4MHYA

Crystal structure of a glutaminyl cyclase from ixodes scapularis in complex with pbd150
Total Genus 109
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
109
sequence length
326
structure length
324
Chain Sequence
LKWPRDLRPLAHHDLLYMGQIEDRGDFNATLRNFLVPRVVGSQKHREVREFIVRSLKDLDWDVEEDCFDGQTPHGIKPFCNVIATLNPSACHRLVLACHYDSLLHKEGTFIGATDSAVPCAQLLYLARSLNGKLQNQKTRGDGLTLQLVFFDGEEAFERWSSHDSLYGSRHLAQKWHEDRTSAERLESCLERSEIANQIDRMEVMVLLDLLGAENPRFYSYFGETQPVYRRLVNIESRLNDAGLMELPRRRRRTNYFSNSSTVGFIEDDHIPFLKRSVPIVHIIPSPFPDVWHTLDDNEQNLHHPTISNLNKIFKAFVSEYLQL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural and functional analyses of a glutaminyl cyclase from Ixodes scapularis reveal metal-independent catalysis and inhibitor binding.
pubmed doi rcsb
source organism Ixodes scapularis
molecule tags Transferase
molecule keywords Glutaminyl cyclase, putative
total genus 109
structure length 324
sequence length 326
ec nomenclature ec 2.3.2.5: Glutaminyl-peptide cyclotransferase.
pdb deposition date 2013-08-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF04389 Peptidase_M28 Peptidase family M28
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.630.10 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Zn peptidases 4mhyA00
3BXMA 2PJ4A 3RBUA 4P6YA 3PB7X 3KGQA 3KASA 5DS0A 4X2TA 4NJQA 3B3VA 4EFDA 3IWWA 1LAPA 1XJOA 1XRYA 2BOAA 2DEAA 2F8HA 3KQXA 3VATA 3WC5A 4A94A 2XEGA 4O23A 3D7GA 2ZEEA 2PJ6A 5LRGA 3B3TA 4MCQA 3VARA 2PJ2A 5CBMA 4ZX8A 4ZYQA 3N5FA 4RUHA 3FF3A 3PB6X 3H8EA 1ELLP 3D7HA 4ZI6A 1Z2LA 2ZENA 3NH5A 4JYWA 3CDXA 2IMOA 4F8ZA 4AXVA 1CP7A 1ZG7A 4UIAA 2PJ9A 1ELMP 4MHYA 4OIDA 4P4FA 2POKA 4W9YA 3RAMA 3BHXA 1ZLHA 4K3NA 3CPAA 3WC6A 4F9VA 3RZAA 1H8LA 3B3SA 4P10A 5D8NA 3FECA 3WABA 1YSJA 2CIJA 1CPSA 4MMOA 4FWUA 2QVPA 5CPAA 1Q7LA 3S9NA 3NA6A 1TKJA 2GLFA 1EE3P 3SJEA 4G1PA 1JQGA 2JEWA 1HDUA 4MHPA 3FEEA 1LOKA 2VL1A 2Q43A 5JH9A 3H8GA 1R43A 4P44A 4NGRA 2AFUA 3IFEA 5HXDA 2JBKA 2GU2A 2V8GA 3BI1A 2ZEPA 4YU9A 4DJLA 3GLJA 2AFSA 1QQ9A 1IY7A 4KSIA 2WYRA 2QJ8A 1KWMA 4P4BA 3KI9A 1LCPA 2ZOFA 3FH4A 1UWYA 1F2PA 3NH4A 4F9UA 1VHEA 4PPZA 4P4DA 4OC0A 1PYTB 3BI0A 2Q51A 3KZWA 4MCSA 1RTQA 4OKOA 2QYVA 1BPNA 2IJZA 2AFOA 5J1QA 2XEJA 2F7VA 4FUUA 4MXUA 5LYDA 4NJRA 2GLJA 3SJGA 3L2NA 5K8NA 1BPMA 2O53A 2HB6A 2OR4A 1DE4C 3FVLA 3D7FA 3MRUA 4OC4A 4YWYA 1HEEA 4NGNA 4MRIA 5D29A 5LRJA 4R6TA 4A39A 4DYOA 4UF4A 1VHOA 2PJ0A 4OIWA 2G9DA 4NGQA 4MHNA 3JRUA 4WWVA 1CX8A 1Y0RA 3B7IA 2RFHA 1YW4A 4R76A 5HVFA 3CPXA 4OC3A 4X8IA 3SI2A 2O4HA 4P4EA 2HC9A 3NFZA 4OMEA 3ISXA 4ONWA 4R8FA 3K9TA 1IGBA 2C6CA 2JBJA 1AMPA 4TWEA 1DTDA 3IC1A 3KR5A 3PFOA 3D4UA 4ZY0A 2PJ8A 3B3CA 4BD9A 3HLPA 3V38A 4PXBA 2V8HA 1AYEA 3H8FA 3SI0A 1VIXA 2ZOGA 4OC1A 3IIBA 1CG2A 4P4JA 2ZEDA 4PXEA 3PB4X 3KL9A 3KHZA 1XBUA 2AFMA 2CTCA 3PRTA 3TX8A 3PEIA 4PXCA 1ARLA 2GREA 2EK9A 8CPAA 1F57A 3PB8X 4Z65A 4IAVA 1QMUA 4P45A 4X3RA 1XFOA 4OC5A 3MN8A 2EWBA 5LYIA 1Z8LA 3B3WA 5IB9A 2AFWA 2NYQA 2AFZA 4Q7AA 2CTBA 3T8WA 2IQ6A 2ZEHA 2J9AA 3TC8A 3SJXA 3GB0A 2ZELA 1CPXA 4JZ0A 3DGVA 1M4LA 2BCOA 3B2YA 4NGPA 1PCAA 3PFEA 4NFRA 4WJBA 1BAVA 2RB7A 1CBXA 4EWTA 2FVGA 3S9MA 4UEEA 2I3CA 3KR4A 5HVGA 3DLJA 5HVHA 5K8MA 1NSAA 4A38A 2PIZA 1FT7A 3V7ZA 3QNVA 4OP4A 2PJAA 4NGTA 3B35A 4MHZA 1TF8A 3K2KA 2Q4ZA 3HUVA 1ZG8A 3VH9A 4MCRA 2BO9A 3S9LA 4P4IA 1ARMA 2ZEMA 3IO1A 5LRKA 2PJ7A 2C1CA 3D67A 4UEFA 4ZX9A 4R7MA 3FX6A 1ZLIA 2OOTA 4FAIA 4OC2A 2PVVA 4PQAA 2ZEGA 2XEIA 3WC7A 3D68A 3PBBA 1LANA 1YMEA 4DUKA 3IJ3A 1VGYA 1BLLE 3LMSA 5JGFA 5LYFA 2AFXA 5JM6A 4TNUA 5LYLA 5I4MA 2ZEFA 4PXDA 7CPAA 4ZY2A 1TKFA 4LQGA 2XEFA 2ANPA 4H2KA 1Y7EA 1F2OA 2V8DA 2PJ1A 2PJ3A 4NGSA 2PE3A 1LAMA 3SJFA 3WT4A 1FNOA 5K8OA 6CPAA 2V77A 2NSMA 2PIYA 2PCUA 1TXRA 3FJUA 3PBEA 1LFWA 3KQZA 2EK8A 4UIBA 1CP6A 4IHMA 5ELYA 4ZY1A 4GM5A 1Z5RA 3I1UA 4NGMA 3NH8A 1TF9A 2ZEOA 1XMBA 3SI1A 5K8PA 2ABZA 3ISZA 1R3NA 5F09A 2WZNA 1OBRA 3GUXA 2PJBA 2PJCA 2PVWA 4IK2A 4MCPA 2PRQA 1YLOA 4EMEA 3KHXA 3FMCA 1ZG9A 3FEDA 2CF4A 3PB9X 3IEHA 1YW6A 4CPAA 1Y0YA 4UEZA 1TKHA 4A37A 4FBEA 2PJ5A 3D7DA 3D66A 2V8VA 1HDQA 3CT9A 4B6ZA 2C6PA 5THWA 2C6GA 3LWUA 1GYTA
chains in the Genus database with same CATH superfamily
3NE7A 5DWMA 1AUGA 4Q36A 4B11A 4KOUA 2NMTA 3BXMA 2PJ4A 3RYOA 2DXQA 3RBUA 4NEXA 1XF8A 4MFKA 2YNDA 2Q0YA 2Z3NA 2OB0A 3PB7X 4P6YA 4B5PB 3KGQA 3V8IA 1N71A 1Y9WA 3KASA 5IX3A 5EMIA 5DS0A 4X2TA 4KVME 4UFWA 4NJQA 2JEVA 4R3KA 2DPTA 1QSMA 1NE9A 3B3VA 3IWWA 4EFDA 1LAPA 1XJOA 1XRYA 2BOAA 2DEAA 2F8HA 3KQXA 4J3GA 4KORA 4PSXA 1ZO0A 3VATA 3WC5A 2XEGA 3JVNA 4O23A 1YREA 3D7GA 3FBUA 4F0YA 2ZEEA 2PJ6A 4XNHC 5LRGA 1JWQA 3B3TA 4MCQA 3G8WA 3VARA 2PJ2A 1BOBA 3CXPA 5CBMA 4ZX8A 2J8RA 3TFYA 4ZYQA 1U6MA 3N5FA 4RUHA 4UCMA 5EC4A 3FF3A 3PB6X 3H8EA 1ELLP 1OZPA 4CAWA 2QMLA 2FT0A 2HQYA 3H5ZA 3PZJA 2C27A 3D7HA 4FD6A 4M6IA 1XOVA 1Z2LA 4ZI6A 1KZFA 2ZENA 3NH5A 2Y0MA 4JYWA 3EXNA 2YNCC 3CDXA 3IWGA 2IMOA 5GCNA 1TIQA 2Z3OA 3D2MA 4F8ZA 4NF1A 4GXHA 4AXVA 1CP7A 1ZG7A 4UIAA 4CS0B 2PJ9A 2FE7A 4U9ZA 4LQ6A 4XNHB 4CYPA 3P2FA 1ELMP 4MHYA 4OIDA 4A2ZA 1XE4A 2REEA 4P4FA 2POKA 4W9YA 5A28A 1J4JA 2Q7BA 3RAMA 3BHXA 1ZLHA 2Z3PA 4K3NA 2Z11A 3CPAA 3OWCA 3WC6A 2PR8A 4F9VA 2CXAA 3DR6A 2WSAA 3IU1A 3UY5A 4FD4A 3KKWA 4CGPA 3RZAA 2Z10A 1H8LA 3GYAA 3B3SA 4P10A 2HV2A 1Z4RA 3F8KA 5D8NA 2ARHA 3FECA 1YLEA 3F5BA 3WABA 1YSJA 2CIJA 1WWZA 4H89A 3MGDA 4UCNA 4UFVA 2JDDA 1CPSA 1GYTA 3LODA 4UWJA 3DDDA 4MMOA 4FWUA 4R87A 1B87A 1S7FA 4KOWA 2QVPA 5CPAA 5AGEA 1Q7LA 3S9NA 2P6EA 5G1ZA 3NA6A 4IF5A 2EO8A 2ATRA 1TKJA 4BMHA 4UA3A 2GLFA 1VKCA 1EE3P 2ODFA 3SJEA 2OZGA 4G1PA 4OADA 4AG9A 1JQGA 3S6KA 4RS2A 2JEWA 1HDUA 1RXTA 4MHPA 2FCKA 5EBVA 3FEEA 2B4DB 1S5KA 3I3GA 1LOKA 2VL1A 2Q43A 1XEBA 3H8GA 5JH9A 1V0CA 1R43A 4P44A 1IB1E 4NGRA 4F0XA 2AFUA 4JXRA 2GIVA 2EUIA 3IFEA 5G20A 1MJAA 1S60A 3DSBA 4LX9A 3NE8A 5HXDA 2FL4A 2JBKA 1Q2DA 2GU2A 4ZGYB 2V8GA 2ZW4A 2ZEPA 3BI1A 4MFQA 4OLLA 1ON0A 4YU9A 4DJLA 3GLJA 2OZHA 3EFAA 4M6HA 2AFSA 3LD2A 1QQ9A 2VBQA 1IY7A 1KUYA 2B3UA 4KSIA 4Y49B 2WYRA 2QJ8A 1KWMA 2D4OA 2FIWA 4P4BA 2H5MA 2CNSA 1LCPA 2ZOFA 3KI9A 4CGLA 1YR0A 4PK2A 2VZZA 2BUEA 3FH4A 1KUXA 4LUAA 4QB9A 1UWYA 1F2PA 3NH4A 4F9UA 2FSRA 2Q7SA 1VHEA 1YGHA 4PPZA 4P4DA 1I21A 5H86A 4OC0A 3T90A 4L89A 1PYTB 2IL4A 2Q51A 2Q4VA 3BI0A 4ZBGA 3KZWA 2P6GA 4MCSA 4KOTA 1RTQA 4OKOA 2QYVA 1BPNA 1P4NA 2Z0ZA 3P2HA 4MBUA 2IJZA 1IIDA 2G3AA 2AFOA 2K5TA 3D3SA 5J1QA 2EBJA 2XEJA 4GS4A 2F7VA 4FUUA 4MFPA 4MXUA 4QUSA 4CYNA 1Z8WA 4R9MA 4NJRA 2GLJA 5LYDA 3IGRA 3SJGA 5F49A 3L2NA 4II9A 5K8NA 3DNSA 3FYNA 1BPMA 2O53A 1Y7RA 2HB6A 2OR4A 4M85A 3ZJ0A 1DE4C 4KLWA 4CGOA 5ISVA 3FVLA 1Q2CA 3D7FA 3MRUA 2OZUA 4KS9A 3JUWA 4UFXA 3CXSA 4OC4A 4YWYA 1HEEA 3R1KA 3BJ7A 4NGNA 4XPLA 1QSOA 3FNCA 4MRIA 2Q44A 4RI1A 1UFHA 5D29A 5LRJA 2GANA 3VWDA 4R6TA 4UCPA 4A39A 1P0HA 4L8AA 2P0WA 4DYOA 1R57A 2BL1A 4KOSA 1VHOA 2PJ0A 4OIWA 4UF4A 2G9DA 2P6FA 3R9GA 4NGQA 3IWEA 2VI7A 3R95A 2FIAA 3W91A 3S6GA 1FY7A 2VXKA 2YNEA 4MHNA 3R9EA 1WK4A 2B58A 2R1IA 2GFQA 3LACA 4YFJA 3BLNA 3JRUA 4MJ8A 1CX8A 4WWVA 1Y0RA 2PSWA 4B10A 3B7IA 2RFHA 1YW4A 3PGPA 5BWAB 4R76A 3TCVA 4Q38A 5KTDA 5HVFA 1YVOA 3FXTA 3CPXA 4OC3A 4X8IA 4JD6A 3SI2A 5G21A 4RN7A 2B5GA 2O4HA 4P4EA 5I0CA 2HC9A 3NFZA 4OMEA 1YK3A 4KSAA 3ISXA 3BJ8A 4PK3A 4ONWA 1RO5A 4R8FA 1QSTA 1YVKA 3I9SA 4FD7A 3K9TA 5HH1A 4B5OA 1IGBA 2C6CA 3QAHA 3FB3A 2JBJA 1AMPA 4OAEA 4TWEA 4HNWB 1DTDA 3IC1A 5F48A 4JXQA 3RNZA 3KR5A 3PFOA 4CRZB 4E2AA 3D4UA 3GKRA 3D8PA 4ZY0A 2PJ8A 3B3CA 3WR7A 2G0BA 5A27A 4BD9A 4KSFA 4B13A 2VQYA 3HLPA 3R9FA 4PXBA 3V38A 2RC4A 2V8HA 1AYEA 3H8FA 3SI0A 4YRHA 1VIXA 2ZOGA 3W6SA 2DF5A 4QVTA 1PUAA 4OC1A 3IIBA 1CG2A 4P4JA 4R3LA 3TE4A 4MFZA 2ZEDA 3G3SA 4PXEA 3W6XA 3TT2A 2ZW6A 3PB4X 4C2YA 4CAXA 2A4NA 3KL9A 3KHZA 1XBUA 2AFMA 2CTCA 3CZXA 3PRTA 4U5YA 1M4IA 1L0CA 3TX8A 3TO7A 4KLVA 3PEIA 4PXCA 1ARLA 4CYQA 2GREA 2EK9A 4CRYB 5C82A 1Z8XA 8CPAA 1F57A 2CY2A 3PB8X 4Z65A 4BINA 4IAVA 1QMUA 2R7HA 4U9YA 4P45A 4X3RA 1XFOA 4OC5A 3MN8A 5AG6A 2EWBA 3C26A 5AG4A 5LYIA 1Z8LA 4KVOE 3B3WA 4MY0A 4CGNA 3S6FA 5IB9A 2I00A 4C2ZA 2AFWA 1M44A 2I79A 2NYQA 2AFZA 4Q7AA 4M6GA 4AVCA 2CTBA 3T8WA 2IQ6A 2ZEHA 2J9AA 4AB7A 5JPHA 3TC8A 5AG5A 3JTKA 3SJXA 3GB0A 2ZELA 1CPXA 3DGVA 4JZ0A 1M4LA 4KUBA 2BCOA 2PR1A 3B2YA 1IICA 3QAYA 4IUSA 1IOFA 2ZPAA 3GY9A 4NGPA 3PP9A 1IYLA 2G3TA 5DWNA 3FIXA 2PDOA 2CNMA 4K30A 4KOXA 1PCAA 1K4JA 3PFEA 4NFRA 4WJBA 1BAVA 4BBHA 2RB7A 3IU2A 1CBXA 2ZXVA 3R96A 4EWTA 4A94A 2Q04A 2FVGA 4H6ZA 2AJ6A 3S9MA 4UEEA 2I3CA 1NMTA 2WPWA 3KR4A 4AG7A 5HVGA 4E0AA 1VHSA 3T9YA 1X12A 4H6UA 3DLJA 2J8MA 5HVHA 4X5KA 5IV0A 5K8MA 1BO4A 2B3VA 3ZZIA 4MI4A 4JWPA 1NSAA 4A38A 1S7LA 1Y9KA 2PIZA 4MHDA 1FT7A 3V7ZA 3TO6A 2PRBA 3K9UA 3QNVA 1M4GA 3DR8A 2Z3MA 4OP4A 5KTAA 4QC6A 2PJAA 2PQ8A 4CAEA 4NGTA 4JJXA 3B35A 4MHZA 5FVJA 4HPSA 1TF8A 2REFA 4XPKA 2ZW7A 1Z4EA 3K2KA 4B5PA 2Q4ZA 2B5GB 3TOAA 3HUVA 1ZG8A 2JDCA 3VH9A 5F47A 5J8FA 2VEZA 2OH1A 4MCRA 4A95A 2BO9A 3S9LA 1S3ZA 4P4IA 4AVBA 1ARMA 2ZEMA 3SHPA 3IO1A 2Z3KA 5E96A 2PJ7A 3TO9A 3RO0A 5LRKA 3A9LA 3SXNA 2EVNA 4UWIA 1M1DA 4UBRA 4PSWA 4JLYA 2C1CA 3QB8A 3D67A 4KZTA 4UEFA 4ZX9A 1CJWA 4R7MA 1ZLIA 2O28A 3FX6A 4MFJA 4A30A 2BSWA 4KOYA 2YNCA 2OOTA 4OC2A 3TTHA 2PVVA 1S7NA 4EVYA 1QSNA 4PQAA 4FAIA 2ZEGA 2KCWA 3FRMA 4R57A 2PC1A 1PU9A 2XEIA 5K8PA 3WC7A 3D68A 2JLMA 3PBBA 1LANA 1YX0A 3TOBA 1B6BA 1YMEA 4DUKA 4C68A 4NSQA 3IJ3A 1VGYA 5IB0A 1BLLE 1KUVA 3EY5A 3LMSA 1LRZA 4E8OA 2OU2A 5JGFA 5LYFA 2AFXA 1XMTA 2GE3A 2WPXA 5JM6A 4TNUA 4XPDC 3S6HA 5LYLA 2X7BA 5I4MA 2ZEFA 4PXDA 7CPAA 4ZY2A 1TKFA 4CYOA 4KUAA 1IU8A 4LQGA 3B8GA 1I1DA 2XEFA 3F0AA 2ANPA 4H2KA 4B12A 1Y7EA 1F2OA 1GHEA 4NXYA 2V8DA 2HUZA 2PJ1A 2PJ3A 2R8VA 4NGSA 2R98A 4HNYB 2DPSA 4Y49C 2PE3A 1LAMA 3N7ZA 3SJFA 5G22A 3WT4A 1IYKA 4NCZA 1YQEA 4FD5A 4C2XA 4MFLA 1FNOA 5K8OA 4HNXB 6CPAA 2QECA 4KOVA 5JQ4A 2YGWA 2V77A 3D2PA 4CAVA 2NSMA 2PIYA 4A32A 1M4DA 1TXRA 2PCUA 3FJUA 1LFWA 3KQZA 2EK8A 3PBEA 4UIBA 2FS5A 2Z3LA 1MJBA 1CP6A 1S7KA 4IHMA 5ELYA 4ZY1A 1Q2YA 4DNCA 3EO4A 4GM5A 1Z5RA 5J8CA 5AG7A 1Z8TA 3I1UA 4NGMA 3NH8A 1TF9A 2ZEOA 4ONUA 1A2ZA 1XMBA 3SI1A 1X10A 3SXOA 4YGOA 4CGMA 2ABZA 2QIRA 1R3NA 3ISZA 1MK4A 2J8NA 4KVXA 4I49A 5CNPA 4B14A 2Q4YA 5F09A 2BEIA 2WZNA 2ZW5A 1OBRA 3GUXA 2PJBA 4M3SA 2PJCA 2FXFA 1MJ9A 2PVWA 2PRQA 1YLOA 4IK2A 1IOIA 4MCPA 4PV6A 5H84A 4EMEA 4HKFA 1CM0A 3KHXA 5F46A 3FMCA 4QBJA 1ZG9A 2B4DA 3FEDA 4A33A 2D4PA 1SQHA 4CAFA 3E0KA 2VZYA 4C7IA 2CF4A 1XIXA 3PB9X 3H4QA 4A31A 5HMNA 3IEHA 1I12A 2F5IA 3VWEA 4F6AA 3EC4A 3CXQA 1YW6A 4C7HA 5C88A 1QSRA 4XPDB 1Z9UA 1NSLA 4AVAA 1Y0YA 4CPAA 4UEZA 1TKHA 4A37A 4MY3A 4FBEA 5KTCA 2PJ5A 3D7DA 4ORFA 2AE6A 3D66A 2V8VA 1HDQA 3CT9A 4B6ZA 2C6PA 3GIUA 2B4BA 5THWA 2WUUA 2C6GA 3LWUA 2CNTA
chains in the Genus database with same CATH topology
3BXMA 2PJ4A 3RBUA 4P6YA 3PB7X 3KGQA 3KASA 5DS0A 4X2TA 4NJQA 3B3VA 4EFDA 3IWWA 1LAPA 1XJOA 1XRYA 2BOAA 2DEAA 2F8HA 3KQXA 3VATA 3WC5A 4A94A 2XEGA 4O23A 3D7GA 2ZEEA 2PJ6A 5LRGA 3B3TA 4MCQA 3VARA 2PJ2A 5CBMA 4ZX8A 4ZYQA 3N5FA 4RUHA 3FF3A 3PB6X 3H8EA 1ELLP 3D7HA 4ZI6A 1Z2LA 2ZENA 3NH5A 4JYWA 3CDXA 2IMOA 4F8ZA 4AXVA 1CP7A 1ZG7A 4UIAA 2PJ9A 1ELMP 4MHYA 4OIDA 4P4FA 2POKA 4W9YA 3RAMA 3BHXA 1ZLHA 4K3NA 3CPAA 3WC6A 4F9VA 3RZAA 1H8LA 3B3SA 4P10A 5D8NA 3FECA 3WABA 1YSJA 2CIJA 1CPSA 4MMOA 4FWUA 2QVPA 5CPAA 1Q7LA 3S9NA 3NA6A 1TKJA 2GLFA 1EE3P 3SJEA 4G1PA 1JQGA 2JEWA 1HDUA 4MHPA 3FEEA 1LOKA 2VL1A 2Q43A 5JH9A 3H8GA 1R43A 4P44A 4NGRA 2AFUA 3IFEA 5HXDA 2JBKA 2GU2A 2V8GA 3BI1A 2ZEPA 4YU9A 4DJLA 3GLJA 2AFSA 1QQ9A 1IY7A 4KSIA 2WYRA 2QJ8A 1KWMA 4P4BA 3KI9A 1LCPA 2ZOFA 3FH4A 1UWYA 1F2PA 3NH4A 4F9UA 1VHEA 4PPZA 4P4DA 4OC0A 1PYTB 3BI0A 2Q51A 3KZWA 4MCSA 1RTQA 4OKOA 2QYVA 1BPNA 2IJZA 2AFOA 5J1QA 2XEJA 2F7VA 4FUUA 4MXUA 5LYDA 4NJRA 2GLJA 3SJGA 3L2NA 5K8NA 1BPMA 2O53A 2HB6A 2OR4A 1DE4C 3FVLA 3D7FA 3MRUA 4OC4A 4YWYA 1HEEA 4NGNA 4MRIA 5D29A 5LRJA 4R6TA 4A39A 4DYOA 4UF4A 1VHOA 2PJ0A 4OIWA 2G9DA 4NGQA 4MHNA 3JRUA 4WWVA 1CX8A 1Y0RA 3B7IA 2RFHA 1YW4A 4R76A 5HVFA 3CPXA 4OC3A 4X8IA 3SI2A 2O4HA 4P4EA 2HC9A 3NFZA 4OMEA 3ISXA 4ONWA 4R8FA 3K9TA 1IGBA 2C6CA 2JBJA 1AMPA 4TWEA 1DTDA 3IC1A 3KR5A 3PFOA 3D4UA 4ZY0A 2PJ8A 3B3CA 4BD9A 3HLPA 3V38A 4PXBA 2V8HA 1AYEA 3H8FA 3SI0A 1VIXA 2ZOGA 4OC1A 3IIBA 1CG2A 4P4JA 2ZEDA 4PXEA 3PB4X 3KL9A 3KHZA 1XBUA 2AFMA 2CTCA 3PRTA 3TX8A 3PEIA 4PXCA 1ARLA 2GREA 2EK9A 8CPAA 1F57A 3PB8X 4Z65A 4IAVA 1QMUA 4P45A 4X3RA 1XFOA 4OC5A 3MN8A 2EWBA 5LYIA 1Z8LA 3B3WA 5IB9A 2AFWA 2NYQA 2AFZA 4Q7AA 2CTBA 3T8WA 2IQ6A 2ZEHA 2J9AA 3TC8A 3SJXA 3GB0A 2ZELA 1CPXA 4JZ0A 3DGVA 1M4LA 2BCOA 3B2YA 4NGPA 1PCAA 3PFEA 4NFRA 4WJBA 1BAVA 2RB7A 1CBXA 4EWTA 2FVGA 3S9MA 4UEEA 2I3CA 3KR4A 5HVGA 3DLJA 5HVHA 5K8MA 1NSAA 4A38A 2PIZA 1FT7A 3V7ZA 3QNVA 4OP4A 2PJAA 4NGTA 3B35A 4MHZA 1TF8A 3K2KA 2Q4ZA 3HUVA 1ZG8A 3VH9A 4MCRA 2BO9A 3S9LA 4P4IA 1ARMA 2ZEMA 3IO1A 5LRKA 2PJ7A 2C1CA 3D67A 4UEFA 4ZX9A 4R7MA 3FX6A 1ZLIA 2OOTA 4FAIA 4OC2A 2PVVA 4PQAA 2ZEGA 2XEIA 3WC7A 3D68A 3PBBA 1LANA 1YMEA 4DUKA 3IJ3A 1VGYA 1BLLE 3LMSA 5JGFA 5LYFA 2AFXA 5JM6A 4TNUA 5LYLA 5I4MA 2ZEFA 4PXDA 7CPAA 4ZY2A 1TKFA 4LQGA 2XEFA 2ANPA 4H2KA 1Y7EA 1F2OA 2V8DA 2PJ1A 2PJ3A 4NGSA 2PE3A 1LAMA 3SJFA 3WT4A 1FNOA 5K8OA 6CPAA 2V77A 2NSMA 2PIYA 2PCUA 1TXRA 3FJUA 3PBEA 1LFWA 3KQZA 2EK8A 4UIBA 1CP6A 4IHMA 5ELYA 4ZY1A 4GM5A 1Z5RA 3I1UA 4NGMA 3NH8A 1TF9A 2ZEOA 1XMBA 3SI1A 5K8PA 2ABZA 3ISZA 1R3NA 5F09A 2WZNA 1OBRA 3GUXA 2PJBA 2PJCA 2PVWA 4IK2A 4MCPA 2PRQA 1YLOA 4EMEA 3KHXA 3FMCA 1ZG9A 3FEDA 2CF4A 3PB9X 3IEHA 1YW6A 4CPAA 1Y0YA 4UEZA 1TKHA 4A37A 4FBEA 2PJ5A 3D7DA 3D66A 2V8VA 1HDQA 3CT9A 4B6ZA 2C6PA 5THWA 2C6GA 3LWUA 1GYTA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3BXM A;  2PJ4 A;  3RBU A;  4P6Y A;  3PB7 X;  3KGQ A;  3KAS A;  5DS0 A;  4X2T A;  4NJQ A;  3B3V A;  4EFD A;  3IWW A;  1LAP A;  1XJO A;  1XRY A;  2BOA A;  2DEA A;  2F8H A;  3KQX A;  3VAT A;  3WC5 A;  4A94 A;  2XEG A;  4O23 A;  3D7G A;  2ZEE A;  2PJ6 A;  5LRG A;  3B3T A;  4MCQ A;  3VAR A;  2PJ2 A;  5CBM A;  4ZX8 A;  4ZYQ A;  3N5F A;  4RUH A;  3FF3 A;  3PB6 X;  3H8E A;  1ELL P;  3D7H A;  4ZI6 A;  1Z2L A;  2ZEN A;  3NH5 A;  4JYW A;  3CDX A;  2IMO A;  4F8Z A;  4AXV A;  1CP7 A;  1ZG7 A;  4UIA A;  2PJ9 A;  1ELM P;  4MHY A;  4OID A;  4P4F A;  2POK A;  4W9Y A;  3RAM A;  3BHX A;  1ZLH A;  4K3N A;  3CPA A;  3WC6 A;  4F9V A;  3RZA A;  1H8L A;  3B3S A;  4P10 A;  5D8N A;  3FEC A;  3WAB A;  1YSJ A;  2CIJ A;  1CPS A;  4MMO A;  4FWU A;  2QVP A;  5CPA A;  1Q7L A;  3S9N A;  3NA6 A;  1TKJ A;  2GLF A;  1EE3 P;  3SJE A;  4G1P A;  1JQG A;  2JEW A;  1HDU A;  4MHP A;  3FEE A;  1LOK A;  2VL1 A;  2Q43 A;  5JH9 A;  3H8G A;  1R43 A;  4P44 A;  4NGR A;  2AFU A;  3IFE A;  5HXD A;  2JBK A;  2GU2 A;  2V8G A;  3BI1 A;  2ZEP A;  4YU9 A;  4DJL A;  3GLJ A;  2AFS A;  1QQ9 A;  1IY7 A;  4KSI A;  2WYR A;  2QJ8 A;  1KWM A;  4P4B A;  3KI9 A;  1LCP A;  2ZOF A;  3FH4 A;  1UWY A;  1F2P A;  3NH4 A;  4F9U A;  1VHE A;  4PPZ A;  4P4D A;  4OC0 A;  1PYT B;  3BI0 A;  2Q51 A;  3KZW A;  4MCS A;  1RTQ A;  4OKO A;  2QYV A;  1BPN A;  2IJZ A;  2AFO A;  5J1Q A;  2XEJ A;  2F7V A;  4FUU A;  4MXU A;  5LYD A;  4NJR A;  2GLJ A;  3SJG A;  3L2N A;  5K8N A;  1BPM A;  2O53 A;  2HB6 A;  2OR4 A;  1DE4 C;  3FVL A;  3D7F A;  3MRU A;  4OC4 A;  4YWY A;  1HEE A;  4NGN A;  4MRI A;  5D29 A;  5LRJ A;  4R6T A;  4A39 A;  4DYO A;  4UF4 A;  1VHO A;  2PJ0 A;  4OIW A;  2G9D A;  4NGQ A;  4MHN A;  3JRU A;  4WWV A;  1CX8 A;  1Y0R A;  3B7I A;  2RFH A;  1YW4 A;  4R76 A;  5HVF A;  3CPX A;  4OC3 A;  4X8I A;  3SI2 A;  2O4H A;  4P4E A;  2HC9 A;  3NFZ A;  4OME A;  3ISX A;  4ONW A;  4R8F A;  3K9T A;  1IGB A;  2C6C A;  2JBJ A;  1AMP A;  4TWE A;  1DTD A;  3IC1 A;  3KR5 A;  3PFO A;  3D4U A;  4ZY0 A;  2PJ8 A;  3B3C A;  4BD9 A;  3HLP A;  3V38 A;  4PXB A;  2V8H A;  1AYE A;  3H8F A;  3SI0 A;  1VIX A;  2ZOG A;  4OC1 A;  3IIB A;  1CG2 A;  4P4J A;  2ZED A;  4PXE A;  3PB4 X;  3KL9 A;  3KHZ A;  1XBU A;  2AFM A;  2CTC A;  3PRT A;  3TX8 A;  3PEI A;  4PXC A;  1ARL A;  2GRE A;  2EK9 A;  8CPA A;  1F57 A;  3PB8 X;  4Z65 A;  4IAV A;  1QMU A;  4P45 A;  4X3R A;  1XFO A;  4OC5 A;  3MN8 A;  2EWB A;  5LYI A;  1Z8L A;  3B3W A;  5IB9 A;  2AFW A;  2NYQ A;  2AFZ A;  4Q7A A;  2CTB A;  3T8W A;  2IQ6 A;  2ZEH A;  2J9A A;  3TC8 A;  3SJX A;  3GB0 A;  2ZEL A;  1CPX A;  4JZ0 A;  3DGV A;  1M4L A;  2BCO A;  3B2Y A;  4NGP A;  1PCA A;  3PFE A;  4NFR A;  4WJB A;  1BAV A;  2RB7 A;  1CBX A;  4EWT A;  2FVG A;  3S9M A;  4UEE A;  2I3C A;  3KR4 A;  5HVG A;  3DLJ A;  5HVH A;  5K8M A;  1NSA A;  4A38 A;  2PIZ A;  1FT7 A;  3V7Z A;  3QNV A;  4OP4 A;  2PJA A;  4NGT A;  3B35 A;  4MHZ A;  1TF8 A;  3K2K A;  2Q4Z A;  3HUV A;  1ZG8 A;  3VH9 A;  4MCR A;  2BO9 A;  3S9L A;  4P4I A;  1ARM A;  2ZEM A;  3IO1 A;  5LRK A;  2PJ7 A;  2C1C A;  3D67 A;  4UEF A;  4ZX9 A;  4R7M A;  3FX6 A;  1ZLI A;  2OOT A;  4FAI A;  4OC2 A;  2PVV A;  4PQA A;  2ZEG A;  2XEI A;  3WC7 A;  3D68 A;  3PBB A;  1LAN A;  1YME A;  4DUK A;  3IJ3 A;  1VGY A;  1BLL E;  3LMS A;  5JGF A;  5LYF A;  2AFX A;  5JM6 A;  4TNU A;  5LYL A;  5I4M A;  2ZEF A;  4PXD A;  7CPA A;  4ZY2 A;  1TKF A;  4LQG A;  2XEF A;  2ANP A;  4H2K A;  1Y7E A;  1F2O A;  2V8D A;  2PJ1 A;  2PJ3 A;  4NGS A;  2PE3 A;  1LAM A;  3SJF A;  3WT4 A;  1FNO A;  5K8O A;  6CPA A;  2V77 A;  2NSM A;  2PIY A;  2PCU A;  1TXR A;  3FJU A;  3PBE A;  1LFW A;  3KQZ A;  2EK8 A;  4UIB A;  1CP6 A;  4IHM A;  5ELY A;  4ZY1 A;  4GM5 A;  1Z5R A;  3I1U A;  4NGM A;  3NH8 A;  1TF9 A;  2ZEO A;  1XMB A;  3SI1 A;  5K8P A;  2ABZ A;  3ISZ A;  1R3N A;  5F09 A;  2WZN A;  1OBR A;  3GUX A;  2PJB A;  2PJC A;  2PVW A;  4IK2 A;  4MCP A;  2PRQ A;  1YLO A;  4EME A;  3KHX A;  3FMC A;  1ZG9 A;  3FED A;  2CF4 A;  3PB9 X;  3IEH A;  1YW6 A;  4CPA A;  1Y0Y A;  4UEZ A;  1TKH A;  4A37 A;  4FBE A;  2PJ5 A;  3D7D A;  3D66 A;  2V8V A;  1HDQ A;  3CT9 A;  4B6Z A;  2C6P A;  5THW A;  2C6G A;  3LWU A;  1GYT A; 
#chains in the Genus database with same CATH topology
 3NE7 A;  5DWM A;  1AUG A;  4Q36 A;  4B11 A;  4KOU A;  2NMT A;  3BXM A;  2PJ4 A;  3RYO A;  2DXQ A;  3RBU A;  4NEX A;  1XF8 A;  4MFK A;  2YND A;  2Q0Y A;  2Z3N A;  2OB0 A;  3PB7 X;  4P6Y A;  4B5P B;  3KGQ A;  3V8I A;  1N71 A;  1Y9W A;  3KAS A;  5IX3 A;  5EMI A;  5DS0 A;  4X2T A;  4KVM E;  4UFW A;  4NJQ A;  2JEV A;  4R3K A;  2DPT A;  1QSM A;  1NE9 A;  3B3V A;  3IWW A;  4EFD A;  1LAP A;  1XJO A;  1XRY A;  2BOA A;  2DEA A;  2F8H A;  3KQX A;  4J3G A;  4KOR A;  4PSX A;  1ZO0 A;  3VAT A;  3WC5 A;  2XEG A;  3JVN A;  4O23 A;  1YRE A;  3D7G A;  3FBU A;  4F0Y A;  2ZEE A;  2PJ6 A;  4XNH C;  5LRG A;  1JWQ A;  3B3T A;  4MCQ A;  3G8W A;  3VAR A;  2PJ2 A;  1BOB A;  3CXP A;  5CBM A;  4ZX8 A;  2J8R A;  3TFY A;  4ZYQ A;  1U6M A;  3N5F A;  4RUH A;  4UCM A;  5EC4 A;  3FF3 A;  3PB6 X;  3H8E A;  1ELL P;  1OZP A;  4CAW A;  2QML A;  2FT0 A;  2HQY A;  3H5Z A;  3PZJ A;  2C27 A;  3D7H A;  4FD6 A;  4M6I A;  1XOV A;  1Z2L A;  4ZI6 A;  1KZF A;  2ZEN A;  3NH5 A;  2Y0M A;  4JYW A;  3EXN A;  2YNC C;  3CDX A;  3IWG A;  2IMO A;  5GCN A;  1TIQ A;  2Z3O A;  3D2M A;  4F8Z A;  4NF1 A;  4GXH A;  4AXV A;  1CP7 A;  1ZG7 A;  4UIA A;  4CS0 B;  2PJ9 A;  2FE7 A;  4U9Z A;  4LQ6 A;  4XNH B;  4CYP A;  3P2F A;  1ELM P;  4MHY A;  4OID A;  4A2Z A;  1XE4 A;  2REE A;  4P4F A;  2POK A;  4W9Y A;  5A28 A;  1J4J A;  2Q7B A;  3RAM A;  3BHX A;  1ZLH A;  2Z3P A;  4K3N A;  2Z11 A;  3CPA A;  3OWC A;  3WC6 A;  2PR8 A;  4F9V A;  2CXA A;  3DR6 A;  2WSA A;  3IU1 A;  3UY5 A;  4FD4 A;  3KKW A;  4CGP A;  3RZA A;  2Z10 A;  1H8L A;  3GYA A;  3B3S A;  4P10 A;  2HV2 A;  1Z4R A;  3F8K A;  5D8N A;  2ARH A;  3FEC A;  1YLE A;  3F5B A;  3WAB A;  1YSJ A;  2CIJ A;  1WWZ A;  4H89 A;  3MGD A;  4UCN A;  4UFV A;  2JDD A;  1CPS A;  1GYT A;  3LOD A;  4UWJ A;  3DDD A;  4MMO A;  4FWU A;  4R87 A;  1B87 A;  1S7F A;  4KOW A;  2QVP A;  5CPA A;  5AGE A;  1Q7L A;  3S9N A;  2P6E A;  5G1Z A;  3NA6 A;  4IF5 A;  2EO8 A;  2ATR A;  1TKJ A;  4BMH A;  4UA3 A;  2GLF A;  1VKC A;  1EE3 P;  2ODF A;  3SJE A;  2OZG A;  4G1P A;  4OAD A;  4AG9 A;  1JQG A;  3S6K A;  4RS2 A;  2JEW A;  1HDU A;  1RXT A;  4MHP A;  2FCK A;  5EBV A;  3FEE A;  2B4D B;  1S5K A;  3I3G A;  1LOK A;  2VL1 A;  2Q43 A;  1XEB A;  3H8G A;  5JH9 A;  1V0C A;  1R43 A;  4P44 A;  1IB1 E;  4NGR A;  4F0X A;  2AFU A;  4JXR A;  2GIV A;  2EUI A;  3IFE A;  5G20 A;  1MJA A;  1S60 A;  3DSB A;  4LX9 A;  3NE8 A;  5HXD A;  2FL4 A;  2JBK A;  1Q2D A;  2GU2 A;  4ZGY B;  2V8G A;  2ZW4 A;  2ZEP A;  3BI1 A;  4MFQ A;  4OLL A;  1ON0 A;  4YU9 A;  4DJL A;  3GLJ A;  2OZH A;  3EFA A;  4M6H A;  2AFS A;  3LD2 A;  1QQ9 A;  2VBQ A;  1IY7 A;  1KUY A;  2B3U A;  4KSI A;  4Y49 B;  2WYR A;  2QJ8 A;  1KWM A;  2D4O A;  2FIW A;  4P4B A;  2H5M A;  2CNS A;  1LCP A;  2ZOF A;  3KI9 A;  4CGL A;  1YR0 A;  4PK2 A;  2VZZ A;  2BUE A;  3FH4 A;  1KUX A;  4LUA A;  4QB9 A;  1UWY A;  1F2P A;  3NH4 A;  4F9U A;  2FSR A;  2Q7S A;  1VHE A;  1YGH A;  4PPZ A;  4P4D A;  1I21 A;  5H86 A;  4OC0 A;  3T90 A;  4L89 A;  1PYT B;  2IL4 A;  2Q51 A;  2Q4V A;  3BI0 A;  4ZBG A;  3KZW A;  2P6G A;  4MCS A;  4KOT A;  1RTQ A;  4OKO A;  2QYV A;  1BPN A;  1P4N A;  2Z0Z A;  3P2H A;  4MBU A;  2IJZ A;  1IID A;  2G3A A;  2AFO A;  2K5T A;  3D3S A;  5J1Q A;  2EBJ A;  2XEJ A;  4GS4 A;  2F7V A;  4FUU A;  4MFP A;  4MXU A;  4QUS A;  4CYN A;  1Z8W A;  4R9M A;  4NJR A;  2GLJ A;  5LYD A;  3IGR A;  3SJG A;  5F49 A;  3L2N A;  4II9 A;  5K8N A;  3DNS A;  3FYN A;  1BPM A;  2O53 A;  1Y7R A;  2HB6 A;  2OR4 A;  4M85 A;  3ZJ0 A;  1DE4 C;  4KLW A;  4CGO A;  5ISV A;  3FVL A;  1Q2C A;  3D7F A;  3MRU A;  2OZU A;  4KS9 A;  3JUW A;  4UFX A;  3CXS A;  4OC4 A;  4YWY A;  1HEE A;  3R1K A;  3BJ7 A;  4NGN A;  4XPL A;  1QSO A;  3FNC A;  4MRI A;  2Q44 A;  4RI1 A;  1UFH A;  5D29 A;  5LRJ A;  2GAN A;  3VWD A;  4R6T A;  4UCP A;  4A39 A;  1P0H A;  4L8A A;  2P0W A;  4DYO A;  1R57 A;  2BL1 A;  4KOS A;  1VHO A;  2PJ0 A;  4OIW A;  4UF4 A;  2G9D A;  2P6F A;  3R9G A;  4NGQ A;  3IWE A;  2VI7 A;  3R95 A;  2FIA A;  3W91 A;  3S6G A;  1FY7 A;  2VXK A;  2YNE A;  4MHN A;  3R9E A;  1WK4 A;  2B58 A;  2R1I A;  2GFQ A;  3LAC A;  4YFJ A;  3BLN A;  3JRU A;  4MJ8 A;  1CX8 A;  4WWV A;  1Y0R A;  2PSW A;  4B10 A;  3B7I A;  2RFH A;  1YW4 A;  3PGP A;  5BWA B;  4R76 A;  3TCV A;  4Q38 A;  5KTD A;  5HVF A;  1YVO A;  3FXT A;  3CPX A;  4OC3 A;  4X8I A;  4JD6 A;  3SI2 A;  5G21 A;  4RN7 A;  2B5G A;  2O4H A;  4P4E A;  5I0C A;  2HC9 A;  3NFZ A;  4OME A;  1YK3 A;  4KSA A;  3ISX A;  3BJ8 A;  4PK3 A;  4ONW A;  1RO5 A;  4R8F A;  1QST A;  1YVK A;  3I9S A;  4FD7 A;  3K9T A;  5HH1 A;  4B5O A;  1IGB A;  2C6C A;  3QAH A;  3FB3 A;  2JBJ A;  1AMP A;  4OAE A;  4TWE A;  4HNW B;  1DTD A;  3IC1 A;  5F48 A;  4JXQ A;  3RNZ A;  3KR5 A;  3PFO A;  4CRZ B;  4E2A A;  3D4U A;  3GKR A;  3D8P A;  4ZY0 A;  2PJ8 A;  3B3C A;  3WR7 A;  2G0B A;  5A27 A;  4BD9 A;  4KSF A;  4B13 A;  2VQY A;  3HLP A;  3R9F A;  4PXB A;  3V38 A;  2RC4 A;  2V8H A;  1AYE A;  3H8F A;  3SI0 A;  4YRH A;  1VIX A;  2ZOG A;  3W6S A;  2DF5 A;  4QVT A;  1PUA A;  4OC1 A;  3IIB A;  1CG2 A;  4P4J A;  4R3L A;  3TE4 A;  4MFZ A;  2ZED A;  3G3S A;  4PXE A;  3W6X A;  3TT2 A;  2ZW6 A;  3PB4 X;  4C2Y A;  4CAX A;  2A4N A;  3KL9 A;  3KHZ A;  1XBU A;  2AFM A;  2CTC A;  3CZX A;  3PRT A;  4U5Y A;  1M4I A;  1L0C A;  3TX8 A;  3TO7 A;  4KLV A;  3PEI A;  4PXC A;  1ARL A;  4CYQ A;  2GRE A;  2EK9 A;  4CRY B;  5C82 A;  1Z8X A;  8CPA A;  1F57 A;  2CY2 A;  3PB8 X;  4Z65 A;  4BIN A;  4IAV A;  1QMU A;  2R7H A;  4U9Y A;  4P45 A;  4X3R A;  1XFO A;  4OC5 A;  3MN8 A;  5AG6 A;  2EWB A;  3C26 A;  5AG4 A;  5LYI A;  1Z8L A;  4KVO E;  3B3W A;  4MY0 A;  4CGN A;  3S6F A;  5IB9 A;  2I00 A;  4C2Z A;  2AFW A;  1M44 A;  2I79 A;  2NYQ A;  2AFZ A;  4Q7A A;  4M6G A;  4AVC A;  2CTB A;  3T8W A;  2IQ6 A;  2ZEH A;  2J9A A;  4AB7 A;  5JPH A;  3TC8 A;  5AG5 A;  3JTK A;  3SJX A;  3GB0 A;  2ZEL A;  1CPX A;  3DGV A;  4JZ0 A;  1M4L A;  4KUB A;  2BCO A;  2PR1 A;  3B2Y A;  1IIC A;  3QAY A;  4IUS A;  1IOF A;  2ZPA A;  3GY9 A;  4NGP A;  3PP9 A;  1IYL A;  2G3T A;  5DWN A;  3FIX A;  2PDO A;  2CNM A;  4K30 A;  4KOX A;  1PCA A;  1K4J A;  3PFE A;  4NFR A;  4WJB A;  1BAV A;  4BBH A;  2RB7 A;  3IU2 A;  1CBX A;  2ZXV A;  3R96 A;  4EWT A;  4A94 A;  2Q04 A;  2FVG A;  4H6Z A;  2AJ6 A;  3S9M A;  4UEE A;  2I3C A;  1NMT A;  2WPW A;  3KR4 A;  4AG7 A;  5HVG A;  4E0A A;  1VHS A;  3T9Y A;  1X12 A;  4H6U A;  3DLJ A;  2J8M A;  5HVH A;  4X5K A;  5IV0 A;  5K8M A;  1BO4 A;  2B3V A;  3ZZI A;  4MI4 A;  4JWP A;  1NSA A;  4A38 A;  1S7L A;  1Y9K A;  2PIZ A;  4MHD A;  1FT7 A;  3V7Z A;  3TO6 A;  2PRB A;  3K9U A;  3QNV A;  1M4G A;  3DR8 A;  2Z3M A;  4OP4 A;  5KTA A;  4QC6 A;  2PJA A;  2PQ8 A;  4CAE A;  4NGT A;  4JJX A;  3B35 A;  4MHZ A;  5FVJ A;  4HPS A;  1TF8 A;  2REF A;  4XPK A;  2ZW7 A;  1Z4E A;  3K2K A;  4B5P A;  2Q4Z A;  2B5G B;  3TOA A;  3HUV A;  1ZG8 A;  2JDC A;  3VH9 A;  5F47 A;  5J8F A;  2VEZ A;  2OH1 A;  4MCR A;  4A95 A;  2BO9 A;  3S9L A;  1S3Z A;  4P4I A;  4AVB A;  1ARM A;  2ZEM A;  3SHP A;  3IO1 A;  2Z3K A;  5E96 A;  2PJ7 A;  3TO9 A;  3RO0 A;  5LRK A;  3A9L A;  3SXN A;  2EVN A;  4UWI A;  1M1D A;  4UBR A;  4PSW A;  4JLY A;  2C1C A;  3QB8 A;  3D67 A;  4KZT A;  4UEF A;  4ZX9 A;  1CJW A;  4R7M A;  1ZLI A;  2O28 A;  3FX6 A;  4MFJ A;  4A30 A;  2BSW A;  4KOY A;  2YNC A;  2OOT A;  4OC2 A;  3TTH A;  2PVV A;  1S7N A;  4EVY A;  1QSN A;  4PQA A;  4FAI A;  2ZEG A;  2KCW A;  3FRM A;  4R57 A;  2PC1 A;  1PU9 A;  2XEI A;  5K8P A;  3WC7 A;  3D68 A;  2JLM A;  3PBB A;  1LAN A;  1YX0 A;  3TOB A;  1B6B A;  1YME A;  4DUK A;  4C68 A;  4NSQ A;  3IJ3 A;  1VGY A;  5IB0 A;  1BLL E;  1KUV A;  3EY5 A;  3LMS A;  1LRZ A;  4E8O A;  2OU2 A;  5JGF A;  5LYF A;  2AFX A;  1XMT A;  2GE3 A;  2WPX A;  5JM6 A;  4TNU A;  4XPD C;  3S6H A;  5LYL A;  2X7B A;  5I4M A;  2ZEF A;  4PXD A;  7CPA A;  4ZY2 A;  1TKF A;  4CYO A;  4KUA A;  1IU8 A;  4LQG A;  3B8G A;  1I1D A;  2XEF A;  3F0A A;  2ANP A;  4H2K A;  4B12 A;  1Y7E A;  1F2O A;  1GHE A;  4NXY A;  2V8D A;  2HUZ A;  2PJ1 A;  2PJ3 A;  2R8V A;  4NGS A;  2R98 A;  4HNY B;  2DPS A;  4Y49 C;  2PE3 A;  1LAM A;  3N7Z A;  3SJF A;  5G22 A;  3WT4 A;  1IYK A;  4NCZ A;  1YQE A;  4FD5 A;  4C2X A;  4MFL A;  1FNO A;  5K8O A;  4HNX B;  6CPA A;  2QEC A;  4KOV A;  5JQ4 A;  2YGW A;  2V77 A;  3D2P A;  4CAV A;  2NSM A;  2PIY A;  4A32 A;  1M4D A;  1TXR A;  2PCU A;  3FJU A;  1LFW A;  3KQZ A;  2EK8 A;  3PBE A;  4UIB A;  2FS5 A;  2Z3L A;  1MJB A;  1CP6 A;  1S7K A;  4IHM A;  5ELY A;  4ZY1 A;  1Q2Y A;  4DNC A;  3EO4 A;  4GM5 A;  1Z5R A;  5J8C A;  5AG7 A;  1Z8T A;  3I1U A;  4NGM A;  3NH8 A;  1TF9 A;  2ZEO A;  4ONU A;  1A2Z A;  1XMB A;  3SI1 A;  1X10 A;  3SXO A;  4YGO A;  4CGM A;  2ABZ A;  2QIR A;  1R3N A;  3ISZ A;  1MK4 A;  2J8N A;  4KVX A;  4I49 A;  5CNP A;  4B14 A;  2Q4Y A;  5F09 A;  2BEI A;  2WZN A;  2ZW5 A;  1OBR A;  3GUX A;  2PJB A;  4M3S A;  2PJC A;  2FXF A;  1MJ9 A;  2PVW A;  2PRQ A;  1YLO A;  4IK2 A;  1IOI A;  4MCP A;  4PV6 A;  5H84 A;  4EME A;  4HKF A;  1CM0 A;  3KHX A;  5F46 A;  3FMC A;  4QBJ A;  1ZG9 A;  2B4D A;  3FED A;  4A33 A;  2D4P A;  1SQH A;  4CAF A;  3E0K A;  2VZY A;  4C7I A;  2CF4 A;  1XIX A;  3PB9 X;  3H4Q A;  4A31 A;  5HMN A;  3IEH A;  1I12 A;  2F5I A;  3VWE A;  4F6A A;  3EC4 A;  3CXQ A;  1YW6 A;  4C7H A;  5C88 A;  1QSR A;  4XPD B;  1Z9U A;  1NSL A;  4AVA A;  1Y0Y A;  4CPA A;  4UEZ A;  1TKH A;  4A37 A;  4MY3 A;  4FBE A;  5KTC A;  2PJ5 A;  3D7D A;  4ORF A;  2AE6 A;  3D66 A;  2V8V A;  1HDQ A;  3CT9 A;  4B6Z A;  2C6P A;  3GIU A;  2B4B A;  5THW A;  2WUU A;  2C6G A;  3LWU A;  2CNT A; 
#chains in the Genus database with same CATH homology
 3BXM A;  2PJ4 A;  3RBU A;  4P6Y A;  3PB7 X;  3KGQ A;  3KAS A;  5DS0 A;  4X2T A;  4NJQ A;  3B3V A;  4EFD A;  3IWW A;  1LAP A;  1XJO A;  1XRY A;  2BOA A;  2DEA A;  2F8H A;  3KQX A;  3VAT A;  3WC5 A;  4A94 A;  2XEG A;  4O23 A;  3D7G A;  2ZEE A;  2PJ6 A;  5LRG A;  3B3T A;  4MCQ A;  3VAR A;  2PJ2 A;  5CBM A;  4ZX8 A;  4ZYQ A;  3N5F A;  4RUH A;  3FF3 A;  3PB6 X;  3H8E A;  1ELL P;  3D7H A;  4ZI6 A;  1Z2L A;  2ZEN A;  3NH5 A;  4JYW A;  3CDX A;  2IMO A;  4F8Z A;  4AXV A;  1CP7 A;  1ZG7 A;  4UIA A;  2PJ9 A;  1ELM P;  4MHY A;  4OID A;  4P4F A;  2POK A;  4W9Y A;  3RAM A;  3BHX A;  1ZLH A;  4K3N A;  3CPA A;  3WC6 A;  4F9V A;  3RZA A;  1H8L A;  3B3S A;  4P10 A;  5D8N A;  3FEC A;  3WAB A;  1YSJ A;  2CIJ A;  1CPS A;  4MMO A;  4FWU A;  2QVP A;  5CPA A;  1Q7L A;  3S9N A;  3NA6 A;  1TKJ A;  2GLF A;  1EE3 P;  3SJE A;  4G1P A;  1JQG A;  2JEW A;  1HDU A;  4MHP A;  3FEE A;  1LOK A;  2VL1 A;  2Q43 A;  5JH9 A;  3H8G A;  1R43 A;  4P44 A;  4NGR A;  2AFU A;  3IFE A;  5HXD A;  2JBK A;  2GU2 A;  2V8G A;  3BI1 A;  2ZEP A;  4YU9 A;  4DJL A;  3GLJ A;  2AFS A;  1QQ9 A;  1IY7 A;  4KSI A;  2WYR A;  2QJ8 A;  1KWM A;  4P4B A;  3KI9 A;  1LCP A;  2ZOF A;  3FH4 A;  1UWY A;  1F2P A;  3NH4 A;  4F9U A;  1VHE A;  4PPZ A;  4P4D A;  4OC0 A;  1PYT B;  3BI0 A;  2Q51 A;  3KZW A;  4MCS A;  1RTQ A;  4OKO A;  2QYV A;  1BPN A;  2IJZ A;  2AFO A;  5J1Q A;  2XEJ A;  2F7V A;  4FUU A;  4MXU A;  5LYD A;  4NJR A;  2GLJ A;  3SJG A;  3L2N A;  5K8N A;  1BPM A;  2O53 A;  2HB6 A;  2OR4 A;  1DE4 C;  3FVL A;  3D7F A;  3MRU A;  4OC4 A;  4YWY A;  1HEE A;  4NGN A;  4MRI A;  5D29 A;  5LRJ A;  4R6T A;  4A39 A;  4DYO A;  4UF4 A;  1VHO A;  2PJ0 A;  4OIW A;  2G9D A;  4NGQ A;  4MHN A;  3JRU A;  4WWV A;  1CX8 A;  1Y0R A;  3B7I A;  2RFH A;  1YW4 A;  4R76 A;  5HVF A;  3CPX A;  4OC3 A;  4X8I A;  3SI2 A;  2O4H A;  4P4E A;  2HC9 A;  3NFZ A;  4OME A;  3ISX A;  4ONW A;  4R8F A;  3K9T A;  1IGB A;  2C6C A;  2JBJ A;  1AMP A;  4TWE A;  1DTD A;  3IC1 A;  3KR5 A;  3PFO A;  3D4U A;  4ZY0 A;  2PJ8 A;  3B3C A;  4BD9 A;  3HLP A;  3V38 A;  4PXB A;  2V8H A;  1AYE A;  3H8F A;  3SI0 A;  1VIX A;  2ZOG A;  4OC1 A;  3IIB A;  1CG2 A;  4P4J A;  2ZED A;  4PXE A;  3PB4 X;  3KL9 A;  3KHZ A;  1XBU A;  2AFM A;  2CTC A;  3PRT A;  3TX8 A;  3PEI A;  4PXC A;  1ARL A;  2GRE A;  2EK9 A;  8CPA A;  1F57 A;  3PB8 X;  4Z65 A;  4IAV A;  1QMU A;  4P45 A;  4X3R A;  1XFO A;  4OC5 A;  3MN8 A;  2EWB A;  5LYI A;  1Z8L A;  3B3W A;  5IB9 A;  2AFW A;  2NYQ A;  2AFZ A;  4Q7A A;  2CTB A;  3T8W A;  2IQ6 A;  2ZEH A;  2J9A A;  3TC8 A;  3SJX A;  3GB0 A;  2ZEL A;  1CPX A;  4JZ0 A;  3DGV A;  1M4L A;  2BCO A;  3B2Y A;  4NGP A;  1PCA A;  3PFE A;  4NFR A;  4WJB A;  1BAV A;  2RB7 A;  1CBX A;  4EWT A;  2FVG A;  3S9M A;  4UEE A;  2I3C A;  3KR4 A;  5HVG A;  3DLJ A;  5HVH A;  5K8M A;  1NSA A;  4A38 A;  2PIZ A;  1FT7 A;  3V7Z A;  3QNV A;  4OP4 A;  2PJA A;  4NGT A;  3B35 A;  4MHZ A;  1TF8 A;  3K2K A;  2Q4Z A;  3HUV A;  1ZG8 A;  3VH9 A;  4MCR A;  2BO9 A;  3S9L A;  4P4I A;  1ARM A;  2ZEM A;  3IO1 A;  5LRK A;  2PJ7 A;  2C1C A;  3D67 A;  4UEF A;  4ZX9 A;  4R7M A;  3FX6 A;  1ZLI A;  2OOT A;  4FAI A;  4OC2 A;  2PVV A;  4PQA A;  2ZEG A;  2XEI A;  3WC7 A;  3D68 A;  3PBB A;  1LAN A;  1YME A;  4DUK A;  3IJ3 A;  1VGY A;  1BLL E;  3LMS A;  5JGF A;  5LYF A;  2AFX A;  5JM6 A;  4TNU A;  5LYL A;  5I4M A;  2ZEF A;  4PXD A;  7CPA A;  4ZY2 A;  1TKF A;  4LQG A;  2XEF A;  2ANP A;  4H2K A;  1Y7E A;  1F2O A;  2V8D A;  2PJ1 A;  2PJ3 A;  4NGS A;  2PE3 A;  1LAM A;  3SJF A;  3WT4 A;  1FNO A;  5K8O A;  6CPA A;  2V77 A;  2NSM A;  2PIY A;  2PCU A;  1TXR A;  3FJU A;  3PBE A;  1LFW A;  3KQZ A;  2EK8 A;  4UIB A;  1CP6 A;  4IHM A;  5ELY A;  4ZY1 A;  4GM5 A;  1Z5R A;  3I1U A;  4NGM A;  3NH8 A;  1TF9 A;  2ZEO A;  1XMB A;  3SI1 A;  5K8P A;  2ABZ A;  3ISZ A;  1R3N A;  5F09 A;  2WZN A;  1OBR A;  3GUX A;  2PJB A;  2PJC A;  2PVW A;  4IK2 A;  4MCP A;  2PRQ A;  1YLO A;  4EME A;  3KHX A;  3FMC A;  1ZG9 A;  3FED A;  2CF4 A;  3PB9 X;  3IEH A;  1YW6 A;  4CPA A;  1Y0Y A;  4UEZ A;  1TKH A;  4A37 A;  4FBE A;  2PJ5 A;  3D7D A;  3D66 A;  2V8V A;  1HDQ A;  3CT9 A;  4B6Z A;  2C6P A;  5THW A;  2C6G A;  3LWU A;  1GYT A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...