1RO5A

Crystal structure of the ahl synthase lasi
Total Genus 56
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
56
sequence length
197
structure length
197
Chain Sequence
GSHMIVQIGRREEFDKKLLGEMHKLRAQVFKERKGWDVSVIDEMEIDGYDALSPYYMLIQEDGQVFGCWRILDTTGPYMLKNTFPELLHGKEAPCSPHIWELSRFAINSGQKGSLGFSDCTLEAMRALARYSLQNDIQTLVTVTTVGVEKMMIRAGLDVSRFGPHLKIGIERAVALRIELNAKTQIALYGGVLVEQR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Autoinducer synthesis protein lasI
publication title Structure of the Pseudomonas aeruginosa acyl-homoserinelactone synthase LasI.
pubmed doi rcsb
source organism Pseudomonas aeruginosa
molecule tags Signaling protein
total genus 56
structure length 197
sequence length 197
ec nomenclature ec 2.3.1.184: Acyl-homoserine-lactone synthase.
pdb deposition date 2003-12-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00765 Autoind_synth Autoinducer synthase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.630.30 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Aminopeptidase 1ro5A01
2FXFA 3S6HA 4UWJA 2Q4VA 1YLEA 2HQYA 4PV6A 2WPXA 4L8AA 1Z4RA 1PUAA 2ZXVA 3R9EA 3H4QA 4MHDA 2QIRA 3PGPA 2REFA 3P2FA 4X5KA 3S6GA 3R9FA 4NF1A 3ZZIA 4R3KA 5KTCA 3EY5A 4B5PA 3DSBA 4FD7A 1S7LA 2EUIA 3EO4A 4NCZA 4UWIA 5I0CA 1Y9KA 1WK4A 3W6XA 1I21A 3IWGA 3CXQA 4U5YA 4CAVA 4NSQA 1YVKA 4R87A 4E8OA 2G3AA 4KLWA 3BJ7A 1Y7RA 5DWMA 3W6SA 5J8FA 4RI1A 1QSNA 3P2HA 5DWNA 1M4GA 5C82A 2R7HA 3TCVA 5E96A 4QC6A 1M4IA 4Y49C 4FD6A 2VQYA 2JDCA 4KOXA 1IYKA 2I00A 3E0KA 1L0CA 3FXTA 3FNCA 5C88A 4CRZB 3BJ8A 3TE4A 4H89A 1YR0A 3CXPA 2P6EA 5CNPA 2ARHA 1YX0A 3FRMA 5JQ4A 2PRBA 2FSRA 1YK3A 2PDOA 4F6AA 4J3GA 3K9UA 3GKRA 3W91A 1KUXA 1S7FA 2ZPAA 3MGDA 3PZJA 1UFHA 3D2MA 1I1DA 4KLVA 5F47A 4H6UA 3SXOA 1NSLA 1YGHA 3C26A 1FY7A 4LUAA 1U6MA 2G3TA 3S6FA 1P4NA 1XF8A 1MJ9A 5H86A 4MJ8A 2JEVA 3QAHA 1V0CA 5F48A 3GYAA 2CNMA 2FIWA 4AB7A 2O28A 3SHPA 3B8GA 1S7NA 4XNHC 2FL4A 3EFAA 4PSXA 4HNXB 5IV0A 3R95A 2OB0A 4U9YA 4HNYB 2VI7A 4PSWA 2WPWA 4H6ZA 1XMTA 2BEIA 4QUSA 4KUBA 3S6KA 1SQHA 4R57A 3TTHA 1J4JA 3IGRA 4JXRA 2Q7BA 3R1KA 4IF5A 2JDDA 5EBVA 1Q2YA 2B5GB 1OZPA 4CRYB 2P0WA 2ZW6A 2ZW7A 4AVCA 3D2PA 3DR6A 4YFJA 3TFYA 4KVOE 3TO7A 4QVTA 2C27A 2REEA 2PR8A 3F5BA 4KVME 4ONUA 2B3VA 4II9A 4HKFA 1RO5A 4MI4A 2Y0MA 1M44A 1Z9UA 4OLLA 2Q44A 1XIXA 2GIVA 4QB9A 4BMHA 1YVOA 3F0AA 2JLMA 4UA3A 2ZW4A 2Z0ZA 3LD2A 4KOWA 1IB1E 4KOUA 4OADA 3BLNA 4KZTA 2VBQA 1M4DA 2F5IA 2P6FA 4GS4A 1LRZA 1YREA 3FYNA 4E2AA 1MJBA 2G0BA 2AJ6A 1XEBA 2I79A 5FVJA 3VWDA 1TIQA 5KTDA 4JXQA 2OU2A 3EC4A 3JVNA 3RYOA 2FE7A 1NE9A 1Z4EA 3DDDA 2VXKA 4PK2A 2OZHA 1MK4A 1GHEA 2B3UA 4KOYA 5HH1A 3NE7A 4QBJA 2AE6A 2Z10A 4CAWA 1VKCA 3R96A 2CNTA 1K4JA 1Y9WA 2B4BA 2EVNA 1BOBA 4MBUA 4RS2A 5F49A 2R98A 1B6BA 2Q04A 4AG9A 3FBUA 4KUAA 1ON0A 4XPDC 1Q2DA 3WR7A 1IYLA 2VEZA 2PC1A 1XE4A 2FIAA 2KCWA 4OAEA 2HUZA 2P6GA 1IIDA 2B4DB 2FS5A 1PU9A 4MY3A 4AVBA 4KOSA 2ATRA 2D4OA 2B5GA 3I3GA 4R3LA 1NMTA 1QSTA 4YRHA 3OWCA 5HMNA 3CXSA 2CY2A 1S60A 2HV2A 4EVYA 5GCNA 3D3SA 2Z11A 4JD6A 3QB8A 4LX9A 2GANA 4ORFA 4AG7A 3DR8A 2PSWA 4FD5A 2X7BA 3T9YA 4I49A 5JPHA 4U9ZA 1MJAA 3D8PA 3N7ZA 1P0HA 4Y49B 4B5PB 2ZW5A 2Q0YA 3F8KA 1KUVA 3DNSA 4NXYA 1VHSA 2DXQA 4NEXA 4MY0A 2QECA 3KKWA 2NMTA 3ZJ0A 4KOTA 4IUSA 4KVXA 1RXTA 3SXNA 2BUEA 2RC4A 4JJXA 2H5MA 2BL1A 1KUYA 2FCKA 2J8NA 2QMLA 3FIXA 3R9GA 4KOVA 4B5OA 5EC4A 1M1DA 4FD4A 4E0AA 2CNSA 2BSWA 4M85A 5IX3A 1QSRA 4M3SA 2J8MA 2J8RA 3TOAA 2PQ8A 1QSMA 3PP9A 2PR1A 3TOBA 4F0YA 1BO4A 4CS0B 4L89A 1I12A 3I9SA 1S5KA 2Q4YA 4R9MA 2IL4A 5KTAA 3GY9A 1QSOA 3T90A 3TO6A 2OH1A 1R57A 2VZZA 5H84A 1S7KA 4PK3A 2R8VA 3G8WA 3UY5A 4AVAA 4JWPA 3EXNA 4XNHB 2GE3A 2OZGA 2R1IA 4YGOA 1CJWA 3G3SA 4ZBGA 1WWZA 4XPDB 4CAXA 5F46A 3FB3A 3TO9A 4JLYA 4UBRA 3LODA 2FT0A 1S3ZA 2B58A 5J8CA 4HNWB 2D4PA 1IICA 2VZYA 4XPKA 1B87A 1Q2CA 4XPLA 1KZFA 3V8IA 5IB0A 2B4DA 2K5TA 2OZUA 4K30A 3VWEA 2A4NA 1CM0A 5ISVA 3TT2A 1N71A 3JUWA 4KORA 4DNCA
chains in the Genus database with same CATH superfamily
2FXFA 4NJQA 3KI9A 4PXBA 4LQGA 4ZYQA 4A94A 3S6HA 4UEEA 4UWJA 2PJ7A 3KHZA 4OC3A 2Q4VA 1YLEA 2HQYA 4PV6A 5LYLA 1ZO0A 2WPXA 1IU8A 5J1QA 4L8AA 3B3CA 2Z3OA 1Z4RA 3WC5A 1PUAA 1ZG8A 3TX8A 4EFDA 3CT9A 4KSIA 2PJ3A 2ZXVA 1ELLP 4MFLA 4UFVA 3R9EA 3H4QA 4MHDA 4F8ZA 6CPAA 2QIRA 1ARMA 3SI2A 2VL1A 3PGPA 2ZEOA 4MXUA 2REFA 3P2FA 4X5KA 3S6GA 5G20A 3R9FA 4IHMA 4NF1A 4ZGYB 3ZZIA 4R3KA 5KTCA 1IOIA 2WSAA 4P4FA 4X2TA 5THWA 3NA6A 3KR4A 3EY5A 4PXCA 4B5PA 4CPAA 3S9LA 3LACA 1F2PA 4MFKA 2Z3NA 3DSBA 3KQXA 2GLJA 4FD7A 1S7LA 2PJ4A 2EUIA 3EO4A 3MRUA 3WC6A 4NCZA 4UWIA 2Q7SA 3B35A 4GM5A 4P6YA 5I0CA 2OR4A 4O23A 1Y9KA 2Q43A 1WK4A 3FEDA 3W6XA 1I21A 3IWGA 3CXQA 4U5YA 4CAVA 2PJ8A 4NSQA 1YVKA 2V8GA 2EWBA 2F7VA 4R87A 2XEGA 4E8OA 2G3AA 2WZNA 3BJ7A 1Y7RA 1XOVA 4KLWA 3IFEA 5DWMA 5K8MA 1CPXA 3W6SA 5J8FA 3FECA 4C68A 3HLPA 4RI1A 3RBUA 1QSNA 3P2HA 4OMEA 1KWMA 5DWNA 2ZEFA 1XFOA 3B2YA 1M4GA 3TC8A 4P45A 4CGPA 4MHNA 3FJUA 1Z8XA 1BLLE 4ZY2A 1TXRA 5C82A 1Z8TA 3IWEA 2R7HA 2PJ9A 3TCVA 5E96A 3IWWA 4QC6A 1M4IA 2BOAA 4Y49C 4FD6A 4X8IA 2VQYA 1DE4C 2PJ1A 2JDCA 4KOXA 1IYKA 3ISXA 4ZY0A 2I00A 3E0KA 4NGRA 1L0CA 3FXTA 4H2KA 4NFRA 3FNCA 4Q36A 5C88A 1Z2LA 4P44A 4CRZB 2QVPA 3GLJA 3PRTA 3BJ8A 3TE4A 2CTBA 2ZEPA 4H89A 4Q7AA 5CBMA 1YR0A 3IU2A 3CXPA 2P6EA 5CNPA 2PJBA 4JZ0A 3K9TA 3SJFA 4CAFA 2ARHA 5LYFA 1YX0A 3WT4A 3FRMA 5JQ4A 2PRBA 3IJ3A 3CDXA 2FSRA 1YK3A 2PDOA 4F6AA 4J3GA 3K9UA 3IIBA 4MCPA 1X10A 2ANPA 3CPAA 1Y0YA 3GKRA 4MCRA 4B11A 1ZLIA 5LYDA 3W91A 1KUXA 1LCPA 1LAPA 1S7FA 2ZPAA 1R3NA 3MGDA 3NFZA 3PZJA 5G21A 5G1ZA 4F9VA 1UFHA 1VIXA 3B3VA 3D2MA 1Z8LA 2AFZA 4HPSA 1I1DA 4UEZA 4B10A 4ZX9A 2PIZA 4KLVA 3DGVA 5F47A 4H6UA 3SXOA 3SJEA 1NSLA 1YGHA 3C26A 1FY7A 2PVVA 4LUAA 4P4DA 3RAMA 1U6MA 2G3TA 3IO1A 1P4NA 4NGNA 3S6FA 1XF8A 1MJ9A 2PE3A 4NGTA 3S9MA 4B6ZA 2IJZA 5H86A 4MJ8A 4C2ZA 4A33A 2DF5A 2JEVA 4MHPA 3QAHA 2AFOA 1DTDA 1V0CA 2PJ5A 5F48A 2QJ8A 3GYAA 2CNMA 1BPMA 4C7HA 1F57A 2FIWA 4UIBA 1M4LA 4AB7A 2O28A 5JM6A 1AUGA 1ZLHA 2Z3KA 4PPZA 4PQAA 3SHPA 3PEIA 3B8GA 3PB6X 1S7NA 2NYQA 2FL4A 3EFAA 3GUXA 4LQ6A 4PSXA 4XNHC 5HVFA 4HNXB 2ZEHA 5IV0A 3FVLA 2CTCA 3R95A 2OB0A 2JBKA 3D7FA 3I1UA 4A30A 2XEIA 4EMEA 2C6PA 4U9YA 3KR5A 4HNYB 4G1PA 1F2OA 2VI7A 4PSWA 2WPWA 4OKOA 4CYQA 3D7HA 1CX8A 4H6ZA 4Z65A 1TF9A 4WWVA 4ONWA 2BO9A 1XMTA 5AG4A 2BEIA 3FEEA 4GXHA 2HC9A 4QUSA 2PJ6A 4KUBA 3S6KA 2EK8A 1SQHA 4FUUA 4R57A 1J4JA 2PJ2A 3TTHA 3KZWA 3CZXA 4A37A 3IGRA 4JXRA 3S9NA 2Q7BA 3R1KA 3IC1A 4IF5A 2JDDA 5EBVA 1Q2YA 2B5GB 1RTQA 1OZPA 1CPSA 1VGYA 2P0WA 3GB0A 4NJRA 2OOTA 4CRYB 2ZW6A 2ZW7A 4KSFA 5EMIA 2DEAA 1IGBA 3D2PA 3DR6A 4AVCA 4KVOE 4B13A 4YFJA 3TFYA 3TO7A 4QVTA 4ZY1A 5AG7A 1R43A 4YU9A 3SJXA 5JH9A 2C27A 2REEA 2PR8A 2PIYA 4NGMA 4A39A 3F5BA 4KVME 2Z3LA 1ARLA 4ONUA 2B3VA 4PXEA 4HKFA 1RO5A 2ZOFA 4MI4A 2DPTA 2O4HA 1M44A 2Y0MA 4DYOA 1VHOA 1Z9UA 4P4BA 4OLLA 1QQ9A 5A27A 2GFQA 5I4MA 2Q44A 1XIXA 4II9A 3B3SA 2GIVA 4R6TA 2JEWA 4A38A 4QB9A 4F0XA 4UF4A 2F8HA 4OP4A 4Q38A 4BMHA 1YVOA 3F0AA 2JLMA 4UA3A 4MHZA 2ZW4A 1LANA 1BPNA 1CP7A 4NGPA 4MCSA 2PJCA 2Z0ZA 3LD2A 4KOWA 4TWEA 2C6CA 2XEFA 3K2KA 4AXVA 1IB1E 2GU2A 3PB7X 2HB6A 4KOUA 4OC0A 4F9UA 2ZEMA 4OADA 3BLNA 3QAYA 2PJAA 4W9YA 4IAVA 4KZTA 5ELYA 2VBQA 3FF3A 3LMSA 1M4DA 3JTKA 2F5IA 2ZELA 4PXDA 1PCAA 2EO8A 2P6FA 4GS4A 3SI1A 1LRZA 1YREA 2AFMA 3FYNA 4E2AA 4MHYA 1MJBA 2G0BA 4A95A 4DJLA 5K8PA 1YQEA 3NH5A 2AJ6A 2EBJA 1XEBA 2I79A 2CIJA 5FVJA 4BD9A 3VWDA 1TIQA 5KTDA 4JXQA 3RZAA 2OU2A 2PJ0A 1LOKA 2YNDA 1UWYA 4X3RA 4K3NA 3EC4A 4A31A 3GIUA 3JRUA 3JVNA 3RYOA 1JWQA 2AFWA 4P4JA 2FE7A 2NSMA 1NE9A 2YNCA 1Z4EA 3FX6A 4UFWA 3D7GA 3DDDA 3IU1A 4TNUA 2I3CA 4OC2A 2VXKA 1XRYA 4CGOA 1YLOA 4EWTA 3BI1A 2AFSA 2PRQA 4PK2A 2OZHA 4UFXA 1LFWA 1GHEA 1MK4A 2B3UA 4MMOA 4KOYA 1ZG7A 2WYRA 5HH1A 3NE7A 3KHXA 4C2XA 4QBJA 1Y0RA 2IMOA 2AE6A 5G22A 2Z10A 4B12A 3PB8X 4CAWA 5AG6A 2ZENA 3LWUA 1YMEA 1YSJA 4C2YA 4OC1A 4RUHA 1VKCA 3MN8A 1IY7A 3R96A 2CNTA 1K4JA 5JGFA 1Y9WA 2B4BA 5A28A 2EVNA 1BOBA 4MBUA 5F09A 1OBRA 4RS2A 5F49A 1VHEA 1B6BA 1XMBA 2R98A 2V8HA 2CF4A 2BCOA 4OC5A 2Q04A 3B3TA 2YNCC 4AG9A 8CPAA 2QYVA 3FBUA 3IEHA 3N5FA 1ON0A 4KUAA 4JYWA 4XPDC 4MCQA 1Q2DA 3WR7A 1IYLA 5BWAB 2VEZA 3KL9A 2PC1A 3FMCA 1XE4A 2FIAA 2KCWA 4KS9A 4UIAA 2V8VA 2PVWA 4OAEA 3D68A 3NH8A 4CYPA 2HUZA 2P6GA 1IIDA 4P10A 1HEEA 2B4DB 2FS5A 3KQZA 1PU9A 4MY3A 5IB9A 4AVBA 3H8EA 1AMPA 3NH4A 4KOSA 1CP6A 2ATRA 2J9AA 3SJGA 4CYNA 3PFEA 2D4OA 5AGEA 2ABZA 3QNVA 2B5GA 3I3GA 4MFQA 4R3LA 1NMTA 1QSTA 3PBBA 4YRHA 4CGLA 4M6HA 3OWCA 2Z3MA 4UCNA 5HMNA 2EK9A 3BHXA 4P4IA 4ZX8A 3RNZA 4FAIA 1Y7EA 3CXSA 3H5ZA 1GYTA 2CY2A 2XEJA 2O53A 1S60A 1FNOA 2C6GA 4MFPA 4UCPA 2HV2A 4EVYA 5GCNA 3D3SA 2Z11A 3D4UA 4KSAA 4JD6A 3QB8A 4B14A 3KGQA 2ZEEA 7CPAA 5AG5A 2AFUA 4LX9A 2GANA 4ORFA 4AG7A 1HDQA 4M6IA 5HXDA 3DR8A 3H8FA 2PSWA 3VATA 4P4EA 1TKFA 4FD5A 2X7BA 3T9YA 4I49A 5JPHA 4U9ZA 1MJAA 1YW6A 4R8FA 3D8PA 1Z8WA 1P0HA 1CG2A 3A9LA 3N7ZA 4Y49B 4B5PB 2ZW5A 2Q0YA 2RB7A 5LRKA 2YGWA 3F8KA 5HVGA 5LYIA 1KUVA 3DNSA 5K8NA 4NXYA 5D29A 1VHSA 2DXQA 4NEXA 4MY0A 2QECA 3H8GA 3B7IA 3BI0A 1ZG9A 1X12A 3KKWA 3L2NA 4BBHA 3SI0A 2NMTA 3PB4X 3ZJ0A 4KOTA 1Q7LA 4IUSA 4OC4A 3RO0A 3ISZA 4KVXA 1PYTB 4IK2A 4CGNA 4ZI6A 1NSAA 4MFJA 4CGMA 1RXTA 1HDUA 3SXNA 4DUKA 2BUEA 4MFZA 5D8NA 2ZOGA 2RC4A 3WABA 4JJXA 3VH9A 2H5MA 1QMUA 2BL1A 1KUYA 2FCKA 2J8NA 1BAVA 2QMLA 2ZEDA 3FIXA 3R9GA 1IOFA 4A2ZA 5DS0A 2C1CA 3D67A 4KOVA 4OIDA 5EC4A 4B5OA 4CYOA 3WC7A 1M1DA 4FD4A 4E0AA 2CNSA 2GREA 2IQ6A 2BSWA 4M85A 5IX3A 1QSRA 3NE8A 4M3SA 2J8MA 2J8RA 4BINA 3TOAA 4NGSA 2PQ8A 1QSMA 2ODFA 3PP9A 2PR1A 4YWYA 2RFHA 3TOBA 4F0YA 1BO4A 3T8WA 4R76A 2PCUA 4CS0B 1XBUA 4M6GA 4L89A 1I12A 1EE3P 3DLJA 3I9SA 1S5KA 2AFXA 2Q4ZA 1TKJA 2Q4YA 4R9MA 2IL4A 2V8DA 5HVHA 5LRJA 5KTAA 2Q51A 3GY9A 1QSOA 3T90A 4R7MA 1YW4A 2OH1A 3TO6A 1R57A 2VZZA 2WUUA 1S7KA 4PK3A 2R8VA 1TKHA 3G8WA 3D7DA 5H84A 3UY5A 4AVAA 1Z5RA 4JWPA 3EXNA 4XNHB 2GE3A 3HUVA 4CAEA 2OZGA 5CPAA 4MRIA 2R1IA 4YGOA 1CJWA 4FBEA 1FT7A 3V7ZA 3G3SA 3PBEA 4ZBGA 1TF8A 1AYEA 1WWZA 2YNEA 3B3WA 1LAMA 4XPDB 2GLFA 4CAXA 2Z3PA 5F46A 3FB3A 3TO9A 4JLYA 4UBRA 1A2ZA 4C7IA 3LODA 2FT0A 1S3ZA 1XJOA 2B58A 3D66A 4NGQA 3KASA 3FH4A 5J8CA 1CBXA 4HNWB 2D4PA 1IICA 2POKA 2JBJA 3V38A 2ZEGA 3CPXA 2VZYA 2G9DA 4XPKA 5K8OA 4FWUA 2V77A 1ELMP 4OIWA 1B87A 1Q2CA 3PB9X 4XPLA 2FVGA 1KZFA 4UCMA 4UEFA 3V8IA 4A32A 5LRGA 3PFOA 2DPSA 5IB0A 1JQGA 2B4DA 2K5TA 2OZUA 4WJBA 4K30A 3VARA 3VWEA 2A4NA 1CM0A 2CXAA 1H8LA 3BXMA 1N71A 3TT2A 3JUWA 5ISVA 4RN7A 4KORA 4DNCA
chains in the Genus database with same CATH topology
2FXFA 3S6HA 4UWJA 2Q4VA 1YLEA 2HQYA 4PV6A 1ZO0A 2WPXA 4L8AA 2Z3OA 1Z4RA 1PUAA 2ZXVA 4MFLA 4UFVA 3R9EA 3H4QA 4MHDA 2QIRA 3PGPA 2REFA 3P2FA 4X5KA 3S6GA 5G20A 3R9FA 4NF1A 4ZGYB 3ZZIA 4R3KA 5KTCA 2WSAA 3EY5A 4B5PA 4MFKA 2Z3NA 3DSBA 4FD7A 1S7LA 2EUIA 3EO4A 4NCZA 4UWIA 5I0CA 1Y9KA 1WK4A 3W6XA 1I21A 3IWGA 3CXQA 4U5YA 4CAVA 4NSQA 1YVKA 4R87A 4E8OA 2G3AA 4KLWA 3BJ7A 1Y7RA 5DWMA 3W6SA 5J8FA 4C68A 4RI1A 1QSNA 3P2HA 5DWNA 1M4GA 4CGPA 5C82A 3IWEA 2R7HA 3TCVA 5E96A 4QC6A 1M4IA 4Y49C 4FD6A 2VQYA 2JDCA 4KOXA 1IYKA 2I00A 3E0KA 1L0CA 3FXTA 3FNCA 4Q36A 5C88A 4CRZB 3BJ8A 3TE4A 4H89A 1YR0A 3IU2A 3CXPA 2P6EA 5CNPA 4CAFA 2ARHA 1YX0A 3FRMA 5JQ4A 2PRBA 2FSRA 1YK3A 2PDOA 4F6AA 4J3GA 3K9UA 3GKRA 4B11A 3W91A 1KUXA 1S7FA 2ZPAA 3MGDA 3PZJA 5G21A 5G1ZA 1UFHA 3D2MA 4B10A 1I1DA 4KLVA 5F47A 4H6UA 3SXOA 1NSLA 1YGHA 3C26A 1FY7A 4LUAA 1U6MA 2G3TA 3S6FA 1P4NA 1XF8A 1MJ9A 5H86A 4MJ8A 4C2ZA 4A33A 2JEVA 3QAHA 1V0CA 5F48A 3GYAA 2CNMA 4C7HA 2FIWA 4AB7A 2O28A 2Z3KA 3SHPA 3B8GA 1S7NA 4XNHC 2FL4A 3EFAA 4PSXA 4HNXB 5IV0A 3R95A 2OB0A 4A30A 4U9YA 4HNYB 2VI7A 4PSWA 2WPWA 4CYQA 4H6ZA 1XMTA 5AG4A 2BEIA 4QUSA 4KUBA 3S6KA 1SQHA 4R57A 3TTHA 1J4JA 3IGRA 4JXRA 2Q7BA 3R1KA 4IF5A 2JDDA 5EBVA 1Q2YA 2B5GB 1OZPA 4CRYB 2P0WA 2ZW6A 2ZW7A 4KSFA 4AVCA 3D2PA 3DR6A 4YFJA 3TFYA 4KVOE 4B13A 3TO7A 4QVTA 5AG7A 2C27A 2REEA 2PR8A 3F5BA 4KVME 2Z3LA 4ONUA 2B3VA 4II9A 4HKFA 1RO5A 4MI4A 2DPTA 2Y0MA 1M44A 1Z9UA 4OLLA 5A27A 2Q44A 1XIXA 2GIVA 4QB9A 4F0XA 4BMHA 4Q38A 1YVOA 3F0AA 2JLMA 4UA3A 2ZW4A 2Z0ZA 3LD2A 4KOWA 1IB1E 4KOUA 4OADA 3BLNA 4KZTA 2VBQA 1M4DA 3JTKA 2F5IA 2P6FA 4GS4A 1LRZA 1YREA 3FYNA 4E2AA 4A95A 1MJBA 2G0BA 2AJ6A 1XEBA 2I79A 5FVJA 3VWDA 1TIQA 5KTDA 4JXQA 2OU2A 2YNDA 3EC4A 4A31A 3JVNA 3RYOA 2FE7A 1NE9A 2YNCA 1Z4EA 4UFWA 3IU1A 3DDDA 2VXKA 4CGOA 4PK2A 2OZHA 4UFXA 1MK4A 1GHEA 2B3UA 4KOYA 5HH1A 3NE7A 4C2XA 4QBJA 2AE6A 5G22A 2Z10A 4B12A 4CAWA 5AG6A 4C2YA 1VKCA 3R96A 2CNTA 1K4JA 1Y9WA 2B4BA 5A28A 2EVNA 1BOBA 4MBUA 4RS2A 5F49A 2R98A 1B6BA 2Q04A 2YNCC 4AG9A 3FBUA 1ON0A 4KUAA 4XPDC 1Q2DA 3WR7A 1IYLA 5BWAB 2VEZA 2PC1A 1XE4A 2FIAA 2KCWA 4KS9A 4OAEA 4CYPA 2HUZA 2P6GA 1IIDA 2B4DB 2FS5A 1PU9A 4MY3A 4AVBA 4KOSA 2ATRA 4CYNA 5AGEA 2D4OA 2B5GA 3I3GA 4MFQA 4R3LA 1NMTA 1QSTA 4YRHA 4CGLA 3OWCA 2Z3MA 4UCNA 5HMNA 3CXSA 3H5ZA 2CY2A 1S60A 4MFPA 4UCPA 2HV2A 4EVYA 5GCNA 3D3SA 2Z11A 4KSAA 4JD6A 3QB8A 4B14A 5AG5A 4LX9A 2GANA 4ORFA 4AG7A 3DR8A 2PSWA 4FD5A 2X7BA 3T9YA 4I49A 5JPHA 4U9ZA 1MJAA 3D8PA 3N7ZA 1P0HA 3A9LA 4Y49B 4B5PB 2ZW5A 2Q0YA 2YGWA 3F8KA 1KUVA 3DNSA 4NXYA 1VHSA 2DXQA 4NEXA 4MY0A 2QECA 3KKWA 4BBHA 2NMTA 3ZJ0A 4KOTA 4IUSA 4KVXA 4CGNA 4MFJA 4CGMA 1RXTA 3SXNA 2BUEA 4MFZA 2RC4A 4JJXA 2H5MA 2BL1A 1KUYA 2FCKA 2J8NA 2QMLA 3FIXA 3R9GA 4A2ZA 4KOVA 4B5OA 5EC4A 4CYOA 1M1DA 4FD4A 4E0AA 2CNSA 2BSWA 4M85A 5IX3A 1QSRA 4M3SA 2J8MA 2J8RA 3TOAA 2PQ8A 1QSMA 3PP9A 2PR1A 3TOBA 4F0YA 1BO4A 4CS0B 4L89A 1I12A 3I9SA 1S5KA 2Q4YA 4R9MA 2IL4A 5KTAA 3GY9A 1QSOA 3T90A 3TO6A 2OH1A 1R57A 2VZZA 2WUUA 1S7KA 4PK3A 2R8VA 3G8WA 5H84A 3UY5A 4AVAA 4JWPA 3EXNA 4XNHB 2GE3A 4CAEA 2OZGA 2R1IA 4YGOA 1CJWA 3G3SA 4ZBGA 1WWZA 2YNEA 4XPDB 4CAXA 2Z3PA 5F46A 3FB3A 3TO9A 4JLYA 4UBRA 4C7IA 3LODA 2FT0A 1S3ZA 2B58A 5J8CA 4HNWB 2D4PA 1IICA 2VZYA 4XPKA 1B87A 1Q2CA 4XPLA 1KZFA 4UCMA 3V8IA 4A32A 5IB0A 2DPSA 2B4DA 2K5TA 2OZUA 4K30A 3VWEA 2A4NA 1CM0A 2CXAA 5ISVA 3TT2A 1N71A 3JUWA 4KORA 4DNCA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2FXF A;  3S6H A;  4UWJ A;  2Q4V A;  1YLE A;  2HQY A;  4PV6 A;  2WPX A;  4L8A A;  1Z4R A;  1PUA A;  2ZXV A;  3R9E A;  3H4Q A;  4MHD A;  2QIR A;  3PGP A;  2REF A;  3P2F A;  4X5K A;  3S6G A;  3R9F A;  4NF1 A;  3ZZI A;  4R3K A;  5KTC A;  3EY5 A;  4B5P A;  3DSB A;  4FD7 A;  1S7L A;  2EUI A;  3EO4 A;  4NCZ A;  4UWI A;  5I0C A;  1Y9K A;  1WK4 A;  3W6X A;  1I21 A;  3IWG A;  3CXQ A;  4U5Y A;  4CAV A;  4NSQ A;  1YVK A;  4R87 A;  4E8O A;  2G3A A;  4KLW A;  3BJ7 A;  1Y7R A;  5DWM A;  3W6S A;  5J8F A;  4RI1 A;  1QSN A;  3P2H A;  5DWN A;  1M4G A;  5C82 A;  2R7H A;  3TCV A;  5E96 A;  4QC6 A;  1M4I A;  4Y49 C;  4FD6 A;  2VQY A;  2JDC A;  4KOX A;  1IYK A;  2I00 A;  3E0K A;  1L0C A;  3FXT A;  3FNC A;  5C88 A;  4CRZ B;  3BJ8 A;  3TE4 A;  4H89 A;  1YR0 A;  3CXP A;  2P6E A;  5CNP A;  2ARH A;  1YX0 A;  3FRM A;  5JQ4 A;  2PRB A;  2FSR A;  1YK3 A;  2PDO A;  4F6A A;  4J3G A;  3K9U A;  3GKR A;  3W91 A;  1KUX A;  1S7F A;  2ZPA A;  3MGD A;  3PZJ A;  1UFH A;  3D2M A;  1I1D A;  4KLV A;  5F47 A;  4H6U A;  3SXO A;  1NSL A;  1YGH A;  3C26 A;  1FY7 A;  4LUA A;  1U6M A;  2G3T A;  3S6F A;  1P4N A;  1XF8 A;  1MJ9 A;  5H86 A;  4MJ8 A;  2JEV A;  3QAH A;  1V0C A;  5F48 A;  3GYA A;  2CNM A;  2FIW A;  4AB7 A;  2O28 A;  3SHP A;  3B8G A;  1S7N A;  4XNH C;  2FL4 A;  3EFA A;  4PSX A;  4HNX B;  5IV0 A;  3R95 A;  2OB0 A;  4U9Y A;  4HNY B;  2VI7 A;  4PSW A;  2WPW A;  4H6Z A;  1XMT A;  2BEI A;  4QUS A;  4KUB A;  3S6K A;  1SQH A;  4R57 A;  3TTH A;  1J4J A;  3IGR A;  4JXR A;  2Q7B A;  3R1K A;  4IF5 A;  2JDD A;  5EBV A;  1Q2Y A;  2B5G B;  1OZP A;  4CRY B;  2P0W A;  2ZW6 A;  2ZW7 A;  4AVC A;  3D2P A;  3DR6 A;  4YFJ A;  3TFY A;  4KVO E;  3TO7 A;  4QVT A;  2C27 A;  2REE A;  2PR8 A;  3F5B A;  4KVM E;  4ONU A;  2B3V A;  4II9 A;  4HKF A;  1RO5 A;  4MI4 A;  2Y0M A;  1M44 A;  1Z9U A;  4OLL A;  2Q44 A;  1XIX A;  2GIV A;  4QB9 A;  4BMH A;  1YVO A;  3F0A A;  2JLM A;  4UA3 A;  2ZW4 A;  2Z0Z A;  3LD2 A;  4KOW A;  1IB1 E;  4KOU A;  4OAD A;  3BLN A;  4KZT A;  2VBQ A;  1M4D A;  2F5I A;  2P6F A;  4GS4 A;  1LRZ A;  1YRE A;  3FYN A;  4E2A A;  1MJB A;  2G0B A;  2AJ6 A;  1XEB A;  2I79 A;  5FVJ A;  3VWD A;  1TIQ A;  5KTD A;  4JXQ A;  2OU2 A;  3EC4 A;  3JVN A;  3RYO A;  2FE7 A;  1NE9 A;  1Z4E A;  3DDD A;  2VXK A;  4PK2 A;  2OZH A;  1MK4 A;  1GHE A;  2B3U A;  4KOY A;  5HH1 A;  3NE7 A;  4QBJ A;  2AE6 A;  2Z10 A;  4CAW A;  1VKC A;  3R96 A;  2CNT A;  1K4J A;  1Y9W A;  2B4B A;  2EVN A;  1BOB A;  4MBU A;  4RS2 A;  5F49 A;  2R98 A;  1B6B A;  2Q04 A;  4AG9 A;  3FBU A;  4KUA A;  1ON0 A;  4XPD C;  1Q2D A;  3WR7 A;  1IYL A;  2VEZ A;  2PC1 A;  1XE4 A;  2FIA A;  2KCW A;  4OAE A;  2HUZ A;  2P6G A;  1IID A;  2B4D B;  2FS5 A;  1PU9 A;  4MY3 A;  4AVB A;  4KOS A;  2ATR A;  2D4O A;  2B5G A;  3I3G A;  4R3L A;  1NMT A;  1QST A;  4YRH A;  3OWC A;  5HMN A;  3CXS A;  2CY2 A;  1S60 A;  2HV2 A;  4EVY A;  5GCN A;  3D3S A;  2Z11 A;  4JD6 A;  3QB8 A;  4LX9 A;  2GAN A;  4ORF A;  4AG7 A;  3DR8 A;  2PSW A;  4FD5 A;  2X7B A;  3T9Y A;  4I49 A;  5JPH A;  4U9Z A;  1MJA A;  3D8P A;  3N7Z A;  1P0H A;  4Y49 B;  4B5P B;  2ZW5 A;  2Q0Y A;  3F8K A;  1KUV A;  3DNS A;  4NXY A;  1VHS A;  2DXQ A;  4NEX A;  4MY0 A;  2QEC A;  3KKW A;  2NMT A;  3ZJ0 A;  4KOT A;  4IUS A;  4KVX A;  1RXT A;  3SXN A;  2BUE A;  2RC4 A;  4JJX A;  2H5M A;  2BL1 A;  1KUY A;  2FCK A;  2J8N A;  2QML A;  3FIX A;  3R9G A;  4KOV A;  4B5O A;  5EC4 A;  1M1D A;  4FD4 A;  4E0A A;  2CNS A;  2BSW A;  4M85 A;  5IX3 A;  1QSR A;  4M3S A;  2J8M A;  2J8R A;  3TOA A;  2PQ8 A;  1QSM A;  3PP9 A;  2PR1 A;  3TOB A;  4F0Y A;  1BO4 A;  4CS0 B;  4L89 A;  1I12 A;  3I9S A;  1S5K A;  2Q4Y A;  4R9M A;  2IL4 A;  5KTA A;  3GY9 A;  1QSO A;  3T90 A;  3TO6 A;  2OH1 A;  1R57 A;  2VZZ A;  5H84 A;  1S7K A;  4PK3 A;  2R8V A;  3G8W A;  3UY5 A;  4AVA A;  4JWP A;  3EXN A;  4XNH B;  2GE3 A;  2OZG A;  2R1I A;  4YGO A;  1CJW A;  3G3S A;  4ZBG A;  1WWZ A;  4XPD B;  4CAX A;  5F46 A;  3FB3 A;  3TO9 A;  4JLY A;  4UBR A;  3LOD A;  2FT0 A;  1S3Z A;  2B58 A;  5J8C A;  4HNW B;  2D4P A;  1IIC A;  2VZY A;  4XPK A;  1B87 A;  1Q2C A;  4XPL A;  1KZF A;  3V8I A;  5IB0 A;  2B4D A;  2K5T A;  2OZU A;  4K30 A;  3VWE A;  2A4N A;  1CM0 A;  5ISV A;  3TT2 A;  1N71 A;  3JUW A;  4KOR A;  4DNC A; 
#chains in the Genus database with same CATH topology
 2FXF A;  4NJQ A;  3KI9 A;  4PXB A;  4LQG A;  4ZYQ A;  4A94 A;  3S6H A;  4UEE A;  4UWJ A;  2PJ7 A;  3KHZ A;  4OC3 A;  2Q4V A;  1YLE A;  2HQY A;  4PV6 A;  5LYL A;  1ZO0 A;  2WPX A;  1IU8 A;  5J1Q A;  4L8A A;  3B3C A;  2Z3O A;  1Z4R A;  3WC5 A;  1PUA A;  1ZG8 A;  3TX8 A;  4EFD A;  3CT9 A;  4KSI A;  2PJ3 A;  2ZXV A;  1ELL P;  4MFL A;  4UFV A;  3R9E A;  3H4Q A;  4MHD A;  4F8Z A;  6CPA A;  2QIR A;  1ARM A;  3SI2 A;  2VL1 A;  3PGP A;  2ZEO A;  4MXU A;  2REF A;  3P2F A;  4X5K A;  3S6G A;  5G20 A;  3R9F A;  4IHM A;  4NF1 A;  4ZGY B;  3ZZI A;  4R3K A;  5KTC A;  1IOI A;  2WSA A;  4P4F A;  4X2T A;  5THW A;  3NA6 A;  3KR4 A;  3EY5 A;  4PXC A;  4B5P A;  4CPA A;  3S9L A;  3LAC A;  1F2P A;  4MFK A;  2Z3N A;  3DSB A;  3KQX A;  2GLJ A;  4FD7 A;  1S7L A;  2PJ4 A;  2EUI A;  3EO4 A;  3MRU A;  3WC6 A;  4NCZ A;  4UWI A;  2Q7S A;  3B35 A;  4GM5 A;  4P6Y A;  5I0C A;  2OR4 A;  4O23 A;  1Y9K A;  2Q43 A;  1WK4 A;  3FED A;  3W6X A;  1I21 A;  3IWG A;  3CXQ A;  4U5Y A;  4CAV A;  2PJ8 A;  4NSQ A;  1YVK A;  2V8G A;  2EWB A;  2F7V A;  4R87 A;  2XEG A;  4E8O A;  2G3A A;  2WZN A;  3BJ7 A;  1Y7R A;  1XOV A;  4KLW A;  3IFE A;  5DWM A;  5K8M A;  1CPX A;  3W6S A;  5J8F A;  3FEC A;  4C68 A;  3HLP A;  4RI1 A;  3RBU A;  1QSN A;  3P2H A;  4OME A;  1KWM A;  5DWN A;  2ZEF A;  1XFO A;  3B2Y A;  1M4G A;  3TC8 A;  4P45 A;  4CGP A;  4MHN A;  3FJU A;  1Z8X A;  1BLL E;  4ZY2 A;  1TXR A;  5C82 A;  1Z8T A;  3IWE A;  2R7H A;  2PJ9 A;  3TCV A;  5E96 A;  3IWW A;  4QC6 A;  1M4I A;  2BOA A;  4Y49 C;  4FD6 A;  4X8I A;  2VQY A;  1DE4 C;  2PJ1 A;  2JDC A;  4KOX A;  1IYK A;  3ISX A;  4ZY0 A;  2I00 A;  3E0K A;  4NGR A;  1L0C A;  3FXT A;  4H2K A;  4NFR A;  3FNC A;  4Q36 A;  5C88 A;  1Z2L A;  4P44 A;  4CRZ B;  2QVP A;  3GLJ A;  3PRT A;  3BJ8 A;  3TE4 A;  2CTB A;  2ZEP A;  4H89 A;  4Q7A A;  5CBM A;  1YR0 A;  3IU2 A;  3CXP A;  2P6E A;  5CNP A;  2PJB A;  4JZ0 A;  3K9T A;  3SJF A;  4CAF A;  2ARH A;  5LYF A;  1YX0 A;  3WT4 A;  3FRM A;  5JQ4 A;  2PRB A;  3IJ3 A;  3CDX A;  2FSR A;  1YK3 A;  2PDO A;  4F6A A;  4J3G A;  3K9U A;  3IIB A;  4MCP A;  1X10 A;  2ANP A;  3CPA A;  1Y0Y A;  3GKR A;  4MCR A;  4B11 A;  1ZLI A;  5LYD A;  3W91 A;  1KUX A;  1LCP A;  1LAP A;  1S7F A;  2ZPA A;  1R3N A;  3MGD A;  3NFZ A;  3PZJ A;  5G21 A;  5G1Z A;  4F9V A;  1UFH A;  1VIX A;  3B3V A;  3D2M A;  1Z8L A;  2AFZ A;  4HPS A;  1I1D A;  4UEZ A;  4B10 A;  4ZX9 A;  2PIZ A;  4KLV A;  3DGV A;  5F47 A;  4H6U A;  3SXO A;  3SJE A;  1NSL A;  1YGH A;  3C26 A;  1FY7 A;  2PVV A;  4LUA A;  4P4D A;  3RAM A;  1U6M A;  2G3T A;  3IO1 A;  1P4N A;  4NGN A;  3S6F A;  1XF8 A;  1MJ9 A;  2PE3 A;  4NGT A;  3S9M A;  4B6Z A;  2IJZ A;  5H86 A;  4MJ8 A;  4C2Z A;  4A33 A;  2DF5 A;  2JEV A;  4MHP A;  3QAH A;  2AFO A;  1DTD A;  1V0C A;  2PJ5 A;  5F48 A;  2QJ8 A;  3GYA A;  2CNM A;  1BPM A;  4C7H A;  1F57 A;  2FIW A;  4UIB A;  1M4L A;  4AB7 A;  2O28 A;  5JM6 A;  1AUG A;  1ZLH A;  2Z3K A;  4PPZ A;  4PQA A;  3SHP A;  3PEI A;  3B8G A;  3PB6 X;  1S7N A;  2NYQ A;  2FL4 A;  3EFA A;  3GUX A;  4LQ6 A;  4PSX A;  4XNH C;  5HVF A;  4HNX B;  2ZEH A;  5IV0 A;  3FVL A;  2CTC A;  3R95 A;  2OB0 A;  2JBK A;  3D7F A;  3I1U A;  4A30 A;  2XEI A;  4EME A;  2C6P A;  4U9Y A;  3KR5 A;  4HNY B;  4G1P A;  1F2O A;  2VI7 A;  4PSW A;  2WPW A;  4OKO A;  4CYQ A;  3D7H A;  1CX8 A;  4H6Z A;  4Z65 A;  1TF9 A;  4WWV A;  4ONW A;  2BO9 A;  1XMT A;  5AG4 A;  2BEI A;  3FEE A;  4GXH A;  2HC9 A;  4QUS A;  2PJ6 A;  4KUB A;  3S6K A;  2EK8 A;  1SQH A;  4FUU A;  4R57 A;  1J4J A;  2PJ2 A;  3TTH A;  3KZW A;  3CZX A;  4A37 A;  3IGR A;  4JXR A;  3S9N A;  2Q7B A;  3R1K A;  3IC1 A;  4IF5 A;  2JDD A;  5EBV A;  1Q2Y A;  2B5G B;  1RTQ A;  1OZP A;  1CPS A;  1VGY A;  2P0W A;  3GB0 A;  4NJR A;  2OOT A;  4CRY B;  2ZW6 A;  2ZW7 A;  4KSF A;  5EMI A;  2DEA A;  1IGB A;  3D2P A;  3DR6 A;  4AVC A;  4KVO E;  4B13 A;  4YFJ A;  3TFY A;  3TO7 A;  4QVT A;  4ZY1 A;  5AG7 A;  1R43 A;  4YU9 A;  3SJX A;  5JH9 A;  2C27 A;  2REE A;  2PR8 A;  2PIY A;  4NGM A;  4A39 A;  3F5B A;  4KVM E;  2Z3L A;  1ARL A;  4ONU A;  2B3V A;  4PXE A;  4HKF A;  1RO5 A;  2ZOF A;  4MI4 A;  2DPT A;  2O4H A;  1M44 A;  2Y0M A;  4DYO A;  1VHO A;  1Z9U A;  4P4B A;  4OLL A;  1QQ9 A;  5A27 A;  2GFQ A;  5I4M A;  2Q44 A;  1XIX A;  4II9 A;  3B3S A;  2GIV A;  4R6T A;  2JEW A;  4A38 A;  4QB9 A;  4F0X A;  4UF4 A;  2F8H A;  4OP4 A;  4Q38 A;  4BMH A;  1YVO A;  3F0A A;  2JLM A;  4UA3 A;  4MHZ A;  2ZW4 A;  1LAN A;  1BPN A;  1CP7 A;  4NGP A;  4MCS A;  2PJC A;  2Z0Z A;  3LD2 A;  4KOW A;  4TWE A;  2C6C A;  2XEF A;  3K2K A;  4AXV A;  1IB1 E;  2GU2 A;  3PB7 X;  2HB6 A;  4KOU A;  4OC0 A;  4F9U A;  2ZEM A;  4OAD A;  3BLN A;  3QAY A;  2PJA A;  4W9Y A;  4IAV A;  4KZT A;  5ELY A;  2VBQ A;  3FF3 A;  3LMS A;  1M4D A;  3JTK A;  2F5I A;  2ZEL A;  4PXD A;  1PCA A;  2EO8 A;  2P6F A;  4GS4 A;  3SI1 A;  1LRZ A;  1YRE A;  2AFM A;  3FYN A;  4E2A A;  4MHY A;  1MJB A;  2G0B A;  4A95 A;  4DJL A;  5K8P A;  1YQE A;  3NH5 A;  2AJ6 A;  2EBJ A;  1XEB A;  2I79 A;  2CIJ A;  5FVJ A;  4BD9 A;  3VWD A;  1TIQ A;  5KTD A;  4JXQ A;  3RZA A;  2OU2 A;  2PJ0 A;  1LOK A;  2YND A;  1UWY A;  4X3R A;  4K3N A;  3EC4 A;  4A31 A;  3GIU A;  3JRU A;  3JVN A;  3RYO A;  1JWQ A;  2AFW A;  4P4J A;  2FE7 A;  2NSM A;  1NE9 A;  2YNC A;  1Z4E A;  3FX6 A;  4UFW A;  3D7G A;  3DDD A;  3IU1 A;  4TNU A;  2I3C A;  4OC2 A;  2VXK A;  1XRY A;  4CGO A;  1YLO A;  4EWT A;  3BI1 A;  2AFS A;  2PRQ A;  4PK2 A;  2OZH A;  4UFX A;  1LFW A;  1GHE A;  1MK4 A;  2B3U A;  4MMO A;  4KOY A;  1ZG7 A;  2WYR A;  5HH1 A;  3NE7 A;  3KHX A;  4C2X A;  4QBJ A;  1Y0R A;  2IMO A;  2AE6 A;  5G22 A;  2Z10 A;  4B12 A;  3PB8 X;  4CAW A;  5AG6 A;  2ZEN A;  3LWU A;  1YME A;  1YSJ A;  4C2Y A;  4OC1 A;  4RUH A;  1VKC A;  3MN8 A;  1IY7 A;  3R96 A;  2CNT A;  1K4J A;  5JGF A;  1Y9W A;  2B4B A;  5A28 A;  2EVN A;  1BOB A;  4MBU A;  5F09 A;  1OBR A;  4RS2 A;  5F49 A;  1VHE A;  1B6B A;  1XMB A;  2R98 A;  2V8H A;  2CF4 A;  2BCO A;  4OC5 A;  2Q04 A;  3B3T A;  2YNC C;  4AG9 A;  8CPA A;  2QYV A;  3FBU A;  3IEH A;  3N5F A;  1ON0 A;  4KUA A;  4JYW A;  4XPD C;  4MCQ A;  1Q2D A;  3WR7 A;  1IYL A;  5BWA B;  2VEZ A;  3KL9 A;  2PC1 A;  3FMC A;  1XE4 A;  2FIA A;  2KCW A;  4KS9 A;  4UIA A;  2V8V A;  2PVW A;  4OAE A;  3D68 A;  3NH8 A;  4CYP A;  2HUZ A;  2P6G A;  1IID A;  4P10 A;  1HEE A;  2B4D B;  2FS5 A;  3KQZ A;  1PU9 A;  4MY3 A;  5IB9 A;  4AVB A;  3H8E A;  1AMP A;  3NH4 A;  4KOS A;  1CP6 A;  2ATR A;  2J9A A;  3SJG A;  4CYN A;  3PFE A;  2D4O A;  5AGE A;  2ABZ A;  3QNV A;  2B5G A;  3I3G A;  4MFQ A;  4R3L A;  1NMT A;  1QST A;  3PBB A;  4YRH A;  4CGL A;  4M6H A;  3OWC A;  2Z3M A;  4UCN A;  5HMN A;  2EK9 A;  3BHX A;  4P4I A;  4ZX8 A;  3RNZ A;  4FAI A;  1Y7E A;  3CXS A;  3H5Z A;  1GYT A;  2CY2 A;  2XEJ A;  2O53 A;  1S60 A;  1FNO A;  2C6G A;  4MFP A;  4UCP A;  2HV2 A;  4EVY A;  5GCN A;  3D3S A;  2Z11 A;  3D4U A;  4KSA A;  4JD6 A;  3QB8 A;  4B14 A;  3KGQ A;  2ZEE A;  7CPA A;  5AG5 A;  2AFU A;  4LX9 A;  2GAN A;  4ORF A;  4AG7 A;  1HDQ A;  4M6I A;  5HXD A;  3DR8 A;  3H8F A;  2PSW A;  3VAT A;  4P4E A;  1TKF A;  4FD5 A;  2X7B A;  3T9Y A;  4I49 A;  5JPH A;  4U9Z A;  1MJA A;  1YW6 A;  4R8F A;  3D8P A;  1Z8W A;  1P0H A;  1CG2 A;  3A9L A;  3N7Z A;  4Y49 B;  4B5P B;  2ZW5 A;  2Q0Y A;  2RB7 A;  5LRK A;  2YGW A;  3F8K A;  5HVG A;  5LYI A;  1KUV A;  3DNS A;  5K8N A;  4NXY A;  5D29 A;  1VHS A;  2DXQ A;  4NEX A;  4MY0 A;  2QEC A;  3H8G A;  3B7I A;  3BI0 A;  1ZG9 A;  1X12 A;  3KKW A;  3L2N A;  4BBH A;  3SI0 A;  2NMT A;  3PB4 X;  3ZJ0 A;  4KOT A;  1Q7L A;  4IUS A;  4OC4 A;  3RO0 A;  3ISZ A;  4KVX A;  1PYT B;  4IK2 A;  4CGN A;  4ZI6 A;  1NSA A;  4MFJ A;  4CGM A;  1RXT A;  1HDU A;  3SXN A;  4DUK A;  2BUE A;  4MFZ A;  5D8N A;  2ZOG A;  2RC4 A;  3WAB A;  4JJX A;  3VH9 A;  2H5M A;  1QMU A;  2BL1 A;  1KUY A;  2FCK A;  2J8N A;  1BAV A;  2QML A;  2ZED A;  3FIX A;  3R9G A;  1IOF A;  4A2Z A;  5DS0 A;  2C1C A;  3D67 A;  4KOV A;  4OID A;  5EC4 A;  4B5O A;  4CYO A;  3WC7 A;  1M1D A;  4FD4 A;  4E0A A;  2CNS A;  2GRE A;  2IQ6 A;  2BSW A;  4M85 A;  5IX3 A;  1QSR A;  3NE8 A;  4M3S A;  2J8M A;  2J8R A;  4BIN A;  3TOA A;  4NGS A;  2PQ8 A;  1QSM A;  2ODF A;  3PP9 A;  2PR1 A;  4YWY A;  2RFH A;  3TOB A;  4F0Y A;  1BO4 A;  3T8W A;  4R76 A;  2PCU A;  4CS0 B;  1XBU A;  4M6G A;  4L89 A;  1I12 A;  1EE3 P;  3DLJ A;  3I9S A;  1S5K A;  2AFX A;  2Q4Z A;  1TKJ A;  2Q4Y A;  4R9M A;  2IL4 A;  2V8D A;  5HVH A;  5LRJ A;  5KTA A;  2Q51 A;  3GY9 A;  1QSO A;  3T90 A;  4R7M A;  1YW4 A;  2OH1 A;  3TO6 A;  1R57 A;  2VZZ A;  2WUU A;  1S7K A;  4PK3 A;  2R8V A;  1TKH A;  3G8W A;  3D7D A;  5H84 A;  3UY5 A;  4AVA A;  1Z5R A;  4JWP A;  3EXN A;  4XNH B;  2GE3 A;  3HUV A;  4CAE A;  2OZG A;  5CPA A;  4MRI A;  2R1I A;  4YGO A;  1CJW A;  4FBE A;  1FT7 A;  3V7Z A;  3G3S A;  3PBE A;  4ZBG A;  1TF8 A;  1AYE A;  1WWZ A;  2YNE A;  3B3W A;  1LAM A;  4XPD B;  2GLF A;  4CAX A;  2Z3P A;  5F46 A;  3FB3 A;  3TO9 A;  4JLY A;  4UBR A;  1A2Z A;  4C7I A;  3LOD A;  2FT0 A;  1S3Z A;  1XJO A;  2B58 A;  3D66 A;  4NGQ A;  3KAS A;  3FH4 A;  5J8C A;  1CBX A;  4HNW B;  2D4P A;  1IIC A;  2POK A;  2JBJ A;  3V38 A;  2ZEG A;  3CPX A;  2VZY A;  2G9D A;  4XPK A;  5K8O A;  4FWU A;  2V77 A;  1ELM P;  4OIW A;  1B87 A;  1Q2C A;  3PB9 X;  4XPL A;  2FVG A;  1KZF A;  4UCM A;  4UEF A;  3V8I A;  4A32 A;  5LRG A;  3PFO A;  2DPS A;  5IB0 A;  1JQG A;  2B4D A;  2K5T A;  2OZU A;  4WJB A;  4K30 A;  3VAR A;  3VWE A;  2A4N A;  1CM0 A;  2CXA A;  1H8L A;  3BXM A;  1N71 A;  3TT2 A;  3JUW A;  5ISV A;  4RN7 A;  4KOR A;  4DNC A; 
#chains in the Genus database with same CATH homology
 2FXF A;  3S6H A;  4UWJ A;  2Q4V A;  1YLE A;  2HQY A;  4PV6 A;  1ZO0 A;  2WPX A;  4L8A A;  2Z3O A;  1Z4R A;  1PUA A;  2ZXV A;  4MFL A;  4UFV A;  3R9E A;  3H4Q A;  4MHD A;  2QIR A;  3PGP A;  2REF A;  3P2F A;  4X5K A;  3S6G A;  5G20 A;  3R9F A;  4NF1 A;  4ZGY B;  3ZZI A;  4R3K A;  5KTC A;  2WSA A;  3EY5 A;  4B5P A;  4MFK A;  2Z3N A;  3DSB A;  4FD7 A;  1S7L A;  2EUI A;  3EO4 A;  4NCZ A;  4UWI A;  5I0C A;  1Y9K A;  1WK4 A;  3W6X A;  1I21 A;  3IWG A;  3CXQ A;  4U5Y A;  4CAV A;  4NSQ A;  1YVK A;  4R87 A;  4E8O A;  2G3A A;  4KLW A;  3BJ7 A;  1Y7R A;  5DWM A;  3W6S A;  5J8F A;  4C68 A;  4RI1 A;  1QSN A;  3P2H A;  5DWN A;  1M4G A;  4CGP A;  5C82 A;  3IWE A;  2R7H A;  3TCV A;  5E96 A;  4QC6 A;  1M4I A;  4Y49 C;  4FD6 A;  2VQY A;  2JDC A;  4KOX A;  1IYK A;  2I00 A;  3E0K A;  1L0C A;  3FXT A;  3FNC A;  4Q36 A;  5C88 A;  4CRZ B;  3BJ8 A;  3TE4 A;  4H89 A;  1YR0 A;  3IU2 A;  3CXP A;  2P6E A;  5CNP A;  4CAF A;  2ARH A;  1YX0 A;  3FRM A;  5JQ4 A;  2PRB A;  2FSR A;  1YK3 A;  2PDO A;  4F6A A;  4J3G A;  3K9U A;  3GKR A;  4B11 A;  3W91 A;  1KUX A;  1S7F A;  2ZPA A;  3MGD A;  3PZJ A;  5G21 A;  5G1Z A;  1UFH A;  3D2M A;  4B10 A;  1I1D A;  4KLV A;  5F47 A;  4H6U A;  3SXO A;  1NSL A;  1YGH A;  3C26 A;  1FY7 A;  4LUA A;  1U6M A;  2G3T A;  3S6F A;  1P4N A;  1XF8 A;  1MJ9 A;  5H86 A;  4MJ8 A;  4C2Z A;  4A33 A;  2JEV A;  3QAH A;  1V0C A;  5F48 A;  3GYA A;  2CNM A;  4C7H A;  2FIW A;  4AB7 A;  2O28 A;  2Z3K A;  3SHP A;  3B8G A;  1S7N A;  4XNH C;  2FL4 A;  3EFA A;  4PSX A;  4HNX B;  5IV0 A;  3R95 A;  2OB0 A;  4A30 A;  4U9Y A;  4HNY B;  2VI7 A;  4PSW A;  2WPW A;  4CYQ A;  4H6Z A;  1XMT A;  5AG4 A;  2BEI A;  4QUS A;  4KUB A;  3S6K A;  1SQH A;  4R57 A;  3TTH A;  1J4J A;  3IGR A;  4JXR A;  2Q7B A;  3R1K A;  4IF5 A;  2JDD A;  5EBV A;  1Q2Y A;  2B5G B;  1OZP A;  4CRY B;  2P0W A;  2ZW6 A;  2ZW7 A;  4KSF A;  4AVC A;  3D2P A;  3DR6 A;  4YFJ A;  3TFY A;  4KVO E;  4B13 A;  3TO7 A;  4QVT A;  5AG7 A;  2C27 A;  2REE A;  2PR8 A;  3F5B A;  4KVM E;  2Z3L A;  4ONU A;  2B3V A;  4II9 A;  4HKF A;  1RO5 A;  4MI4 A;  2DPT A;  2Y0M A;  1M44 A;  1Z9U A;  4OLL A;  5A27 A;  2Q44 A;  1XIX A;  2GIV A;  4QB9 A;  4F0X A;  4BMH A;  4Q38 A;  1YVO A;  3F0A A;  2JLM A;  4UA3 A;  2ZW4 A;  2Z0Z A;  3LD2 A;  4KOW A;  1IB1 E;  4KOU A;  4OAD A;  3BLN A;  4KZT A;  2VBQ A;  1M4D A;  3JTK A;  2F5I A;  2P6F A;  4GS4 A;  1LRZ A;  1YRE A;  3FYN A;  4E2A A;  4A95 A;  1MJB A;  2G0B A;  2AJ6 A;  1XEB A;  2I79 A;  5FVJ A;  3VWD A;  1TIQ A;  5KTD A;  4JXQ A;  2OU2 A;  2YND A;  3EC4 A;  4A31 A;  3JVN A;  3RYO A;  2FE7 A;  1NE9 A;  2YNC A;  1Z4E A;  4UFW A;  3IU1 A;  3DDD A;  2VXK A;  4CGO A;  4PK2 A;  2OZH A;  4UFX A;  1MK4 A;  1GHE A;  2B3U A;  4KOY A;  5HH1 A;  3NE7 A;  4C2X A;  4QBJ A;  2AE6 A;  5G22 A;  2Z10 A;  4B12 A;  4CAW A;  5AG6 A;  4C2Y A;  1VKC A;  3R96 A;  2CNT A;  1K4J A;  1Y9W A;  2B4B A;  5A28 A;  2EVN A;  1BOB A;  4MBU A;  4RS2 A;  5F49 A;  2R98 A;  1B6B A;  2Q04 A;  2YNC C;  4AG9 A;  3FBU A;  1ON0 A;  4KUA A;  4XPD C;  1Q2D A;  3WR7 A;  1IYL A;  5BWA B;  2VEZ A;  2PC1 A;  1XE4 A;  2FIA A;  2KCW A;  4KS9 A;  4OAE A;  4CYP A;  2HUZ A;  2P6G A;  1IID A;  2B4D B;  2FS5 A;  1PU9 A;  4MY3 A;  4AVB A;  4KOS A;  2ATR A;  4CYN A;  5AGE A;  2D4O A;  2B5G A;  3I3G A;  4MFQ A;  4R3L A;  1NMT A;  1QST A;  4YRH A;  4CGL A;  3OWC A;  2Z3M A;  4UCN A;  5HMN A;  3CXS A;  3H5Z A;  2CY2 A;  1S60 A;  4MFP A;  4UCP A;  2HV2 A;  4EVY A;  5GCN A;  3D3S A;  2Z11 A;  4KSA A;  4JD6 A;  3QB8 A;  4B14 A;  5AG5 A;  4LX9 A;  2GAN A;  4ORF A;  4AG7 A;  3DR8 A;  2PSW A;  4FD5 A;  2X7B A;  3T9Y A;  4I49 A;  5JPH A;  4U9Z A;  1MJA A;  3D8P A;  3N7Z A;  1P0H A;  3A9L A;  4Y49 B;  4B5P B;  2ZW5 A;  2Q0Y A;  2YGW A;  3F8K A;  1KUV A;  3DNS A;  4NXY A;  1VHS A;  2DXQ A;  4NEX A;  4MY0 A;  2QEC A;  3KKW A;  4BBH A;  2NMT A;  3ZJ0 A;  4KOT A;  4IUS A;  4KVX A;  4CGN A;  4MFJ A;  4CGM A;  1RXT A;  3SXN A;  2BUE A;  4MFZ A;  2RC4 A;  4JJX A;  2H5M A;  2BL1 A;  1KUY A;  2FCK A;  2J8N A;  2QML A;  3FIX A;  3R9G A;  4A2Z A;  4KOV A;  4B5O A;  5EC4 A;  4CYO A;  1M1D A;  4FD4 A;  4E0A A;  2CNS A;  2BSW A;  4M85 A;  5IX3 A;  1QSR A;  4M3S A;  2J8M A;  2J8R A;  3TOA A;  2PQ8 A;  1QSM A;  3PP9 A;  2PR1 A;  3TOB A;  4F0Y A;  1BO4 A;  4CS0 B;  4L89 A;  1I12 A;  3I9S A;  1S5K A;  2Q4Y A;  4R9M A;  2IL4 A;  5KTA A;  3GY9 A;  1QSO A;  3T90 A;  3TO6 A;  2OH1 A;  1R57 A;  2VZZ A;  2WUU A;  1S7K A;  4PK3 A;  2R8V A;  3G8W A;  5H84 A;  3UY5 A;  4AVA A;  4JWP A;  3EXN A;  4XNH B;  2GE3 A;  4CAE A;  2OZG A;  2R1I A;  4YGO A;  1CJW A;  3G3S A;  4ZBG A;  1WWZ A;  2YNE A;  4XPD B;  4CAX A;  2Z3P A;  5F46 A;  3FB3 A;  3TO9 A;  4JLY A;  4UBR A;  4C7I A;  3LOD A;  2FT0 A;  1S3Z A;  2B58 A;  5J8C A;  4HNW B;  2D4P A;  1IIC A;  2VZY A;  4XPK A;  1B87 A;  1Q2C A;  4XPL A;  1KZF A;  4UCM A;  3V8I A;  4A32 A;  5IB0 A;  2DPS A;  2B4D A;  2K5T A;  2OZU A;  4K30 A;  3VWE A;  2A4N A;  1CM0 A;  2CXA A;  5ISV A;  3TT2 A;  1N71 A;  3JUW A;  4KOR A;  4DNC A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...