4UEFA

Crystal structure of the human carboxypeptidase a1 in complex with the phosphinic inhibitor acetyl-tyr-ala-y(po2ch2)-homophe-oh
Total Genus 115
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
115
sequence length
306
structure length
306
Chain Sequence
STDTFNYATYHTLEEIYDFLDLLVAENPHLVSKIQIGNTYEGRPIYVLKFSTGGSKRPAIWIDTGIHSREWVTQASGVWFAKKITQDYGQDAAFTAILDTLDIFLEIVTNPDGFAFTHSTNRMWRKTRSHTAGSLCIGVDPNRNWDAGFGLSGASSNPCSETYHGKFANSEVEVKSIVDFVKDHGNIKAFISIHSYSQLLMYPYGYKTEPVPDQDELDQLSKAAVTALASLYGTKFNYGSIIKAIYQASGSTIDWTYSQGIKYSFTFELRDTGRYGFLLPASQIIPTAKETWLALLTIMEHTLNHP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords CARBOXYPEPTIDASE A1
publication title Crystal Structure of the Human Carboxypeptidase A1 in Complex with Phosphinic Inhibitors
rcsb
source organism Homo sapiens
molecule tags Hydrolase
total genus 115
structure length 306
sequence length 306
chains with identical sequence B
ec nomenclature ec 3.4.17.1: Carboxypeptidase A.
pdb deposition date 2014-12-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00246 Peptidase_M14 Zinc carboxypeptidase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.630.10 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Zn peptidases 4uefA00
3RZAA 4R76A 3RBUA 2PJ3A 3KASA 2GREA 2RFHA 3BXMA 3SJEA 3CPXA 4B6ZA 3GLJA 3KR4A 3PB8X 5JH9A 4ONWA 3HLPA 4FWUA 3N5FA 5LYLA 4IK2A 8CPAA 3PBBA 2JBJA 4ZX9A 4P6YA 1Z2LA 3NH8A 3L2NA 3IEHA 1IY7A 2OOTA 4NGPA 3WC7A 4F8ZA 2PRQA 5D8NA 4FAIA 3NFZA 1ZLHA 4NFRA 3SI1A 4O23A 2XEIA 3NH4A 5LYDA 4NJQA 1BLLE 1F2PA 2PJ4A 4EFDA 7CPAA 4P10A 3FECA 3MN8A 5LRGA 3D67A 2NSMA 2O53A 3DLJA 4TNUA 4NGMA 4NGRA 3FX6A 3SJGA 3PFOA 1LFWA 3FH4A 3S9MA 3GUXA 5J1QA 1CG2A 4P44A 3B7IA 2ZEHA 3TX8A 1YW4A 4ZY2A 5K8NA 1ZLIA 4P4EA 3KQZA 4R8FA 3WC5A 3KGQA 3V38A 4ZY0A 1FNOA 1CP7A 1VIXA 1HEEA 2BO9A 4NGTA 4X2TA 2CTBA 3FMCA 2CIJA 5JGFA 4P4FA 5D29A 3LWUA 4OIDA 1Y7EA 2C6GA 2HC9A 4DYOA 3PBEA 3FEEA 1HDUA 1BAVA 4PXBA 3WC6A 2C1CA 3K9TA 1IGBA 2PJ7A 4MMOA 1TF9A 2C6PA 4RUHA 2BCOA 1BPNA 2PVWA 3T8WA 1F57A 2ZEPA 1ELLP 1YW6A 3S9NA 2F8HA 3I1UA 2G9DA 6CPAA 2PJ9A 2J9AA 3IIBA 2ZEOA 2ZELA 4OC5A 3ISXA 2GLFA 2O4HA 4PXCA 2JBKA 2Q4ZA 3WT4A 2PCUA 1XRYA 3KI9A 4ZX8A 4WWVA 1LAPA 3B35A 4UIAA 2PJ6A 4JYWA 1TXRA 2ABZA 2ZOGA 2ZEGA 2I3CA 4NGQA 4P4JA 4YWYA 1GYTA 4R7MA 2PIYA 4MXUA 4A38A 1R3NA 2JEWA 1TKJA 1LCPA 1CP6A 3IWWA 4Z65A 4H2KA 4OMEA 3CPAA 1YMEA 2V77A 1LAMA 3GB0A 1TKFA 4MCSA 4EMEA 2PVVA 1EE3P 5CPAA 1UWYA 2AFUA 5ELYA 3PB7X 3FF3A 2OR4A 2AFMA 3PEIA 1AMPA 3SJXA 4OIWA 4P4DA 2GLJA 1CPXA 3WABA 1ARMA 4MCPA 4K3NA 2NYQA 4UEFA 1Z8LA 2V8VA 2QJ8A 2ZEFA 2Q51A 2WYRA 4JZ0A 3D7FA 4ZYQA 2CTCA 4OC1A 2ZEMA 1VGYA 5I4MA 1KWMA 1LANA 3BI1A 4DJLA 2PE3A 4GM5A 3MRUA 3SI0A 5THWA 4OC2A 4WJBA 1TF8A 4X3RA 3S9LA 2PIZA 3H8EA 5DS0A 3B3TA 3D68A 1VHEA 4OP4A 4F9VA 2AFXA 4PQAA 4MCRA 4MHZA 2AFZA 3KR5A 4OC4A 2ZEEA 5K8MA 2IQ6A 4A94A 2CF4A 4A39A 1DTDA 2DEAA 2ZEDA 3V7ZA 1VHOA 1Y0RA 2C6CA 1JQGA 2V8DA 3QNVA 3PRTA 1XBUA 3VATA 4FBEA 4MCQA 3VH9A 5F09A 3KHXA 1CX8A 3D7GA 2ZOFA 3K2KA 4EWTA 5HVFA 4A37A 2PJ0A 3D7HA 4UIBA 4CPAA 2POKA 4ZY1A 2PJAA 3IJ3A 4P4IA 2VL1A 4UEEA 2V8GA 4F9UA 1RTQA 4AXVA 4UF4A 3B3VA 2AFWA 4UEZA 2QYVA 2EWBA 4PXEA 1Z5RA 4G1PA 3PB9X 2ANPA 3JRUA 3BHXA 1ZG9A 2AFSA 3KHZA 4P4BA 3H8GA 4OC3A 4R6TA 1LOKA 4PPZA 2ZENA 2PJBA 3IC1A 2BOAA 3NH5A 5LYIA 4MRIA 5K8OA 3FJUA 2HB6A 1YLOA 3PFEA 1ZG7A 2F7VA 1ARLA 2QVPA 4NGNA 1CBXA 3KQXA 3KZWA 1BPMA 2XEFA 3B3WA 3RAMA 3NA6A 1QMUA 3VARA 2XEJA 2IJZA 3DGVA 1H8LA 4P45A 3SI2A 1R43A 1QQ9A 4OC0A 3IFEA 2V8HA 2PJ1A 1YSJA 1XMBA 3PB6X 5HVHA 4FUUA 2PJ8A 3CDXA 5JM6A 3BI0A 4TWEA 3HUVA 3B3SA 4NGSA 2EK8A 3FEDA 4PXDA 3ISZA 4ZI6A 4DUKA 3LMSA 2GU2A 4Q7AA 2IMOA 4BD9A 1TKHA 1PCAA 3TC8A 4KSIA 2AFOA 3FVLA 2PJ5A 3SJFA 4OKOA 1XJOA 3D7DA 1AYEA 3PB4X 1PYTB 4NJRA 4IAVA 3D66A 3CT9A 2EK9A 4MHYA 3D4UA 4IHMA 1XFOA 1OBRA 1F2OA 1FT7A 4YU9A 5LYFA 5IB9A 2PJCA 1HDQA 3B3CA 1ELMP 2Q43A 3H8FA 2PJ2A 5LRJA 5CBMA 5HXDA 5HVGA 1M4LA 5K8PA 5LRKA 1Y0YA 1CPSA 2WZNA 3B2YA 1Q7LA 1ZG8A 4MHPA 2FVGA 3KL9A 1NSAA 3IO1A 2XEGA 4LQGA 4W9YA 4MHNA 1DE4C 4X8IA 2RB7A
chains in the Genus database with same CATH superfamily
2FIWA 3RZAA 4KSAA 4R76A 4LX9A 5KTAA 3R96A 4XNHC 3RBUA 4JXQA 2PJ3A 3BJ8A 3P2FA 2Z0ZA 3F0AA 3KASA 4CAFA 2GREA 2RFHA 3BXMA 2B4DB 1KZFA 3K9UA 4JWPA 1YK3A 3CPXA 3GY9A 3SJEA 3W6XA 4B6ZA 1VKCA 5ISVA 1S7LA 4GXHA 1K4JA 3GLJA 3KR4A 3PB8X 5JH9A 4ONWA 5F47A 3HLPA 4FWUA 4CYQA 5I0CA 2P6GA 3BJ7A 4MJ8A 3N5FA 5LYLA 4C68A 4PK3A 1Z4RA 4Y49B 3I9SA 4KLWA 2ATRA 5AG6A 5H84A 1JWQA 2CXAA 4IK2A 8CPAA 4NXYA 3S6HA 2ZXVA 3PBBA 4UCMA 2A4NA 2JBJA 1RXTA 2BEIA 4P6YA 4ZX9A 1Z2LA 2FIAA 3NH8A 3TTHA 4A30A 2GANA 3IEHA 1IY7A 1Y9KA 3L2NA 2OOTA 4NGPA 3WC7A 4F8ZA 2B4DA 2PRQA 5EBVA 5D8NA 4CRYB 4FAIA 3NFZA 4AG7A 3IWGA 1ZLHA 4NFRA 3SI1A 4O23A 2XEIA 4CAEA 3NH4A 5LYDA 4NJQA 1BLLE 1F2PA 2PJ4A 4EFDA 7CPAA 4B5PB 4P10A 5A27A 3FECA 3IU1A 3E0KA 3MN8A 3FB3A 2Q7BA 5LRGA 4A95A 3D8PA 3D67A 2NSMA 2O53A 3DLJA 3GYAA 4TNUA 2YNDA 4X5KA 4NGMA 4NGRA 3FX6A 3RYOA 2F5IA 1P0HA 3SJGA 3T9YA 3PFOA 3SXNA 1LFWA 2PDOA 3FH4A 3S9MA 1QSMA 2J8RA 1VHSA 3GUXA 5J1QA 1CG2A 4P44A 4UA3A 3B7IA 4KLVA 4MFPA 2ZEHA 4QVTA 3TOBA 1X10A 4R87A 3DR6A 3OWCA 4CRZB 2G3TA 5E96A 2FXFA 3A9LA 1AUGA 1R57A 2JDCA 1YW4A 2B3UA 4RN7A 4ZY2A 4CAXA 4B5PA 1MJAA 4F6AA 2YNCC 1GHEA 5HMNA 5JPHA 1ZLIA 3SXOA 4P4EA 1M4IA 3KQZA 4R8FA 3WC5A 1QSRA 3KGQA 1M4DA 1TIQA 1IIDA 1FNOA 1CP7A 3V38A 4ZY0A 2WSAA 3TO7A 5DWNA 1VIXA 2R8VA 1HEEA 4BBHA 1M4GA 2BO9A 4NGTA 4X2TA 2CTBA 2PR8A 2HQYA 3FMCA 1YX0A 2CIJA 4KOSA 4MFKA 5JGFA 4P4FA 2ARHA 2Z3LA 4LQ6A 4RS2A 1Z8TA 5D29A 4Y49C 2Z3KA 3LWUA 4OIDA 3NE8A 1V0CA 1Y7EA 4KOVA 3FRMA 2D4PA 2C6GA 2DXQA 2HC9A 4M6HA 2EVNA 4C2XA 4DYOA 2CNMA 3PBEA 3FEEA 1HDUA 4H6UA 1BAVA 5AG5A 4ORFA 3T90A 2ZW5A 4PXBA 3FIXA 2REEA 4JLYA 4IUSA 3LODA 3WC6A 1Z9UA 2C1CA 1LRZA 2WUUA 3V8IA 3K9TA 1IGBA 4QB9A 2ZW6A 4KZTA 2PJ7A 1Y7RA 4YGOA 3FYNA 4PSWA 4AG9A 4RI1A 1FY7A 3TO9A 4MMOA 3N7ZA 4HKFA 1TF9A 2C6PA 4RUHA 2BCOA 1BPNA 2PVWA 4AVCA 1KUYA 4KVME 4CYOA 2FSRA 3T8WA 3BLNA 1S5KA 4M3SA 4XPKA 3WR7A 1MJ9A 2BUEA 4E2AA 1F57A 2PQ8A 2ZEPA 3R9FA 3S6KA 1ELLP 1XEBA 1YW6A 4JJXA 4CGLA 3S9NA 4B11A 2F8HA 4JXRA 3I1UA 2G9DA 4UWJA 6CPAA 2ZW4A 2Z3NA 5H86A 2PJ9A 2BL1A 3D2PA 2J9AA 3IIBA 2ZEOA 4KUBA 1IICA 2ZELA 4OC5A 4QBJA 3ISXA 1IYKA 2GLFA 1XF8A 2O4HA 4PXCA 2JBKA 5G20A 1N71A 2GE3A 2WPWA 1IOFA 1CJWA 2Q4ZA 2K5TA 1XRYA 2PCUA 3KI9A 4ZX8A 3WT4A 2YNCA 3DR8A 3FBUA 4WWVA 2Z11A 5AG7A 4B14A 1CM0A 1LAPA 4M85A 2DF5A 3B35A 4UIAA 4BMHA 2PJ6A 4JYWA 1TXRA 1QSTA 4UCPA 5FVJA 2ABZA 2ODFA 2ZOGA 4UFWA 3TCVA 1ON0A 4MFJA 2OZUA 1ZO0A 2VI7A 2VXKA 2ZEGA 4A2ZA 2I3CA 3ZZIA 1Z4EA 4NGQA 4P4JA 2ZPAA 2O28A 2R98A 4YWYA 3TOAA 1GYTA 4R7MA 4CGPA 5F49A 5J8CA 2PIYA 2Y0MA 4B10A 4MXUA 3SHPA 1S3ZA 4A38A 4QUSA 4A33A 1R3NA 2DPSA 3JUWA 2JEWA 1Q2CA 1TKJA 5BWAB 1LCPA 2FL4A 5J8FA 1CP6A 3D2MA 3IWWA 4Z65A 4H2KA 4OMEA 3CPAA 4CAWA 1YMEA 4AVBA 2V77A 1LAMA 4FD7A 4JD6A 5IB0A 4H89A 3GB0A 2BSWA 3I3GA 1TKFA 4NEXA 4MCSA 4MFLA 3W6SA 5AG4A 3FXTA 4EMEA 2PVVA 1EE3P 3JVNA 2Q4VA 1I21A 5CPAA 1UWYA 2AFUA 4UWIA 5ELYA 5IX3A 3PB7X 3FF3A 4II9A 3GKRA 2CNTA 2OR4A 2AFMA 5F46A 3PEIA 1AMPA 3R95A 3SJXA 1I1DA 2OZHA 3DSBA 4OIWA 4P4DA 4CS0B 1SQHA 1CPXA 2GLJA 4OADA 2OZGA 1QSOA 3WABA 2VZZA 4KUAA 5A28A 2Z3MA 4KOXA 4Q36A 2FT0A 3W91A 1ARMA 2VBQA 3IU2A 1PUAA 5JQ4A 4MCPA 4K3NA 1WWZA 4R3KA 3LACA 2NYQA 4UEFA 3VWEA 3R9EA 1Z8LA 1IOIA 4A31A 2V8VA 2PC1A 2QJ8A 1Q2DA 2Q51A 2WYRA 2ZEFA 4JZ0A 3EO4A 3D7FA 2PR1A 4ZYQA 2CTCA 3TE4A 4OC1A 2G0BA 2JLMA 4OLLA 3CZXA 4B5OA 4PSXA 2ZEMA 1VGYA 5I4MA 3KKWA 2FE7A 4FD4A 5GCNA 1KWMA 1LANA 3BI1A 2Q4YA 3CXQA 4DJLA 2PE3A 4GM5A 3MRUA 3SI0A 5THWA 4MHDA 4OC2A 1TF8A 3PP9A 4WJBA 4X3RA 2PIZA 4XPDB 3H8EA 2D4OA 5DS0A 4OAEA 3B3TA 1QSNA 4QC6A 3D68A 1VHEA 2HV2A 4OP4A 2ZW7A 4MFQA 4U5YA 3ZJ0A 2AFXA 2C27A 2PRBA 4PQAA 4MCRA 4MHZA 4F9VA 2AFZA 3KR5A 4OC4A 1YLEA 2WPXA 1BOBA 2ZEEA 3QB8A 2VZYA 2G3AA 1PU9A 2Z3PA 4LUAA 4R3LA 5K8MA 2IQ6A 4HNYB 4A94A 5HH1A 2CF4A 3PZJA 1DTDA 2DEAA 1YREA 2ZEDA 3V7ZA 4A39A 5EMIA 1NSLA 1M44A 1VHOA 1Y0RA 2C6CA 1JQGA 2V8DA 4A32A 1Q2YA 3QNVA 3PRTA 1S7FA 1XBUA 2Q7SA 3VATA 4FBEA 4MCQA 3VH9A 3NE7A 5F09A 1NE9A 3KHXA 3QAHA 4U9ZA 4UFXA 4NSQA 1CX8A 5G22A 3D7GA 4KSFA 2ZOFA 1U6MA 3K2KA 3FNCA 2B5GB 2YNEA 4EWTA 5C88A 4C7IA 5HVFA 4A37A 5DWMA 2PJ0A 3D7HA 5G21A 4UIBA 1A2ZA 3B8GA 4M6IA 4CPAA 2POKA 4UBRA 3RO0A 4CYNA 4ZY1A 1KUVA 5F48A 4CAVA 2PJAA 3IJ3A 4P4IA 1XE4A 2VL1A 4UEEA 2V8GA 1YGHA 4F9UA 1RTQA 2R7HA 4UF4A 2QIRA 4AXVA 3B3VA 4R57A 2QECA 4CGNA 4NF1A 3GIUA 2AFWA 4C7HA 4UEZA 1B87A 1OZPA 1MJBA 2QYVA 2OB0A 2DPTA 2EWBA 4PXEA 1S60A 4FD5A 2REFA 1Z5RA 4G1PA 3PB9X 2H5MA 4KVXA 2ANPA 3UY5A 4KOUA 2EUIA 4KORA 2B5GA 2IL4A 4XPLA 5CNPA 1KUXA 4U9YA 4HNXB 3JRUA 4B12A 3BHXA 2NMTA 2B58A 2Q04A 1ZG9A 4ZBGA 2CNSA 2Z3OA 5G1ZA 1XOVA 3G3SA 2AFSA 4HPSA 4AB7A 4XPDC 3R1KA 3KHZA 3PGPA 4P4BA 3LD2A 2AE6A 3H8GA 4DNCA 4OC3A 2FCKA 4ZGYB 1I12A 1YVOA 4R6TA 1LOKA 4PPZA 3S9LA 2ZENA 2R1IA 2PJBA 3IC1A 2BOAA 1IU8A 3NH5A 5LYIA 2JDDA 2I79A 4MRIA 5K8OA 3CXPA 2B4BA 3FJUA 2HB6A 1B6BA 4C2YA 1YLOA 3PFEA 2J8NA 1ZG7A 2F7VA 5C82A 4HNWB 4KVOE 1M1DA 4C2ZA 1ARLA 2QVPA 4NGNA 1CBXA 2OH1A 3KQXA 1L0CA 2B3VA 4R9MA 5EC4A 3G8WA 2AJ6A 5KTCA 3JTKA 3KZWA 1BPMA 4PK2A 1Y9WA 4E8OA 4F0YA 2XEFA 3B3WA 3RAMA 4CGMA 3NA6A 1QMUA 3QAYA 3TFYA 2Q0YA 4XNHB 3VARA 1WK4A 3EXNA 2XEJA 2IJZA 1Z8XA 3DGVA 1H8LA 3D3SA 4P45A 1S7NA 2KCWA 1MK4A 1R43A 3SI2A 1QQ9A 2P6FA 4MBUA 4YFJA 2EBJA 2P0WA 3F8KA 4MY3A 4OC0A 3MGDA 4I49A 1RO5A 3IFEA 1YQEA 2PJ1A 2V8HA 4UCNA 1YSJA 2I00A 3C26A 1XMBA 3CXSA 3IWEA 4J3GA 4M6GA 4UFVA 4YRHA 3S6GA 3PB6X 3DDDA 5HVHA 2J8MA 4FUUA 5AGEA 4E0AA 2PJ8A 3CDXA 4EVYA 5JM6A 1YVKA 3BI0A 4TWEA 3DNSA 1J4JA 2VEZA 3HUVA 1YR0A 4KS9A 3B3SA 4NGSA 2RC4A 2EK8A 3FEDA 2GIVA 4NCZA 4PXDA 3VWDA 3S6FA 3ISZA 4B13A 1S7KA 4ZI6A 3EC4A 3H5ZA 4K30A 3F5BA 4DUKA 3LMSA 2GU2A 3TX8A 4Q7AA 3EY5A 3H4QA 2IMOA 4BD9A 1TKHA 1PCAA 3TC8A 4KSIA 4L8AA 2AFOA 3FVLA 4F0XA 1UFHA 2PJ5A 3EFAA 5IV0A 2GFQA 3SJFA 4OKOA 1XJOA 4CGOA 1Z8WA 2EO8A 2HUZA 1X12A 2VQYA 4PV6A 3D7DA 1AYEA 3PB4X 3P2HA 1PYTB 3IGRA 1NMTA 4NJRA 4IAVA 3D66A 3CT9A 2EK9A 4FD6A 4KOYA 4MHYA 4MY0A 3D4UA 4IHMA 1XFOA 4BINA 1OBRA 4KOTA 5KTDA 1F2OA 1FT7A 4YU9A 4CYPA 5K8NA 4H6ZA 1XMTA 5LYFA 2X7BA 5IB9A 2CY2A 2PJCA 1HDQA 4ONUA 3B3CA 1ELMP 4MI4A 1XIXA 2Q43A 3H8FA 2PJ2A 5LRJA 2FS5A 4MFZA 5CBMA 1M4LA 5HVGA 5HXDA 5K8PA 5LRKA 1Y0YA 1CPSA 2WZNA 3B2YA 4Q38A 1P4NA 1Q7LA 1ZG8A 1BO4A 1IB1E 2QMLA 2YGWA 4AVAA 4IF5A 4MHPA 2FVGA 3KL9A 2PSWA 3TO6A 1IYLA 2P6EA 4GS4A 1NSAA 2Q44A 2XEGA 3IO1A 2OU2A 2Z10A 4LQGA 4W9YA 4MHNA 3RNZA 2JEVA 4KOWA 4L89A 1DE4C 3R9GA 4X8IA 3TT2A 2RB7A
chains in the Genus database with same CATH topology
3RZAA 4R76A 3RBUA 2PJ3A 3KASA 2GREA 2RFHA 3BXMA 3SJEA 3CPXA 4B6ZA 3GLJA 3KR4A 3PB8X 5JH9A 4ONWA 3HLPA 4FWUA 3N5FA 5LYLA 4IK2A 8CPAA 3PBBA 2JBJA 4ZX9A 4P6YA 1Z2LA 3NH8A 3L2NA 3IEHA 1IY7A 2OOTA 4NGPA 3WC7A 4F8ZA 2PRQA 5D8NA 4FAIA 3NFZA 1ZLHA 4NFRA 3SI1A 4O23A 2XEIA 3NH4A 5LYDA 4NJQA 1BLLE 1F2PA 2PJ4A 4EFDA 7CPAA 4P10A 3FECA 3MN8A 5LRGA 3D67A 2NSMA 2O53A 3DLJA 4TNUA 4NGMA 4NGRA 3FX6A 3SJGA 3PFOA 1LFWA 3FH4A 3S9MA 3GUXA 5J1QA 1CG2A 4P44A 3B7IA 2ZEHA 3TX8A 1YW4A 4ZY2A 5K8NA 1ZLIA 4P4EA 3KQZA 4R8FA 3WC5A 3KGQA 3V38A 4ZY0A 1FNOA 1CP7A 1VIXA 1HEEA 2BO9A 4NGTA 4X2TA 2CTBA 3FMCA 2CIJA 5JGFA 4P4FA 5D29A 3LWUA 4OIDA 1Y7EA 2C6GA 2HC9A 4DYOA 3PBEA 3FEEA 1HDUA 1BAVA 4PXBA 3WC6A 2C1CA 3K9TA 1IGBA 2PJ7A 4MMOA 1TF9A 2C6PA 4RUHA 2BCOA 1BPNA 2PVWA 3T8WA 1F57A 2ZEPA 1ELLP 1YW6A 3S9NA 2F8HA 3I1UA 2G9DA 6CPAA 2PJ9A 2J9AA 3IIBA 2ZEOA 2ZELA 4OC5A 3ISXA 2GLFA 2O4HA 4PXCA 2JBKA 2Q4ZA 3WT4A 2PCUA 1XRYA 3KI9A 4ZX8A 4WWVA 1LAPA 3B35A 4UIAA 2PJ6A 4JYWA 1TXRA 2ABZA 2ZOGA 2ZEGA 2I3CA 4NGQA 4P4JA 4YWYA 1GYTA 4R7MA 2PIYA 4MXUA 4A38A 1R3NA 2JEWA 1TKJA 1LCPA 1CP6A 3IWWA 4Z65A 4H2KA 4OMEA 3CPAA 1YMEA 2V77A 1LAMA 3GB0A 1TKFA 4MCSA 4EMEA 2PVVA 1EE3P 5CPAA 1UWYA 2AFUA 5ELYA 3PB7X 3FF3A 2OR4A 2AFMA 3PEIA 1AMPA 3SJXA 4OIWA 4P4DA 2GLJA 1CPXA 3WABA 1ARMA 4MCPA 4K3NA 2NYQA 4UEFA 1Z8LA 2V8VA 2QJ8A 2ZEFA 2Q51A 2WYRA 4JZ0A 3D7FA 4ZYQA 2CTCA 4OC1A 2ZEMA 1VGYA 5I4MA 1KWMA 1LANA 3BI1A 4DJLA 2PE3A 4GM5A 3MRUA 3SI0A 5THWA 4OC2A 4WJBA 1TF8A 4X3RA 3S9LA 2PIZA 3H8EA 5DS0A 3B3TA 3D68A 1VHEA 4OP4A 4F9VA 2AFXA 4PQAA 4MCRA 4MHZA 2AFZA 3KR5A 4OC4A 2ZEEA 5K8MA 2IQ6A 4A94A 2CF4A 4A39A 1DTDA 2DEAA 2ZEDA 3V7ZA 1VHOA 1Y0RA 2C6CA 1JQGA 2V8DA 3QNVA 3PRTA 1XBUA 3VATA 4FBEA 4MCQA 3VH9A 5F09A 3KHXA 1CX8A 3D7GA 2ZOFA 3K2KA 4EWTA 5HVFA 4A37A 2PJ0A 3D7HA 4UIBA 4CPAA 2POKA 4ZY1A 2PJAA 3IJ3A 4P4IA 2VL1A 4UEEA 2V8GA 4F9UA 1RTQA 4AXVA 4UF4A 3B3VA 2AFWA 4UEZA 2QYVA 2EWBA 4PXEA 1Z5RA 4G1PA 3PB9X 2ANPA 3JRUA 3BHXA 1ZG9A 2AFSA 3KHZA 4P4BA 3H8GA 4OC3A 4R6TA 1LOKA 4PPZA 2ZENA 2PJBA 3IC1A 2BOAA 3NH5A 5LYIA 4MRIA 5K8OA 3FJUA 2HB6A 1YLOA 3PFEA 1ZG7A 2F7VA 1ARLA 2QVPA 4NGNA 1CBXA 3KQXA 3KZWA 1BPMA 2XEFA 3B3WA 3RAMA 3NA6A 1QMUA 3VARA 2XEJA 2IJZA 3DGVA 1H8LA 4P45A 3SI2A 1R43A 1QQ9A 4OC0A 3IFEA 2V8HA 2PJ1A 1YSJA 1XMBA 3PB6X 5HVHA 4FUUA 2PJ8A 3CDXA 5JM6A 3BI0A 4TWEA 3HUVA 3B3SA 4NGSA 2EK8A 3FEDA 4PXDA 3ISZA 4ZI6A 4DUKA 3LMSA 2GU2A 4Q7AA 2IMOA 4BD9A 1TKHA 1PCAA 3TC8A 4KSIA 2AFOA 3FVLA 2PJ5A 3SJFA 4OKOA 1XJOA 3D7DA 1AYEA 3PB4X 1PYTB 4NJRA 4IAVA 3D66A 3CT9A 2EK9A 4MHYA 3D4UA 4IHMA 1XFOA 1OBRA 1F2OA 1FT7A 4YU9A 5LYFA 5IB9A 2PJCA 1HDQA 3B3CA 1ELMP 2Q43A 3H8FA 2PJ2A 5LRJA 5CBMA 5HXDA 5HVGA 1M4LA 5K8PA 5LRKA 1Y0YA 1CPSA 2WZNA 3B2YA 1Q7LA 1ZG8A 4MHPA 2FVGA 3KL9A 1NSAA 3IO1A 2XEGA 4LQGA 4W9YA 4MHNA 1DE4C 4X8IA 2RB7A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3RZA A;  4R76 A;  3RBU A;  2PJ3 A;  3KAS A;  2GRE A;  2RFH A;  3BXM A;  3SJE A;  3CPX A;  4B6Z A;  3GLJ A;  3KR4 A;  3PB8 X;  5JH9 A;  4ONW A;  3HLP A;  4FWU A;  3N5F A;  5LYL A;  4IK2 A;  8CPA A;  3PBB A;  2JBJ A;  4ZX9 A;  4P6Y A;  1Z2L A;  3NH8 A;  3L2N A;  3IEH A;  1IY7 A;  2OOT A;  4NGP A;  3WC7 A;  4F8Z A;  2PRQ A;  5D8N A;  4FAI A;  3NFZ A;  1ZLH A;  4NFR A;  3SI1 A;  4O23 A;  2XEI A;  3NH4 A;  5LYD A;  4NJQ A;  1BLL E;  1F2P A;  2PJ4 A;  4EFD A;  7CPA A;  4P10 A;  3FEC A;  3MN8 A;  5LRG A;  3D67 A;  2NSM A;  2O53 A;  3DLJ A;  4TNU A;  4NGM A;  4NGR A;  3FX6 A;  3SJG A;  3PFO A;  1LFW A;  3FH4 A;  3S9M A;  3GUX A;  5J1Q A;  1CG2 A;  4P44 A;  3B7I A;  2ZEH A;  3TX8 A;  1YW4 A;  4ZY2 A;  5K8N A;  1ZLI A;  4P4E A;  3KQZ A;  4R8F A;  3WC5 A;  3KGQ A;  3V38 A;  4ZY0 A;  1FNO A;  1CP7 A;  1VIX A;  1HEE A;  2BO9 A;  4NGT A;  4X2T A;  2CTB A;  3FMC A;  2CIJ A;  5JGF A;  4P4F A;  5D29 A;  3LWU A;  4OID A;  1Y7E A;  2C6G A;  2HC9 A;  4DYO A;  3PBE A;  3FEE A;  1HDU A;  1BAV A;  4PXB A;  3WC6 A;  2C1C A;  3K9T A;  1IGB A;  2PJ7 A;  4MMO A;  1TF9 A;  2C6P A;  4RUH A;  2BCO A;  1BPN A;  2PVW A;  3T8W A;  1F57 A;  2ZEP A;  1ELL P;  1YW6 A;  3S9N A;  2F8H A;  3I1U A;  2G9D A;  6CPA A;  2PJ9 A;  2J9A A;  3IIB A;  2ZEO A;  2ZEL A;  4OC5 A;  3ISX A;  2GLF A;  2O4H A;  4PXC A;  2JBK A;  2Q4Z A;  3WT4 A;  2PCU A;  1XRY A;  3KI9 A;  4ZX8 A;  4WWV A;  1LAP A;  3B35 A;  4UIA A;  2PJ6 A;  4JYW A;  1TXR A;  2ABZ A;  2ZOG A;  2ZEG A;  2I3C A;  4NGQ A;  4P4J A;  4YWY A;  1GYT A;  4R7M A;  2PIY A;  4MXU A;  4A38 A;  1R3N A;  2JEW A;  1TKJ A;  1LCP A;  1CP6 A;  3IWW A;  4Z65 A;  4H2K A;  4OME A;  3CPA A;  1YME A;  2V77 A;  1LAM A;  3GB0 A;  1TKF A;  4MCS A;  4EME A;  2PVV A;  1EE3 P;  5CPA A;  1UWY A;  2AFU A;  5ELY A;  3PB7 X;  3FF3 A;  2OR4 A;  2AFM A;  3PEI A;  1AMP A;  3SJX A;  4OIW A;  4P4D A;  2GLJ A;  1CPX A;  3WAB A;  1ARM A;  4MCP A;  4K3N A;  2NYQ A;  4UEF A;  1Z8L A;  2V8V A;  2QJ8 A;  2ZEF A;  2Q51 A;  2WYR A;  4JZ0 A;  3D7F A;  4ZYQ A;  2CTC A;  4OC1 A;  2ZEM A;  1VGY A;  5I4M A;  1KWM A;  1LAN A;  3BI1 A;  4DJL A;  2PE3 A;  4GM5 A;  3MRU A;  3SI0 A;  5THW A;  4OC2 A;  4WJB A;  1TF8 A;  4X3R A;  3S9L A;  2PIZ A;  3H8E A;  5DS0 A;  3B3T A;  3D68 A;  1VHE A;  4OP4 A;  4F9V A;  2AFX A;  4PQA A;  4MCR A;  4MHZ A;  2AFZ A;  3KR5 A;  4OC4 A;  2ZEE A;  5K8M A;  2IQ6 A;  4A94 A;  2CF4 A;  4A39 A;  1DTD A;  2DEA A;  2ZED A;  3V7Z A;  1VHO A;  1Y0R A;  2C6C A;  1JQG A;  2V8D A;  3QNV A;  3PRT A;  1XBU A;  3VAT A;  4FBE A;  4MCQ A;  3VH9 A;  5F09 A;  3KHX A;  1CX8 A;  3D7G A;  2ZOF A;  3K2K A;  4EWT A;  5HVF A;  4A37 A;  2PJ0 A;  3D7H A;  4UIB A;  4CPA A;  2POK A;  4ZY1 A;  2PJA A;  3IJ3 A;  4P4I A;  2VL1 A;  4UEE A;  2V8G A;  4F9U A;  1RTQ A;  4AXV A;  4UF4 A;  3B3V A;  2AFW A;  4UEZ A;  2QYV A;  2EWB A;  4PXE A;  1Z5R A;  4G1P A;  3PB9 X;  2ANP A;  3JRU A;  3BHX A;  1ZG9 A;  2AFS A;  3KHZ A;  4P4B A;  3H8G A;  4OC3 A;  4R6T A;  1LOK A;  4PPZ A;  2ZEN A;  2PJB A;  3IC1 A;  2BOA A;  3NH5 A;  5LYI A;  4MRI A;  5K8O A;  3FJU A;  2HB6 A;  1YLO A;  3PFE A;  1ZG7 A;  2F7V A;  1ARL A;  2QVP A;  4NGN A;  1CBX A;  3KQX A;  3KZW A;  1BPM A;  2XEF A;  3B3W A;  3RAM A;  3NA6 A;  1QMU A;  3VAR A;  2XEJ A;  2IJZ A;  3DGV A;  1H8L A;  4P45 A;  3SI2 A;  1R43 A;  1QQ9 A;  4OC0 A;  3IFE A;  2V8H A;  2PJ1 A;  1YSJ A;  1XMB A;  3PB6 X;  5HVH A;  4FUU A;  2PJ8 A;  3CDX A;  5JM6 A;  3BI0 A;  4TWE A;  3HUV A;  3B3S A;  4NGS A;  2EK8 A;  3FED A;  4PXD A;  3ISZ A;  4ZI6 A;  4DUK A;  3LMS A;  2GU2 A;  4Q7A A;  2IMO A;  4BD9 A;  1TKH A;  1PCA A;  3TC8 A;  4KSI A;  2AFO A;  3FVL A;  2PJ5 A;  3SJF A;  4OKO A;  1XJO A;  3D7D A;  1AYE A;  3PB4 X;  1PYT B;  4NJR A;  4IAV A;  3D66 A;  3CT9 A;  2EK9 A;  4MHY A;  3D4U A;  4IHM A;  1XFO A;  1OBR A;  1F2O A;  1FT7 A;  4YU9 A;  5LYF A;  5IB9 A;  2PJC A;  1HDQ A;  3B3C A;  1ELM P;  2Q43 A;  3H8F A;  2PJ2 A;  5LRJ A;  5CBM A;  5HXD A;  5HVG A;  1M4L A;  5K8P A;  5LRK A;  1Y0Y A;  1CPS A;  2WZN A;  3B2Y A;  1Q7L A;  1ZG8 A;  4MHP A;  2FVG A;  3KL9 A;  1NSA A;  3IO1 A;  2XEG A;  4LQG A;  4W9Y A;  4MHN A;  1DE4 C;  4X8I A;  2RB7 A; 
#chains in the Genus database with same CATH topology
 2FIW A;  3RZA A;  4KSA A;  4R76 A;  4LX9 A;  5KTA A;  3R96 A;  4XNH C;  3RBU A;  4JXQ A;  2PJ3 A;  3BJ8 A;  3P2F A;  2Z0Z A;  3F0A A;  3KAS A;  4CAF A;  2GRE A;  2RFH A;  3BXM A;  2B4D B;  1KZF A;  3K9U A;  4JWP A;  1YK3 A;  3CPX A;  3GY9 A;  3SJE A;  3W6X A;  4B6Z A;  1VKC A;  5ISV A;  1S7L A;  4GXH A;  1K4J A;  3GLJ A;  3KR4 A;  3PB8 X;  5JH9 A;  4ONW A;  5F47 A;  3HLP A;  4FWU A;  4CYQ A;  5I0C A;  2P6G A;  3BJ7 A;  4MJ8 A;  3N5F A;  5LYL A;  4C68 A;  4PK3 A;  1Z4R A;  4Y49 B;  3I9S A;  4KLW A;  2ATR A;  5AG6 A;  5H84 A;  1JWQ A;  2CXA A;  4IK2 A;  8CPA A;  4NXY A;  3S6H A;  2ZXV A;  3PBB A;  4UCM A;  2A4N A;  2JBJ A;  1RXT A;  2BEI A;  4P6Y A;  4ZX9 A;  1Z2L A;  2FIA A;  3NH8 A;  3TTH A;  4A30 A;  2GAN A;  3IEH A;  1IY7 A;  1Y9K A;  3L2N A;  2OOT A;  4NGP A;  3WC7 A;  4F8Z A;  2B4D A;  2PRQ A;  5EBV A;  5D8N A;  4CRY B;  4FAI A;  3NFZ A;  4AG7 A;  3IWG A;  1ZLH A;  4NFR A;  3SI1 A;  4O23 A;  2XEI A;  4CAE A;  3NH4 A;  5LYD A;  4NJQ A;  1BLL E;  1F2P A;  2PJ4 A;  4EFD A;  7CPA A;  4B5P B;  4P10 A;  5A27 A;  3FEC A;  3IU1 A;  3E0K A;  3MN8 A;  3FB3 A;  2Q7B A;  5LRG A;  4A95 A;  3D8P A;  3D67 A;  2NSM A;  2O53 A;  3DLJ A;  3GYA A;  4TNU A;  2YND A;  4X5K A;  4NGM A;  4NGR A;  3FX6 A;  3RYO A;  2F5I A;  1P0H A;  3SJG A;  3T9Y A;  3PFO A;  3SXN A;  1LFW A;  2PDO A;  3FH4 A;  3S9M A;  1QSM A;  2J8R A;  1VHS A;  3GUX A;  5J1Q A;  1CG2 A;  4P44 A;  4UA3 A;  3B7I A;  4KLV A;  4MFP A;  2ZEH A;  4QVT A;  3TOB A;  1X10 A;  4R87 A;  3DR6 A;  3OWC A;  4CRZ B;  2G3T A;  5E96 A;  2FXF A;  3A9L A;  1AUG A;  1R57 A;  2JDC A;  1YW4 A;  2B3U A;  4RN7 A;  4ZY2 A;  4CAX A;  4B5P A;  1MJA A;  4F6A A;  2YNC C;  1GHE A;  5HMN A;  5JPH A;  1ZLI A;  3SXO A;  4P4E A;  1M4I A;  3KQZ A;  4R8F A;  3WC5 A;  1QSR A;  3KGQ A;  1M4D A;  1TIQ A;  1IID A;  1FNO A;  1CP7 A;  3V38 A;  4ZY0 A;  2WSA A;  3TO7 A;  5DWN A;  1VIX A;  2R8V A;  1HEE A;  4BBH A;  1M4G A;  2BO9 A;  4NGT A;  4X2T A;  2CTB A;  2PR8 A;  2HQY A;  3FMC A;  1YX0 A;  2CIJ A;  4KOS A;  4MFK A;  5JGF A;  4P4F A;  2ARH A;  2Z3L A;  4LQ6 A;  4RS2 A;  1Z8T A;  5D29 A;  4Y49 C;  2Z3K A;  3LWU A;  4OID A;  3NE8 A;  1V0C A;  1Y7E A;  4KOV A;  3FRM A;  2D4P A;  2C6G A;  2DXQ A;  2HC9 A;  4M6H A;  2EVN A;  4C2X A;  4DYO A;  2CNM A;  3PBE A;  3FEE A;  1HDU A;  4H6U A;  1BAV A;  5AG5 A;  4ORF A;  3T90 A;  2ZW5 A;  4PXB A;  3FIX A;  2REE A;  4JLY A;  4IUS A;  3LOD A;  3WC6 A;  1Z9U A;  2C1C A;  1LRZ A;  2WUU A;  3V8I A;  3K9T A;  1IGB A;  4QB9 A;  2ZW6 A;  4KZT A;  2PJ7 A;  1Y7R A;  4YGO A;  3FYN A;  4PSW A;  4AG9 A;  4RI1 A;  1FY7 A;  3TO9 A;  4MMO A;  3N7Z A;  4HKF A;  1TF9 A;  2C6P A;  4RUH A;  2BCO A;  1BPN A;  2PVW A;  4AVC A;  1KUY A;  4KVM E;  4CYO A;  2FSR A;  3T8W A;  3BLN A;  1S5K A;  4M3S A;  4XPK A;  3WR7 A;  1MJ9 A;  2BUE A;  4E2A A;  1F57 A;  2PQ8 A;  2ZEP A;  3R9F A;  3S6K A;  1ELL P;  1XEB A;  1YW6 A;  4JJX A;  4CGL A;  3S9N A;  4B11 A;  2F8H A;  4JXR A;  3I1U A;  2G9D A;  4UWJ A;  6CPA A;  2ZW4 A;  2Z3N A;  5H86 A;  2PJ9 A;  2BL1 A;  3D2P A;  2J9A A;  3IIB A;  2ZEO A;  4KUB A;  1IIC A;  2ZEL A;  4OC5 A;  4QBJ A;  3ISX A;  1IYK A;  2GLF A;  1XF8 A;  2O4H A;  4PXC A;  2JBK A;  5G20 A;  1N71 A;  2GE3 A;  2WPW A;  1IOF A;  1CJW A;  2Q4Z A;  2K5T A;  1XRY A;  2PCU A;  3KI9 A;  4ZX8 A;  3WT4 A;  2YNC A;  3DR8 A;  3FBU A;  4WWV A;  2Z11 A;  5AG7 A;  4B14 A;  1CM0 A;  1LAP A;  4M85 A;  2DF5 A;  3B35 A;  4UIA A;  4BMH A;  2PJ6 A;  4JYW A;  1TXR A;  1QST A;  4UCP A;  5FVJ A;  2ABZ A;  2ODF A;  2ZOG A;  4UFW A;  3TCV A;  1ON0 A;  4MFJ A;  2OZU A;  1ZO0 A;  2VI7 A;  2VXK A;  2ZEG A;  4A2Z A;  2I3C A;  3ZZI A;  1Z4E A;  4NGQ A;  4P4J A;  2ZPA A;  2O28 A;  2R98 A;  4YWY A;  3TOA A;  1GYT A;  4R7M A;  4CGP A;  5F49 A;  5J8C A;  2PIY A;  2Y0M A;  4B10 A;  4MXU A;  3SHP A;  1S3Z A;  4A38 A;  4QUS A;  4A33 A;  1R3N A;  2DPS A;  3JUW A;  2JEW A;  1Q2C A;  1TKJ A;  5BWA B;  1LCP A;  2FL4 A;  5J8F A;  1CP6 A;  3D2M A;  3IWW A;  4Z65 A;  4H2K A;  4OME A;  3CPA A;  4CAW A;  1YME A;  4AVB A;  2V77 A;  1LAM A;  4FD7 A;  4JD6 A;  5IB0 A;  4H89 A;  3GB0 A;  2BSW A;  3I3G A;  1TKF A;  4NEX A;  4MCS A;  4MFL A;  3W6S A;  5AG4 A;  3FXT A;  4EME A;  2PVV A;  1EE3 P;  3JVN A;  2Q4V A;  1I21 A;  5CPA A;  1UWY A;  2AFU A;  4UWI A;  5ELY A;  5IX3 A;  3PB7 X;  3FF3 A;  4II9 A;  3GKR A;  2CNT A;  2OR4 A;  2AFM A;  5F46 A;  3PEI A;  1AMP A;  3R95 A;  3SJX A;  1I1D A;  2OZH A;  3DSB A;  4OIW A;  4P4D A;  4CS0 B;  1SQH A;  1CPX A;  2GLJ A;  4OAD A;  2OZG A;  1QSO A;  3WAB A;  2VZZ A;  4KUA A;  5A28 A;  2Z3M A;  4KOX A;  4Q36 A;  2FT0 A;  3W91 A;  1ARM A;  2VBQ A;  3IU2 A;  1PUA A;  5JQ4 A;  4MCP A;  4K3N A;  1WWZ A;  4R3K A;  3LAC A;  2NYQ A;  4UEF A;  3VWE A;  3R9E A;  1Z8L A;  1IOI A;  4A31 A;  2V8V A;  2PC1 A;  2QJ8 A;  1Q2D A;  2Q51 A;  2WYR A;  2ZEF A;  4JZ0 A;  3EO4 A;  3D7F A;  2PR1 A;  4ZYQ A;  2CTC A;  3TE4 A;  4OC1 A;  2G0B A;  2JLM A;  4OLL A;  3CZX A;  4B5O A;  4PSX A;  2ZEM A;  1VGY A;  5I4M A;  3KKW A;  2FE7 A;  4FD4 A;  5GCN A;  1KWM A;  1LAN A;  3BI1 A;  2Q4Y A;  3CXQ A;  4DJL A;  2PE3 A;  4GM5 A;  3MRU A;  3SI0 A;  5THW A;  4MHD A;  4OC2 A;  1TF8 A;  3PP9 A;  4WJB A;  4X3R A;  2PIZ A;  4XPD B;  3H8E A;  2D4O A;  5DS0 A;  4OAE A;  3B3T A;  1QSN A;  4QC6 A;  3D68 A;  1VHE A;  2HV2 A;  4OP4 A;  2ZW7 A;  4MFQ A;  4U5Y A;  3ZJ0 A;  2AFX A;  2C27 A;  2PRB A;  4PQA A;  4MCR A;  4MHZ A;  4F9V A;  2AFZ A;  3KR5 A;  4OC4 A;  1YLE A;  2WPX A;  1BOB A;  2ZEE A;  3QB8 A;  2VZY A;  2G3A A;  1PU9 A;  2Z3P A;  4LUA A;  4R3L A;  5K8M A;  2IQ6 A;  4HNY B;  4A94 A;  5HH1 A;  2CF4 A;  3PZJ A;  1DTD A;  2DEA A;  1YRE A;  2ZED A;  3V7Z A;  4A39 A;  5EMI A;  1NSL A;  1M44 A;  1VHO A;  1Y0R A;  2C6C A;  1JQG A;  2V8D A;  4A32 A;  1Q2Y A;  3QNV A;  3PRT A;  1S7F A;  1XBU A;  2Q7S A;  3VAT A;  4FBE A;  4MCQ A;  3VH9 A;  3NE7 A;  5F09 A;  1NE9 A;  3KHX A;  3QAH A;  4U9Z A;  4UFX A;  4NSQ A;  1CX8 A;  5G22 A;  3D7G A;  4KSF A;  2ZOF A;  1U6M A;  3K2K A;  3FNC A;  2B5G B;  2YNE A;  4EWT A;  5C88 A;  4C7I A;  5HVF A;  4A37 A;  5DWM A;  2PJ0 A;  3D7H A;  5G21 A;  4UIB A;  1A2Z A;  3B8G A;  4M6I A;  4CPA A;  2POK A;  4UBR A;  3RO0 A;  4CYN A;  4ZY1 A;  1KUV A;  5F48 A;  4CAV A;  2PJA A;  3IJ3 A;  4P4I A;  1XE4 A;  2VL1 A;  4UEE A;  2V8G A;  1YGH A;  4F9U A;  1RTQ A;  2R7H A;  4UF4 A;  2QIR A;  4AXV A;  3B3V A;  4R57 A;  2QEC A;  4CGN A;  4NF1 A;  3GIU A;  2AFW A;  4C7H A;  4UEZ A;  1B87 A;  1OZP A;  1MJB A;  2QYV A;  2OB0 A;  2DPT A;  2EWB A;  4PXE A;  1S60 A;  4FD5 A;  2REF A;  1Z5R A;  4G1P A;  3PB9 X;  2H5M A;  4KVX A;  2ANP A;  3UY5 A;  4KOU A;  2EUI A;  4KOR A;  2B5G A;  2IL4 A;  4XPL A;  5CNP A;  1KUX A;  4U9Y A;  4HNX B;  3JRU A;  4B12 A;  3BHX A;  2NMT A;  2B58 A;  2Q04 A;  1ZG9 A;  4ZBG A;  2CNS A;  2Z3O A;  5G1Z A;  1XOV A;  3G3S A;  2AFS A;  4HPS A;  4AB7 A;  4XPD C;  3R1K A;  3KHZ A;  3PGP A;  4P4B A;  3LD2 A;  2AE6 A;  3H8G A;  4DNC A;  4OC3 A;  2FCK A;  4ZGY B;  1I12 A;  1YVO A;  4R6T A;  1LOK A;  4PPZ A;  3S9L A;  2ZEN A;  2R1I A;  2PJB A;  3IC1 A;  2BOA A;  1IU8 A;  3NH5 A;  5LYI A;  2JDD A;  2I79 A;  4MRI A;  5K8O A;  3CXP A;  2B4B A;  3FJU A;  2HB6 A;  1B6B A;  4C2Y A;  1YLO A;  3PFE A;  2J8N A;  1ZG7 A;  2F7V A;  5C82 A;  4HNW B;  4KVO E;  1M1D A;  4C2Z A;  1ARL A;  2QVP A;  4NGN A;  1CBX A;  2OH1 A;  3KQX A;  1L0C A;  2B3V A;  4R9M A;  5EC4 A;  3G8W A;  2AJ6 A;  5KTC A;  3JTK A;  3KZW A;  1BPM A;  4PK2 A;  1Y9W A;  4E8O A;  4F0Y A;  2XEF A;  3B3W A;  3RAM A;  4CGM A;  3NA6 A;  1QMU A;  3QAY A;  3TFY A;  2Q0Y A;  4XNH B;  3VAR A;  1WK4 A;  3EXN A;  2XEJ A;  2IJZ A;  1Z8X A;  3DGV A;  1H8L A;  3D3S A;  4P45 A;  1S7N A;  2KCW A;  1MK4 A;  1R43 A;  3SI2 A;  1QQ9 A;  2P6F A;  4MBU A;  4YFJ A;  2EBJ A;  2P0W A;  3F8K A;  4MY3 A;  4OC0 A;  3MGD A;  4I49 A;  1RO5 A;  3IFE A;  1YQE A;  2PJ1 A;  2V8H A;  4UCN A;  1YSJ A;  2I00 A;  3C26 A;  1XMB A;  3CXS A;  3IWE A;  4J3G A;  4M6G A;  4UFV A;  4YRH A;  3S6G A;  3PB6 X;  3DDD A;  5HVH A;  2J8M A;  4FUU A;  5AGE A;  4E0A A;  2PJ8 A;  3CDX A;  4EVY A;  5JM6 A;  1YVK A;  3BI0 A;  4TWE A;  3DNS A;  1J4J A;  2VEZ A;  3HUV A;  1YR0 A;  4KS9 A;  3B3S A;  4NGS A;  2RC4 A;  2EK8 A;  3FED A;  2GIV A;  4NCZ A;  4PXD A;  3VWD A;  3S6F A;  3ISZ A;  4B13 A;  1S7K A;  4ZI6 A;  3EC4 A;  3H5Z A;  4K30 A;  3F5B A;  4DUK A;  3LMS A;  2GU2 A;  3TX8 A;  4Q7A A;  3EY5 A;  3H4Q A;  2IMO A;  4BD9 A;  1TKH A;  1PCA A;  3TC8 A;  4KSI A;  4L8A A;  2AFO A;  3FVL A;  4F0X A;  1UFH A;  2PJ5 A;  3EFA A;  5IV0 A;  2GFQ A;  3SJF A;  4OKO A;  1XJO A;  4CGO A;  1Z8W A;  2EO8 A;  2HUZ A;  1X12 A;  2VQY A;  4PV6 A;  3D7D A;  1AYE A;  3PB4 X;  3P2H A;  1PYT B;  3IGR A;  1NMT A;  4NJR A;  4IAV A;  3D66 A;  3CT9 A;  2EK9 A;  4FD6 A;  4KOY A;  4MHY A;  4MY0 A;  3D4U A;  4IHM A;  1XFO A;  4BIN A;  1OBR A;  4KOT A;  5KTD A;  1F2O A;  1FT7 A;  4YU9 A;  4CYP A;  5K8N A;  4H6Z A;  1XMT A;  5LYF A;  2X7B A;  5IB9 A;  2CY2 A;  2PJC A;  1HDQ A;  4ONU A;  3B3C A;  1ELM P;  4MI4 A;  1XIX A;  2Q43 A;  3H8F A;  2PJ2 A;  5LRJ A;  2FS5 A;  4MFZ A;  5CBM A;  1M4L A;  5HVG A;  5HXD A;  5K8P A;  5LRK A;  1Y0Y A;  1CPS A;  2WZN A;  3B2Y A;  4Q38 A;  1P4N A;  1Q7L A;  1ZG8 A;  1BO4 A;  1IB1 E;  2QML A;  2YGW A;  4AVA A;  4IF5 A;  4MHP A;  2FVG A;  3KL9 A;  2PSW A;  3TO6 A;  1IYL A;  2P6E A;  4GS4 A;  1NSA A;  2Q44 A;  2XEG A;  3IO1 A;  2OU2 A;  2Z10 A;  4LQG A;  4W9Y A;  4MHN A;  3RNZ A;  2JEV A;  4KOW A;  4L89 A;  1DE4 C;  3R9G A;  4X8I A;  3TT2 A;  2RB7 A; 
#chains in the Genus database with same CATH homology
 3RZA A;  4R76 A;  3RBU A;  2PJ3 A;  3KAS A;  2GRE A;  2RFH A;  3BXM A;  3SJE A;  3CPX A;  4B6Z A;  3GLJ A;  3KR4 A;  3PB8 X;  5JH9 A;  4ONW A;  3HLP A;  4FWU A;  3N5F A;  5LYL A;  4IK2 A;  8CPA A;  3PBB A;  2JBJ A;  4ZX9 A;  4P6Y A;  1Z2L A;  3NH8 A;  3L2N A;  3IEH A;  1IY7 A;  2OOT A;  4NGP A;  3WC7 A;  4F8Z A;  2PRQ A;  5D8N A;  4FAI A;  3NFZ A;  1ZLH A;  4NFR A;  3SI1 A;  4O23 A;  2XEI A;  3NH4 A;  5LYD A;  4NJQ A;  1BLL E;  1F2P A;  2PJ4 A;  4EFD A;  7CPA A;  4P10 A;  3FEC A;  3MN8 A;  5LRG A;  3D67 A;  2NSM A;  2O53 A;  3DLJ A;  4TNU A;  4NGM A;  4NGR A;  3FX6 A;  3SJG A;  3PFO A;  1LFW A;  3FH4 A;  3S9M A;  3GUX A;  5J1Q A;  1CG2 A;  4P44 A;  3B7I A;  2ZEH A;  3TX8 A;  1YW4 A;  4ZY2 A;  5K8N A;  1ZLI A;  4P4E A;  3KQZ A;  4R8F A;  3WC5 A;  3KGQ A;  3V38 A;  4ZY0 A;  1FNO A;  1CP7 A;  1VIX A;  1HEE A;  2BO9 A;  4NGT A;  4X2T A;  2CTB A;  3FMC A;  2CIJ A;  5JGF A;  4P4F A;  5D29 A;  3LWU A;  4OID A;  1Y7E A;  2C6G A;  2HC9 A;  4DYO A;  3PBE A;  3FEE A;  1HDU A;  1BAV A;  4PXB A;  3WC6 A;  2C1C A;  3K9T A;  1IGB A;  2PJ7 A;  4MMO A;  1TF9 A;  2C6P A;  4RUH A;  2BCO A;  1BPN A;  2PVW A;  3T8W A;  1F57 A;  2ZEP A;  1ELL P;  1YW6 A;  3S9N A;  2F8H A;  3I1U A;  2G9D A;  6CPA A;  2PJ9 A;  2J9A A;  3IIB A;  2ZEO A;  2ZEL A;  4OC5 A;  3ISX A;  2GLF A;  2O4H A;  4PXC A;  2JBK A;  2Q4Z A;  3WT4 A;  2PCU A;  1XRY A;  3KI9 A;  4ZX8 A;  4WWV A;  1LAP A;  3B35 A;  4UIA A;  2PJ6 A;  4JYW A;  1TXR A;  2ABZ A;  2ZOG A;  2ZEG A;  2I3C A;  4NGQ A;  4P4J A;  4YWY A;  1GYT A;  4R7M A;  2PIY A;  4MXU A;  4A38 A;  1R3N A;  2JEW A;  1TKJ A;  1LCP A;  1CP6 A;  3IWW A;  4Z65 A;  4H2K A;  4OME A;  3CPA A;  1YME A;  2V77 A;  1LAM A;  3GB0 A;  1TKF A;  4MCS A;  4EME A;  2PVV A;  1EE3 P;  5CPA A;  1UWY A;  2AFU A;  5ELY A;  3PB7 X;  3FF3 A;  2OR4 A;  2AFM A;  3PEI A;  1AMP A;  3SJX A;  4OIW A;  4P4D A;  2GLJ A;  1CPX A;  3WAB A;  1ARM A;  4MCP A;  4K3N A;  2NYQ A;  4UEF A;  1Z8L A;  2V8V A;  2QJ8 A;  2ZEF A;  2Q51 A;  2WYR A;  4JZ0 A;  3D7F A;  4ZYQ A;  2CTC A;  4OC1 A;  2ZEM A;  1VGY A;  5I4M A;  1KWM A;  1LAN A;  3BI1 A;  4DJL A;  2PE3 A;  4GM5 A;  3MRU A;  3SI0 A;  5THW A;  4OC2 A;  4WJB A;  1TF8 A;  4X3R A;  3S9L A;  2PIZ A;  3H8E A;  5DS0 A;  3B3T A;  3D68 A;  1VHE A;  4OP4 A;  4F9V A;  2AFX A;  4PQA A;  4MCR A;  4MHZ A;  2AFZ A;  3KR5 A;  4OC4 A;  2ZEE A;  5K8M A;  2IQ6 A;  4A94 A;  2CF4 A;  4A39 A;  1DTD A;  2DEA A;  2ZED A;  3V7Z A;  1VHO A;  1Y0R A;  2C6C A;  1JQG A;  2V8D A;  3QNV A;  3PRT A;  1XBU A;  3VAT A;  4FBE A;  4MCQ A;  3VH9 A;  5F09 A;  3KHX A;  1CX8 A;  3D7G A;  2ZOF A;  3K2K A;  4EWT A;  5HVF A;  4A37 A;  2PJ0 A;  3D7H A;  4UIB A;  4CPA A;  2POK A;  4ZY1 A;  2PJA A;  3IJ3 A;  4P4I A;  2VL1 A;  4UEE A;  2V8G A;  4F9U A;  1RTQ A;  4AXV A;  4UF4 A;  3B3V A;  2AFW A;  4UEZ A;  2QYV A;  2EWB A;  4PXE A;  1Z5R A;  4G1P A;  3PB9 X;  2ANP A;  3JRU A;  3BHX A;  1ZG9 A;  2AFS A;  3KHZ A;  4P4B A;  3H8G A;  4OC3 A;  4R6T A;  1LOK A;  4PPZ A;  2ZEN A;  2PJB A;  3IC1 A;  2BOA A;  3NH5 A;  5LYI A;  4MRI A;  5K8O A;  3FJU A;  2HB6 A;  1YLO A;  3PFE A;  1ZG7 A;  2F7V A;  1ARL A;  2QVP A;  4NGN A;  1CBX A;  3KQX A;  3KZW A;  1BPM A;  2XEF A;  3B3W A;  3RAM A;  3NA6 A;  1QMU A;  3VAR A;  2XEJ A;  2IJZ A;  3DGV A;  1H8L A;  4P45 A;  3SI2 A;  1R43 A;  1QQ9 A;  4OC0 A;  3IFE A;  2V8H A;  2PJ1 A;  1YSJ A;  1XMB A;  3PB6 X;  5HVH A;  4FUU A;  2PJ8 A;  3CDX A;  5JM6 A;  3BI0 A;  4TWE A;  3HUV A;  3B3S A;  4NGS A;  2EK8 A;  3FED A;  4PXD A;  3ISZ A;  4ZI6 A;  4DUK A;  3LMS A;  2GU2 A;  4Q7A A;  2IMO A;  4BD9 A;  1TKH A;  1PCA A;  3TC8 A;  4KSI A;  2AFO A;  3FVL A;  2PJ5 A;  3SJF A;  4OKO A;  1XJO A;  3D7D A;  1AYE A;  3PB4 X;  1PYT B;  4NJR A;  4IAV A;  3D66 A;  3CT9 A;  2EK9 A;  4MHY A;  3D4U A;  4IHM A;  1XFO A;  1OBR A;  1F2O A;  1FT7 A;  4YU9 A;  5LYF A;  5IB9 A;  2PJC A;  1HDQ A;  3B3C A;  1ELM P;  2Q43 A;  3H8F A;  2PJ2 A;  5LRJ A;  5CBM A;  5HXD A;  5HVG A;  1M4L A;  5K8P A;  5LRK A;  1Y0Y A;  1CPS A;  2WZN A;  3B2Y A;  1Q7L A;  1ZG8 A;  4MHP A;  2FVG A;  3KL9 A;  1NSA A;  3IO1 A;  2XEG A;  4LQG A;  4W9Y A;  4MHN A;  1DE4 C;  4X8I A;  2RB7 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...