1RO5A

Crystal structure of the ahl synthase lasi
Total Genus 56
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
56
sequence length
197
structure length
197
Chain Sequence
GSHMIVQIGRREEFDKKLLGEMHKLRAQVFKERKGWDVSVIDEMEIDGYDALSPYYMLIQEDGQVFGCWRILDTTGPYMLKNTFPELLHGKEAPCSPHIWELSRFAINSGQKGSLGFSDCTLEAMRALARYSLQNDIQTLVTVTTVGVEKMMIRAGLDVSRFGPHLKIGIERAVALRIELNAKTQIALYGGVLVEQR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Signaling protein
molecule keywords Autoinducer synthesis protein lasI
publication title Structure of the Pseudomonas aeruginosa acyl-homoserinelactone synthase LasI.
pubmed doi rcsb
source organism Pseudomonas aeruginosa
total genus 56
structure length 197
sequence length 197
ec nomenclature ec 2.3.1.184: Acyl-homoserine-lactone synthase.
pdb deposition date 2003-12-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00765 Autoind_synth Autoinducer synthase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.630.30 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Aminopeptidase 1ro5A01
1K4JA 3SXNA 4OAEA 1CM0A 4OLLA 3FNCA 4XNHC 2JDDA 3JVNA 1P0HA 2QECA 1IYKA 4JJXA 3EY5A 4KVME 2WPWA 2GE3A 3LD2A 1MK4A 4KVOE 2WPXA 5IV0A 1IYLA 3LODA 2QIRA 2REEA 1RXTA 3SHPA 3DNSA 4L89A 1SQHA 4KZTA 4MY0A 2Y0MA 2PR1A 2Q04A 3W6SA 1Q2DA 2ZW6A 2EVNA 4AG7A 2Z11A 3F5BA 1NMTA 2I00A 4R87A 4LUAA 4QVTA 2VZZA 4QC6A 3R96A 1S7NA 3I3GA 5H86A 3TOAA 3UY5A 4PK2A 3V8IA 5ISVA 1YGHA 2Q4VA 1M4DA 2CY2A 2O28A 4UBRA 3ZJ0A 3VWEA 4YFJA 5HMNA 3F8KA 1BOBA 2REFA 2CNSA 3ZZIA 5EC4A 4KOSA 2Q7BA 4UA3A 4NEXA 4QUSA 4BMHA 5J8FA 2Q44A 2ZPAA 4IF5A 2B3UA 2FT0A 2DXQA 2ZW5A 3GYAA 4MBUA 1YVKA 4NSQA 4R3LA 1XMTA 4PK3A 4AG9A 3T90A 4FD5A 1BO4A 4UWIA 4R3KA 4ZBGA 4PSWA 3D2MA 2RC4A 3TO6A 3CXQA 2HQYA 4H6UA 3FXTA 3BJ7A 3JUWA 3EO4A 3TCVA 4U5YA 4F0YA 1I21A 4H89A 1R57A 1QSOA 3D2PA 4ONUA 4MI4A 3DSBA 4CRZB 4NF1A 1IIDA 2AE6A 4R57A 4IUSA 3PZJA 4U9ZA 3EFAA 3R1KA 3FYNA 4PSXA 3PGPA 2OB0A 2BL1A 2FSRA 3IWGA 2KCWA 5H84A 4AVAA 2VI7A 1KZFA 1VHSA 3TT2A 1MJ9A 1I12A 2Z0ZA 3DDDA 3SXOA 2PQ8A 4RI1A 5HH1A 3R9FA 4CS0B 2VXKA 5I0CA 4OADA 1PU9A 4XPDB 1YVOA 2B4DA 1IB1E 1LRZA 2FIAA 4PV6A 2NMTA 2GANA 2JEVA 2JDCA 4KUAA 3FIXA 5DWMA 4CRYB 4AVBA 1I1DA 5CNPA 3TO7A 1MJBA 3TE4A 4E2AA 2PDOA 2FIWA 4K30A 4XPDC 3TTHA 2VEZA 2I79A 1TIQA 4KOXA 1KUXA 4FD7A 4M3SA 2IL4A 3TOBA 3TO9A 4KOUA 5IB0A 2CNMA 4X5KA 1L0CA 1YX0A 4KUBA 4HNYB 3R95A 2D4OA 5FVJA 4NXYA 4KOYA 4B5PA 4J3GA 4DNCA 4KOTA 3CXPA 4XPLA 2QMLA 4JD6A 4LX9A 4KVXA 2R1IA 3E0KA 1S3ZA 2BUEA 4RS2A 1PUAA 1U6MA 4M85A 5IX3A 1YR0A 2OZGA 1S7KA 1KUVA 1MJAA 3S6HA 4B5PB 4CAVA 1Z4RA 4YGOA 2PR8A 2ZXVA 1V0CA 1P4NA 2H5MA 2VBQA 1XE4A 2P6GA 3R9EA 1M44A 3K9UA 4E0AA 1QSMA 2B4BA 3B8GA 3WR7A 1S60A 2R7HA 3F0AA 3I9SA 4HNWB 4UWJA 1YK3A 5KTCA 1XIXA 2CNTA 4KOVA 1M1DA 4KLWA 5GCNA 3TFYA 2OH1A 5C88A 4CAWA 3R9GA 2EUIA 2PRBA 2Z10A 1NE9A 5F46A 4CAXA 3S6GA 2R8VA 4JXQA 3S6KA 1ON0A 3GKRA 2BSWA 1WK4A 1N71A 4Y49B 5KTAA 5F47A 3CXSA 4ORFA 1QSRA 2BEIA 5F49A 1S7FA 4HKFA 1Q2YA 3RYOA 1J4JA 4QBJA 2P0WA 4JWPA 4FD4A 3FB3A 1M4GA 2ZW4A 3MGDA 5E96A 4H6ZA 4U9YA 4JXRA 4YRHA 3QB8A 1S7LA 3IGRA 3P2HA 1OZPA 4KOWA 1YREA 4AVCA 1IICA 1YLEA 4Y49C 1M4IA 2G3TA 5DWNA 4KORA 5JPHA 2ATRA 4AB7A 5KTDA 2B4DB 3FBUA 2G0BA 5F48A 2P6EA 2Q0YA 2GIVA 3DR8A 3D3SA 2B5GA 1KUYA 2X7BA 4L8AA 1WWZA 3KKWA 2OZHA 2HUZA 2FCKA 1Q2CA 2OU2A 4MJ8A 2B58A 3C26A 3VWDA 1Y9WA 2P6FA 3EC4A 2JLMA 3NE7A 1FY7A 2FL4A 2ZW7A 2OZUA 1QSTA 2G3AA 3G8WA 4I49A 2FXFA 1CJWA 1Y7RA 2FE7A 3T9YA 1Y9KA 1B6BA 1Z4EA 1XF8A 5C82A 2B5GB 2J8MA 4KLVA 2D4PA 3QAHA 1VKCA 4GS4A 3BJ8A 1S5KA 2HV2A 4R9MA 4II9A 4JLYA 1B87A 3BLNA 2Q4YA 3PP9A 2ARHA 2F5IA 2FS5A 4NCZA 3GY9A 3H4QA 3G3SA 4QB9A 4FD6A 2R98A 3N7ZA 4HNXB 3OWCA 2PSWA 3S6FA 5EBVA 2J8RA 5J8CA 3EXNA 4EVYA 2AJ6A 3FRMA 4MY3A 5JQ4A 1NSLA 1Z9UA 2VZYA 3W91A 1GHEA 1XEBA 4XPKA 4XNHB 2K5TA 2PC1A 4MHDA 2VQYA 2J8NA 4F6AA 3D8PA 4E8OA 4B5OA 1UFHA 2C27A 1RO5A 1QSNA 3P2FA 2B3VA 3DR6A 3W6XA 2A4NA
chains in the Genus database with same CATH superfamily
5HVHA 3PFOA 2AFWA 1K4JA 3SXNA 1IU8A 5CBMA 3WC6A 4OAEA 1CM0A 4IHMA 4OLLA 3FNCA 4KSAA 3D7DA 1FT7A 4XNHC 4OMEA 2JDDA 4C7IA 4DJLA 2V8HA 3JVNA 4FWUA 3BI0A 1P0HA 4WJBA 3H8EA 2QECA 1IYKA 2V8VA 2XEIA 4JJXA 1Z5RA 1ZO0A 3PB4X 2HB6A 1BAVA 3EY5A 4KVME 2WPWA 4CAEA 2GE3A 1BPMA 1AUGA 1MK4A 3LD2A 4OIDA 4KVOE 2WPXA 5IV0A 3QAYA 1IYLA 3LODA 2QIRA 2REEA 2GLJA 2Q51A 1RXTA 3SJEA 3SHPA 4CGPA 2EWBA 3DNSA 2DPTA 3N5FA 3CPAA 4L89A 2Z3OA 1SQHA 4KZTA 1Y0YA 2ABZA 4MY0A 1XMBA 2Y0MA 2V77A 2PR1A 2Q04A 3W6SA 4MCQA 4JZ0A 1Q2DA 3GLJA 2O4HA 2ZW6A 2EVNA 4AG7A 4A39A 2RFHA 2Z11A 2PJ1A 3F5BA 1NMTA 2I00A 4R87A 3D7HA 1GYTA 4LUAA 4QVTA 4UFVA 1H8LA 1ELMP 3PB7X 4W9YA 4NJRA 2VZZA 4ONWA 4JYWA 4QC6A 1TF9A 3R96A 1S7NA 3RO0A 3I3GA 2NYQA 5H86A 3TOAA 4ZY1A 3UY5A 1ZG7A 3L2NA 4PK2A 4M6GA 3KL9A 3V8IA 1BPNA 4NGNA 3T8WA 5ISVA 1X12A 1YGHA 1CX8A 2Q4VA 1M4DA 2CY2A 1PCAA 2O28A 2PJAA 4HPSA 4UBRA 4UEFA 3ZJ0A 2IJZA 3D67A 3VWEA 4YFJA 3KR5A 3B35A 4OC2A 5HMNA 3F8KA 3NH5A 4B13A 1BOBA 3FJUA 2PIZA 4TNUA 2REFA 2CNSA 3RZAA 5AG6A 2CTCA 3ZZIA 4P4BA 2OR4A 4BINA 5EC4A 2PRQA 1YLOA 3CZXA 4KOSA 4GXHA 3BXMA 4RN7A 2Q7BA 4A94A 4KS9A 4UA3A 4NEXA 4QUSA 4BMHA 2PE3A 3RAMA 5J8FA 5LRJA 2Q44A 1CPSA 4A2ZA 2ZPAA 1HEEA 1LFWA 3VATA 4IF5A 2B3UA 2GFQA 2FT0A 2DXQA 4UIBA 3D68A 3RNZA 3WC7A 3FEDA 1ZLIA 2ZW5A 3GYAA 4ZYQA 5F09A 5JH9A 4UEZA 4MBUA 1YVKA 3IIBA 4NSQA 1XMTA 2EK8A 4P44A 1F57A 4R3LA 3WC5A 2AFOA 5AGEA 3VH9A 4PK3A 3LMSA 2JBJA 3T90A 4AG9A 2O53A 3ISZA 4FD5A 1BO4A 2ZELA 3A9LA 3CDXA 4UWIA 4NGQA 4R3KA 2YGWA 4ZBGA 4PSWA 1HDQA 3D2MA 2ZENA 2ZOGA 4YU9A 4MCSA 4P4DA 4B6ZA 2RC4A 3TO6A 3CXQA 4CPAA 1YSJA 4GM5A 4MCRA 4PPZA 2HQYA 4KSIA 2PVVA 4H6UA 2ZEEA 5D29A 3FXTA 4C2ZA 3JTKA 1ZG9A 1Y0RA 2PJ0A 2Z3MA 3BJ7A 3JUWA 2VL1A 1Z2LA 3GB0A 3ISXA 1LOKA 2PVWA 3EO4A 4NGMA 3TCVA 4U5YA 4F0YA 1I21A 1QMUA 4H89A 1R57A 1QSOA 3D2PA 4ONUA 4MI4A 4IK2A 5G22A 3DSBA 4O23A 1JQGA 5HVGA 4CRZB 1NSAA 4NF1A 1IIDA 2AE6A 5A27A 4CGNA 4R57A 3FEEA 4IUSA 2JBKA 3PFEA 3I1UA 3PZJA 4U9ZA 2QJ8A 4Q7AA 4A32A 3EFAA 3R1KA 2J9AA 3FYNA 4X8IA 2WSAA 4PSXA 3PGPA 3GIUA 3BI1A 2OB0A 1XOVA 2BL1A 2BOAA 2CF4A 2FSRA 5CPAA 8CPAA 3IWGA 2KCWA 4BBHA 5H84A 2PJ9A 3NA6A 4AVAA 1XRYA 1LAPA 2VI7A 1KZFA 1VHSA 2PJ3A 2PIYA 3K9TA 3TT2A 1MJ9A 5AG5A 4MRIA 4OC4A 3D7FA 5HXDA 1I12A 4PXBA 2Z0ZA 3SI1A 3DDDA 2QVPA 1XFOA 3BHXA 3SXOA 4ZI6A 2PQ8A 2Z3NA 4RI1A 5HH1A 2ZEGA 3R9FA 2PCUA 2QYVA 4CS0B 2VXKA 5I0CA 4DUKA 1DE4C 4OADA 1ZG8A 2DF5A 1PU9A 3PEIA 4XPDB 4A31A 4NGSA 4P6YA 1YVOA 2B4DA 1IB1E 1LRZA 2FIAA 4PV6A 3B2YA 3S9MA 2NMTA 4B12A 2GANA 2JEVA 2JDCA 4NJQA 4KUAA 1X10A 3FIXA 3H8FA 5DWMA 4CRYB 4UCPA 4AVBA 1I1DA 4MFLA 1XBUA 4WWVA 5LYLA 4CGLA 5CNPA 1TKHA 2ANPA 3V38A 4ZGYB 3KQXA 3TO7A 1MJBA 3IWEA 4MCPA 2EO8A 3K2KA 3TE4A 4Z65A 4NGTA 4UCMA 2GLFA 4H2KA 4ZX8A 3KR4A 4MHNA 2RB7A 5LYIA 3CT9A 5K8PA 4E2AA 2PDOA 2FIWA 4K30A 4XPDC 1R3NA 2VEZA 2I79A 3TTHA 1TIQA 5A28A 4KOXA 2POKA 4NGPA 4PXDA 1KUXA 4FD7A 2XEJA 4M3SA 4C7HA 2IL4A 3TOBA 3TO9A 4KOUA 2AFUA 4MXUA 5IB0A 2ZEPA 3MN8A 3PB8X 2CNMA 4X5KA 1QQ9A 1L0CA 1YX0A 2Q43A 3KQZA 4HNYB 4KUBA 4CYPA 1YMEA 3R95A 2D4OA 2YNEA 3MRUA 4UIAA 5FVJA 4NXYA 1ARLA 3D4UA 4P4EA 2ZEHA 5HVFA 4KOYA 4B5PA 4J3GA 5LRGA 2Z3PA 5DS0A 3TX8A 4DNCA 2V8DA 3CXPA 4KOTA 4XPLA 2QMLA 4EFDA 1KWMA 4JD6A 4LX9A 4KVXA 1Z8WA 2R1IA 3E0KA 2WUUA 5JM6A 1S3ZA 2BUEA 4EMEA 4OKOA 1PUAA 4RS2A 1U6MA 2Q4ZA 4M85A 2ZEMA 4P4IA 2JEWA 4PQAA 4MFZA 5IX3A 1YR0A 4CYQA 2IMOA 4UEEA 4FUUA 3LWUA 2OZGA 1XJOA 3KI9A 2ZEFA 1S7KA 1Z8XA 4NGRA 1KUVA 1MJAA 3S6HA 4P45A 3GUXA 4A38A 4R76A 1CP7A 3DGVA 3IJ3A 3D66A 3PBBA 5EMIA 4B5PB 4CAVA 1Z4RA 3HUVA 4YGOA 1F2PA 2PR8A 2ZXVA 2C6PA 1V0CA 4C68A 2PJ8A 1YQEA 1P4NA 3IO1A 4A33A 4UFWA 4YWYA 2H5MA 2VBQA 1XE4A 2CIJA 2P6GA 1IOFA 1LAMA 3IU1A 3R9EA 1M44A 4K3NA 4MHZA 4P4JA 2Q7SA 3K9UA 4E0AA 5K8NA 1QSMA 4M6IA 2B4BA 2CXAA 3S9NA 3B8GA 4ZX9A 3WR7A 1YW4A 3SJXA 2HC9A 5BWAB 1S60A 4X3RA 2R7HA 3F0AA 3I9SA 4F9VA 4HNWB 4UWJA 1YK3A 2FVGA 5KTCA 7CPAA 3FX6A 2C6GA 4M6HA 1Q7LA 1XIXA 2CNTA 1F2OA 4R6TA 2F7VA 2Z3KA 3KHZA 4KOVA 1M1DA 4KLWA 5GCNA 3TFYA 2OH1A 5I4MA 5C88A 4CAWA 3R9GA 4FBEA 5THWA 4KSFA 2EUIA 2PRBA 5JGFA 2Z10A 1NE9A 5F46A 4MFQA 1ZLHA 3PRTA 4CAXA 3D7GA 3S6GA 4B10A 2EK9A 2R8VA 4JXQA 2YNCA 1LANA 3S6KA 1ARMA 1VGYA 1ON0A 4B11A 3GKRA 2BSWA 1WK4A 1N71A 2WYRA 4Y49B 1A2ZA 1RTQA 1YW6A 5KTAA 4MHPA 5F47A 2PJ5A 3CXSA 4ORFA 3B3CA 1QSRA 2BEIA 1TKJA 1FNOA 2AFSA 2I3CA 5F49A 5LYDA 1S7FA 3IFEA 4HKFA 1Q2YA 4G1PA 4AXVA 4CYOA 2XEGA 3RYOA 2PJ4A 4X2TA 2AFMA 1J4JA 4QBJA 5AG4A 3SJFA 4ZY0A 4UFXA 1R43A 2P0WA 4JWPA 3B3VA 3FB3A 4FD4A 1M4GA 2PJBA 1TF8A 2ZW4A 4P4FA 1DTDA 3B7IA 3MGDA 5E96A 2C6CA 4H6ZA 4OP4A 3FECA 4U9YA 4JXRA 4YRHA 3QB8A 1VIXA 1S7LA 3IGRA 4MHYA 3P2HA 4MFKA 1OZPA 2Z3LA 4KOWA 1YREA 2ODFA 4AVCA 1IICA 1CG2A 1UWYA 1YLEA 1IGBA 4Y49C 4EWTA 4MMOA 1HDUA 1M4IA 2G3TA 1OBRA 3CPXA 3KASA 5LYFA 5DWNA 2OOTA 4CYNA 5ELYA 4KORA 2GU2A 3PBEA 5JPHA 1JWQA 3H5ZA 2ATRA 5G21A 4AB7A 2BO9A 3TC8A 5KTDA 2PJ2A 2B4DB 4CGMA 3FBUA 2G0BA 3HLPA 2P6EA 2ZEDA 2Q0YA 5F48A 2GIVA 4UCNA 3DR8A 5G1ZA 3D3SA 3H8GA 2WZNA 2PJ6A 5K8MA 3DLJA 2B5GA 1KUYA 2X7BA 4L8AA 1WWZA 3NFZA 3KKWA 4Q36A 2YNCC 4UF4A 3V7ZA 2OZHA 5IB9A 2HUZA 2FCKA 5AG7A 3WT4A 5K8OA 1Q2CA 3PB6X 4OC1A 2C1CA 3B3WA 2OU2A 2AFZA 1VHOA 4BD9A 4MJ8A 2B58A 3C26A 3VWDA 1Y9WA 2BCOA 1CPXA 2P6FA 3EC4A 2JLMA 5G20A 3NE7A 4F9UA 2F8HA 6CPAA 5LRKA 1Z8TA 1FY7A 2FL4A 2ZW7A 2OZUA 1QSTA 2G3AA 1ELLP 1AYEA 1LCPA 3G8WA 2NSMA 4I49A 2FXFA 4B14A 1CJWA 1Y7RA 2CTBA 2FE7A 3KHXA 4P10A 3T9YA 1Y9KA 3WABA 1B6BA 1Z4EA 1XF8A 3FMCA 2EBJA 3VARA 4A30A 2AFXA 4MFJA 4A37A 1VHEA 5C82A 4FAIA 2B5GB 2J8MA 4KLVA 2D4PA 3QAHA 3PB9X 5D8NA 4OC5A 4DYOA 3SJGA 3KGQA 1VKCA 4GS4A 1CBXA 3FH4A 3BJ8A 1AMPA 1S5KA 2HV2A 3SI0A 4R9MA 4CGOA 4II9A 4JLYA 1B87A 3BLNA 2Q4YA 2PJ7A 3PP9A 4RUHA 2ARHA 2PJCA 3NH4A 2F5IA 2FS5A 3IEHA 1CP6A 4NFRA 1BLLE 1TKFA 4ZY2A 4NCZA 2IQ6A 3FF3A 3GY9A 1IY7A 3SI2A 1IOIA 3H4QA 2ZEOA 3FVLA 3G3SA 4QB9A 4FD6A 4F0XA 2R98A 3N7ZA 3QNVA 4HNXB 4LQGA 4OIWA 1EE3P 3OWCA 2PSWA 3S6FA 5EBVA 4MFPA 2J8RA 3IU2A 2V8GA 2G9DA 4R7MA 2YNDA 5J8CA 3EXNA 4EVYA 2AJ6A 3FRMA 4MY3A 4OC3A 4TWEA 5JQ4A 1PYTB 4LQ6A 1NSLA 1Z9UA 4Q38A 2VZYA 4PXEA 3W91A 1GHEA 1XEBA 4OC0A 1Z8LA 4XPKA 2DEAA 4PXCA 3KZWA 3RBUA 4F8ZA 2GREA 4XNHB 2XEFA 3S9LA 4A95A 2K5TA 5J1QA 3NH8A 2PC1A 3IC1A 4MHDA 2VQYA 2J8NA 3LACA 4F6AA 3JRUA 1M4LA 3D8PA 4E8OA 4B5OA 1UFHA 2C27A 4C2YA 2DPSA 2ZOFA 1RO5A 1TXRA 3IWWA 1QSNA 1Y7EA 4C2XA 3NE8A 3P2FA 2B3VA 3B3SA 3B3TA 3DR6A 4IAVA 4R8FA 3W6XA 2A4NA 4CAFA
chains in the Genus database with same CATH topology
1K4JA 3SXNA 4OAEA 1CM0A 4OLLA 3FNCA 4KSAA 4XNHC 4C7IA 2JDDA 3JVNA 1P0HA 2QECA 1IYKA 4JJXA 1ZO0A 3EY5A 4KVME 2WPWA 4CAEA 2GE3A 3LD2A 1MK4A 4KVOE 2WPXA 5IV0A 1IYLA 3LODA 2QIRA 2REEA 1RXTA 3SHPA 4CGPA 3DNSA 2DPTA 4L89A 2Z3OA 1SQHA 4KZTA 4MY0A 2Y0MA 2PR1A 2Q04A 3W6SA 1Q2DA 2ZW6A 2EVNA 4AG7A 2Z11A 3F5BA 1NMTA 2I00A 4R87A 4LUAA 4QVTA 4UFVA 2VZZA 4QC6A 3R96A 1S7NA 3I3GA 5H86A 3TOAA 3UY5A 4PK2A 3V8IA 5ISVA 1YGHA 2Q4VA 1M4DA 2CY2A 2O28A 4UBRA 3ZJ0A 3VWEA 4YFJA 5HMNA 3F8KA 4B13A 1BOBA 2REFA 2CNSA 3ZZIA 5AG6A 5EC4A 4KOSA 2Q7BA 4KS9A 4UA3A 4NEXA 4QUSA 4BMHA 5J8FA 2Q44A 4A2ZA 2ZPAA 4IF5A 2B3UA 2FT0A 2DXQA 2ZW5A 3GYAA 4MBUA 1YVKA 4NSQA 4R3LA 1XMTA 5AGEA 4PK3A 4AG9A 3T90A 4FD5A 1BO4A 3A9LA 4UWIA 4R3KA 2YGWA 4ZBGA 4PSWA 3D2MA 2RC4A 3TO6A 3CXQA 2HQYA 4H6UA 3FXTA 4C2ZA 3JTKA 2Z3MA 3BJ7A 3JUWA 3EO4A 3TCVA 4U5YA 4F0YA 1I21A 4H89A 1R57A 1QSOA 3D2PA 4ONUA 4MI4A 5G22A 3DSBA 4CRZB 4NF1A 1IIDA 2AE6A 5A27A 4CGNA 4R57A 4IUSA 3PZJA 4U9ZA 4A32A 3EFAA 3R1KA 3FYNA 2WSAA 4PSXA 3PGPA 2OB0A 2BL1A 2FSRA 3IWGA 2KCWA 4BBHA 5H84A 4AVAA 2VI7A 1KZFA 1VHSA 3TT2A 1MJ9A 5AG5A 1I12A 2Z0ZA 3DDDA 3SXOA 2PQ8A 2Z3NA 4RI1A 5HH1A 3R9FA 4CS0B 2VXKA 5I0CA 4OADA 1PU9A 4XPDB 4A31A 1YVOA 2B4DA 1IB1E 1LRZA 2FIAA 4PV6A 2NMTA 4B12A 2GANA 2JEVA 2JDCA 4KUAA 3FIXA 5DWMA 4CRYB 4UCPA 4AVBA 1I1DA 4MFLA 4CGLA 5CNPA 4ZGYB 3TO7A 1MJBA 3IWEA 3TE4A 4UCMA 4E2AA 2PDOA 2FIWA 4K30A 4XPDC 3TTHA 2VEZA 2I79A 1TIQA 5A28A 4KOXA 1KUXA 4FD7A 4M3SA 4C7HA 2IL4A 3TOBA 3TO9A 4KOUA 5IB0A 2CNMA 4X5KA 1L0CA 1YX0A 4KUBA 4HNYB 4CYPA 3R95A 2D4OA 2YNEA 5FVJA 4NXYA 4KOYA 4B5PA 4J3GA 2Z3PA 4DNCA 3CXPA 4KOTA 4XPLA 2QMLA 4JD6A 4LX9A 4KVXA 2R1IA 3E0KA 2WUUA 1S3ZA 2BUEA 4RS2A 1PUAA 1U6MA 4M85A 4MFZA 5IX3A 1YR0A 4CYQA 2OZGA 1S7KA 1KUVA 1MJAA 3S6HA 4B5PB 4CAVA 1Z4RA 4YGOA 2PR8A 2ZXVA 1V0CA 4C68A 1P4NA 4A33A 4UFWA 2H5MA 2VBQA 1XE4A 3IU1A 2P6GA 3R9EA 1M44A 3K9UA 4E0AA 1QSMA 2B4BA 2CXAA 3B8GA 3WR7A 5BWAB 1S60A 2R7HA 3F0AA 3I9SA 4HNWB 4UWJA 1YK3A 5KTCA 1XIXA 2CNTA 2Z3KA 4KOVA 1M1DA 4KLWA 5GCNA 3TFYA 2OH1A 5C88A 4CAWA 3R9GA 4KSFA 2EUIA 2PRBA 2Z10A 1NE9A 5F46A 4MFQA 4CAXA 3S6GA 4B10A 2R8VA 4JXQA 2YNCA 3S6KA 1ON0A 4B11A 3GKRA 2BSWA 1WK4A 1N71A 4Y49B 5KTAA 5F47A 3CXSA 4ORFA 1QSRA 2BEIA 5F49A 1S7FA 4HKFA 1Q2YA 4CYOA 3RYOA 1J4JA 4QBJA 5AG4A 4UFXA 2P0WA 4JWPA 4FD4A 3FB3A 1M4GA 2ZW4A 3MGDA 5E96A 4H6ZA 4U9YA 4JXRA 4YRHA 3QB8A 1S7LA 3IGRA 3P2HA 4MFKA 1OZPA 2Z3LA 4KOWA 1YREA 4AVCA 1IICA 1YLEA 4Y49C 1M4IA 2G3TA 5DWNA 4CYNA 4KORA 5JPHA 3H5ZA 2ATRA 5G21A 4AB7A 5KTDA 2B4DB 4CGMA 3FBUA 2G0BA 5F48A 2P6EA 2Q0YA 2GIVA 4UCNA 3DR8A 5G1ZA 3D3SA 2B5GA 1KUYA 2X7BA 4L8AA 1WWZA 3KKWA 4Q36A 2YNCC 2OZHA 2HUZA 2FCKA 5AG7A 1Q2CA 2OU2A 4MJ8A 2B58A 3C26A 3VWDA 1Y9WA 2P6FA 3EC4A 2JLMA 5G20A 3NE7A 1FY7A 2FL4A 2ZW7A 2OZUA 1QSTA 2G3AA 3G8WA 4B14A 4I49A 2FXFA 1CJWA 1Y7RA 2FE7A 3T9YA 1Y9KA 1B6BA 1Z4EA 1XF8A 4A30A 5C82A 4MFJA 2B5GB 2J8MA 4KLVA 2D4PA 3QAHA 1VKCA 4GS4A 3BJ8A 1S5KA 2HV2A 4R9MA 4CGOA 4II9A 4JLYA 1B87A 3BLNA 2Q4YA 3PP9A 2ARHA 2F5IA 2FS5A 4NCZA 3GY9A 3H4QA 3G3SA 4QB9A 4FD6A 4F0XA 2R98A 3N7ZA 4HNXB 3OWCA 2PSWA 3S6FA 5EBVA 4MFPA 2J8RA 3IU2A 2YNDA 5J8CA 3EXNA 4EVYA 2AJ6A 3FRMA 4MY3A 5JQ4A 1NSLA 1Z9UA 4Q38A 2VZYA 3W91A 1GHEA 1XEBA 4XPKA 4XNHB 4A95A 2K5TA 2PC1A 4MHDA 2VQYA 2J8NA 4F6AA 3D8PA 4E8OA 4B5OA 1UFHA 2C27A 4C2YA 2DPSA 1RO5A 1QSNA 4C2XA 3P2FA 2B3VA 3DR6A 3W6XA 2A4NA 4CAFA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1K4J A;  3SXN A;  4OAE A;  1CM0 A;  4OLL A;  3FNC A;  4XNH C;  2JDD A;  3JVN A;  1P0H A;  2QEC A;  1IYK A;  4JJX A;  3EY5 A;  4KVM E;  2WPW A;  2GE3 A;  3LD2 A;  1MK4 A;  4KVO E;  2WPX A;  5IV0 A;  1IYL A;  3LOD A;  2QIR A;  2REE A;  1RXT A;  3SHP A;  3DNS A;  4L89 A;  1SQH A;  4KZT A;  4MY0 A;  2Y0M A;  2PR1 A;  2Q04 A;  3W6S A;  1Q2D A;  2ZW6 A;  2EVN A;  4AG7 A;  2Z11 A;  3F5B A;  1NMT A;  2I00 A;  4R87 A;  4LUA A;  4QVT A;  2VZZ A;  4QC6 A;  3R96 A;  1S7N A;  3I3G A;  5H86 A;  3TOA A;  3UY5 A;  4PK2 A;  3V8I A;  5ISV A;  1YGH A;  2Q4V A;  1M4D A;  2CY2 A;  2O28 A;  4UBR A;  3ZJ0 A;  3VWE A;  4YFJ A;  5HMN A;  3F8K A;  1BOB A;  2REF A;  2CNS A;  3ZZI A;  5EC4 A;  4KOS A;  2Q7B A;  4UA3 A;  4NEX A;  4QUS A;  4BMH A;  5J8F A;  2Q44 A;  2ZPA A;  4IF5 A;  2B3U A;  2FT0 A;  2DXQ A;  2ZW5 A;  3GYA A;  4MBU A;  1YVK A;  4NSQ A;  4R3L A;  1XMT A;  4PK3 A;  4AG9 A;  3T90 A;  4FD5 A;  1BO4 A;  4UWI A;  4R3K A;  4ZBG A;  4PSW A;  3D2M A;  2RC4 A;  3TO6 A;  3CXQ A;  2HQY A;  4H6U A;  3FXT A;  3BJ7 A;  3JUW A;  3EO4 A;  3TCV A;  4U5Y A;  4F0Y A;  1I21 A;  4H89 A;  1R57 A;  1QSO A;  3D2P A;  4ONU A;  4MI4 A;  3DSB A;  4CRZ B;  4NF1 A;  1IID A;  2AE6 A;  4R57 A;  4IUS A;  3PZJ A;  4U9Z A;  3EFA A;  3R1K A;  3FYN A;  4PSX A;  3PGP A;  2OB0 A;  2BL1 A;  2FSR A;  3IWG A;  2KCW A;  5H84 A;  4AVA A;  2VI7 A;  1KZF A;  1VHS A;  3TT2 A;  1MJ9 A;  1I12 A;  2Z0Z A;  3DDD A;  3SXO A;  2PQ8 A;  4RI1 A;  5HH1 A;  3R9F A;  4CS0 B;  2VXK A;  5I0C A;  4OAD A;  1PU9 A;  4XPD B;  1YVO A;  2B4D A;  1IB1 E;  1LRZ A;  2FIA A;  4PV6 A;  2NMT A;  2GAN A;  2JEV A;  2JDC A;  4KUA A;  3FIX A;  5DWM A;  4CRY B;  4AVB A;  1I1D A;  5CNP A;  3TO7 A;  1MJB A;  3TE4 A;  4E2A A;  2PDO A;  2FIW A;  4K30 A;  4XPD C;  3TTH A;  2VEZ A;  2I79 A;  1TIQ A;  4KOX A;  1KUX A;  4FD7 A;  4M3S A;  2IL4 A;  3TOB A;  3TO9 A;  4KOU A;  5IB0 A;  2CNM A;  4X5K A;  1L0C A;  1YX0 A;  4KUB A;  4HNY B;  3R95 A;  2D4O A;  5FVJ A;  4NXY A;  4KOY A;  4B5P A;  4J3G A;  4DNC A;  4KOT A;  3CXP A;  4XPL A;  2QML A;  4JD6 A;  4LX9 A;  4KVX A;  2R1I A;  3E0K A;  1S3Z A;  2BUE A;  4RS2 A;  1PUA A;  1U6M A;  4M85 A;  5IX3 A;  1YR0 A;  2OZG A;  1S7K A;  1KUV A;  1MJA A;  3S6H A;  4B5P B;  4CAV A;  1Z4R A;  4YGO A;  2PR8 A;  2ZXV A;  1V0C A;  1P4N A;  2H5M A;  2VBQ A;  1XE4 A;  2P6G A;  3R9E A;  1M44 A;  3K9U A;  4E0A A;  1QSM A;  2B4B A;  3B8G A;  3WR7 A;  1S60 A;  2R7H A;  3F0A A;  3I9S A;  4HNW B;  4UWJ A;  1YK3 A;  5KTC A;  1XIX A;  2CNT A;  4KOV A;  1M1D A;  4KLW A;  5GCN A;  3TFY A;  2OH1 A;  5C88 A;  4CAW A;  3R9G A;  2EUI A;  2PRB A;  2Z10 A;  1NE9 A;  5F46 A;  4CAX A;  3S6G A;  2R8V A;  4JXQ A;  3S6K A;  1ON0 A;  3GKR A;  2BSW A;  1WK4 A;  1N71 A;  4Y49 B;  5KTA A;  5F47 A;  3CXS A;  4ORF A;  1QSR A;  2BEI A;  5F49 A;  1S7F A;  4HKF A;  1Q2Y A;  3RYO A;  1J4J A;  4QBJ A;  2P0W A;  4JWP A;  4FD4 A;  3FB3 A;  1M4G A;  2ZW4 A;  3MGD A;  5E96 A;  4H6Z A;  4U9Y A;  4JXR A;  4YRH A;  3QB8 A;  1S7L A;  3IGR A;  3P2H A;  1OZP A;  4KOW A;  1YRE A;  4AVC A;  1IIC A;  1YLE A;  4Y49 C;  1M4I A;  2G3T A;  5DWN A;  4KOR A;  5JPH A;  2ATR A;  4AB7 A;  5KTD A;  2B4D B;  3FBU A;  2G0B A;  5F48 A;  2P6E A;  2Q0Y A;  2GIV A;  3DR8 A;  3D3S A;  2B5G A;  1KUY A;  2X7B A;  4L8A A;  1WWZ A;  3KKW A;  2OZH A;  2HUZ A;  2FCK A;  1Q2C A;  2OU2 A;  4MJ8 A;  2B58 A;  3C26 A;  3VWD A;  1Y9W A;  2P6F A;  3EC4 A;  2JLM A;  3NE7 A;  1FY7 A;  2FL4 A;  2ZW7 A;  2OZU A;  1QST A;  2G3A A;  3G8W A;  4I49 A;  2FXF A;  1CJW A;  1Y7R A;  2FE7 A;  3T9Y A;  1Y9K A;  1B6B A;  1Z4E A;  1XF8 A;  5C82 A;  2B5G B;  2J8M A;  4KLV A;  2D4P A;  3QAH A;  1VKC A;  4GS4 A;  3BJ8 A;  1S5K A;  2HV2 A;  4R9M A;  4II9 A;  4JLY A;  1B87 A;  3BLN A;  2Q4Y A;  3PP9 A;  2ARH A;  2F5I A;  2FS5 A;  4NCZ A;  3GY9 A;  3H4Q A;  3G3S A;  4QB9 A;  4FD6 A;  2R98 A;  3N7Z A;  4HNX B;  3OWC A;  2PSW A;  3S6F A;  5EBV A;  2J8R A;  5J8C A;  3EXN A;  4EVY A;  2AJ6 A;  3FRM A;  4MY3 A;  5JQ4 A;  1NSL A;  1Z9U A;  2VZY A;  3W91 A;  1GHE A;  1XEB A;  4XPK A;  4XNH B;  2K5T A;  2PC1 A;  4MHD A;  2VQY A;  2J8N A;  4F6A A;  3D8P A;  4E8O A;  4B5O A;  1UFH A;  2C27 A;  1RO5 A;  1QSN A;  3P2F A;  2B3V A;  3DR6 A;  3W6X A;  2A4N A; 
#chains in the Genus database with same CATH topology
 5HVH A;  3PFO A;  2AFW A;  1K4J A;  3SXN A;  1IU8 A;  5CBM A;  3WC6 A;  4OAE A;  1CM0 A;  4IHM A;  4OLL A;  3FNC A;  4KSA A;  3D7D A;  1FT7 A;  4XNH C;  4OME A;  2JDD A;  4C7I A;  4DJL A;  2V8H A;  3JVN A;  4FWU A;  3BI0 A;  1P0H A;  4WJB A;  3H8E A;  2QEC A;  1IYK A;  2V8V A;  2XEI A;  4JJX A;  1Z5R A;  1ZO0 A;  3PB4 X;  2HB6 A;  1BAV A;  3EY5 A;  4KVM E;  2WPW A;  4CAE A;  2GE3 A;  1BPM A;  1AUG A;  1MK4 A;  3LD2 A;  4OID A;  4KVO E;  2WPX A;  5IV0 A;  3QAY A;  1IYL A;  3LOD A;  2QIR A;  2REE A;  2GLJ A;  2Q51 A;  1RXT A;  3SJE A;  3SHP A;  4CGP A;  2EWB A;  3DNS A;  2DPT A;  3N5F A;  3CPA A;  4L89 A;  2Z3O A;  1SQH A;  4KZT A;  1Y0Y A;  2ABZ A;  4MY0 A;  1XMB A;  2Y0M A;  2V77 A;  2PR1 A;  2Q04 A;  3W6S A;  4MCQ A;  4JZ0 A;  1Q2D A;  3GLJ A;  2O4H A;  2ZW6 A;  2EVN A;  4AG7 A;  4A39 A;  2RFH A;  2Z11 A;  2PJ1 A;  3F5B A;  1NMT A;  2I00 A;  4R87 A;  3D7H A;  1GYT A;  4LUA A;  4QVT A;  4UFV A;  1H8L A;  1ELM P;  3PB7 X;  4W9Y A;  4NJR A;  2VZZ A;  4ONW A;  4JYW A;  4QC6 A;  1TF9 A;  3R96 A;  1S7N A;  3RO0 A;  3I3G A;  2NYQ A;  5H86 A;  3TOA A;  4ZY1 A;  3UY5 A;  1ZG7 A;  3L2N A;  4PK2 A;  4M6G A;  3KL9 A;  3V8I A;  1BPN A;  4NGN A;  3T8W A;  5ISV A;  1X12 A;  1YGH A;  1CX8 A;  2Q4V A;  1M4D A;  2CY2 A;  1PCA A;  2O28 A;  2PJA A;  4HPS A;  4UBR A;  4UEF A;  3ZJ0 A;  2IJZ A;  3D67 A;  3VWE A;  4YFJ A;  3KR5 A;  3B35 A;  4OC2 A;  5HMN A;  3F8K A;  3NH5 A;  4B13 A;  1BOB A;  3FJU A;  2PIZ A;  4TNU A;  2REF A;  2CNS A;  3RZA A;  5AG6 A;  2CTC A;  3ZZI A;  4P4B A;  2OR4 A;  4BIN A;  5EC4 A;  2PRQ A;  1YLO A;  3CZX A;  4KOS A;  4GXH A;  3BXM A;  4RN7 A;  2Q7B A;  4A94 A;  4KS9 A;  4UA3 A;  4NEX A;  4QUS A;  4BMH A;  2PE3 A;  3RAM A;  5J8F A;  5LRJ A;  2Q44 A;  1CPS A;  4A2Z A;  2ZPA A;  1HEE A;  1LFW A;  3VAT A;  4IF5 A;  2B3U A;  2GFQ A;  2FT0 A;  2DXQ A;  4UIB A;  3D68 A;  3RNZ A;  3WC7 A;  3FED A;  1ZLI A;  2ZW5 A;  3GYA A;  4ZYQ A;  5F09 A;  5JH9 A;  4UEZ A;  4MBU A;  1YVK A;  3IIB A;  4NSQ A;  1XMT A;  2EK8 A;  4P44 A;  1F57 A;  4R3L A;  3WC5 A;  2AFO A;  5AGE A;  3VH9 A;  4PK3 A;  3LMS A;  2JBJ A;  3T90 A;  4AG9 A;  2O53 A;  3ISZ A;  4FD5 A;  1BO4 A;  2ZEL A;  3A9L A;  3CDX A;  4UWI A;  4NGQ A;  4R3K A;  2YGW A;  4ZBG A;  4PSW A;  1HDQ A;  3D2M A;  2ZEN A;  2ZOG A;  4YU9 A;  4MCS A;  4P4D A;  4B6Z A;  2RC4 A;  3TO6 A;  3CXQ A;  4CPA A;  1YSJ A;  4GM5 A;  4MCR A;  4PPZ A;  2HQY A;  4KSI A;  2PVV A;  4H6U A;  2ZEE A;  5D29 A;  3FXT A;  4C2Z A;  3JTK A;  1ZG9 A;  1Y0R A;  2PJ0 A;  2Z3M A;  3BJ7 A;  3JUW A;  2VL1 A;  1Z2L A;  3GB0 A;  3ISX A;  1LOK A;  2PVW A;  3EO4 A;  4NGM A;  3TCV A;  4U5Y A;  4F0Y A;  1I21 A;  1QMU A;  4H89 A;  1R57 A;  1QSO A;  3D2P A;  4ONU A;  4MI4 A;  4IK2 A;  5G22 A;  3DSB A;  4O23 A;  1JQG A;  5HVG A;  4CRZ B;  1NSA A;  4NF1 A;  1IID A;  2AE6 A;  5A27 A;  4CGN A;  4R57 A;  3FEE A;  4IUS A;  2JBK A;  3PFE A;  3I1U A;  3PZJ A;  4U9Z A;  2QJ8 A;  4Q7A A;  4A32 A;  3EFA A;  3R1K A;  2J9A A;  3FYN A;  4X8I A;  2WSA A;  4PSX A;  3PGP A;  3GIU A;  3BI1 A;  2OB0 A;  1XOV A;  2BL1 A;  2BOA A;  2CF4 A;  2FSR A;  5CPA A;  8CPA A;  3IWG A;  2KCW A;  4BBH A;  5H84 A;  2PJ9 A;  3NA6 A;  4AVA A;  1XRY A;  1LAP A;  2VI7 A;  1KZF A;  1VHS A;  2PJ3 A;  2PIY A;  3K9T A;  3TT2 A;  1MJ9 A;  5AG5 A;  4MRI A;  4OC4 A;  3D7F A;  5HXD A;  1I12 A;  4PXB A;  2Z0Z A;  3SI1 A;  3DDD A;  2QVP A;  1XFO A;  3BHX A;  3SXO A;  4ZI6 A;  2PQ8 A;  2Z3N A;  4RI1 A;  5HH1 A;  2ZEG A;  3R9F A;  2PCU A;  2QYV A;  4CS0 B;  2VXK A;  5I0C A;  4DUK A;  1DE4 C;  4OAD A;  1ZG8 A;  2DF5 A;  1PU9 A;  3PEI A;  4XPD B;  4A31 A;  4NGS A;  4P6Y A;  1YVO A;  2B4D A;  1IB1 E;  1LRZ A;  2FIA A;  4PV6 A;  3B2Y A;  3S9M A;  2NMT A;  4B12 A;  2GAN A;  2JEV A;  2JDC A;  4NJQ A;  4KUA A;  1X10 A;  3FIX A;  3H8F A;  5DWM A;  4CRY B;  4UCP A;  4AVB A;  1I1D A;  4MFL A;  1XBU A;  4WWV A;  5LYL A;  4CGL A;  5CNP A;  1TKH A;  2ANP A;  3V38 A;  4ZGY B;  3KQX A;  3TO7 A;  1MJB A;  3IWE A;  4MCP A;  2EO8 A;  3K2K A;  3TE4 A;  4Z65 A;  4NGT A;  4UCM A;  2GLF A;  4H2K A;  4ZX8 A;  3KR4 A;  4MHN A;  2RB7 A;  5LYI A;  3CT9 A;  5K8P A;  4E2A A;  2PDO A;  2FIW A;  4K30 A;  4XPD C;  1R3N A;  2VEZ A;  2I79 A;  3TTH A;  1TIQ A;  5A28 A;  4KOX A;  2POK A;  4NGP A;  4PXD A;  1KUX A;  4FD7 A;  2XEJ A;  4M3S A;  4C7H A;  2IL4 A;  3TOB A;  3TO9 A;  4KOU A;  2AFU A;  4MXU A;  5IB0 A;  2ZEP A;  3MN8 A;  3PB8 X;  2CNM A;  4X5K A;  1QQ9 A;  1L0C A;  1YX0 A;  2Q43 A;  3KQZ A;  4HNY B;  4KUB A;  4CYP A;  1YME A;  3R95 A;  2D4O A;  2YNE A;  3MRU A;  4UIA A;  5FVJ A;  4NXY A;  1ARL A;  3D4U A;  4P4E A;  2ZEH A;  5HVF A;  4KOY A;  4B5P A;  4J3G A;  5LRG A;  2Z3P A;  5DS0 A;  3TX8 A;  4DNC A;  2V8D A;  3CXP A;  4KOT A;  4XPL A;  2QML A;  4EFD A;  1KWM A;  4JD6 A;  4LX9 A;  4KVX A;  1Z8W A;  2R1I A;  3E0K A;  2WUU A;  5JM6 A;  1S3Z A;  2BUE A;  4EME A;  4OKO A;  1PUA A;  4RS2 A;  1U6M A;  2Q4Z A;  4M85 A;  2ZEM A;  4P4I A;  2JEW A;  4PQA A;  4MFZ A;  5IX3 A;  1YR0 A;  4CYQ A;  2IMO A;  4UEE A;  4FUU A;  3LWU A;  2OZG A;  1XJO A;  3KI9 A;  2ZEF A;  1S7K A;  1Z8X A;  4NGR A;  1KUV A;  1MJA A;  3S6H A;  4P45 A;  3GUX A;  4A38 A;  4R76 A;  1CP7 A;  3DGV A;  3IJ3 A;  3D66 A;  3PBB A;  5EMI A;  4B5P B;  4CAV A;  1Z4R A;  3HUV A;  4YGO A;  1F2P A;  2PR8 A;  2ZXV A;  2C6P A;  1V0C A;  4C68 A;  2PJ8 A;  1YQE A;  1P4N A;  3IO1 A;  4A33 A;  4UFW A;  4YWY A;  2H5M A;  2VBQ A;  1XE4 A;  2CIJ A;  2P6G A;  1IOF A;  1LAM A;  3IU1 A;  3R9E A;  1M44 A;  4K3N A;  4MHZ A;  4P4J A;  2Q7S A;  3K9U A;  4E0A A;  5K8N A;  1QSM A;  4M6I A;  2B4B A;  2CXA A;  3S9N A;  3B8G A;  4ZX9 A;  3WR7 A;  1YW4 A;  3SJX A;  2HC9 A;  5BWA B;  1S60 A;  4X3R A;  2R7H A;  3F0A A;  3I9S A;  4F9V A;  4HNW B;  4UWJ A;  1YK3 A;  2FVG A;  5KTC A;  7CPA A;  3FX6 A;  2C6G A;  4M6H A;  1Q7L A;  1XIX A;  2CNT A;  1F2O A;  4R6T A;  2F7V A;  2Z3K A;  3KHZ A;  4KOV A;  1M1D A;  4KLW A;  5GCN A;  3TFY A;  2OH1 A;  5I4M A;  5C88 A;  4CAW A;  3R9G A;  4FBE A;  5THW A;  4KSF A;  2EUI A;  2PRB A;  5JGF A;  2Z10 A;  1NE9 A;  5F46 A;  4MFQ A;  1ZLH A;  3PRT A;  4CAX A;  3D7G A;  3S6G A;  4B10 A;  2EK9 A;  2R8V A;  4JXQ A;  2YNC A;  1LAN A;  3S6K A;  1ARM A;  1VGY A;  1ON0 A;  4B11 A;  3GKR A;  2BSW A;  1WK4 A;  1N71 A;  2WYR A;  4Y49 B;  1A2Z A;  1RTQ A;  1YW6 A;  5KTA A;  4MHP A;  5F47 A;  2PJ5 A;  3CXS A;  4ORF A;  3B3C A;  1QSR A;  2BEI A;  1TKJ A;  1FNO A;  2AFS A;  2I3C A;  5F49 A;  5LYD A;  1S7F A;  3IFE A;  4HKF A;  1Q2Y A;  4G1P A;  4AXV A;  4CYO A;  2XEG A;  3RYO A;  2PJ4 A;  4X2T A;  2AFM A;  1J4J A;  4QBJ A;  5AG4 A;  3SJF A;  4ZY0 A;  4UFX A;  1R43 A;  2P0W A;  4JWP A;  3B3V A;  3FB3 A;  4FD4 A;  1M4G A;  2PJB A;  1TF8 A;  2ZW4 A;  4P4F A;  1DTD A;  3B7I A;  3MGD A;  5E96 A;  2C6C A;  4H6Z A;  4OP4 A;  3FEC A;  4U9Y A;  4JXR A;  4YRH A;  3QB8 A;  1VIX A;  1S7L A;  3IGR A;  4MHY A;  3P2H A;  4MFK A;  1OZP A;  2Z3L A;  4KOW A;  1YRE A;  2ODF A;  4AVC A;  1IIC A;  1CG2 A;  1UWY A;  1YLE A;  1IGB A;  4Y49 C;  4EWT A;  4MMO A;  1HDU A;  1M4I A;  2G3T A;  1OBR A;  3CPX A;  3KAS A;  5LYF A;  5DWN A;  2OOT A;  4CYN A;  5ELY A;  4KOR A;  2GU2 A;  3PBE A;  5JPH A;  1JWQ A;  3H5Z A;  2ATR A;  5G21 A;  4AB7 A;  2BO9 A;  3TC8 A;  5KTD A;  2PJ2 A;  2B4D B;  4CGM A;  3FBU A;  2G0B A;  3HLP A;  2P6E A;  2ZED A;  2Q0Y A;  5F48 A;  2GIV A;  4UCN A;  3DR8 A;  5G1Z A;  3D3S A;  3H8G A;  2WZN A;  2PJ6 A;  5K8M A;  3DLJ A;  2B5G A;  1KUY A;  2X7B A;  4L8A A;  1WWZ A;  3NFZ A;  3KKW A;  4Q36 A;  2YNC C;  4UF4 A;  3V7Z A;  2OZH A;  5IB9 A;  2HUZ A;  2FCK A;  5AG7 A;  3WT4 A;  5K8O A;  1Q2C A;  3PB6 X;  4OC1 A;  2C1C A;  3B3W A;  2OU2 A;  2AFZ A;  1VHO A;  4BD9 A;  4MJ8 A;  2B58 A;  3C26 A;  3VWD A;  1Y9W A;  2BCO A;  1CPX A;  2P6F A;  3EC4 A;  2JLM A;  5G20 A;  3NE7 A;  4F9U A;  2F8H A;  6CPA A;  5LRK A;  1Z8T A;  1FY7 A;  2FL4 A;  2ZW7 A;  2OZU A;  1QST A;  2G3A A;  1ELL P;  1AYE A;  1LCP A;  3G8W A;  2NSM A;  4I49 A;  2FXF A;  4B14 A;  1CJW A;  1Y7R A;  2CTB A;  2FE7 A;  3KHX A;  4P10 A;  3T9Y A;  1Y9K A;  3WAB A;  1B6B A;  1Z4E A;  1XF8 A;  3FMC A;  2EBJ A;  3VAR A;  4A30 A;  2AFX A;  4MFJ A;  4A37 A;  1VHE A;  5C82 A;  4FAI A;  2B5G B;  2J8M A;  4KLV A;  2D4P A;  3QAH A;  3PB9 X;  5D8N A;  4OC5 A;  4DYO A;  3SJG A;  3KGQ A;  1VKC A;  4GS4 A;  1CBX A;  3FH4 A;  3BJ8 A;  1AMP A;  1S5K A;  2HV2 A;  3SI0 A;  4R9M A;  4CGO A;  4II9 A;  4JLY A;  1B87 A;  3BLN A;  2Q4Y A;  2PJ7 A;  3PP9 A;  4RUH A;  2ARH A;  2PJC A;  3NH4 A;  2F5I A;  2FS5 A;  3IEH A;  1CP6 A;  4NFR A;  1BLL E;  1TKF A;  4ZY2 A;  4NCZ A;  2IQ6 A;  3FF3 A;  3GY9 A;  1IY7 A;  3SI2 A;  1IOI A;  3H4Q A;  2ZEO A;  3FVL A;  3G3S A;  4QB9 A;  4FD6 A;  4F0X A;  2R98 A;  3N7Z A;  3QNV A;  4HNX B;  4LQG A;  4OIW A;  1EE3 P;  3OWC A;  2PSW A;  3S6F A;  5EBV A;  4MFP A;  2J8R A;  3IU2 A;  2V8G A;  2G9D A;  4R7M A;  2YND A;  5J8C A;  3EXN A;  4EVY A;  2AJ6 A;  3FRM A;  4MY3 A;  4OC3 A;  4TWE A;  5JQ4 A;  1PYT B;  4LQ6 A;  1NSL A;  1Z9U A;  4Q38 A;  2VZY A;  4PXE A;  3W91 A;  1GHE A;  1XEB A;  4OC0 A;  1Z8L A;  4XPK A;  2DEA A;  4PXC A;  3KZW A;  3RBU A;  4F8Z A;  2GRE A;  4XNH B;  2XEF A;  3S9L A;  4A95 A;  2K5T A;  5J1Q A;  3NH8 A;  2PC1 A;  3IC1 A;  4MHD A;  2VQY A;  2J8N A;  3LAC A;  4F6A A;  3JRU A;  1M4L A;  3D8P A;  4E8O A;  4B5O A;  1UFH A;  2C27 A;  4C2Y A;  2DPS A;  2ZOF A;  1RO5 A;  1TXR A;  3IWW A;  1QSN A;  1Y7E A;  4C2X A;  3NE8 A;  3P2F A;  2B3V A;  3B3S A;  3B3T A;  3DR6 A;  4IAV A;  4R8F A;  3W6X A;  2A4N A;  4CAF A; 
#chains in the Genus database with same CATH homology
 1K4J A;  3SXN A;  4OAE A;  1CM0 A;  4OLL A;  3FNC A;  4KSA A;  4XNH C;  4C7I A;  2JDD A;  3JVN A;  1P0H A;  2QEC A;  1IYK A;  4JJX A;  1ZO0 A;  3EY5 A;  4KVM E;  2WPW A;  4CAE A;  2GE3 A;  3LD2 A;  1MK4 A;  4KVO E;  2WPX A;  5IV0 A;  1IYL A;  3LOD A;  2QIR A;  2REE A;  1RXT A;  3SHP A;  4CGP A;  3DNS A;  2DPT A;  4L89 A;  2Z3O A;  1SQH A;  4KZT A;  4MY0 A;  2Y0M A;  2PR1 A;  2Q04 A;  3W6S A;  1Q2D A;  2ZW6 A;  2EVN A;  4AG7 A;  2Z11 A;  3F5B A;  1NMT A;  2I00 A;  4R87 A;  4LUA A;  4QVT A;  4UFV A;  2VZZ A;  4QC6 A;  3R96 A;  1S7N A;  3I3G A;  5H86 A;  3TOA A;  3UY5 A;  4PK2 A;  3V8I A;  5ISV A;  1YGH A;  2Q4V A;  1M4D A;  2CY2 A;  2O28 A;  4UBR A;  3ZJ0 A;  3VWE A;  4YFJ A;  5HMN A;  3F8K A;  4B13 A;  1BOB A;  2REF A;  2CNS A;  3ZZI A;  5AG6 A;  5EC4 A;  4KOS A;  2Q7B A;  4KS9 A;  4UA3 A;  4NEX A;  4QUS A;  4BMH A;  5J8F A;  2Q44 A;  4A2Z A;  2ZPA A;  4IF5 A;  2B3U A;  2FT0 A;  2DXQ A;  2ZW5 A;  3GYA A;  4MBU A;  1YVK A;  4NSQ A;  4R3L A;  1XMT A;  5AGE A;  4PK3 A;  4AG9 A;  3T90 A;  4FD5 A;  1BO4 A;  3A9L A;  4UWI A;  4R3K A;  2YGW A;  4ZBG A;  4PSW A;  3D2M A;  2RC4 A;  3TO6 A;  3CXQ A;  2HQY A;  4H6U A;  3FXT A;  4C2Z A;  3JTK A;  2Z3M A;  3BJ7 A;  3JUW A;  3EO4 A;  3TCV A;  4U5Y A;  4F0Y A;  1I21 A;  4H89 A;  1R57 A;  1QSO A;  3D2P A;  4ONU A;  4MI4 A;  5G22 A;  3DSB A;  4CRZ B;  4NF1 A;  1IID A;  2AE6 A;  5A27 A;  4CGN A;  4R57 A;  4IUS A;  3PZJ A;  4U9Z A;  4A32 A;  3EFA A;  3R1K A;  3FYN A;  2WSA A;  4PSX A;  3PGP A;  2OB0 A;  2BL1 A;  2FSR A;  3IWG A;  2KCW A;  4BBH A;  5H84 A;  4AVA A;  2VI7 A;  1KZF A;  1VHS A;  3TT2 A;  1MJ9 A;  5AG5 A;  1I12 A;  2Z0Z A;  3DDD A;  3SXO A;  2PQ8 A;  2Z3N A;  4RI1 A;  5HH1 A;  3R9F A;  4CS0 B;  2VXK A;  5I0C A;  4OAD A;  1PU9 A;  4XPD B;  4A31 A;  1YVO A;  2B4D A;  1IB1 E;  1LRZ A;  2FIA A;  4PV6 A;  2NMT A;  4B12 A;  2GAN A;  2JEV A;  2JDC A;  4KUA A;  3FIX A;  5DWM A;  4CRY B;  4UCP A;  4AVB A;  1I1D A;  4MFL A;  4CGL A;  5CNP A;  4ZGY B;  3TO7 A;  1MJB A;  3IWE A;  3TE4 A;  4UCM A;  4E2A A;  2PDO A;  2FIW A;  4K30 A;  4XPD C;  3TTH A;  2VEZ A;  2I79 A;  1TIQ A;  5A28 A;  4KOX A;  1KUX A;  4FD7 A;  4M3S A;  4C7H A;  2IL4 A;  3TOB A;  3TO9 A;  4KOU A;  5IB0 A;  2CNM A;  4X5K A;  1L0C A;  1YX0 A;  4KUB A;  4HNY B;  4CYP A;  3R95 A;  2D4O A;  2YNE A;  5FVJ A;  4NXY A;  4KOY A;  4B5P A;  4J3G A;  2Z3P A;  4DNC A;  3CXP A;  4KOT A;  4XPL A;  2QML A;  4JD6 A;  4LX9 A;  4KVX A;  2R1I A;  3E0K A;  2WUU A;  1S3Z A;  2BUE A;  4RS2 A;  1PUA A;  1U6M A;  4M85 A;  4MFZ A;  5IX3 A;  1YR0 A;  4CYQ A;  2OZG A;  1S7K A;  1KUV A;  1MJA A;  3S6H A;  4B5P B;  4CAV A;  1Z4R A;  4YGO A;  2PR8 A;  2ZXV A;  1V0C A;  4C68 A;  1P4N A;  4A33 A;  4UFW A;  2H5M A;  2VBQ A;  1XE4 A;  3IU1 A;  2P6G A;  3R9E A;  1M44 A;  3K9U A;  4E0A A;  1QSM A;  2B4B A;  2CXA A;  3B8G A;  3WR7 A;  5BWA B;  1S60 A;  2R7H A;  3F0A A;  3I9S A;  4HNW B;  4UWJ A;  1YK3 A;  5KTC A;  1XIX A;  2CNT A;  2Z3K A;  4KOV A;  1M1D A;  4KLW A;  5GCN A;  3TFY A;  2OH1 A;  5C88 A;  4CAW A;  3R9G A;  4KSF A;  2EUI A;  2PRB A;  2Z10 A;  1NE9 A;  5F46 A;  4MFQ A;  4CAX A;  3S6G A;  4B10 A;  2R8V A;  4JXQ A;  2YNC A;  3S6K A;  1ON0 A;  4B11 A;  3GKR A;  2BSW A;  1WK4 A;  1N71 A;  4Y49 B;  5KTA A;  5F47 A;  3CXS A;  4ORF A;  1QSR A;  2BEI A;  5F49 A;  1S7F A;  4HKF A;  1Q2Y A;  4CYO A;  3RYO A;  1J4J A;  4QBJ A;  5AG4 A;  4UFX A;  2P0W A;  4JWP A;  4FD4 A;  3FB3 A;  1M4G A;  2ZW4 A;  3MGD A;  5E96 A;  4H6Z A;  4U9Y A;  4JXR A;  4YRH A;  3QB8 A;  1S7L A;  3IGR A;  3P2H A;  4MFK A;  1OZP A;  2Z3L A;  4KOW A;  1YRE A;  4AVC A;  1IIC A;  1YLE A;  4Y49 C;  1M4I A;  2G3T A;  5DWN A;  4CYN A;  4KOR A;  5JPH A;  3H5Z A;  2ATR A;  5G21 A;  4AB7 A;  5KTD A;  2B4D B;  4CGM A;  3FBU A;  2G0B A;  5F48 A;  2P6E A;  2Q0Y A;  2GIV A;  4UCN A;  3DR8 A;  5G1Z A;  3D3S A;  2B5G A;  1KUY A;  2X7B A;  4L8A A;  1WWZ A;  3KKW A;  4Q36 A;  2YNC C;  2OZH A;  2HUZ A;  2FCK A;  5AG7 A;  1Q2C A;  2OU2 A;  4MJ8 A;  2B58 A;  3C26 A;  3VWD A;  1Y9W A;  2P6F A;  3EC4 A;  2JLM A;  5G20 A;  3NE7 A;  1FY7 A;  2FL4 A;  2ZW7 A;  2OZU A;  1QST A;  2G3A A;  3G8W A;  4B14 A;  4I49 A;  2FXF A;  1CJW A;  1Y7R A;  2FE7 A;  3T9Y A;  1Y9K A;  1B6B A;  1Z4E A;  1XF8 A;  4A30 A;  5C82 A;  4MFJ A;  2B5G B;  2J8M A;  4KLV A;  2D4P A;  3QAH A;  1VKC A;  4GS4 A;  3BJ8 A;  1S5K A;  2HV2 A;  4R9M A;  4CGO A;  4II9 A;  4JLY A;  1B87 A;  3BLN A;  2Q4Y A;  3PP9 A;  2ARH A;  2F5I A;  2FS5 A;  4NCZ A;  3GY9 A;  3H4Q A;  3G3S A;  4QB9 A;  4FD6 A;  4F0X A;  2R98 A;  3N7Z A;  4HNX B;  3OWC A;  2PSW A;  3S6F A;  5EBV A;  4MFP A;  2J8R A;  3IU2 A;  2YND A;  5J8C A;  3EXN A;  4EVY A;  2AJ6 A;  3FRM A;  4MY3 A;  5JQ4 A;  1NSL A;  1Z9U A;  4Q38 A;  2VZY A;  3W91 A;  1GHE A;  1XEB A;  4XPK A;  4XNH B;  4A95 A;  2K5T A;  2PC1 A;  4MHD A;  2VQY A;  2J8N A;  4F6A A;  3D8P A;  4E8O A;  4B5O A;  1UFH A;  2C27 A;  4C2Y A;  2DPS A;  1RO5 A;  1QSN A;  4C2X A;  3P2F A;  2B3V A;  3DR6 A;  3W6X A;  2A4N A;  4CAF A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...