3B7IA

Crystal structure of the s228a mutant of the aminopeptidase from vibrio proteolyticus in complex with leucine phosphonic acid
Total Genus 111
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
111
sequence length
291
structure length
291
Chain Sequence
MPPITQQATVTAWLPQVDASQITGTISSLESFTNRFYTTTSGAQASDWIASEWQALSASLPNASVKQVSHSGYNQKSVVMTITGSEAPDEWIVIGGHLDSTIGSHTNEQSVAPGADDDASGIAAVTEVIRVLSENNFQPKRSIAFMAYAAEEVGLRGSQDLANQYKSEGKNVVSALQLDMTNYKGSAQDVVFITDYTDSNFTQYLTQLMDEYLPSLTYGFDTCGYACADHASWHNAGYPAAMPFESKFNDYNPRIHTTQDTLANSDPTGSHAKKFTQLGLAYAIEMGSATG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords Bacterial leucyl aminopeptidase
publication title Zinc coordination geometry and ligand binding affinity: the structural and kinetic analysis of the second-shell serine 228 residue and the methionine 180 residue of the aminopeptidase from Vibrio proteolyticus.
pubmed doi rcsb
source organism Vibrio proteolyticus
total genus 111
structure length 291
sequence length 291
ec nomenclature ec 3.4.11.10: Bacterial leucyl aminopeptidase.
pdb deposition date 2007-10-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF04389 Peptidase_M28 Peptidase family M28
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.630.10 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Zn peptidases 3b7iA00
5D29A 4MRIA 2PE3A 4X2TA 4EFDA 5LYDA 1ELMP 2PJ1A 1VHOA 4MCPA 2VL1A 3B7IA 1CPXA 2ZEFA 4IHMA 2ABZA 3K9TA 3CPXA 1AYEA 3D4UA 4MMOA 2V8HA 4DYOA 4G1PA 1HDQA 2V77A 4MCSA 2QYVA 2ZENA 4IAVA 1FT7A 3T8WA 4ONWA 3KL9A 2DEAA 7CPAA 1ZG9A 1XFOA 2HC9A 4ZX8A 4OIDA 2ZOFA 3PB7X 4FBEA 4MCQA 3QNVA 3DGVA 1CP7A 1CX8A 4X8IA 3H8GA 4H2KA 4AXVA 4PXEA 4LQGA 5F09A 4PXBA 5K8PA 5IB9A 2EWBA 3NH8A 5K8MA 5LRJA 3NH5A 4OP4A 3KQZA 3SJEA 2GLFA 4KSIA 1QMUA 3CT9A 5LYIA 4NGTA 3PBBA 4MHZA 4UIAA 3LMSA 4NGSA 4O23A 2ZEDA 4OKOA 1ZLHA 4A39A 5CPAA 2V8GA 5CBMA 4NFRA 4ZY2A 4UF4A 3NH4A 1IY7A 2PJAA 2PJ2A 4YWYA 2C6CA 1DE4C 2PCUA 3I1UA 1Y0RA 1BAVA 4IK2A 4R8FA 4DUKA 4OIWA 4A38A 3WC7A 1UWYA 3CDXA 4GM5A 1GYTA 1AMPA 3WC6A 2QVPA 5JGFA 4P4JA 1ZG7A 2J9AA 3PB9X 4R6TA 3D7DA 3PFOA 2XEGA 1CBXA 3S9LA 3VATA 3KASA 1TKHA 2PVWA 1ARMA 3FECA 3PFEA 4OC2A 2PJ3A 1VIXA 4RUHA 8CPAA 3IFEA 4R76A 1Z2LA 3BI1A 4B6ZA 3D7HA 3IO1A 2RB7A 1DTDA 2C6GA 4Z65A 1H8LA 1ARLA 1BLLE 4Q7AA 3PRTA 4FAIA 3SJXA 3B2YA 5HVFA 3KQXA 4P4DA 4JZ0A 1BPMA 5I4MA 3PB8X 1Y0YA 3S9MA 2F7VA 1YMEA 2PRQA 5K8OA 4UEZA 4FWUA 2ZOGA 2Q51A 2O53A 1LOKA 3MN8A 1TKFA 3SI0A 1Z5RA 5DS0A 4UIBA 5HXDA 2GREA 5J1QA 1PYTB 4TWEA 4F8ZA 1IGBA 2O4HA 2AFOA 2OR4A 4OC0A 3PEIA 1YW6A 1Z8LA 3D66A 2ZEPA 1QQ9A 3K2KA 4MHNA 2JBJA 2AFXA 3B3TA 5LYLA 4YU9A 1LANA 2AFMA 3L2NA 1LAMA 3BHXA 4K3NA 2ZEHA 3GUXA 1BPNA 1VHEA 1CG2A 1PCAA 3HUVA 1YW4A 2PJ4A 4A37A 1LAPA 2PJ7A 3IJ3A 1CP6A 5K8NA 4P4IA 3IC1A 3D67A 2PJ9A 4NGQA 4WJBA 3NA6A 3IWWA 1VGYA 2AFSA 1HEEA 3VH9A 1XBUA 4PXCA 3SJFA 4CPAA 1OBRA 2EK8A 2NYQA 3D7FA 2CTBA 3KGQA 5ELYA 2PJ5A 3RBUA 2V8DA 1Q7LA 3TC8A 2EK9A 2ZEGA 2WZNA 3V38A 4F9UA 3S9NA 4NGRA 2IJZA 4P6YA 3RAMA 3HLPA 1YLOA 2PIZA 3SI2A 4F9VA 3WABA 4TNUA 3KR4A 1ZG8A 1R3NA 5LRKA 2PJCA 3V7ZA 3MRUA 4W9YA 2XEJA 4UEEA 1R43A 1M4LA 4UEFA 1F2OA 2POKA 2ZELA 3B35A 3BXMA 3VARA 4P4FA 4OC4A 4MHYA 1F57A 3B3CA 3FEDA 4MCRA 1XRYA 4OC1A 4PXDA 1JQGA 2JBKA 3B3SA 3SJGA 4P4BA 4PPZA 1XMBA 4EMEA 3FX6A 2C6PA 3IIBA 4ZY1A 3KHZA 3TX8A 3N5FA 3B3VA 2Q43A 2PVVA 4NGPA 4P10A 2FVGA 2F8HA 1XJOA 3FMCA 4NGNA 2BCOA 4P4EA 5JM6A 3H8EA 2Q4ZA 3WT4A 1ZLIA 3LWUA 2G9DA 3PB6X 4JYWA 4P45A 4ZY0A 2PIYA 3WC5A 4ZYQA 5HVHA 3B3WA 4DJLA 2PJBA 5JH9A 3FF3A 4OC5A 3PB4X 4BD9A 2QJ8A 4MXUA 4OC3A 3NFZA 2RFHA 2AFWA 3IEHA 4NJQA 3H8FA 3KI9A 2NSMA 4NJRA 4R7MA 3DLJA 3ISXA 3KR5A 6CPAA 1KWMA 4A94A 1ELLP 2WYRA 4WWVA 5LYFA 2I3CA 2V8VA 4P44A 2XEIA 3FH4A 4ZI6A 5LRGA 2ANPA 3BI0A 3D68A 3PBEA 3JRUA 3D7GA 2OOTA 3KZWA 1LCPA 2BO9A 4NGMA 2BOAA 3GLJA 2GU2A 2CTCA 1RTQA 2PJ6A 1HDUA 1LFWA 1YSJA 2PJ0A 2C1CA 3FVLA 2GLJA 2IMOA 1FNOA 2CF4A 5D8NA 3ISZA 3FEEA 3GB0A 2ZEEA 2HB6A 4PQAA 1TF8A 1TXRA 3RZAA 2AFZA 2CIJA 1TKJA 2XEFA 1NSAA 4OMEA 5THWA 2AFUA 2JEWA 4MHPA 4EWTA 2ZEOA 4ZX9A 1CPSA 5HVGA 3KHXA 1Y7EA 1EE3P 4FUUA 2ZEMA 4X3RA 1TF9A 3SI1A 2PJ8A 3CPAA 1F2PA 3FJUA 2IQ6A
chains in the Genus database with same CATH superfamily
4QUSA 4MRIA 5D29A 2PE3A 2Q7BA 4B5PB 4X2TA 4EFDA 4KOYA 4NEXA 4PSXA 1ELMP 5LYDA 2PJ1A 3EC4A 1VHOA 4HNXB 3DR6A 4MCPA 3TT2A 1WK4A 2VL1A 3B7IA 1CPXA 4B11A 1Z4EA 5G1ZA 2ZEFA 2HUZA 2ZXVA 1MJAA 3K9UA 2R7HA 3D2PA 1S5KA 2PQ8A 2ABZA 3K9TA 4GXHA 4IHMA 2CY2A 3CPXA 4UWJA 2B4DB 1NSLA 1AYEA 4NF1A 4ONUA 1XE4A 3D4UA 2GFQA 3BJ8A 4MMOA 2V8HA 4DYOA 4YRHA 4KOXA 4G1PA 2GIVA 2FS5A 4KOTA 1HDQA 4UBRA 4KORA 2V77A 4HNWB 2O28A 4MCSA 2CNMA 2QYVA 5IX3A 4OAEA 4KOSA 1IOFA 2ZENA 3A9LA 2Y0MA 3R9GA 4IAVA 1FT7A 3T8WA 4ONWA 4MI4A 2Z3MA 2OB0A 3KL9A 2DEAA 4AVAA 7CPAA 4MBUA 2YNCC 2OH1A 1ZG9A 4OLLA 1OZPA 1VKCA 1XFOA 2HC9A 4BMHA 4ZX8A 2P6GA 4OIDA 3V8IA 2ZW5A 4E0AA 1S3ZA 5KTCA 2ZOFA 3PB7X 4FBEA 2NMTA 4MCQA 1YR0A 2DPSA 2OZHA 2Z3NA 1CP7A 3DGVA 3QNVA 1CX8A 4M85A 4R9MA 5F47A 4YFJA 4X8IA 3I9SA 1NE9A 3H8GA 4H2KA 1R57A 4UWIA 4QBJA 4AXVA 1Z8WA 4FD5A 4PXEA 4CGPA 1Y9KA 4LQGA 5F09A 1KUYA 4PXBA 1CM0A 4KOUA 5K8PA 1IYLA 2Z11A 2VBQA 5H86A 5IB9A 1TIQA 1M44A 2EWBA 3NH8A 4PSWA 4XNHC 5LRJA 3NH5A 5K8MA 3LACA 2D4PA 4OP4A 4QC6A 4UFVA 5J8CA 3KQZA 3ZJ0A 4F6AA 3SJEA 2GLFA 4C7IA 1Y7RA 4F0XA 5EC4A 4KSIA 3TE4A 1QMUA 3CT9A 4HNYB 5LYIA 4NGTA 1X10A 3PBBA 4B13A 1QSRA 4E2AA 4LX9A 4MHZA 1AUGA 4X5KA 3GYAA 2IL4A 4UIAA 4CAXA 3FNCA 4PK2A 3LMSA 5F46A 1IIDA 4A95A 3DSBA 4NGSA 5AG5A 4O23A 4KZTA 2ZEDA 3CXPA 4Y49B 3H5ZA 4MFLA 1IICA 4C2XA 2VEZA 2PR1A 4OKOA 3R9FA 1ZLHA 2FT0A 4A39A 2PC1A 5CPAA 2V8GA 3H4QA 4RS2A 5CBMA 4CGMA 2J8NA 4NFRA 2JLMA 3FIXA 4ZY2A 3CXQA 4UF4A 3NH4A 4CRYB 1IY7A 4AVCA 5C88A 1KUXA 2PJAA 2YNCA 2PJ2A 2AJ6A 1UFHA 4YWYA 2OZUA 2C6CA 1DE4C 1MJBA 2PCUA 1X12A 3I1UA 3TOBA 2VI7A 1Y0RA 1Z8XA 3IWGA 3FYNA 1IYKA 1Q2CA 1BAVA 1A2ZA 2B58A 1N71A 3EFAA 4IK2A 4R8FA 4CGNA 4DUKA 3TO9A 2KCWA 4B14A 4OIWA 1MK4A 1S7KA 4A38A 3WC7A 4KSFA 1UWYA 3CDXA 3OWCA 4GM5A 1GYTA 1AMPA 2EO8A 3WC6A 2QVPA 5JGFA 4KLVA 2PRBA 4P4JA 4I49A 1ZG7A 2J9AA 1M1DA 1KUVA 2VXKA 3PB9X 3QB8A 4UFXA 2HV2A 4J3GA 4MFKA 2QIRA 4R6TA 3D7DA 3PFOA 3R9EA 2XEGA 3F0AA 2HQYA 1CBXA 4FD4A 3S9LA 2R1IA 3D2MA 4BBHA 2WUUA 4CAWA 3VATA 3KASA 1TKHA 5AGEA 5KTDA 2PVWA 1ARMA 2CNSA 3FECA 4JJXA 3PFEA 3DNSA 1JWQA 4OC2A 4XPDC 3S6GA 3CXSA 3VWEA 1Q2YA 2Q4VA 2PJ3A 1LRZA 1VIXA 4RUHA 4AVBA 8CPAA 3IFEA 2B5GB 4R76A 1Z2LA 3BI1A 2FE7A 2K5TA 2FIAA 3D7HA 3G8WA 3IO1A 2RB7A 4B6ZA 2ODFA 1DTDA 2C6GA 4Z65A 3SXOA 1H8LA 2PSWA 3WR7A 4B12A 1ARLA 1BLLE 1YREA 2DXQA 2JEVA 3NE7A 3PRTA 4Q7AA 5HH1A 4FAIA 4M3SA 2BEIA 4MFZA 4C7HA 3SJXA 3B2YA 5ISVA 4NCZA 4KSAA 1V0CA 5HVFA 1P4NA 1Y9WA 3FXTA 3KQXA 4JZ0A 4P4DA 1BPMA 5I4MA 4C2YA 2REEA 3PB8X 2WPXA 4CYNA 4JWPA 3LODA 1Y0YA 3S9MA 1QSTA 2F7VA 1YMEA 4IUSA 2PRQA 3NE8A 5K8OA 4UEZA 2WSAA 4FWUA 3TO6A 2ZOGA 4C68A 3D8PA 2CXAA 3S6KA 2Q51A 3JTKA 2O53A 1LOKA 2DPTA 3MN8A 4HPSA 5G22A 1TKFA 3EY5A 3SI0A 2ZW7A 4KUBA 1Z5RA 4Q36A 2J8MA 5DS0A 2B3UA 3F5BA 4UFWA 4UIBA 5HXDA 2GREA 4LQ6A 1M4DA 4QB9A 4MY0A 5J1QA 1PYTB 4TWEA 1ZO0A 2H5MA 4F8ZA 2O4HA 1IGBA 1YVKA 2AFOA 2OR4A 3JUWA 3PEIA 1YW6A 4OC0A 5CNPA 3S6HA 4AB7A 4B5PA 1Z8LA 2WPWA 3D66A 2ZEPA 1I12A 1QQ9A 3VWDA 3K2KA 2QMLA 4E8OA 3R1KA 4MHNA 2JBJA 2AFXA 3B3TA 4UCMA 5IB0A 3P2HA 5LYLA 1BOBA 2X7BA 4YU9A 2Q4YA 5G20A 1LANA 2AFMA 3L2NA 1LAMA 3BHXA 4K3NA 4KOWA 2Q0YA 5JPHA 2R98A 2Z0ZA 2ZEHA 3GUXA 1BPNA 4M6IA 3TFYA 1VHEA 4CYPA 1S7FA 3IU2A 2FSRA 2ATRA 1CG2A 1PCAA 1L0CA 5I0CA 3HUVA 1M4GA 1YW4A 2PJ4A 2R8VA 2VZZA 1LAPA 4A37A 4A2ZA 2PJ7A 3IJ3A 3I3GA 4CS0B 1CP6A 5K8NA 1P0HA 4P4IA 2Q44A 2B4BA 2Z10A 3IC1A 2ZW4A 5F48A 3D67A 4CGLA 2PJ9A 2F5IA 4NGQA 3FRMA 1XOVA 2ZPAA 4KS9A 4KVXA 4WJBA 3QAHA 4BINA 3NA6A 1M4IA 3IWWA 1VGYA 2AFSA 4CAFA 1HEEA 4RI1A 3VH9A 4XNHB 4R3KA 1CJWA 4Q38A 2REFA 1XBUA 3C26A 5AG4A 4PXCA 3SJFA 4CPAA 1WWZA 1OBRA 2J8RA 3F8KA 2JDCA 3ZZIA 2EK8A 1FY7A 2NYQA 3D7FA 2CTBA 3KGQA 1PUAA 4FD6A 4KUAA 4RN7A 4B5OA 4JXRA 5A28A 5ELYA 4MFPA 1Z8TA 3CZXA 1U6MA 4JXQA 4MFJA 4CYQA 3SXNA 2PJ5A 3PZJA 2VZYA 1YGHA 2V8DA 4UA3A 3RBUA 4H89A 1Q7LA 1XMTA 2PR8A 4R3LA 3S6FA 3TTHA 4NXYA 3TC8A 2EK9A 1ON0A 2ZEGA 1GHEA 2WZNA 3RNZA 3V38A 4F9UA 3S9NA 3RYOA 4NGRA 2IJZA 3FBUA 4P6YA 3RAMA 3KKWA 1S7NA 2VQYA 3HLPA 2Z3LA 1YLOA 4H6ZA 3T9YA 2EUIA 2C27A 5DWNA 2ZW6A 2PIZA 1IB1E 2YNDA 3SI2A 3UY5A 4II9A 2DF5A 4XPKA 4F9VA 3WABA 3P2FA 5C82A 4TNUA 3KR4A 1ZG8A 1R3NA 5LRKA 2Z3PA 2Q04A 2PJCA 3V7ZA 3MRUA 4W9YA 2XEJA 5JQ4A 3T90A 5IV0A 4UEEA 1VHSA 4M6GA 1R43A 4K30A 2FL4A 3PGPA 4M6HA 4CYOA 1M4LA 4NSQA 4UEFA 1F2OA 1YLEA 2POKA 4LUAA 1QSOA 2ZELA 5HMNA 3FJUA 3B35A 3BXMA 3IWEA 3VARA 3IGRA 4P4FA 5EBVA 4OC4A 4C2ZA 5FVJA 4MHYA 5EMIA 2RC4A 1F57A 4L8AA 3B3CA 3FEDA 4MCRA 4KLWA 1XRYA 4OC1A 4PXDA 1QSNA 4CGOA 1JQGA 2JBKA 3BLNA 4HKFA 5AG6A 1XIXA 3B3SA 3SJGA 4P4BA 4PPZA 1XMBA 5DWMA 1I21A 3FX6A 4EMEA 1YVOA 2C6PA 4MJ8A 3IIBA 4ZY1A 3KHZA 3TX8A 3N7ZA 3N5FA 1YK3A 3BJ7A 4XPLA 1XEBA 1BO4A 3B3VA 3DDDA 3EXNA 2A4NA 2Q43A 1IU8A 2PVVA 4NGPA 4R57A 4XPDB 4P10A 4CRZB 2FVGA 2YNEA 3TCVA 4F0YA 2F8HA 2P6FA 2AE6A 1XJOA 3FMCA 4NGNA 2BCOA 4P4EA 2P6EA 5JM6A 4FD7A 5G21A 3H8EA 1SQHA 1Z9UA 3GY9A 2Q4ZA 4B10A 3WT4A 1ZLIA 3LWUA 2G9DA 3PB6X 4H6UA 4JYWA 4P45A 4ZY0A 2PIYA 3WC5A 4ZYQA 5HVHA 3B3WA 3G3SA 4DJLA 3JVNA 4KVOE 2PJBA 4GS4A 5BWAB 5JH9A 4R87A 2P0WA 5F49A 3FF3A 4OC5A 4A31A 5A27A 4U9YA 3PB4X 2BL1A 2PDOA 4YGOA 4BD9A 2QJ8A 4MXUA 1B87A 4OC3A 3NFZA 4EVYA 3QAYA 4A30A 2Q7SA 2RFHA 2AFWA 3IEHA 4NJQA 4IF5A 2B5GA 4A33A 2B4DA 2GANA 3H8FA 3D3SA 3KI9A 2NSMA 2I79A 4NJRA 4ZGYB 4R7MA 3DLJA 1Q2DA 3ISXA 3KR5A 2B3VA 1MJ9A 1QSMA 2BUEA 4Y49C 3TOAA 4MY3A 1KWMA 6CPAA 4A94A 2YGWA 4A32A 4MFQA 1KZFA 1ELLP 1RO5A 2WYRA 4WWVA 1B6BA 2GE3A 5LYFA 3E0KA 3EO4A 2I3CA 5J8FA 5AG7A 2V8VA 4MHDA 4P44A 2XEIA 3FH4A 4ORFA 3R95A 4ZI6A 5LRGA 2ANPA 3W6XA 1YQEA 4QVTA 3BI0A 3D68A 1NMTA 3GIUA 2Z3OA 3PBEA 3JRUA 3D7GA 1Z4RA 2OOTA 3B8GA 3KZWA 2FIWA 4JD6A 1LCPA 2CNTA 2BO9A 1YX0A 3FB3A 3RO0A 4U9ZA 4NGMA 2BOAA 3GLJA 1K4JA 4U5YA 2GU2A 2CTCA 3W6SA 1RTQA 2PJ6A 4CAVA 1HDUA 1LFWA 1YSJA 2PJ0A 3GKRA 2C1CA 2FCKA 3FVLA 2OU2A 2D4OA 1S60A 2GLJA 2IMOA 3SHPA 1FNOA 2CF4A 5D8NA 3ISZA 3FEEA 3GB0A 2ARHA 2ZEEA 4JLYA 2HB6A 1J4JA 4AG7A 1S7LA 3DR8A 3W91A 3MGDA 4OADA 4PQAA 1TF8A 1TXRA 1IOIA 2G0BA 3RZAA 5KTAA 2AFZA 5E96A 2CIJA 4UCPA 1TKJA 2FXFA 2XEFA 1NSAA 2I00A 4OMEA 3PP9A 5THWA 1RXTA 2OZGA 2AFUA 2EVNA 2JEWA 3R96A 1I1DA 4MHPA 4EWTA 2BSWA 2QECA 2G3AA 2ZEOA 4ZX9A 4DNCA 1CPSA 5H84A 3LD2A 4CAEA 5HVGA 2G3TA 1XF8A 2JDDA 3KHXA 4AG9A 1Y7EA 1EE3P 4FUUA 4PK3A 2ZEMA 4ZBGA 4X3RA 1TF9A 4KOVA 4KVME 2Z3KA 3SI1A 4PV6A 2PJ8A 5GCNA 4UCNA 3CPAA 1F2PA 3TO7A 2EBJA 1PU9A 3IU1A 4L89A 2IQ6A
chains in the Genus database with same CATH topology
5D29A 4MRIA 2PE3A 4X2TA 4EFDA 5LYDA 1ELMP 2PJ1A 1VHOA 4MCPA 2VL1A 3B7IA 1CPXA 2ZEFA 4IHMA 2ABZA 3K9TA 3CPXA 1AYEA 3D4UA 4MMOA 2V8HA 4DYOA 4G1PA 1HDQA 2V77A 4MCSA 2QYVA 2ZENA 4IAVA 1FT7A 3T8WA 4ONWA 3KL9A 2DEAA 7CPAA 1ZG9A 1XFOA 2HC9A 4ZX8A 4OIDA 2ZOFA 3PB7X 4FBEA 4MCQA 3QNVA 3DGVA 1CP7A 1CX8A 4X8IA 3H8GA 4H2KA 4AXVA 4PXEA 4LQGA 5F09A 4PXBA 5K8PA 5IB9A 2EWBA 3NH8A 5K8MA 5LRJA 3NH5A 4OP4A 3KQZA 3SJEA 2GLFA 4KSIA 1QMUA 3CT9A 5LYIA 4NGTA 3PBBA 4MHZA 4UIAA 3LMSA 4NGSA 4O23A 2ZEDA 4OKOA 1ZLHA 4A39A 5CPAA 2V8GA 5CBMA 4NFRA 4ZY2A 4UF4A 3NH4A 1IY7A 2PJAA 2PJ2A 4YWYA 2C6CA 1DE4C 2PCUA 3I1UA 1Y0RA 1BAVA 4IK2A 4R8FA 4DUKA 4OIWA 4A38A 3WC7A 1UWYA 3CDXA 4GM5A 1GYTA 1AMPA 3WC6A 2QVPA 5JGFA 4P4JA 1ZG7A 2J9AA 3PB9X 4R6TA 3D7DA 3PFOA 2XEGA 1CBXA 3S9LA 3VATA 3KASA 1TKHA 2PVWA 1ARMA 3FECA 3PFEA 4OC2A 2PJ3A 1VIXA 4RUHA 8CPAA 3IFEA 4R76A 1Z2LA 3BI1A 4B6ZA 3D7HA 3IO1A 2RB7A 1DTDA 2C6GA 4Z65A 1H8LA 1ARLA 1BLLE 4Q7AA 3PRTA 4FAIA 3SJXA 3B2YA 5HVFA 3KQXA 4P4DA 4JZ0A 1BPMA 5I4MA 3PB8X 1Y0YA 3S9MA 2F7VA 1YMEA 2PRQA 5K8OA 4UEZA 4FWUA 2ZOGA 2Q51A 2O53A 1LOKA 3MN8A 1TKFA 3SI0A 1Z5RA 5DS0A 4UIBA 5HXDA 2GREA 5J1QA 1PYTB 4TWEA 4F8ZA 1IGBA 2O4HA 2AFOA 2OR4A 4OC0A 3PEIA 1YW6A 1Z8LA 3D66A 2ZEPA 1QQ9A 3K2KA 4MHNA 2JBJA 2AFXA 3B3TA 5LYLA 4YU9A 1LANA 2AFMA 3L2NA 1LAMA 3BHXA 4K3NA 2ZEHA 3GUXA 1BPNA 1VHEA 1CG2A 1PCAA 3HUVA 1YW4A 2PJ4A 4A37A 1LAPA 2PJ7A 3IJ3A 1CP6A 5K8NA 4P4IA 3IC1A 3D67A 2PJ9A 4NGQA 4WJBA 3NA6A 3IWWA 1VGYA 2AFSA 1HEEA 3VH9A 1XBUA 4PXCA 3SJFA 4CPAA 1OBRA 2EK8A 2NYQA 3D7FA 2CTBA 3KGQA 5ELYA 2PJ5A 3RBUA 2V8DA 1Q7LA 3TC8A 2EK9A 2ZEGA 2WZNA 3V38A 4F9UA 3S9NA 4NGRA 2IJZA 4P6YA 3RAMA 3HLPA 1YLOA 2PIZA 3SI2A 4F9VA 3WABA 4TNUA 3KR4A 1ZG8A 1R3NA 5LRKA 2PJCA 3V7ZA 3MRUA 4W9YA 2XEJA 4UEEA 1R43A 1M4LA 4UEFA 1F2OA 2POKA 2ZELA 3B35A 3BXMA 3VARA 4P4FA 4OC4A 4MHYA 1F57A 3B3CA 3FEDA 4MCRA 1XRYA 4OC1A 4PXDA 1JQGA 2JBKA 3B3SA 3SJGA 4P4BA 4PPZA 1XMBA 4EMEA 3FX6A 2C6PA 3IIBA 4ZY1A 3KHZA 3TX8A 3N5FA 3B3VA 2Q43A 2PVVA 4NGPA 4P10A 2FVGA 2F8HA 1XJOA 3FMCA 4NGNA 2BCOA 4P4EA 5JM6A 3H8EA 2Q4ZA 3WT4A 1ZLIA 3LWUA 2G9DA 3PB6X 4JYWA 4P45A 4ZY0A 2PIYA 3WC5A 4ZYQA 5HVHA 3B3WA 4DJLA 2PJBA 5JH9A 3FF3A 4OC5A 3PB4X 4BD9A 2QJ8A 4MXUA 4OC3A 3NFZA 2RFHA 2AFWA 3IEHA 4NJQA 3H8FA 3KI9A 2NSMA 4NJRA 4R7MA 3DLJA 3ISXA 3KR5A 6CPAA 1KWMA 4A94A 1ELLP 2WYRA 4WWVA 5LYFA 2I3CA 2V8VA 4P44A 2XEIA 3FH4A 4ZI6A 5LRGA 2ANPA 3BI0A 3D68A 3PBEA 3JRUA 3D7GA 2OOTA 3KZWA 1LCPA 2BO9A 4NGMA 2BOAA 3GLJA 2GU2A 2CTCA 1RTQA 2PJ6A 1HDUA 1LFWA 1YSJA 2PJ0A 2C1CA 3FVLA 2GLJA 2IMOA 1FNOA 2CF4A 5D8NA 3ISZA 3FEEA 3GB0A 2ZEEA 2HB6A 4PQAA 1TF8A 1TXRA 3RZAA 2AFZA 2CIJA 1TKJA 2XEFA 1NSAA 4OMEA 5THWA 2AFUA 2JEWA 4MHPA 4EWTA 2ZEOA 4ZX9A 1CPSA 5HVGA 3KHXA 1Y7EA 1EE3P 4FUUA 2ZEMA 4X3RA 1TF9A 3SI1A 2PJ8A 3CPAA 1F2PA 3FJUA 2IQ6A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5D29 A;  4MRI A;  2PE3 A;  4X2T A;  4EFD A;  5LYD A;  1ELM P;  2PJ1 A;  1VHO A;  4MCP A;  2VL1 A;  3B7I A;  1CPX A;  2ZEF A;  4IHM A;  2ABZ A;  3K9T A;  3CPX A;  1AYE A;  3D4U A;  4MMO A;  2V8H A;  4DYO A;  4G1P A;  1HDQ A;  2V77 A;  4MCS A;  2QYV A;  2ZEN A;  4IAV A;  1FT7 A;  3T8W A;  4ONW A;  3KL9 A;  2DEA A;  7CPA A;  1ZG9 A;  1XFO A;  2HC9 A;  4ZX8 A;  4OID A;  2ZOF A;  3PB7 X;  4FBE A;  4MCQ A;  3QNV A;  3DGV A;  1CP7 A;  1CX8 A;  4X8I A;  3H8G A;  4H2K A;  4AXV A;  4PXE A;  4LQG A;  5F09 A;  4PXB A;  5K8P A;  5IB9 A;  2EWB A;  3NH8 A;  5K8M A;  5LRJ A;  3NH5 A;  4OP4 A;  3KQZ A;  3SJE A;  2GLF A;  4KSI A;  1QMU A;  3CT9 A;  5LYI A;  4NGT A;  3PBB A;  4MHZ A;  4UIA A;  3LMS A;  4NGS A;  4O23 A;  2ZED A;  4OKO A;  1ZLH A;  4A39 A;  5CPA A;  2V8G A;  5CBM A;  4NFR A;  4ZY2 A;  4UF4 A;  3NH4 A;  1IY7 A;  2PJA A;  2PJ2 A;  4YWY A;  2C6C A;  1DE4 C;  2PCU A;  3I1U A;  1Y0R A;  1BAV A;  4IK2 A;  4R8F A;  4DUK A;  4OIW A;  4A38 A;  3WC7 A;  1UWY A;  3CDX A;  4GM5 A;  1GYT A;  1AMP A;  3WC6 A;  2QVP A;  5JGF A;  4P4J A;  1ZG7 A;  2J9A A;  3PB9 X;  4R6T A;  3D7D A;  3PFO A;  2XEG A;  1CBX A;  3S9L A;  3VAT A;  3KAS A;  1TKH A;  2PVW A;  1ARM A;  3FEC A;  3PFE A;  4OC2 A;  2PJ3 A;  1VIX A;  4RUH A;  8CPA A;  3IFE A;  4R76 A;  1Z2L A;  3BI1 A;  4B6Z A;  3D7H A;  3IO1 A;  2RB7 A;  1DTD A;  2C6G A;  4Z65 A;  1H8L A;  1ARL A;  1BLL E;  4Q7A A;  3PRT A;  4FAI A;  3SJX A;  3B2Y A;  5HVF A;  3KQX A;  4P4D A;  4JZ0 A;  1BPM A;  5I4M A;  3PB8 X;  1Y0Y A;  3S9M A;  2F7V A;  1YME A;  2PRQ A;  5K8O A;  4UEZ A;  4FWU A;  2ZOG A;  2Q51 A;  2O53 A;  1LOK A;  3MN8 A;  1TKF A;  3SI0 A;  1Z5R A;  5DS0 A;  4UIB A;  5HXD A;  2GRE A;  5J1Q A;  1PYT B;  4TWE A;  4F8Z A;  1IGB A;  2O4H A;  2AFO A;  2OR4 A;  4OC0 A;  3PEI A;  1YW6 A;  1Z8L A;  3D66 A;  2ZEP A;  1QQ9 A;  3K2K A;  4MHN A;  2JBJ A;  2AFX A;  3B3T A;  5LYL A;  4YU9 A;  1LAN A;  2AFM A;  3L2N A;  1LAM A;  3BHX A;  4K3N A;  2ZEH A;  3GUX A;  1BPN A;  1VHE A;  1CG2 A;  1PCA A;  3HUV A;  1YW4 A;  2PJ4 A;  4A37 A;  1LAP A;  2PJ7 A;  3IJ3 A;  1CP6 A;  5K8N A;  4P4I A;  3IC1 A;  3D67 A;  2PJ9 A;  4NGQ A;  4WJB A;  3NA6 A;  3IWW A;  1VGY A;  2AFS A;  1HEE A;  3VH9 A;  1XBU A;  4PXC A;  3SJF A;  4CPA A;  1OBR A;  2EK8 A;  2NYQ A;  3D7F A;  2CTB A;  3KGQ A;  5ELY A;  2PJ5 A;  3RBU A;  2V8D A;  1Q7L A;  3TC8 A;  2EK9 A;  2ZEG A;  2WZN A;  3V38 A;  4F9U A;  3S9N A;  4NGR A;  2IJZ A;  4P6Y A;  3RAM A;  3HLP A;  1YLO A;  2PIZ A;  3SI2 A;  4F9V A;  3WAB A;  4TNU A;  3KR4 A;  1ZG8 A;  1R3N A;  5LRK A;  2PJC A;  3V7Z A;  3MRU A;  4W9Y A;  2XEJ A;  4UEE A;  1R43 A;  1M4L A;  4UEF A;  1F2O A;  2POK A;  2ZEL A;  3B35 A;  3BXM A;  3VAR A;  4P4F A;  4OC4 A;  4MHY A;  1F57 A;  3B3C A;  3FED A;  4MCR A;  1XRY A;  4OC1 A;  4PXD A;  1JQG A;  2JBK A;  3B3S A;  3SJG A;  4P4B A;  4PPZ A;  1XMB A;  4EME A;  3FX6 A;  2C6P A;  3IIB A;  4ZY1 A;  3KHZ A;  3TX8 A;  3N5F A;  3B3V A;  2Q43 A;  2PVV A;  4NGP A;  4P10 A;  2FVG A;  2F8H A;  1XJO A;  3FMC A;  4NGN A;  2BCO A;  4P4E A;  5JM6 A;  3H8E A;  2Q4Z A;  3WT4 A;  1ZLI A;  3LWU A;  2G9D A;  3PB6 X;  4JYW A;  4P45 A;  4ZY0 A;  2PIY A;  3WC5 A;  4ZYQ A;  5HVH A;  3B3W A;  4DJL A;  2PJB A;  5JH9 A;  3FF3 A;  4OC5 A;  3PB4 X;  4BD9 A;  2QJ8 A;  4MXU A;  4OC3 A;  3NFZ A;  2RFH A;  2AFW A;  3IEH A;  4NJQ A;  3H8F A;  3KI9 A;  2NSM A;  4NJR A;  4R7M A;  3DLJ A;  3ISX A;  3KR5 A;  6CPA A;  1KWM A;  4A94 A;  1ELL P;  2WYR A;  4WWV A;  5LYF A;  2I3C A;  2V8V A;  4P44 A;  2XEI A;  3FH4 A;  4ZI6 A;  5LRG A;  2ANP A;  3BI0 A;  3D68 A;  3PBE A;  3JRU A;  3D7G A;  2OOT A;  3KZW A;  1LCP A;  2BO9 A;  4NGM A;  2BOA A;  3GLJ A;  2GU2 A;  2CTC A;  1RTQ A;  2PJ6 A;  1HDU A;  1LFW A;  1YSJ A;  2PJ0 A;  2C1C A;  3FVL A;  2GLJ A;  2IMO A;  1FNO A;  2CF4 A;  5D8N A;  3ISZ A;  3FEE A;  3GB0 A;  2ZEE A;  2HB6 A;  4PQA A;  1TF8 A;  1TXR A;  3RZA A;  2AFZ A;  2CIJ A;  1TKJ A;  2XEF A;  1NSA A;  4OME A;  5THW A;  2AFU A;  2JEW A;  4MHP A;  4EWT A;  2ZEO A;  4ZX9 A;  1CPS A;  5HVG A;  3KHX A;  1Y7E A;  1EE3 P;  4FUU A;  2ZEM A;  4X3R A;  1TF9 A;  3SI1 A;  2PJ8 A;  3CPA A;  1F2P A;  3FJU A;  2IQ6 A; 
#chains in the Genus database with same CATH topology
 4QUS A;  4MRI A;  5D29 A;  2PE3 A;  2Q7B A;  4B5P B;  4X2T A;  4EFD A;  4KOY A;  4NEX A;  4PSX A;  1ELM P;  5LYD A;  2PJ1 A;  3EC4 A;  1VHO A;  4HNX B;  3DR6 A;  4MCP A;  3TT2 A;  1WK4 A;  2VL1 A;  3B7I A;  1CPX A;  4B11 A;  1Z4E A;  5G1Z A;  2ZEF A;  2HUZ A;  2ZXV A;  1MJA A;  3K9U A;  2R7H A;  3D2P A;  1S5K A;  2PQ8 A;  2ABZ A;  3K9T A;  4GXH A;  4IHM A;  2CY2 A;  3CPX A;  4UWJ A;  2B4D B;  1NSL A;  1AYE A;  4NF1 A;  4ONU A;  1XE4 A;  3D4U A;  2GFQ A;  3BJ8 A;  4MMO A;  2V8H A;  4DYO A;  4YRH A;  4KOX A;  4G1P A;  2GIV A;  2FS5 A;  4KOT A;  1HDQ A;  4UBR A;  4KOR A;  2V77 A;  4HNW B;  2O28 A;  4MCS A;  2CNM A;  2QYV A;  5IX3 A;  4OAE A;  4KOS A;  1IOF A;  2ZEN A;  3A9L A;  2Y0M A;  3R9G A;  4IAV A;  1FT7 A;  3T8W A;  4ONW A;  4MI4 A;  2Z3M A;  2OB0 A;  3KL9 A;  2DEA A;  4AVA A;  7CPA A;  4MBU A;  2YNC C;  2OH1 A;  1ZG9 A;  4OLL A;  1OZP A;  1VKC A;  1XFO A;  2HC9 A;  4BMH A;  4ZX8 A;  2P6G A;  4OID A;  3V8I A;  2ZW5 A;  4E0A A;  1S3Z A;  5KTC A;  2ZOF A;  3PB7 X;  4FBE A;  2NMT A;  4MCQ A;  1YR0 A;  2DPS A;  2OZH A;  2Z3N A;  1CP7 A;  3DGV A;  3QNV A;  1CX8 A;  4M85 A;  4R9M A;  5F47 A;  4YFJ A;  4X8I A;  3I9S A;  1NE9 A;  3H8G A;  4H2K A;  1R57 A;  4UWI A;  4QBJ A;  4AXV A;  1Z8W A;  4FD5 A;  4PXE A;  4CGP A;  1Y9K A;  4LQG A;  5F09 A;  1KUY A;  4PXB A;  1CM0 A;  4KOU A;  5K8P A;  1IYL A;  2Z11 A;  2VBQ A;  5H86 A;  5IB9 A;  1TIQ A;  1M44 A;  2EWB A;  3NH8 A;  4PSW A;  4XNH C;  5LRJ A;  3NH5 A;  5K8M A;  3LAC A;  2D4P A;  4OP4 A;  4QC6 A;  4UFV A;  5J8C A;  3KQZ A;  3ZJ0 A;  4F6A A;  3SJE A;  2GLF A;  4C7I A;  1Y7R A;  4F0X A;  5EC4 A;  4KSI A;  3TE4 A;  1QMU A;  3CT9 A;  4HNY B;  5LYI A;  4NGT A;  1X10 A;  3PBB A;  4B13 A;  1QSR A;  4E2A A;  4LX9 A;  4MHZ A;  1AUG A;  4X5K A;  3GYA A;  2IL4 A;  4UIA A;  4CAX A;  3FNC A;  4PK2 A;  3LMS A;  5F46 A;  1IID A;  4A95 A;  3DSB A;  4NGS A;  5AG5 A;  4O23 A;  4KZT A;  2ZED A;  3CXP A;  4Y49 B;  3H5Z A;  4MFL A;  1IIC A;  4C2X A;  2VEZ A;  2PR1 A;  4OKO A;  3R9F A;  1ZLH A;  2FT0 A;  4A39 A;  2PC1 A;  5CPA A;  2V8G A;  3H4Q A;  4RS2 A;  5CBM A;  4CGM A;  2J8N A;  4NFR A;  2JLM A;  3FIX A;  4ZY2 A;  3CXQ A;  4UF4 A;  3NH4 A;  4CRY B;  1IY7 A;  4AVC A;  5C88 A;  1KUX A;  2PJA A;  2YNC A;  2PJ2 A;  2AJ6 A;  1UFH A;  4YWY A;  2OZU A;  2C6C A;  1DE4 C;  1MJB A;  2PCU A;  1X12 A;  3I1U A;  3TOB A;  2VI7 A;  1Y0R A;  1Z8X A;  3IWG A;  3FYN A;  1IYK A;  1Q2C A;  1BAV A;  1A2Z A;  2B58 A;  1N71 A;  3EFA A;  4IK2 A;  4R8F A;  4CGN A;  4DUK A;  3TO9 A;  2KCW A;  4B14 A;  4OIW A;  1MK4 A;  1S7K A;  4A38 A;  3WC7 A;  4KSF A;  1UWY A;  3CDX A;  3OWC A;  4GM5 A;  1GYT A;  1AMP A;  2EO8 A;  3WC6 A;  2QVP A;  5JGF A;  4KLV A;  2PRB A;  4P4J A;  4I49 A;  1ZG7 A;  2J9A A;  1M1D A;  1KUV A;  2VXK A;  3PB9 X;  3QB8 A;  4UFX A;  2HV2 A;  4J3G A;  4MFK A;  2QIR A;  4R6T A;  3D7D A;  3PFO A;  3R9E A;  2XEG A;  3F0A A;  2HQY A;  1CBX A;  4FD4 A;  3S9L A;  2R1I A;  3D2M A;  4BBH A;  2WUU A;  4CAW A;  3VAT A;  3KAS A;  1TKH A;  5AGE A;  5KTD A;  2PVW A;  1ARM A;  2CNS A;  3FEC A;  4JJX A;  3PFE A;  3DNS A;  1JWQ A;  4OC2 A;  4XPD C;  3S6G A;  3CXS A;  3VWE A;  1Q2Y A;  2Q4V A;  2PJ3 A;  1LRZ A;  1VIX A;  4RUH A;  4AVB A;  8CPA A;  3IFE A;  2B5G B;  4R76 A;  1Z2L A;  3BI1 A;  2FE7 A;  2K5T A;  2FIA A;  3D7H A;  3G8W A;  3IO1 A;  2RB7 A;  4B6Z A;  2ODF A;  1DTD A;  2C6G A;  4Z65 A;  3SXO A;  1H8L A;  2PSW A;  3WR7 A;  4B12 A;  1ARL A;  1BLL E;  1YRE A;  2DXQ A;  2JEV A;  3NE7 A;  3PRT A;  4Q7A A;  5HH1 A;  4FAI A;  4M3S A;  2BEI A;  4MFZ A;  4C7H A;  3SJX A;  3B2Y A;  5ISV A;  4NCZ A;  4KSA A;  1V0C A;  5HVF A;  1P4N A;  1Y9W A;  3FXT A;  3KQX A;  4JZ0 A;  4P4D A;  1BPM A;  5I4M A;  4C2Y A;  2REE A;  3PB8 X;  2WPX A;  4CYN A;  4JWP A;  3LOD A;  1Y0Y A;  3S9M A;  1QST A;  2F7V A;  1YME A;  4IUS A;  2PRQ A;  3NE8 A;  5K8O A;  4UEZ A;  2WSA A;  4FWU A;  3TO6 A;  2ZOG A;  4C68 A;  3D8P A;  2CXA A;  3S6K A;  2Q51 A;  3JTK A;  2O53 A;  1LOK A;  2DPT A;  3MN8 A;  4HPS A;  5G22 A;  1TKF A;  3EY5 A;  3SI0 A;  2ZW7 A;  4KUB A;  1Z5R A;  4Q36 A;  2J8M A;  5DS0 A;  2B3U A;  3F5B A;  4UFW A;  4UIB A;  5HXD A;  2GRE A;  4LQ6 A;  1M4D A;  4QB9 A;  4MY0 A;  5J1Q A;  1PYT B;  4TWE A;  1ZO0 A;  2H5M A;  4F8Z A;  2O4H A;  1IGB A;  1YVK A;  2AFO A;  2OR4 A;  3JUW A;  3PEI A;  1YW6 A;  4OC0 A;  5CNP A;  3S6H A;  4AB7 A;  4B5P A;  1Z8L A;  2WPW A;  3D66 A;  2ZEP A;  1I12 A;  1QQ9 A;  3VWD A;  3K2K A;  2QML A;  4E8O A;  3R1K A;  4MHN A;  2JBJ A;  2AFX A;  3B3T A;  4UCM A;  5IB0 A;  3P2H A;  5LYL A;  1BOB A;  2X7B A;  4YU9 A;  2Q4Y A;  5G20 A;  1LAN A;  2AFM A;  3L2N A;  1LAM A;  3BHX A;  4K3N A;  4KOW A;  2Q0Y A;  5JPH A;  2R98 A;  2Z0Z A;  2ZEH A;  3GUX A;  1BPN A;  4M6I A;  3TFY A;  1VHE A;  4CYP A;  1S7F A;  3IU2 A;  2FSR A;  2ATR A;  1CG2 A;  1PCA A;  1L0C A;  5I0C A;  3HUV A;  1M4G A;  1YW4 A;  2PJ4 A;  2R8V A;  2VZZ A;  1LAP A;  4A37 A;  4A2Z A;  2PJ7 A;  3IJ3 A;  3I3G A;  4CS0 B;  1CP6 A;  5K8N A;  1P0H A;  4P4I A;  2Q44 A;  2B4B A;  2Z10 A;  3IC1 A;  2ZW4 A;  5F48 A;  3D67 A;  4CGL A;  2PJ9 A;  2F5I A;  4NGQ A;  3FRM A;  1XOV A;  2ZPA A;  4KS9 A;  4KVX A;  4WJB A;  3QAH A;  4BIN A;  3NA6 A;  1M4I A;  3IWW A;  1VGY A;  2AFS A;  4CAF A;  1HEE A;  4RI1 A;  3VH9 A;  4XNH B;  4R3K A;  1CJW A;  4Q38 A;  2REF A;  1XBU A;  3C26 A;  5AG4 A;  4PXC A;  3SJF A;  4CPA A;  1WWZ A;  1OBR A;  2J8R A;  3F8K A;  2JDC A;  3ZZI A;  2EK8 A;  1FY7 A;  2NYQ A;  3D7F A;  2CTB A;  3KGQ A;  1PUA A;  4FD6 A;  4KUA A;  4RN7 A;  4B5O A;  4JXR A;  5A28 A;  5ELY A;  4MFP A;  1Z8T A;  3CZX A;  1U6M A;  4JXQ A;  4MFJ A;  4CYQ A;  3SXN A;  2PJ5 A;  3PZJ A;  2VZY A;  1YGH A;  2V8D A;  4UA3 A;  3RBU A;  4H89 A;  1Q7L A;  1XMT A;  2PR8 A;  4R3L A;  3S6F A;  3TTH A;  4NXY A;  3TC8 A;  2EK9 A;  1ON0 A;  2ZEG A;  1GHE A;  2WZN A;  3RNZ A;  3V38 A;  4F9U A;  3S9N A;  3RYO A;  4NGR A;  2IJZ A;  3FBU A;  4P6Y A;  3RAM A;  3KKW A;  1S7N A;  2VQY A;  3HLP A;  2Z3L A;  1YLO A;  4H6Z A;  3T9Y A;  2EUI A;  2C27 A;  5DWN A;  2ZW6 A;  2PIZ A;  1IB1 E;  2YND A;  3SI2 A;  3UY5 A;  4II9 A;  2DF5 A;  4XPK A;  4F9V A;  3WAB A;  3P2F A;  5C82 A;  4TNU A;  3KR4 A;  1ZG8 A;  1R3N A;  5LRK A;  2Z3P A;  2Q04 A;  2PJC A;  3V7Z A;  3MRU A;  4W9Y A;  2XEJ A;  5JQ4 A;  3T90 A;  5IV0 A;  4UEE A;  1VHS A;  4M6G A;  1R43 A;  4K30 A;  2FL4 A;  3PGP A;  4M6H A;  4CYO A;  1M4L A;  4NSQ A;  4UEF A;  1F2O A;  1YLE A;  2POK A;  4LUA A;  1QSO A;  2ZEL A;  5HMN A;  3FJU A;  3B35 A;  3BXM A;  3IWE A;  3VAR A;  3IGR A;  4P4F A;  5EBV A;  4OC4 A;  4C2Z A;  5FVJ A;  4MHY A;  5EMI A;  2RC4 A;  1F57 A;  4L8A A;  3B3C A;  3FED A;  4MCR A;  4KLW A;  1XRY A;  4OC1 A;  4PXD A;  1QSN A;  4CGO A;  1JQG A;  2JBK A;  3BLN A;  4HKF A;  5AG6 A;  1XIX A;  3B3S A;  3SJG A;  4P4B A;  4PPZ A;  1XMB A;  5DWM A;  1I21 A;  3FX6 A;  4EME A;  1YVO A;  2C6P A;  4MJ8 A;  3IIB A;  4ZY1 A;  3KHZ A;  3TX8 A;  3N7Z A;  3N5F A;  1YK3 A;  3BJ7 A;  4XPL A;  1XEB A;  1BO4 A;  3B3V A;  3DDD A;  3EXN A;  2A4N A;  2Q43 A;  1IU8 A;  2PVV A;  4NGP A;  4R57 A;  4XPD B;  4P10 A;  4CRZ B;  2FVG A;  2YNE A;  3TCV A;  4F0Y A;  2F8H A;  2P6F A;  2AE6 A;  1XJO A;  3FMC A;  4NGN A;  2BCO A;  4P4E A;  2P6E A;  5JM6 A;  4FD7 A;  5G21 A;  3H8E A;  1SQH A;  1Z9U A;  3GY9 A;  2Q4Z A;  4B10 A;  3WT4 A;  1ZLI A;  3LWU A;  2G9D A;  3PB6 X;  4H6U A;  4JYW A;  4P45 A;  4ZY0 A;  2PIY A;  3WC5 A;  4ZYQ A;  5HVH A;  3B3W A;  3G3S A;  4DJL A;  3JVN A;  4KVO E;  2PJB A;  4GS4 A;  5BWA B;  5JH9 A;  4R87 A;  2P0W A;  5F49 A;  3FF3 A;  4OC5 A;  4A31 A;  5A27 A;  4U9Y A;  3PB4 X;  2BL1 A;  2PDO A;  4YGO A;  4BD9 A;  2QJ8 A;  4MXU A;  1B87 A;  4OC3 A;  3NFZ A;  4EVY A;  3QAY A;  4A30 A;  2Q7S A;  2RFH A;  2AFW A;  3IEH A;  4NJQ A;  4IF5 A;  2B5G A;  4A33 A;  2B4D A;  2GAN A;  3H8F A;  3D3S A;  3KI9 A;  2NSM A;  2I79 A;  4NJR A;  4ZGY B;  4R7M A;  3DLJ A;  1Q2D A;  3ISX A;  3KR5 A;  2B3V A;  1MJ9 A;  1QSM A;  2BUE A;  4Y49 C;  3TOA A;  4MY3 A;  1KWM A;  6CPA A;  4A94 A;  2YGW A;  4A32 A;  4MFQ A;  1KZF A;  1ELL P;  1RO5 A;  2WYR A;  4WWV A;  1B6B A;  2GE3 A;  5LYF A;  3E0K A;  3EO4 A;  2I3C A;  5J8F A;  5AG7 A;  2V8V A;  4MHD A;  4P44 A;  2XEI A;  3FH4 A;  4ORF A;  3R95 A;  4ZI6 A;  5LRG A;  2ANP A;  3W6X A;  1YQE A;  4QVT A;  3BI0 A;  3D68 A;  1NMT A;  3GIU A;  2Z3O A;  3PBE A;  3JRU A;  3D7G A;  1Z4R A;  2OOT A;  3B8G A;  3KZW A;  2FIW A;  4JD6 A;  1LCP A;  2CNT A;  2BO9 A;  1YX0 A;  3FB3 A;  3RO0 A;  4U9Z A;  4NGM A;  2BOA A;  3GLJ A;  1K4J A;  4U5Y A;  2GU2 A;  2CTC A;  3W6S A;  1RTQ A;  2PJ6 A;  4CAV A;  1HDU A;  1LFW A;  1YSJ A;  2PJ0 A;  3GKR A;  2C1C A;  2FCK A;  3FVL A;  2OU2 A;  2D4O A;  1S60 A;  2GLJ A;  2IMO A;  3SHP A;  1FNO A;  2CF4 A;  5D8N A;  3ISZ A;  3FEE A;  3GB0 A;  2ARH A;  2ZEE A;  4JLY A;  2HB6 A;  1J4J A;  4AG7 A;  1S7L A;  3DR8 A;  3W91 A;  3MGD A;  4OAD A;  4PQA A;  1TF8 A;  1TXR A;  1IOI A;  2G0B A;  3RZA A;  5KTA A;  2AFZ A;  5E96 A;  2CIJ A;  4UCP A;  1TKJ A;  2FXF A;  2XEF A;  1NSA A;  2I00 A;  4OME A;  3PP9 A;  5THW A;  1RXT A;  2OZG A;  2AFU A;  2EVN A;  2JEW A;  3R96 A;  1I1D A;  4MHP A;  4EWT A;  2BSW A;  2QEC A;  2G3A A;  2ZEO A;  4ZX9 A;  4DNC A;  1CPS A;  5H84 A;  3LD2 A;  4CAE A;  5HVG A;  2G3T A;  1XF8 A;  2JDD A;  3KHX A;  4AG9 A;  1Y7E A;  1EE3 P;  4FUU A;  4PK3 A;  2ZEM A;  4ZBG A;  4X3R A;  1TF9 A;  4KOV A;  4KVM E;  2Z3K A;  3SI1 A;  4PV6 A;  2PJ8 A;  5GCN A;  4UCN A;  3CPA A;  1F2P A;  3TO7 A;  2EBJ A;  1PU9 A;  3IU1 A;  4L89 A;  2IQ6 A; 
#chains in the Genus database with same CATH homology
 5D29 A;  4MRI A;  2PE3 A;  4X2T A;  4EFD A;  5LYD A;  1ELM P;  2PJ1 A;  1VHO A;  4MCP A;  2VL1 A;  3B7I A;  1CPX A;  2ZEF A;  4IHM A;  2ABZ A;  3K9T A;  3CPX A;  1AYE A;  3D4U A;  4MMO A;  2V8H A;  4DYO A;  4G1P A;  1HDQ A;  2V77 A;  4MCS A;  2QYV A;  2ZEN A;  4IAV A;  1FT7 A;  3T8W A;  4ONW A;  3KL9 A;  2DEA A;  7CPA A;  1ZG9 A;  1XFO A;  2HC9 A;  4ZX8 A;  4OID A;  2ZOF A;  3PB7 X;  4FBE A;  4MCQ A;  3QNV A;  3DGV A;  1CP7 A;  1CX8 A;  4X8I A;  3H8G A;  4H2K A;  4AXV A;  4PXE A;  4LQG A;  5F09 A;  4PXB A;  5K8P A;  5IB9 A;  2EWB A;  3NH8 A;  5K8M A;  5LRJ A;  3NH5 A;  4OP4 A;  3KQZ A;  3SJE A;  2GLF A;  4KSI A;  1QMU A;  3CT9 A;  5LYI A;  4NGT A;  3PBB A;  4MHZ A;  4UIA A;  3LMS A;  4NGS A;  4O23 A;  2ZED A;  4OKO A;  1ZLH A;  4A39 A;  5CPA A;  2V8G A;  5CBM A;  4NFR A;  4ZY2 A;  4UF4 A;  3NH4 A;  1IY7 A;  2PJA A;  2PJ2 A;  4YWY A;  2C6C A;  1DE4 C;  2PCU A;  3I1U A;  1Y0R A;  1BAV A;  4IK2 A;  4R8F A;  4DUK A;  4OIW A;  4A38 A;  3WC7 A;  1UWY A;  3CDX A;  4GM5 A;  1GYT A;  1AMP A;  3WC6 A;  2QVP A;  5JGF A;  4P4J A;  1ZG7 A;  2J9A A;  3PB9 X;  4R6T A;  3D7D A;  3PFO A;  2XEG A;  1CBX A;  3S9L A;  3VAT A;  3KAS A;  1TKH A;  2PVW A;  1ARM A;  3FEC A;  3PFE A;  4OC2 A;  2PJ3 A;  1VIX A;  4RUH A;  8CPA A;  3IFE A;  4R76 A;  1Z2L A;  3BI1 A;  4B6Z A;  3D7H A;  3IO1 A;  2RB7 A;  1DTD A;  2C6G A;  4Z65 A;  1H8L A;  1ARL A;  1BLL E;  4Q7A A;  3PRT A;  4FAI A;  3SJX A;  3B2Y A;  5HVF A;  3KQX A;  4P4D A;  4JZ0 A;  1BPM A;  5I4M A;  3PB8 X;  1Y0Y A;  3S9M A;  2F7V A;  1YME A;  2PRQ A;  5K8O A;  4UEZ A;  4FWU A;  2ZOG A;  2Q51 A;  2O53 A;  1LOK A;  3MN8 A;  1TKF A;  3SI0 A;  1Z5R A;  5DS0 A;  4UIB A;  5HXD A;  2GRE A;  5J1Q A;  1PYT B;  4TWE A;  4F8Z A;  1IGB A;  2O4H A;  2AFO A;  2OR4 A;  4OC0 A;  3PEI A;  1YW6 A;  1Z8L A;  3D66 A;  2ZEP A;  1QQ9 A;  3K2K A;  4MHN A;  2JBJ A;  2AFX A;  3B3T A;  5LYL A;  4YU9 A;  1LAN A;  2AFM A;  3L2N A;  1LAM A;  3BHX A;  4K3N A;  2ZEH A;  3GUX A;  1BPN A;  1VHE A;  1CG2 A;  1PCA A;  3HUV A;  1YW4 A;  2PJ4 A;  4A37 A;  1LAP A;  2PJ7 A;  3IJ3 A;  1CP6 A;  5K8N A;  4P4I A;  3IC1 A;  3D67 A;  2PJ9 A;  4NGQ A;  4WJB A;  3NA6 A;  3IWW A;  1VGY A;  2AFS A;  1HEE A;  3VH9 A;  1XBU A;  4PXC A;  3SJF A;  4CPA A;  1OBR A;  2EK8 A;  2NYQ A;  3D7F A;  2CTB A;  3KGQ A;  5ELY A;  2PJ5 A;  3RBU A;  2V8D A;  1Q7L A;  3TC8 A;  2EK9 A;  2ZEG A;  2WZN A;  3V38 A;  4F9U A;  3S9N A;  4NGR A;  2IJZ A;  4P6Y A;  3RAM A;  3HLP A;  1YLO A;  2PIZ A;  3SI2 A;  4F9V A;  3WAB A;  4TNU A;  3KR4 A;  1ZG8 A;  1R3N A;  5LRK A;  2PJC A;  3V7Z A;  3MRU A;  4W9Y A;  2XEJ A;  4UEE A;  1R43 A;  1M4L A;  4UEF A;  1F2O A;  2POK A;  2ZEL A;  3B35 A;  3BXM A;  3VAR A;  4P4F A;  4OC4 A;  4MHY A;  1F57 A;  3B3C A;  3FED A;  4MCR A;  1XRY A;  4OC1 A;  4PXD A;  1JQG A;  2JBK A;  3B3S A;  3SJG A;  4P4B A;  4PPZ A;  1XMB A;  4EME A;  3FX6 A;  2C6P A;  3IIB A;  4ZY1 A;  3KHZ A;  3TX8 A;  3N5F A;  3B3V A;  2Q43 A;  2PVV A;  4NGP A;  4P10 A;  2FVG A;  2F8H A;  1XJO A;  3FMC A;  4NGN A;  2BCO A;  4P4E A;  5JM6 A;  3H8E A;  2Q4Z A;  3WT4 A;  1ZLI A;  3LWU A;  2G9D A;  3PB6 X;  4JYW A;  4P45 A;  4ZY0 A;  2PIY A;  3WC5 A;  4ZYQ A;  5HVH A;  3B3W A;  4DJL A;  2PJB A;  5JH9 A;  3FF3 A;  4OC5 A;  3PB4 X;  4BD9 A;  2QJ8 A;  4MXU A;  4OC3 A;  3NFZ A;  2RFH A;  2AFW A;  3IEH A;  4NJQ A;  3H8F A;  3KI9 A;  2NSM A;  4NJR A;  4R7M A;  3DLJ A;  3ISX A;  3KR5 A;  6CPA A;  1KWM A;  4A94 A;  1ELL P;  2WYR A;  4WWV A;  5LYF A;  2I3C A;  2V8V A;  4P44 A;  2XEI A;  3FH4 A;  4ZI6 A;  5LRG A;  2ANP A;  3BI0 A;  3D68 A;  3PBE A;  3JRU A;  3D7G A;  2OOT A;  3KZW A;  1LCP A;  2BO9 A;  4NGM A;  2BOA A;  3GLJ A;  2GU2 A;  2CTC A;  1RTQ A;  2PJ6 A;  1HDU A;  1LFW A;  1YSJ A;  2PJ0 A;  2C1C A;  3FVL A;  2GLJ A;  2IMO A;  1FNO A;  2CF4 A;  5D8N A;  3ISZ A;  3FEE A;  3GB0 A;  2ZEE A;  2HB6 A;  4PQA A;  1TF8 A;  1TXR A;  3RZA A;  2AFZ A;  2CIJ A;  1TKJ A;  2XEF A;  1NSA A;  4OME A;  5THW A;  2AFU A;  2JEW A;  4MHP A;  4EWT A;  2ZEO A;  4ZX9 A;  1CPS A;  5HVG A;  3KHX A;  1Y7E A;  1EE3 P;  4FUU A;  2ZEM A;  4X3R A;  1TF9 A;  3SI1 A;  2PJ8 A;  3CPA A;  1F2P A;  3FJU A;  2IQ6 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...