4MHYA

Crystal structure of a glutaminyl cyclase from ixodes scapularis in complex with pbd150
Total Genus 109
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
109
sequence length
326
structure length
324
Chain Sequence
b'LKWPRDLRPLAHHDLLYMGQIEDRGDFNATLRNFLVPRVVGSQKHREVREFIVRSLKDLDWDVEEDCFDGQTPHGIKPFCNVIATLNPSACHRLVLACHYDSLLHKEGTFIGATDSAVPCAQLLYLARSLNGKLQNQKTRGDGLTLQLVFFDGEEAFERWSSHDSLYGSRHLAQKWHEDRTSAERLESCLERSEIANQIDRMEVMVLLDLLGAENPRFYSYFGETQPVYRRLVNIESRLNDAGLMELPRRRRRTNYFSNSSTVGFIEDDHIPFLKRSVPIVHIIPSPFPDVWHTLDDNEQNLHHPTISNLNKIFKAFVSEYLQL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Glutaminyl cyclase, putative
publication title Structural and functional analyses of a glutaminyl cyclase from Ixodes scapularis reveal metal-independent catalysis and inhibitor binding.
pubmed doi rcsb
source organism Ixodes scapularis
molecule tags Transferase
total genus 109
structure length 324
sequence length 326
ec nomenclature ec 2.3.2.5: Glutaminyl-peptide cyclotransferase.
pdb deposition date 2013-08-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF04389 Peptidase_M28 Peptidase family M28
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.630.10 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Zn peptidases 4mhyA00
2C6GA 4P4IA 1YW6A 2O53A 2PJAA 1VHOA 4UF4A 3SJXA 3CPXA 1CPSA 1ZLIA 3FECA 2RB7A 4YWYA 3PB6X 1YLOA 5HVFA 4A39A 1XJOA 3KASA 1ELMP 2GREA 3TC8A 2VL1A 1YMEA 3IC1A 4MXUA 4YU9A 4PXDA 4UEEA 1AMPA 2PJ2A 2V77A 4O23A 3VH9A 2AFZA 5LYLA 4H2KA 3B7IA 4OC5A 3PB4X 3T8WA 1RTQA 4P6YA 5HXDA 3GUXA 3ISZA 3FEEA 3B3SA 4MHYA 1ARMA 3D7HA 2XEGA 3V38A 3CPAA 4MHPA 4ZY2A 4NGTA 1ELLP 2CTCA 5K8NA 1BPMA 3PB7X 2ZEOA 4UEFA 3KHXA 3GLJA 2OOTA 4FUUA 3WABA 4MCPA 4OP4A 3D67A 4X8IA 2ZEEA 3IEHA 4NJQA 4ZX9A 2WYRA 1ZG8A 1TKJA 4EMEA 4ZY0A 4X2TA 3BXMA 4ZX8A 1YW4A 3D7FA 1XRYA 1CG2A 3SJEA 5D29A 1BPNA 4WWVA 1Y0RA 1Y0YA 4GM5A 2PJ5A 3S9MA 1HEEA 3IO1A 2NSMA 4P10A 4OC4A 1F2OA 4MRIA 4P4EA 3H8GA 3PB8X 5HVHA 1XMBA 3DLJA 1TF9A 1CP7A 1VHEA 3PBEA 4OC3A 3PFEA 3WC6A 4A94A 2WZNA 4F9UA 4R6TA 4EWTA 3B3CA 5K8PA 4FBEA 2PCUA 4P4BA 2JEWA 3CT9A 4MMOA 3LWUA 5JH9A 3KZWA 3HLPA 5LRGA 2C6CA 1Z8LA 4P4DA 2PJ7A 2HC9A 5LYFA 1OBRA 1GYTA 1F2PA 2ZEHA 1LAPA 2ZENA 2AFMA 3ISXA 3JRUA 4WJBA 2AFWA 3FEDA 3SI2A 3K9TA 2RFHA 3SJGA 3D7DA 3RZAA 3BI1A 3D4UA 3KR4A 3SJFA 3WT4A 5JM6A 1BAVA 3IIBA 4UIAA 2PJ3A 1M4LA 2PJ1A 3NH4A 2QVPA 3BHXA 7CPAA 4Z65A 1PYTB 4K3NA 2C6PA 4TNUA 1EE3P 2PJ4A 4NGMA 4ZI6A 2IJZA 4KSIA 5K8OA 1ZG9A 2QYVA 2XEFA 1HDUA 1ZLHA 2CIJA 5K8MA 4ZYQA 1PCAA 5JGFA 4R76A 2HB6A 1CX8A 4RUHA 3D7GA 2PIYA 3SI0A 5LRJA 3MRUA 1UWYA 1XFOA 5D8NA 1AYEA 2V8GA 4ZY1A 2F7VA 4NGRA 1LOKA 2ZOGA 5THWA 3NH8A 4OIDA 4AXVA 1DE4C 1XBUA 3B2YA 1VIXA 3HUVA 3RBUA 4TWEA 4P4JA 1R3NA 5I4MA 2PIZA 4NGQA 1CP6A 4PQAA 4A37A 4MHNA 3IJ3A 3MN8A 4LQGA 3PEIA 2PJ8A 2O4HA 4UIBA 4IK2A 1Z2LA 4MCRA 1Y7EA 4Q7AA 1NSAA 2QJ8A 3SI1A 4OC0A 3VATA 1HDQA 2ZEDA 3IFEA 5CPAA 1TXRA 1IGBA 3S9LA 3TX8A 4JYWA 4MHZA 2ZEFA 1Q7LA 1VGYA 2GLFA 2IMOA 2Q51A 1CBXA 1H8LA 5DS0A 4PXBA 2PRQA 2PJ9A 1FT7A 3FF3A 1TKHA 3H8FA 1TF8A 3B3TA 4P44A 2J9AA 2BO9A 1QQ9A 4DYOA 2I3CA 3FVLA 3FX6A 2V8HA 3D68A 4IAVA 3KGQA 4MCSA 3KQXA 1R43A 2AFXA 4A38A 5IB9A 3GB0A 4OIWA 2JBJA 2NYQA 2PJ0A 2OR4A 4PXCA 2BOAA 2EWBA 3KQZA 1LANA 8CPAA 3BI0A 1ZG7A 2V8DA 4MCQA 1Z5RA 3K2KA 2EK9A 2ZEPA 4CPAA 5F09A 2F8HA 3H8EA 1YSJA 2XEJA 3B3VA 2AFUA 3PFOA 2GLJA 1BLLE 1LCPA 2Q4ZA 1DTDA 3KR5A 4NGPA 3L2NA 1JQGA 4OKOA 3QNVA 4NFRA 3WC5A 4NGNA 2ANPA 4P4FA 5LRKA 2EK8A 2DEAA 4R7MA 4P45A 3D66A 1ARLA 4BD9A 1CPXA 4ONWA 4W9YA 2G9DA 3B3WA 2JBKA 2V8VA 3RAMA 5ELYA 1LFWA 3CDXA 1QMUA 3KI9A 3PBBA 4OC2A 5LYIA 2FVGA 2PE3A 3KL9A 2POKA 1FNOA 2PVWA 2IQ6A 4X3RA 3FH4A 4B6ZA 2GU2A 2ABZA 3N5FA 2ZOFA 4G1PA 3FJUA 3NA6A 3I1UA 4R8FA 2CTBA 2PJ6A 4EFDA 2ZEGA 4FWUA 1LAMA 5J1QA 4NJRA 4OMEA 2ZEMA 2ZELA 3FMCA 2AFSA 2CF4A 3IWWA 4PPZA 1KWMA 5LYDA 2C1CA 4NGSA 3NH5A 2Q43A 3B35A 3KHZA 1F57A 5CBMA 3V7ZA 4PXEA 2PVVA 2PJCA 3LMSA 3PB9X 3S9NA 2PJBA 4OC1A 1IY7A 3NFZA 5HVGA 4FAIA 6CPAA 2AFOA 2XEIA 3DGVA 4F9VA 3VARA 4DJLA 4DUKA 3PRTA 1TKFA 3WC7A 4F8ZA 2BCOA 4JZ0A 4IHMA 4UEZA
chains in the Genus database with same CATH superfamily
3NE8A 2C6GA 4P4IA 5HMNA 3F0AA 1BO4A 2G3AA 1YW6A 3FBUA 2J8RA 4MI4A 4ZBGA 2O53A 3FRMA 2EO8A 4R9MA 3TFYA 2FIWA 2PJAA 1VHOA 2OH1A 3RYOA 2J8MA 4UF4A 4FD6A 3SJXA 3CPXA 1CM0A 1CPSA 1PUAA 5KTCA 1S5KA 1ZLIA 3FECA 2X7BA 1CJWA 3FNCA 2RB7A 4L8AA 4YWYA 5J8CA 3FXTA 2Z11A 3PB6X 1YLOA 2CNTA 4R3KA 5HVFA 5FVJA 3TT2A 1M4DA 3JVNA 4A39A 1XJOA 3KASA 1ELMP 3TO7A 2GREA 4CRYB 4A30A 3TC8A 2K5TA 1Z4RA 2YGWA 3R95A 2VL1A 1YMEA 3IC1A 4U9ZA 4MXUA 5JQ4A 3G3SA 1XOVA 4KOYA 4YU9A 2J8NA 3GIUA 4PXDA 5AG5A 2GANA 4UEEA 1AMPA 2PJ2A 2V77A 4O23A 2HQYA 1MJ9A 3VH9A 2AFZA 1YVOA 1TIQA 4KVME 2OZUA 5LYLA 4QVTA 3PGPA 4UCPA 4H2KA 2P6FA 3B7IA 3EY5A 5I0CA 5KTDA 4OC5A 3PB4X 3T8WA 3TOAA 3TE4A 2OB0A 4XPLA 1RTQA 1WWZA 3P2FA 4P6YA 3LACA 2Z3LA 4MFPA 5HXDA 3GUXA 3ISZA 1WK4A 3FEEA 2JDCA 3B3SA 2R98A 4B5PB 4MHYA 2ZW5A 3UY5A 5F48A 1LRZA 1ARMA 3D7HA 1IOIA 2XEGA 4I49A 3V38A 3CPAA 4MHPA 4Q36A 4ZY2A 1NE9A 4NGTA 1YLEA 4B10A 1ELLP 1Z9UA 5HH1A 2CTCA 5K8NA 1BPMA 2OU2A 3OWCA 3PB7X 4UWIA 3TTHA 2ZEOA 4UEFA 3KHXA 2B4BA 3EXNA 3GLJA 2OOTA 5BWAB 1I1DA 4FUUA 3WABA 4MCPA 4QB9A 4OP4A 3D67A 3EO4A 1Y9WA 4X8IA 4XPKA 2ZEEA 3IEHA 3QAYA 4NJQA 4ZX9A 2Q7BA 2R7HA 4XNHB 4CGPA 2B5GA 2WYRA 1ZG8A 1TKJA 4AVCA 4EMEA 2ZW7A 1IYKA 4M3SA 4ZY0A 4NSQA 4C2ZA 4X2TA 3BXMA 4ZX8A 1YW4A 4C7HA 5GCNA 3D7FA 1XRYA 1CG2A 1L0CA 4UA3A 3SJEA 5D29A 1BPNA 4WWVA 1Y0RA 4JWPA 1IOFA 2Y0MA 1Y0YA 4GM5A 2PJ5A 2ARHA 2Q44A 2VI7A 4JD6A 2DXQA 2Q7SA 4QC6A 3S9MA 1HEEA 4E8OA 3IU2A 3IO1A 2FIAA 2NSMA 4OADA 5E96A 4YFJA 4P10A 2R1IA 4OC4A 1F2OA 3JUWA 4MRIA 4F6AA 4P4EA 3H8GA 3PB8X 2I00A 3DNSA 5HVHA 3H5ZA 5JPHA 1XMBA 4QUSA 3FIXA 2ZPAA 3DLJA 1S7FA 4AG7A 1TF9A 1CP7A 1M4GA 1QSNA 3CXQA 1VHEA 3PBEA 4OC3A 3PFEA 3ZJ0A 3WC6A 4KORA 4A94A 4GS4A 3D3SA 4Q38A 1MJAA 3EC4A 2WZNA 3R9EA 4F9UA 2Q0YA 5C88A 4R6TA 4EWTA 1YVKA 1X10A 3B3CA 3PP9A 4A2ZA 4M6GA 1PU9A 5K8PA 3P2HA 4FBEA 2REEA 1QSTA 4CYPA 2P0WA 2PCUA 4MHDA 4P4BA 4DNCA 2JEWA 3CT9A 4MMOA 1A2ZA 1S7KA 4AB7A 3LWUA 2OZHA 5JH9A 3CZXA 3KZWA 4ONUA 3HLPA 2JDDA 5LRGA 2DF5A 2C6CA 4XNHC 5F49A 1K4JA 1Z8LA 3D2MA 1MK4A 3IU1A 4PV6A 4P4DA 2PJ7A 2HC9A 4A95A 5LYFA 5A28A 1M44A 1OBRA 3T9YA 1GYTA 1F2PA 2ZEHA 1V0CA 1M1DA 2FL4A 4KOSA 1LAPA 4KOUA 2ZENA 1S7NA 3B8GA 4U5YA 2AFMA 3E0KA 3ISXA 3JRUA 4UFXA 4RN7A 4WJBA 2VZYA 2AFWA 2YNEA 2RC4A 3TCVA 3FEDA 3SI2A 3K9TA 2RFHA 1Z4EA 3D7DA 3SJGA 5F46A 2P6GA 3RZAA 3BI1A 2A4NA 2WPWA 3D4UA 3KR4A 3SJFA 4KOXA 3WT4A 5JM6A 3TO9A 1BAVA 2B3UA 3IIBA 4UIAA 2ZW6A 3W6XA 4M85A 2PJ3A 4II9A 4MFLA 4GXHA 4PK3A 3R96A 1M4LA 1KZFA 2EBJA 2PJ1A 3NH4A 2QVPA 3BHXA 7CPAA 4JXQA 4Z65A 3QB8A 4KZTA 1PYTB 4K3NA 3WR7A 2C6PA 4C68A 4E0AA 3DR6A 4KSFA 5DWNA 1NMTA 2ODFA 4UFWA 3CXSA 4TNUA 2B58A 1EE3P 2PJ4A 3JTKA 4NGMA 2IJZA 4ZI6A 4BINA 4KSIA 3ZZIA 1ZG9A 4H6ZA 3SHPA 5K8OA 2QYVA 2XEFA 1BOBA 3VWEA 1HDUA 1ZLHA 2CIJA 4M6HA 5K8MA 4ZGYB 1UFHA 2JEVA 3S6HA 2DPTA 4ZYQA 1PCAA 1MJBA 4CAWA 5JGFA 1AUGA 4R76A 2HB6A 1CX8A 3R9GA 4RUHA 3D7GA 2PIYA 4R87A 2G0BA 5IX3A 1M4IA 1S3ZA 2YNCA 3BLNA 4M6IA 3SI0A 3R1KA 5CNPA 5LRJA 5AG4A 3MRUA 1UWYA 1IIDA 3S6GA 1XFOA 5H86A 5D8NA 4E2AA 1AYEA 2V8GA 1KUXA 2GFQA 1N71A 4ZY1A 2VEZA 4H6UA 3DSBA 2F7VA 3CXPA 4NGRA 4H89A 1LOKA 2ZOGA 5A27A 5THWA 3NH8A 4OIDA 4UFVA 4AXVA 1DE4C 1IYLA 4KLWA 5AGEA 1XBUA 4K30A 3B2YA 1VIXA 3HUVA 4LQ6A 3RBUA 2NMTA 4TWEA 4P4JA 1R3NA 4KUBA 4CGOA 1Q2CA 5I4MA 2PIZA 4NGQA 1CP6A 4PQAA 1Y9KA 4A37A 2Z0ZA 3FB3A 4XPDB 4MHNA 3IJ3A 1XE4A 3KKWA 4YRHA 3MN8A 4LQGA 3PEIA 2BL1A 1XIXA 3G8WA 2PJ8A 2O4HA 4MY3A 2H5MA 4UIBA 4IK2A 1Z2LA 4MCRA 1Y7EA 4Q7AA 1RXTA 4U9YA 1NSAA 2QJ8A 3SI1A 4OC0A 3VATA 1HDQA 2ZEDA 3IFEA 5CPAA 1TXRA 4HNYB 4AVAA 5EC4A 1IGBA 5KTAA 4F0YA 3S9LA 3TX8A 3RNZA 1XF8A 4JYWA 4MHZA 2ZEFA 4PSXA 4A33A 1Q7LA 2B4DA 2FSRA 1YGHA 1VGYA 2GLFA 3BJ7A 2IMOA 5G20A 2ZW4A 1P4NA 2Q51A 1QSMA 3W91A 1CBXA 1KUVA 1H8LA 2AJ6A 3SXNA 3IWGA 5IB0A 5DS0A 4PXBA 3N7ZA 2PRQA 2PJ9A 2R8VA 2WPXA 1FT7A 1P0HA 3FYNA 3FF3A 1TKHA 3H8FA 1TF8A 3B3TA 4KVXA 4P44A 1Q2DA 1S7LA 4BMHA 4CYQA 2D4OA 5EBVA 2J9AA 2BO9A 1QQ9A 2G3TA 4KOVA 4DYOA 2I3CA 3BJ8A 3FVLA 4B13A 1B87A 1B6BA 1FY7A 2V8HA 2VXKA 3FX6A 3I9SA 4NCZA 4OAEA 4FD4A 4B5PA 2CNMA 3D68A 1GHEA 4IAVA 3KGQA 4MCSA 2WUUA 1I21A 3KQXA 4CYOA 1IB1E 2BEIA 1R43A 3DDDA 2AFXA 4RI1A 5H84A 4A38A 1KUYA 4MFQA 4HKFA 2Z3OA 3PZJA 3V8IA 4XPDC 3GB0A 4CRZB 5IB9A 4OIWA 3NE7A 1Z8TA 2JBJA 2NYQA 2P6EA 2PJ0A 2FCKA 3TO6A 2OR4A 4A31A 4PXCA 3T90A 4CAVA 4CGLA 2QIRA 2BOAA 1NSLA 1Z8XA 4CS0B 2EWBA 3KQZA 2Z3MA 1LANA 4HNWB 8CPAA 2B5GB 1ZG7A 2CNSA 2FT0A 2PSWA 3BI0A 2V8DA 4MCQA 1Z5RA 3K2KA 2EK9A 4L89A 5DWMA 2GE3A 2IL4A 1X12A 2ZEPA 4CPAA 5F09A 4J3GA 2F8HA 3H8EA 2C27A 2Z3PA 2PDOA 3GY9A 4C7IA 4CGNA 1YSJA 4MJ8A 2QECA 4AG9A 2XEJA 3B3VA 5J8FA 4KSAA 2AFUA 2VBQA 5G1ZA 2B3VA 2F5IA 1ZO0A 3PFOA 2GLJA 1BLLE 2I79A 2D4PA 1LCPA 4UCMA 1R57A 2Q4ZA 1DTDA 1YQEA 4B12A 3KR5A 4NGPA 2ATRA 2GIVA 4JLYA 2KCWA 4KOWA 3L2NA 1JQGA 4OKOA 3QNVA 4NFRA 4UCNA 4RS2A 2REFA 3VWDA 2B4DB 3WC5A 4B14A 4NGNA 2ZXVA 4Y49B 2ANPA 4IUSA 4P4FA 5LRKA 2EK8A 5G22A 4QBJA 2DEAA 4R7MA 2YNCC 4P45A 3D66A 3S6KA 1ARLA 4FD7A 4R3LA 1VKCA 3DR8A 1YX0A 3GKRA 4PK2A 4AVBA 4BD9A 4MFZA 4MY0A 5IV0A 1CPXA 3GYAA 3D2PA 4ONWA 5EMIA 4W9YA 2G9DA 3B3WA 2JBKA 2V8VA 3RO0A 3W6SA 3RAMA 3I3GA 5ELYA 1LFWA 3CDXA 3C26A 2FXFA 4FD5A 1QMUA 2PR1A 3F5BA 3KI9A 3PBBA 2DPSA 4OC2A 5LYIA 1XEBA 2FVGA 5F47A 5AG7A 2FS5A 2PE3A 3KL9A 2POKA 1FNOA 1QSRA 2PVWA 4BBHA 4CAFA 4C2XA 4OLLA 2IQ6A 4X3RA 2Q4YA 3FH4A 4B6ZA 4ORFA 4CAEA 2GU2A 2OZGA 2ABZA 3N5FA 4LX9A 2ZOFA 4G1PA 3FJUA 4LUAA 1ON0A 1XMTA 2PC1A 4JXRA 1J4JA 4NF1A 3NA6A 5C82A 4UBRA 3I1UA 2EUIA 4R8FA 2PQ8A 2CTBA 5AG6A 2PJ6A 4CGMA 4EFDA 3F8KA 2ZEGA 4FWUA 4EVYA 4NXYA 3QAHA 4KS9A 4PSWA 1LAMA 2CY2A 2HV2A 4A32A 5J1QA 1Q2YA 2JLMA 4YGOA 5G21A 4NJRA 4OMEA 2ZEMA 3A9LA 4F0XA 2AE6A 2ZELA 4IF5A 2CXAA 3FMCA 2Q04A 2AFSA 2CF4A 2PR8A 3IWWA 4PPZA 3EFAA 1KWMA 4MBUA 1YREA 5LYDA 4Y49C 1Z8WA 2C1CA 3IWEA 4NGSA 1IU8A 3NH5A 2Q43A 1I12A 3TOBA 1QSOA 1S60A 2YNDA 1Y7RA 3B35A 4NEXA 2FE7A 4B5OA 3KHZA 3IGRA 2WSAA 4KLVA 1F57A 1VHSA 4CYNA 4KVOE 4MFKA 2HUZA 5CBMA 2BUEA 3S6FA 1YK3A 4PXEA 2PVVA 3V7ZA 2Q4VA 4B11A 2PJCA 2PRBA 3LODA 3LMSA 1RO5A 3PB9X 2PJBA 4UWJA 2Z3KA 3S9NA 4OC1A 1IY7A 1U6MA 3NFZA 1YR0A 4JJXA 4CAXA 5HVGA 4R57A 2O28A 1JWQA 4FAIA 3SXOA 1SQHA 6CPAA 3MGDA 2AFOA 2Z10A 2XEIA 2BSWA 3DGVA 3R9FA 2VQYA 3K9UA 4C2YA 4F9VA 3LD2A 3VARA 4KUAA 1IICA 4MFJA 4X5KA 4DJLA 3H4QA 4DUKA 3PRTA 2Z3NA 1TKFA 4HPSA 3WC7A 4F8ZA 4KOTA 1OZPA 5ISVA 2EVNA 2BCOA 2VZZA 4JZ0A 4IHMA 4UEZA 3D8PA 2QMLA 4HNXB
chains in the Genus database with same CATH topology
2C6GA 4P4IA 1YW6A 2O53A 2PJAA 1VHOA 4UF4A 3SJXA 3CPXA 1CPSA 1ZLIA 3FECA 2RB7A 4YWYA 3PB6X 1YLOA 5HVFA 4A39A 1XJOA 3KASA 1ELMP 2GREA 3TC8A 2VL1A 1YMEA 3IC1A 4MXUA 4YU9A 4PXDA 4UEEA 1AMPA 2PJ2A 2V77A 4O23A 3VH9A 2AFZA 5LYLA 4H2KA 3B7IA 4OC5A 3PB4X 3T8WA 1RTQA 4P6YA 5HXDA 3GUXA 3ISZA 3FEEA 3B3SA 4MHYA 1ARMA 3D7HA 2XEGA 3V38A 3CPAA 4MHPA 4ZY2A 4NGTA 1ELLP 2CTCA 5K8NA 1BPMA 3PB7X 2ZEOA 4UEFA 3KHXA 3GLJA 2OOTA 4FUUA 3WABA 4MCPA 4OP4A 3D67A 4X8IA 2ZEEA 3IEHA 4NJQA 4ZX9A 2WYRA 1ZG8A 1TKJA 4EMEA 4ZY0A 4X2TA 3BXMA 4ZX8A 1YW4A 3D7FA 1XRYA 1CG2A 3SJEA 5D29A 1BPNA 4WWVA 1Y0RA 1Y0YA 4GM5A 2PJ5A 3S9MA 1HEEA 3IO1A 2NSMA 4P10A 4OC4A 1F2OA 4MRIA 4P4EA 3H8GA 3PB8X 5HVHA 1XMBA 3DLJA 1TF9A 1CP7A 1VHEA 3PBEA 4OC3A 3PFEA 3WC6A 4A94A 2WZNA 4F9UA 4R6TA 4EWTA 3B3CA 5K8PA 4FBEA 2PCUA 4P4BA 2JEWA 3CT9A 4MMOA 3LWUA 5JH9A 3KZWA 3HLPA 5LRGA 2C6CA 1Z8LA 4P4DA 2PJ7A 2HC9A 5LYFA 1OBRA 1GYTA 1F2PA 2ZEHA 1LAPA 2ZENA 2AFMA 3ISXA 3JRUA 4WJBA 2AFWA 3FEDA 3SI2A 3K9TA 2RFHA 3SJGA 3D7DA 3RZAA 3BI1A 3D4UA 3KR4A 3SJFA 3WT4A 5JM6A 1BAVA 3IIBA 4UIAA 2PJ3A 1M4LA 2PJ1A 3NH4A 2QVPA 3BHXA 7CPAA 4Z65A 1PYTB 4K3NA 2C6PA 4TNUA 1EE3P 2PJ4A 4NGMA 4ZI6A 2IJZA 4KSIA 5K8OA 1ZG9A 2QYVA 2XEFA 1HDUA 1ZLHA 2CIJA 5K8MA 4ZYQA 1PCAA 5JGFA 4R76A 2HB6A 1CX8A 4RUHA 3D7GA 2PIYA 3SI0A 5LRJA 3MRUA 1UWYA 1XFOA 5D8NA 1AYEA 2V8GA 4ZY1A 2F7VA 4NGRA 1LOKA 2ZOGA 5THWA 3NH8A 4OIDA 4AXVA 1DE4C 1XBUA 3B2YA 1VIXA 3HUVA 3RBUA 4TWEA 4P4JA 1R3NA 5I4MA 2PIZA 4NGQA 1CP6A 4PQAA 4A37A 4MHNA 3IJ3A 3MN8A 4LQGA 3PEIA 2PJ8A 2O4HA 4UIBA 4IK2A 1Z2LA 4MCRA 1Y7EA 4Q7AA 1NSAA 2QJ8A 3SI1A 4OC0A 3VATA 1HDQA 2ZEDA 3IFEA 5CPAA 1TXRA 1IGBA 3S9LA 3TX8A 4JYWA 4MHZA 2ZEFA 1Q7LA 1VGYA 2GLFA 2IMOA 2Q51A 1CBXA 1H8LA 5DS0A 4PXBA 2PRQA 2PJ9A 1FT7A 3FF3A 1TKHA 3H8FA 1TF8A 3B3TA 4P44A 2J9AA 2BO9A 1QQ9A 4DYOA 2I3CA 3FVLA 3FX6A 2V8HA 3D68A 4IAVA 3KGQA 4MCSA 3KQXA 1R43A 2AFXA 4A38A 5IB9A 3GB0A 4OIWA 2JBJA 2NYQA 2PJ0A 2OR4A 4PXCA 2BOAA 2EWBA 3KQZA 1LANA 8CPAA 3BI0A 1ZG7A 2V8DA 4MCQA 1Z5RA 3K2KA 2EK9A 2ZEPA 4CPAA 5F09A 2F8HA 3H8EA 1YSJA 2XEJA 3B3VA 2AFUA 3PFOA 2GLJA 1BLLE 1LCPA 2Q4ZA 1DTDA 3KR5A 4NGPA 3L2NA 1JQGA 4OKOA 3QNVA 4NFRA 3WC5A 4NGNA 2ANPA 4P4FA 5LRKA 2EK8A 2DEAA 4R7MA 4P45A 3D66A 1ARLA 4BD9A 1CPXA 4ONWA 4W9YA 2G9DA 3B3WA 2JBKA 2V8VA 3RAMA 5ELYA 1LFWA 3CDXA 1QMUA 3KI9A 3PBBA 4OC2A 5LYIA 2FVGA 2PE3A 3KL9A 2POKA 1FNOA 2PVWA 2IQ6A 4X3RA 3FH4A 4B6ZA 2GU2A 2ABZA 3N5FA 2ZOFA 4G1PA 3FJUA 3NA6A 3I1UA 4R8FA 2CTBA 2PJ6A 4EFDA 2ZEGA 4FWUA 1LAMA 5J1QA 4NJRA 4OMEA 2ZEMA 2ZELA 3FMCA 2AFSA 2CF4A 3IWWA 4PPZA 1KWMA 5LYDA 2C1CA 4NGSA 3NH5A 2Q43A 3B35A 3KHZA 1F57A 5CBMA 3V7ZA 4PXEA 2PVVA 2PJCA 3LMSA 3PB9X 3S9NA 2PJBA 4OC1A 1IY7A 3NFZA 5HVGA 4FAIA 6CPAA 2AFOA 2XEIA 3DGVA 4F9VA 3VARA 4DJLA 4DUKA 3PRTA 1TKFA 3WC7A 4F8ZA 2BCOA 4JZ0A 4IHMA 4UEZA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2C6G A;  4P4I A;  1YW6 A;  2O53 A;  2PJA A;  1VHO A;  4UF4 A;  3SJX A;  3CPX A;  1CPS A;  1ZLI A;  3FEC A;  2RB7 A;  4YWY A;  3PB6 X;  1YLO A;  5HVF A;  4A39 A;  1XJO A;  3KAS A;  1ELM P;  2GRE A;  3TC8 A;  2VL1 A;  1YME A;  3IC1 A;  4MXU A;  4YU9 A;  4PXD A;  4UEE A;  1AMP A;  2PJ2 A;  2V77 A;  4O23 A;  3VH9 A;  2AFZ A;  5LYL A;  4H2K A;  3B7I A;  4OC5 A;  3PB4 X;  3T8W A;  1RTQ A;  4P6Y A;  5HXD A;  3GUX A;  3ISZ A;  3FEE A;  3B3S A;  4MHY A;  1ARM A;  3D7H A;  2XEG A;  3V38 A;  3CPA A;  4MHP A;  4ZY2 A;  4NGT A;  1ELL P;  2CTC A;  5K8N A;  1BPM A;  3PB7 X;  2ZEO A;  4UEF A;  3KHX A;  3GLJ A;  2OOT A;  4FUU A;  3WAB A;  4MCP A;  4OP4 A;  3D67 A;  4X8I A;  2ZEE A;  3IEH A;  4NJQ A;  4ZX9 A;  2WYR A;  1ZG8 A;  1TKJ A;  4EME A;  4ZY0 A;  4X2T A;  3BXM A;  4ZX8 A;  1YW4 A;  3D7F A;  1XRY A;  1CG2 A;  3SJE A;  5D29 A;  1BPN A;  4WWV A;  1Y0R A;  1Y0Y A;  4GM5 A;  2PJ5 A;  3S9M A;  1HEE A;  3IO1 A;  2NSM A;  4P10 A;  4OC4 A;  1F2O A;  4MRI A;  4P4E A;  3H8G A;  3PB8 X;  5HVH A;  1XMB A;  3DLJ A;  1TF9 A;  1CP7 A;  1VHE A;  3PBE A;  4OC3 A;  3PFE A;  3WC6 A;  4A94 A;  2WZN A;  4F9U A;  4R6T A;  4EWT A;  3B3C A;  5K8P A;  4FBE A;  2PCU A;  4P4B A;  2JEW A;  3CT9 A;  4MMO A;  3LWU A;  5JH9 A;  3KZW A;  3HLP A;  5LRG A;  2C6C A;  1Z8L A;  4P4D A;  2PJ7 A;  2HC9 A;  5LYF A;  1OBR A;  1GYT A;  1F2P A;  2ZEH A;  1LAP A;  2ZEN A;  2AFM A;  3ISX A;  3JRU A;  4WJB A;  2AFW A;  3FED A;  3SI2 A;  3K9T A;  2RFH A;  3SJG A;  3D7D A;  3RZA A;  3BI1 A;  3D4U A;  3KR4 A;  3SJF A;  3WT4 A;  5JM6 A;  1BAV A;  3IIB A;  4UIA A;  2PJ3 A;  1M4L A;  2PJ1 A;  3NH4 A;  2QVP A;  3BHX A;  7CPA A;  4Z65 A;  1PYT B;  4K3N A;  2C6P A;  4TNU A;  1EE3 P;  2PJ4 A;  4NGM A;  4ZI6 A;  2IJZ A;  4KSI A;  5K8O A;  1ZG9 A;  2QYV A;  2XEF A;  1HDU A;  1ZLH A;  2CIJ A;  5K8M A;  4ZYQ A;  1PCA A;  5JGF A;  4R76 A;  2HB6 A;  1CX8 A;  4RUH A;  3D7G A;  2PIY A;  3SI0 A;  5LRJ A;  3MRU A;  1UWY A;  1XFO A;  5D8N A;  1AYE A;  2V8G A;  4ZY1 A;  2F7V A;  4NGR A;  1LOK A;  2ZOG A;  5THW A;  3NH8 A;  4OID A;  4AXV A;  1DE4 C;  1XBU A;  3B2Y A;  1VIX A;  3HUV A;  3RBU A;  4TWE A;  4P4J A;  1R3N A;  5I4M A;  2PIZ A;  4NGQ A;  1CP6 A;  4PQA A;  4A37 A;  4MHN A;  3IJ3 A;  3MN8 A;  4LQG A;  3PEI A;  2PJ8 A;  2O4H A;  4UIB A;  4IK2 A;  1Z2L A;  4MCR A;  1Y7E A;  4Q7A A;  1NSA A;  2QJ8 A;  3SI1 A;  4OC0 A;  3VAT A;  1HDQ A;  2ZED A;  3IFE A;  5CPA A;  1TXR A;  1IGB A;  3S9L A;  3TX8 A;  4JYW A;  4MHZ A;  2ZEF A;  1Q7L A;  1VGY A;  2GLF A;  2IMO A;  2Q51 A;  1CBX A;  1H8L A;  5DS0 A;  4PXB A;  2PRQ A;  2PJ9 A;  1FT7 A;  3FF3 A;  1TKH A;  3H8F A;  1TF8 A;  3B3T A;  4P44 A;  2J9A A;  2BO9 A;  1QQ9 A;  4DYO A;  2I3C A;  3FVL A;  3FX6 A;  2V8H A;  3D68 A;  4IAV A;  3KGQ A;  4MCS A;  3KQX A;  1R43 A;  2AFX A;  4A38 A;  5IB9 A;  3GB0 A;  4OIW A;  2JBJ A;  2NYQ A;  2PJ0 A;  2OR4 A;  4PXC A;  2BOA A;  2EWB A;  3KQZ A;  1LAN A;  8CPA A;  3BI0 A;  1ZG7 A;  2V8D A;  4MCQ A;  1Z5R A;  3K2K A;  2EK9 A;  2ZEP A;  4CPA A;  5F09 A;  2F8H A;  3H8E A;  1YSJ A;  2XEJ A;  3B3V A;  2AFU A;  3PFO A;  2GLJ A;  1BLL E;  1LCP A;  2Q4Z A;  1DTD A;  3KR5 A;  4NGP A;  3L2N A;  1JQG A;  4OKO A;  3QNV A;  4NFR A;  3WC5 A;  4NGN A;  2ANP A;  4P4F A;  5LRK A;  2EK8 A;  2DEA A;  4R7M A;  4P45 A;  3D66 A;  1ARL A;  4BD9 A;  1CPX A;  4ONW A;  4W9Y A;  2G9D A;  3B3W A;  2JBK A;  2V8V A;  3RAM A;  5ELY A;  1LFW A;  3CDX A;  1QMU A;  3KI9 A;  3PBB A;  4OC2 A;  5LYI A;  2FVG A;  2PE3 A;  3KL9 A;  2POK A;  1FNO A;  2PVW A;  2IQ6 A;  4X3R A;  3FH4 A;  4B6Z A;  2GU2 A;  2ABZ A;  3N5F A;  2ZOF A;  4G1P A;  3FJU A;  3NA6 A;  3I1U A;  4R8F A;  2CTB A;  2PJ6 A;  4EFD A;  2ZEG A;  4FWU A;  1LAM A;  5J1Q A;  4NJR A;  4OME A;  2ZEM A;  2ZEL A;  3FMC A;  2AFS A;  2CF4 A;  3IWW A;  4PPZ A;  1KWM A;  5LYD A;  2C1C A;  4NGS A;  3NH5 A;  2Q43 A;  3B35 A;  3KHZ A;  1F57 A;  5CBM A;  3V7Z A;  4PXE A;  2PVV A;  2PJC A;  3LMS A;  3PB9 X;  3S9N A;  2PJB A;  4OC1 A;  1IY7 A;  3NFZ A;  5HVG A;  4FAI A;  6CPA A;  2AFO A;  2XEI A;  3DGV A;  4F9V A;  3VAR A;  4DJL A;  4DUK A;  3PRT A;  1TKF A;  3WC7 A;  4F8Z A;  2BCO A;  4JZ0 A;  4IHM A;  4UEZ A; 
#chains in the Genus database with same CATH topology
 3NE8 A;  2C6G A;  4P4I A;  5HMN A;  3F0A A;  1BO4 A;  2G3A A;  1YW6 A;  3FBU A;  2J8R A;  4MI4 A;  4ZBG A;  2O53 A;  3FRM A;  2EO8 A;  4R9M A;  3TFY A;  2FIW A;  2PJA A;  1VHO A;  2OH1 A;  3RYO A;  2J8M A;  4UF4 A;  4FD6 A;  3SJX A;  3CPX A;  1CM0 A;  1CPS A;  1PUA A;  5KTC A;  1S5K A;  1ZLI A;  3FEC A;  2X7B A;  1CJW A;  3FNC A;  2RB7 A;  4L8A A;  4YWY A;  5J8C A;  3FXT A;  2Z11 A;  3PB6 X;  1YLO A;  2CNT A;  4R3K A;  5HVF A;  5FVJ A;  3TT2 A;  1M4D A;  3JVN A;  4A39 A;  1XJO A;  3KAS A;  1ELM P;  3TO7 A;  2GRE A;  4CRY B;  4A30 A;  3TC8 A;  2K5T A;  1Z4R A;  2YGW A;  3R95 A;  2VL1 A;  1YME A;  3IC1 A;  4U9Z A;  4MXU A;  5JQ4 A;  3G3S A;  1XOV A;  4KOY A;  4YU9 A;  2J8N A;  3GIU A;  4PXD A;  5AG5 A;  2GAN A;  4UEE A;  1AMP A;  2PJ2 A;  2V77 A;  4O23 A;  2HQY A;  1MJ9 A;  3VH9 A;  2AFZ A;  1YVO A;  1TIQ A;  4KVM E;  2OZU A;  5LYL A;  4QVT A;  3PGP A;  4UCP A;  4H2K A;  2P6F A;  3B7I A;  3EY5 A;  5I0C A;  5KTD A;  4OC5 A;  3PB4 X;  3T8W A;  3TOA A;  3TE4 A;  2OB0 A;  4XPL A;  1RTQ A;  1WWZ A;  3P2F A;  4P6Y A;  3LAC A;  2Z3L A;  4MFP A;  5HXD A;  3GUX A;  3ISZ A;  1WK4 A;  3FEE A;  2JDC A;  3B3S A;  2R98 A;  4B5P B;  4MHY A;  2ZW5 A;  3UY5 A;  5F48 A;  1LRZ A;  1ARM A;  3D7H A;  1IOI A;  2XEG A;  4I49 A;  3V38 A;  3CPA A;  4MHP A;  4Q36 A;  4ZY2 A;  1NE9 A;  4NGT A;  1YLE A;  4B10 A;  1ELL P;  1Z9U A;  5HH1 A;  2CTC A;  5K8N A;  1BPM A;  2OU2 A;  3OWC A;  3PB7 X;  4UWI A;  3TTH A;  2ZEO A;  4UEF A;  3KHX A;  2B4B A;  3EXN A;  3GLJ A;  2OOT A;  5BWA B;  1I1D A;  4FUU A;  3WAB A;  4MCP A;  4QB9 A;  4OP4 A;  3D67 A;  3EO4 A;  1Y9W A;  4X8I A;  4XPK A;  2ZEE A;  3IEH A;  3QAY A;  4NJQ A;  4ZX9 A;  2Q7B A;  2R7H A;  4XNH B;  4CGP A;  2B5G A;  2WYR A;  1ZG8 A;  1TKJ A;  4AVC A;  4EME A;  2ZW7 A;  1IYK A;  4M3S A;  4ZY0 A;  4NSQ A;  4C2Z A;  4X2T A;  3BXM A;  4ZX8 A;  1YW4 A;  4C7H A;  5GCN A;  3D7F A;  1XRY A;  1CG2 A;  1L0C A;  4UA3 A;  3SJE A;  5D29 A;  1BPN A;  4WWV A;  1Y0R A;  4JWP A;  1IOF A;  2Y0M A;  1Y0Y A;  4GM5 A;  2PJ5 A;  2ARH A;  2Q44 A;  2VI7 A;  4JD6 A;  2DXQ A;  2Q7S A;  4QC6 A;  3S9M A;  1HEE A;  4E8O A;  3IU2 A;  3IO1 A;  2FIA A;  2NSM A;  4OAD A;  5E96 A;  4YFJ A;  4P10 A;  2R1I A;  4OC4 A;  1F2O A;  3JUW A;  4MRI A;  4F6A A;  4P4E A;  3H8G A;  3PB8 X;  2I00 A;  3DNS A;  5HVH A;  3H5Z A;  5JPH A;  1XMB A;  4QUS A;  3FIX A;  2ZPA A;  3DLJ A;  1S7F A;  4AG7 A;  1TF9 A;  1CP7 A;  1M4G A;  1QSN A;  3CXQ A;  1VHE A;  3PBE A;  4OC3 A;  3PFE A;  3ZJ0 A;  3WC6 A;  4KOR A;  4A94 A;  4GS4 A;  3D3S A;  4Q38 A;  1MJA A;  3EC4 A;  2WZN A;  3R9E A;  4F9U A;  2Q0Y A;  5C88 A;  4R6T A;  4EWT A;  1YVK A;  1X10 A;  3B3C A;  3PP9 A;  4A2Z A;  4M6G A;  1PU9 A;  5K8P A;  3P2H A;  4FBE A;  2REE A;  1QST A;  4CYP A;  2P0W A;  2PCU A;  4MHD A;  4P4B A;  4DNC A;  2JEW A;  3CT9 A;  4MMO A;  1A2Z A;  1S7K A;  4AB7 A;  3LWU A;  2OZH A;  5JH9 A;  3CZX A;  3KZW A;  4ONU A;  3HLP A;  2JDD A;  5LRG A;  2DF5 A;  2C6C A;  4XNH C;  5F49 A;  1K4J A;  1Z8L A;  3D2M A;  1MK4 A;  3IU1 A;  4PV6 A;  4P4D A;  2PJ7 A;  2HC9 A;  4A95 A;  5LYF A;  5A28 A;  1M44 A;  1OBR A;  3T9Y A;  1GYT A;  1F2P A;  2ZEH A;  1V0C A;  1M1D A;  2FL4 A;  4KOS A;  1LAP A;  4KOU A;  2ZEN A;  1S7N A;  3B8G A;  4U5Y A;  2AFM A;  3E0K A;  3ISX A;  3JRU A;  4UFX A;  4RN7 A;  4WJB A;  2VZY A;  2AFW A;  2YNE A;  2RC4 A;  3TCV A;  3FED A;  3SI2 A;  3K9T A;  2RFH A;  1Z4E A;  3D7D A;  3SJG A;  5F46 A;  2P6G A;  3RZA A;  3BI1 A;  2A4N A;  2WPW A;  3D4U A;  3KR4 A;  3SJF A;  4KOX A;  3WT4 A;  5JM6 A;  3TO9 A;  1BAV A;  2B3U A;  3IIB A;  4UIA A;  2ZW6 A;  3W6X A;  4M85 A;  2PJ3 A;  4II9 A;  4MFL A;  4GXH A;  4PK3 A;  3R96 A;  1M4L A;  1KZF A;  2EBJ A;  2PJ1 A;  3NH4 A;  2QVP A;  3BHX A;  7CPA A;  4JXQ A;  4Z65 A;  3QB8 A;  4KZT A;  1PYT B;  4K3N A;  3WR7 A;  2C6P A;  4C68 A;  4E0A A;  3DR6 A;  4KSF A;  5DWN A;  1NMT A;  2ODF A;  4UFW A;  3CXS A;  4TNU A;  2B58 A;  1EE3 P;  2PJ4 A;  3JTK A;  4NGM A;  2IJZ A;  4ZI6 A;  4BIN A;  4KSI A;  3ZZI A;  1ZG9 A;  4H6Z A;  3SHP A;  5K8O A;  2QYV A;  2XEF A;  1BOB A;  3VWE A;  1HDU A;  1ZLH A;  2CIJ A;  4M6H A;  5K8M A;  4ZGY B;  1UFH A;  2JEV A;  3S6H A;  2DPT A;  4ZYQ A;  1PCA A;  1MJB A;  4CAW A;  5JGF A;  1AUG A;  4R76 A;  2HB6 A;  1CX8 A;  3R9G A;  4RUH A;  3D7G A;  2PIY A;  4R87 A;  2G0B A;  5IX3 A;  1M4I A;  1S3Z A;  2YNC A;  3BLN A;  4M6I A;  3SI0 A;  3R1K A;  5CNP A;  5LRJ A;  5AG4 A;  3MRU A;  1UWY A;  1IID A;  3S6G A;  1XFO A;  5H86 A;  5D8N A;  4E2A A;  1AYE A;  2V8G A;  1KUX A;  2GFQ A;  1N71 A;  4ZY1 A;  2VEZ A;  4H6U A;  3DSB A;  2F7V A;  3CXP A;  4NGR A;  4H89 A;  1LOK A;  2ZOG A;  5A27 A;  5THW A;  3NH8 A;  4OID A;  4UFV A;  4AXV A;  1DE4 C;  1IYL A;  4KLW A;  5AGE A;  1XBU A;  4K30 A;  3B2Y A;  1VIX A;  3HUV A;  4LQ6 A;  3RBU A;  2NMT A;  4TWE A;  4P4J A;  1R3N A;  4KUB A;  4CGO A;  1Q2C A;  5I4M A;  2PIZ A;  4NGQ A;  1CP6 A;  4PQA A;  1Y9K A;  4A37 A;  2Z0Z A;  3FB3 A;  4XPD B;  4MHN A;  3IJ3 A;  1XE4 A;  3KKW A;  4YRH A;  3MN8 A;  4LQG A;  3PEI A;  2BL1 A;  1XIX A;  3G8W A;  2PJ8 A;  2O4H A;  4MY3 A;  2H5M A;  4UIB A;  4IK2 A;  1Z2L A;  4MCR A;  1Y7E A;  4Q7A A;  1RXT A;  4U9Y A;  1NSA A;  2QJ8 A;  3SI1 A;  4OC0 A;  3VAT A;  1HDQ A;  2ZED A;  3IFE A;  5CPA A;  1TXR A;  4HNY B;  4AVA A;  5EC4 A;  1IGB A;  5KTA A;  4F0Y A;  3S9L A;  3TX8 A;  3RNZ A;  1XF8 A;  4JYW A;  4MHZ A;  2ZEF A;  4PSX A;  4A33 A;  1Q7L A;  2B4D A;  2FSR A;  1YGH A;  1VGY A;  2GLF A;  3BJ7 A;  2IMO A;  5G20 A;  2ZW4 A;  1P4N A;  2Q51 A;  1QSM A;  3W91 A;  1CBX A;  1KUV A;  1H8L A;  2AJ6 A;  3SXN A;  3IWG A;  5IB0 A;  5DS0 A;  4PXB A;  3N7Z A;  2PRQ A;  2PJ9 A;  2R8V A;  2WPX A;  1FT7 A;  1P0H A;  3FYN A;  3FF3 A;  1TKH A;  3H8F A;  1TF8 A;  3B3T A;  4KVX A;  4P44 A;  1Q2D A;  1S7L A;  4BMH A;  4CYQ A;  2D4O A;  5EBV A;  2J9A A;  2BO9 A;  1QQ9 A;  2G3T A;  4KOV A;  4DYO A;  2I3C A;  3BJ8 A;  3FVL A;  4B13 A;  1B87 A;  1B6B A;  1FY7 A;  2V8H A;  2VXK A;  3FX6 A;  3I9S A;  4NCZ A;  4OAE A;  4FD4 A;  4B5P A;  2CNM A;  3D68 A;  1GHE A;  4IAV A;  3KGQ A;  4MCS A;  2WUU A;  1I21 A;  3KQX A;  4CYO A;  1IB1 E;  2BEI A;  1R43 A;  3DDD A;  2AFX A;  4RI1 A;  5H84 A;  4A38 A;  1KUY A;  4MFQ A;  4HKF A;  2Z3O A;  3PZJ A;  3V8I A;  4XPD C;  3GB0 A;  4CRZ B;  5IB9 A;  4OIW A;  3NE7 A;  1Z8T A;  2JBJ A;  2NYQ A;  2P6E A;  2PJ0 A;  2FCK A;  3TO6 A;  2OR4 A;  4A31 A;  4PXC A;  3T90 A;  4CAV A;  4CGL A;  2QIR A;  2BOA A;  1NSL A;  1Z8X A;  4CS0 B;  2EWB A;  3KQZ A;  2Z3M A;  1LAN A;  4HNW B;  8CPA A;  2B5G B;  1ZG7 A;  2CNS A;  2FT0 A;  2PSW A;  3BI0 A;  2V8D A;  4MCQ A;  1Z5R A;  3K2K A;  2EK9 A;  4L89 A;  5DWM A;  2GE3 A;  2IL4 A;  1X12 A;  2ZEP A;  4CPA A;  5F09 A;  4J3G A;  2F8H A;  3H8E A;  2C27 A;  2Z3P A;  2PDO A;  3GY9 A;  4C7I A;  4CGN A;  1YSJ A;  4MJ8 A;  2QEC A;  4AG9 A;  2XEJ A;  3B3V A;  5J8F A;  4KSA A;  2AFU A;  2VBQ A;  5G1Z A;  2B3V A;  2F5I A;  1ZO0 A;  3PFO A;  2GLJ A;  1BLL E;  2I79 A;  2D4P A;  1LCP A;  4UCM A;  1R57 A;  2Q4Z A;  1DTD A;  1YQE A;  4B12 A;  3KR5 A;  4NGP A;  2ATR A;  2GIV A;  4JLY A;  2KCW A;  4KOW A;  3L2N A;  1JQG A;  4OKO A;  3QNV A;  4NFR A;  4UCN A;  4RS2 A;  2REF A;  3VWD A;  2B4D B;  3WC5 A;  4B14 A;  4NGN A;  2ZXV A;  4Y49 B;  2ANP A;  4IUS A;  4P4F A;  5LRK A;  2EK8 A;  5G22 A;  4QBJ A;  2DEA A;  4R7M A;  2YNC C;  4P45 A;  3D66 A;  3S6K A;  1ARL A;  4FD7 A;  4R3L A;  1VKC A;  3DR8 A;  1YX0 A;  3GKR A;  4PK2 A;  4AVB A;  4BD9 A;  4MFZ A;  4MY0 A;  5IV0 A;  1CPX A;  3GYA A;  3D2P A;  4ONW A;  5EMI A;  4W9Y A;  2G9D A;  3B3W A;  2JBK A;  2V8V A;  3RO0 A;  3W6S A;  3RAM A;  3I3G A;  5ELY A;  1LFW A;  3CDX A;  3C26 A;  2FXF A;  4FD5 A;  1QMU A;  2PR1 A;  3F5B A;  3KI9 A;  3PBB A;  2DPS A;  4OC2 A;  5LYI A;  1XEB A;  2FVG A;  5F47 A;  5AG7 A;  2FS5 A;  2PE3 A;  3KL9 A;  2POK A;  1FNO A;  1QSR A;  2PVW A;  4BBH A;  4CAF A;  4C2X A;  4OLL A;  2IQ6 A;  4X3R A;  2Q4Y A;  3FH4 A;  4B6Z A;  4ORF A;  4CAE A;  2GU2 A;  2OZG A;  2ABZ A;  3N5F A;  4LX9 A;  2ZOF A;  4G1P A;  3FJU A;  4LUA A;  1ON0 A;  1XMT A;  2PC1 A;  4JXR A;  1J4J A;  4NF1 A;  3NA6 A;  5C82 A;  4UBR A;  3I1U A;  2EUI A;  4R8F A;  2PQ8 A;  2CTB A;  5AG6 A;  2PJ6 A;  4CGM A;  4EFD A;  3F8K A;  2ZEG A;  4FWU A;  4EVY A;  4NXY A;  3QAH A;  4KS9 A;  4PSW A;  1LAM A;  2CY2 A;  2HV2 A;  4A32 A;  5J1Q A;  1Q2Y A;  2JLM A;  4YGO A;  5G21 A;  4NJR A;  4OME A;  2ZEM A;  3A9L A;  4F0X A;  2AE6 A;  2ZEL A;  4IF5 A;  2CXA A;  3FMC A;  2Q04 A;  2AFS A;  2CF4 A;  2PR8 A;  3IWW A;  4PPZ A;  3EFA A;  1KWM A;  4MBU A;  1YRE A;  5LYD A;  4Y49 C;  1Z8W A;  2C1C A;  3IWE A;  4NGS A;  1IU8 A;  3NH5 A;  2Q43 A;  1I12 A;  3TOB A;  1QSO A;  1S60 A;  2YND A;  1Y7R A;  3B35 A;  4NEX A;  2FE7 A;  4B5O A;  3KHZ A;  3IGR A;  2WSA A;  4KLV A;  1F57 A;  1VHS A;  4CYN A;  4KVO E;  4MFK A;  2HUZ A;  5CBM A;  2BUE A;  3S6F A;  1YK3 A;  4PXE A;  2PVV A;  3V7Z A;  2Q4V A;  4B11 A;  2PJC A;  2PRB A;  3LOD A;  3LMS A;  1RO5 A;  3PB9 X;  2PJB A;  4UWJ A;  2Z3K A;  3S9N A;  4OC1 A;  1IY7 A;  1U6M A;  3NFZ A;  1YR0 A;  4JJX A;  4CAX A;  5HVG A;  4R57 A;  2O28 A;  1JWQ A;  4FAI A;  3SXO A;  1SQH A;  6CPA A;  3MGD A;  2AFO A;  2Z10 A;  2XEI A;  2BSW A;  3DGV A;  3R9F A;  2VQY A;  3K9U A;  4C2Y A;  4F9V A;  3LD2 A;  3VAR A;  4KUA A;  1IIC A;  4MFJ A;  4X5K A;  4DJL A;  3H4Q A;  4DUK A;  3PRT A;  2Z3N A;  1TKF A;  4HPS A;  3WC7 A;  4F8Z A;  4KOT A;  1OZP A;  5ISV A;  2EVN A;  2BCO A;  2VZZ A;  4JZ0 A;  4IHM A;  4UEZ A;  3D8P A;  2QML A;  4HNX B; 
#chains in the Genus database with same CATH homology
 2C6G A;  4P4I A;  1YW6 A;  2O53 A;  2PJA A;  1VHO A;  4UF4 A;  3SJX A;  3CPX A;  1CPS A;  1ZLI A;  3FEC A;  2RB7 A;  4YWY A;  3PB6 X;  1YLO A;  5HVF A;  4A39 A;  1XJO A;  3KAS A;  1ELM P;  2GRE A;  3TC8 A;  2VL1 A;  1YME A;  3IC1 A;  4MXU A;  4YU9 A;  4PXD A;  4UEE A;  1AMP A;  2PJ2 A;  2V77 A;  4O23 A;  3VH9 A;  2AFZ A;  5LYL A;  4H2K A;  3B7I A;  4OC5 A;  3PB4 X;  3T8W A;  1RTQ A;  4P6Y A;  5HXD A;  3GUX A;  3ISZ A;  3FEE A;  3B3S A;  4MHY A;  1ARM A;  3D7H A;  2XEG A;  3V38 A;  3CPA A;  4MHP A;  4ZY2 A;  4NGT A;  1ELL P;  2CTC A;  5K8N A;  1BPM A;  3PB7 X;  2ZEO A;  4UEF A;  3KHX A;  3GLJ A;  2OOT A;  4FUU A;  3WAB A;  4MCP A;  4OP4 A;  3D67 A;  4X8I A;  2ZEE A;  3IEH A;  4NJQ A;  4ZX9 A;  2WYR A;  1ZG8 A;  1TKJ A;  4EME A;  4ZY0 A;  4X2T A;  3BXM A;  4ZX8 A;  1YW4 A;  3D7F A;  1XRY A;  1CG2 A;  3SJE A;  5D29 A;  1BPN A;  4WWV A;  1Y0R A;  1Y0Y A;  4GM5 A;  2PJ5 A;  3S9M A;  1HEE A;  3IO1 A;  2NSM A;  4P10 A;  4OC4 A;  1F2O A;  4MRI A;  4P4E A;  3H8G A;  3PB8 X;  5HVH A;  1XMB A;  3DLJ A;  1TF9 A;  1CP7 A;  1VHE A;  3PBE A;  4OC3 A;  3PFE A;  3WC6 A;  4A94 A;  2WZN A;  4F9U A;  4R6T A;  4EWT A;  3B3C A;  5K8P A;  4FBE A;  2PCU A;  4P4B A;  2JEW A;  3CT9 A;  4MMO A;  3LWU A;  5JH9 A;  3KZW A;  3HLP A;  5LRG A;  2C6C A;  1Z8L A;  4P4D A;  2PJ7 A;  2HC9 A;  5LYF A;  1OBR A;  1GYT A;  1F2P A;  2ZEH A;  1LAP A;  2ZEN A;  2AFM A;  3ISX A;  3JRU A;  4WJB A;  2AFW A;  3FED A;  3SI2 A;  3K9T A;  2RFH A;  3SJG A;  3D7D A;  3RZA A;  3BI1 A;  3D4U A;  3KR4 A;  3SJF A;  3WT4 A;  5JM6 A;  1BAV A;  3IIB A;  4UIA A;  2PJ3 A;  1M4L A;  2PJ1 A;  3NH4 A;  2QVP A;  3BHX A;  7CPA A;  4Z65 A;  1PYT B;  4K3N A;  2C6P A;  4TNU A;  1EE3 P;  2PJ4 A;  4NGM A;  4ZI6 A;  2IJZ A;  4KSI A;  5K8O A;  1ZG9 A;  2QYV A;  2XEF A;  1HDU A;  1ZLH A;  2CIJ A;  5K8M A;  4ZYQ A;  1PCA A;  5JGF A;  4R76 A;  2HB6 A;  1CX8 A;  4RUH A;  3D7G A;  2PIY A;  3SI0 A;  5LRJ A;  3MRU A;  1UWY A;  1XFO A;  5D8N A;  1AYE A;  2V8G A;  4ZY1 A;  2F7V A;  4NGR A;  1LOK A;  2ZOG A;  5THW A;  3NH8 A;  4OID A;  4AXV A;  1DE4 C;  1XBU A;  3B2Y A;  1VIX A;  3HUV A;  3RBU A;  4TWE A;  4P4J A;  1R3N A;  5I4M A;  2PIZ A;  4NGQ A;  1CP6 A;  4PQA A;  4A37 A;  4MHN A;  3IJ3 A;  3MN8 A;  4LQG A;  3PEI A;  2PJ8 A;  2O4H A;  4UIB A;  4IK2 A;  1Z2L A;  4MCR A;  1Y7E A;  4Q7A A;  1NSA A;  2QJ8 A;  3SI1 A;  4OC0 A;  3VAT A;  1HDQ A;  2ZED A;  3IFE A;  5CPA A;  1TXR A;  1IGB A;  3S9L A;  3TX8 A;  4JYW A;  4MHZ A;  2ZEF A;  1Q7L A;  1VGY A;  2GLF A;  2IMO A;  2Q51 A;  1CBX A;  1H8L A;  5DS0 A;  4PXB A;  2PRQ A;  2PJ9 A;  1FT7 A;  3FF3 A;  1TKH A;  3H8F A;  1TF8 A;  3B3T A;  4P44 A;  2J9A A;  2BO9 A;  1QQ9 A;  4DYO A;  2I3C A;  3FVL A;  3FX6 A;  2V8H A;  3D68 A;  4IAV A;  3KGQ A;  4MCS A;  3KQX A;  1R43 A;  2AFX A;  4A38 A;  5IB9 A;  3GB0 A;  4OIW A;  2JBJ A;  2NYQ A;  2PJ0 A;  2OR4 A;  4PXC A;  2BOA A;  2EWB A;  3KQZ A;  1LAN A;  8CPA A;  3BI0 A;  1ZG7 A;  2V8D A;  4MCQ A;  1Z5R A;  3K2K A;  2EK9 A;  2ZEP A;  4CPA A;  5F09 A;  2F8H A;  3H8E A;  1YSJ A;  2XEJ A;  3B3V A;  2AFU A;  3PFO A;  2GLJ A;  1BLL E;  1LCP A;  2Q4Z A;  1DTD A;  3KR5 A;  4NGP A;  3L2N A;  1JQG A;  4OKO A;  3QNV A;  4NFR A;  3WC5 A;  4NGN A;  2ANP A;  4P4F A;  5LRK A;  2EK8 A;  2DEA A;  4R7M A;  4P45 A;  3D66 A;  1ARL A;  4BD9 A;  1CPX A;  4ONW A;  4W9Y A;  2G9D A;  3B3W A;  2JBK A;  2V8V A;  3RAM A;  5ELY A;  1LFW A;  3CDX A;  1QMU A;  3KI9 A;  3PBB A;  4OC2 A;  5LYI A;  2FVG A;  2PE3 A;  3KL9 A;  2POK A;  1FNO A;  2PVW A;  2IQ6 A;  4X3R A;  3FH4 A;  4B6Z A;  2GU2 A;  2ABZ A;  3N5F A;  2ZOF A;  4G1P A;  3FJU A;  3NA6 A;  3I1U A;  4R8F A;  2CTB A;  2PJ6 A;  4EFD A;  2ZEG A;  4FWU A;  1LAM A;  5J1Q A;  4NJR A;  4OME A;  2ZEM A;  2ZEL A;  3FMC A;  2AFS A;  2CF4 A;  3IWW A;  4PPZ A;  1KWM A;  5LYD A;  2C1C A;  4NGS A;  3NH5 A;  2Q43 A;  3B35 A;  3KHZ A;  1F57 A;  5CBM A;  3V7Z A;  4PXE A;  2PVV A;  2PJC A;  3LMS A;  3PB9 X;  3S9N A;  2PJB A;  4OC1 A;  1IY7 A;  3NFZ A;  5HVG A;  4FAI A;  6CPA A;  2AFO A;  2XEI A;  3DGV A;  4F9V A;  3VAR A;  4DJL A;  4DUK A;  3PRT A;  1TKF A;  3WC7 A;  4F8Z A;  2BCO A;  4JZ0 A;  4IHM A;  4UEZ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...