4UEFA

Crystal structure of the human carboxypeptidase a1 in complex with the phosphinic inhibitor acetyl-tyr-ala-y(po2ch2)-homophe-oh
Total Genus 115
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
115
sequence length
306
structure length
306
Chain Sequence
STDTFNYATYHTLEEIYDFLDLLVAENPHLVSKIQIGNTYEGRPIYVLKFSTGGSKRPAIWIDTGIHSREWVTQASGVWFAKKITQDYGQDAAFTAILDTLDIFLEIVTNPDGFAFTHSTNRMWRKTRSHTAGSLCIGVDPNRNWDAGFGLSGASSNPCSETYHGKFANSEVEVKSIVDFVKDHGNIKAFISIHSYSQLLMYPYGYKTEPVPDQDELDQLSKAAVTALASLYGTKFNYGSIIKAIYQASGSTIDWTYSQGIKYSFTFELRDTGRYGFLLPASQIIPTAKETWLALLTIMEHTLNHP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords CARBOXYPEPTIDASE A1
publication title Crystal Structure of the Human Carboxypeptidase A1 in Complex with Phosphinic Inhibitors
rcsb
source organism Homo sapiens
total genus 115
structure length 306
sequence length 306
chains with identical sequence B
ec nomenclature ec 3.4.17.1: Carboxypeptidase A.
pdb deposition date 2014-12-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00246 Peptidase_M14 Zinc carboxypeptidase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.630.10 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Zn peptidases 4uefA00
4NGQA 2GLJA 3TC8A 4ONWA 3B3TA 3TX8A 5I4MA 3GUXA 4FWUA 3RBUA 2ANPA 4MHYA 4OIDA 2Q51A 2WYRA 3H8FA 1Q7LA 2ZOFA 2CTBA 2BCOA 5D29A 1CP7A 2ZELA 3CDXA 1F2OA 5LRJA 4NJRA 2EWBA 4MMOA 4H2KA 4DUKA 5IB9A 1TF8A 4DYOA 2ZEMA 5LRGA 4X2TA 3S9LA 1Z2LA 1EE3P 3K2KA 3KR5A 2EK8A 1AYEA 1LOKA 2PJ4A 3LMSA 2V8DA 1HDQA 3GLJA 3B7IA 3IFEA 1PCAA 3VH9A 2Q43A 2FVGA 2V8GA 3D68A 4OMEA 4MCPA 4R76A 4AXVA 3B3WA 4X8IA 1TXRA 2ZOGA 3JRUA 3MRUA 4PQAA 2AFXA 2PJ5A 4OC3A 1R43A 2GU2A 3WABA 2C1CA 2XEGA 4OC1A 1YMEA 2F7VA 4UEFA 3T8WA 1CPSA 4OC2A 4OC4A 2BO9A 4ZYQA 1Z8LA 2QVPA 3NA6A 3SJGA 2QJ8A 3NH5A 3FJUA 1VGYA 2C6CA 1CBXA 3H8EA 1BPMA 4OP4A 3ISXA 3PB4X 1YLOA 4ZI6A 4MHPA 4G1PA 1UWYA 4NFRA 2AFZA 1LCPA 1BAVA 1LAPA 5D8NA 3VARA 1XMBA 4ZY1A 4MHZA 4Z65A 2JBJA 3IEHA 2PJ2A 1YSJA 4NGNA 2XEFA 3KI9A 4ZX8A 1ARMA 1QQ9A 4CPAA 2OOTA 1Y0RA 2POKA 2OR4A 2ZEOA 1OBRA 1BPNA 3WC7A 2PJ7A 2JEWA 3PFOA 1CP6A 5F09A 3WC6A 5HXDA 2AFOA 2PJ0A 3B3SA 1H8LA 2F8HA 4A39A 2ABZA 3SJXA 2RFHA 5ELYA 4FAIA 1ZG9A 4OIWA 3KQZA 1HEEA 4X3RA 5THWA 4NJQA 2HC9A 3CT9A 3LWUA 3B2YA 4NGRA 4UEZA 2G9DA 1DE4C 3NH4A 2XEIA 4PXEA 3SJEA 5CBMA 4P4EA 4IAVA 1IGBA 3FH4A 1TKFA 3KASA 2PIYA 1ZLIA 3D7FA 4EWTA 3KHZA 2PIZA 2O4HA 3MN8A 3D7DA 4F8ZA 4UF4A 3FX6A 2J9AA 3NFZA 4ZY2A 4YWYA 6CPAA 2I3CA 1LANA 2PRQA 1FNOA 1F57A 1TKHA 4IK2A 3D4UA 4P4JA 1LFWA 3FVLA 4IHMA 3IO1A 3PB7X 4NGTA 4OKOA 5LYFA 4TWEA 2JBKA 1NSAA 3FMCA 2CIJA 2WZNA 1CPXA 4A94A 4MCRA 3PB9X 3SI2A 4ZY0A 1KWMA 3KHXA 1VHEA 1F2PA 1ZG8A 4OC0A 3IWWA 2PJ1A 4F9UA 3DGVA 2CTCA 3NH8A 4TNUA 3SI1A 3V7ZA 4MXUA 1ELLP 5LYDA 3PFEA 3FEDA 4PXDA 3KQXA 3D7GA 1QMUA 1PYTB 8CPAA 4P4IA 2ZEEA 4K3NA 2PJ9A 3GB0A 2PJCA 5LYIA 5DS0A 3I1UA 1YW4A 4WJBA 1CG2A 5LYLA 3KL9A 4R6TA 3S9MA 2RB7A 3IC1A 4MCSA 2PE3A 2ZEFA 2PJAA 2CF4A 2PVVA 4MCQA 2AFWA 3SI0A 2C6GA 2Q4ZA 4FBEA 2AFUA 3BXMA 3HLPA 3KGQA 1AMPA 2AFSA 4P44A 3WT4A 1HDUA 2IMOA 1IY7A 2ZEHA 1JQGA 1CX8A 2O53A 3QNVA 2NYQA 1ARLA 4O23A 1BLLE 3KR4A 4P4BA 1Y7EA 3BI1A 4WWVA 5K8OA 4Q7AA 4MRIA 3IIBA 2GREA 2GLFA 4MHNA 7CPAA 1Z5RA 3D7HA 4W9YA 1Y0YA 3PEIA 4ZX9A 2V77A 3KZWA 3D67A 3H8GA 4R7MA 5JGFA 2HB6A 3PB8X 1XFOA 5CPAA 4UEEA 2ZEDA 2QYVA 3SJFA 3CPAA 4BD9A 3PRTA 1XJOA 5J1QA 4NGSA 4A37A 4PPZA 1VHOA 2DEAA 4NGPA 1VIXA 4FUUA 3VATA 1ELMP 3ISZA 1XRYA 4OC5A 2PJ6A 1TKJA 5K8NA 5LRKA 5HVFA 5JM6A 3V38A 4UIAA 2NSMA 4JZ0A 4P4FA 2PCUA 4B6ZA 4PXCA 2ZEPA 2PJ3A 4EMEA 3WC5A 3CPXA 3D66A 2BOAA 3PBBA 3RAMA 1ZG7A 2EK9A 1YW6A 4UIBA 4P10A 3PBEA 4A38A 4EFDA 2IJZA 1RTQA 3BI0A 1DTDA 4GM5A 5JH9A 2PJ8A 1ZLHA 4P6YA 3HUVA 1FT7A 5K8MA 1XBUA 1M4LA 3B35A 3FECA 3K9TA 3N5FA 4P45A 3L2NA 4JYWA 4DJLA 3IJ3A 2PJBA 2ZEGA 4KSIA 2PVWA 2XEJA 4F9VA 2AFMA 2IQ6A 2V8VA 4RUHA 4YU9A 2VL1A 5HVGA 3S9NA 4PXBA 5K8PA 3PB6X 3RZAA 3BHXA 2ZENA 2C6PA 2V8HA 3FF3A 1TF9A 4P4DA 1R3NA 4LQGA 3B3CA 5HVHA 4NGMA 4R8FA 3DLJA 1LAMA 3FEEA 3B3VA 1GYTA
chains in the Genus database with same CATH superfamily
4NGQA 2AJ6A 1S7NA 2GLJA 4H89A 2Q4YA 4E0AA 3TC8A 4ONWA 3B3TA 3TX8A 4A31A 5I4MA 3TE4A 3QAHA 3GUXA 4A30A 1QSTA 4FWUA 3RBUA 3SXOA 3WR7A 2J8NA 3KKWA 2G3TA 4KS9A 4AVCA 2ANPA 2WPXA 3DSBA 4Y49B 5JQ4A 4MHYA 2HV2A 2Z3OA 4OIDA 2Q51A 4KOWA 3G8WA 2YGWA 1YVKA 1YK3A 2AE6A 2WYRA 3H8FA 1Q7LA 2ZOFA 2CTBA 2JLMA 2QMLA 1YQEA 4JJXA 1Q2YA 4U9YA 4MY0A 2BCOA 3A9LA 4UWIA 5D29A 3S6GA 3FBUA 1CP7A 1VHSA 2ZELA 3CDXA 1F2OA 2B4DB 5LRJA 2X7BA 5AG4A 4NJRA 5KTCA 3GKRA 4B12A 5AG6A 2EWBA 4MMOA 2BUEA 4H2KA 4DUKA 5IB9A 1TF8A 3DNSA 4CGMA 4CGPA 4DYOA 1KUYA 1GHEA 1ON0A 3R95A 2O28A 5AGEA 2ZEMA 5G1ZA 4GXHA 1IOIA 3EY5A 4X2TA 5LRGA 4CS0B 3S9LA 1IICA 1MJBA 1NMTA 2PRBA 4FD7A 3FYNA 1M1DA 3SHPA 1Z2LA 1EE3P 3R1KA 2CNSA 2ZW7A 5C88A 3C26A 3K2KA 3KR5A 2EK8A 3D2MA 1AYEA 3T90A 1LOKA 2PJ4A 1IIDA 1WWZA 3LMSA 2V8DA 2GIVA 2Z3KA 4I49A 4M85A 4KVXA 5H86A 3RYOA 1HDQA 3GLJA 2Q0YA 3B7IA 4JXQA 3IFEA 1PCAA 2PSWA 4JLYA 3VH9A 2Q43A 2FVGA 2FXFA 2V8GA 3D68A 4KOUA 2VBQA 4OMEA 4MCPA 3BJ7A 4R76A 4AXVA 3B3WA 4CYPA 4X8IA 1TXRA 2ZOGA 1R57A 2H5MA 3JRUA 4NXYA 3P2FA 3MRUA 4PQAA 1Q2DA 2AFXA 4KOTA 2PJ5A 4A33A 3F5BA 1IB1E 4U5YA 4OC3A 1R43A 2GU2A 3WABA 2C1CA 4KLVA 4CYQA 2XEGA 4OC1A 1YMEA 2F7VA 4UEFA 3T8WA 2ZW5A 1CPSA 4OC2A 4OC4A 5HMNA 2EUIA 2BO9A 4ZYQA 4A32A 2PQ8A 1Z8LA 2QVPA 1Z9UA 3FNCA 1N71A 4AG7A 3NA6A 3QB8A 1NE9A 3SJGA 2QJ8A 1B6BA 3NH5A 4UCNA 3D8PA 3FJUA 2P6GA 4Q36A 4PV6A 1MK4A 1VGYA 2C6CA 3ZJ0A 1RXTA 1CBXA 3JVNA 3H8EA 1BPMA 1V0CA 4OP4A 4BMHA 3ISXA 3PB4X 1YLOA 4AG9A 4OLLA 4ZI6A 2F5IA 2HQYA 2Q04A 4J3GA 3EFAA 1Z8TA 4G1PA 4KOYA 4MHPA 5FVJA 3BJ8A 1UWYA 2RC4A 4NEXA 4HKFA 3EC4A 1QSMA 4CAVA 1YREA 4NFRA 2AFZA 1LCPA 3H5ZA 4H6ZA 2FL4A 1I21A 1I12A 5DWMA 1S7LA 1S60A 1TIQA 1BAVA 2VZYA 1LAPA 1L0CA 5D8NA 3VARA 1XEBA 2BSWA 3LACA 4UWJA 3BLNA 3S6FA 1XMBA 2BEIA 4ZY1A 4MHZA 3TO6A 4Z65A 2JBJA 3JTKA 4C2YA 2CNTA 3IEHA 4QB9A 1BOBA 2EVNA 1IU8A 2CNMA 2GE3A 2PJ2A 1PU9A 1YSJA 4U9ZA 4NGNA 2XEFA 3PP9A 3KI9A 1NSLA 4ZX8A 4MJ8A 2OB0A 4DNCA 1ARMA 1QQ9A 4CPAA 2A4NA 4PK3A 1Y0RA 4MFZA 2POKA 4QUSA 2OOTA 4F0YA 2OR4A 2ODFA 4HNWB 4KUBA 4UCMA 2ZEOA 4KOVA 1OBRA 1BPNA 1XIXA 5I0CA 1M4GA 3WC7A 1JWQA 2PJ7A 4ZBGA 5DWNA 4A2ZA 2ZPAA 1PUAA 2REFA 1KUXA 3TT2A 5KTAA 3TOAA 2ZW4A 2JEWA 3PFOA 1CP6A 3EXNA 2Z3PA 3RNZA 1IYLA 4GS4A 3WC6A 5F09A 3W6SA 5HXDA 3GYAA 2C27A 2AFOA 2PJ0A 3IWEA 1FY7A 3B3SA 4RS2A 1H8LA 2F8HA 4A39A 2VI7A 4JD6A 3TO7A 2ABZA 3TOBA 5AG7A 4B11A 2KCWA 3SJXA 4RI1A 4KUAA 2R7HA 2RFHA 5CNPA 5ELYA 4FAIA 1ZG9A 4OIWA 4NCZA 3TTHA 3KQZA 1HEEA 2VZZA 4X3RA 5THWA 3W6XA 4NJQA 2HC9A 3CT9A 4XNHC 3LWUA 3IGRA 3B2YA 2ARHA 4NGRA 4UEZA 2FE7A 2VXKA 4KOSA 4K30A 5J8CA 4CRYB 4C7IA 1QSRA 2G9DA 1XE4A 1DE4C 3NH4A 2GFQA 2J8RA 2XEIA 1P0HA 4PXEA 3NE7A 2JEVA 3IWGA 4AVAA 5GCNA 3SJEA 2OZGA 2FT0A 1QSOA 5CBMA 1U6MA 4P4EA 4C7HA 4IAVA 5F49A 1IGBA 1S3ZA 2Z3NA 3FH4A 1TKFA 2BL1A 3KASA 1YR0A 3QAYA 4XNHB 2PIYA 1ZLIA 3D7FA 4EWTA 3KHZA 2PIZA 3ZZIA 2O4HA 1P4NA 1S7FA 3MN8A 4MY3A 3D7DA 4F8ZA 4UF4A 4F6AA 3FX6A 4UFXA 3FRMA 2ZW6A 2J9AA 3CXQA 4FD6A 3NFZA 4UBRA 4YWYA 4ZY2A 5C82A 6CPAA 2I3CA 3TFYA 1WK4A 1LANA 2PRQA 1FNOA 4KZTA 1F57A 1TKHA 3SXNA 4IK2A 2VQYA 3D4UA 4B5OA 4P4JA 1LFWA 4KOXA 3FVLA 4C68A 4IHMA 2PC1A 3IO1A 4KVOE 1OZPA 3PB7X 4NGTA 4IUSA 4OKOA 1RO5A 5LYFA 3D3SA 4TWEA 2JBKA 1NSAA 2G3AA 1Z4EA 2WUUA 3FMCA 2CIJA 4UA3A 2WZNA 4JXRA 1CPXA 4M6HA 3V8IA 4X5KA 4C2ZA 1S5KA 4MHDA 3I3GA 4II9A 4A94A 3FB3A 4CYOA 4MCRA 4C2XA 3PB9X 3SI2A 4ZY0A 1KWMA 3KHXA 3S6KA 3UY5A 1VHEA 1XMTA 2HUZA 4KLWA 1F2PA 1ZG8A 2R98A 4OC0A 2B5GA 1KUVA 2REEA 4MFLA 3IWWA 2PJ1A 1XOVA 4F9UA 4KVME 2ATRA 4CAFA 3E0KA 3DGVA 2CTCA 2B3UA 3NH8A 4MFQA 3F8KA 4R3LA 4TNUA 5AG5A 3SI1A 3NE8A 3V7ZA 2YNEA 4MXUA 1CM0A 4OAEA 1ELLP 5LYDA 2Q44A 3PFEA 2FIAA 1YLEA 3FEDA 4PXDA 3KQXA 4F0XA 1MJ9A 1QMUA 1PYTB 3D7GA 5F47A 4H6UA 8CPAA 4NF1A 2B5GB 4P4IA 4M6IA 2ZEEA 4K3NA 4BINA 2PJ9A 3GB0A 2PJCA 5LYIA 3IU1A 5DS0A 4CGOA 2R8VA 5A27A 4MFKA 3I1UA 1YW4A 2Y0MA 4PK2A 4WJBA 1CG2A 5LYLA 4UFWA 2WSAA 2JDDA 1LRZA 3KL9A 4MFJA 2OU2A 3OWCA 4R6TA 3S9MA 2RB7A 3TCVA 3IC1A 4MCSA 2PE3A 2ZEFA 2PJAA 2CF4A 3G3SA 1AUGA 2PVVA 4XPDC 4B13A 4MCQA 1X10A 2AFWA 4EVYA 3SI0A 2C6GA 2Z11A 4CGLA 2Q4ZA 3B8GA 5A28A 4FBEA 2EBJA 2AFUA 3S6HA 2PR1A 2JDCA 3BXMA 3HLPA 4KSFA 2Q7SA 4Q38A 3KGQA 1AMPA 2AFSA 4P44A 1SQHA 4R57A 1HDUA 2IMOA 3WT4A 1IY7A 4RN7A 5E96A 2ZEHA 1JQGA 2QECA 1CX8A 1ZO0A 2O53A 3QNVA 4FD4A 4M6GA 5JPHA 1Y7RA 5EMIA 5IV0A 2NYQA 4HPSA 4XPLA 4FD5A 1ARLA 4O23A 4A95A 1BLLE 3KR4A 4P4BA 1Y7EA 3BI1A 4ONUA 4WWVA 4CAWA 5K8OA 1M4DA 4Q7AA 4MRIA 3IIBA 2FS5A 3CXPA 2GREA 2GLFA 4MHNA 2Z10A 7CPAA 2CY2A 1Z5RA 3D7HA 4W9YA 4AB7A 2OZHA 1Y0YA 3PEIA 4HNYB 4R87A 5KTDA 4ZX9A 2V77A 3KZWA 3D67A 1IOFA 3H8GA 4R7MA 5JGFA 2HB6A 3PB8X 4AVBA 1XFOA 3N7ZA 4NSQA 1M44A 3DDDA 4OADA 1S7KA 5CPAA 4UEEA 1QSNA 3R9EA 3R9GA 2ZEDA 2QYVA 1VKCA 2FCKA 3SJFA 3CPAA 4BD9A 3PRTA 5EC4A 1XJOA 1Y9WA 5J1QA 4NGSA 4QBJA 4MFPA 4ZGYB 4LUAA 4A37A 4PPZA 1VHOA 4B10A 4R9MA 2DEAA 5ISVA 2D4OA 2Z3MA 4NGPA 1Z4RA 4PSWA 1VIXA 4UFVA 4FUUA 5EBVA 3VATA 4CYNA 1Z8WA 1ELMP 4M3SA 3JUWA 3PZJA 2B58A 3ISZA 1XRYA 1CJWA 1X12A 4OC5A 2Z0ZA 5IB0A 3FIXA 5G20A 4YGOA 2PJ6A 1TKJA 2K5TA 4PSXA 3PGPA 5K8NA 5LRKA 3CXSA 1Z8XA 3F0AA 5HVFA 4BBHA 5G22A 1J4JA 5JM6A 3V38A 4UIAA 2NSMA 3I9SA 4JZ0A 4P4FA 5F46A 2PCUA 4CAEA 4B6ZA 4PXCA 5J8FA 5H84A 2VEZA 2ZEPA 2PJ3A 4EMEA 3WC5A 1Q2CA 2DXQA 2J8MA 3CPXA 1A2ZA 3D66A 5HH1A 2GANA 2NMTA 3K9UA 3GIUA 3LODA 2BOAA 3PBBA 2OH1A 3RAMA 1K4JA 1YVOA 3D2PA 2I79A 1ZG7A 3W91A 3MGDA 4CGNA 2EK9A 1YW6A 4UIBA 2FSRA 2QIRA 4P10A 3PBEA 1YX0A 4A38A 4EFDA 2IJZA 2WPWA 2D4PA 4R3KA 2B3VA 1RTQA 4QVTA 2R1IA 3BI0A 2ZXVA 1DTDA 2DPTA 4GM5A 4UCPA 3T9YA 5JH9A 2PJ8A 1ZLHA 4P6YA 3HUVA 1FT7A 4YRHA 1B87A 3H4QA 5K8MA 4ORFA 4E8OA 1XBUA 3DR6A 1M4LA 3B35A 3FECA 3K9TA 1YGHA 3N5FA 5BWAB 4P45A 2I00A 2B4BA 5G21A 3VWDA 1MJAA 3L2NA 4JYWA 3VWEA 4DJLA 1I1DA 3DR8A 4B5PA 3R9FA 3IJ3A 3CZXA 1Y9KA 3EO4A 5F48A 4LQ6A 1KZFA 4CRZB 2YNCA 2PJBA 2ZEGA 3FXTA 4KSIA 4IF5A 2PVWA 4MBUA 2XEJA 4F9VA 2AFMA 2IQ6A 2V8VA 3LD2A 4KSAA 2PR8A 4XPKA 4RUHA 4YU9A 2IL4A 2VL1A 5HVGA 3S9NA 2YNCC 3IU2A 2Q4VA 4PXBA 2YNDA 3PB6X 4CAXA 2CXAA 2P6FA 1UFHA 5K8PA 4JWPA 3R96A 2Z3LA 2P0WA 3BHXA 2ZENA 3RZAA 2C6PA 3RO0A 4E2AA 2V8HA 4B14A 3FF3A 1M4IA 3TO9A 5IX3A 1TF9A 4P4DA 1R3NA 4LQGA 2PDOA 4MI4A 1IYKA 3GY9A 3B3CA 2EO8A 2FIWA 5HVHA 4B5PB 4LX9A 2OZUA 4HNXB 4NGMA 4XPDB 4R8FA 2G0BA 1BO4A 3DLJA 4Y49C 1LAMA 2DF5A 2DPSA 1XF8A 3FEEA 3P2HA 4L8AA 4L89A 2Q7BA 4QC6A 2P6EA 4YFJA 4KORA 2B4DA 3B3VA 1GYTA
chains in the Genus database with same CATH topology
4NGQA 2GLJA 3TC8A 4ONWA 3B3TA 3TX8A 5I4MA 3GUXA 4FWUA 3RBUA 2ANPA 4MHYA 4OIDA 2Q51A 2WYRA 3H8FA 1Q7LA 2ZOFA 2CTBA 2BCOA 5D29A 1CP7A 2ZELA 3CDXA 1F2OA 5LRJA 4NJRA 2EWBA 4MMOA 4H2KA 4DUKA 5IB9A 1TF8A 4DYOA 2ZEMA 5LRGA 4X2TA 3S9LA 1Z2LA 1EE3P 3K2KA 3KR5A 2EK8A 1AYEA 1LOKA 2PJ4A 3LMSA 2V8DA 1HDQA 3GLJA 3B7IA 3IFEA 1PCAA 3VH9A 2Q43A 2FVGA 2V8GA 3D68A 4OMEA 4MCPA 4R76A 4AXVA 3B3WA 4X8IA 1TXRA 2ZOGA 3JRUA 3MRUA 4PQAA 2AFXA 2PJ5A 4OC3A 1R43A 2GU2A 3WABA 2C1CA 2XEGA 4OC1A 1YMEA 2F7VA 4UEFA 3T8WA 1CPSA 4OC2A 4OC4A 2BO9A 4ZYQA 1Z8LA 2QVPA 3NA6A 3SJGA 2QJ8A 3NH5A 3FJUA 1VGYA 2C6CA 1CBXA 3H8EA 1BPMA 4OP4A 3ISXA 3PB4X 1YLOA 4ZI6A 4MHPA 4G1PA 1UWYA 4NFRA 2AFZA 1LCPA 1BAVA 1LAPA 5D8NA 3VARA 1XMBA 4ZY1A 4MHZA 4Z65A 2JBJA 3IEHA 2PJ2A 1YSJA 4NGNA 2XEFA 3KI9A 4ZX8A 1ARMA 1QQ9A 4CPAA 2OOTA 1Y0RA 2POKA 2OR4A 2ZEOA 1OBRA 1BPNA 3WC7A 2PJ7A 2JEWA 3PFOA 1CP6A 5F09A 3WC6A 5HXDA 2AFOA 2PJ0A 3B3SA 1H8LA 2F8HA 4A39A 2ABZA 3SJXA 2RFHA 5ELYA 4FAIA 1ZG9A 4OIWA 3KQZA 1HEEA 4X3RA 5THWA 4NJQA 2HC9A 3CT9A 3LWUA 3B2YA 4NGRA 4UEZA 2G9DA 1DE4C 3NH4A 2XEIA 4PXEA 3SJEA 5CBMA 4P4EA 4IAVA 1IGBA 3FH4A 1TKFA 3KASA 2PIYA 1ZLIA 3D7FA 4EWTA 3KHZA 2PIZA 2O4HA 3MN8A 3D7DA 4F8ZA 4UF4A 3FX6A 2J9AA 3NFZA 4ZY2A 4YWYA 6CPAA 2I3CA 1LANA 2PRQA 1FNOA 1F57A 1TKHA 4IK2A 3D4UA 4P4JA 1LFWA 3FVLA 4IHMA 3IO1A 3PB7X 4NGTA 4OKOA 5LYFA 4TWEA 2JBKA 1NSAA 3FMCA 2CIJA 2WZNA 1CPXA 4A94A 4MCRA 3PB9X 3SI2A 4ZY0A 1KWMA 3KHXA 1VHEA 1F2PA 1ZG8A 4OC0A 3IWWA 2PJ1A 4F9UA 3DGVA 2CTCA 3NH8A 4TNUA 3SI1A 3V7ZA 4MXUA 1ELLP 5LYDA 3PFEA 3FEDA 4PXDA 3KQXA 3D7GA 1QMUA 1PYTB 8CPAA 4P4IA 2ZEEA 4K3NA 2PJ9A 3GB0A 2PJCA 5LYIA 5DS0A 3I1UA 1YW4A 4WJBA 1CG2A 5LYLA 3KL9A 4R6TA 3S9MA 2RB7A 3IC1A 4MCSA 2PE3A 2ZEFA 2PJAA 2CF4A 2PVVA 4MCQA 2AFWA 3SI0A 2C6GA 2Q4ZA 4FBEA 2AFUA 3BXMA 3HLPA 3KGQA 1AMPA 2AFSA 4P44A 3WT4A 1HDUA 2IMOA 1IY7A 2ZEHA 1JQGA 1CX8A 2O53A 3QNVA 2NYQA 1ARLA 4O23A 1BLLE 3KR4A 4P4BA 1Y7EA 3BI1A 4WWVA 5K8OA 4Q7AA 4MRIA 3IIBA 2GREA 2GLFA 4MHNA 7CPAA 1Z5RA 3D7HA 4W9YA 1Y0YA 3PEIA 4ZX9A 2V77A 3KZWA 3D67A 3H8GA 4R7MA 5JGFA 2HB6A 3PB8X 1XFOA 5CPAA 4UEEA 2ZEDA 2QYVA 3SJFA 3CPAA 4BD9A 3PRTA 1XJOA 5J1QA 4NGSA 4A37A 4PPZA 1VHOA 2DEAA 4NGPA 1VIXA 4FUUA 3VATA 1ELMP 3ISZA 1XRYA 4OC5A 2PJ6A 1TKJA 5K8NA 5LRKA 5HVFA 5JM6A 3V38A 4UIAA 2NSMA 4JZ0A 4P4FA 2PCUA 4B6ZA 4PXCA 2ZEPA 2PJ3A 4EMEA 3WC5A 3CPXA 3D66A 2BOAA 3PBBA 3RAMA 1ZG7A 2EK9A 1YW6A 4UIBA 4P10A 3PBEA 4A38A 4EFDA 2IJZA 1RTQA 3BI0A 1DTDA 4GM5A 5JH9A 2PJ8A 1ZLHA 4P6YA 3HUVA 1FT7A 5K8MA 1XBUA 1M4LA 3B35A 3FECA 3K9TA 3N5FA 4P45A 3L2NA 4JYWA 4DJLA 3IJ3A 2PJBA 2ZEGA 4KSIA 2PVWA 2XEJA 4F9VA 2AFMA 2IQ6A 2V8VA 4RUHA 4YU9A 2VL1A 5HVGA 3S9NA 4PXBA 5K8PA 3PB6X 3RZAA 3BHXA 2ZENA 2C6PA 2V8HA 3FF3A 1TF9A 4P4DA 1R3NA 4LQGA 3B3CA 5HVHA 4NGMA 4R8FA 3DLJA 1LAMA 3FEEA 3B3VA 1GYTA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4NGQ A;  2GLJ A;  3TC8 A;  4ONW A;  3B3T A;  3TX8 A;  5I4M A;  3GUX A;  4FWU A;  3RBU A;  2ANP A;  4MHY A;  4OID A;  2Q51 A;  2WYR A;  3H8F A;  1Q7L A;  2ZOF A;  2CTB A;  2BCO A;  5D29 A;  1CP7 A;  2ZEL A;  3CDX A;  1F2O A;  5LRJ A;  4NJR A;  2EWB A;  4MMO A;  4H2K A;  4DUK A;  5IB9 A;  1TF8 A;  4DYO A;  2ZEM A;  5LRG A;  4X2T A;  3S9L A;  1Z2L A;  1EE3 P;  3K2K A;  3KR5 A;  2EK8 A;  1AYE A;  1LOK A;  2PJ4 A;  3LMS A;  2V8D A;  1HDQ A;  3GLJ A;  3B7I A;  3IFE A;  1PCA A;  3VH9 A;  2Q43 A;  2FVG A;  2V8G A;  3D68 A;  4OME A;  4MCP A;  4R76 A;  4AXV A;  3B3W A;  4X8I A;  1TXR A;  2ZOG A;  3JRU A;  3MRU A;  4PQA A;  2AFX A;  2PJ5 A;  4OC3 A;  1R43 A;  2GU2 A;  3WAB A;  2C1C A;  2XEG A;  4OC1 A;  1YME A;  2F7V A;  4UEF A;  3T8W A;  1CPS A;  4OC2 A;  4OC4 A;  2BO9 A;  4ZYQ A;  1Z8L A;  2QVP A;  3NA6 A;  3SJG A;  2QJ8 A;  3NH5 A;  3FJU A;  1VGY A;  2C6C A;  1CBX A;  3H8E A;  1BPM A;  4OP4 A;  3ISX A;  3PB4 X;  1YLO A;  4ZI6 A;  4MHP A;  4G1P A;  1UWY A;  4NFR A;  2AFZ A;  1LCP A;  1BAV A;  1LAP A;  5D8N A;  3VAR A;  1XMB A;  4ZY1 A;  4MHZ A;  4Z65 A;  2JBJ A;  3IEH A;  2PJ2 A;  1YSJ A;  4NGN A;  2XEF A;  3KI9 A;  4ZX8 A;  1ARM A;  1QQ9 A;  4CPA A;  2OOT A;  1Y0R A;  2POK A;  2OR4 A;  2ZEO A;  1OBR A;  1BPN A;  3WC7 A;  2PJ7 A;  2JEW A;  3PFO A;  1CP6 A;  5F09 A;  3WC6 A;  5HXD A;  2AFO A;  2PJ0 A;  3B3S A;  1H8L A;  2F8H A;  4A39 A;  2ABZ A;  3SJX A;  2RFH A;  5ELY A;  4FAI A;  1ZG9 A;  4OIW A;  3KQZ A;  1HEE A;  4X3R A;  5THW A;  4NJQ A;  2HC9 A;  3CT9 A;  3LWU A;  3B2Y A;  4NGR A;  4UEZ A;  2G9D A;  1DE4 C;  3NH4 A;  2XEI A;  4PXE A;  3SJE A;  5CBM A;  4P4E A;  4IAV A;  1IGB A;  3FH4 A;  1TKF A;  3KAS A;  2PIY A;  1ZLI A;  3D7F A;  4EWT A;  3KHZ A;  2PIZ A;  2O4H A;  3MN8 A;  3D7D A;  4F8Z A;  4UF4 A;  3FX6 A;  2J9A A;  3NFZ A;  4ZY2 A;  4YWY A;  6CPA A;  2I3C A;  1LAN A;  2PRQ A;  1FNO A;  1F57 A;  1TKH A;  4IK2 A;  3D4U A;  4P4J A;  1LFW A;  3FVL A;  4IHM A;  3IO1 A;  3PB7 X;  4NGT A;  4OKO A;  5LYF A;  4TWE A;  2JBK A;  1NSA A;  3FMC A;  2CIJ A;  2WZN A;  1CPX A;  4A94 A;  4MCR A;  3PB9 X;  3SI2 A;  4ZY0 A;  1KWM A;  3KHX A;  1VHE A;  1F2P A;  1ZG8 A;  4OC0 A;  3IWW A;  2PJ1 A;  4F9U A;  3DGV A;  2CTC A;  3NH8 A;  4TNU A;  3SI1 A;  3V7Z A;  4MXU A;  1ELL P;  5LYD A;  3PFE A;  3FED A;  4PXD A;  3KQX A;  3D7G A;  1QMU A;  1PYT B;  8CPA A;  4P4I A;  2ZEE A;  4K3N A;  2PJ9 A;  3GB0 A;  2PJC A;  5LYI A;  5DS0 A;  3I1U A;  1YW4 A;  4WJB A;  1CG2 A;  5LYL A;  3KL9 A;  4R6T A;  3S9M A;  2RB7 A;  3IC1 A;  4MCS A;  2PE3 A;  2ZEF A;  2PJA A;  2CF4 A;  2PVV A;  4MCQ A;  2AFW A;  3SI0 A;  2C6G A;  2Q4Z A;  4FBE A;  2AFU A;  3BXM A;  3HLP A;  3KGQ A;  1AMP A;  2AFS A;  4P44 A;  3WT4 A;  1HDU A;  2IMO A;  1IY7 A;  2ZEH A;  1JQG A;  1CX8 A;  2O53 A;  3QNV A;  2NYQ A;  1ARL A;  4O23 A;  1BLL E;  3KR4 A;  4P4B A;  1Y7E A;  3BI1 A;  4WWV A;  5K8O A;  4Q7A A;  4MRI A;  3IIB A;  2GRE A;  2GLF A;  4MHN A;  7CPA A;  1Z5R A;  3D7H A;  4W9Y A;  1Y0Y A;  3PEI A;  4ZX9 A;  2V77 A;  3KZW A;  3D67 A;  3H8G A;  4R7M A;  5JGF A;  2HB6 A;  3PB8 X;  1XFO A;  5CPA A;  4UEE A;  2ZED A;  2QYV A;  3SJF A;  3CPA A;  4BD9 A;  3PRT A;  1XJO A;  5J1Q A;  4NGS A;  4A37 A;  4PPZ A;  1VHO A;  2DEA A;  4NGP A;  1VIX A;  4FUU A;  3VAT A;  1ELM P;  3ISZ A;  1XRY A;  4OC5 A;  2PJ6 A;  1TKJ A;  5K8N A;  5LRK A;  5HVF A;  5JM6 A;  3V38 A;  4UIA A;  2NSM A;  4JZ0 A;  4P4F A;  2PCU A;  4B6Z A;  4PXC A;  2ZEP A;  2PJ3 A;  4EME A;  3WC5 A;  3CPX A;  3D66 A;  2BOA A;  3PBB A;  3RAM A;  1ZG7 A;  2EK9 A;  1YW6 A;  4UIB A;  4P10 A;  3PBE A;  4A38 A;  4EFD A;  2IJZ A;  1RTQ A;  3BI0 A;  1DTD A;  4GM5 A;  5JH9 A;  2PJ8 A;  1ZLH A;  4P6Y A;  3HUV A;  1FT7 A;  5K8M A;  1XBU A;  1M4L A;  3B35 A;  3FEC A;  3K9T A;  3N5F A;  4P45 A;  3L2N A;  4JYW A;  4DJL A;  3IJ3 A;  2PJB A;  2ZEG A;  4KSI A;  2PVW A;  2XEJ A;  4F9V A;  2AFM A;  2IQ6 A;  2V8V A;  4RUH A;  4YU9 A;  2VL1 A;  5HVG A;  3S9N A;  4PXB A;  5K8P A;  3PB6 X;  3RZA A;  3BHX A;  2ZEN A;  2C6P A;  2V8H A;  3FF3 A;  1TF9 A;  4P4D A;  1R3N A;  4LQG A;  3B3C A;  5HVH A;  4NGM A;  4R8F A;  3DLJ A;  1LAM A;  3FEE A;  3B3V A;  1GYT A; 
#chains in the Genus database with same CATH topology
 4NGQ A;  2AJ6 A;  1S7N A;  2GLJ A;  4H89 A;  2Q4Y A;  4E0A A;  3TC8 A;  4ONW A;  3B3T A;  3TX8 A;  4A31 A;  5I4M A;  3TE4 A;  3QAH A;  3GUX A;  4A30 A;  1QST A;  4FWU A;  3RBU A;  3SXO A;  3WR7 A;  2J8N A;  3KKW A;  2G3T A;  4KS9 A;  4AVC A;  2ANP A;  2WPX A;  3DSB A;  4Y49 B;  5JQ4 A;  4MHY A;  2HV2 A;  2Z3O A;  4OID A;  2Q51 A;  4KOW A;  3G8W A;  2YGW A;  1YVK A;  1YK3 A;  2AE6 A;  2WYR A;  3H8F A;  1Q7L A;  2ZOF A;  2CTB A;  2JLM A;  2QML A;  1YQE A;  4JJX A;  1Q2Y A;  4U9Y A;  4MY0 A;  2BCO A;  3A9L A;  4UWI A;  5D29 A;  3S6G A;  3FBU A;  1CP7 A;  1VHS A;  2ZEL A;  3CDX A;  1F2O A;  2B4D B;  5LRJ A;  2X7B A;  5AG4 A;  4NJR A;  5KTC A;  3GKR A;  4B12 A;  5AG6 A;  2EWB A;  4MMO A;  2BUE A;  4H2K A;  4DUK A;  5IB9 A;  1TF8 A;  3DNS A;  4CGM A;  4CGP A;  4DYO A;  1KUY A;  1GHE A;  1ON0 A;  3R95 A;  2O28 A;  5AGE A;  2ZEM A;  5G1Z A;  4GXH A;  1IOI A;  3EY5 A;  4X2T A;  5LRG A;  4CS0 B;  3S9L A;  1IIC A;  1MJB A;  1NMT A;  2PRB A;  4FD7 A;  3FYN A;  1M1D A;  3SHP A;  1Z2L A;  1EE3 P;  3R1K A;  2CNS A;  2ZW7 A;  5C88 A;  3C26 A;  3K2K A;  3KR5 A;  2EK8 A;  3D2M A;  1AYE A;  3T90 A;  1LOK A;  2PJ4 A;  1IID A;  1WWZ A;  3LMS A;  2V8D A;  2GIV A;  2Z3K A;  4I49 A;  4M85 A;  4KVX A;  5H86 A;  3RYO A;  1HDQ A;  3GLJ A;  2Q0Y A;  3B7I A;  4JXQ A;  3IFE A;  1PCA A;  2PSW A;  4JLY A;  3VH9 A;  2Q43 A;  2FVG A;  2FXF A;  2V8G A;  3D68 A;  4KOU A;  2VBQ A;  4OME A;  4MCP A;  3BJ7 A;  4R76 A;  4AXV A;  3B3W A;  4CYP A;  4X8I A;  1TXR A;  2ZOG A;  1R57 A;  2H5M A;  3JRU A;  4NXY A;  3P2F A;  3MRU A;  4PQA A;  1Q2D A;  2AFX A;  4KOT A;  2PJ5 A;  4A33 A;  3F5B A;  1IB1 E;  4U5Y A;  4OC3 A;  1R43 A;  2GU2 A;  3WAB A;  2C1C A;  4KLV A;  4CYQ A;  2XEG A;  4OC1 A;  1YME A;  2F7V A;  4UEF A;  3T8W A;  2ZW5 A;  1CPS A;  4OC2 A;  4OC4 A;  5HMN A;  2EUI A;  2BO9 A;  4ZYQ A;  4A32 A;  2PQ8 A;  1Z8L A;  2QVP A;  1Z9U A;  3FNC A;  1N71 A;  4AG7 A;  3NA6 A;  3QB8 A;  1NE9 A;  3SJG A;  2QJ8 A;  1B6B A;  3NH5 A;  4UCN A;  3D8P A;  3FJU A;  2P6G A;  4Q36 A;  4PV6 A;  1MK4 A;  1VGY A;  2C6C A;  3ZJ0 A;  1RXT A;  1CBX A;  3JVN A;  3H8E A;  1BPM A;  1V0C A;  4OP4 A;  4BMH A;  3ISX A;  3PB4 X;  1YLO A;  4AG9 A;  4OLL A;  4ZI6 A;  2F5I A;  2HQY A;  2Q04 A;  4J3G A;  3EFA A;  1Z8T A;  4G1P A;  4KOY A;  4MHP A;  5FVJ A;  3BJ8 A;  1UWY A;  2RC4 A;  4NEX A;  4HKF A;  3EC4 A;  1QSM A;  4CAV A;  1YRE A;  4NFR A;  2AFZ A;  1LCP A;  3H5Z A;  4H6Z A;  2FL4 A;  1I21 A;  1I12 A;  5DWM A;  1S7L A;  1S60 A;  1TIQ A;  1BAV A;  2VZY A;  1LAP A;  1L0C A;  5D8N A;  3VAR A;  1XEB A;  2BSW A;  3LAC A;  4UWJ A;  3BLN A;  3S6F A;  1XMB A;  2BEI A;  4ZY1 A;  4MHZ A;  3TO6 A;  4Z65 A;  2JBJ A;  3JTK A;  4C2Y A;  2CNT A;  3IEH A;  4QB9 A;  1BOB A;  2EVN A;  1IU8 A;  2CNM A;  2GE3 A;  2PJ2 A;  1PU9 A;  1YSJ A;  4U9Z A;  4NGN A;  2XEF A;  3PP9 A;  3KI9 A;  1NSL A;  4ZX8 A;  4MJ8 A;  2OB0 A;  4DNC A;  1ARM A;  1QQ9 A;  4CPA A;  2A4N A;  4PK3 A;  1Y0R A;  4MFZ A;  2POK A;  4QUS A;  2OOT A;  4F0Y A;  2OR4 A;  2ODF A;  4HNW B;  4KUB A;  4UCM A;  2ZEO A;  4KOV A;  1OBR A;  1BPN A;  1XIX A;  5I0C A;  1M4G A;  3WC7 A;  1JWQ A;  2PJ7 A;  4ZBG A;  5DWN A;  4A2Z A;  2ZPA A;  1PUA A;  2REF A;  1KUX A;  3TT2 A;  5KTA A;  3TOA A;  2ZW4 A;  2JEW A;  3PFO A;  1CP6 A;  3EXN A;  2Z3P A;  3RNZ A;  1IYL A;  4GS4 A;  3WC6 A;  5F09 A;  3W6S A;  5HXD A;  3GYA A;  2C27 A;  2AFO A;  2PJ0 A;  3IWE A;  1FY7 A;  3B3S A;  4RS2 A;  1H8L A;  2F8H A;  4A39 A;  2VI7 A;  4JD6 A;  3TO7 A;  2ABZ A;  3TOB A;  5AG7 A;  4B11 A;  2KCW A;  3SJX A;  4RI1 A;  4KUA A;  2R7H A;  2RFH A;  5CNP A;  5ELY A;  4FAI A;  1ZG9 A;  4OIW A;  4NCZ A;  3TTH A;  3KQZ A;  1HEE A;  2VZZ A;  4X3R A;  5THW A;  3W6X A;  4NJQ A;  2HC9 A;  3CT9 A;  4XNH C;  3LWU A;  3IGR A;  3B2Y A;  2ARH A;  4NGR A;  4UEZ A;  2FE7 A;  2VXK A;  4KOS A;  4K30 A;  5J8C A;  4CRY B;  4C7I A;  1QSR A;  2G9D A;  1XE4 A;  1DE4 C;  3NH4 A;  2GFQ A;  2J8R A;  2XEI A;  1P0H A;  4PXE A;  3NE7 A;  2JEV A;  3IWG A;  4AVA A;  5GCN A;  3SJE A;  2OZG A;  2FT0 A;  1QSO A;  5CBM A;  1U6M A;  4P4E A;  4C7H A;  4IAV A;  5F49 A;  1IGB A;  1S3Z A;  2Z3N A;  3FH4 A;  1TKF A;  2BL1 A;  3KAS A;  1YR0 A;  3QAY A;  4XNH B;  2PIY A;  1ZLI A;  3D7F A;  4EWT A;  3KHZ A;  2PIZ A;  3ZZI A;  2O4H A;  1P4N A;  1S7F A;  3MN8 A;  4MY3 A;  3D7D A;  4F8Z A;  4UF4 A;  4F6A A;  3FX6 A;  4UFX A;  3FRM A;  2ZW6 A;  2J9A A;  3CXQ A;  4FD6 A;  3NFZ A;  4UBR A;  4YWY A;  4ZY2 A;  5C82 A;  6CPA A;  2I3C A;  3TFY A;  1WK4 A;  1LAN A;  2PRQ A;  1FNO A;  4KZT A;  1F57 A;  1TKH A;  3SXN A;  4IK2 A;  2VQY A;  3D4U A;  4B5O A;  4P4J A;  1LFW A;  4KOX A;  3FVL A;  4C68 A;  4IHM A;  2PC1 A;  3IO1 A;  4KVO E;  1OZP A;  3PB7 X;  4NGT A;  4IUS A;  4OKO A;  1RO5 A;  5LYF A;  3D3S A;  4TWE A;  2JBK A;  1NSA A;  2G3A A;  1Z4E A;  2WUU A;  3FMC A;  2CIJ A;  4UA3 A;  2WZN A;  4JXR A;  1CPX A;  4M6H A;  3V8I A;  4X5K A;  4C2Z A;  1S5K A;  4MHD A;  3I3G A;  4II9 A;  4A94 A;  3FB3 A;  4CYO A;  4MCR A;  4C2X A;  3PB9 X;  3SI2 A;  4ZY0 A;  1KWM A;  3KHX A;  3S6K A;  3UY5 A;  1VHE A;  1XMT A;  2HUZ A;  4KLW A;  1F2P A;  1ZG8 A;  2R98 A;  4OC0 A;  2B5G A;  1KUV A;  2REE A;  4MFL A;  3IWW A;  2PJ1 A;  1XOV A;  4F9U A;  4KVM E;  2ATR A;  4CAF A;  3E0K A;  3DGV A;  2CTC A;  2B3U A;  3NH8 A;  4MFQ A;  3F8K A;  4R3L A;  4TNU A;  5AG5 A;  3SI1 A;  3NE8 A;  3V7Z A;  2YNE A;  4MXU A;  1CM0 A;  4OAE A;  1ELL P;  5LYD A;  2Q44 A;  3PFE A;  2FIA A;  1YLE A;  3FED A;  4PXD A;  3KQX A;  4F0X A;  1MJ9 A;  1QMU A;  1PYT B;  3D7G A;  5F47 A;  4H6U A;  8CPA A;  4NF1 A;  2B5G B;  4P4I A;  4M6I A;  2ZEE A;  4K3N A;  4BIN A;  2PJ9 A;  3GB0 A;  2PJC A;  5LYI A;  3IU1 A;  5DS0 A;  4CGO A;  2R8V A;  5A27 A;  4MFK A;  3I1U A;  1YW4 A;  2Y0M A;  4PK2 A;  4WJB A;  1CG2 A;  5LYL A;  4UFW A;  2WSA A;  2JDD A;  1LRZ A;  3KL9 A;  4MFJ A;  2OU2 A;  3OWC A;  4R6T A;  3S9M A;  2RB7 A;  3TCV A;  3IC1 A;  4MCS A;  2PE3 A;  2ZEF A;  2PJA A;  2CF4 A;  3G3S A;  1AUG A;  2PVV A;  4XPD C;  4B13 A;  4MCQ A;  1X10 A;  2AFW A;  4EVY A;  3SI0 A;  2C6G A;  2Z11 A;  4CGL A;  2Q4Z A;  3B8G A;  5A28 A;  4FBE A;  2EBJ A;  2AFU A;  3S6H A;  2PR1 A;  2JDC A;  3BXM A;  3HLP A;  4KSF A;  2Q7S A;  4Q38 A;  3KGQ A;  1AMP A;  2AFS A;  4P44 A;  1SQH A;  4R57 A;  1HDU A;  2IMO A;  3WT4 A;  1IY7 A;  4RN7 A;  5E96 A;  2ZEH A;  1JQG A;  2QEC A;  1CX8 A;  1ZO0 A;  2O53 A;  3QNV A;  4FD4 A;  4M6G A;  5JPH A;  1Y7R A;  5EMI A;  5IV0 A;  2NYQ A;  4HPS A;  4XPL A;  4FD5 A;  1ARL A;  4O23 A;  4A95 A;  1BLL E;  3KR4 A;  4P4B A;  1Y7E A;  3BI1 A;  4ONU A;  4WWV A;  4CAW A;  5K8O A;  1M4D A;  4Q7A A;  4MRI A;  3IIB A;  2FS5 A;  3CXP A;  2GRE A;  2GLF A;  4MHN A;  2Z10 A;  7CPA A;  2CY2 A;  1Z5R A;  3D7H A;  4W9Y A;  4AB7 A;  2OZH A;  1Y0Y A;  3PEI A;  4HNY B;  4R87 A;  5KTD A;  4ZX9 A;  2V77 A;  3KZW A;  3D67 A;  1IOF A;  3H8G A;  4R7M A;  5JGF A;  2HB6 A;  3PB8 X;  4AVB A;  1XFO A;  3N7Z A;  4NSQ A;  1M44 A;  3DDD A;  4OAD A;  1S7K A;  5CPA A;  4UEE A;  1QSN A;  3R9E A;  3R9G A;  2ZED A;  2QYV A;  1VKC A;  2FCK A;  3SJF A;  3CPA A;  4BD9 A;  3PRT A;  5EC4 A;  1XJO A;  1Y9W A;  5J1Q A;  4NGS A;  4QBJ A;  4MFP A;  4ZGY B;  4LUA A;  4A37 A;  4PPZ A;  1VHO A;  4B10 A;  4R9M A;  2DEA A;  5ISV A;  2D4O A;  2Z3M A;  4NGP A;  1Z4R A;  4PSW A;  1VIX A;  4UFV A;  4FUU A;  5EBV A;  3VAT A;  4CYN A;  1Z8W A;  1ELM P;  4M3S A;  3JUW A;  3PZJ A;  2B58 A;  3ISZ A;  1XRY A;  1CJW A;  1X12 A;  4OC5 A;  2Z0Z A;  5IB0 A;  3FIX A;  5G20 A;  4YGO A;  2PJ6 A;  1TKJ A;  2K5T A;  4PSX A;  3PGP A;  5K8N A;  5LRK A;  3CXS A;  1Z8X A;  3F0A A;  5HVF A;  4BBH A;  5G22 A;  1J4J A;  5JM6 A;  3V38 A;  4UIA A;  2NSM A;  3I9S A;  4JZ0 A;  4P4F A;  5F46 A;  2PCU A;  4CAE A;  4B6Z A;  4PXC A;  5J8F A;  5H84 A;  2VEZ A;  2ZEP A;  2PJ3 A;  4EME A;  3WC5 A;  1Q2C A;  2DXQ A;  2J8M A;  3CPX A;  1A2Z A;  3D66 A;  5HH1 A;  2GAN A;  2NMT A;  3K9U A;  3GIU A;  3LOD A;  2BOA A;  3PBB A;  2OH1 A;  3RAM A;  1K4J A;  1YVO A;  3D2P A;  2I79 A;  1ZG7 A;  3W91 A;  3MGD A;  4CGN A;  2EK9 A;  1YW6 A;  4UIB A;  2FSR A;  2QIR A;  4P10 A;  3PBE A;  1YX0 A;  4A38 A;  4EFD A;  2IJZ A;  2WPW A;  2D4P A;  4R3K A;  2B3V A;  1RTQ A;  4QVT A;  2R1I A;  3BI0 A;  2ZXV A;  1DTD A;  2DPT A;  4GM5 A;  4UCP A;  3T9Y A;  5JH9 A;  2PJ8 A;  1ZLH A;  4P6Y A;  3HUV A;  1FT7 A;  4YRH A;  1B87 A;  3H4Q A;  5K8M A;  4ORF A;  4E8O A;  1XBU A;  3DR6 A;  1M4L A;  3B35 A;  3FEC A;  3K9T A;  1YGH A;  3N5F A;  5BWA B;  4P45 A;  2I00 A;  2B4B A;  5G21 A;  3VWD A;  1MJA A;  3L2N A;  4JYW A;  3VWE A;  4DJL A;  1I1D A;  3DR8 A;  4B5P A;  3R9F A;  3IJ3 A;  3CZX A;  1Y9K A;  3EO4 A;  5F48 A;  4LQ6 A;  1KZF A;  4CRZ B;  2YNC A;  2PJB A;  2ZEG A;  3FXT A;  4KSI A;  4IF5 A;  2PVW A;  4MBU A;  2XEJ A;  4F9V A;  2AFM A;  2IQ6 A;  2V8V A;  3LD2 A;  4KSA A;  2PR8 A;  4XPK A;  4RUH A;  4YU9 A;  2IL4 A;  2VL1 A;  5HVG A;  3S9N A;  2YNC C;  3IU2 A;  2Q4V A;  4PXB A;  2YND A;  3PB6 X;  4CAX A;  2CXA A;  2P6F A;  1UFH A;  5K8P A;  4JWP A;  3R96 A;  2Z3L A;  2P0W A;  3BHX A;  2ZEN A;  3RZA A;  2C6P A;  3RO0 A;  4E2A A;  2V8H A;  4B14 A;  3FF3 A;  1M4I A;  3TO9 A;  5IX3 A;  1TF9 A;  4P4D A;  1R3N A;  4LQG A;  2PDO A;  4MI4 A;  1IYK A;  3GY9 A;  3B3C A;  2EO8 A;  2FIW A;  5HVH A;  4B5P B;  4LX9 A;  2OZU A;  4HNX B;  4NGM A;  4XPD B;  4R8F A;  2G0B A;  1BO4 A;  3DLJ A;  4Y49 C;  1LAM A;  2DF5 A;  2DPS A;  1XF8 A;  3FEE A;  3P2H A;  4L8A A;  4L89 A;  2Q7B A;  4QC6 A;  2P6E A;  4YFJ A;  4KOR A;  2B4D A;  3B3V A;  1GYT A; 
#chains in the Genus database with same CATH homology
 4NGQ A;  2GLJ A;  3TC8 A;  4ONW A;  3B3T A;  3TX8 A;  5I4M A;  3GUX A;  4FWU A;  3RBU A;  2ANP A;  4MHY A;  4OID A;  2Q51 A;  2WYR A;  3H8F A;  1Q7L A;  2ZOF A;  2CTB A;  2BCO A;  5D29 A;  1CP7 A;  2ZEL A;  3CDX A;  1F2O A;  5LRJ A;  4NJR A;  2EWB A;  4MMO A;  4H2K A;  4DUK A;  5IB9 A;  1TF8 A;  4DYO A;  2ZEM A;  5LRG A;  4X2T A;  3S9L A;  1Z2L A;  1EE3 P;  3K2K A;  3KR5 A;  2EK8 A;  1AYE A;  1LOK A;  2PJ4 A;  3LMS A;  2V8D A;  1HDQ A;  3GLJ A;  3B7I A;  3IFE A;  1PCA A;  3VH9 A;  2Q43 A;  2FVG A;  2V8G A;  3D68 A;  4OME A;  4MCP A;  4R76 A;  4AXV A;  3B3W A;  4X8I A;  1TXR A;  2ZOG A;  3JRU A;  3MRU A;  4PQA A;  2AFX A;  2PJ5 A;  4OC3 A;  1R43 A;  2GU2 A;  3WAB A;  2C1C A;  2XEG A;  4OC1 A;  1YME A;  2F7V A;  4UEF A;  3T8W A;  1CPS A;  4OC2 A;  4OC4 A;  2BO9 A;  4ZYQ A;  1Z8L A;  2QVP A;  3NA6 A;  3SJG A;  2QJ8 A;  3NH5 A;  3FJU A;  1VGY A;  2C6C A;  1CBX A;  3H8E A;  1BPM A;  4OP4 A;  3ISX A;  3PB4 X;  1YLO A;  4ZI6 A;  4MHP A;  4G1P A;  1UWY A;  4NFR A;  2AFZ A;  1LCP A;  1BAV A;  1LAP A;  5D8N A;  3VAR A;  1XMB A;  4ZY1 A;  4MHZ A;  4Z65 A;  2JBJ A;  3IEH A;  2PJ2 A;  1YSJ A;  4NGN A;  2XEF A;  3KI9 A;  4ZX8 A;  1ARM A;  1QQ9 A;  4CPA A;  2OOT A;  1Y0R A;  2POK A;  2OR4 A;  2ZEO A;  1OBR A;  1BPN A;  3WC7 A;  2PJ7 A;  2JEW A;  3PFO A;  1CP6 A;  5F09 A;  3WC6 A;  5HXD A;  2AFO A;  2PJ0 A;  3B3S A;  1H8L A;  2F8H A;  4A39 A;  2ABZ A;  3SJX A;  2RFH A;  5ELY A;  4FAI A;  1ZG9 A;  4OIW A;  3KQZ A;  1HEE A;  4X3R A;  5THW A;  4NJQ A;  2HC9 A;  3CT9 A;  3LWU A;  3B2Y A;  4NGR A;  4UEZ A;  2G9D A;  1DE4 C;  3NH4 A;  2XEI A;  4PXE A;  3SJE A;  5CBM A;  4P4E A;  4IAV A;  1IGB A;  3FH4 A;  1TKF A;  3KAS A;  2PIY A;  1ZLI A;  3D7F A;  4EWT A;  3KHZ A;  2PIZ A;  2O4H A;  3MN8 A;  3D7D A;  4F8Z A;  4UF4 A;  3FX6 A;  2J9A A;  3NFZ A;  4ZY2 A;  4YWY A;  6CPA A;  2I3C A;  1LAN A;  2PRQ A;  1FNO A;  1F57 A;  1TKH A;  4IK2 A;  3D4U A;  4P4J A;  1LFW A;  3FVL A;  4IHM A;  3IO1 A;  3PB7 X;  4NGT A;  4OKO A;  5LYF A;  4TWE A;  2JBK A;  1NSA A;  3FMC A;  2CIJ A;  2WZN A;  1CPX A;  4A94 A;  4MCR A;  3PB9 X;  3SI2 A;  4ZY0 A;  1KWM A;  3KHX A;  1VHE A;  1F2P A;  1ZG8 A;  4OC0 A;  3IWW A;  2PJ1 A;  4F9U A;  3DGV A;  2CTC A;  3NH8 A;  4TNU A;  3SI1 A;  3V7Z A;  4MXU A;  1ELL P;  5LYD A;  3PFE A;  3FED A;  4PXD A;  3KQX A;  3D7G A;  1QMU A;  1PYT B;  8CPA A;  4P4I A;  2ZEE A;  4K3N A;  2PJ9 A;  3GB0 A;  2PJC A;  5LYI A;  5DS0 A;  3I1U A;  1YW4 A;  4WJB A;  1CG2 A;  5LYL A;  3KL9 A;  4R6T A;  3S9M A;  2RB7 A;  3IC1 A;  4MCS A;  2PE3 A;  2ZEF A;  2PJA A;  2CF4 A;  2PVV A;  4MCQ A;  2AFW A;  3SI0 A;  2C6G A;  2Q4Z A;  4FBE A;  2AFU A;  3BXM A;  3HLP A;  3KGQ A;  1AMP A;  2AFS A;  4P44 A;  3WT4 A;  1HDU A;  2IMO A;  1IY7 A;  2ZEH A;  1JQG A;  1CX8 A;  2O53 A;  3QNV A;  2NYQ A;  1ARL A;  4O23 A;  1BLL E;  3KR4 A;  4P4B A;  1Y7E A;  3BI1 A;  4WWV A;  5K8O A;  4Q7A A;  4MRI A;  3IIB A;  2GRE A;  2GLF A;  4MHN A;  7CPA A;  1Z5R A;  3D7H A;  4W9Y A;  1Y0Y A;  3PEI A;  4ZX9 A;  2V77 A;  3KZW A;  3D67 A;  3H8G A;  4R7M A;  5JGF A;  2HB6 A;  3PB8 X;  1XFO A;  5CPA A;  4UEE A;  2ZED A;  2QYV A;  3SJF A;  3CPA A;  4BD9 A;  3PRT A;  1XJO A;  5J1Q A;  4NGS A;  4A37 A;  4PPZ A;  1VHO A;  2DEA A;  4NGP A;  1VIX A;  4FUU A;  3VAT A;  1ELM P;  3ISZ A;  1XRY A;  4OC5 A;  2PJ6 A;  1TKJ A;  5K8N A;  5LRK A;  5HVF A;  5JM6 A;  3V38 A;  4UIA A;  2NSM A;  4JZ0 A;  4P4F A;  2PCU A;  4B6Z A;  4PXC A;  2ZEP A;  2PJ3 A;  4EME A;  3WC5 A;  3CPX A;  3D66 A;  2BOA A;  3PBB A;  3RAM A;  1ZG7 A;  2EK9 A;  1YW6 A;  4UIB A;  4P10 A;  3PBE A;  4A38 A;  4EFD A;  2IJZ A;  1RTQ A;  3BI0 A;  1DTD A;  4GM5 A;  5JH9 A;  2PJ8 A;  1ZLH A;  4P6Y A;  3HUV A;  1FT7 A;  5K8M A;  1XBU A;  1M4L A;  3B35 A;  3FEC A;  3K9T A;  3N5F A;  4P45 A;  3L2N A;  4JYW A;  4DJL A;  3IJ3 A;  2PJB A;  2ZEG A;  4KSI A;  2PVW A;  2XEJ A;  4F9V A;  2AFM A;  2IQ6 A;  2V8V A;  4RUH A;  4YU9 A;  2VL1 A;  5HVG A;  3S9N A;  4PXB A;  5K8P A;  3PB6 X;  3RZA A;  3BHX A;  2ZEN A;  2C6P A;  2V8H A;  3FF3 A;  1TF9 A;  4P4D A;  1R3N A;  4LQG A;  3B3C A;  5HVH A;  4NGM A;  4R8F A;  3DLJ A;  1LAM A;  3FEE A;  3B3V A;  1GYT A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...