO0A 4XNHC 3TOAA 1MJAA 4KUBA 4NXYA 4C7IA 3OWCA 4U9ZA 2ZW4A 4H6ZA 4JLYA 2FCKA 3TO7A 3ZZIA 1M1DA 1BOBA 2PR8A 1I12A 3IU2A 2A4NA 1PU9A 1L0CA 1MJBA 2B5GB 2BUEA 1NE9A 1WWZA 5HMNA 4C2YA 2HUZA 2F5IA 4B5PA 4E2AA 5HH1A 3RYOA 3FRMA 4YFJA 4MBUA 2WPXA 4QBJA 1CJWA 2CXAA 1IYKA 3TE4A 3T9YA 1SQHA 2PQ8A 1YK3A 4MFJA 2GE3A 5AG6A 2JLMA 4A95A 4J3GA 4KORA 5A28A 3R95A 4HNWB 3D2MA 4MFZA 5EBVA 4FD5A 4NF1A 1Q2YA 4B11A 1XEBA 4CYPA 4YGOA 3H4QA 4CAXA 3EO4A 4C2ZA 3LODA 3FBUA 4AG9A 3DR8A 4QUSA 4R57A 5AG5A 2Z10A 2FSRA 3C26A 4B13A 3S6FA 4RS2A 1XE4A 2YNCA 2G3AA 3GYAA 1RO5A 1KZFA 3GY9A 2AE6A 1CM0A 4X5KA 1I21A 3FB3A 2PRBA 2CNMA 2Q44A 4KOSA 1YVOA 3FYNA 4JWPA 4CYQA 1OZPA 4CAEA 3QAHA 3EY5A 5F47A 2ZW7A 3FXTA 4UCNA 4KVME 4CYOA 1M4IA 4IF5A 3D3SA 4JJXA 2FT0A 5IV0A 2KCWA 2C27A 4MJ8A 5IX3A 4KS9A 2G0BA 1KUVA 1NSLA 2OU2A 2WPWA 4AVCA 3F5BA 2YNCC 1Z4EA 2FE7A 1XMTA 2ATRA 1LRZA 4MY3A 5IB0A 4NSQA 2P6GA 1S7KA 4CGMA 2Z3KA 2Y0MA 4NEXA 2GIVA 2FIWA 3IGRA 4KLWA 2R98A 3EFAA 4ZBGA 3V8IA 5I0CA 4UFVA 1S60A 1Z4RA 3S6HA 2VXKA 2HV2A 3G3SA 3DR6A 4OADA 4MHDA 1S7LA 4KOWA 4B12A 4PSWA 2Z3LA 4Q36A 3QB8A 3UY5A 4MI4A 3R96A 4A30A 4DNCA 4M3SA 4XPDB 3VWDA 4PV6A 4KOVA 3F8KA 5AG7A 5KTDA 4B5OA 4C68A 2OB0A 1P0HA 4KLVA 3MGDA 4L8AA 3SHPA 2J8RA 2D4OA 1NMTA 1YGHA 2OZUA 4KSFA 5J8FA 2JEVA 2WUUA 4MY0A 5A27A 5KTCA 1I1DA 2K5TA 2P0WA 4A33A 2B5GA 2FL4A 4KOUA 4KUAA 2B4DA 3R1KA 4A32A 4B14A 1IB1E 5F49A 1ON0A 4UFWA 2PC1A 4OLLA 1YX0A 4U5YA 4PK2A 3I9SA 3N7ZA 3D2PA 3F0AA 4MFQA 5H84A 2Z3MA 1S3ZA 5EC4A 1BO4A 2ZW6A 4ZGYB 2Q04A 3ZJ0A 4KVOE 4PSXA 3W6SA 3CXPA 3IU1A 2VEZA 4IUSA 3JUWA 3D8PA 5FVJA 1IICA 2FIAA 1YR0A 4XPKA 4RI1A 1B87A 4HKFA 1Q2DA 2GANA 4YRHA 2Z3OA 3S6GA 3R9GA 5BWAB 4QB9A 2YNEA 1VHSA 2IL4A 2R1IA 3TO6A 3KKWA 2B58A 2O28A 1QSOA 4CGNA 2G3TA 3PZJA 2ZPAA 4CAFA 4AB7A 4KSAA 3G8WA 1YVKA 2JDCA 4B10A 4KZTA 1QSMA 4FD6A 3TO9A 1UFHA 2WSAA 4Q38A 3TT2A 2DXQA 3R9FA 4L89A 3EC4A 5H86A 5DWNA 1IYLA 2DPTA 4I49A 5G1ZA 1QSTA 1S5KA 1GHEA 2AJ6A 2PR1A 4HNYB 2R7HA 5C88A 1WK4A 2CY2A 4CS0B 3BJ8A 5G20A 4KOYA 2Q7BA 4HNXB 4NCZA 5F46A 4E0AA 4UA3A 4AVBA 3PGPA 4CRYB 2FS5A 4CGPA 2REEA 3B8GA 3FIXA 2Z3PA 4C7HA 4K30A 5GCNA 4JXQA 4F0XA 3BLNA 4B5PB 1M44A 2H5MA 4H89A 3WR7A 3K9UA 2VZYA 1KUYA 2B4DB 4MFPA 3W91A 1N71A 4EVYA 5AGEA 4E8OA 4A31A 2Z0ZA 2X7BA 1Y9WA 5JQ4A 3PP9A 4UCMA 5C82A 4KOXA 1PUAA 2Q4YA 4XPDC 3DSBA 2BSWA 1VKCA 5CNPA 3VWEA 4UWJA 2I00A 3P2HA 2OZHA 2QMLA 5JPHA 4QVTA 4MFLA 4C2XA 2HQYA 2YNDA 2FXFA 1M4DA 5G22A 4XPLA 2ZW5A 2Z11A 5DWMA 2CNSA 1S7FA 1FY7A 1S7NA 3P2FA 4R87A 4BMHA 1XIXA 4M85A 1QSNA 3NE7A 4R9MA 5ISVA 3IWEA 5F48A 4LUAA 3TTHA 2Z3NA 3TFYA 3SXOA 2BL1A 2Q4VA 3CXQA 4R3LA 4CRZB 4JD6A 4UFXA 5E96A 4CYNA 3W6XA 1Q2CA 4UBRA 2JDDA 4F0YA 4U9YA 2J8NA 5G21A 2QIRA 2YGWA 1RXTA 1J4JA 3I3GA 2BEIA 2NMTA 3T90A 1QSRA 1Y9KA 4AG7A 4JXRA 3BJ7A 1Y7RA 1XF8A 3R9EA 2P6FA 4CGOA 2QECA 2ZXVA 1YREA 2P6EA 1Z9UA 4A2ZA 4II9A 4H6UA 4CAVA 4UWIA 4FD7A 2DPSA 2ARHA 4FD4A 4KVXA 2OH1A 2B3UA 4Y49B 2J8MA 3S6KA 1U6MA 1TIQA 1YLEA 4QC6A 1M4GA 2VZZA 3GKRA 2I79A 4LX9A 4BBHA 1B6BA 1IIDA 2R8VA 1P4NA 3A9LA 4GS4A 2VBQA 2CNTA 2PDOA 1R57A 1MK4A 2VI7A 3EXNA 5J8CA 2PSWA 3E0KA 4MFKA 4CGLA 2RC4A 5AG4A 4UCPA 3TOBA 4ORFA 5KTAA 4CAWA 2B3VA 3LD2A 3SXNA 4Y49C 1K4JA 3JVNA 1KUXA 4KOTA 2D4PA 3JTKA 4OAEA 3DNSA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3DDD A;  3FNC A;  3TCV A;  2Q0Y A;  4F6A A;  4XNH B;  1MJ9 A;  2OZG A;  2EUI A;  1V0C A;  4ONU A;  2B4B A;  4R3K A;  2VQY A;  3IWG A;  2EVN A;  4AVA A;  4PK3 A;  2REF A;  3CXS A;  4XNH C;  3TOA A;  1MJA A;  4KUB A;  4NXY A;  3OWC A;  4U9Z A;  2ZW4 A;  4H6Z A;  4JLY A;  2FCK A;  3TO7 A;  3ZZI A;  1M1D A;  1BOB A;  2PR8 A;  1I12 A;  2A4N A;  1PU9 A;  1L0C A;  1MJB A;  2B5G B;  2BUE A;  1NE9 A;  1WWZ A;  5HMN A;  2HUZ A;  2F5I A;  4B5P A;  4E2A A;  5HH1 A;  3RYO A;  3FRM A;  4YFJ A;  4MBU A;  2WPX A;  4QBJ A;  1CJW A;  1IYK A;  3TE4 A;  3T9Y A;  1SQH A;  2PQ8 A;  1YK3 A;  2GE3 A;  2JLM A;  4J3G A;  4KOR A;  3R95 A;  4HNW B;  3D2M A;  5EBV A;  4FD5 A;  4NF1 A;  1Q2Y A;  1XEB A;  4YGO A;  3H4Q A;  4CAX A;  3EO4 A;  3LOD A;  3FBU A;  4AG9 A;  3DR8 A;  4QUS A;  4R57 A;  2Z10 A;  2FSR A;  3C26 A;  3S6F A;  4RS2 A;  1XE4 A;  3GYA A;  2G3A A;  1RO5 A;  1KZF A;  3GY9 A;  2AE6 A;  1CM0 A;  4X5K A;  1I21 A;  3FB3 A;  2PRB A;  2CNM A;  2Q44 A;  4KOS A;  1YVO A;  3FYN A;  4JWP A;  1OZP A;  3QAH A;  3EY5 A;  5F47 A;  2ZW7 A;  3FXT A;  4KVM E;  1M4I A;  4IF5 A;  3D3S A;  4JJX A;  2FT0 A;  5IV0 A;  2KCW A;  2C27 A;  4MJ8 A;  5IX3 A;  2G0B A;  1KUV A;  1NSL A;  2OU2 A;  2WPW A;  4AVC A;  3F5B A;  1Z4E A;  2FE7 A;  1XMT A;  2ATR A;  1LRZ A;  4MY3 A;  5IB0 A;  4NSQ A;  2P6G A;  1S7K A;  2Y0M A;  4NEX A;  2GIV A;  2FIW A;  3IGR A;  4KLW A;  2R98 A;  3EFA A;  4ZBG A;  3V8I A;  5I0C A;  1S60 A;  1Z4R A;  3S6H A;  2VXK A;  2HV2 A;  3G3S A;  3DR6 A;  4OAD A;  4MHD A;  1S7L A;  4KOW A;  4PSW A;  3QB8 A;  3UY5 A;  4MI4 A;  3R96 A;  4DNC A;  4M3S A;  4XPD B;  3VWD A;  4PV6 A;  4KOV A;  3F8K A;  5KTD A;  4B5O A;  2OB0 A;  1P0H A;  4KLV A;  3MGD A;  4L8A A;  3SHP A;  2J8R A;  2D4O A;  1NMT A;  1YGH A;  2OZU A;  5J8F A;  2JEV A;  4MY0 A;  5KTC A;  1I1D A;  2K5T A;  2P0W A;  2B5G A;  2FL4 A;  4KOU A;  4KUA A;  2B4D A;  3R1K A;  1IB1 E;  5F49 A;  1ON0 A;  2PC1 A;  4OLL A;  1YX0 A;  4U5Y A;  4PK2 A;  3I9S A;  3N7Z A;  3D2P A;  3F0A A;  5H84 A;  1S3Z A;  5EC4 A;  1BO4 A;  2ZW6 A;  2Q04 A;  3ZJ0 A;  4KVO E;  4PSX A;  3W6S A;  3CXP A;  2VEZ A;  4IUS A;  3JUW A;  3D8P A;  5FVJ A;  1IIC A;  2FIA A;  1YR0 A;  4XPK A;  4RI1 A;  1B87 A;  4HKF A;  1Q2D A;  2GAN A;  4YRH A;  3S6G A;  3R9G A;  4QB9 A;  1VHS A;  2IL4 A;  2R1I A;  3TO6 A;  3KKW A;  2B58 A;  2O28 A;  1QSO A;  2G3T A;  3PZJ A;  2ZPA A;  4AB7 A;  3G8W A;  1YVK A;  2JDC A;  4KZT A;  1QSM A;  4FD6 A;  3TO9 A;  1UFH A;  3TT2 A;  2DXQ A;  3R9F A;  4L89 A;  3EC4 A;  5H86 A;  5DWN A;  1IYL A;  4I49 A;  1QST A;  1S5K A;  1GHE A;  2AJ6 A;  2PR1 A;  4HNY B;  2R7H A;  5C88 A;  1WK4 A;  2CY2 A;  4CS0 B;  3BJ8 A;  4KOY A;  2Q7B A;  4HNX B;  4NCZ A;  5F46 A;  4E0A A;  4UA3 A;  4AVB A;  3PGP A;  4CRY B;  2FS5 A;  2REE A;  3B8G A;  3FIX A;  4K30 A;  5GCN A;  4JXQ A;  3BLN A;  4B5P B;  1M44 A;  2H5M A;  4H89 A;  3WR7 A;  3K9U A;  2VZY A;  1KUY A;  2B4D B;  3W91 A;  1N71 A;  4EVY A;  4E8O A;  2Z0Z A;  2X7B A;  1Y9W A;  5JQ4 A;  3PP9 A;  5C82 A;  4KOX A;  1PUA A;  2Q4Y A;  4XPD C;  3DSB A;  2BSW A;  1VKC A;  5CNP A;  3VWE A;  4UWJ A;  2I00 A;  3P2H A;  2OZH A;  2QML A;  5JPH A;  4QVT A;  2HQY A;  2FXF A;  1M4D A;  4XPL A;  2ZW5 A;  2Z11 A;  5DWM A;  2CNS A;  1S7F A;  1FY7 A;  1S7N A;  3P2F A;  4R87 A;  4BMH A;  1XIX A;  4M85 A;  1QSN A;  3NE7 A;  4R9M A;  5ISV A;  5F48 A;  4LUA A;  3TTH A;  3TFY A;  3SXO A;  2BL1 A;  2Q4V A;  3CXQ A;  4R3L A;  4CRZ B;  4JD6 A;  5E96 A;  3W6X A;  1Q2C A;  4UBR A;  2JDD A;  4F0Y A;  4U9Y A;  2J8N A;  2QIR A;  1RXT A;  1J4J A;  3I3G A;  2BEI A;  2NMT A;  3T90 A;  1QSR A;  1Y9K A;  4AG7 A;  4JXR A;  3BJ7 A;  1Y7R A;  1XF8 A;  3R9E A;  2P6F A;  2QEC A;  2ZXV A;  1YRE A;  2P6E A;  1Z9U A;  4II9 A;  4H6U A;  4CAV A;  4UWI A;  4FD7 A;  2ARH A;  4FD4 A;  4KVX A;  2OH1 A;  2B3U A;  4Y49 B;  2J8M A;  3S6K A;  1U6M A;  4QC6 A;  1TIQ A;  1YLE A;  1M4G A;  2VZZ A;  3GKR A;  2I79 A;  4LX9 A;  1B6B A;  1IID A;  2R8V A;  1P4N A;  4GS4 A;  2VBQ A;  2CNT A;  2PDO A;  1R57 A;  1MK4 A;  2VI7 A;  3EXN A;  5J8C A;  2PSW A;  3E0K A;  2RC4 A;  3TOB A;  4ORF A;  5KTA A;  4CAW A;  2B3V A;  3LD2 A;  3SXN A;  4Y49 C;  1K4J A;  3JVN A;  1KUX A;  4KOT A;  2D4P A;  4OAE A;  3DNS A; 
#chains in the Genus database with same CATH topology
 4Z65 A;  3DDD A;  3FNC A;  3IEH A;  4MRI A;  1LOK A;  3VAT A;  3TCV A;  2Q0Y A;  4F6A A;  1GYT A;  4XNH B;  1MJ9 A;  2OZG A;  3KQZ A;  4FUU A;  2EUI A;  1V0C A;  4ONU A;  2B4B A;  4R3K A;  2AFU A;  3SI0 A;  2HC9 A;  1CP7 A;  2VQY A;  4GXH A;  3IWG A;  2EVN A;  4NGQ A;  4AVA A;  3H5Z A;  2REF A;  4PK3 A;  1CPX A;  3CXS A;  4ZI6 A;  1TKF A;  3D7F A;  1NSA A;  1ZO0 A;  2ODF A;  4XNH C;  3TOA A;  1MJA A;  4UEE A;  3WC7 A;  4KUB A;  3CZX A;  1BPN A;  2I3C A;  2F8H A;  4NXY A;  3RAM A;  2V8H A;  4C7I A;  3OWC A;  4U9Z A;  3PB8 X;  3DGV A;  1QMU A;  2ZW4 A;  4H6Z A;  4JLY A;  2FCK A;  2F7V A;  3TO7 A;  1ZG7 A;  2J9A A;  2DF5 A;  4Q7A A;  1R3N A;  3ZZI A;  1M1D A;  3RNZ A;  2CTB A;  1BOB A;  5LRK A;  2PR8 A;  1BAV A;  3NH8 A;  6CPA A;  1I12 A;  3IU2 A;  2A4N A;  2DEA A;  2EO8 A;  1PU9 A;  3PB7 X;  1L0C A;  3K9T A;  1MJB A;  2B5G B;  4P4I A;  3CT9 A;  2PJ7 A;  2BUE A;  1LCP A;  3NH5 A;  1NE9 A;  3VAR A;  4DJL A;  1WWZ A;  3K2K A;  3SI2 A;  4FBE A;  5HMN A;  3B7I A;  4C2Y A;  3CDX A;  2HUZ A;  2F5I A;  4B5P A;  4E2A A;  1IOI A;  5HH1 A;  3FH4 A;  3RYO A;  3B35 A;  3FRM A;  1ARM A;  2EWB A;  4MBU A;  4YFJ A;  2WPX A;  4QBJ A;  1CJW A;  3PFO A;  3SJG A;  2JEW A;  1CP6 A;  2CXA A;  1IYK A;  2PJC A;  3SJX A;  4R8F A;  3T9Y A;  3TE4 A;  1SQH A;  1YME A;  2PQ8 A;  1YK3 A;  4MFJ A;  3WC5 A;  2GE3 A;  5AG6 A;  1JWQ A;  3B3V A;  1CG2 A;  2JLM A;  3GUX A;  2O53 A;  4A95 A;  4ZX8 A;  1ELL P;  4J3G A;  4KOR A;  4YWY A;  5A28 A;  3R95 A;  4HNW B;  4TNU A;  3D2M A;  4P45 A;  5HVG A;  4MFZ A;  2QJ8 A;  5EBV A;  4FD5 A;  4IK2 A;  1FT7 A;  4NF1 A;  1Q2Y A;  4B11 A;  4H2K A;  4UF4 A;  4A37 A;  4TWE A;  4JZ0 A;  1XEB A;  4CYP A;  1LAM A;  4YGO A;  2ZOG A;  3H4Q A;  4CAX A;  1Y0Y A;  1XOV A;  3EO4 A;  4GM5 A;  2IJZ A;  2V8D A;  4P4D A;  4C2Z A;  2AFM A;  3WC6 A;  3LOD A;  3FBU A;  2IQ6 A;  4AG9 A;  3NE8 A;  3NA6 A;  3WT4 A;  4AXV A;  2Q43 A;  2PIZ A;  3DR8 A;  4QUS A;  4R57 A;  3S9N A;  5AG5 A;  2Z10 A;  2FSR A;  1ZG8 A;  3C26 A;  4UEZ A;  4B13 A;  3S6F A;  4RS2 A;  1XE4 A;  2YNC A;  2G3A A;  3GYA A;  1CPS A;  1RO5 A;  3ISX A;  3TC8 A;  2GLF A;  3DLJ A;  3B3W A;  1KZF A;  3GY9 A;  2AE6 A;  5THW A;  1AYE A;  2PJA A;  3VH9 A;  3NH4 A;  3KR4 A;  1FNO A;  1CM0 A;  1CBX A;  3KHZ A;  4X5K A;  1I21 A;  3FB3 A;  2PRB A;  2CNM A;  2Q44 A;  2WYR A;  2XEG A;  2PVV A;  4M6H A;  4KOS A;  1YVO A;  2PJ3 A;  3FYN A;  4JWP A;  4CYQ A;  3FX6 A;  1OZP A;  5LRG A;  4CAE A;  4MHZ A;  3QAH A;  4MHP A;  3SJE A;  3EY5 A;  4OP4 A;  2PJ8 A;  1XMB A;  5F47 A;  2ZW7 A;  4A94 A;  3FXT A;  4B6Z A;  4UCN A;  4KVM E;  4PXD A;  1M4I A;  4CYO A;  1LAN A;  3RZA A;  2CF4 A;  4IF5 A;  3D3S A;  4JJX A;  2CTC A;  2FT0 A;  3V38 A;  5IV0 A;  2KCW A;  2C27 A;  4MJ8 A;  2PIY A;  1TKH A;  4KS9 A;  4R6T A;  5IX3 A;  3IIB A;  2G0B A;  4MCR A;  4UIA A;  1KUV A;  1NSL A;  2OU2 A;  2WPW A;  3KGQ A;  4AVC A;  3F5B A;  2YNC C;  1JQG A;  5K8M A;  1Z4E A;  1VIX A;  2FE7 A;  1XMT A;  2ATR A;  2JBJ A;  1LRZ A;  4MY3 A;  1KWM A;  1VHE A;  3IC1 A;  5IB0 A;  4NSQ A;  2P6G A;  1S7K A;  4CGM A;  1F2P A;  2Y0M A;  2Z3K A;  2GIV A;  4NEX A;  2FIW A;  3IGR A;  4KLW A;  3CPA A;  1RTQ A;  4RUH A;  2R98 A;  1Z5R A;  3EFA A;  4UEF A;  4ZBG A;  4X2T A;  2PJ6 A;  3V8I A;  4G1P A;  5I0C A;  4UFV A;  2XEI A;  1S60 A;  2V8V A;  1Z4R A;  3S6H A;  5J1Q A;  2AFW A;  2VXK A;  1XRY A;  2HV2 A;  3G3S A;  1EE3 P;  3DR6 A;  4ZY0 A;  3SI1 A;  2ABZ A;  3GB0 A;  4NGP A;  2AFO A;  4OAD A;  2XEJ A;  4MHD A;  1S7L A;  4KOW A;  4B12 A;  4PSW A;  2Z3L A;  1TXR A;  4Q36 A;  4X3R A;  1ZLH A;  3IJ3 A;  3QB8 A;  4MI4 A;  3R96 A;  3UY5 A;  4A30 A;  4DNC A;  4M3S A;  4MMO A;  4XPD B;  3VWD A;  4M6G A;  4PV6 A;  4KOV A;  3F8K A;  5AG7 A;  5KTD A;  4B5O A;  4FAI A;  4MHN A;  4C68 A;  5JH9 A;  2OB0 A;  1P0H A;  3D68 A;  4KLV A;  1AMP A;  3MGD A;  1XBU A;  2AFX A;  4L8A A;  3SHP A;  2HB6 A;  1PYT B;  4ZY1 A;  4M6I A;  2J8R A;  2D4O A;  4W9Y A;  4ZX9 A;  1NMT A;  1YGH A;  1Z8T A;  2OZU A;  3FEC A;  4KSF A;  8CPA A;  5J8F A;  2JEV A;  2WUU A;  4MY0 A;  5A27 A;  5KTC A;  1I1D A;  2K5T A;  2P0W A;  4A33 A;  1YW4 A;  4OC4 A;  2B5G A;  2FL4 A;  1X12 A;  2ZEF A;  4KOU A;  4KUA A;  1UWY A;  2B4D A;  3R1K A;  4A32 A;  4B14 A;  1VHO A;  1IB1 E;  5F49 A;  3D67 A;  3PBE A;  1ON0 A;  4UFW A;  4PXC A;  2PC1 A;  1TF8 A;  4OLL A;  1YX0 A;  4BIN A;  4U5Y A;  5K8P A;  3FMC A;  3PRT A;  5IB9 A;  4PK2 A;  3FJU A;  3I9S A;  3N7Z A;  3D2P A;  3BI1 A;  3D7G A;  3F0A A;  4NGN A;  4MFQ A;  2PCU A;  5H84 A;  2Z3M A;  1S3Z A;  5EC4 A;  1BO4 A;  2ANP A;  2RFH A;  4LQG A;  2ZW6 A;  4ZGY B;  4NGT A;  2Q04 A;  2PJ5 A;  3L2N A;  2GRE A;  2VL1 A;  3ZJ0 A;  3LMS A;  5K8O A;  1LAP A;  1H8L A;  4KVO E;  3IO1 A;  4PSX A;  3W6S A;  3CXP A;  3IU1 A;  2VEZ A;  4IUS A;  4A38 A;  3H8G A;  4RN7 A;  3B3S A;  3JUW A;  3D66 A;  1HDQ A;  3D8P A;  4R7M A;  1VGY A;  5FVJ A;  1IIC A;  3D7D A;  3BI0 A;  2FIA A;  4P4F A;  1YR0 A;  1TKJ A;  4XPK A;  4F9V A;  4RI1 A;  4NGS A;  5HVH A;  1B87 A;  2NYQ A;  5I4M A;  3FEE A;  3LAC A;  2GU2 A;  1Q2D A;  2GAN A;  4HKF A;  4UIB A;  3KQX A;  4YRH A;  2Z3O A;  2AFZ A;  3S6G A;  3R9G A;  5DS0 A;  5LYF A;  5BWA B;  4QB9 A;  2YNE A;  1VHS A;  4MCQ A;  2IL4 A;  2R1I A;  3TO6 A;  2C6C A;  3KKW A;  2B58 A;  5LYL A;  4PPZ A;  2O28 A;  1QSO A;  5CPA A;  2BCO A;  3PB6 X;  4CGN A;  2G3T A;  2V8G A;  3PZJ A;  2ZPA A;  3GIU A;  4OC5 A;  4CAF A;  4AB7 A;  4KSA A;  3G8W A;  3H8E A;  1YVK A;  1IU8 A;  4A39 A;  2JDC A;  2PJB A;  3PFE A;  2QVP A;  4B10 A;  4KZT A;  4HPS A;  1QSM A;  4FD6 A;  3TO9 A;  3S9L A;  4NJR A;  1UFH A;  1OBR A;  2WSA A;  3B3C A;  4Q38 A;  3TT2 A;  2DXQ A;  2ZEM A;  3KHX A;  1Z2L A;  5LRJ A;  3R9F A;  3I1U A;  4L89 A;  5K8N A;  1Z8X A;  1Y0R A;  3EC4 A;  5H86 A;  5DWN A;  3ISZ A;  1IYL A;  2DPT A;  4I49 A;  5G1Z A;  1QST A;  1S5K A;  2PJ1 A;  4P4B A;  2Q7S A;  1GHE A;  2AJ6 A;  2PR1 A;  4HNY B;  2R7H A;  5C88 A;  1WK4 A;  2CY2 A;  2PJ2 A;  3KAS A;  4CS0 B;  3BJ8 A;  5G20 A;  4KOY A;  1IY7 A;  1DTD A;  4X8I A;  2Q7B A;  1Z8L A;  4HNX B;  4NCZ A;  4WWV A;  5F46 A;  4E0A A;  4MCP A;  3BXM A;  4UA3 A;  4AVB A;  3PGP A;  2Q51 A;  4CRY B;  1BLL E;  2FS5 A;  2PE3 A;  4CGP A;  2REE A;  4NFR A;  4IAV A;  3B8G A;  3FIX A;  2C6P A;  2Z3P A;  4C7H A;  4K30 A;  5GCN A;  4JXQ A;  4F0X A;  5JM6 A;  3BLN A;  4EWT A;  5EMI A;  3WAB A;  4B5P B;  3LWU A;  1M44 A;  1YLO A;  1X10 A;  2H5M A;  2ZEP A;  4CPA A;  3KR5 A;  4H89 A;  2OR4 A;  4MCS A;  4F9U A;  3WR7 A;  3KI9 A;  4P6Y A;  4P4E A;  2QYV A;  2VZY A;  1KUY A;  3K9U A;  4FWU A;  2PJ0 A;  4R76 A;  2B4D B;  4MFP A;  3TX8 A;  3W91 A;  1N71 A;  4EVY A;  5AGE A;  5D8N A;  4NJQ A;  3D4U A;  3IFE A;  4E8O A;  4ZYQ A;  4A31 A;  2Z0Z A;  2X7B A;  1Y9W A;  1M4L A;  3B2Y A;  3T8W A;  3PB4 X;  5JQ4 A;  3PP9 A;  4PXB A;  4UCM A;  5C82 A;  4IHM A;  4KOX A;  1PUA A;  3FVL A;  2Q4Y A;  5ELY A;  4XPD C;  1F2O A;  2JBK A;  3DSB A;  2BSW A;  1VKC A;  3H8F A;  1TF9 A;  5CNP A;  2EBJ A;  3VWE A;  2PVW A;  2ZEG A;  4UWJ A;  1XJO A;  2I00 A;  3P2H A;  2OZH A;  2QML A;  2RB7 A;  5JPH A;  4QVT A;  4MFL A;  4C2X A;  5JGF A;  2HQY A;  1ZLI A;  2OOT A;  5CBM A;  2YND A;  4NGM A;  2ZEE A;  2FXF A;  3FED A;  2PJ9 A;  2EK8 A;  2BOA A;  1M4D A;  5G22 A;  4EME A;  1DE4 C;  4XPL A;  2ZW5 A;  2Z11 A;  5LYD A;  5LYI A;  3SJF A;  1IOF A;  4BD9 A;  2ZEN A;  5DWM A;  1HDU A;  1Q7L A;  1CX8 A;  4OC1 A;  2CNS A;  3RO0 A;  4PXE A;  1S7F A;  1FY7 A;  1S7N A;  2POK A;  3P2F A;  4R87 A;  4YU9 A;  4BMH A;  2O4H A;  3RBU A;  1XIX A;  4M85 A;  1QSN A;  3NE7 A;  3BHX A;  4R9M A;  3IWE A;  1IGB A;  3KZW A;  5F48 A;  4LUA A;  5ISV A;  3TTH A;  2Z3N A;  3TFY A;  4MHY A;  2ZOF A;  4ONW A;  2C6G A;  3SXO A;  2BL1 A;  2Q4V A;  3CXQ A;  4R3L A;  3PBB A;  4CRZ B;  1HEE A;  4PQA A;  4JD6 A;  4UFX A;  5E96 A;  1ZG9 A;  4CYN A;  3W6X A;  2ZEL A;  3D7H A;  5F09 A;  5HVF A;  1Q2C A;  3MRU A;  4UBR A;  2JDD A;  4NGR A;  4U9Y A;  4F0Y A;  2J8N A;  5G21 A;  2Q4Z A;  2QIR A;  2YGW A;  1RXT A;  1J4J A;  3MN8 A;  3I3G A;  3NFZ A;  1Y7E A;  2BEI A;  2NSM A;  2NMT A;  3T90 A;  1QSR A;  1Y9K A;  4AG7 A;  4JXR A;  3QNV A;  2ZEH A;  2C1C A;  3BJ7 A;  1Y7R A;  4OC0 A;  2BO9 A;  2XEF A;  1XF8 A;  2ZED A;  4OME A;  3R9E A;  3GLJ A;  2P6F A;  4CGO A;  2QEC A;  2ZXV A;  1YRE A;  2P6E A;  1Z9U A;  4A2Z A;  2PRQ A;  4H6U A;  4II9 A;  4CAV A;  4OC2 A;  3JRU A;  4UWI A;  4P44 A;  4FD7 A;  2DPS A;  1BPM A;  2ARH A;  4FD4 A;  4KVX A;  2OH1 A;  2GFQ A;  2B3U A;  4Y49 B;  3FF3 A;  1YSJ A;  7CPA A;  2J8M A;  3PEI A;  2GLJ A;  3S6K A;  1U6M A;  3IWW A;  1TIQ A;  1YLE A;  4QC6 A;  1M4G A;  3N5F A;  2ZEO A;  4O23 A;  2VZZ A;  3GKR A;  2I79 A;  4LX9 A;  4OC3 A;  4BBH A;  4EFD A;  2G9D A;  1B6B A;  4LQ6 A;  1AUG A;  1A2Z A;  1ELM P;  3HUV A;  1IID A;  1ARL A;  4P4J A;  2IMO A;  2R8V A;  1PCA A;  4DYO A;  4OIW A;  2AFS A;  3KL9 A;  1XFO A;  2EK9 A;  1P4N A;  3PB9 X;  3A9L A;  4GS4 A;  2VBQ A;  3S9M A;  2CNT A;  2PDO A;  5HXD A;  2FVG A;  4OKO A;  1R57 A;  2WZN A;  1MK4 A;  2VI7 A;  1F57 A;  2V77 A;  1Z8W A;  4KSI A;  3V7Z A;  3EXN A;  3HLP A;  5J8C A;  2PSW A;  3E0K A;  4MFK A;  4F8Z A;  4JYW A;  4CGL A;  4K3N A;  2CIJ A;  2RC4 A;  1QQ9 A;  4ZY2 A;  3QAY A;  5D29 A;  5AG4 A;  4UCP A;  1YQE A;  3TOB A;  4ORF A;  5KTA A;  4CAW A;  4OID A;  4MXU A;  3CPX A;  2B3V A;  3LD2 A;  1YW6 A;  1R43 A;  4P10 A;  1LFW A;  3SXN A;  4WJB A;  4Y49 C;  1K4J A;  3JVN A;  3B3T A;  1KUX A;  2PJ4 A;  2D4P A;  3JTK A;  4KOT A;  4DUK A;  4OAE A;  3DNS A; 
#chains in the Genus database with same CATH homology
 3DDD A;  3FNC A;  3TCV A;  2Q0Y A;  4F6A A;  4XNH B;  1MJ9 A;  2OZG A;  2EUI A;  1V0C A;  4ONU A;  2B4B A;  4R3K A;  2VQY A;  3IWG A;  2EVN A;  4AVA A;  3H5Z A;  2REF A;  4PK3 A;  3CXS A;  1ZO0 A;  4XNH C;  3TOA A;  1MJA A;  4KUB A;  4NXY A;  4C7I A;  3OWC A;  4U9Z A;  2ZW4 A;  4H6Z A;  4JLY A;  2FCK A;  3TO7 A;  3ZZI A;  1M1D A;  1BOB A;  2PR8 A;  1I12 A;  3IU2 A;  2A4N A;  1PU9 A;  1L0C A;  1MJB A;  2B5G B;  2BUE A;  1NE9 A;  1WWZ A;  5HMN A;  4C2Y A;  2HUZ A;  2F5I A;  4B5P A;  4E2A A;  5HH1 A;  3RYO A;  3FRM A;  4YFJ A;  4MBU A;  2WPX A;  4QBJ A;  1CJW A;  2CXA A;  1IYK A;  3TE4 A;  3T9Y A;  1SQH A;  2PQ8 A;  1YK3 A;  4MFJ A;  2GE3 A;  5AG6 A;  2JLM A;  4A95 A;  4J3G A;  4KOR A;  5A28 A;  3R95 A;  4HNW B;  3D2M A;  4MFZ A;  5EBV A;  4FD5 A;  4NF1 A;  1Q2Y A;  4B11 A;  1XEB A;  4CYP A;  4YGO A;  3H4Q A;  4CAX A;  3EO4 A;  4C2Z A;  3LOD A;  3FBU A;  4AG9 A;  3DR8 A;  4QUS A;  4R57 A;  5AG5 A;  2Z10 A;  2FSR A;  3C26 A;  4B13 A;  3S6F A;  4RS2 A;  1XE4 A;  2YNC A;  2G3A A;  3GYA A;  1RO5 A;  1KZF A;  3GY9 A;  2AE6 A;  1CM0 A;  4X5K A;  1I21 A;  3FB3 A;  2PRB A;  2CNM A;  2Q44 A;  4KOS A;  1YVO A;  3FYN A;  4JWP A;  4CYQ A;  1OZP A;  4CAE A;  3QAH A;  3EY5 A;  5F47 A;  2ZW7 A;  3FXT A;  4UCN A;  4KVM E;  4CYO A;  1M4I A;  4IF5 A;  3D3S A;  4JJX A;  2FT0 A;  5IV0 A;  2KCW A;  2C27 A;  4MJ8 A;  5IX3 A;  4KS9 A;  2G0B A;  1KUV A;  1NSL A;  2OU2 A;  2WPW A;  4AVC A;  3F5B A;  2YNC C;  1Z4E A;  2FE7 A;  1XMT A;  2ATR A;  1LRZ A;  4MY3 A;  5IB0 A;  4NSQ A;  2P6G A;  1S7K A;  4CGM A;  2Z3K A;  2Y0M A;  4NEX A;  2GIV A;  2FIW A;  3IGR A;  4KLW A;  2R98 A;  3EFA A;  4ZBG A;  3V8I A;  5I0C A;  4UFV A;  1S60 A;  1Z4R A;  3S6H A;  2VXK A;  2HV2 A;  3G3S A;  3DR6 A;  4OAD A;  4MHD A;  1S7L A;  4KOW A;  4B12 A;  4PSW A;  2Z3L A;  4Q36 A;  3QB8 A;  3UY5 A;  4MI4 A;  3R96 A;  4A30 A;  4DNC A;  4M3S A;  4XPD B;  3VWD A;  4PV6 A;  4KOV A;  3F8K A;  5AG7 A;  5KTD A;  4B5O A;  4C68 A;  2OB0 A;  1P0H A;  4KLV A;  3MGD A;  4L8A A;  3SHP A;  2J8R A;  2D4O A;  1NMT A;  1YGH A;  2OZU A;  4KSF A;  5J8F A;  2JEV A;  2WUU A;  4MY0 A;  5A27 A;  5KTC A;  1I1D A;  2K5T A;  2P0W A;  4A33 A;  2B5G A;  2FL4 A;  4KOU A;  4KUA A;  2B4D A;  3R1K A;  4A32 A;  4B14 A;  1IB1 E;  5F49 A;  1ON0 A;  4UFW A;  2PC1 A;  4OLL A;  1YX0 A;  4U5Y A;  4PK2 A;  3I9S A;  3N7Z A;  3D2P A;  3F0A A;  4MFQ A;  5H84 A;  2Z3M A;  1S3Z A;  5EC4 A;  1BO4 A;  2ZW6 A;  4ZGY B;  2Q04 A;  3ZJ0 A;  4KVO E;  4PSX A;  3W6S A;  3CXP A;  3IU1 A;  2VEZ A;  4IUS A;  3JUW A;  3D8P A;  5FVJ A;  1IIC A;  2FIA A;  1YR0 A;  4XPK A;  4RI1 A;  1B87 A;  4HKF A;  1Q2D A;  2GAN A;  4YRH A;  2Z3O A;  3S6G A;  3R9G A;  5BWA B;  4QB9 A;  2YNE A;  1VHS A;  2IL4 A;  2R1I A;  3TO6 A;  3KKW A;  2B58 A;  2O28 A;  1QSO A;  4CGN A;  2G3T A;  3PZJ A;  2ZPA A;  4CAF A;  4AB7 A;  4KSA A;  3G8W A;  1YVK A;  2JDC A;  4B10 A;  4KZT A;  1QSM A;  4FD6 A;  3TO9 A;  1UFH A;  2WSA A;  4Q38 A;  3TT2 A;  2DXQ A;  3R9F A;  4L89 A;  3EC4 A;  5H86 A;  5DWN A;  1IYL A;  2DPT A;  4I49 A;  5G1Z A;  1QST A;  1S5K A;  1GHE A;  2AJ6 A;  2PR1 A;  4HNY B;  2R7H A;  5C88 A;  1WK4 A;  2CY2 A;  4CS0 B;  3BJ8 A;  5G20 A;  4KOY A;  2Q7B A;  4HNX B;  4NCZ A;  5F46 A;  4E0A A;  4UA3 A;  4AVB A;  3PGP A;  4CRY B;  2FS5 A;  4CGP A;  2REE A;  3B8G A;  3FIX A;  2Z3P A;  4C7H A;  4K30 A;  5GCN A;  4JXQ A;  4F0X A;  3BLN A;  4B5P B;  1M44 A;  2H5M A;  4H89 A;  3WR7 A;  3K9U A;  2VZY A;  1KUY A;  2B4D B;  4MFP A;  3W91 A;  1N71 A;  4EVY A;  5AGE A;  4E8O A;  4A31 A;  2Z0Z A;  2X7B A;  1Y9W A;  5JQ4 A;  3PP9 A;  4UCM A;  5C82 A;  4KOX A;  1PUA A;  2Q4Y A;  4XPD C;  3DSB A;  2BSW A;  1VKC A;  5CNP A;  3VWE A;  4UWJ A;  2I00 A;  3P2H A;  2OZH A;  2QML A;  5JPH A;  4QVT A;  4MFL A;  4C2X A;  2HQY A;  2YND A;  2FXF A;  1M4D A;  5G22 A;  4XPL A;  2ZW5 A;  2Z11 A;  5DWM A;  2CNS A;  1S7F A;  1FY7 A;  1S7N A;  3P2F A;  4R87 A;  4BMH A;  1XIX A;  4M85 A;  1QSN A;  3NE7 A;  4R9M A;  5ISV A;  3IWE A;  5F48 A;  4LUA A;  3TTH A;  2Z3N A;  3TFY A;  3SXO A;  2BL1 A;  2Q4V A;  3CXQ A;  4R3L A;  4CRZ B;  4JD6 A;  4UFX A;  5E96 A;  4CYN A;  3W6X A;  1Q2C A;  4UBR A;  2JDD A;  4F0Y A;  4U9Y A;  2J8N A;  5G21 A;  2QIR A;  2YGW A;  1RXT A;  1J4J A;  3I3G A;  2BEI A;  2NMT A;  3T90 A;  1QSR A;  1Y9K A;  4AG7 A;  4JXR A;  3BJ7 A;  1Y7R A;  1XF8 A;  3R9E A;  2P6F A;  4CGO A;  2QEC A;  2ZXV A;  1YRE A;  2P6E A;  1Z9U A;  4A2Z A;  4II9 A;  4H6U A;  4CAV A;  4UWI A;  4FD7 A;  2DPS A;  2ARH A;  4FD4 A;  4KVX A;  2OH1 A;  2B3U A;  4Y49 B;  2J8M A;  3S6K A;  1U6M A;  1TIQ A;  1YLE A;  4QC6 A;  1M4G A;  2VZZ A;  3GKR A;  2I79 A;  4LX9 A;  4BBH A;  1B6B A;  1IID A;  2R8V A;  1P4N A;  3A9L A;  4GS4 A;  2VBQ A;  2CNT A;  2PDO A;  1R57 A;  1MK4 A;  2VI7 A;  3EXN A;  5J8C A;  2PSW A;  3E0K A;  4MFK A;  4CGL A;  2RC4 A;  5AG4 A;  4UCP A;  3TOB A;  4ORF A;  5KTA A;  4CAW A;  2B3V A;  3LD2 A;  3SXN A;  4Y49 C;  1K4J A;  3JVN A;  1KUX A;  4KOT A;  2D4P A;  3JTK A;  4OAE A;  3DNS A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...