3B7IA

Crystal structure of the s228a mutant of the aminopeptidase from vibrio proteolyticus in complex with leucine phosphonic acid
Total Genus 111
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
111
sequence length
291
structure length
291
Chain Sequence
MPPITQQATVTAWLPQVDASQITGTISSLESFTNRFYTTTSGAQASDWIASEWQALSASLPNASVKQVSHSGYNQKSVVMTITGSEAPDEWIVIGGHLDSTIGSHTNEQSVAPGADDDASGIAAVTEVIRVLSENNFQPKRSIAFMAYAAEEVGLRGSQDLANQYKSEGKNVVSALQLDMTNYKGSAQDVVFITDYTDSNFTQYLTQLMDEYLPSLTYGFDTCGYACADHASWHNAGYPAAMPFESKFNDYNPRIHTTQDTLANSDPTGSHAKKFTQLGLAYAIEMGSATG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Bacterial leucyl aminopeptidase
publication title Zinc coordination geometry and ligand binding affinity: the structural and kinetic analysis of the second-shell serine 228 residue and the methionine 180 residue of the aminopeptidase from Vibrio proteolyticus.
pubmed doi rcsb
source organism Vibrio proteolyticus
molecule tags Hydrolase
total genus 111
structure length 291
sequence length 291
ec nomenclature ec 3.4.11.10: Bacterial leucyl aminopeptidase.
pdb deposition date 2007-10-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF04389 Peptidase_M28 Peptidase family M28
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.630.10 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Zn peptidases 3b7iA00
2PJ9A 3ISXA 4ZY2A 4RUHA 2QYVA 3KR5A 4NGMA 4P6YA 4MHYA 2ZEPA 2FVGA 4UEZA 1F2OA 3PB4X 3CT9A 5LRKA 3IWWA 4EFDA 3PFEA 2PJ3A 2PJ6A 3K2KA 4IAVA 4ZYQA 2GLJA 1YSJA 1GYTA 3S9LA 2F8HA 3CPAA 1ARMA 2EK9A 2ZEOA 3KI9A 1TXRA 1TKJA 4ZY0A 3HUVA 1HDUA 1IGBA 3NA6A 2BO9A 3FECA 4MHNA 3L2NA 2O4HA 4UIAA 5LRJA 3GB0A 1ELMP 3PB9X 1Y7EA 1PCAA 4LQGA 5F09A 3D7GA 3BI0A 1LANA 2C6GA 5JGFA 3S9MA 1XMBA 4Q7AA 3B3TA 3WC5A 4OKOA 1BPNA 2NSMA 2JBKA 2PE3A 1LCPA 4MRIA 2GU2A 2PJ2A 1FNOA 4F9VA 3IEHA 1VIXA 5I4MA 2ZEEA 1ZG8A 4FWUA 2V8HA 4X8IA 3RZAA 1LFWA 3DGVA 3B3WA 4MCSA 2XEJA 4EMEA 1XFOA 5K8OA 2AFXA 3MN8A 4UIBA 3FEEA 4X3RA 3PBEA 2QVPA 3FH4A 1TKHA 3BHXA 4F9UA 2PJ1A 2V77A 4FBEA 3WABA 4TNUA 3IIBA 1Q7LA 1YLOA 1ZLIA 3MRUA 3B3SA 4NGTA 4FUUA 4R76A 4OC5A 3VATA 5LYDA 3FVLA 4P44A 1NSAA 3D67A 1ELLP 2WZNA 3FEDA 2CTCA 2C6CA 3D7HA 2GLFA 3CPXA 5CPAA 4EWTA 3PB8X 2ABZA 4R8FA 5HVFA 3SJFA 3KL9A 1BPMA 1HEEA 5HVHA 5IB9A 1FT7A 2AFZA 5J1QA 3TC8A 4R7MA 3D66A 5LYIA 1CBXA 2PVVA 3FMCA 4MMOA 3PFOA 3PEIA 2V8VA 3D68A 1Z8LA 2ZEMA 2V8DA 4O23A 4ONWA 4DJLA 1XJOA 3H8GA 4MCPA 3DLJA 4KSIA 4IHMA 2F7VA 3KASA 1CPSA 4B6ZA 4P4EA 2G9DA 4G1PA 1YMEA 4MHZA 4NGNA 3KHZA 3FF3A 2IQ6A 3RAMA 2EWBA 1M4LA 4OC3A 5K8PA 1VHOA 1CX8A 2BOAA 4UEFA 3WC7A 1HDQA 8CPAA 5HXDA 1TKFA 5ELYA 4JYWA 1ARLA 2AFSA 5HVGA 2PJ4A 1XBUA 2ZOGA 3SI1A 2HC9A 2ZELA 2Q51A 3SI2A 2ZENA 1Z5RA 2PJ7A 4ZX9A 4MXUA 4TWEA 4NGQA 2ZEFA 2PCUA 2PIYA 4ZX8A 3D7DA 4W9YA 4PPZA 3B3CA 4WWVA 4UF4A 4NGRA 3PB6X 4PQAA 3RBUA 3BXMA 3B35A 3NH4A 1R3NA 4R6TA 2AFOA 4MCQA 4ZI6A 3KGQA 3FX6A 3KR4A 4P4FA 3H8EA 1LOKA 2PJCA 2CTBA 3NFZA 1TF9A 2ZEDA 2IMOA 4MHPA 1H8LA 1Z2LA 5K8NA 4P4IA 3PRTA 1RTQA 3KQZA 3V7ZA 2EK8A 3N5FA 4GM5A 3WC6A 2C6PA 4P10A 2ZEHA 2AFUA 3VARA 1YW4A 4P4JA 4OC4A 4A94A 5K8MA 3S9NA 4OIWA 5D29A 1R43A 2J9AA 3D7FA 2RB7A 4A37A 1LAMA 2XEFA 3B7IA 1BAVA 1CPXA 3K9TA 3WT4A 3LMSA 1IY7A 4IK2A 4AXVA 2XEIA 3T8WA 5D8NA 1LAPA 3SJXA 2PJ5A 4OC0A 4Z65A 1AYEA 4P45A 4ZY1A 7CPAA 4WJBA 3IO1A 3SI0A 2Q43A 4NFRA 2BCOA 4OMEA 4BD9A 3IFEA 5DS0A 2NYQA 3ISZA 3I1UA 4F8ZA 2GREA 3KZWA 2PJ8A 2AFMA 2QJ8A 3B3VA 3QNVA 3SJGA 2Q4ZA 3KHXA 2RFHA 4P4BA 1CP7A 4A39A 2PJAA 2JEWA 1DE4C 5LRGA 2PVWA 2PJBA 4H2KA 4YU9A 1ZLHA 3LWUA 4X2TA 3SJEA 3FJUA 2OOTA 2V8GA 5LYLA 1Y0RA 2ZOFA 4NJQA 4OIDA 3H8FA 6CPAA 2DEAA 4NGPA 1VGYA 3GLJA 3PB7X 1EE3P 2O53A 3NH8A 4PXBA 4K3NA 3KQXA 1AMPA 2CIJA 2C1CA 1ZG7A 1VHEA 4MCRA 4UEEA 5THWA 2PIZA 4CPAA 1ZG9A 1PYTB 4PXDA 4NGSA 3HLPA 3IC1A 2POKA 3GUXA 2CF4A 3V38A 1QQ9A 4PXCA 4DUKA 1F2PA 4YWYA 1XRYA 1CP6A 4OP4A 2IJZA 5CBMA 3BI1A 5LYFA 2AFWA 4PXEA 4NJRA 4FAIA 2WYRA 2I3CA 3IJ3A 1F57A 3CDXA 2VL1A 1QMUA 1UWYA 1DTDA 3PBBA 3JRUA 3TX8A 4P4DA 2HB6A 4OC2A 1OBRA 2JBJA 4OC1A 3NH5A 1TF8A 1JQGA 4JZ0A 2ZEGA 5JH9A 1BLLE 2OR4A 2ANPA 1YW6A 1KWMA 2PJ0A 4A38A 1CG2A 4DYOA 1Y0YA 3VH9A 5JM6A 2PRQA 3D4UA 2XEGA 3B2YA
chains in the Genus database with same CATH superfamily
2PJ9A 3ISXA 4ZY2A 4RUHA 2QYVA 2VZZA 3KR5A 2Q4YA 4NGMA 4P6YA 4M85A 1VKCA 4MJ8A 4C7HA 4MHYA 5ISVA 1QSMA 3ZZIA 1N71A 2ZEPA 5HH1A 2FVGA 2OZHA 3S6GA 4M6IA 4CAEA 1MK4A 4UEZA 2EVNA 2YNCC 1F2OA 2B5GA 3PB4X 4A32A 4OLLA 4KOVA 2BSWA 3CT9A 4CGOA 3E0KA 5LRKA 2Q0YA 3IWWA 3PFEA 2FSRA 4B14A 4EFDA 3D2MA 2PJ3A 1YGHA 2PJ6A 5F49A 3R9FA 1XF8A 3RNZA 2Q4VA 5J8CA 4JXQA 3SHPA 4FD5A 5F47A 3K2KA 2B4DB 3SXOA 4BMHA 4IUSA 4IAVA 4II9A 3TT2A 4ZYQA 2HUZA 2GLJA 2DXQA 1YSJA 1GYTA 4U9ZA 2F8HA 5JPHA 3S9LA 3CPAA 1ARMA 4KSAA 4ZGYB 3A9LA 2EK9A 2ZEOA 2Z11A 3IWGA 3KI9A 3FRMA 2DPTA 1TXRA 2VQYA 1TKJA 3ZJ0A 4ZY0A 1R57A 3HUVA 1Z4EA 3LODA 1HDUA 1IGBA 3NA6A 2BO9A 3FECA 1Z8TA 4YRHA 3F5BA 4Y49B 4JXRA 4MHNA 4B13A 3L2NA 1JWQA 2O4HA 4Q38A 4UIAA 5LRJA 4C68A 2GFQA 3GB0A 3TFYA 1ELMP 4X5KA 2GIVA 3PB9X 4CRYB 5F48A 1WWZA 1Y7EA 3CXSA 1PCAA 4LQGA 4CAVA 3D7GA 3BI0A 5F09A 2OU2A 1LANA 2C6GA 3D8PA 4A33A 2Z3PA 5JGFA 1IYKA 4PK3A 1XMBA 3S9MA 4E2AA 2ZXVA 2Q7BA 2EUIA 4AVBA 3DR6A 5G1ZA 1YQEA 4Q7AA 1UFHA 3B3TA 3WC5A 4CAFA 3EC4A 3JTKA 4OKOA 2DF5A 4YGOA 1BPNA 1YREA 2NSMA 4CGLA 4CS0B 2WPXA 1BOBA 4KSFA 2Z3LA 3GY9A 3TO7A 2JBKA 1M1DA 1MJBA 4CAXA 2PE3A 3IU2A 2GANA 1LCPA 5H84A 4MRIA 2IL4A 2GU2A 2PJ2A 3GIUA 1FNOA 3BLNA 4R3LA 1IOIA 4F9VA 1P4NA 3IEHA 2B58A 1VIXA 4A2ZA 5DWMA 5I4MA 2ZEEA 1ZG8A 4AB7A 5AG4A 1TIQA 3QAYA 4FWUA 4GS4A 3W6SA 4E0AA 2FT0A 2V8HA 2HQYA 4X8IA 1LFWA 1B87A 3RZAA 3DGVA 3B3WA 1S60A 4JD6A 1XMTA 4XPKA 2REFA 2XEJA 4MCSA 4EMEA 2ARHA 1XFOA 5IV0A 5K8OA 2FIAA 3JUWA 4ONUA 5AG6A 4KOSA 2AFXA 4AG9A 4F0XA 4NSQA 3MN8A 4UIBA 3FEEA 4X3RA 4KOTA 5BWAB 3PBEA 4AXVA 2QVPA 3FH4A 4U9YA 1TKHA 4YFJA 5JQ4A 4ZBGA 3BHXA 4F9UA 1YK3A 2NMTA 1FY7A 3V8IA 3QB8A 2PJ1A 2V77A 4FBEA 5KTAA 3WABA 4TNUA 3DSBA 2OB0A 1Q7LA 1YLOA 1NE9A 1ZLIA 3GKRA 3IIBA 1X10A 2HV2A 1S7NA 2D4PA 2F5IA 2P6EA 3D2PA 3MRUA 4B11A 3B3SA 4NGTA 3FB3A 3CXQA 4FUUA 2Z3OA 4R76A 4OC5A 3VATA 4UWIA 5LYDA 3FVLA 3DNSA 4P44A 1NSAA 3D67A 1ELLP 2WZNA 3FEDA 1MJ9A 3IGRA 2CTCA 2C6CA 3D7HA 2GLFA 3CPXA 4B5PB 5F46A 5CPAA 4EWTA 3PB8X 2ABZA 4R8FA 2K5TA 4FD6A 5HVFA 3PGPA 3I3GA 3R1KA 3SJFA 4F0YA 2I00A 5HXDA 2PSWA 1AUGA 1KZFA 4MBUA 1KUYA 4HNWB 3KL9A 4QUSA 5I0CA 4GXHA 2Q7SA 1BPMA 1HEEA 1I21A 4JWPA 4KUBA 5HVHA 5IB9A 1X12A 1FT7A 2AFZA 4R57A 5J1QA 2BL1A 3EY5A 3TC8A 4CGPA 3G8WA 2FCKA 4R7MA 3D66A 5LYIA 1CBXA 4HNXB 2PVVA 4M3SA 2G3AA 3FMCA 4MMOA 3CXPA 3PFOA 3PEIA 4MY0A 3WR7A 4MY3A 4ORFA 2V8VA 3D68A 4KOXA 2VEZA 1Z8LA 3FNCA 4I49A 3S6KA 2X7BA 2ZEMA 2V8DA 4O23A 2Z10A 4ONWA 4DJLA 1XJOA 1A2ZA 2AJ6A 3D3SA 1V0CA 4IF5A 3H8GA 4MFJA 2P0WA 4MCPA 3DLJA 3S6HA 2PDOA 4KSIA 4IHMA 2F7VA 3KASA 2REEA 3GYAA 1CPSA 2VZYA 4B6ZA 4P4EA 4R9MA 2G9DA 1S5KA 4PSXA 4G1PA 5G21A 3BJ8A 1YMEA 3LD2A 4MHZA 4NGNA 4AG7A 3KHZA 4A30A 1YR0A 3IU1A 4KLWA 3FF3A 2FIWA 4H6UA 3R95A 1YVOA 4MHDA 4LX9A 2IQ6A 4AVAA 1IICA 4NCZA 3RAMA 3IWEA 4PV6A 4C2ZA 4UCNA 1S7LA 2EWBA 3G3SA 1M4LA 4J3GA 4UA3A 4BINA 4MFPA 4OC3A 4C7IA 4QC6A 5K8PA 3FYNA 1Z8XA 2BOAA 1VHOA 1CX8A 2ZW6A 4KUAA 1HDQA 4UEFA 1MJAA 3WC7A 3N7ZA 5AG7A 1TKFA 5ELYA 8CPAA 4JYWA 1ARLA 2AFSA 2KCWA 3EO4A 5HVGA 2PJ4A 1XBUA 4NF1A 1XOVA 2ZOGA 3SI1A 3TOAA 3FXTA 2HC9A 4F6AA 2ZELA 4KOUA 5EMIA 5HMNA 2B4DA 2Q51A 3NE8A 3SI2A 3W6XA 2ZENA 3VWEA 1Z5RA 2PJ7A 4ZX9A 4MXUA 2VI7A 3F8KA 2FXFA 4XPDB 4TWEA 2PC1A 3RO0A 4NGQA 5C82A 1Q2DA 4H6ZA 2ZEFA 1CJWA 2PCUA 2PIYA 1LRZA 2G0BA 2WSAA 2ZW7A 4ZX8A 3D7DA 3DDDA 4PPZA 4W9YA 1ZO0A 3B3CA 1I1DA 1S3ZA 4WWVA 4UF4A 2H5MA 1Q2CA 4NGRA 1M4IA 4MFQA 3PB6X 4PQAA 3RBUA 3BXMA 4MFKA 3B35A 2JDCA 1XEBA 3NH4A 5GCNA 2YNEA 4L89A 3R96A 1R3NA 4R6TA 3VWDA 2OZUA 1Z9UA 2AFOA 4MCQA 4ZI6A 4XNHB 3KGQA 3FX6A 1VHSA 3KR4A 4P4FA 3H8EA 1LOKA 3TO9A 2FS5A 3RYOA 4R87A 5CNPA 2PJCA 4C2XA 2CNTA 2CTBA 4M6HA 4QB9A 4UWJA 3NFZA 2WPWA 4HNYB 1TF9A 2ZEDA 2FL4A 4JJXA 2IMOA 4HKFA 4MHPA 3F0AA 1H8LA 1Z2LA 1IYLA 5H86A 4P4IA 3PRTA 5K8NA 1RTQA 4KVOE 1Y9WA 4OAEA 3KQZA 4UFXA 2CNSA 2BUEA 1NSLA 3V7ZA 4RI1A 1Z4RA 4LQ6A 2EK8A 3TO6A 3N5FA 2D4OA 4GM5A 3WC6A 2ODFA 4Q36A 2CNMA 2C6PA 4P10A 1KUXA 4XPDC 2ZEHA 4KVME 4KOYA 4CYQA 2AFUA 2VBQA 2CY2A 4KLVA 1K4JA 3VARA 4A95A 4BBHA 1YW4A 4P4JA 5E96A 1XE4A 2B5GB 1QSNA 2PR8A 4OC4A 3T90A 4A94A 4OIWA 5D29A 5K8MA 3S9NA 1R43A 2J9AA 4KOWA 2BEIA 3D7FA 3DR8A 2AE6A 1Z8WA 2RB7A 4A37A 1B6BA 1LAMA 2XEFA 4LUAA 2EBJA 2Z3MA 3TOBA 2YNCA 3B7IA 1BAVA 1CPXA 3K9TA 4UFWA 3WT4A 2Q44A 3LMSA 1IY7A 2JDDA 4IK2A 3MGDA 4NXYA 4XNHC 1KUVA 2XEIA 3R9EA 5D8NA 3T8WA 1LAPA 4MFLA 4E8OA 3SJXA 2PJ5A 4OC0A 4Z65A 1AYEA 4P45A 4ZY1A 7CPAA 4WJBA 2PQ8A 3P2HA 2YNDA 3IO1A 3EXNA 3SI0A 1M4GA 1Y7RA 4C2YA 3K9UA 4MFZA 2Q43A 4NFRA 2BCOA 2B3UA 4FD4A 1ON0A 4OMEA 3LACA 4UFVA 4MI4A 4BD9A 5A28A 3IFEA 1GHEA 1IIDA 2Z0ZA 3R9GA 5DS0A 5IB0A 1NMTA 2NYQA 1PU9A 5J8FA 3ISZA 4UCMA 2WUUA 3I1UA 2VXKA 4QVTA 5IX3A 2JLMA 4B5PA 3QAHA 3JVNA 4F8ZA 2PR1A 2GREA 3KZWA 1P0HA 2PJ8A 1YLEA 4NEXA 5G20A 3TE4A 1YX0A 3FIXA 2AFMA 2QJ8A 3B3VA 3QNVA 3SJGA 2Q4ZA 2R7HA 2RFHA 3KHXA 3PP9A 4P4BA 1CP7A 4A39A 2PJAA 2JEWA 1DE4C 5LRGA 2PVWA 3KKWA 1SQHA 1IB1E 2PJBA 2ATRA 4H2KA 4YU9A 4B12A 1M44A 4U5YA 1ZLHA 1CM0A 1M4DA 2J8MA 1BO4A 3LWUA 2FE7A 4X2TA 3FBUA 3SJEA 4QBJA 3FJUA 4RS2A 1Q2YA 3S6FA 2OOTA 2V8GA 1U6MA 2P6FA 5LYLA 1Y0RA 2GE3A 2ZOFA 4NJQA 4OIDA 3H8FA 6CPAA 2JEVA 3H5ZA 4L8AA 3T9YA 2DEAA 2P6GA 4NGPA 1VGYA 3GLJA 3W91A 3PB7X 4KORA 4CYPA 1EE3P 2O53A 5KTCA 2PRBA 2QECA 3NH8A 3SXNA 4PXBA 5C88A 4K3NA 3KQXA 1AMPA 2DPSA 2CIJA 2Z3KA 4OADA 4B10A 2OH1A 2C1CA 1ZG7A 1VHEA 4KZTA 2G3TA 4MCRA 4UEEA 5THWA 2EO8A 2PIZA 4CPAA 1ZG9A 3C26A 1PYTB 2CXAA 4UBRA 3H4QA 3TTHA 4KS9A 1XIXA 1OZPA 4PXDA 2A4NA 4XPLA 4NGSA 2J8NA 3HLPA 2ZW5A 5FVJA 1QSRA 3IC1A 2POKA 3GUXA 2CF4A 2O28A 4EVYA 3V38A 3OWCA 1QQ9A 4PXCA 2QIRA 4DUKA 1F2PA 1IOFA 4YWYA 2I79A 1XRYA 4DNCA 2RC4A 5KTDA 1CP6A 4FD7A 4OP4A 2IJZA 5CBMA 3BI1A 1QSTA 4Y49C 5LYFA 3PZJA 2AFWA 2ZW4A 4M6GA 4PXEA 2QMLA 4NJRA 4FAIA 2WYRA 2B4BA 2I3CA 1F57A 3IJ3A 5AGEA 5A27A 4UCPA 1S7FA 3CDXA 2ZPAA 2VL1A 3BJ7A 3TCVA 2Z3NA 1QMUA 5G22A 4AVCA 3CZXA 2Y0MA 1L0CA 4PK2A 2R1IA 4RN7A 2YGWA 4HPSA 1UWYA 1Y9KA 4CYNA 1DTDA 3PBBA 1RXTA 4R3KA 3JRUA 3TX8A 4P4DA 5EC4A 1YVKA 4CYOA 2HB6A 2OZGA 1OBRA 4OC2A 2JBJA 4CGMA 3UY5A 2B3VA 4OC1A 3NH5A 2J8RA 3P2FA 1TF8A 2R8VA 1JQGA 5EBVA 1PUAA 4JZ0A 3EFAA 2C27A 3NE7A 2ZEGA 5JH9A 5DWNA 1BLLE 1J4JA 1S7KA 4CAWA 2OR4A 4JLYA 4CGNA 4A31A 2ANPA 2R98A 1YW6A 1KWMA 2PJ0A 4H89A 5AG5A 3B8GA 4A38A 1CG2A 4DYOA 1Y0YA 4K30A 3VH9A 1I12A 5JM6A 2PRQA 3D4UA 2Q04A 2XEGA 4CRZB 1RO5A 1IU8A 3I9SA 1WK4A 4KVXA 4PSWA 3B2YA 1QSOA 4B5OA
chains in the Genus database with same CATH topology
2PJ9A 3ISXA 4ZY2A 4RUHA 2QYVA 3KR5A 4NGMA 4P6YA 4MHYA 2ZEPA 2FVGA 4UEZA 1F2OA 3PB4X 3CT9A 5LRKA 3IWWA 4EFDA 3PFEA 2PJ3A 2PJ6A 3K2KA 4IAVA 4ZYQA 2GLJA 1YSJA 1GYTA 3S9LA 2F8HA 3CPAA 1ARMA 2EK9A 2ZEOA 3KI9A 1TXRA 1TKJA 4ZY0A 3HUVA 1HDUA 1IGBA 3NA6A 2BO9A 3FECA 4MHNA 3L2NA 2O4HA 4UIAA 5LRJA 3GB0A 1ELMP 3PB9X 1Y7EA 1PCAA 4LQGA 5F09A 3D7GA 3BI0A 1LANA 2C6GA 5JGFA 3S9MA 1XMBA 4Q7AA 3B3TA 3WC5A 4OKOA 1BPNA 2NSMA 2JBKA 2PE3A 1LCPA 4MRIA 2GU2A 2PJ2A 1FNOA 4F9VA 3IEHA 1VIXA 5I4MA 2ZEEA 1ZG8A 4FWUA 2V8HA 4X8IA 3RZAA 1LFWA 3DGVA 3B3WA 4MCSA 2XEJA 4EMEA 1XFOA 5K8OA 2AFXA 3MN8A 4UIBA 3FEEA 4X3RA 3PBEA 2QVPA 3FH4A 1TKHA 3BHXA 4F9UA 2PJ1A 2V77A 4FBEA 3WABA 4TNUA 3IIBA 1Q7LA 1YLOA 1ZLIA 3MRUA 3B3SA 4NGTA 4FUUA 4R76A 4OC5A 3VATA 5LYDA 3FVLA 4P44A 1NSAA 3D67A 1ELLP 2WZNA 3FEDA 2CTCA 2C6CA 3D7HA 2GLFA 3CPXA 5CPAA 4EWTA 3PB8X 2ABZA 4R8FA 5HVFA 3SJFA 3KL9A 1BPMA 1HEEA 5HVHA 5IB9A 1FT7A 2AFZA 5J1QA 3TC8A 4R7MA 3D66A 5LYIA 1CBXA 2PVVA 3FMCA 4MMOA 3PFOA 3PEIA 2V8VA 3D68A 1Z8LA 2ZEMA 2V8DA 4O23A 4ONWA 4DJLA 1XJOA 3H8GA 4MCPA 3DLJA 4KSIA 4IHMA 2F7VA 3KASA 1CPSA 4B6ZA 4P4EA 2G9DA 4G1PA 1YMEA 4MHZA 4NGNA 3KHZA 3FF3A 2IQ6A 3RAMA 2EWBA 1M4LA 4OC3A 5K8PA 1VHOA 1CX8A 2BOAA 4UEFA 3WC7A 1HDQA 8CPAA 5HXDA 1TKFA 5ELYA 4JYWA 1ARLA 2AFSA 5HVGA 2PJ4A 1XBUA 2ZOGA 3SI1A 2HC9A 2ZELA 2Q51A 3SI2A 2ZENA 1Z5RA 2PJ7A 4ZX9A 4MXUA 4TWEA 4NGQA 2ZEFA 2PCUA 2PIYA 4ZX8A 3D7DA 4W9YA 4PPZA 3B3CA 4WWVA 4UF4A 4NGRA 3PB6X 4PQAA 3RBUA 3BXMA 3B35A 3NH4A 1R3NA 4R6TA 2AFOA 4MCQA 4ZI6A 3KGQA 3FX6A 3KR4A 4P4FA 3H8EA 1LOKA 2PJCA 2CTBA 3NFZA 1TF9A 2ZEDA 2IMOA 4MHPA 1H8LA 1Z2LA 5K8NA 4P4IA 3PRTA 1RTQA 3KQZA 3V7ZA 2EK8A 3N5FA 4GM5A 3WC6A 2C6PA 4P10A 2ZEHA 2AFUA 3VARA 1YW4A 4P4JA 4OC4A 4A94A 5K8MA 3S9NA 4OIWA 5D29A 1R43A 2J9AA 3D7FA 2RB7A 4A37A 1LAMA 2XEFA 3B7IA 1BAVA 1CPXA 3K9TA 3WT4A 3LMSA 1IY7A 4IK2A 4AXVA 2XEIA 3T8WA 5D8NA 1LAPA 3SJXA 2PJ5A 4OC0A 4Z65A 1AYEA 4P45A 4ZY1A 7CPAA 4WJBA 3IO1A 3SI0A 2Q43A 4NFRA 2BCOA 4OMEA 4BD9A 3IFEA 5DS0A 2NYQA 3ISZA 3I1UA 4F8ZA 2GREA 3KZWA 2PJ8A 2AFMA 2QJ8A 3B3VA 3QNVA 3SJGA 2Q4ZA 3KHXA 2RFHA 4P4BA 1CP7A 4A39A 2PJAA 2JEWA 1DE4C 5LRGA 2PVWA 2PJBA 4H2KA 4YU9A 1ZLHA 3LWUA 4X2TA 3SJEA 3FJUA 2OOTA 2V8GA 5LYLA 1Y0RA 2ZOFA 4NJQA 4OIDA 3H8FA 6CPAA 2DEAA 4NGPA 1VGYA 3GLJA 3PB7X 1EE3P 2O53A 3NH8A 4PXBA 4K3NA 3KQXA 1AMPA 2CIJA 2C1CA 1ZG7A 1VHEA 4MCRA 4UEEA 5THWA 2PIZA 4CPAA 1ZG9A 1PYTB 4PXDA 4NGSA 3HLPA 3IC1A 2POKA 3GUXA 2CF4A 3V38A 1QQ9A 4PXCA 4DUKA 1F2PA 4YWYA 1XRYA 1CP6A 4OP4A 2IJZA 5CBMA 3BI1A 5LYFA 2AFWA 4PXEA 4NJRA 4FAIA 2WYRA 2I3CA 3IJ3A 1F57A 3CDXA 2VL1A 1QMUA 1UWYA 1DTDA 3PBBA 3JRUA 3TX8A 4P4DA 2HB6A 4OC2A 1OBRA 2JBJA 4OC1A 3NH5A 1TF8A 1JQGA 4JZ0A 2ZEGA 5JH9A 1BLLE 2OR4A 2ANPA 1YW6A 1KWMA 2PJ0A 4A38A 1CG2A 4DYOA 1Y0YA 3VH9A 5JM6A 2PRQA 3D4UA 2XEGA 3B2YA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2PJ9 A;  3ISX A;  4ZY2 A;  4RUH A;  2QYV A;  3KR5 A;  4NGM A;  4P6Y A;  4MHY A;  2ZEP A;  2FVG A;  4UEZ A;  1F2O A;  3PB4 X;  3CT9 A;  5LRK A;  3IWW A;  4EFD A;  3PFE A;  2PJ3 A;  2PJ6 A;  3K2K A;  4IAV A;  4ZYQ A;  2GLJ A;  1YSJ A;  1GYT A;  3S9L A;  2F8H A;  3CPA A;  1ARM A;  2EK9 A;  2ZEO A;  3KI9 A;  1TXR A;  1TKJ A;  4ZY0 A;  3HUV A;  1HDU A;  1IGB A;  3NA6 A;  2BO9 A;  3FEC A;  4MHN A;  3L2N A;  2O4H A;  4UIA A;  5LRJ A;  3GB0 A;  1ELM P;  3PB9 X;  1Y7E A;  1PCA A;  4LQG A;  5F09 A;  3D7G A;  3BI0 A;  1LAN A;  2C6G A;  5JGF A;  3S9M A;  1XMB A;  4Q7A A;  3B3T A;  3WC5 A;  4OKO A;  1BPN A;  2NSM A;  2JBK A;  2PE3 A;  1LCP A;  4MRI A;  2GU2 A;  2PJ2 A;  1FNO A;  4F9V A;  3IEH A;  1VIX A;  5I4M A;  2ZEE A;  1ZG8 A;  4FWU A;  2V8H A;  4X8I A;  3RZA A;  1LFW A;  3DGV A;  3B3W A;  4MCS A;  2XEJ A;  4EME A;  1XFO A;  5K8O A;  2AFX A;  3MN8 A;  4UIB A;  3FEE A;  4X3R A;  3PBE A;  2QVP A;  3FH4 A;  1TKH A;  3BHX A;  4F9U A;  2PJ1 A;  2V77 A;  4FBE A;  3WAB A;  4TNU A;  3IIB A;  1Q7L A;  1YLO A;  1ZLI A;  3MRU A;  3B3S A;  4NGT A;  4FUU A;  4R76 A;  4OC5 A;  3VAT A;  5LYD A;  3FVL A;  4P44 A;  1NSA A;  3D67 A;  1ELL P;  2WZN A;  3FED A;  2CTC A;  2C6C A;  3D7H A;  2GLF A;  3CPX A;  5CPA A;  4EWT A;  3PB8 X;  2ABZ A;  4R8F A;  5HVF A;  3SJF A;  3KL9 A;  1BPM A;  1HEE A;  5HVH A;  5IB9 A;  1FT7 A;  2AFZ A;  5J1Q A;  3TC8 A;  4R7M A;  3D66 A;  5LYI A;  1CBX A;  2PVV A;  3FMC A;  4MMO A;  3PFO A;  3PEI A;  2V8V A;  3D68 A;  1Z8L A;  2ZEM A;  2V8D A;  4O23 A;  4ONW A;  4DJL A;  1XJO A;  3H8G A;  4MCP A;  3DLJ A;  4KSI A;  4IHM A;  2F7V A;  3KAS A;  1CPS A;  4B6Z A;  4P4E A;  2G9D A;  4G1P A;  1YME A;  4MHZ A;  4NGN A;  3KHZ A;  3FF3 A;  2IQ6 A;  3RAM A;  2EWB A;  1M4L A;  4OC3 A;  5K8P A;  1VHO A;  1CX8 A;  2BOA A;  4UEF A;  3WC7 A;  1HDQ A;  8CPA A;  5HXD A;  1TKF A;  5ELY A;  4JYW A;  1ARL A;  2AFS A;  5HVG A;  2PJ4 A;  1XBU A;  2ZOG A;  3SI1 A;  2HC9 A;  2ZEL A;  2Q51 A;  3SI2 A;  2ZEN A;  1Z5R A;  2PJ7 A;  4ZX9 A;  4MXU A;  4TWE A;  4NGQ A;  2ZEF A;  2PCU A;  2PIY A;  4ZX8 A;  3D7D A;  4W9Y A;  4PPZ A;  3B3C A;  4WWV A;  4UF4 A;  4NGR A;  3PB6 X;  4PQA A;  3RBU A;  3BXM A;  3B35 A;  3NH4 A;  1R3N A;  4R6T A;  2AFO A;  4MCQ A;  4ZI6 A;  3KGQ A;  3FX6 A;  3KR4 A;  4P4F A;  3H8E A;  1LOK A;  2PJC A;  2CTB A;  3NFZ A;  1TF9 A;  2ZED A;  2IMO A;  4MHP A;  1H8L A;  1Z2L A;  5K8N A;  4P4I A;  3PRT A;  1RTQ A;  3KQZ A;  3V7Z A;  2EK8 A;  3N5F A;  4GM5 A;  3WC6 A;  2C6P A;  4P10 A;  2ZEH A;  2AFU A;  3VAR A;  1YW4 A;  4P4J A;  4OC4 A;  4A94 A;  5K8M A;  3S9N A;  4OIW A;  5D29 A;  1R43 A;  2J9A A;  3D7F A;  2RB7 A;  4A37 A;  1LAM A;  2XEF A;  3B7I A;  1BAV A;  1CPX A;  3K9T A;  3WT4 A;  3LMS A;  1IY7 A;  4IK2 A;  4AXV A;  2XEI A;  3T8W A;  5D8N A;  1LAP A;  3SJX A;  2PJ5 A;  4OC0 A;  4Z65 A;  1AYE A;  4P45 A;  4ZY1 A;  7CPA A;  4WJB A;  3IO1 A;  3SI0 A;  2Q43 A;  4NFR A;  2BCO A;  4OME A;  4BD9 A;  3IFE A;  5DS0 A;  2NYQ A;  3ISZ A;  3I1U A;  4F8Z A;  2GRE A;  3KZW A;  2PJ8 A;  2AFM A;  2QJ8 A;  3B3V A;  3QNV A;  3SJG A;  2Q4Z A;  3KHX A;  2RFH A;  4P4B A;  1CP7 A;  4A39 A;  2PJA A;  2JEW A;  1DE4 C;  5LRG A;  2PVW A;  2PJB A;  4H2K A;  4YU9 A;  1ZLH A;  3LWU A;  4X2T A;  3SJE A;  3FJU A;  2OOT A;  2V8G A;  5LYL A;  1Y0R A;  2ZOF A;  4NJQ A;  4OID A;  3H8F A;  6CPA A;  2DEA A;  4NGP A;  1VGY A;  3GLJ A;  3PB7 X;  1EE3 P;  2O53 A;  3NH8 A;  4PXB A;  4K3N A;  3KQX A;  1AMP A;  2CIJ A;  2C1C A;  1ZG7 A;  1VHE A;  4MCR A;  4UEE A;  5THW A;  2PIZ A;  4CPA A;  1ZG9 A;  1PYT B;  4PXD A;  4NGS A;  3HLP A;  3IC1 A;  2POK A;  3GUX A;  2CF4 A;  3V38 A;  1QQ9 A;  4PXC A;  4DUK A;  1F2P A;  4YWY A;  1XRY A;  1CP6 A;  4OP4 A;  2IJZ A;  5CBM A;  3BI1 A;  5LYF A;  2AFW A;  4PXE A;  4NJR A;  4FAI A;  2WYR A;  2I3C A;  3IJ3 A;  1F57 A;  3CDX A;  2VL1 A;  1QMU A;  1UWY A;  1DTD A;  3PBB A;  3JRU A;  3TX8 A;  4P4D A;  2HB6 A;  4OC2 A;  1OBR A;  2JBJ A;  4OC1 A;  3NH5 A;  1TF8 A;  1JQG A;  4JZ0 A;  2ZEG A;  5JH9 A;  1BLL E;  2OR4 A;  2ANP A;  1YW6 A;  1KWM A;  2PJ0 A;  4A38 A;  1CG2 A;  4DYO A;  1Y0Y A;  3VH9 A;  5JM6 A;  2PRQ A;  3D4U A;  2XEG A;  3B2Y A; 
#chains in the Genus database with same CATH topology
 2PJ9 A;  3ISX A;  4ZY2 A;  4RUH A;  2QYV A;  2VZZ A;  3KR5 A;  2Q4Y A;  4NGM A;  4P6Y A;  4M85 A;  1VKC A;  4MJ8 A;  4C7H A;  4MHY A;  5ISV A;  1QSM A;  3ZZI A;  1N71 A;  2ZEP A;  5HH1 A;  2FVG A;  2OZH A;  3S6G A;  4M6I A;  4CAE A;  1MK4 A;  4UEZ A;  2EVN A;  2YNC C;  1F2O A;  2B5G A;  3PB4 X;  4A32 A;  4OLL A;  4KOV A;  2BSW A;  3CT9 A;  4CGO A;  3E0K A;  5LRK A;  2Q0Y A;  3IWW A;  3PFE A;  2FSR A;  4B14 A;  4EFD A;  3D2M A;  2PJ3 A;  1YGH A;  2PJ6 A;  5F49 A;  3R9F A;  1XF8 A;  3RNZ A;  2Q4V A;  5J8C A;  4JXQ A;  3SHP A;  4FD5 A;  5F47 A;  3K2K A;  2B4D B;  3SXO A;  4BMH A;  4IUS A;  4IAV A;  4II9 A;  3TT2 A;  4ZYQ A;  2HUZ A;  2GLJ A;  2DXQ A;  1YSJ A;  1GYT A;  4U9Z A;  2F8H A;  5JPH A;  3S9L A;  3CPA A;  1ARM A;  4KSA A;  4ZGY B;  3A9L A;  2EK9 A;  2ZEO A;  2Z11 A;  3IWG A;  3KI9 A;  3FRM A;  2DPT A;  1TXR A;  2VQY A;  1TKJ A;  3ZJ0 A;  4ZY0 A;  1R57 A;  3HUV A;  1Z4E A;  3LOD A;  1HDU A;  1IGB A;  3NA6 A;  2BO9 A;  3FEC A;  1Z8T A;  4YRH A;  3F5B A;  4Y49 B;  4JXR A;  4MHN A;  4B13 A;  3L2N A;  1JWQ A;  2O4H A;  4Q38 A;  4UIA A;  5LRJ A;  4C68 A;  2GFQ A;  3GB0 A;  3TFY A;  1ELM P;  4X5K A;  2GIV A;  3PB9 X;  4CRY B;  5F48 A;  1WWZ A;  1Y7E A;  3CXS A;  1PCA A;  4LQG A;  4CAV A;  3D7G A;  3BI0 A;  5F09 A;  2OU2 A;  1LAN A;  2C6G A;  3D8P A;  4A33 A;  2Z3P A;  5JGF A;  1IYK A;  4PK3 A;  1XMB A;  3S9M A;  4E2A A;  2ZXV A;  2Q7B A;  2EUI A;  4AVB A;  3DR6 A;  5G1Z A;  1YQE A;  4Q7A A;  1UFH A;  3B3T A;  3WC5 A;  4CAF A;  3EC4 A;  3JTK A;  4OKO A;  2DF5 A;  4YGO A;  1BPN A;  1YRE A;  2NSM A;  4CGL A;  4CS0 B;  2WPX A;  1BOB A;  4KSF A;  2Z3L A;  3GY9 A;  3TO7 A;  2JBK A;  1M1D A;  1MJB A;  4CAX A;  2PE3 A;  3IU2 A;  2GAN A;  1LCP A;  5H84 A;  4MRI A;  2IL4 A;  2GU2 A;  2PJ2 A;  3GIU A;  1FNO A;  3BLN A;  4R3L A;  1IOI A;  4F9V A;  1P4N A;  3IEH A;  2B58 A;  1VIX A;  4A2Z A;  5DWM A;  5I4M A;  2ZEE A;  1ZG8 A;  4AB7 A;  5AG4 A;  1TIQ A;  3QAY A;  4FWU A;  4GS4 A;  3W6S A;  4E0A A;  2FT0 A;  2V8H A;  2HQY A;  4X8I A;  1LFW A;  1B87 A;  3RZA A;  3DGV A;  3B3W A;  1S60 A;  4JD6 A;  1XMT A;  4XPK A;  2REF A;  2XEJ A;  4MCS A;  4EME A;  2ARH A;  1XFO A;  5IV0 A;  5K8O A;  2FIA A;  3JUW A;  4ONU A;  5AG6 A;  4KOS A;  2AFX A;  4AG9 A;  4F0X A;  4NSQ A;  3MN8 A;  4UIB A;  3FEE A;  4X3R A;  4KOT A;  5BWA B;  3PBE A;  4AXV A;  2QVP A;  3FH4 A;  4U9Y A;  1TKH A;  4YFJ A;  5JQ4 A;  4ZBG A;  3BHX A;  4F9U A;  1YK3 A;  2NMT A;  1FY7 A;  3V8I A;  3QB8 A;  2PJ1 A;  2V77 A;  4FBE A;  5KTA A;  3WAB A;  4TNU A;  3DSB A;  2OB0 A;  1Q7L A;  1YLO A;  1NE9 A;  1ZLI A;  3GKR A;  3IIB A;  1X10 A;  2HV2 A;  1S7N A;  2D4P A;  2F5I A;  2P6E A;  3D2P A;  3MRU A;  4B11 A;  3B3S A;  4NGT A;  3FB3 A;  3CXQ A;  4FUU A;  2Z3O A;  4R76 A;  4OC5 A;  3VAT A;  4UWI A;  5LYD A;  3FVL A;  3DNS A;  4P44 A;  1NSA A;  3D67 A;  1ELL P;  2WZN A;  3FED A;  1MJ9 A;  3IGR A;  2CTC A;  2C6C A;  3D7H A;  2GLF A;  3CPX A;  4B5P B;  5F46 A;  5CPA A;  4EWT A;  3PB8 X;  2ABZ A;  4R8F A;  2K5T A;  4FD6 A;  5HVF A;  3PGP A;  3I3G A;  3R1K A;  3SJF A;  4F0Y A;  2I00 A;  5HXD A;  2PSW A;  1AUG A;  1KZF A;  4MBU A;  1KUY A;  4HNW B;  3KL9 A;  4QUS A;  5I0C A;  4GXH A;  2Q7S A;  1BPM A;  1HEE A;  1I21 A;  4JWP A;  4KUB A;  5HVH A;  5IB9 A;  1X12 A;  1FT7 A;  2AFZ A;  4R57 A;  5J1Q A;  2BL1 A;  3EY5 A;  3TC8 A;  4CGP A;  3G8W A;  2FCK A;  4R7M A;  3D66 A;  5LYI A;  1CBX A;  4HNX B;  2PVV A;  4M3S A;  2G3A A;  3FMC A;  4MMO A;  3CXP A;  3PFO A;  3PEI A;  4MY0 A;  3WR7 A;  4MY3 A;  4ORF A;  2V8V A;  3D68 A;  4KOX A;  2VEZ A;  1Z8L A;  3FNC A;  4I49 A;  3S6K A;  2X7B A;  2ZEM A;  2V8D A;  4O23 A;  2Z10 A;  4ONW A;  4DJL A;  1XJO A;  1A2Z A;  2AJ6 A;  3D3S A;  1V0C A;  4IF5 A;  3H8G A;  4MFJ A;  2P0W A;  4MCP A;  3DLJ A;  3S6H A;  2PDO A;  4KSI A;  4IHM A;  2F7V A;  3KAS A;  2REE A;  3GYA A;  1CPS A;  2VZY A;  4B6Z A;  4P4E A;  4R9M A;  2G9D A;  1S5K A;  4PSX A;  4G1P A;  5G21 A;  3BJ8 A;  1YME A;  3LD2 A;  4MHZ A;  4NGN A;  4AG7 A;  3KHZ A;  4A30 A;  1YR0 A;  3IU1 A;  4KLW A;  3FF3 A;  2FIW A;  4H6U A;  3R95 A;  1YVO A;  4MHD A;  4LX9 A;  2IQ6 A;  4AVA A;  1IIC A;  4NCZ A;  3RAM A;  3IWE A;  4PV6 A;  4C2Z A;  4UCN A;  1S7L A;  2EWB A;  3G3S A;  1M4L A;  4J3G A;  4UA3 A;  4BIN A;  4MFP A;  4OC3 A;  4C7I A;  4QC6 A;  5K8P A;  3FYN A;  1Z8X A;  2BOA A;  1VHO A;  1CX8 A;  2ZW6 A;  4KUA A;  1HDQ A;  4UEF A;  1MJA A;  3WC7 A;  3N7Z A;  5AG7 A;  1TKF A;  5ELY A;  8CPA A;  4JYW A;  1ARL A;  2AFS A;  2KCW A;  3EO4 A;  5HVG A;  2PJ4 A;  1XBU A;  4NF1 A;  1XOV A;  2ZOG A;  3SI1 A;  3TOA A;  3FXT A;  2HC9 A;  4F6A A;  2ZEL A;  4KOU A;  5EMI A;  5HMN A;  2B4D A;  2Q51 A;  3NE8 A;  3SI2 A;  3W6X A;  2ZEN A;  3VWE A;  1Z5R A;  2PJ7 A;  4ZX9 A;  4MXU A;  2VI7 A;  3F8K A;  2FXF A;  4XPD B;  4TWE A;  2PC1 A;  3RO0 A;  4NGQ A;  5C82 A;  1Q2D A;  4H6Z A;  2ZEF A;  1CJW A;  2PCU A;  2PIY A;  1LRZ A;  2G0B A;  2WSA A;  2ZW7 A;  4ZX8 A;  3D7D A;  3DDD A;  4PPZ A;  4W9Y A;  1ZO0 A;  3B3C A;  1I1D A;  1S3Z A;  4WWV A;  4UF4 A;  2H5M A;  1Q2C A;  4NGR A;  1M4I A;  4MFQ A;  3PB6 X;  4PQA A;  3RBU A;  3BXM A;  4MFK A;  3B35 A;  2JDC A;  1XEB A;  3NH4 A;  5GCN A;  2YNE A;  4L89 A;  3R96 A;  1R3N A;  4R6T A;  3VWD A;  2OZU A;  1Z9U A;  2AFO A;  4MCQ A;  4ZI6 A;  4XNH B;  3KGQ A;  3FX6 A;  1VHS A;  3KR4 A;  4P4F A;  3H8E A;  1LOK A;  3TO9 A;  2FS5 A;  3RYO A;  4R87 A;  5CNP A;  2PJC A;  4C2X A;  2CNT A;  2CTB A;  4M6H A;  4QB9 A;  4UWJ A;  3NFZ A;  2WPW A;  4HNY B;  1TF9 A;  2ZED A;  2FL4 A;  4JJX A;  2IMO A;  4HKF A;  4MHP A;  3F0A A;  1H8L A;  1Z2L A;  1IYL A;  5H86 A;  4P4I A;  3PRT A;  5K8N A;  1RTQ A;  4KVO E;  1Y9W A;  4OAE A;  3KQZ A;  4UFX A;  2CNS A;  2BUE A;  1NSL A;  3V7Z A;  4RI1 A;  1Z4R A;  4LQ6 A;  2EK8 A;  3TO6 A;  3N5F A;  2D4O A;  4GM5 A;  3WC6 A;  2ODF A;  4Q36 A;  2CNM A;  2C6P A;  4P10 A;  1KUX A;  4XPD C;  2ZEH A;  4KVM E;  4KOY A;  4CYQ A;  2AFU A;  2VBQ A;  2CY2 A;  4KLV A;  1K4J A;  3VAR A;  4A95 A;  4BBH A;  1YW4 A;  4P4J A;  5E96 A;  1XE4 A;  2B5G B;  1QSN A;  2PR8 A;  4OC4 A;  3T90 A;  4A94 A;  4OIW A;  5D29 A;  5K8M A;  3S9N A;  1R43 A;  2J9A A;  4KOW A;  2BEI A;  3D7F A;  3DR8 A;  2AE6 A;  1Z8W A;  2RB7 A;  4A37 A;  1B6B A;  1LAM A;  2XEF A;  4LUA A;  2EBJ A;  2Z3M A;  3TOB A;  2YNC A;  3B7I A;  1BAV A;  1CPX A;  3K9T A;  4UFW A;  3WT4 A;  2Q44 A;  3LMS A;  1IY7 A;  2JDD A;  4IK2 A;  3MGD A;  4NXY A;  4XNH C;  1KUV A;  2XEI A;  3R9E A;  5D8N A;  3T8W A;  1LAP A;  4MFL A;  4E8O A;  3SJX A;  2PJ5 A;  4OC0 A;  4Z65 A;  1AYE A;  4P45 A;  4ZY1 A;  7CPA A;  4WJB A;  2PQ8 A;  3P2H A;  2YND A;  3IO1 A;  3EXN A;  3SI0 A;  1M4G A;  1Y7R A;  4C2Y A;  3K9U A;  4MFZ A;  2Q43 A;  4NFR A;  2BCO A;  2B3U A;  4FD4 A;  1ON0 A;  4OME A;  3LAC A;  4UFV A;  4MI4 A;  4BD9 A;  5A28 A;  3IFE A;  1GHE A;  1IID A;  2Z0Z A;  3R9G A;  5DS0 A;  5IB0 A;  1NMT A;  2NYQ A;  1PU9 A;  5J8F A;  3ISZ A;  4UCM A;  2WUU A;  3I1U A;  2VXK A;  4QVT A;  5IX3 A;  2JLM A;  4B5P A;  3QAH A;  3JVN A;  4F8Z A;  2PR1 A;  2GRE A;  3KZW A;  1P0H A;  2PJ8 A;  1YLE A;  4NEX A;  5G20 A;  3TE4 A;  1YX0 A;  3FIX A;  2AFM A;  2QJ8 A;  3B3V A;  3QNV A;  3SJG A;  2Q4Z A;  2R7H A;  2RFH A;  3KHX A;  3PP9 A;  4P4B A;  1CP7 A;  4A39 A;  2PJA A;  2JEW A;  1DE4 C;  5LRG A;  2PVW A;  3KKW A;  1SQH A;  1IB1 E;  2PJB A;  2ATR A;  4H2K A;  4YU9 A;  4B12 A;  1M44 A;  4U5Y A;  1ZLH A;  1CM0 A;  1M4D A;  2J8M A;  1BO4 A;  3LWU A;  2FE7 A;  4X2T A;  3FBU A;  3SJE A;  4QBJ A;  3FJU A;  4RS2 A;  1Q2Y A;  3S6F A;  2OOT A;  2V8G A;  1U6M A;  2P6F A;  5LYL A;  1Y0R A;  2GE3 A;  2ZOF A;  4NJQ A;  4OID A;  3H8F A;  6CPA A;  2JEV A;  3H5Z A;  4L8A A;  3T9Y A;  2DEA A;  2P6G A;  4NGP A;  1VGY A;  3GLJ A;  3W91 A;  3PB7 X;  4KOR A;  4CYP A;  1EE3 P;  2O53 A;  5KTC A;  2PRB A;  2QEC A;  3NH8 A;  3SXN A;  4PXB A;  5C88 A;  4K3N A;  3KQX A;  1AMP A;  2DPS A;  2CIJ A;  2Z3K A;  4OAD A;  4B10 A;  2OH1 A;  2C1C A;  1ZG7 A;  1VHE A;  4KZT A;  2G3T A;  4MCR A;  4UEE A;  5THW A;  2EO8 A;  2PIZ A;  4CPA A;  1ZG9 A;  3C26 A;  1PYT B;  2CXA A;  4UBR A;  3H4Q A;  3TTH A;  4KS9 A;  1XIX A;  1OZP A;  4PXD A;  2A4N A;  4XPL A;  4NGS A;  2J8N A;  3HLP A;  2ZW5 A;  5FVJ A;  1QSR A;  3IC1 A;  2POK A;  3GUX A;  2CF4 A;  2O28 A;  4EVY A;  3V38 A;  3OWC A;  1QQ9 A;  4PXC A;  2QIR A;  4DUK A;  1F2P A;  1IOF A;  4YWY A;  2I79 A;  1XRY A;  4DNC A;  2RC4 A;  5KTD A;  1CP6 A;  4FD7 A;  4OP4 A;  2IJZ A;  5CBM A;  3BI1 A;  1QST A;  4Y49 C;  5LYF A;  3PZJ A;  2AFW A;  2ZW4 A;  4M6G A;  4PXE A;  2QML A;  4NJR A;  4FAI A;  2WYR A;  2B4B A;  2I3C A;  1F57 A;  3IJ3 A;  5AGE A;  5A27 A;  4UCP A;  1S7F A;  3CDX A;  2ZPA A;  2VL1 A;  3BJ7 A;  3TCV A;  2Z3N A;  1QMU A;  5G22 A;  4AVC A;  3CZX A;  2Y0M A;  1L0C A;  4PK2 A;  2R1I A;  4RN7 A;  2YGW A;  4HPS A;  1UWY A;  1Y9K A;  4CYN A;  1DTD A;  3PBB A;  1RXT A;  4R3K A;  3JRU A;  3TX8 A;  4P4D A;  5EC4 A;  1YVK A;  4CYO A;  2HB6 A;  2OZG A;  1OBR A;  4OC2 A;  2JBJ A;  4CGM A;  3UY5 A;  2B3V A;  4OC1 A;  3NH5 A;  2J8R A;  3P2F A;  1TF8 A;  2R8V A;  1JQG A;  5EBV A;  1PUA A;  4JZ0 A;  3EFA A;  2C27 A;  3NE7 A;  2ZEG A;  5JH9 A;  5DWN A;  1BLL E;  1J4J A;  1S7K A;  4CAW A;  2OR4 A;  4JLY A;  4CGN A;  4A31 A;  2ANP A;  2R98 A;  1YW6 A;  1KWM A;  2PJ0 A;  4H89 A;  5AG5 A;  3B8G A;  4A38 A;  1CG2 A;  4DYO A;  1Y0Y A;  4K30 A;  3VH9 A;  1I12 A;  5JM6 A;  2PRQ A;  3D4U A;  2Q04 A;  2XEG A;  4CRZ B;  1RO5 A;  1IU8 A;  3I9S A;  1WK4 A;  4KVX A;  4PSW A;  3B2Y A;  1QSO A;  4B5O A; 
#chains in the Genus database with same CATH homology
 2PJ9 A;  3ISX A;  4ZY2 A;  4RUH A;  2QYV A;  3KR5 A;  4NGM A;  4P6Y A;  4MHY A;  2ZEP A;  2FVG A;  4UEZ A;  1F2O A;  3PB4 X;  3CT9 A;  5LRK A;  3IWW A;  4EFD A;  3PFE A;  2PJ3 A;  2PJ6 A;  3K2K A;  4IAV A;  4ZYQ A;  2GLJ A;  1YSJ A;  1GYT A;  3S9L A;  2F8H A;  3CPA A;  1ARM A;  2EK9 A;  2ZEO A;  3KI9 A;  1TXR A;  1TKJ A;  4ZY0 A;  3HUV A;  1HDU A;  1IGB A;  3NA6 A;  2BO9 A;  3FEC A;  4MHN A;  3L2N A;  2O4H A;  4UIA A;  5LRJ A;  3GB0 A;  1ELM P;  3PB9 X;  1Y7E A;  1PCA A;  4LQG A;  5F09 A;  3D7G A;  3BI0 A;  1LAN A;  2C6G A;  5JGF A;  3S9M A;  1XMB A;  4Q7A A;  3B3T A;  3WC5 A;  4OKO A;  1BPN A;  2NSM A;  2JBK A;  2PE3 A;  1LCP A;  4MRI A;  2GU2 A;  2PJ2 A;  1FNO A;  4F9V A;  3IEH A;  1VIX A;  5I4M A;  2ZEE A;  1ZG8 A;  4FWU A;  2V8H A;  4X8I A;  3RZA A;  1LFW A;  3DGV A;  3B3W A;  4MCS A;  2XEJ A;  4EME A;  1XFO A;  5K8O A;  2AFX A;  3MN8 A;  4UIB A;  3FEE A;  4X3R A;  3PBE A;  2QVP A;  3FH4 A;  1TKH A;  3BHX A;  4F9U A;  2PJ1 A;  2V77 A;  4FBE A;  3WAB A;  4TNU A;  3IIB A;  1Q7L A;  1YLO A;  1ZLI A;  3MRU A;  3B3S A;  4NGT A;  4FUU A;  4R76 A;  4OC5 A;  3VAT A;  5LYD A;  3FVL A;  4P44 A;  1NSA A;  3D67 A;  1ELL P;  2WZN A;  3FED A;  2CTC A;  2C6C A;  3D7H A;  2GLF A;  3CPX A;  5CPA A;  4EWT A;  3PB8 X;  2ABZ A;  4R8F A;  5HVF A;  3SJF A;  3KL9 A;  1BPM A;  1HEE A;  5HVH A;  5IB9 A;  1FT7 A;  2AFZ A;  5J1Q A;  3TC8 A;  4R7M A;  3D66 A;  5LYI A;  1CBX A;  2PVV A;  3FMC A;  4MMO A;  3PFO A;  3PEI A;  2V8V A;  3D68 A;  1Z8L A;  2ZEM A;  2V8D A;  4O23 A;  4ONW A;  4DJL A;  1XJO A;  3H8G A;  4MCP A;  3DLJ A;  4KSI A;  4IHM A;  2F7V A;  3KAS A;  1CPS A;  4B6Z A;  4P4E A;  2G9D A;  4G1P A;  1YME A;  4MHZ A;  4NGN A;  3KHZ A;  3FF3 A;  2IQ6 A;  3RAM A;  2EWB A;  1M4L A;  4OC3 A;  5K8P A;  1VHO A;  1CX8 A;  2BOA A;  4UEF A;  3WC7 A;  1HDQ A;  8CPA A;  5HXD A;  1TKF A;  5ELY A;  4JYW A;  1ARL A;  2AFS A;  5HVG A;  2PJ4 A;  1XBU A;  2ZOG A;  3SI1 A;  2HC9 A;  2ZEL A;  2Q51 A;  3SI2 A;  2ZEN A;  1Z5R A;  2PJ7 A;  4ZX9 A;  4MXU A;  4TWE A;  4NGQ A;  2ZEF A;  2PCU A;  2PIY A;  4ZX8 A;  3D7D A;  4W9Y A;  4PPZ A;  3B3C A;  4WWV A;  4UF4 A;  4NGR A;  3PB6 X;  4PQA A;  3RBU A;  3BXM A;  3B35 A;  3NH4 A;  1R3N A;  4R6T A;  2AFO A;  4MCQ A;  4ZI6 A;  3KGQ A;  3FX6 A;  3KR4 A;  4P4F A;  3H8E A;  1LOK A;  2PJC A;  2CTB A;  3NFZ A;  1TF9 A;  2ZED A;  2IMO A;  4MHP A;  1H8L A;  1Z2L A;  5K8N A;  4P4I A;  3PRT A;  1RTQ A;  3KQZ A;  3V7Z A;  2EK8 A;  3N5F A;  4GM5 A;  3WC6 A;  2C6P A;  4P10 A;  2ZEH A;  2AFU A;  3VAR A;  1YW4 A;  4P4J A;  4OC4 A;  4A94 A;  5K8M A;  3S9N A;  4OIW A;  5D29 A;  1R43 A;  2J9A A;  3D7F A;  2RB7 A;  4A37 A;  1LAM A;  2XEF A;  3B7I A;  1BAV A;  1CPX A;  3K9T A;  3WT4 A;  3LMS A;  1IY7 A;  4IK2 A;  4AXV A;  2XEI A;  3T8W A;  5D8N A;  1LAP A;  3SJX A;  2PJ5 A;  4OC0 A;  4Z65 A;  1AYE A;  4P45 A;  4ZY1 A;  7CPA A;  4WJB A;  3IO1 A;  3SI0 A;  2Q43 A;  4NFR A;  2BCO A;  4OME A;  4BD9 A;  3IFE A;  5DS0 A;  2NYQ A;  3ISZ A;  3I1U A;  4F8Z A;  2GRE A;  3KZW A;  2PJ8 A;  2AFM A;  2QJ8 A;  3B3V A;  3QNV A;  3SJG A;  2Q4Z A;  3KHX A;  2RFH A;  4P4B A;  1CP7 A;  4A39 A;  2PJA A;  2JEW A;  1DE4 C;  5LRG A;  2PVW A;  2PJB A;  4H2K A;  4YU9 A;  1ZLH A;  3LWU A;  4X2T A;  3SJE A;  3FJU A;  2OOT A;  2V8G A;  5LYL A;  1Y0R A;  2ZOF A;  4NJQ A;  4OID A;  3H8F A;  6CPA A;  2DEA A;  4NGP A;  1VGY A;  3GLJ A;  3PB7 X;  1EE3 P;  2O53 A;  3NH8 A;  4PXB A;  4K3N A;  3KQX A;  1AMP A;  2CIJ A;  2C1C A;  1ZG7 A;  1VHE A;  4MCR A;  4UEE A;  5THW A;  2PIZ A;  4CPA A;  1ZG9 A;  1PYT B;  4PXD A;  4NGS A;  3HLP A;  3IC1 A;  2POK A;  3GUX A;  2CF4 A;  3V38 A;  1QQ9 A;  4PXC A;  4DUK A;  1F2P A;  4YWY A;  1XRY A;  1CP6 A;  4OP4 A;  2IJZ A;  5CBM A;  3BI1 A;  5LYF A;  2AFW A;  4PXE A;  4NJR A;  4FAI A;  2WYR A;  2I3C A;  3IJ3 A;  1F57 A;  3CDX A;  2VL1 A;  1QMU A;  1UWY A;  1DTD A;  3PBB A;  3JRU A;  3TX8 A;  4P4D A;  2HB6 A;  4OC2 A;  1OBR A;  2JBJ A;  4OC1 A;  3NH5 A;  1TF8 A;  1JQG A;  4JZ0 A;  2ZEG A;  5JH9 A;  1BLL E;  2OR4 A;  2ANP A;  1YW6 A;  1KWM A;  2PJ0 A;  4A38 A;  1CG2 A;  4DYO A;  1Y0Y A;  3VH9 A;  5JM6 A;  2PRQ A;  3D4U A;  2XEG A;  3B2Y A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...