3B7IA

Crystal structure of the s228a mutant of the aminopeptidase from vibrio proteolyticus in complex with leucine phosphonic acid
Total Genus 111
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
111
sequence length
291
structure length
291
Chain Sequence
MPPITQQATVTAWLPQVDASQITGTISSLESFTNRFYTTTSGAQASDWIASEWQALSASLPNASVKQVSHSGYNQKSVVMTITGSEAPDEWIVIGGHLDSTIGSHTNEQSVAPGADDDASGIAAVTEVIRVLSENNFQPKRSIAFMAYAAEEVGLRGSQDLANQYKSEGKNVVSALQLDMTNYKGSAQDVVFITDYTDSNFTQYLTQLMDEYLPSLTYGFDTCGYACADHASWHNAGYPAAMPFESKFNDYNPRIHTTQDTLANSDPTGSHAKKFTQLGLAYAIEMGSATG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Bacterial leucyl aminopeptidase
publication title Zinc coordination geometry and ligand binding affinity: the structural and kinetic analysis of the second-shell serine 228 residue and the methionine 180 residue of the aminopeptidase from Vibrio proteolyticus.
pubmed doi rcsb
source organism Vibrio proteolyticus
molecule tags Hydrolase
total genus 111
structure length 291
sequence length 291
ec nomenclature ec 3.4.11.10: Bacterial leucyl aminopeptidase.
pdb deposition date 2007-10-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF04389 Peptidase_M28 Peptidase family M28
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.630.10 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Zn peptidases 3b7iA00
4BD9A 2V8GA 4O23A 3WABA 3H8GA 2JBJA 4F9UA 2G9DA 1FNOA 4ZY1A 3K2KA 2PRQA 3CT9A 5JM6A 5LRJA 3B3TA 4MCSA 3B35A 2PJ7A 4MCPA 3NFZA 4OIDA 2IJZA 2WYRA 1LOKA 5CPAA 3PB6X 4UIAA 2PJBA 3FF3A 2CF4A 1IY7A 3LMSA 2HB6A 4FBEA 1OBRA 4YWYA 4ZX8A 2C6PA 4Q7AA 3ISZA 1ZG9A 2IMOA 2Q4ZA 5LRGA 2AFWA 1R43A 1XRYA 1VHEA 1TKHA 3D68A 3D66A 4PXCA 2F8HA 2QYVA 4OP4A 3KZWA 2PJ1A 2AFXA 4PPZA 3SJXA 4WWVA 1XMBA 2GU2A 2POKA 3DLJA 3SI2A 2AFUA 1LAMA 4EWTA 1CX8A 3IJ3A 4R8FA 3S9MA 5HVHA 4GM5A 3HUVA 1LCPA 3KASA 2NSMA 2Q51A 4UEFA 1CG2A 2ZOFA 4NGPA 4RUHA 3GLJA 4NGRA 1DE4C 1ELMP 1ARMA 5IB9A 3VARA 2PJ2A 3FX6A 5D8NA 4ZX9A 4P4IA 2J9AA 3IEHA 4MHPA 3PRTA 4FAIA 3WT4A 5ELYA 4P6YA 3B3SA 4PXBA 3PFEA 3CDXA 3MRUA 2XEFA 2XEJA 1TKJA 1AMPA 1FT7A 1ARLA 1RTQA 3V38A 4B6ZA 6CPAA 5JGFA 3KHXA 2V8DA 3T8WA 2PJ0A 1R3NA 3HLPA 3GUXA 1HEEA 1VIXA 3VH9A 4KSIA 2EK9A 5HVGA 1BPMA 4MHNA 4F8ZA 2ZEFA 1YLOA 3K9TA 1M4LA 1QQ9A 2AFSA 4P45A 3FMCA 2FVGA 3FECA 2PJ4A 3BXMA 4W9YA 1YSJA 3S9NA 3PB7X 2OR4A 2ZEGA 4DUKA 3SJGA 5J1QA 2QJ8A 8CPAA 2CIJA 1CPSA 1Y7EA 2ZEMA 1ELLP 4IAVA 5LYFA 2GREA 4NGSA 2ZENA 2QVPA 5HVFA 1NSAA 1XFOA 3D7GA 2VL1A 2EK8A 2Q43A 4P4FA 2ZOGA 4UEZA 1CP7A 3FJUA 3TX8A 3NH5A 1ZLIA 2C1CA 4NGQA 1DTDA 1TXRA 2GLJA 2ZEHA 3KQZA 4OKOA 4FWUA 2PJCA 5D29A 3H8FA 4X8IA 4F9VA 2PJ6A 3JRUA 2ABZA 3PBEA 5LYLA 3V7ZA 3PFOA 2C6CA 4P4EA 4A38A 1Q7LA 5HXDA 2ZEOA 3CPAA 4G1PA 1CP6A 1Y0RA 4X2TA 2GLFA 3SJFA 3B3VA 2RFHA 2ZELA 1XBUA 5THWA 1KWMA 1ZLHA 3PBBA 4DYOA 1LAPA 3S9LA 2BOAA 1GYTA 1Y0YA 1Z8LA 3PB9X 3MN8A 4H2KA 3BI0A 1CPXA 2OOTA 4MHYA 4NFRA 1YW6A 2XEIA 5K8NA 2XEGA 4NJRA 2I3CA 4P10A 3NH8A 4EMEA 4NGTA 1IGBA 1YW4A 3WC7A 3FEEA 3H8EA 5I4MA 4P4BA 3I1UA 4TNUA 1UWYA 2V8VA 1ZG8A 4A94A 4NJQA 2AFOA 2V77A 3KR4A 4EFDA 4JZ0A 3WC5A 5DS0A 3BI1A 5LRKA 4UEEA 1F57A 1VGYA 2CTCA 4MCQA 2V8HA 3NH4A 3RBUA 4OMEA 3KHZA 3DGVA 4LQGA 3SI0A 1H8LA 2PCUA 2PVWA 4TWEA 2NYQA 2JBKA 3B2YA 4OC1A 4OC0A 2AFZA 2PJ8A 4R76A 3D4UA 3SJEA 5K8MA 2ANPA 2PJ9A 1HDQA 4ZY2A 2O53A 4PXEA 1TKFA 2BO9A 3IO1A 2PVVA 2HC9A 1TF8A 4NGNA 3IWWA 5LYIA 1YMEA 3KR5A 2WZNA 1CBXA 2ZEPA 3D67A 3PB8X 4P4JA 1Z2LA 5F09A 1F2OA 4AXVA 1PCAA 1AYEA 2BCOA 4OC5A 4A37A 2O4HA 4ZI6A 4DJLA 1LANA 3SI1A 4R6TA 2PE3A 4OIWA 2PJ5A 4MHZA 3B7IA 1JQGA 4R7MA 2C6GA 2PJAA 4ONWA 4OC2A 3IC1A 1PYTB 4MMOA 4CPAA 3IFEA 3N5FA 2ZEDA 1QMUA 2JEWA 1ZG7A 4X3RA 5K8OA 4PQAA 3BHXA 2EWBA 3D7HA 3IIBA 3RZAA 3D7FA 4IK2A 2RB7A 4MRIA 4P44A 2PIZA 3D7DA 3LWUA 2PJ3A 4FUUA 1VHOA 4Z65A 3KQXA 1TF9A 4UF4A 3ISXA 4YU9A 5CBMA 1F2PA 3PEIA 2F7VA 4A39A 3PB4X 4ZY0A 5LYDA 3B3CA 5K8PA 2CTBA 4WJBA 3KL9A 3FVLA 3RAMA 1BLLE 3KGQA 2IQ6A 1BAVA 1EE3P 7CPAA 3VATA 3QNVA 5JH9A 2DEAA 4K3NA 1Z5RA 4P4DA 3KI9A 2ZEEA 3WC6A 4MXUA 3L2NA 3GB0A 4MCRA 4UIBA 4IHMA 4NGMA 4OC3A 4ZYQA 3CPXA 1LFWA 4PXDA 2PIYA 3B3WA 4OC4A 3TC8A 3FEDA 1BPNA 2AFMA 3NA6A 4JYWA 3FH4A 1XJOA 1HDUA
chains in the Genus database with same CATH superfamily
4BD9A 2HV2A 3VWEA 2V8GA 4O23A 4XNHC 3WABA 3PZJA 1VKCA 1YREA 4CRYB 3H8GA 2JBJA 4F9UA 2G9DA 4J3GA 1FNOA 3PP9A 4ZY1A 1UFHA 5IX3A 3K2KA 3JUWA 4AG9A 2PRQA 1IOIA 3CT9A 2H5MA 4UCPA 5JM6A 5LRJA 4KOWA 3B3TA 1J4JA 4MCSA 4PK3A 3W91A 4KOVA 3CXSA 2B3UA 2OU2A 2ZW6A 3B35A 1RXTA 5G1ZA 2PJ7A 3GYAA 4MCPA 2FE7A 3NFZA 5F48A 2IJZA 4OIDA 4II9A 2WYRA 2B4DA 1LOKA 5CPAA 4AVAA 4PSWA 4ZBGA 3PB6X 1Z4RA 4UIAA 4Q36A 2PJBA 3FF3A 2I79A 2FS5A 2CF4A 3D8PA 1IYKA 4NSQA 1IY7A 3LMSA 2HB6A 4FBEA 1NMTA 3FBUA 1OBRA 4YWYA 1Q2YA 5G22A 4ZX8A 5EMIA 3DSBA 1Z8TA 2ARHA 2C6PA 4Q7AA 3ISZA 2R98A 4F0YA 2Y0MA 2Z10A 1YQEA 1ZG9A 2IMOA 1QSNA 2Q4ZA 4KOSA 4IF5A 2AFWA 4MFQA 1R43A 2HQYA 3B8GA 1XRYA 1ON0A 1VHEA 1TKHA 3D68A 3EFAA 3GIUA 3D66A 3QB8A 2F8HA 4PXCA 3R9GA 5KTAA 2QYVA 2P6GA 4PV6A 4M85A 2Q0YA 2FT0A 3S6KA 4OP4A 1PU9A 1S7LA 3T90A 5AG4A 3QAYA 3KZWA 2PJ1A 2AFXA 1QSTA 4H6UA 5EBVA 4U9ZA 4XNHB 4PPZA 3PGPA 3SJXA 1I1DA 4A95A 4H89A 4M6IA 2R8VA 1M44A 4WWVA 1XMBA 2GU2A 4F0XA 2POKA 2REFA 3DLJA 4R57A 1RO5A 4Q38A 4JLYA 3D3SA 3SI2A 2X7BA 4RS2A 2AFUA 2REEA 3E0KA 4B11A 3GY9A 1LAMA 3C26A 4A33A 5AGEA 4PK2A 4MFJA 4KS9A 3TO7A 2KCWA 4CYPA 4EWTA 1CX8A 4KVXA 4RI1A 3IJ3A 4B13A 4R8FA 1XIXA 3S9MA 5HVHA 4B10A 4GM5A 4U5YA 2FSRA 3HUVA 1LCPA 3KASA 5E96A 2VI7A 2NSMA 2Q51A 3LODA 4UEFA 1CG2A 2ZOFA 3CZXA 2EO8A 1IOFA 4NGPA 3MGDA 4RUHA 4FD5A 3GLJA 3NE8A 4KUAA 4NGRA 4UWJA 2F5IA 1DE4C 1ELMP 4HNWB 2Q44A 4A2ZA 1ARMA 1Z8XA 5IB9A 1Q2CA 2FIAA 2QECA 2YNEA 3VARA 2PJ2A 2EUIA 4QC6A 2D4PA 2ZXVA 3FX6A 5D8NA 4CYNA 1AUGA 4CAXA 5F47A 1CM0A 4KORA 4ZX9A 4KOTA 4P4IA 4UCMA 5AG5A 4EVYA 3IU2A 2J9AA 3IEHA 4MHPA 3PRTA 3DDDA 1KUYA 3WT4A 4FAIA 5ELYA 3VWDA 4P6YA 3B3SA 4PXBA 4M3SA 3PFEA 3CDXA 3FRMA 2GIVA 2XEFA 3MRUA 3UY5A 5A27A 5J8CA 2XEJA 1NE9A 1TKJA 2Q04A 1M4IA 1AMPA 1FT7A 1MJAA 1ARLA 3ZJ0A 4R87A 1RTQA 3V38A 4B6ZA 1B87A 1NSLA 2G0BA 6CPAA 5F46A 5JGFA 1KZFA 4FD4A 3KHXA 5C82A 3CXPA 2A4NA 2V8DA 4JWPA 4KZTA 5ISVA 3T8WA 3JVNA 2DPSA 2FCKA 1R3NA 2PJ0A 3HLPA 3GUXA 3TOBA 1HEEA 2JDDA 2Z3KA 1VIXA 3VH9A 4KSIA 2EK9A 3G3SA 1BPMA 5HVGA 4NXYA 5JQ4A 3TT2A 4MHNA 4F8ZA 5FVJA 3IGRA 2ZEFA 1YLOA 3D2MA 4UWIA 1R57A 3R95A 3BJ7A 3K9TA 1M4LA 1YGHA 3I9SA 1QQ9A 2AFSA 4P45A 3FMCA 4XPLA 2FVGA 2OZGA 3FECA 2DPTA 4B12A 2J8RA 2PJ4A 2OB0A 2WSAA 3SHPA 1Y9WA 1S5KA 3BXMA 4JJXA 4W9YA 1YSJA 3S9NA 3PB7X 2OR4A 2ZEGA 4MJ8A 3D2PA 3SJGA 4DUKA 5J1QA 4UA3A 1CJWA 4MY3A 1S60A 2BL1A 2QJ8A 4HPSA 4CGOA 3FXTA 4CGNA 8CPAA 3F8KA 2ATRA 4BBHA 2CIJA 3BLNA 3TO6A 1CPSA 4B14A 1Y7EA 2ZEMA 1ELLP 4IAVA 4ORFA 2GREA 4NGSA 2ZENA 2QVPA 3I3GA 5HVFA 3TOAA 5LYFA 3EO4A 4KSAA 4ONUA 4MFPA 1NSAA 1XFOA 2FL4A 2VL1A 3D7GA 5AG6A 2EK8A 2Q43A 1Z8WA 4P4FA 1TIQA 1XF8A 3R1KA 4MFKA 4FD7A 2ZOGA 4UEZA 2DF5A 1CP7A 1IB1E 3FJUA 5KTCA 5J8FA 3TX8A 3NH5A 4B5PB 2CNTA 1ZLIA 4YFJA 2GANA 4MY0A 2C1CA 1DTDA 1TXRA 4NGQA 1M4GA 2GLJA 2ZEHA 3KQZA 4OKOA 1OZPA 3H4QA 4FWUA 2DXQA 2PJCA 4GXHA 1BO4A 2GFQA 1MK4A 4KLVA 4UFVA 5D29A 3H8FA 2GE3A 1A2ZA 4KOYA 4X8IA 2PQ8A 2CNMA 3IWEA 4F9VA 3SXOA 1IU8A 2PJ6A 1PUAA 1QSOA 3JRUA 4CAWA 2ABZA 3PBEA 5LYLA 3V7ZA 3PFOA 5C88A 1YR0A 5I0CA 2C6CA 3F5BA 1YVKA 4P4EA 1QSMA 4UCNA 4HNYB 4A38A 3KKWA 1Q7LA 5HXDA 1IICA 2ZEOA 4NCZA 3CPAA 4IUSA 4G1PA 1CP6A 1Y0RA 2Q4YA 1P4NA 4X2TA 2GLFA 4CAFA 3SJFA 1ZO0A 4L89A 2VZYA 3B3VA 2RFHA 3A9LA 2ZELA 5DWMA 4CAEA 3EC4A 1XBUA 5THWA 4AVCA 3SXNA 1KWMA 1ZLHA 2P0WA 3QAHA 3PBBA 5EC4A 4CYQA 4DNCA 4DYOA 1LAPA 1U6MA 3EXNA 3S9LA 2BOAA 4UFWA 4AG7A 3P2FA 1GYTA 4A31A 3RO0A 2YNCC 1Y0YA 4OAEA 4R3LA 4JXRA 4QB9A 3TO9A 2YNDA 1GHEA 2Z3LA 3K9UA 1Z8LA 3PB9X 3MN8A 4H2KA 2VEZA 3BI0A 3FIXA 1CPXA 4MFZA 4MHYA 1LRZA 2OOTA 4NFRA 5F49A 4AVBA 5IB0A 1YW6A 2BSWA 2XEIA 5K8NA 2FXFA 2B3VA 2XEGA 4NJRA 4PSXA 1M4DA 1L0CA 2I3CA 1Y9KA 4P10A 1YX0A 1YLEA 3NH8A 4EMEA 4NGTA 1IGBA 1IIDA 3EY5A 1YW4A 3WC7A 1YVOA 2B5GB 3FEEA 1Z4EA 1Y7RA 2G3TA 3H8EA 5I4MA 4KSFA 3TFYA 4P4BA 2EBJA 3I1UA 3W6XA 4TNUA 1UWYA 3S6FA 3H5ZA 2JDCA 2R7HA 2V8VA 2K5TA 4B5PA 4HNXB 4CS0B 4A32A 1JWQA 3LD2A 1ZG8A 4CRZB 4A94A 4NJQA 2PSWA 3DR8A 1FY7A 1QSRA 2C27A 2AFOA 2V77A 3KR4A 3LACA 4EFDA 4JZ0A 1Z9UA 2VQYA 4K30A 5DS0A 3WC5A 3BI1A 5AG7A 4UEEA 1F57A 4YRHA 5H84A 3TTHA 5LRKA 1VGYA 3G8WA 2CTCA 1M1DA 2V8HA 3NH4A 2WPXA 4MCQA 4OMEA 3RBUA 3JTKA 4MFLA 3KHZA 3DGVA 4MBUA 4LQGA 3SI0A 1H8LA 3T9YA 4AB7A 2PCUA 1BOBA 3P2HA 2PC1A 2OZUA 4CGMA 4KVOE 2PVWA 3BJ8A 5IV0A 4TWEA 2NYQA 2JBKA 5HMNA 3B2YA 3CXQA 2P6FA 4H6ZA 4OC1A 3TE4A 4OC0A 2AFZA 2PJ8A 5H86A 4OLLA 4R76A 1X12A 3D4UA 3SJEA 3RNZA 5K8MA 4I49A 2ANPA 2PJ9A 2QIRA 2O28A 2AE6A 1HDQA 4ZY2A 2O53A 2Z0ZA 4A30A 4OADA 1KUVA 3FYNA 2OH1A 4UFXA 2PR1A 2G3AA 4PXEA 4BINA 1TKFA 2BO9A 3IO1A 4NEXA 4KUBA 2PVVA 4E0AA 4B5OA 1XOVA 2HC9A 4L8AA 1TF8A 4CGPA 2CNSA 4NGNA 3IWWA 2Z3NA 5LYIA 2VZZA 1S7FA 2PR8A 1YMEA 2ZW5A 3KR5A 2WZNA 1CBXA 4JD6A 4LUAA 4R9MA 4Y49C 2ZEPA 4CGLA 2D4OA 4C2ZA 5JPHA 3D67A 3PB8X 4P4JA 2QMLA 4XPKA 1Z2LA 2B5GA 5F09A 2P6EA 1F2OA 4C2YA 2Z3PA 2BUEA 4U9YA 4QUSA 4AXVA 2AJ6A 4R3KA 1PCAA 4UBRA 3W6SA 1AYEA 2BCOA 4KVME 4MI4A 4OC5A 4A37A 2O4HA 2YGWA 2Q7BA 2JLMA 4ZI6A 4DJLA 1I21A 2Z3MA 1LANA 3SI1A 4R6TA 2J8MA 4C2XA 2PE3A 4OIWA 2PJ5A 4HKFA 4MHZA 1Q2DA 4LQ6A 3B7IA 1JQGA 4R7MA 2C6GA 3N7ZA 3TCVA 4F6AA 2ZPAA 2PJAA 3R9EA 1XMTA 2I00A 4ONWA 4OC2A 3IC1A 1MJ9A 4E8OA 1PYTB 4MMOA 4E2AA 4XPDC 4CPAA 4NF1A 3IFEA 3N5FA 2ZEDA 1QMUA 2B4BA 4LX9A 4CYOA 2JEWA 1ZG7A 3DR6A 4X3RA 5K8OA 2YNCA 3WR7A 5G20A 3IU1A 3RYOA 1S7KA 1XE4A 2Z11A 4YGOA 1S7NA 2J8NA 2VXKA 4PQAA 2Q7SA 3BHXA 2EWBA 3D7HA 4FD6A 3IIBA 3RZAA 4QBJA 5A28A 3D7FA 4IK2A 4MHDA 2RB7A 4MRIA 4X5KA 4P44A 5GCNA 3OWCA 2BEIA 2PIZA 3D7DA 3LWUA 2PJ3A 5DWNA 1IYLA 4C7HA 4Y49B 2OZHA 4C7IA 4BMHA 4CAVA 4FUUA 1VHOA 2PRBA 4Z65A 3KQXA 1TF9A 2B4DB 4UF4A 3ISXA 5LRGA 4YU9A 5CBMA 2Q4VA 1X10A 1F2PA 3PEIA 2F7VA 1P0HA 2VBQA 4A39A 4GS4A 3R96A 5HH1A 2EVNA 1S3ZA 3PB4X 2NMTA 4KLWA 4ZY0A 5LYDA 3IWGA 2PDOA 3GKRA 3B3CA 5K8PA 1V0CA 4C68A 2CTBA 4WJBA 4QVTA 3KL9A 1KUXA 3FVLA 3RAMA 3DNSA 4M6HA 1BLLE 1SQHA 2R1IA 1I12A 4RN7A 3S6HA 1XEBA 2ZW4A 2RC4A 3KGQA 2IQ6A 2FIWA 4KOUA 1BAVA 3F0AA 1EE3P 4M6GA 7CPAA 1WWZA 2Z3OA 2ZW7A 3QNVA 4XPDB 3VATA 5JH9A 2DEAA 4K3NA 3ZZIA 1Z5RA 5KTDA 2CY2A 4P4DA 3KI9A 2WPWA 3S6GA 2ZEEA 1WK4A 4KOXA 3WC6A 4MXUA 2CXAA 5CNPA 2B58A 3FNCA 5BWAB 3L2NA 3GB0A 3NE7A 4MCRA 2IL4A 4UIBA 4IHMA 4NGMA 4OC3A 1YK3A 5G21A 3FB3A 3R9FA 4ZYQA 3CPXA 1LFWA 2JEVA 4PXDA 2PIYA 3B3WA 4OC4A 3TC8A 2ODFA 3FEDA 4ZGYB 1BPNA 1K4JA 2HUZA 2AFMA 3V8IA 3NA6A 4JXQA 4JYWA 2WUUA 3FH4A 1N71A 1MJBA 1XJOA 1HDUA 1B6BA 1VHSA
chains in the Genus database with same CATH topology
4BD9A 2V8GA 4O23A 3WABA 3H8GA 2JBJA 4F9UA 2G9DA 1FNOA 4ZY1A 3K2KA 2PRQA 3CT9A 5JM6A 5LRJA 3B3TA 4MCSA 3B35A 2PJ7A 4MCPA 3NFZA 4OIDA 2IJZA 2WYRA 1LOKA 5CPAA 3PB6X 4UIAA 2PJBA 3FF3A 2CF4A 1IY7A 3LMSA 2HB6A 4FBEA 1OBRA 4YWYA 4ZX8A 2C6PA 4Q7AA 3ISZA 1ZG9A 2IMOA 2Q4ZA 5LRGA 2AFWA 1R43A 1XRYA 1VHEA 1TKHA 3D68A 3D66A 4PXCA 2F8HA 2QYVA 4OP4A 3KZWA 2PJ1A 2AFXA 4PPZA 3SJXA 4WWVA 1XMBA 2GU2A 2POKA 3DLJA 3SI2A 2AFUA 1LAMA 4EWTA 1CX8A 3IJ3A 4R8FA 3S9MA 5HVHA 4GM5A 3HUVA 1LCPA 3KASA 2NSMA 2Q51A 4UEFA 1CG2A 2ZOFA 4NGPA 4RUHA 3GLJA 4NGRA 1DE4C 1ELMP 1ARMA 5IB9A 3VARA 2PJ2A 3FX6A 5D8NA 4ZX9A 4P4IA 2J9AA 3IEHA 4MHPA 3PRTA 4FAIA 3WT4A 5ELYA 4P6YA 3B3SA 4PXBA 3PFEA 3CDXA 3MRUA 2XEFA 2XEJA 1TKJA 1AMPA 1FT7A 1ARLA 1RTQA 3V38A 4B6ZA 6CPAA 5JGFA 3KHXA 2V8DA 3T8WA 2PJ0A 1R3NA 3HLPA 3GUXA 1HEEA 1VIXA 3VH9A 4KSIA 2EK9A 5HVGA 1BPMA 4MHNA 4F8ZA 2ZEFA 1YLOA 3K9TA 1M4LA 1QQ9A 2AFSA 4P45A 3FMCA 2FVGA 3FECA 2PJ4A 3BXMA 4W9YA 1YSJA 3S9NA 3PB7X 2OR4A 2ZEGA 4DUKA 3SJGA 5J1QA 2QJ8A 8CPAA 2CIJA 1CPSA 1Y7EA 2ZEMA 1ELLP 4IAVA 5LYFA 2GREA 4NGSA 2ZENA 2QVPA 5HVFA 1NSAA 1XFOA 3D7GA 2VL1A 2EK8A 2Q43A 4P4FA 2ZOGA 4UEZA 1CP7A 3FJUA 3TX8A 3NH5A 1ZLIA 2C1CA 4NGQA 1DTDA 1TXRA 2GLJA 2ZEHA 3KQZA 4OKOA 4FWUA 2PJCA 5D29A 3H8FA 4X8IA 4F9VA 2PJ6A 3JRUA 2ABZA 3PBEA 5LYLA 3V7ZA 3PFOA 2C6CA 4P4EA 4A38A 1Q7LA 5HXDA 2ZEOA 3CPAA 4G1PA 1CP6A 1Y0RA 4X2TA 2GLFA 3SJFA 3B3VA 2RFHA 2ZELA 1XBUA 5THWA 1KWMA 1ZLHA 3PBBA 4DYOA 1LAPA 3S9LA 2BOAA 1GYTA 1Y0YA 1Z8LA 3PB9X 3MN8A 4H2KA 3BI0A 1CPXA 2OOTA 4MHYA 4NFRA 1YW6A 2XEIA 5K8NA 2XEGA 4NJRA 2I3CA 4P10A 3NH8A 4EMEA 4NGTA 1IGBA 1YW4A 3WC7A 3FEEA 3H8EA 5I4MA 4P4BA 3I1UA 4TNUA 1UWYA 2V8VA 1ZG8A 4A94A 4NJQA 2AFOA 2V77A 3KR4A 4EFDA 4JZ0A 3WC5A 5DS0A 3BI1A 5LRKA 4UEEA 1F57A 1VGYA 2CTCA 4MCQA 2V8HA 3NH4A 3RBUA 4OMEA 3KHZA 3DGVA 4LQGA 3SI0A 1H8LA 2PCUA 2PVWA 4TWEA 2NYQA 2JBKA 3B2YA 4OC1A 4OC0A 2AFZA 2PJ8A 4R76A 3D4UA 3SJEA 5K8MA 2ANPA 2PJ9A 1HDQA 4ZY2A 2O53A 4PXEA 1TKFA 2BO9A 3IO1A 2PVVA 2HC9A 1TF8A 4NGNA 3IWWA 5LYIA 1YMEA 3KR5A 2WZNA 1CBXA 2ZEPA 3D67A 3PB8X 4P4JA 1Z2LA 5F09A 1F2OA 4AXVA 1PCAA 1AYEA 2BCOA 4OC5A 4A37A 2O4HA 4ZI6A 4DJLA 1LANA 3SI1A 4R6TA 2PE3A 4OIWA 2PJ5A 4MHZA 3B7IA 1JQGA 4R7MA 2C6GA 2PJAA 4ONWA 4OC2A 3IC1A 1PYTB 4MMOA 4CPAA 3IFEA 3N5FA 2ZEDA 1QMUA 2JEWA 1ZG7A 4X3RA 5K8OA 4PQAA 3BHXA 2EWBA 3D7HA 3IIBA 3RZAA 3D7FA 4IK2A 2RB7A 4MRIA 4P44A 2PIZA 3D7DA 3LWUA 2PJ3A 4FUUA 1VHOA 4Z65A 3KQXA 1TF9A 4UF4A 3ISXA 4YU9A 5CBMA 1F2PA 3PEIA 2F7VA 4A39A 3PB4X 4ZY0A 5LYDA 3B3CA 5K8PA 2CTBA 4WJBA 3KL9A 3FVLA 3RAMA 1BLLE 3KGQA 2IQ6A 1BAVA 1EE3P 7CPAA 3VATA 3QNVA 5JH9A 2DEAA 4K3NA 1Z5RA 4P4DA 3KI9A 2ZEEA 3WC6A 4MXUA 3L2NA 3GB0A 4MCRA 4UIBA 4IHMA 4NGMA 4OC3A 4ZYQA 3CPXA 1LFWA 4PXDA 2PIYA 3B3WA 4OC4A 3TC8A 3FEDA 1BPNA 2AFMA 3NA6A 4JYWA 3FH4A 1XJOA 1HDUA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4BD9 A;  2V8G A;  4O23 A;  3WAB A;  3H8G A;  2JBJ A;  4F9U A;  2G9D A;  1FNO A;  4ZY1 A;  3K2K A;  2PRQ A;  3CT9 A;  5JM6 A;  5LRJ A;  3B3T A;  4MCS A;  3B35 A;  2PJ7 A;  4MCP A;  3NFZ A;  4OID A;  2IJZ A;  2WYR A;  1LOK A;  5CPA A;  3PB6 X;  4UIA A;  2PJB A;  3FF3 A;  2CF4 A;  1IY7 A;  3LMS A;  2HB6 A;  4FBE A;  1OBR A;  4YWY A;  4ZX8 A;  2C6P A;  4Q7A A;  3ISZ A;  1ZG9 A;  2IMO A;  2Q4Z A;  5LRG A;  2AFW A;  1R43 A;  1XRY A;  1VHE A;  1TKH A;  3D68 A;  3D66 A;  4PXC A;  2F8H A;  2QYV A;  4OP4 A;  3KZW A;  2PJ1 A;  2AFX A;  4PPZ A;  3SJX A;  4WWV A;  1XMB A;  2GU2 A;  2POK A;  3DLJ A;  3SI2 A;  2AFU A;  1LAM A;  4EWT A;  1CX8 A;  3IJ3 A;  4R8F A;  3S9M A;  5HVH A;  4GM5 A;  3HUV A;  1LCP A;  3KAS A;  2NSM A;  2Q51 A;  4UEF A;  1CG2 A;  2ZOF A;  4NGP A;  4RUH A;  3GLJ A;  4NGR A;  1DE4 C;  1ELM P;  1ARM A;  5IB9 A;  3VAR A;  2PJ2 A;  3FX6 A;  5D8N A;  4ZX9 A;  4P4I A;  2J9A A;  3IEH A;  4MHP A;  3PRT A;  4FAI A;  3WT4 A;  5ELY A;  4P6Y A;  3B3S A;  4PXB A;  3PFE A;  3CDX A;  3MRU A;  2XEF A;  2XEJ A;  1TKJ A;  1AMP A;  1FT7 A;  1ARL A;  1RTQ A;  3V38 A;  4B6Z A;  6CPA A;  5JGF A;  3KHX A;  2V8D A;  3T8W A;  2PJ0 A;  1R3N A;  3HLP A;  3GUX A;  1HEE A;  1VIX A;  3VH9 A;  4KSI A;  2EK9 A;  5HVG A;  1BPM A;  4MHN A;  4F8Z A;  2ZEF A;  1YLO A;  3K9T A;  1M4L A;  1QQ9 A;  2AFS A;  4P45 A;  3FMC A;  2FVG A;  3FEC A;  2PJ4 A;  3BXM A;  4W9Y A;  1YSJ A;  3S9N A;  3PB7 X;  2OR4 A;  2ZEG A;  4DUK A;  3SJG A;  5J1Q A;  2QJ8 A;  8CPA A;  2CIJ A;  1CPS A;  1Y7E A;  2ZEM A;  1ELL P;  4IAV A;  5LYF A;  2GRE A;  4NGS A;  2ZEN A;  2QVP A;  5HVF A;  1NSA A;  1XFO A;  3D7G A;  2VL1 A;  2EK8 A;  2Q43 A;  4P4F A;  2ZOG A;  4UEZ A;  1CP7 A;  3FJU A;  3TX8 A;  3NH5 A;  1ZLI A;  2C1C A;  4NGQ A;  1DTD A;  1TXR A;  2GLJ A;  2ZEH A;  3KQZ A;  4OKO A;  4FWU A;  2PJC A;  5D29 A;  3H8F A;  4X8I A;  4F9V A;  2PJ6 A;  3JRU A;  2ABZ A;  3PBE A;  5LYL A;  3V7Z A;  3PFO A;  2C6C A;  4P4E A;  4A38 A;  1Q7L A;  5HXD A;  2ZEO A;  3CPA A;  4G1P A;  1CP6 A;  1Y0R A;  4X2T A;  2GLF A;  3SJF A;  3B3V A;  2RFH A;  2ZEL A;  1XBU A;  5THW A;  1KWM A;  1ZLH A;  3PBB A;  4DYO A;  1LAP A;  3S9L A;  2BOA A;  1GYT A;  1Y0Y A;  1Z8L A;  3PB9 X;  3MN8 A;  4H2K A;  3BI0 A;  1CPX A;  2OOT A;  4MHY A;  4NFR A;  1YW6 A;  2XEI A;  5K8N A;  2XEG A;  4NJR A;  2I3C A;  4P10 A;  3NH8 A;  4EME A;  4NGT A;  1IGB A;  1YW4 A;  3WC7 A;  3FEE A;  3H8E A;  5I4M A;  4P4B A;  3I1U A;  4TNU A;  1UWY A;  2V8V A;  1ZG8 A;  4A94 A;  4NJQ A;  2AFO A;  2V77 A;  3KR4 A;  4EFD A;  4JZ0 A;  3WC5 A;  5DS0 A;  3BI1 A;  5LRK A;  4UEE A;  1F57 A;  1VGY A;  2CTC A;  4MCQ A;  2V8H A;  3NH4 A;  3RBU A;  4OME A;  3KHZ A;  3DGV A;  4LQG A;  3SI0 A;  1H8L A;  2PCU A;  2PVW A;  4TWE A;  2NYQ A;  2JBK A;  3B2Y A;  4OC1 A;  4OC0 A;  2AFZ A;  2PJ8 A;  4R76 A;  3D4U A;  3SJE A;  5K8M A;  2ANP A;  2PJ9 A;  1HDQ A;  4ZY2 A;  2O53 A;  4PXE A;  1TKF A;  2BO9 A;  3IO1 A;  2PVV A;  2HC9 A;  1TF8 A;  4NGN A;  3IWW A;  5LYI A;  1YME A;  3KR5 A;  2WZN A;  1CBX A;  2ZEP A;  3D67 A;  3PB8 X;  4P4J A;  1Z2L A;  5F09 A;  1F2O A;  4AXV A;  1PCA A;  1AYE A;  2BCO A;  4OC5 A;  4A37 A;  2O4H A;  4ZI6 A;  4DJL A;  1LAN A;  3SI1 A;  4R6T A;  2PE3 A;  4OIW A;  2PJ5 A;  4MHZ A;  3B7I A;  1JQG A;  4R7M A;  2C6G A;  2PJA A;  4ONW A;  4OC2 A;  3IC1 A;  1PYT B;  4MMO A;  4CPA A;  3IFE A;  3N5F A;  2ZED A;  1QMU A;  2JEW A;  1ZG7 A;  4X3R A;  5K8O A;  4PQA A;  3BHX A;  2EWB A;  3D7H A;  3IIB A;  3RZA A;  3D7F A;  4IK2 A;  2RB7 A;  4MRI A;  4P44 A;  2PIZ A;  3D7D A;  3LWU A;  2PJ3 A;  4FUU A;  1VHO A;  4Z65 A;  3KQX A;  1TF9 A;  4UF4 A;  3ISX A;  4YU9 A;  5CBM A;  1F2P A;  3PEI A;  2F7V A;  4A39 A;  3PB4 X;  4ZY0 A;  5LYD A;  3B3C A;  5K8P A;  2CTB A;  4WJB A;  3KL9 A;  3FVL A;  3RAM A;  1BLL E;  3KGQ A;  2IQ6 A;  1BAV A;  1EE3 P;  7CPA A;  3VAT A;  3QNV A;  5JH9 A;  2DEA A;  4K3N A;  1Z5R A;  4P4D A;  3KI9 A;  2ZEE A;  3WC6 A;  4MXU A;  3L2N A;  3GB0 A;  4MCR A;  4UIB A;  4IHM A;  4NGM A;  4OC3 A;  4ZYQ A;  3CPX A;  1LFW A;  4PXD A;  2PIY A;  3B3W A;  4OC4 A;  3TC8 A;  3FED A;  1BPN A;  2AFM A;  3NA6 A;  4JYW A;  3FH4 A;  1XJO A;  1HDU A; 
#chains in the Genus database with same CATH topology
 4BD9 A;  2HV2 A;  3VWE A;  2V8G A;  4O23 A;  4XNH C;  3WAB A;  3PZJ A;  1VKC A;  1YRE A;  4CRY B;  3H8G A;  2JBJ A;  4F9U A;  2G9D A;  4J3G A;  1FNO A;  3PP9 A;  4ZY1 A;  1UFH A;  5IX3 A;  3K2K A;  3JUW A;  4AG9 A;  2PRQ A;  1IOI A;  3CT9 A;  2H5M A;  4UCP A;  5JM6 A;  5LRJ A;  4KOW A;  3B3T A;  1J4J A;  4MCS A;  4PK3 A;  3W91 A;  4KOV A;  3CXS A;  2B3U A;  2OU2 A;  2ZW6 A;  3B35 A;  1RXT A;  5G1Z A;  2PJ7 A;  3GYA A;  4MCP A;  2FE7 A;  3NFZ A;  5F48 A;  2IJZ A;  4OID A;  4II9 A;  2WYR A;  2B4D A;  1LOK A;  5CPA A;  4AVA A;  4PSW A;  4ZBG A;  3PB6 X;  1Z4R A;  4UIA A;  4Q36 A;  2PJB A;  3FF3 A;  2I79 A;  2FS5 A;  2CF4 A;  3D8P A;  1IYK A;  4NSQ A;  1IY7 A;  3LMS A;  2HB6 A;  4FBE A;  1NMT A;  3FBU A;  1OBR A;  4YWY A;  1Q2Y A;  5G22 A;  4ZX8 A;  5EMI A;  3DSB A;  1Z8T A;  2ARH A;  2C6P A;  4Q7A A;  3ISZ A;  2R98 A;  4F0Y A;  2Y0M A;  2Z10 A;  1YQE A;  1ZG9 A;  2IMO A;  1QSN A;  2Q4Z A;  4KOS A;  4IF5 A;  2AFW A;  4MFQ A;  1R43 A;  2HQY A;  3B8G A;  1XRY A;  1ON0 A;  1VHE A;  1TKH A;  3D68 A;  3EFA A;  3GIU A;  3D66 A;  3QB8 A;  2F8H A;  4PXC A;  3R9G A;  5KTA A;  2QYV A;  2P6G A;  4PV6 A;  4M85 A;  2Q0Y A;  2FT0 A;  3S6K A;  4OP4 A;  1PU9 A;  1S7L A;  3T90 A;  5AG4 A;  3QAY A;  3KZW A;  2PJ1 A;  2AFX A;  1QST A;  4H6U A;  5EBV A;  4U9Z A;  4XNH B;  4PPZ A;  3PGP A;  3SJX A;  1I1D A;  4A95 A;  4H89 A;  4M6I A;  2R8V A;  1M44 A;  4WWV A;  1XMB A;  2GU2 A;  4F0X A;  2POK A;  2REF A;  3DLJ A;  4R57 A;  1RO5 A;  4Q38 A;  4JLY A;  3D3S A;  3SI2 A;  2X7B A;  4RS2 A;  2AFU A;  2REE A;  3E0K A;  4B11 A;  3GY9 A;  1LAM A;  3C26 A;  4A33 A;  5AGE A;  4PK2 A;  4MFJ A;  4KS9 A;  3TO7 A;  2KCW A;  4CYP A;  4EWT A;  1CX8 A;  4KVX A;  4RI1 A;  3IJ3 A;  4B13 A;  4R8F A;  1XIX A;  3S9M A;  5HVH A;  4B10 A;  4GM5 A;  4U5Y A;  2FSR A;  3HUV A;  1LCP A;  3KAS A;  5E96 A;  2VI7 A;  2NSM A;  2Q51 A;  3LOD A;  4UEF A;  1CG2 A;  2ZOF A;  3CZX A;  2EO8 A;  1IOF A;  4NGP A;  3MGD A;  4RUH A;  4FD5 A;  3GLJ A;  3NE8 A;  4KUA A;  4NGR A;  4UWJ A;  2F5I A;  1DE4 C;  1ELM P;  4HNW B;  2Q44 A;  4A2Z A;  1ARM A;  1Z8X A;  5IB9 A;  1Q2C A;  2FIA A;  2QEC A;  2YNE A;  3VAR A;  2PJ2 A;  2EUI A;  4QC6 A;  2D4P A;  2ZXV A;  3FX6 A;  5D8N A;  4CYN A;  1AUG A;  4CAX A;  5F47 A;  1CM0 A;  4KOR A;  4ZX9 A;  4KOT A;  4P4I A;  4UCM A;  5AG5 A;  4EVY A;  3IU2 A;  2J9A A;  3IEH A;  4MHP A;  3PRT A;  3DDD A;  1KUY A;  3WT4 A;  4FAI A;  5ELY A;  3VWD A;  4P6Y A;  3B3S A;  4PXB A;  4M3S A;  3PFE A;  3CDX A;  3FRM A;  2GIV A;  2XEF A;  3MRU A;  3UY5 A;  5A27 A;  5J8C A;  2XEJ A;  1NE9 A;  1TKJ A;  2Q04 A;  1M4I A;  1AMP A;  1FT7 A;  1MJA A;  1ARL A;  3ZJ0 A;  4R87 A;  1RTQ A;  3V38 A;  4B6Z A;  1B87 A;  1NSL A;  2G0B A;  6CPA A;  5F46 A;  5JGF A;  1KZF A;  4FD4 A;  3KHX A;  5C82 A;  3CXP A;  2A4N A;  2V8D A;  4JWP A;  4KZT A;  5ISV A;  3T8W A;  3JVN A;  2DPS A;  2FCK A;  1R3N A;  2PJ0 A;  3HLP A;  3GUX A;  3TOB A;  1HEE A;  2JDD A;  2Z3K A;  1VIX A;  3VH9 A;  4KSI A;  2EK9 A;  3G3S A;  1BPM A;  5HVG A;  4NXY A;  5JQ4 A;  3TT2 A;  4MHN A;  4F8Z A;  5FVJ A;  3IGR A;  2ZEF A;  1YLO A;  3D2M A;  4UWI A;  1R57 A;  3R95 A;  3BJ7 A;  3K9T A;  1M4L A;  1YGH A;  3I9S A;  1QQ9 A;  2AFS A;  4P45 A;  3FMC A;  4XPL A;  2FVG A;  2OZG A;  3FEC A;  2DPT A;  4B12 A;  2J8R A;  2PJ4 A;  2OB0 A;  2WSA A;  3SHP A;  1Y9W A;  1S5K A;  3BXM A;  4JJX A;  4W9Y A;  1YSJ A;  3S9N A;  3PB7 X;  2OR4 A;  2ZEG A;  4MJ8 A;  3D2P A;  3SJG A;  4DUK A;  5J1Q A;  4UA3 A;  1CJW A;  4MY3 A;  1S60 A;  2BL1 A;  2QJ8 A;  4HPS A;  4CGO A;  3FXT A;  4CGN A;  8CPA A;  3F8K A;  2ATR A;  4BBH A;  2CIJ A;  3BLN A;  3TO6 A;  1CPS A;  4B14 A;  1Y7E A;  2ZEM A;  1ELL P;  4IAV A;  4ORF A;  2GRE A;  4NGS A;  2ZEN A;  2QVP A;  3I3G A;  5HVF A;  3TOA A;  5LYF A;  3EO4 A;  4KSA A;  4ONU A;  4MFP A;  1NSA A;  1XFO A;  2FL4 A;  2VL1 A;  3D7G A;  5AG6 A;  2EK8 A;  2Q43 A;  1Z8W A;  4P4F A;  1TIQ A;  1XF8 A;  3R1K A;  4MFK A;  4FD7 A;  2ZOG A;  4UEZ A;  2DF5 A;  1CP7 A;  1IB1 E;  3FJU A;  5KTC A;  5J8F A;  3TX8 A;  3NH5 A;  4B5P B;  2CNT A;  1ZLI A;  4YFJ A;  2GAN A;  4MY0 A;  2C1C A;  1DTD A;  1TXR A;  4NGQ A;  1M4G A;  2GLJ A;  2ZEH A;  3KQZ A;  4OKO A;  1OZP A;  3H4Q A;  4FWU A;  2DXQ A;  2PJC A;  4GXH A;  1BO4 A;  2GFQ A;  1MK4 A;  4KLV A;  4UFV A;  5D29 A;  3H8F A;  2GE3 A;  1A2Z A;  4KOY A;  4X8I A;  2PQ8 A;  2CNM A;  3IWE A;  4F9V A;  3SXO A;  1IU8 A;  2PJ6 A;  1PUA A;  1QSO A;  3JRU A;  4CAW A;  2ABZ A;  3PBE A;  5LYL A;  3V7Z A;  3PFO A;  5C88 A;  1YR0 A;  5I0C A;  2C6C A;  3F5B A;  1YVK A;  4P4E A;  1QSM A;  4UCN A;  4HNY B;  4A38 A;  3KKW A;  1Q7L A;  5HXD A;  1IIC A;  2ZEO A;  4NCZ A;  3CPA A;  4IUS A;  4G1P A;  1CP6 A;  1Y0R A;  2Q4Y A;  1P4N A;  4X2T A;  2GLF A;  4CAF A;  3SJF A;  1ZO0 A;  4L89 A;  2VZY A;  3B3V A;  2RFH A;  3A9L A;  2ZEL A;  5DWM A;  4CAE A;  3EC4 A;  1XBU A;  5THW A;  4AVC A;  3SXN A;  1KWM A;  1ZLH A;  2P0W A;  3QAH A;  3PBB A;  5EC4 A;  4CYQ A;  4DNC A;  4DYO A;  1LAP A;  1U6M A;  3EXN A;  3S9L A;  2BOA A;  4UFW A;  4AG7 A;  3P2F A;  1GYT A;  4A31 A;  3RO0 A;  2YNC C;  1Y0Y A;  4OAE A;  4R3L A;  4JXR A;  4QB9 A;  3TO9 A;  2YND A;  1GHE A;  2Z3L A;  3K9U A;  1Z8L A;  3PB9 X;  3MN8 A;  4H2K A;  2VEZ A;  3BI0 A;  3FIX A;  1CPX A;  4MFZ A;  4MHY A;  1LRZ A;  2OOT A;  4NFR A;  5F49 A;  4AVB A;  5IB0 A;  1YW6 A;  2BSW A;  2XEI A;  5K8N A;  2FXF A;  2B3V A;  2XEG A;  4NJR A;  4PSX A;  1M4D A;  1L0C A;  2I3C A;  1Y9K A;  4P10 A;  1YX0 A;  1YLE A;  3NH8 A;  4EME A;  4NGT A;  1IGB A;  1IID A;  3EY5 A;  1YW4 A;  3WC7 A;  1YVO A;  2B5G B;  3FEE A;  1Z4E A;  1Y7R A;  2G3T A;  3H8E A;  5I4M A;  4KSF A;  3TFY A;  4P4B A;  2EBJ A;  3I1U A;  3W6X A;  4TNU A;  1UWY A;  3S6F A;  3H5Z A;  2JDC A;  2R7H A;  2V8V A;  2K5T A;  4B5P A;  4HNX B;  4CS0 B;  4A32 A;  1JWQ A;  3LD2 A;  1ZG8 A;  4CRZ B;  4A94 A;  4NJQ A;  2PSW A;  3DR8 A;  1FY7 A;  1QSR A;  2C27 A;  2AFO A;  2V77 A;  3KR4 A;  3LAC A;  4EFD A;  4JZ0 A;  1Z9U A;  2VQY A;  4K30 A;  5DS0 A;  3WC5 A;  3BI1 A;  5AG7 A;  4UEE A;  1F57 A;  4YRH A;  5H84 A;  3TTH A;  5LRK A;  1VGY A;  3G8W A;  2CTC A;  1M1D A;  2V8H A;  3NH4 A;  2WPX A;  4MCQ A;  4OME A;  3RBU A;  3JTK A;  4MFL A;  3KHZ A;  3DGV A;  4MBU A;  4LQG A;  3SI0 A;  1H8L A;  3T9Y A;  4AB7 A;  2PCU A;  1BOB A;  3P2H A;  2PC1 A;  2OZU A;  4CGM A;  4KVO E;  2PVW A;  3BJ8 A;  5IV0 A;  4TWE A;  2NYQ A;  2JBK A;  5HMN A;  3B2Y A;  3CXQ A;  2P6F A;  4H6Z A;  4OC1 A;  3TE4 A;  4OC0 A;  2AFZ A;  2PJ8 A;  5H86 A;  4OLL A;  4R76 A;  1X12 A;  3D4U A;  3SJE A;  3RNZ A;  5K8M A;  4I49 A;  2ANP A;  2PJ9 A;  2QIR A;  2O28 A;  2AE6 A;  1HDQ A;  4ZY2 A;  2O53 A;  2Z0Z A;  4A30 A;  4OAD A;  1KUV A;  3FYN A;  2OH1 A;  4UFX A;  2PR1 A;  2G3A A;  4PXE A;  4BIN A;  1TKF A;  2BO9 A;  3IO1 A;  4NEX A;  4KUB A;  2PVV A;  4E0A A;  4B5O A;  1XOV A;  2HC9 A;  4L8A A;  1TF8 A;  4CGP A;  2CNS A;  4NGN A;  3IWW A;  2Z3N A;  5LYI A;  2VZZ A;  1S7F A;  2PR8 A;  1YME A;  2ZW5 A;  3KR5 A;  2WZN A;  1CBX A;  4JD6 A;  4LUA A;  4R9M A;  4Y49 C;  2ZEP A;  4CGL A;  2D4O A;  4C2Z A;  5JPH A;  3D67 A;  3PB8 X;  4P4J A;  2QML A;  4XPK A;  1Z2L A;  2B5G A;  5F09 A;  2P6E A;  1F2O A;  4C2Y A;  2Z3P A;  2BUE A;  4U9Y A;  4QUS A;  4AXV A;  2AJ6 A;  4R3K A;  1PCA A;  4UBR A;  3W6S A;  1AYE A;  2BCO A;  4KVM E;  4MI4 A;  4OC5 A;  4A37 A;  2O4H A;  2YGW A;  2Q7B A;  2JLM A;  4ZI6 A;  4DJL A;  1I21 A;  2Z3M A;  1LAN A;  3SI1 A;  4R6T A;  2J8M A;  4C2X A;  2PE3 A;  4OIW A;  2PJ5 A;  4HKF A;  4MHZ A;  1Q2D A;  4LQ6 A;  3B7I A;  1JQG A;  4R7M A;  2C6G A;  3N7Z A;  3TCV A;  4F6A A;  2ZPA A;  2PJA A;  3R9E A;  1XMT A;  2I00 A;  4ONW A;  4OC2 A;  3IC1 A;  1MJ9 A;  4E8O A;  1PYT B;  4MMO A;  4E2A A;  4XPD C;  4CPA A;  4NF1 A;  3IFE A;  3N5F A;  2ZED A;  1QMU A;  2B4B A;  4LX9 A;  4CYO A;  2JEW A;  1ZG7 A;  3DR6 A;  4X3R A;  5K8O A;  2YNC A;  3WR7 A;  5G20 A;  3IU1 A;  3RYO A;  1S7K A;  1XE4 A;  2Z11 A;  4YGO A;  1S7N A;  2J8N A;  2VXK A;  4PQA A;  2Q7S A;  3BHX A;  2EWB A;  3D7H A;  4FD6 A;  3IIB A;  3RZA A;  4QBJ A;  5A28 A;  3D7F A;  4IK2 A;  4MHD A;  2RB7 A;  4MRI A;  4X5K A;  4P44 A;  5GCN A;  3OWC A;  2BEI A;  2PIZ A;  3D7D A;  3LWU A;  2PJ3 A;  5DWN A;  1IYL A;  4C7H A;  4Y49 B;  2OZH A;  4C7I A;  4BMH A;  4CAV A;  4FUU A;  1VHO A;  2PRB A;  4Z65 A;  3KQX A;  1TF9 A;  2B4D B;  4UF4 A;  3ISX A;  5LRG A;  4YU9 A;  5CBM A;  2Q4V A;  1X10 A;  1F2P A;  3PEI A;  2F7V A;  1P0H A;  2VBQ A;  4A39 A;  4GS4 A;  3R96 A;  5HH1 A;  2EVN A;  1S3Z A;  3PB4 X;  2NMT A;  4KLW A;  4ZY0 A;  5LYD A;  3IWG A;  2PDO A;  3GKR A;  3B3C A;  5K8P A;  1V0C A;  4C68 A;  2CTB A;  4WJB A;  4QVT A;  3KL9 A;  1KUX A;  3FVL A;  3RAM A;  3DNS A;  4M6H A;  1BLL E;  1SQH A;  2R1I A;  1I12 A;  4RN7 A;  3S6H A;  1XEB A;  2ZW4 A;  2RC4 A;  3KGQ A;  2IQ6 A;  2FIW A;  4KOU A;  1BAV A;  3F0A A;  1EE3 P;  4M6G A;  7CPA A;  1WWZ A;  2Z3O A;  2ZW7 A;  3QNV A;  4XPD B;  3VAT A;  5JH9 A;  2DEA A;  4K3N A;  3ZZI A;  1Z5R A;  5KTD A;  2CY2 A;  4P4D A;  3KI9 A;  2WPW A;  3S6G A;  2ZEE A;  1WK4 A;  4KOX A;  3WC6 A;  4MXU A;  2CXA A;  5CNP A;  2B58 A;  3FNC A;  5BWA B;  3L2N A;  3GB0 A;  3NE7 A;  4MCR A;  2IL4 A;  4UIB A;  4IHM A;  4NGM A;  4OC3 A;  1YK3 A;  5G21 A;  3FB3 A;  3R9F A;  4ZYQ A;  3CPX A;  1LFW A;  2JEV A;  4PXD A;  2PIY A;  3B3W A;  4OC4 A;  3TC8 A;  2ODF A;  3FED A;  4ZGY B;  1BPN A;  1K4J A;  2HUZ A;  2AFM A;  3V8I A;  3NA6 A;  4JXQ A;  4JYW A;  2WUU A;  3FH4 A;  1N71 A;  1MJB A;  1XJO A;  1HDU A;  1B6B A;  1VHS A; 
#chains in the Genus database with same CATH homology
 4BD9 A;  2V8G A;  4O23 A;  3WAB A;  3H8G A;  2JBJ A;  4F9U A;  2G9D A;  1FNO A;  4ZY1 A;  3K2K A;  2PRQ A;  3CT9 A;  5JM6 A;  5LRJ A;  3B3T A;  4MCS A;  3B35 A;  2PJ7 A;  4MCP A;  3NFZ A;  4OID A;  2IJZ A;  2WYR A;  1LOK A;  5CPA A;  3PB6 X;  4UIA A;  2PJB A;  3FF3 A;  2CF4 A;  1IY7 A;  3LMS A;  2HB6 A;  4FBE A;  1OBR A;  4YWY A;  4ZX8 A;  2C6P A;  4Q7A A;  3ISZ A;  1ZG9 A;  2IMO A;  2Q4Z A;  5LRG A;  2AFW A;  1R43 A;  1XRY A;  1VHE A;  1TKH A;  3D68 A;  3D66 A;  4PXC A;  2F8H A;  2QYV A;  4OP4 A;  3KZW A;  2PJ1 A;  2AFX A;  4PPZ A;  3SJX A;  4WWV A;  1XMB A;  2GU2 A;  2POK A;  3DLJ A;  3SI2 A;  2AFU A;  1LAM A;  4EWT A;  1CX8 A;  3IJ3 A;  4R8F A;  3S9M A;  5HVH A;  4GM5 A;  3HUV A;  1LCP A;  3KAS A;  2NSM A;  2Q51 A;  4UEF A;  1CG2 A;  2ZOF A;  4NGP A;  4RUH A;  3GLJ A;  4NGR A;  1DE4 C;  1ELM P;  1ARM A;  5IB9 A;  3VAR A;  2PJ2 A;  3FX6 A;  5D8N A;  4ZX9 A;  4P4I A;  2J9A A;  3IEH A;  4MHP A;  3PRT A;  4FAI A;  3WT4 A;  5ELY A;  4P6Y A;  3B3S A;  4PXB A;  3PFE A;  3CDX A;  3MRU A;  2XEF A;  2XEJ A;  1TKJ A;  1AMP A;  1FT7 A;  1ARL A;  1RTQ A;  3V38 A;  4B6Z A;  6CPA A;  5JGF A;  3KHX A;  2V8D A;  3T8W A;  2PJ0 A;  1R3N A;  3HLP A;  3GUX A;  1HEE A;  1VIX A;  3VH9 A;  4KSI A;  2EK9 A;  5HVG A;  1BPM A;  4MHN A;  4F8Z A;  2ZEF A;  1YLO A;  3K9T A;  1M4L A;  1QQ9 A;  2AFS A;  4P45 A;  3FMC A;  2FVG A;  3FEC A;  2PJ4 A;  3BXM A;  4W9Y A;  1YSJ A;  3S9N A;  3PB7 X;  2OR4 A;  2ZEG A;  4DUK A;  3SJG A;  5J1Q A;  2QJ8 A;  8CPA A;  2CIJ A;  1CPS A;  1Y7E A;  2ZEM A;  1ELL P;  4IAV A;  5LYF A;  2GRE A;  4NGS A;  2ZEN A;  2QVP A;  5HVF A;  1NSA A;  1XFO A;  3D7G A;  2VL1 A;  2EK8 A;  2Q43 A;  4P4F A;  2ZOG A;  4UEZ A;  1CP7 A;  3FJU A;  3TX8 A;  3NH5 A;  1ZLI A;  2C1C A;  4NGQ A;  1DTD A;  1TXR A;  2GLJ A;  2ZEH A;  3KQZ A;  4OKO A;  4FWU A;  2PJC A;  5D29 A;  3H8F A;  4X8I A;  4F9V A;  2PJ6 A;  3JRU A;  2ABZ A;  3PBE A;  5LYL A;  3V7Z A;  3PFO A;  2C6C A;  4P4E A;  4A38 A;  1Q7L A;  5HXD A;  2ZEO A;  3CPA A;  4G1P A;  1CP6 A;  1Y0R A;  4X2T A;  2GLF A;  3SJF A;  3B3V A;  2RFH A;  2ZEL A;  1XBU A;  5THW A;  1KWM A;  1ZLH A;  3PBB A;  4DYO A;  1LAP A;  3S9L A;  2BOA A;  1GYT A;  1Y0Y A;  1Z8L A;  3PB9 X;  3MN8 A;  4H2K A;  3BI0 A;  1CPX A;  2OOT A;  4MHY A;  4NFR A;  1YW6 A;  2XEI A;  5K8N A;  2XEG A;  4NJR A;  2I3C A;  4P10 A;  3NH8 A;  4EME A;  4NGT A;  1IGB A;  1YW4 A;  3WC7 A;  3FEE A;  3H8E A;  5I4M A;  4P4B A;  3I1U A;  4TNU A;  1UWY A;  2V8V A;  1ZG8 A;  4A94 A;  4NJQ A;  2AFO A;  2V77 A;  3KR4 A;  4EFD A;  4JZ0 A;  3WC5 A;  5DS0 A;  3BI1 A;  5LRK A;  4UEE A;  1F57 A;  1VGY A;  2CTC A;  4MCQ A;  2V8H A;  3NH4 A;  3RBU A;  4OME A;  3KHZ A;  3DGV A;  4LQG A;  3SI0 A;  1H8L A;  2PCU A;  2PVW A;  4TWE A;  2NYQ A;  2JBK A;  3B2Y A;  4OC1 A;  4OC0 A;  2AFZ A;  2PJ8 A;  4R76 A;  3D4U A;  3SJE A;  5K8M A;  2ANP A;  2PJ9 A;  1HDQ A;  4ZY2 A;  2O53 A;  4PXE A;  1TKF A;  2BO9 A;  3IO1 A;  2PVV A;  2HC9 A;  1TF8 A;  4NGN A;  3IWW A;  5LYI A;  1YME A;  3KR5 A;  2WZN A;  1CBX A;  2ZEP A;  3D67 A;  3PB8 X;  4P4J A;  1Z2L A;  5F09 A;  1F2O A;  4AXV A;  1PCA A;  1AYE A;  2BCO A;  4OC5 A;  4A37 A;  2O4H A;  4ZI6 A;  4DJL A;  1LAN A;  3SI1 A;  4R6T A;  2PE3 A;  4OIW A;  2PJ5 A;  4MHZ A;  3B7I A;  1JQG A;  4R7M A;  2C6G A;  2PJA A;  4ONW A;  4OC2 A;  3IC1 A;  1PYT B;  4MMO A;  4CPA A;  3IFE A;  3N5F A;  2ZED A;  1QMU A;  2JEW A;  1ZG7 A;  4X3R A;  5K8O A;  4PQA A;  3BHX A;  2EWB A;  3D7H A;  3IIB A;  3RZA A;  3D7F A;  4IK2 A;  2RB7 A;  4MRI A;  4P44 A;  2PIZ A;  3D7D A;  3LWU A;  2PJ3 A;  4FUU A;  1VHO A;  4Z65 A;  3KQX A;  1TF9 A;  4UF4 A;  3ISX A;  4YU9 A;  5CBM A;  1F2P A;  3PEI A;  2F7V A;  4A39 A;  3PB4 X;  4ZY0 A;  5LYD A;  3B3C A;  5K8P A;  2CTB A;  4WJB A;  3KL9 A;  3FVL A;  3RAM A;  1BLL E;  3KGQ A;  2IQ6 A;  1BAV A;  1EE3 P;  7CPA A;  3VAT A;  3QNV A;  5JH9 A;  2DEA A;  4K3N A;  1Z5R A;  4P4D A;  3KI9 A;  2ZEE A;  3WC6 A;  4MXU A;  3L2N A;  3GB0 A;  4MCR A;  4UIB A;  4IHM A;  4NGM A;  4OC3 A;  4ZYQ A;  3CPX A;  1LFW A;  4PXD A;  2PIY A;  3B3W A;  4OC4 A;  3TC8 A;  3FED A;  1BPN A;  2AFM A;  3NA6 A;  4JYW A;  3FH4 A;  1XJO A;  1HDU A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...