4MHYA

Crystal structure of a glutaminyl cyclase from ixodes scapularis in complex with pbd150
Total Genus 109
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
109
sequence length
326
structure length
324
Chain Sequence
LKWPRDLRPLAHHDLLYMGQIEDRGDFNATLRNFLVPRVVGSQKHREVREFIVRSLKDLDWDVEEDCFDGQTPHGIKPFCNVIATLNPSACHRLVLACHYDSLLHKEGTFIGATDSAVPCAQLLYLARSLNGKLQNQKTRGDGLTLQLVFFDGEEAFERWSSHDSLYGSRHLAQKWHEDRTSAERLESCLERSEIANQIDRMEVMVLLDLLGAENPRFYSYFGETQPVYRRLVNIESRLNDAGLMELPRRRRRTNYFSNSSTVGFIEDDHIPFLKRSVPIVHIIPSPFPDVWHTLDDNEQNLHHPTISNLNKIFKAFVSEYLQL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords Glutaminyl cyclase, putative
publication title Structural and functional analyses of a glutaminyl cyclase from Ixodes scapularis reveal metal-independent catalysis and inhibitor binding.
pubmed doi rcsb
source organism Ixodes scapularis
total genus 109
structure length 324
sequence length 326
ec nomenclature ec 2.3.2.5: Glutaminyl-peptide cyclotransferase.
pdb deposition date 2013-08-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF04389 Peptidase_M28 Peptidase family M28
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.630.10 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Zn peptidases 4mhyA00
3TC8A 1Z8LA 2C6PA 2VL1A 2AFOA 4MRIA 3PEIA 2AFWA 3IJ3A 1CP7A 2IQ6A 4F8ZA 3SI1A 4F9UA 3PB7X 4TWEA 4X2TA 3LWUA 3FJUA 4EFDA 5JH9A 3HUVA 3NA6A 4P4FA 3FX6A 2PIZA 2ZEFA 3GLJA 2ZELA 4LQGA 3QNVA 3RZAA 3BI0A 2JEWA 5HVFA 3IIBA 2HB6A 1F57A 2C1CA 1R43A 5HXDA 4UEFA 2V8DA 1RTQA 3WABA 2POKA 4P4DA 4R7MA 5JM6A 3D7GA 4GM5A 4FBEA 3SJEA 1CP6A 2AFUA 4P4EA 1YSJA 3KQXA 1TF9A 1TKFA 3D4UA 4NGMA 3SJXA 3I1UA 4TNUA 5J1QA 2JBKA 1M4LA 5D8NA 4NGRA 3V38A 8CPAA 5LYDA 3HLPA 3PB9X 2PJ7A 1CG2A 2ZEOA 4OP4A 4OMEA 2CTCA 3KASA 5HVGA 4P4IA 4ZX9A 7CPAA 1ELLP 2NYQA 4CPAA 3SJGA 2PVVA 1R3NA 6CPAA 4UIAA 1ZG9A 3S9MA 3PRTA 2GU2A 3B7IA 4NGPA 5LYLA 1LCPA 3CT9A 1FNOA 5JGFA 2PIYA 3KL9A 4MCPA 2PCUA 2ZEGA 2QYVA 4ZI6A 2V8HA 3NH5A 4WJBA 1UWYA 2AFXA 5CBMA 3T8WA 3D68A 4IAVA 4MHPA 4UIBA 4OC3A 1VIXA 3KR5A 2OR4A 2XEIA 4YWYA 4B6ZA 4DYOA 1XFOA 4R8FA 4MHNA 4OKOA 4OC1A 3B3CA 4ZY0A 3S9LA 4A38A 2V8GA 5LRJA 5THWA 2RFHA 4P4JA 1TKHA 1YW4A 4MHYA 1CX8A 2PJCA 5IB9A 2ABZA 4IHMA 4PXEA 4ZY1A 1PYTB 1DTDA 4OC5A 1DE4C 1ZLIA 3ISZA 3TX8A 3ISXA 1HEEA 4FWUA 2WZNA 1Y7EA 4UEEA 1EE3P 1LAPA 1JQGA 3PBEA 4P45A 4NJRA 4PQAA 4UF4A 4F9VA 2ZEPA 2DEAA 1Y0RA 3B3TA 1VGYA 3IO1A 1BLLE 4PXBA 2GLFA 3WC5A 4PPZA 2ZOFA 3N5FA 3FH4A 2ZEEA 2GREA 3FEEA 4FAIA 1Y0YA 3BI1A 4P44A 2G9DA 1GYTA 2PJ9A 2PJ3A 1LANA 1ZG8A 3FMCA 3SI2A 2PJ1A 4RUHA 1TXRA 2BO9A 4G1PA 3NH8A 2J9AA 2PJ6A 1OBRA 2ZEDA 3VATA 3FECA 3NH4A 3BHXA 3FEDA 1LFWA 1BPMA 3H8GA 3H8FA 2CIJA 4ONWA 2AFZA 4MCRA 2CTBA 1Z2LA 2BOAA 4P4BA 2AFMA 3S9NA 4ZY2A 2AFSA 3WC7A 4OC0A 4OIWA 3RAMA 3WT4A 3K9TA 3MRUA 3PBBA 2EK9A 1ARMA 1F2PA 2V8VA 1YLOA 3K2KA 4Z65A 2OOTA 3IEHA 2QVPA 2F7VA 2QJ8A 4WWVA 2FVGA 2GLJA 3KHXA 4OC2A 4P6YA 5DS0A 3CPXA 4MHZA 4UEZA 1IGBA 2O4HA 1XRYA 5K8OA 2C6GA 3DLJA 3V7ZA 3CPAA 3KGQA 5ELYA 4X3RA 3D7HA 3D7DA 3H8EA 2PJ5A 4NGQA 5F09A 4K3NA 1QQ9A 2PJ8A 3IC1A 4MCSA 1ZG7A 1Q7LA 4DUKA 2WYRA 3RBUA 1KWMA 4AXVA 4A37A 2BCOA 3KQZA 5CPAA 1YW6A 4R76A 1HDUA 3B35A 3SJFA 5I4MA 2ZEHA 4EWTA 3JRUA 3VH9A 2PJ0A 4NJQA 4NGTA 3NFZA 2EWBA 5K8PA 4IK2A 2V77A 2CF4A 1AYEA 3PB8X 2Q43A 2XEJA 1H8LA 2IMOA 4W9YA 1LAMA 4ZYQA 5LRKA 4DJLA 3GUXA 2ZENA 4PXCA 4BD9A 3VARA 1FT7A 2EK8A 3KR4A 1CPXA 1TKJA 2ZOGA 2ZEMA 1TF8A 4JZ0A 3WC6A 2XEGA 4R6TA 1BPNA 4NFRA 1QMUA 2PJAA 4ZX8A 2HC9A 1ARLA 1ELMP 2PJBA 1XMBA 2PVWA 3FVLA 3LMSA 1BAVA 5LYIA 3IFEA 4O23A 1Z5RA 1AMPA 3PB6X 3B3VA 1PCAA 2F8HA 2I3CA 2IJZA 5K8MA 4KSIA 2Q4ZA 1VHEA 2RB7A 1F2OA 2ANPA 3PFEA 5HVHA 1XBUA 1VHOA 3D66A 3IWWA 3B3SA 2C6CA 4H2KA 3L2NA 2PE3A 2PJ4A 3SI0A 1YMEA 3MN8A 1XJOA 4YU9A 4PXDA 4JYWA 1NSAA 2XEFA 4OIDA 4NGSA 4A94A 4X8IA 4MXUA 2Q51A 3B2YA 2JBJA 1CBXA 5LRGA 4MCQA 2PRQA 4NGNA 3PB4X 3GB0A 3KHZA 1ZLHA 5LYFA 1LOKA 5D29A 1CPSA 5K8NA 4MMOA 4A39A 3D7FA 3CDXA 2NSMA 1IY7A 3D67A 4Q7AA 4OC4A 3DGVA 3PFOA 2PJ2A 4P10A 4FUUA 3B3WA 3KI9A 3BXMA 3FF3A 4EMEA 1HDQA 3KZWA 2O53A
chains in the Genus database with same CATH superfamily
3TC8A 1Z8LA 5EBVA 2C6PA 2VL1A 1IYKA 2AFOA 4B10A 4MRIA 3PEIA 1VHSA 4HNWB 5KTDA 2AFWA 2PDOA 3IJ3A 3CXQA 1CP7A 2IQ6A 4F8ZA 4M6IA 3RNZA 3SI1A 1XMTA 4LX9A 4F9UA 2Z3KA 4BINA 3PB7X 4TWEA 2D4OA 4X2TA 3NE7A 3LWUA 3FJUA 2P6FA 4EFDA 5JH9A 3D3SA 2R1IA 3HUVA 1ON0A 3NA6A 3CXSA 1QSTA 2BUEA 3FIXA 4P4FA 3R96A 3FX6A 2PIZA 4E2AA 4MFPA 4UWJA 1SQHA 1QSMA 2VQYA 3JVNA 2ZEFA 2Q04A 3FXTA 5AG7A 3GLJA 3TO9A 2ZELA 3N7ZA 4FD6A 4LQGA 3QNVA 3RZAA 3BI0A 2JEWA 4R3KA 5HVFA 3IIBA 5IV0A 2HB6A 1F57A 2C1CA 3LD2A 1R43A 1XE4A 5HXDA 3ZZIA 4UEFA 2EBJA 4MFKA 2V8DA 4IF5A 4MHDA 5J8FA 1RTQA 3NE8A 1OZPA 1S3ZA 4QBJA 5KTCA 4CYNA 3WABA 2FL4A 2POKA 1PUAA 4ORFA 2Q7BA 2FIAA 4NF1A 4P4DA 4R7MA 5JM6A 2ZW4A 3D7GA 4QB9A 5DWMA 4GM5A 4FBEA 2FCKA 4AB7A 5F46A 2OH1A 3SJEA 1CP6A 2AFUA 4P4EA 5I0CA 1YSJA 3KQXA 5CNPA 1A2ZA 4MFZA 1TF9A 3V8IA 1Z8WA 1TKFA 4CGMA 1Z8TA 3D4UA 4CGNA 2CXAA 4NGMA 4XPLA 1MK4A 2JDCA 4KVME 4XNHB 3SJXA 1XF8A 4B13A 5G20A 3I1UA 4TNUA 5J1QA 2B58A 2JBKA 1M4LA 5D8NA 4NGRA 2VEZA 1J4JA 4EVYA 3V38A 2Q7SA 4QUSA 4YRHA 5GCNA 8CPAA 5LYDA 5JQ4A 1YK3A 3GKRA 3HLPA 3PB9X 4R87A 2B5GA 3T9YA 4CRYB 2PJ7A 3FRMA 1CG2A 2YNCA 2ZEOA 4OP4A 4OMEA 3WC6A 5J8CA 2CTCA 3KASA 4I49A 3DSBA 4RI1A 4CGLA 4M6GA 5HVGA 4P4IA 4ZX9A 1M4DA 3H5ZA 7CPAA 1ELLP 3GIUA 2NYQA 4UBRA 4M85A 3TE4A 5HH1A 1S5KA 4CPAA 3DNSA 4PSXA 4E0AA 4HNXB 3SJGA 4NSQA 2PVVA 1R3NA 3R9EA 6CPAA 4UIAA 4C7HA 2Z0ZA 3IWEA 2QMLA 2CNSA 4LUAA 4FD7A 1ZG9A 4XPDB 1XIXA 4JLYA 4KORA 1YGHA 4Y49B 3S9MA 1S60A 3PRTA 2GU2A 2G3AA 3B7IA 1X12A 4H6ZA 3CXPA 2R98A 4NGPA 4CGOA 4A30A 5LYLA 4L8AA 2FE7A 3FBUA 4ONUA 1LCPA 3CT9A 3TO7A 1FNOA 3TO6A 5JGFA 4UFVA 2WUUA 3CZXA 4C2ZA 2PIYA 2PC1A 2PRBA 3KL9A 4MCPA 4DNCA 3P2HA 4JD6A 4CAFA 1I1DA 2PCUA 1P0HA 1TIQA 4KVOE 4II9A 2ZEGA 2Z3MA 4HNYB 4ZGYB 5IB0A 2QYVA 3F5BA 2YNEA 5H84A 4ZI6A 4JJXA 4AG7A 2QECA 1JWQA 2V8HA 1FY7A 2YNCC 3NH5A 1UWYA 4WJBA 2AFXA 5CBMA 1MJ9A 1XOVA 3T8WA 3D68A 4IAVA 4KLWA 5AG6A 3PZJA 4MHPA 2RC4A 4UIBA 4OC3A 3R95A 1VIXA 3KR5A 2OR4A 4A2ZA 2XEIA 2YNDA 4YWYA 4B6ZA 3VWEA 4AVAA 2B4BA 4DYOA 4M6HA 4C7IA 1XFOA 4R8FA 4MHNA 2FSRA 3G3SA 3DR6A 3EY5A 4UCPA 1M4IA 4OKOA 4OC1A 3B3CA 5BWAB 4MFQA 4ZY0A 4PK2A 3S9LA 1YLEA 3SXNA 4A38A 2FIWA 2V8GA 4A31A 2HUZA 2NMTA 5LRJA 4X5KA 5THWA 2RFHA 2P0WA 4P4JA 4J3GA 1M1DA 3FNCA 4UCNA 5KTAA 1TKHA 4FD5A 3I3GA 1YQEA 1YW4A 1Q2DA 1S7LA 4MHYA 1CX8A 2KCWA 2PSWA 1IIDA 2PJCA 5IB9A 2ABZA 2BSWA 4C2XA 2WPWA 4IHMA 1IB1E 1KUYA 4PXEA 4ZY1A 4LQ6A 1PYTB 3S6KA 2DF5A 1DTDA 2VZYA 4OC5A 1R57A 1DE4C 2O28A 1ZLIA 3ISZA 4MY3A 3TX8A 3ISXA 1HEEA 4CAWA 3T90A 2REFA 4FWUA 2PQ8A 4CS0B 2WZNA 4MY0A 1WK4A 1Y7EA 4UEEA 1EE3P 3I9SA 4JXQA 2JLMA 3BJ8A 1LAPA 2H5MA 1JQGA 3PBEA 5EMIA 2JDDA 4P45A 5F48A 4KZTA 4NJRA 4PQAA 4KS9A 5G21A 3VWDA 4UF4A 4F9VA 2ZEPA 2DEAA 1Y0RA 5IX3A 1VKCA 3B3TA 2PR8A 2Y0MA 1VGYA 2EUIA 4HPSA 5A27A 3S6FA 3IO1A 1BLLE 2Z10A 4A33A 4CGPA 1NSLA 4PXBA 1L0CA 2GLFA 3WC5A 2DXQA 2B3VA 2IL4A 4PPZA 1K4JA 2FS5A 2ZOFA 3N5FA 5G22A 3D8PA 1YX0A 4L89A 3KKWA 4KVXA 1QSOA 2ZEEA 2GREA 1B6BA 3FH4A 4KOWA 2OZHA 3FEEA 3IWGA 4FAIA 2AJ6A 5EC4A 1Y0YA 3BI1A 3JUWA 4P44A 1IOIA 2G9DA 4A95A 4MFJA 2CY2A 4PK3A 1GYTA 1QSRA 1Z8XA 2PJ9A 2PJ3A 1LANA 1ZG8A 3G8WA 4U9ZA 3FB3A 1S7NA 3FMCA 3SI2A 2PJ1A 3EC4A 4UCMA 4RUHA 1TXRA 2BO9A 3RYOA 5C82A 4G1PA 2QIRA 1BO4A 2ZW5A 3A9LA 3NH8A 2J9AA 2EO8A 4GXHA 2PJ6A 1OBRA 2ZEDA 3VATA 3FECA 3NH4A 3BHXA 2ZXVA 4CAVA 3FEDA 3R9GA 1LFWA 1BPMA 3H8GA 3PP9A 4NCZA 2G3TA 3H8FA 4KOYA 2CIJA 2GANA 3IU1A 4ONWA 5HMNA 3B8GA 4CYOA 3S6HA 2AFZA 3TOBA 4MCRA 2CTBA 1Z2LA 1N71A 2BOAA 4P4BA 2AFMA 3S9NA 4R57A 4KOUA 4AVBA 4K30A 1NMTA 4ZY2A 2AFSA 2P6EA 3WC7A 3EXNA 4OC0A 4H89A 4OIWA 3RAMA 3WT4A 1IYLA 3K9TA 5ISVA 1U6MA 3TT2A 1V0CA 3MRUA 3PBBA 2EK9A 2G0BA 3QAHA 2FT0A 2A4NA 1ARMA 1F2PA 2JEVA 2B5GB 2V8VA 5C88A 1YLOA 1LRZA 1S7FA 3EO4A 3K2KA 4Z65A 4E8OA 1B87A 4F0XA 2OOTA 4UWIA 1M4GA 2R7HA 3IEHA 2FXFA 1QSNA 3TCVA 2QVPA 2J8NA 2F7VA 2Q0YA 4AVCA 1MJBA 3R9FA 2VXKA 4Q38A 2QJ8A 3SXOA 2ATRA 5FVJA 4HKFA 2GIVA 2FVGA 4WWVA 2GLJA 3KHXA 4OC2A 5AG5A 4GS4A 3WR7A 5F49A 5AG4A 4P6YA 5DS0A 2ODFA 2GFQA 3CPXA 4MHZA 4UEZA 4F0YA 1IGBA 4RN7A 2O4HA 3SHPA 3BJ7A 3D2PA 1XRYA 5K8OA 4CAEA 2C6GA 2PR1A 4KUAA 3DLJA 3V7ZA 3PGPA 3CPAA 3KGQA 4MJ8A 3IGRA 5ELYA 4X3RA 4C2YA 3D7HA 3D7DA 4KSAA 1RO5A 1X10A 3H8EA 2PJ5A 4NGQA 2EVNA 1YVKA 2Q4YA 4A32A 1I21A 4ZBGA 5F09A 4K3NA 1Y7RA 1QQ9A 2PJ8A 2Z3PA 3IC1A 4MCSA 3UY5A 4BMHA 2B3UA 4MI4A 2ZW7A 1YREA 2I79A 1ZG7A 1Q7LA 3MGDA 1GHEA 2OB0A 5DWNA 1S7KA 4R3LA 4KOTA 4DUKA 2C27A 2WYRA 3W6SA 2DPSA 4M3SA 3RBUA 3IU2A 2CNMA 1RXTA 1KWMA 4AXVA 3EFAA 2R8VA 4A37A 2BCOA 3KQZA 5CPAA 1Y9WA 1YW6A 4R76A 3LODA 1HDUA 1Q2CA 1Z9UA 4CYQA 3B35A 2J8RA 3DR8A 3SJFA 2ZEHA 5I4MA 4EWTA 3JRUA 3VH9A 2PJ0A 2X7BA 4NJQA 4NGTA 2B4DA 3NFZA 2EWBA 5K8PA 3GY9A 3DDDA 1Y9KA 4IK2A 2HV2A 2V77A 2CF4A 4KUBA 4UA3A 1AYEA 2Q44A 3PB8X 2Q43A 2XEJA 1H8LA 2IMOA 4W9YA 1LAMA 4UFWA 4ZYQA 2REEA 4FD4A 3R1KA 1Z4RA 5LRKA 1XEBA 3JTKA 1IICA 1ZO0A 4DJLA 1Z4EA 3C26A 4B11A 1I12A 3GUXA 2ZENA 4PV6A 4PXCA 3VARA 4BD9A 1FT7A 5G1ZA 2EK8A 2F5IA 1YVOA 3KR4A 1CPXA 1TKJA 4C68A 2ZOGA 5A28A 2ZEMA 1TF8A 4JZ0A 1MJAA 1M44A 1NE9A 2XEGA 2Z3LA 1BPNA 4NFRA 4NXYA 1QMUA 2CNTA 2PJAA 4R6TA 3W6XA 4ZX8A 4AG9A 3E0KA 2Z11A 4MFLA 4UFXA 2HC9A 1ARLA 3GYAA 4JWPA 1ELMP 2PJBA 1XMBA 2ARHA 2OU2A 2PVWA 3FVLA 3LMSA 3TTHA 1BAVA 2WPXA 3IFEA 3QB8A 4O23A 1Z5RA 5LYIA 1AMPA 4CYPA 3PB6X 1CJWA 3B3VA 1PCAA 2F8HA 2I3CA 2IJZA 2OZGA 5K8MA 4KSIA 2B4DB 5H86A 3P2FA 2ZPAA 2Q4ZA 1VHEA 3K9UA 4XNHC 2RB7A 4MBUA 4YGOA 1F2OA 2ANPA 3PFEA 4BBHA 5HVHA 3F0AA 1XBUA 4JXRA 5AGEA 1VHOA 4PSWA 1CM0A 4CAXA 3TFYA 3D66A 3S6GA 3IWWA 4U5YA 3B3SA 2C6CA 2VBQA 4B5OA 1UFHA 3L2NA 2PE3A 1KZFA 2PJ4A 4H2KA 1YMEA 3MN8A 3SI0A 1XJOA 4YU9A 4PXDA 4JYWA 3F8KA 1NSAA 2XEFA 4OIDA 1PU9A 2AE6A 2K5TA 4NGSA 4A94A 4B5PA 4X8IA 4MXUA 2Q51A 3B2YA 4YFJA 2JBJA 3D2MA 4RS2A 4B14A 4XPKA 4QC6A 4F6AA 3OWCA 1CBXA 4XPDC 2VZZA 5LRGA 4KLVA 4MCQA 1WWZA 2Z3OA 2PRQA 4Y49C 3TOAA 2P6GA 4OADA 3PB4X 3GB0A 3KHZA 4NGNA 1ZLHA 2YGWA 1BOBA 2BL1A 3H4QA 3ZJ0A 1KUVA 1LOKA 4KOVA 5D29A 2ZW6A 1CPSA 2Z3NA 4H6UA 1AUGA 2Q4VA 4KOSA 5E96A 4OAEA 5K8NA 4QVTA 2OZUA 2D4PA 4KOXA 4MMOA 4NEXA 3LACA 4R9MA 2HQYA 4A39A 3D7FA 2GE3A 3CDXA 2NSMA 1P4NA 1IY7A 3D67A 3FYNA 4U9YA 4Q7AA 2J8MA 2I00A 4OC4A 3DGVA 3RO0A 4IUSA 5LYFA 3PFOA 1Q2YA 2BEIA 2PJ2A 4P10A 4B12A 4FUUA 3B3WA 1IOFA 3KI9A 3QAYA 3BLNA 1YR0A 5JPHA 3BXMA 3FF3A 2DPTA 1HDQA 1IU8A 4EMEA 3W91A 4Q36A 4B5PB 3KZWA 1KUXA 4KSFA 2VI7A 4OLLA 5F47A 2WSAA 2O53A 4CRZB
chains in the Genus database with same CATH topology
3TC8A 1Z8LA 2C6PA 2VL1A 2AFOA 4MRIA 3PEIA 2AFWA 3IJ3A 1CP7A 2IQ6A 4F8ZA 3SI1A 4F9UA 3PB7X 4TWEA 4X2TA 3LWUA 3FJUA 4EFDA 5JH9A 3HUVA 3NA6A 4P4FA 3FX6A 2PIZA 2ZEFA 3GLJA 2ZELA 4LQGA 3QNVA 3RZAA 3BI0A 2JEWA 5HVFA 3IIBA 2HB6A 1F57A 2C1CA 1R43A 5HXDA 4UEFA 2V8DA 1RTQA 3WABA 2POKA 4P4DA 4R7MA 5JM6A 3D7GA 4GM5A 4FBEA 3SJEA 1CP6A 2AFUA 4P4EA 1YSJA 3KQXA 1TF9A 1TKFA 3D4UA 4NGMA 3SJXA 3I1UA 4TNUA 5J1QA 2JBKA 1M4LA 5D8NA 4NGRA 3V38A 8CPAA 5LYDA 3HLPA 3PB9X 2PJ7A 1CG2A 2ZEOA 4OP4A 4OMEA 2CTCA 3KASA 5HVGA 4P4IA 4ZX9A 7CPAA 1ELLP 2NYQA 4CPAA 3SJGA 2PVVA 1R3NA 6CPAA 4UIAA 1ZG9A 3S9MA 3PRTA 2GU2A 3B7IA 4NGPA 5LYLA 1LCPA 3CT9A 1FNOA 5JGFA 2PIYA 3KL9A 4MCPA 2PCUA 2ZEGA 2QYVA 4ZI6A 2V8HA 3NH5A 4WJBA 1UWYA 2AFXA 5CBMA 3T8WA 3D68A 4IAVA 4MHPA 4UIBA 4OC3A 1VIXA 3KR5A 2OR4A 2XEIA 4YWYA 4B6ZA 4DYOA 1XFOA 4R8FA 4MHNA 4OKOA 4OC1A 3B3CA 4ZY0A 3S9LA 4A38A 2V8GA 5LRJA 5THWA 2RFHA 4P4JA 1TKHA 1YW4A 4MHYA 1CX8A 2PJCA 5IB9A 2ABZA 4IHMA 4PXEA 4ZY1A 1PYTB 1DTDA 4OC5A 1DE4C 1ZLIA 3ISZA 3TX8A 3ISXA 1HEEA 4FWUA 2WZNA 1Y7EA 4UEEA 1EE3P 1LAPA 1JQGA 3PBEA 4P45A 4NJRA 4PQAA 4UF4A 4F9VA 2ZEPA 2DEAA 1Y0RA 3B3TA 1VGYA 3IO1A 1BLLE 4PXBA 2GLFA 3WC5A 4PPZA 2ZOFA 3N5FA 3FH4A 2ZEEA 2GREA 3FEEA 4FAIA 1Y0YA 3BI1A 4P44A 2G9DA 1GYTA 2PJ9A 2PJ3A 1LANA 1ZG8A 3FMCA 3SI2A 2PJ1A 4RUHA 1TXRA 2BO9A 4G1PA 3NH8A 2J9AA 2PJ6A 1OBRA 2ZEDA 3VATA 3FECA 3NH4A 3BHXA 3FEDA 1LFWA 1BPMA 3H8GA 3H8FA 2CIJA 4ONWA 2AFZA 4MCRA 2CTBA 1Z2LA 2BOAA 4P4BA 2AFMA 3S9NA 4ZY2A 2AFSA 3WC7A 4OC0A 4OIWA 3RAMA 3WT4A 3K9TA 3MRUA 3PBBA 2EK9A 1ARMA 1F2PA 2V8VA 1YLOA 3K2KA 4Z65A 2OOTA 3IEHA 2QVPA 2F7VA 2QJ8A 4WWVA 2FVGA 2GLJA 3KHXA 4OC2A 4P6YA 5DS0A 3CPXA 4MHZA 4UEZA 1IGBA 2O4HA 1XRYA 5K8OA 2C6GA 3DLJA 3V7ZA 3CPAA 3KGQA 5ELYA 4X3RA 3D7HA 3D7DA 3H8EA 2PJ5A 4NGQA 5F09A 4K3NA 1QQ9A 2PJ8A 3IC1A 4MCSA 1ZG7A 1Q7LA 4DUKA 2WYRA 3RBUA 1KWMA 4AXVA 4A37A 2BCOA 3KQZA 5CPAA 1YW6A 4R76A 1HDUA 3B35A 3SJFA 5I4MA 2ZEHA 4EWTA 3JRUA 3VH9A 2PJ0A 4NJQA 4NGTA 3NFZA 2EWBA 5K8PA 4IK2A 2V77A 2CF4A 1AYEA 3PB8X 2Q43A 2XEJA 1H8LA 2IMOA 4W9YA 1LAMA 4ZYQA 5LRKA 4DJLA 3GUXA 2ZENA 4PXCA 4BD9A 3VARA 1FT7A 2EK8A 3KR4A 1CPXA 1TKJA 2ZOGA 2ZEMA 1TF8A 4JZ0A 3WC6A 2XEGA 4R6TA 1BPNA 4NFRA 1QMUA 2PJAA 4ZX8A 2HC9A 1ARLA 1ELMP 2PJBA 1XMBA 2PVWA 3FVLA 3LMSA 1BAVA 5LYIA 3IFEA 4O23A 1Z5RA 1AMPA 3PB6X 3B3VA 1PCAA 2F8HA 2I3CA 2IJZA 5K8MA 4KSIA 2Q4ZA 1VHEA 2RB7A 1F2OA 2ANPA 3PFEA 5HVHA 1XBUA 1VHOA 3D66A 3IWWA 3B3SA 2C6CA 4H2KA 3L2NA 2PE3A 2PJ4A 3SI0A 1YMEA 3MN8A 1XJOA 4YU9A 4PXDA 4JYWA 1NSAA 2XEFA 4OIDA 4NGSA 4A94A 4X8IA 4MXUA 2Q51A 3B2YA 2JBJA 1CBXA 5LRGA 4MCQA 2PRQA 4NGNA 3PB4X 3GB0A 3KHZA 1ZLHA 5LYFA 1LOKA 5D29A 1CPSA 5K8NA 4MMOA 4A39A 3D7FA 3CDXA 2NSMA 1IY7A 3D67A 4Q7AA 4OC4A 3DGVA 3PFOA 2PJ2A 4P10A 4FUUA 3B3WA 3KI9A 3BXMA 3FF3A 4EMEA 1HDQA 3KZWA 2O53A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3TC8 A;  1Z8L A;  2C6P A;  2VL1 A;  2AFO A;  4MRI A;  3PEI A;  2AFW A;  3IJ3 A;  1CP7 A;  2IQ6 A;  4F8Z A;  3SI1 A;  4F9U A;  3PB7 X;  4TWE A;  4X2T A;  3LWU A;  3FJU A;  4EFD A;  5JH9 A;  3HUV A;  3NA6 A;  4P4F A;  3FX6 A;  2PIZ A;  2ZEF A;  3GLJ A;  2ZEL A;  4LQG A;  3QNV A;  3RZA A;  3BI0 A;  2JEW A;  5HVF A;  3IIB A;  2HB6 A;  1F57 A;  2C1C A;  1R43 A;  5HXD A;  4UEF A;  2V8D A;  1RTQ A;  3WAB A;  2POK A;  4P4D A;  4R7M A;  5JM6 A;  3D7G A;  4GM5 A;  4FBE A;  3SJE A;  1CP6 A;  2AFU A;  4P4E A;  1YSJ A;  3KQX A;  1TF9 A;  1TKF A;  3D4U A;  4NGM A;  3SJX A;  3I1U A;  4TNU A;  5J1Q A;  2JBK A;  1M4L A;  5D8N A;  4NGR A;  3V38 A;  8CPA A;  5LYD A;  3HLP A;  3PB9 X;  2PJ7 A;  1CG2 A;  2ZEO A;  4OP4 A;  4OME A;  2CTC A;  3KAS A;  5HVG A;  4P4I A;  4ZX9 A;  7CPA A;  1ELL P;  2NYQ A;  4CPA A;  3SJG A;  2PVV A;  1R3N A;  6CPA A;  4UIA A;  1ZG9 A;  3S9M A;  3PRT A;  2GU2 A;  3B7I A;  4NGP A;  5LYL A;  1LCP A;  3CT9 A;  1FNO A;  5JGF A;  2PIY A;  3KL9 A;  4MCP A;  2PCU A;  2ZEG A;  2QYV A;  4ZI6 A;  2V8H A;  3NH5 A;  4WJB A;  1UWY A;  2AFX A;  5CBM A;  3T8W A;  3D68 A;  4IAV A;  4MHP A;  4UIB A;  4OC3 A;  1VIX A;  3KR5 A;  2OR4 A;  2XEI A;  4YWY A;  4B6Z A;  4DYO A;  1XFO A;  4R8F A;  4MHN A;  4OKO A;  4OC1 A;  3B3C A;  4ZY0 A;  3S9L A;  4A38 A;  2V8G A;  5LRJ A;  5THW A;  2RFH A;  4P4J A;  1TKH A;  1YW4 A;  4MHY A;  1CX8 A;  2PJC A;  5IB9 A;  2ABZ A;  4IHM A;  4PXE A;  4ZY1 A;  1PYT B;  1DTD A;  4OC5 A;  1DE4 C;  1ZLI A;  3ISZ A;  3TX8 A;  3ISX A;  1HEE A;  4FWU A;  2WZN A;  1Y7E A;  4UEE A;  1EE3 P;  1LAP A;  1JQG A;  3PBE A;  4P45 A;  4NJR A;  4PQA A;  4UF4 A;  4F9V A;  2ZEP A;  2DEA A;  1Y0R A;  3B3T A;  1VGY A;  3IO1 A;  1BLL E;  4PXB A;  2GLF A;  3WC5 A;  4PPZ A;  2ZOF A;  3N5F A;  3FH4 A;  2ZEE A;  2GRE A;  3FEE A;  4FAI A;  1Y0Y A;  3BI1 A;  4P44 A;  2G9D A;  1GYT A;  2PJ9 A;  2PJ3 A;  1LAN A;  1ZG8 A;  3FMC A;  3SI2 A;  2PJ1 A;  4RUH A;  1TXR A;  2BO9 A;  4G1P A;  3NH8 A;  2J9A A;  2PJ6 A;  1OBR A;  2ZED A;  3VAT A;  3FEC A;  3NH4 A;  3BHX A;  3FED A;  1LFW A;  1BPM A;  3H8G A;  3H8F A;  2CIJ A;  4ONW A;  2AFZ A;  4MCR A;  2CTB A;  1Z2L A;  2BOA A;  4P4B A;  2AFM A;  3S9N A;  4ZY2 A;  2AFS A;  3WC7 A;  4OC0 A;  4OIW A;  3RAM A;  3WT4 A;  3K9T A;  3MRU A;  3PBB A;  2EK9 A;  1ARM A;  1F2P A;  2V8V A;  1YLO A;  3K2K A;  4Z65 A;  2OOT A;  3IEH A;  2QVP A;  2F7V A;  2QJ8 A;  4WWV A;  2FVG A;  2GLJ A;  3KHX A;  4OC2 A;  4P6Y A;  5DS0 A;  3CPX A;  4MHZ A;  4UEZ A;  1IGB A;  2O4H A;  1XRY A;  5K8O A;  2C6G A;  3DLJ A;  3V7Z A;  3CPA A;  3KGQ A;  5ELY A;  4X3R A;  3D7H A;  3D7D A;  3H8E A;  2PJ5 A;  4NGQ A;  5F09 A;  4K3N A;  1QQ9 A;  2PJ8 A;  3IC1 A;  4MCS A;  1ZG7 A;  1Q7L A;  4DUK A;  2WYR A;  3RBU A;  1KWM A;  4AXV A;  4A37 A;  2BCO A;  3KQZ A;  5CPA A;  1YW6 A;  4R76 A;  1HDU A;  3B35 A;  3SJF A;  5I4M A;  2ZEH A;  4EWT A;  3JRU A;  3VH9 A;  2PJ0 A;  4NJQ A;  4NGT A;  3NFZ A;  2EWB A;  5K8P A;  4IK2 A;  2V77 A;  2CF4 A;  1AYE A;  3PB8 X;  2Q43 A;  2XEJ A;  1H8L A;  2IMO A;  4W9Y A;  1LAM A;  4ZYQ A;  5LRK A;  4DJL A;  3GUX A;  2ZEN A;  4PXC A;  4BD9 A;  3VAR A;  1FT7 A;  2EK8 A;  3KR4 A;  1CPX A;  1TKJ A;  2ZOG A;  2ZEM A;  1TF8 A;  4JZ0 A;  3WC6 A;  2XEG A;  4R6T A;  1BPN A;  4NFR A;  1QMU A;  2PJA A;  4ZX8 A;  2HC9 A;  1ARL A;  1ELM P;  2PJB A;  1XMB A;  2PVW A;  3FVL A;  3LMS A;  1BAV A;  5LYI A;  3IFE A;  4O23 A;  1Z5R A;  1AMP A;  3PB6 X;  3B3V A;  1PCA A;  2F8H A;  2I3C A;  2IJZ A;  5K8M A;  4KSI A;  2Q4Z A;  1VHE A;  2RB7 A;  1F2O A;  2ANP A;  3PFE A;  5HVH A;  1XBU A;  1VHO A;  3D66 A;  3IWW A;  3B3S A;  2C6C A;  4H2K A;  3L2N A;  2PE3 A;  2PJ4 A;  3SI0 A;  1YME A;  3MN8 A;  1XJO A;  4YU9 A;  4PXD A;  4JYW A;  1NSA A;  2XEF A;  4OID A;  4NGS A;  4A94 A;  4X8I A;  4MXU A;  2Q51 A;  3B2Y A;  2JBJ A;  1CBX A;  5LRG A;  4MCQ A;  2PRQ A;  4NGN A;  3PB4 X;  3GB0 A;  3KHZ A;  1ZLH A;  5LYF A;  1LOK A;  5D29 A;  1CPS A;  5K8N A;  4MMO A;  4A39 A;  3D7F A;  3CDX A;  2NSM A;  1IY7 A;  3D67 A;  4Q7A A;  4OC4 A;  3DGV A;  3PFO A;  2PJ2 A;  4P10 A;  4FUU A;  3B3W A;  3KI9 A;  3BXM A;  3FF3 A;  4EME A;  1HDQ A;  3KZW A;  2O53 A; 
#chains in the Genus database with same CATH topology
 3TC8 A;  1Z8L A;  5EBV A;  2C6P A;  2VL1 A;  1IYK A;  2AFO A;  4B10 A;  4MRI A;  3PEI A;  1VHS A;  4HNW B;  5KTD A;  2AFW A;  2PDO A;  3IJ3 A;  3CXQ A;  1CP7 A;  2IQ6 A;  4F8Z A;  4M6I A;  3RNZ A;  3SI1 A;  1XMT A;  4LX9 A;  4F9U A;  2Z3K A;  4BIN A;  3PB7 X;  4TWE A;  2D4O A;  4X2T A;  3NE7 A;  3LWU A;  3FJU A;  2P6F A;  4EFD A;  5JH9 A;  3D3S A;  2R1I A;  3HUV A;  1ON0 A;  3NA6 A;  3CXS A;  1QST A;  2BUE A;  3FIX A;  4P4F A;  3R96 A;  3FX6 A;  2PIZ A;  4E2A A;  4MFP A;  4UWJ A;  1SQH A;  1QSM A;  2VQY A;  3JVN A;  2ZEF A;  2Q04 A;  3FXT A;  5AG7 A;  3GLJ A;  3TO9 A;  2ZEL A;  3N7Z A;  4FD6 A;  4LQG A;  3QNV A;  3RZA A;  3BI0 A;  2JEW A;  4R3K A;  5HVF A;  3IIB A;  5IV0 A;  2HB6 A;  1F57 A;  2C1C A;  3LD2 A;  1R43 A;  1XE4 A;  5HXD A;  3ZZI A;  4UEF A;  2EBJ A;  4MFK A;  2V8D A;  4IF5 A;  4MHD A;  5J8F A;  1RTQ A;  3NE8 A;  1OZP A;  1S3Z A;  4QBJ A;  5KTC A;  4CYN A;  3WAB A;  2FL4 A;  2POK A;  1PUA A;  4ORF A;  2Q7B A;  2FIA A;  4NF1 A;  4P4D A;  4R7M A;  5JM6 A;  2ZW4 A;  3D7G A;  4QB9 A;  5DWM A;  4GM5 A;  4FBE A;  2FCK A;  4AB7 A;  5F46 A;  2OH1 A;  3SJE A;  1CP6 A;  2AFU A;  4P4E A;  5I0C A;  1YSJ A;  3KQX A;  5CNP A;  1A2Z A;  4MFZ A;  1TF9 A;  3V8I A;  1Z8W A;  1TKF A;  4CGM A;  1Z8T A;  3D4U A;  4CGN A;  2CXA A;  4NGM A;  4XPL A;  1MK4 A;  2JDC A;  4KVM E;  4XNH B;  3SJX A;  1XF8 A;  4B13 A;  5G20 A;  3I1U A;  4TNU A;  5J1Q A;  2B58 A;  2JBK A;  1M4L A;  5D8N A;  4NGR A;  2VEZ A;  1J4J A;  4EVY A;  3V38 A;  2Q7S A;  4QUS A;  4YRH A;  5GCN A;  8CPA A;  5LYD A;  5JQ4 A;  1YK3 A;  3GKR A;  3HLP A;  3PB9 X;  4R87 A;  2B5G A;  3T9Y A;  4CRY B;  2PJ7 A;  3FRM A;  1CG2 A;  2YNC A;  2ZEO A;  4OP4 A;  4OME A;  3WC6 A;  5J8C A;  2CTC A;  3KAS A;  4I49 A;  3DSB A;  4RI1 A;  4CGL A;  4M6G A;  5HVG A;  4P4I A;  4ZX9 A;  1M4D A;  3H5Z A;  7CPA A;  1ELL P;  3GIU A;  2NYQ A;  4UBR A;  4M85 A;  3TE4 A;  5HH1 A;  1S5K A;  4CPA A;  3DNS A;  4PSX A;  4E0A A;  4HNX B;  3SJG A;  4NSQ A;  2PVV A;  1R3N A;  3R9E A;  6CPA A;  4UIA A;  4C7H A;  2Z0Z A;  3IWE A;  2QML A;  2CNS A;  4LUA A;  4FD7 A;  1ZG9 A;  4XPD B;  1XIX A;  4JLY A;  4KOR A;  1YGH A;  4Y49 B;  3S9M A;  1S60 A;  3PRT A;  2GU2 A;  2G3A A;  3B7I A;  1X12 A;  4H6Z A;  3CXP A;  2R98 A;  4NGP A;  4CGO A;  4A30 A;  5LYL A;  4L8A A;  2FE7 A;  3FBU A;  4ONU A;  1LCP A;  3CT9 A;  3TO7 A;  1FNO A;  3TO6 A;  5JGF A;  4UFV A;  2WUU A;  3CZX A;  4C2Z A;  2PIY A;  2PC1 A;  2PRB A;  3KL9 A;  4MCP A;  4DNC A;  3P2H A;  4JD6 A;  4CAF A;  1I1D A;  2PCU A;  1P0H A;  1TIQ A;  4KVO E;  4II9 A;  2ZEG A;  2Z3M A;  4HNY B;  4ZGY B;  5IB0 A;  2QYV A;  3F5B A;  2YNE A;  5H84 A;  4ZI6 A;  4JJX A;  4AG7 A;  2QEC A;  1JWQ A;  2V8H A;  1FY7 A;  2YNC C;  3NH5 A;  1UWY A;  4WJB A;  2AFX A;  5CBM A;  1MJ9 A;  1XOV A;  3T8W A;  3D68 A;  4IAV A;  4KLW A;  5AG6 A;  3PZJ A;  4MHP A;  2RC4 A;  4UIB A;  4OC3 A;  3R95 A;  1VIX A;  3KR5 A;  2OR4 A;  4A2Z A;  2XEI A;  2YND A;  4YWY A;  4B6Z A;  3VWE A;  4AVA A;  2B4B A;  4DYO A;  4M6H A;  4C7I A;  1XFO A;  4R8F A;  4MHN A;  2FSR A;  3G3S A;  3DR6 A;  3EY5 A;  4UCP A;  1M4I A;  4OKO A;  4OC1 A;  3B3C A;  5BWA B;  4MFQ A;  4ZY0 A;  4PK2 A;  3S9L A;  1YLE A;  3SXN A;  4A38 A;  2FIW A;  2V8G A;  4A31 A;  2HUZ A;  2NMT A;  5LRJ A;  4X5K A;  5THW A;  2RFH A;  2P0W A;  4P4J A;  4J3G A;  1M1D A;  3FNC A;  4UCN A;  5KTA A;  1TKH A;  4FD5 A;  3I3G A;  1YQE A;  1YW4 A;  1Q2D A;  1S7L A;  4MHY A;  1CX8 A;  2KCW A;  2PSW A;  1IID A;  2PJC A;  5IB9 A;  2ABZ A;  2BSW A;  4C2X A;  2WPW A;  4IHM A;  1IB1 E;  1KUY A;  4PXE A;  4ZY1 A;  4LQ6 A;  1PYT B;  3S6K A;  2DF5 A;  1DTD A;  2VZY A;  4OC5 A;  1R57 A;  1DE4 C;  2O28 A;  1ZLI A;  3ISZ A;  4MY3 A;  3TX8 A;  3ISX A;  1HEE A;  4CAW A;  3T90 A;  2REF A;  4FWU A;  2PQ8 A;  4CS0 B;  2WZN A;  4MY0 A;  1WK4 A;  1Y7E A;  4UEE A;  1EE3 P;  3I9S A;  4JXQ A;  2JLM A;  3BJ8 A;  1LAP A;  2H5M A;  1JQG A;  3PBE A;  5EMI A;  2JDD A;  4P45 A;  5F48 A;  4KZT A;  4NJR A;  4PQA A;  4KS9 A;  5G21 A;  3VWD A;  4UF4 A;  4F9V A;  2ZEP A;  2DEA A;  1Y0R A;  5IX3 A;  1VKC A;  3B3T A;  2PR8 A;  2Y0M A;  1VGY A;  2EUI A;  4HPS A;  5A27 A;  3S6F A;  3IO1 A;  1BLL E;  2Z10 A;  4A33 A;  4CGP A;  1NSL A;  4PXB A;  1L0C A;  2GLF A;  3WC5 A;  2DXQ A;  2B3V A;  2IL4 A;  4PPZ A;  1K4J A;  2FS5 A;  2ZOF A;  3N5F A;  5G22 A;  3D8P A;  1YX0 A;  4L89 A;  3KKW A;  4KVX A;  1QSO A;  2ZEE A;  2GRE A;  1B6B A;  3FH4 A;  4KOW A;  2OZH A;  3FEE A;  3IWG A;  4FAI A;  2AJ6 A;  5EC4 A;  1Y0Y A;  3BI1 A;  3JUW A;  4P44 A;  1IOI A;  2G9D A;  4A95 A;  4MFJ A;  2CY2 A;  4PK3 A;  1GYT A;  1QSR A;  1Z8X A;  2PJ9 A;  2PJ3 A;  1LAN A;  1ZG8 A;  3G8W A;  4U9Z A;  3FB3 A;  1S7N A;  3FMC A;  3SI2 A;  2PJ1 A;  3EC4 A;  4UCM A;  4RUH A;  1TXR A;  2BO9 A;  3RYO A;  5C82 A;  4G1P A;  2QIR A;  1BO4 A;  2ZW5 A;  3A9L A;  3NH8 A;  2J9A A;  2EO8 A;  4GXH A;  2PJ6 A;  1OBR A;  2ZED A;  3VAT A;  3FEC A;  3NH4 A;  3BHX A;  2ZXV A;  4CAV A;  3FED A;  3R9G A;  1LFW A;  1BPM A;  3H8G A;  3PP9 A;  4NCZ A;  2G3T A;  3H8F A;  4KOY A;  2CIJ A;  2GAN A;  3IU1 A;  4ONW A;  5HMN A;  3B8G A;  4CYO A;  3S6H A;  2AFZ A;  3TOB A;  4MCR A;  2CTB A;  1Z2L A;  1N71 A;  2BOA A;  4P4B A;  2AFM A;  3S9N A;  4R57 A;  4KOU A;  4AVB A;  4K30 A;  1NMT A;  4ZY2 A;  2AFS A;  2P6E A;  3WC7 A;  3EXN A;  4OC0 A;  4H89 A;  4OIW A;  3RAM A;  3WT4 A;  1IYL A;  3K9T A;  5ISV A;  1U6M A;  3TT2 A;  1V0C A;  3MRU A;  3PBB A;  2EK9 A;  2G0B A;  3QAH A;  2FT0 A;  2A4N A;  1ARM A;  1F2P A;  2JEV A;  2B5G B;  2V8V A;  5C88 A;  1YLO A;  1LRZ A;  1S7F A;  3EO4 A;  3K2K A;  4Z65 A;  4E8O A;  1B87 A;  4F0X A;  2OOT A;  4UWI A;  1M4G A;  2R7H A;  3IEH A;  2FXF A;  1QSN A;  3TCV A;  2QVP A;  2J8N A;  2F7V A;  2Q0Y A;  4AVC A;  1MJB A;  3R9F A;  2VXK A;  4Q38 A;  2QJ8 A;  3SXO A;  2ATR A;  5FVJ A;  4HKF A;  2GIV A;  2FVG A;  4WWV A;  2GLJ A;  3KHX A;  4OC2 A;  5AG5 A;  4GS4 A;  3WR7 A;  5F49 A;  5AG4 A;  4P6Y A;  5DS0 A;  2ODF A;  2GFQ A;  3CPX A;  4MHZ A;  4UEZ A;  4F0Y A;  1IGB A;  4RN7 A;  2O4H A;  3SHP A;  3BJ7 A;  3D2P A;  1XRY A;  5K8O A;  4CAE A;  2C6G A;  2PR1 A;  4KUA A;  3DLJ A;  3V7Z A;  3PGP A;  3CPA A;  3KGQ A;  4MJ8 A;  3IGR A;  5ELY A;  4X3R A;  4C2Y A;  3D7H A;  3D7D A;  4KSA A;  1RO5 A;  1X10 A;  3H8E A;  2PJ5 A;  4NGQ A;  2EVN A;  1YVK A;  2Q4Y A;  4A32 A;  1I21 A;  4ZBG A;  5F09 A;  4K3N A;  1Y7R A;  1QQ9 A;  2PJ8 A;  2Z3P A;  3IC1 A;  4MCS A;  3UY5 A;  4BMH A;  2B3U A;  4MI4 A;  2ZW7 A;  1YRE A;  2I79 A;  1ZG7 A;  1Q7L A;  3MGD A;  1GHE A;  2OB0 A;  5DWN A;  1S7K A;  4R3L A;  4KOT A;  4DUK A;  2C27 A;  2WYR A;  3W6S A;  2DPS A;  4M3S A;  3RBU A;  3IU2 A;  2CNM A;  1RXT A;  1KWM A;  4AXV A;  3EFA A;  2R8V A;  4A37 A;  2BCO A;  3KQZ A;  5CPA A;  1Y9W A;  1YW6 A;  4R76 A;  3LOD A;  1HDU A;  1Q2C A;  1Z9U A;  4CYQ A;  3B35 A;  2J8R A;  3DR8 A;  3SJF A;  2ZEH A;  5I4M A;  4EWT A;  3JRU A;  3VH9 A;  2PJ0 A;  2X7B A;  4NJQ A;  4NGT A;  2B4D A;  3NFZ A;  2EWB A;  5K8P A;  3GY9 A;  3DDD A;  1Y9K A;  4IK2 A;  2HV2 A;  2V77 A;  2CF4 A;  4KUB A;  4UA3 A;  1AYE A;  2Q44 A;  3PB8 X;  2Q43 A;  2XEJ A;  1H8L A;  2IMO A;  4W9Y A;  1LAM A;  4UFW A;  4ZYQ A;  2REE A;  4FD4 A;  3R1K A;  1Z4R A;  5LRK A;  1XEB A;  3JTK A;  1IIC A;  1ZO0 A;  4DJL A;  1Z4E A;  3C26 A;  4B11 A;  1I12 A;  3GUX A;  2ZEN A;  4PV6 A;  4PXC A;  3VAR A;  4BD9 A;  1FT7 A;  5G1Z A;  2EK8 A;  2F5I A;  1YVO A;  3KR4 A;  1CPX A;  1TKJ A;  4C68 A;  2ZOG A;  5A28 A;  2ZEM A;  1TF8 A;  4JZ0 A;  1MJA A;  1M44 A;  1NE9 A;  2XEG A;  2Z3L A;  1BPN A;  4NFR A;  4NXY A;  1QMU A;  2CNT A;  2PJA A;  4R6T A;  3W6X A;  4ZX8 A;  4AG9 A;  3E0K A;  2Z11 A;  4MFL A;  4UFX A;  2HC9 A;  1ARL A;  3GYA A;  4JWP A;  1ELM P;  2PJB A;  1XMB A;  2ARH A;  2OU2 A;  2PVW A;  3FVL A;  3LMS A;  3TTH A;  1BAV A;  2WPX A;  3IFE A;  3QB8 A;  4O23 A;  1Z5R A;  5LYI A;  1AMP A;  4CYP A;  3PB6 X;  1CJW A;  3B3V A;  1PCA A;  2F8H A;  2I3C A;  2IJZ A;  2OZG A;  5K8M A;  4KSI A;  2B4D B;  5H86 A;  3P2F A;  2ZPA A;  2Q4Z A;  1VHE A;  3K9U A;  4XNH C;  2RB7 A;  4MBU A;  4YGO A;  1F2O A;  2ANP A;  3PFE A;  4BBH A;  5HVH A;  3F0A A;  1XBU A;  4JXR A;  5AGE A;  1VHO A;  4PSW A;  1CM0 A;  4CAX A;  3TFY A;  3D66 A;  3S6G A;  3IWW A;  4U5Y A;  3B3S A;  2C6C A;  2VBQ A;  4B5O A;  1UFH A;  3L2N A;  2PE3 A;  1KZF A;  2PJ4 A;  4H2K A;  1YME A;  3MN8 A;  3SI0 A;  1XJO A;  4YU9 A;  4PXD A;  4JYW A;  3F8K A;  1NSA A;  2XEF A;  4OID A;  1PU9 A;  2AE6 A;  2K5T A;  4NGS A;  4A94 A;  4B5P A;  4X8I A;  4MXU A;  2Q51 A;  3B2Y A;  4YFJ A;  2JBJ A;  3D2M A;  4RS2 A;  4B14 A;  4XPK A;  4QC6 A;  4F6A A;  3OWC A;  1CBX A;  4XPD C;  2VZZ A;  5LRG A;  4KLV A;  4MCQ A;  1WWZ A;  2Z3O A;  2PRQ A;  4Y49 C;  3TOA A;  2P6G A;  4OAD A;  3PB4 X;  3GB0 A;  3KHZ A;  4NGN A;  1ZLH A;  2YGW A;  1BOB A;  2BL1 A;  3H4Q A;  3ZJ0 A;  1KUV A;  1LOK A;  4KOV A;  5D29 A;  2ZW6 A;  1CPS A;  2Z3N A;  4H6U A;  1AUG A;  2Q4V A;  4KOS A;  5E96 A;  4OAE A;  5K8N A;  4QVT A;  2OZU A;  2D4P A;  4KOX A;  4MMO A;  4NEX A;  3LAC A;  4R9M A;  2HQY A;  4A39 A;  3D7F A;  2GE3 A;  3CDX A;  2NSM A;  1P4N A;  1IY7 A;  3D67 A;  3FYN A;  4U9Y A;  4Q7A A;  2J8M A;  2I00 A;  4OC4 A;  3DGV A;  3RO0 A;  4IUS A;  5LYF A;  3PFO A;  1Q2Y A;  2BEI A;  2PJ2 A;  4P10 A;  4B12 A;  4FUU A;  3B3W A;  1IOF A;  3KI9 A;  3QAY A;  3BLN A;  1YR0 A;  5JPH A;  3BXM A;  3FF3 A;  2DPT A;  1HDQ A;  1IU8 A;  4EME A;  3W91 A;  4Q36 A;  4B5P B;  3KZW A;  1KUX A;  4KSF A;  2VI7 A;  4OLL A;  5F47 A;  2WSA A;  2O53 A;  4CRZ B; 
#chains in the Genus database with same CATH homology
 3TC8 A;  1Z8L A;  2C6P A;  2VL1 A;  2AFO A;  4MRI A;  3PEI A;  2AFW A;  3IJ3 A;  1CP7 A;  2IQ6 A;  4F8Z A;  3SI1 A;  4F9U A;  3PB7 X;  4TWE A;  4X2T A;  3LWU A;  3FJU A;  4EFD A;  5JH9 A;  3HUV A;  3NA6 A;  4P4F A;  3FX6 A;  2PIZ A;  2ZEF A;  3GLJ A;  2ZEL A;  4LQG A;  3QNV A;  3RZA A;  3BI0 A;  2JEW A;  5HVF A;  3IIB A;  2HB6 A;  1F57 A;  2C1C A;  1R43 A;  5HXD A;  4UEF A;  2V8D A;  1RTQ A;  3WAB A;  2POK A;  4P4D A;  4R7M A;  5JM6 A;  3D7G A;  4GM5 A;  4FBE A;  3SJE A;  1CP6 A;  2AFU A;  4P4E A;  1YSJ A;  3KQX A;  1TF9 A;  1TKF A;  3D4U A;  4NGM A;  3SJX A;  3I1U A;  4TNU A;  5J1Q A;  2JBK A;  1M4L A;  5D8N A;  4NGR A;  3V38 A;  8CPA A;  5LYD A;  3HLP A;  3PB9 X;  2PJ7 A;  1CG2 A;  2ZEO A;  4OP4 A;  4OME A;  2CTC A;  3KAS A;  5HVG A;  4P4I A;  4ZX9 A;  7CPA A;  1ELL P;  2NYQ A;  4CPA A;  3SJG A;  2PVV A;  1R3N A;  6CPA A;  4UIA A;  1ZG9 A;  3S9M A;  3PRT A;  2GU2 A;  3B7I A;  4NGP A;  5LYL A;  1LCP A;  3CT9 A;  1FNO A;  5JGF A;  2PIY A;  3KL9 A;  4MCP A;  2PCU A;  2ZEG A;  2QYV A;  4ZI6 A;  2V8H A;  3NH5 A;  4WJB A;  1UWY A;  2AFX A;  5CBM A;  3T8W A;  3D68 A;  4IAV A;  4MHP A;  4UIB A;  4OC3 A;  1VIX A;  3KR5 A;  2OR4 A;  2XEI A;  4YWY A;  4B6Z A;  4DYO A;  1XFO A;  4R8F A;  4MHN A;  4OKO A;  4OC1 A;  3B3C A;  4ZY0 A;  3S9L A;  4A38 A;  2V8G A;  5LRJ A;  5THW A;  2RFH A;  4P4J A;  1TKH A;  1YW4 A;  4MHY A;  1CX8 A;  2PJC A;  5IB9 A;  2ABZ A;  4IHM A;  4PXE A;  4ZY1 A;  1PYT B;  1DTD A;  4OC5 A;  1DE4 C;  1ZLI A;  3ISZ A;  3TX8 A;  3ISX A;  1HEE A;  4FWU A;  2WZN A;  1Y7E A;  4UEE A;  1EE3 P;  1LAP A;  1JQG A;  3PBE A;  4P45 A;  4NJR A;  4PQA A;  4UF4 A;  4F9V A;  2ZEP A;  2DEA A;  1Y0R A;  3B3T A;  1VGY A;  3IO1 A;  1BLL E;  4PXB A;  2GLF A;  3WC5 A;  4PPZ A;  2ZOF A;  3N5F A;  3FH4 A;  2ZEE A;  2GRE A;  3FEE A;  4FAI A;  1Y0Y A;  3BI1 A;  4P44 A;  2G9D A;  1GYT A;  2PJ9 A;  2PJ3 A;  1LAN A;  1ZG8 A;  3FMC A;  3SI2 A;  2PJ1 A;  4RUH A;  1TXR A;  2BO9 A;  4G1P A;  3NH8 A;  2J9A A;  2PJ6 A;  1OBR A;  2ZED A;  3VAT A;  3FEC A;  3NH4 A;  3BHX A;  3FED A;  1LFW A;  1BPM A;  3H8G A;  3H8F A;  2CIJ A;  4ONW A;  2AFZ A;  4MCR A;  2CTB A;  1Z2L A;  2BOA A;  4P4B A;  2AFM A;  3S9N A;  4ZY2 A;  2AFS A;  3WC7 A;  4OC0 A;  4OIW A;  3RAM A;  3WT4 A;  3K9T A;  3MRU A;  3PBB A;  2EK9 A;  1ARM A;  1F2P A;  2V8V A;  1YLO A;  3K2K A;  4Z65 A;  2OOT A;  3IEH A;  2QVP A;  2F7V A;  2QJ8 A;  4WWV A;  2FVG A;  2GLJ A;  3KHX A;  4OC2 A;  4P6Y A;  5DS0 A;  3CPX A;  4MHZ A;  4UEZ A;  1IGB A;  2O4H A;  1XRY A;  5K8O A;  2C6G A;  3DLJ A;  3V7Z A;  3CPA A;  3KGQ A;  5ELY A;  4X3R A;  3D7H A;  3D7D A;  3H8E A;  2PJ5 A;  4NGQ A;  5F09 A;  4K3N A;  1QQ9 A;  2PJ8 A;  3IC1 A;  4MCS A;  1ZG7 A;  1Q7L A;  4DUK A;  2WYR A;  3RBU A;  1KWM A;  4AXV A;  4A37 A;  2BCO A;  3KQZ A;  5CPA A;  1YW6 A;  4R76 A;  1HDU A;  3B35 A;  3SJF A;  5I4M A;  2ZEH A;  4EWT A;  3JRU A;  3VH9 A;  2PJ0 A;  4NJQ A;  4NGT A;  3NFZ A;  2EWB A;  5K8P A;  4IK2 A;  2V77 A;  2CF4 A;  1AYE A;  3PB8 X;  2Q43 A;  2XEJ A;  1H8L A;  2IMO A;  4W9Y A;  1LAM A;  4ZYQ A;  5LRK A;  4DJL A;  3GUX A;  2ZEN A;  4PXC A;  4BD9 A;  3VAR A;  1FT7 A;  2EK8 A;  3KR4 A;  1CPX A;  1TKJ A;  2ZOG A;  2ZEM A;  1TF8 A;  4JZ0 A;  3WC6 A;  2XEG A;  4R6T A;  1BPN A;  4NFR A;  1QMU A;  2PJA A;  4ZX8 A;  2HC9 A;  1ARL A;  1ELM P;  2PJB A;  1XMB A;  2PVW A;  3FVL A;  3LMS A;  1BAV A;  5LYI A;  3IFE A;  4O23 A;  1Z5R A;  1AMP A;  3PB6 X;  3B3V A;  1PCA A;  2F8H A;  2I3C A;  2IJZ A;  5K8M A;  4KSI A;  2Q4Z A;  1VHE A;  2RB7 A;  1F2O A;  2ANP A;  3PFE A;  5HVH A;  1XBU A;  1VHO A;  3D66 A;  3IWW A;  3B3S A;  2C6C A;  4H2K A;  3L2N A;  2PE3 A;  2PJ4 A;  3SI0 A;  1YME A;  3MN8 A;  1XJO A;  4YU9 A;  4PXD A;  4JYW A;  1NSA A;  2XEF A;  4OID A;  4NGS A;  4A94 A;  4X8I A;  4MXU A;  2Q51 A;  3B2Y A;  2JBJ A;  1CBX A;  5LRG A;  4MCQ A;  2PRQ A;  4NGN A;  3PB4 X;  3GB0 A;  3KHZ A;  1ZLH A;  5LYF A;  1LOK A;  5D29 A;  1CPS A;  5K8N A;  4MMO A;  4A39 A;  3D7F A;  3CDX A;  2NSM A;  1IY7 A;  3D67 A;  4Q7A A;  4OC4 A;  3DGV A;  3PFO A;  2PJ2 A;  4P10 A;  4FUU A;  3B3W A;  3KI9 A;  3BXM A;  3FF3 A;  4EME A;  1HDQ A;  3KZW A;  2O53 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...