4UEFA

Crystal structure of the human carboxypeptidase a1 in complex with the phosphinic inhibitor acetyl-tyr-ala-y(po2ch2)-homophe-oh
Total Genus 115
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
115
sequence length
306
structure length
306
Chain Sequence
STDTFNYATYHTLEEIYDFLDLLVAENPHLVSKIQIGNTYEGRPIYVLKFSTGGSKRPAIWIDTGIHSREWVTQASGVWFAKKITQDYGQDAAFTAILDTLDIFLEIVTNPDGFAFTHSTNRMWRKTRSHTAGSLCIGVDPNRNWDAGFGLSGASSNPCSETYHGKFANSEVEVKSIVDFVKDHGNIKAFISIHSYSQLLMYPYGYKTEPVPDQDELDQLSKAAVTALASLYGTKFNYGSIIKAIYQASGSTIDWTYSQGIKYSFTFELRDTGRYGFLLPASQIIPTAKETWLALLTIMEHTLNHP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal Structure of the Human Carboxypeptidase A1 in Complex with Phosphinic Inhibitors
rcsb
source organism Homo sapiens
molecule tags Hydrolase
molecule keywords CARBOXYPEPTIDASE A1
total genus 115
structure length 306
sequence length 306
chains with identical sequence B
ec nomenclature ec 3.4.17.1: Carboxypeptidase A.
pdb deposition date 2014-12-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00246 Peptidase_M14 Zinc carboxypeptidase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.630.10 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Zn peptidases 4uefA00
1BLLE 4FAIA 4NGNA 4H2KA 3NFZA 3KR4A 2OR4A 2PJBA 2PJ7A 3PFEA 3TC8A 1ELMP 4DUKA 3KI9A 3I1UA 1CX8A 2C6CA 2PJ3A 3N5FA 4P4EA 5JGFA 1VHEA 2PVVA 1ZG7A 3MRUA 4EWTA 4JZ0A 3IC1A 5LYDA 3FJUA 4F9UA 4MXUA 1Y0YA 3KASA 3B7IA 3VH9A 2BOAA 4X8IA 5HVGA 4G1PA 4P4BA 1Z2LA 1XMBA 2PIYA 3WC6A 1LFWA 2AFSA 2OOTA 2V8HA 2ZEOA 4P6YA 4ZI6A 2AFWA 2ZEMA 4P45A 2V8GA 4OC2A 4W9YA 2PJ1A 2F7VA 4P4DA 1ARMA 1TF8A 1FNOA 2WZNA 2EWBA 2QVPA 3S9MA 4MHNA 4MCPA 5IB9A 4WJBA 4K3NA 4B6ZA 4UF4A 4ZX9A 1KWMA 3WC7A 4X3RA 3D7HA 2XEFA 3B3CA 4BD9A 4X2TA 3PFOA 2ZENA 3B3TA 1ARLA 4IHMA 3S9NA 5K8OA 2AFXA 3DLJA 1VGYA 4MRIA 1YLOA 1BPNA 4RUHA 5LRGA 1DE4C 2BCOA 1LOKA 8CPAA 2ZEEA 2ZEDA 3FEEA 3B3VA 1PYTB 3CPAA 2GLFA 4P10A 1HDUA 2PCUA 3D68A 3K9TA 3WC5A 4A37A 5K8PA 3RZAA 3PBBA 3BHXA 3H8EA 1GYTA 3KR5A 3CT9A 5F09A 4NGSA 2JBKA 1M4LA 4PQAA 4ZX8A 2XEGA 2PJ9A 2PJCA 3D7GA 2FVGA 3H8GA 2IJZA 2V8DA 1QQ9A 4UEFA 5I4MA 4NGRA 3PRTA 3FX6A 1AMPA 2ZOGA 3KQZA 1CP7A 2HC9A 1YSJA 3IWWA 1LANA 4ZY2A 2RB7A 3GB0A 4LQGA 3FVLA 4F8ZA 3NH8A 2QJ8A 2PJ4A 1LAMA 3SJXA 2ZELA 3BXMA 4NJQA 4R8FA 4MCSA 2ZOFA 1DTDA 3H8FA 2GU2A 3WT4A 1JQGA 4EMEA 1ZLIA 3IO1A 1XJOA 1EE3P 3FMCA 1ELLP 3PB8X 2PJ6A 3WABA 5LRKA 4ZY1A 4AXVA 1TKFA 2ANPA 3RBUA 4UIBA 1NSAA 2NSMA 2IMOA 3BI0A 2XEIA 1UWYA 4KSIA 1CP6A 2PJ5A 2QYVA 1R3NA 4MMOA 3ISXA 4PXDA 4O23A 4FUUA 5K8MA 2F8HA 3IIBA 4NGMA 3SI0A 1TF9A 4F9VA 3IJ3A 3VARA 4WWVA 3FECA 4EFDA 4YU9A 1FT7A 4GM5A 1OBRA 4UEZA 3NH4A 4IK2A 4NGQA 1CG2A 3MN8A 4MCRA 2CTCA 4MHYA 4R7MA 3D4UA 3D66A 3PB7X 2ZEHA 1IGBA 4NJRA 1CBXA 1VIXA 2Q43A 2V77A 3CDXA 4PXCA 4OC3A 3B3SA 2J9AA 5K8NA 2HB6A 3SJGA 2ZEGA 2CF4A 3SJFA 2AFMA 2Q51A 5JH9A 4OP4A 7CPAA 2WYRA 1CPXA 3KQXA 1LAPA 5HVHA 3PBEA 3HLPA 1RTQA 3FF3A 1F2OA 3GUXA 3LMSA 3VATA 2CTBA 2I3CA 3DGVA 4PPZA 3FH4A 2PJ0A 4A39A 3NA6A 3LWUA 5HVFA 2EK9A 4ONWA 4OC0A 3BI1A 1YW6A 1YW4A 1QMUA 2XEJA 4ZY0A 3KZWA 2Q4ZA 4PXEA 3PEIA 4OC4A 2PJ8A 3KHXA 4NFRA 1Y7EA 3PB6X 2PVWA 3HUVA 4TWEA 2O53A 1XRYA 4IAVA 4MHZA 1ZG8A 1TKJA 3SI2A 1IY7A 5LYIA 1BAVA 3PB4X 4UEEA 2PIZA 2O4HA 4P4JA 1AYEA 4OC1A 2JEWA 2CIJA 3QNVA 5THWA 4TNUA 4CPAA 2EK8A 3S9LA 1YMEA 5LYFA 2ZEPA 4NGPA 2G9DA 1F2PA 1Y0RA 1BPMA 3CPXA 5J1QA 3V7ZA 1HDQA 1Z8LA 2C1CA 2GREA 4NGTA 1F57A 4UIAA 4P4FA 3GLJA 4MCQA 4OIWA 5CPAA 2AFOA 3SI1A 4FWUA 3TX8A 4OIDA 3KL9A 2PRQA 4MHPA 3B2YA 4R76A 4FBEA 1ZLHA 3K2KA 2GLJA 2JBJA 2C6PA 1TXRA 5JM6A 1CPSA 4ZYQA 3B3WA 1TKHA 2ABZA 3IEHA 3KHZA 2RFHA 4P44A 3PB9X 4OKOA 3JRUA 2IQ6A 1R43A 1PCAA 4YWYA 3L2NA 4R6TA 3RAMA 1VHOA 5D29A 5LRJA 3FEDA 3T8WA 4OC5A 3D7DA 1LCPA 4DJLA 3B35A 5HXDA 2BO9A 2AFUA 6CPAA 5D8NA 2PJ2A 4A94A 5CBMA 5ELYA 3D7FA 4JYWA 2PE3A 4P4IA 3NH5A 1H8LA 2POKA 2DEAA 2ZEFA 3ISZA 4DYOA 2C6GA 1XBUA 1XFOA 3D67A 5DS0A 4OMEA 1Z5RA 3KGQA 4PXBA 3IFEA 2AFZA 3V38A 4A38A 2V8VA 3SJEA 5LYLA 1HEEA 2NYQA 4Z65A 1Q7LA 1ZG9A 2PJAA 4Q7AA 2VL1A
chains in the Genus database with same CATH superfamily
4E0AA 1BLLE 4FAIA 1KUXA 4C68A 2ZW5A 1Y7RA 4H2KA 4NGNA 1CM0A 1VHSA 2Z3PA 3RNZA 3NFZA 2FS5A 3KR4A 2OR4A 2PJBA 4KLVA 2H5MA 2PJ7A 3PFEA 3TC8A 1ELMP 1Q2DA 4DUKA 3KI9A 3I1UA 4KORA 1CX8A 2B3VA 2C6CA 1S7NA 2PJ3A 4AVAA 4L8AA 4XPDB 4NF1A 3TCVA 4KLWA 2PSWA 4QVTA 1XF8A 3N5FA 4P4EA 1R57A 2HUZA 1VHEA 2PVVA 5JGFA 5EC4A 3CXPA 3D2PA 1ZG7A 3MRUA 2PR1A 4KZTA 4JZ0A 4OLLA 4EWTA 1M4GA 3IC1A 4KOTA 4A30A 5LYDA 2G3AA 3FJUA 4B12A 2JLMA 4MXUA 4F9UA 1Y0YA 3KASA 4KOWA 4MY0A 3B7IA 3ZZIA 3F0AA 4FD7A 1M1DA 3VH9A 4CYPA 3TOBA 2BOAA 4X8IA 5HVGA 4G1PA 4P4BA 4XNHB 1Z2LA 3FRMA 4M6HA 1XMBA 5AG5A 2I00A 2PIYA 4YFJA 3WC6A 2HQYA 1LFWA 4YGOA 2GE3A 2AFSA 2R1IA 2OOTA 2B4BA 2V8HA 4F0YA 3W6XA 5A28A 2ZEOA 4P6YA 4BINA 2Z3LA 4OADA 4ZI6A 1Q2YA 2AFWA 2QIRA 2ZEMA 3FNCA 2V8GA 4KSAA 4OC2A 4P45A 4MFJA 2BEIA 4W9YA 4BMHA 4C7IA 4DNCA 2ODFA 2PJ1A 4XNHC 2F7VA 4R9MA 2A4NA 4P4DA 1ARMA 4CRYB 1TF8A 1IIDA 2HV2A 1FNOA 2OB0A 2WZNA 4AG9A 4AB7A 2EWBA 2Z0ZA 2QVPA 3S9MA 4CYQA 4CYOA 3CZXA 4MHNA 1CJWA 2GFQA 4MCPA 5IB9A 4WJBA 3K9UA 1S60A 5HH1A 3QAYA 5C88A 4U9ZA 4CS0B 2VEZA 4K3NA 4B6ZA 4C2ZA 4UF4A 4Q36A 1PU9A 2Z10A 4ZX9A 1QSMA 2VXKA 1S7FA 4RI1A 4QUSA 5F48A 1KWMA 2Z3MA 2OZHA 4X3RA 3WC7A 3BJ7A 3UY5A 3D7HA 1ZO0A 2XEFA 1XEBA 1IYLA 3B3CA 4BD9A 4X2TA 3B8GA 2YNCA 3PFOA 2ZENA 2EO8A 4JWPA 3B3TA 4A31A 1ARLA 4IHMA 4CGOA 3TOAA 3S9NA 4JLYA 5K8OA 2AFXA 3IWGA 3DLJA 3D2MA 1VGYA 3S6HA 2OZGA 4MRIA 4UWIA 1YLOA 1BPNA 2AE6A 4ORFA 5LRGA 1DE4C 4RUHA 2ZW7A 2BCOA 1LOKA 8CPAA 4C2XA 2ZEEA 1N71A 1I1DA 2B5GB 1XIXA 2ZEDA 5J8CA 5KTAA 3FEEA 4MHDA 4UCNA 3IU1A 4XPDC 3W91A 3PZJA 2FIAA 3B3VA 3S6GA 1PYTB 3CPAA 2GLFA 2FL4A 4P10A 4GXHA 4XPKA 2FSRA 2Z3OA 2GANA 1HDUA 4NEXA 2PCUA 3D68A 3TO7A 3DSBA 1B87A 4QBJA 2Q7SA 4M3SA 4B5PB 3EO4A 3K9TA 3WC5A 2Z3NA 4A37A 5K8PA 2ZXVA 3RZAA 5EBVA 1Z8XA 4KOXA 3DR8A 2WSAA 3PGPA 3PBBA 4KUBA 3MGDA 3IU2A 3FXTA 3BHXA 2Q4YA 3H8EA 1YGHA 1GYTA 3KR5A 1P0HA 3CT9A 3N7ZA 4F6AA 5F09A 2ZPAA 4NGSA 1L0CA 2JBKA 4H6ZA 5E96A 4E2AA 4B5PA 3DNSA 2Q04A 3A9LA 1Q2CA 1M4LA 4UFXA 5JPHA 4PQAA 4ZX8A 2XEGA 2PJ9A 2NMTA 1NE9A 3RBUA 4PK2A 2WPWA 2PJCA 3D7GA 4UBRA 2FVGA 2IL4A 3H8GA 2IJZA 2V8DA 2BL1A 1QSRA 3D8PA 1XMTA 1QQ9A 3P2HA 4UEFA 4Y49C 2FXFA 5I4MA 4NGRA 3PRTA 5G20A 5IB0A 3C26A 4ZGYB 2ATRA 3FX6A 4A32A 3R9FA 4B14A 1AMPA 4CAVA 5A27A 2ZOGA 3KQZA 4H89A 1CP7A 2HC9A 2KCWA 3TO9A 1YSJA 1S5KA 2Q4VA 2R8VA 4FD4A 1WWZA 3IWWA 3IWEA 1LANA 4CGNA 1MJBA 4ZY2A 1P4NA 3KKWA 2Q7BA 2RB7A 1XE4A 3GB0A 4MI4A 4LQGA 1X10A 3FVLA 4F8ZA 3NH8A 3SHPA 2QJ8A 2PJ4A 1LAMA 3SJXA 2ZELA 3BXMA 4NJQA 2FT0A 1IU8A 2ZOFA 4MBUA 4MCSA 2REEA 4R8FA 5CNPA 2BUEA 2PC1A 1DTDA 3H8FA 2EUIA 3R1KA 5G22A 4B13A 2GU2A 3EFAA 3WT4A 1JQGA 1SQHA 4EMEA 2R7HA 5JQ4A 1YR0A 1ZLIA 3IO1A 4KUAA 4UFWA 5AG7A 3VWDA 1XJOA 2G0BA 2WUUA 1EE3P 3FMCA 1ELLP 1TIQA 3PB8X 4IF5A 4NXYA 5DWNA 1OZPA 4MFPA 1I12A 2PJ6A 2B5GA 3WABA 4KOSA 2Y0MA 5LRKA 4ZY1A 2REFA 4AXVA 1TKFA 1Z9UA 2ANPA 4RS2A 1WK4A 3QB8A 1NSAA 4LX9A 4RN7A 4UIBA 2NSMA 4HPSA 4AG7A 4B10A 2IMOA 3W6SA 3G8WA 1IB1E 3FBUA 1XOVA 3BI0A 2XEIA 3GIUA 3GY9A 1AUGA 4L89A 1B6BA 4BBHA 3R9EA 4CAFA 2BSWA 1UWYA 2B4DB 4KSIA 1CP6A 4HNXB 2PJ5A 2QYVA 1R3NA 4MMOA 4A33A 1GHEA 3ISXA 4PXDA 4E8OA 1S3ZA 4KS9A 4O23A 5H84A 4FUUA 1NMTA 4CAXA 2J8MA 5K8MA 4GS4A 2F8HA 4M6GA 3T90A 3IIBA 4NGMA 1IICA 3SI0A 2VBQA 2OU2A 1TF9A 4CAEA 2JDDA 4F9VA 3IJ3A 3VARA 4WWVA 4KSFA 3FECA 4EFDA 4NSQA 4YU9A 1FT7A 4GM5A 1OBRA 4UEZA 1BOBA 4KVXA 3NH4A 3BLNA 2QMLA 3F8KA 4IK2A 4M85A 4NGQA 1CG2A 3MN8A 1YLEA 4MCRA 3E0KA 2CTCA 4MHYA 4FD5A 1A2ZA 3RYOA 4R7MA 4ONUA 3D4UA 4QC6A 2X7BA 3D66A 3PB7X 1IOIA 2ZEHA 3D3SA 1IGBA 4NJRA 3FIXA 1CBXA 1VIXA 2D4PA 2Q43A 2V77A 3CDXA 4PXCA 2OZUA 2ZW4A 2R98A 3CXQA 3GYAA 4OC3A 2B4DA 3B3SA 2J9AA 3S6FA 5K8NA 2HB6A 3SJGA 2ZEGA 4R3KA 1KUVA 2B58A 1YREA 2CF4A 4U9YA 2ZW6A 4MFZA 3SJFA 2AFMA 2Q51A 1S7KA 3TFYA 5DWMA 2J8RA 4OP4A 7CPAA 5JH9A 2WYRA 1CPXA 3KQXA 1LAPA 1I21A 3I3GA 3R95A 4C7HA 4B11A 2O28A 5HVHA 3PBEA 3HLPA 1RTQA 3FF3A 1KUYA 2AJ6A 1F2OA 4JXRA 1X12A 4A95A 3GUXA 3LMSA 2Q0YA 2JDCA 2VZYA 3H5ZA 1YVOA 2VI7A 3NE7A 3VATA 1YVKA 1QSNA 2EVNA 2D4OA 2CTBA 2I3CA 3DGVA 5J8FA 4ZBGA 1YK3A 4PPZA 1PUAA 1FY7A 2PQ8A 3CXSA 4IUSA 4CAWA 3FH4A 2PJ0A 2JEVA 4A39A 3JUWA 3LWUA 3NA6A 3S6KA 4AVBA 4QB9A 2WPXA 1M4IA 5HVFA 2EK9A 4ONWA 1BO4A 3G3SA 4OC0A 4C2YA 3BI1A 1YW6A 1QSTA 1YW4A 3I9SA 3H4QA 4X5KA 4XPLA 5IX3A 2ARHA 1QMUA 5AG6A 1V0CA 2GIVA 2XEJA 4ZY0A 5KTDA 3KZWA 3SXOA 4UA3A 5F49A 4MFKA 2Q4ZA 1YQEA 2PDOA 1Y9WA 4PXEA 3PEIA 4OC4A 2I79A 2PJ8A 3KHXA 3PP9A 3V8IA 5F46A 4NFRA 4CYNA 1Y7EA 3PB6X 2PVWA 3BJ8A 3LD2A 1IOFA 3HUVA 5F47A 3TO6A 3TTHA 4TWEA 2O53A 1XRYA 4IAVA 4MHZA 1ZG8A 3EXNA 1TKJA 3SI2A 3WR7A 2P6GA 3QAHA 2P6FA 4HNWB 1IY7A 2VQYA 4NCZA 5G21A 5LYIA 1BAVA 4EVYA 3PB4X 4UEEA 4CGLA 2PIZA 4MFLA 2O4HA 4P4JA 4PV6A 3ZJ0A 1KZFA 1AYEA 4PK3A 4JD6A 2JEWA 4OC1A 4R57A 2CY2A 2CIJA 3QNVA 5THWA 4TNUA 3TT2A 4CGMA 4YRHA 2EK8A 1J4JA 1YMEA 4CPAA 5LYFA 3S9LA 2FCKA 2ZEPA 1JWQA 1Y9KA 4NGPA 4U5YA 4LUAA 4PSWA 1Z4RA 2G9DA 1F2PA 1Y0RA 1BPMA 4MY3A 3CPXA 1MJAA 5J1QA 2Q44A 3V7ZA 1HDQA 1Z8LA 2C1CA 5FVJA 2GREA 3GKRA 3JTKA 4NGTA 1F57A 1QSOA 3OWCA 2CNTA 4J3GA 4MFQA 4R87A 2PR8A 1UFHA 4CGPA 2YNDA 4KVME 4UIAA 2FE7A 4P4FA 3GLJA 4MCQA 4OIWA 4UCPA 1RO5A 5CPAA 2AFOA 3T9YA 5KTCA 3SI1A 2YNEA 2DPTA 4FWUA 4K30A 3TX8A 5HMNA 2DPSA 4KVOE 4OIDA 5H86A 3KL9A 5IV0A 1K4JA 2PRQA 4MHPA 5AG4A 3B2YA 4R76A 4FBEA 5BWAB 5ISVA 1ZLHA 3K2KA 2GLJA 2B3UA 2JBJA 2C6PA 2OH1A 1TXRA 3DR6A 5G1ZA 5JM6A 1CPSA 4ZYQA 3B3WA 2CXAA 4JJXA 2YGWA 4II9A 1TKHA 2ABZA 3IEHA 3KHZA 4M6IA 2RFHA 4P44A 3PB9X 5C82A 2DXQA 4HKFA 2VZZA 1M44A 4F0XA 2FIWA 4OKOA 4HNYB 3JRUA 2IQ6A 1R43A 1PCAA 1Z4EA 1YX0A 4YWYA 2CNMA 3L2NA 4R6TA 3RAMA 4KOYA 1VHOA 2Z3KA 4AVCA 5D29A 5LRJA 3FEDA 3R96A 3FB3A 3T8WA 2J8NA 4OC5A 3D7DA 1LCPA 1Z8TA 2P0WA 3FYNA 4JXQA 4DJLA 5EMIA 3B35A 2F5IA 2C27A 4Q7AA 1U6MA 3F5BA 1MK4A 3JVNA 5HXDA 2BO9A 3TE4A 2AFUA 1Z8WA 1RXTA 6CPAA 5D8NA 4CRZB 2EBJA 2PJ2A 5GCNA 2PRBA 2Z11A 4A94A 1M4DA 5CBMA 5ELYA 3SXNA 2K5TA 3D7FA 4JYWA 3LACA 2PE3A 3EY5A 4UCMA 4P4IA 4Y49B 3NH5A 1H8LA 1MJ9A 2POKA 1S7LA 2DEAA 2ZEFA 3EC4A 3ISZA 3NE8A 4H6UA 3IGRA 4DYOA 4Q38A 2C6GA 4I49A 1XBUA 2G3TA 3RO0A 1XFOA 3P2FA 3D67A 5DS0A 1NSLA 3R9GA 1VKCA 4OMEA 4LQ6A 1Z5RA 5AGEA 3KGQA 2DF5A 4PXBA 3IFEA 2AFZA 3V38A 2QECA 4KOUA 4A38A 4OAEA 3VWEA 2V8VA 3LODA 4KOVA 4UFVA 1IYKA 3SJEA 4R3LA 2RC4A 1LRZA 5LYLA 1HEEA 2NYQA 4Z65A 2YNCC 4FD6A 1Q7LA 4MJ8A 1ON0A 2P6EA 4PSXA 1ZG9A 5I0CA 4UWJA 3DDDA 2PJAA 4A2ZA 4B5OA 2CNSA 2VL1A
chains in the Genus database with same CATH topology
1BLLE 4FAIA 4NGNA 4H2KA 3NFZA 3KR4A 2OR4A 2PJBA 2PJ7A 3PFEA 3TC8A 1ELMP 4DUKA 3KI9A 3I1UA 1CX8A 2C6CA 2PJ3A 3N5FA 4P4EA 5JGFA 1VHEA 2PVVA 1ZG7A 3MRUA 4EWTA 4JZ0A 3IC1A 5LYDA 3FJUA 4F9UA 4MXUA 1Y0YA 3KASA 3B7IA 3VH9A 2BOAA 4X8IA 5HVGA 4G1PA 4P4BA 1Z2LA 1XMBA 2PIYA 3WC6A 1LFWA 2AFSA 2OOTA 2V8HA 2ZEOA 4P6YA 4ZI6A 2AFWA 2ZEMA 4P45A 2V8GA 4OC2A 4W9YA 2PJ1A 2F7VA 4P4DA 1ARMA 1TF8A 1FNOA 2WZNA 2EWBA 2QVPA 3S9MA 4MHNA 4MCPA 5IB9A 4WJBA 4K3NA 4B6ZA 4UF4A 4ZX9A 1KWMA 3WC7A 4X3RA 3D7HA 2XEFA 3B3CA 4BD9A 4X2TA 3PFOA 2ZENA 3B3TA 1ARLA 4IHMA 3S9NA 5K8OA 2AFXA 3DLJA 1VGYA 4MRIA 1YLOA 1BPNA 4RUHA 5LRGA 1DE4C 2BCOA 1LOKA 8CPAA 2ZEEA 2ZEDA 3FEEA 3B3VA 1PYTB 3CPAA 2GLFA 4P10A 1HDUA 2PCUA 3D68A 3K9TA 3WC5A 4A37A 5K8PA 3RZAA 3PBBA 3BHXA 3H8EA 1GYTA 3KR5A 3CT9A 5F09A 4NGSA 2JBKA 1M4LA 4PQAA 4ZX8A 2XEGA 2PJ9A 2PJCA 3D7GA 2FVGA 3H8GA 2IJZA 2V8DA 1QQ9A 4UEFA 5I4MA 4NGRA 3PRTA 3FX6A 1AMPA 2ZOGA 3KQZA 1CP7A 2HC9A 1YSJA 3IWWA 1LANA 4ZY2A 2RB7A 3GB0A 4LQGA 3FVLA 4F8ZA 3NH8A 2QJ8A 2PJ4A 1LAMA 3SJXA 2ZELA 3BXMA 4NJQA 4R8FA 4MCSA 2ZOFA 1DTDA 3H8FA 2GU2A 3WT4A 1JQGA 4EMEA 1ZLIA 3IO1A 1XJOA 1EE3P 3FMCA 1ELLP 3PB8X 2PJ6A 3WABA 5LRKA 4ZY1A 4AXVA 1TKFA 2ANPA 3RBUA 4UIBA 1NSAA 2NSMA 2IMOA 3BI0A 2XEIA 1UWYA 4KSIA 1CP6A 2PJ5A 2QYVA 1R3NA 4MMOA 3ISXA 4PXDA 4O23A 4FUUA 5K8MA 2F8HA 3IIBA 4NGMA 3SI0A 1TF9A 4F9VA 3IJ3A 3VARA 4WWVA 3FECA 4EFDA 4YU9A 1FT7A 4GM5A 1OBRA 4UEZA 3NH4A 4IK2A 4NGQA 1CG2A 3MN8A 4MCRA 2CTCA 4MHYA 4R7MA 3D4UA 3D66A 3PB7X 2ZEHA 1IGBA 4NJRA 1CBXA 1VIXA 2Q43A 2V77A 3CDXA 4PXCA 4OC3A 3B3SA 2J9AA 5K8NA 2HB6A 3SJGA 2ZEGA 2CF4A 3SJFA 2AFMA 2Q51A 5JH9A 4OP4A 7CPAA 2WYRA 1CPXA 3KQXA 1LAPA 5HVHA 3PBEA 3HLPA 1RTQA 3FF3A 1F2OA 3GUXA 3LMSA 3VATA 2CTBA 2I3CA 3DGVA 4PPZA 3FH4A 2PJ0A 4A39A 3NA6A 3LWUA 5HVFA 2EK9A 4ONWA 4OC0A 3BI1A 1YW6A 1YW4A 1QMUA 2XEJA 4ZY0A 3KZWA 2Q4ZA 4PXEA 3PEIA 4OC4A 2PJ8A 3KHXA 4NFRA 1Y7EA 3PB6X 2PVWA 3HUVA 4TWEA 2O53A 1XRYA 4IAVA 4MHZA 1ZG8A 1TKJA 3SI2A 1IY7A 5LYIA 1BAVA 3PB4X 4UEEA 2PIZA 2O4HA 4P4JA 1AYEA 4OC1A 2JEWA 2CIJA 3QNVA 5THWA 4TNUA 4CPAA 2EK8A 3S9LA 1YMEA 5LYFA 2ZEPA 4NGPA 2G9DA 1F2PA 1Y0RA 1BPMA 3CPXA 5J1QA 3V7ZA 1HDQA 1Z8LA 2C1CA 2GREA 4NGTA 1F57A 4UIAA 4P4FA 3GLJA 4MCQA 4OIWA 5CPAA 2AFOA 3SI1A 4FWUA 3TX8A 4OIDA 3KL9A 2PRQA 4MHPA 3B2YA 4R76A 4FBEA 1ZLHA 3K2KA 2GLJA 2JBJA 2C6PA 1TXRA 5JM6A 1CPSA 4ZYQA 3B3WA 1TKHA 2ABZA 3IEHA 3KHZA 2RFHA 4P44A 3PB9X 4OKOA 3JRUA 2IQ6A 1R43A 1PCAA 4YWYA 3L2NA 4R6TA 3RAMA 1VHOA 5D29A 5LRJA 3FEDA 3T8WA 4OC5A 3D7DA 1LCPA 4DJLA 3B35A 5HXDA 2BO9A 2AFUA 6CPAA 5D8NA 2PJ2A 4A94A 5CBMA 5ELYA 3D7FA 4JYWA 2PE3A 4P4IA 3NH5A 1H8LA 2POKA 2DEAA 2ZEFA 3ISZA 4DYOA 2C6GA 1XBUA 1XFOA 3D67A 5DS0A 4OMEA 1Z5RA 3KGQA 4PXBA 3IFEA 2AFZA 3V38A 4A38A 2V8VA 3SJEA 5LYLA 1HEEA 2NYQA 4Z65A 1Q7LA 1ZG9A 2PJAA 4Q7AA 2VL1A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1BLL E;  4FAI A;  4NGN A;  4H2K A;  3NFZ A;  3KR4 A;  2OR4 A;  2PJB A;  2PJ7 A;  3PFE A;  3TC8 A;  1ELM P;  4DUK A;  3KI9 A;  3I1U A;  1CX8 A;  2C6C A;  2PJ3 A;  3N5F A;  4P4E A;  5JGF A;  1VHE A;  2PVV A;  1ZG7 A;  3MRU A;  4EWT A;  4JZ0 A;  3IC1 A;  5LYD A;  3FJU A;  4F9U A;  4MXU A;  1Y0Y A;  3KAS A;  3B7I A;  3VH9 A;  2BOA A;  4X8I A;  5HVG A;  4G1P A;  4P4B A;  1Z2L A;  1XMB A;  2PIY A;  3WC6 A;  1LFW A;  2AFS A;  2OOT A;  2V8H A;  2ZEO A;  4P6Y A;  4ZI6 A;  2AFW A;  2ZEM A;  4P45 A;  2V8G A;  4OC2 A;  4W9Y A;  2PJ1 A;  2F7V A;  4P4D A;  1ARM A;  1TF8 A;  1FNO A;  2WZN A;  2EWB A;  2QVP A;  3S9M A;  4MHN A;  4MCP A;  5IB9 A;  4WJB A;  4K3N A;  4B6Z A;  4UF4 A;  4ZX9 A;  1KWM A;  3WC7 A;  4X3R A;  3D7H A;  2XEF A;  3B3C A;  4BD9 A;  4X2T A;  3PFO A;  2ZEN A;  3B3T A;  1ARL A;  4IHM A;  3S9N A;  5K8O A;  2AFX A;  3DLJ A;  1VGY A;  4MRI A;  1YLO A;  1BPN A;  4RUH A;  5LRG A;  1DE4 C;  2BCO A;  1LOK A;  8CPA A;  2ZEE A;  2ZED A;  3FEE A;  3B3V A;  1PYT B;  3CPA A;  2GLF A;  4P10 A;  1HDU A;  2PCU A;  3D68 A;  3K9T A;  3WC5 A;  4A37 A;  5K8P A;  3RZA A;  3PBB A;  3BHX A;  3H8E A;  1GYT A;  3KR5 A;  3CT9 A;  5F09 A;  4NGS A;  2JBK A;  1M4L A;  4PQA A;  4ZX8 A;  2XEG A;  2PJ9 A;  2PJC A;  3D7G A;  2FVG A;  3H8G A;  2IJZ A;  2V8D A;  1QQ9 A;  4UEF A;  5I4M A;  4NGR A;  3PRT A;  3FX6 A;  1AMP A;  2ZOG A;  3KQZ A;  1CP7 A;  2HC9 A;  1YSJ A;  3IWW A;  1LAN A;  4ZY2 A;  2RB7 A;  3GB0 A;  4LQG A;  3FVL A;  4F8Z A;  3NH8 A;  2QJ8 A;  2PJ4 A;  1LAM A;  3SJX A;  2ZEL A;  3BXM A;  4NJQ A;  4R8F A;  4MCS A;  2ZOF A;  1DTD A;  3H8F A;  2GU2 A;  3WT4 A;  1JQG A;  4EME A;  1ZLI A;  3IO1 A;  1XJO A;  1EE3 P;  3FMC A;  1ELL P;  3PB8 X;  2PJ6 A;  3WAB A;  5LRK A;  4ZY1 A;  4AXV A;  1TKF A;  2ANP A;  3RBU A;  4UIB A;  1NSA A;  2NSM A;  2IMO A;  3BI0 A;  2XEI A;  1UWY A;  4KSI A;  1CP6 A;  2PJ5 A;  2QYV A;  1R3N A;  4MMO A;  3ISX A;  4PXD A;  4O23 A;  4FUU A;  5K8M A;  2F8H A;  3IIB A;  4NGM A;  3SI0 A;  1TF9 A;  4F9V A;  3IJ3 A;  3VAR A;  4WWV A;  3FEC A;  4EFD A;  4YU9 A;  1FT7 A;  4GM5 A;  1OBR A;  4UEZ A;  3NH4 A;  4IK2 A;  4NGQ A;  1CG2 A;  3MN8 A;  4MCR A;  2CTC A;  4MHY A;  4R7M A;  3D4U A;  3D66 A;  3PB7 X;  2ZEH A;  1IGB A;  4NJR A;  1CBX A;  1VIX A;  2Q43 A;  2V77 A;  3CDX A;  4PXC A;  4OC3 A;  3B3S A;  2J9A A;  5K8N A;  2HB6 A;  3SJG A;  2ZEG A;  2CF4 A;  3SJF A;  2AFM A;  2Q51 A;  5JH9 A;  4OP4 A;  7CPA A;  2WYR A;  1CPX A;  3KQX A;  1LAP A;  5HVH A;  3PBE A;  3HLP A;  1RTQ A;  3FF3 A;  1F2O A;  3GUX A;  3LMS A;  3VAT A;  2CTB A;  2I3C A;  3DGV A;  4PPZ A;  3FH4 A;  2PJ0 A;  4A39 A;  3NA6 A;  3LWU A;  5HVF A;  2EK9 A;  4ONW A;  4OC0 A;  3BI1 A;  1YW6 A;  1YW4 A;  1QMU A;  2XEJ A;  4ZY0 A;  3KZW A;  2Q4Z A;  4PXE A;  3PEI A;  4OC4 A;  2PJ8 A;  3KHX A;  4NFR A;  1Y7E A;  3PB6 X;  2PVW A;  3HUV A;  4TWE A;  2O53 A;  1XRY A;  4IAV A;  4MHZ A;  1ZG8 A;  1TKJ A;  3SI2 A;  1IY7 A;  5LYI A;  1BAV A;  3PB4 X;  4UEE A;  2PIZ A;  2O4H A;  4P4J A;  1AYE A;  4OC1 A;  2JEW A;  2CIJ A;  3QNV A;  5THW A;  4TNU A;  4CPA A;  2EK8 A;  3S9L A;  1YME A;  5LYF A;  2ZEP A;  4NGP A;  2G9D A;  1F2P A;  1Y0R A;  1BPM A;  3CPX A;  5J1Q A;  3V7Z A;  1HDQ A;  1Z8L A;  2C1C A;  2GRE A;  4NGT A;  1F57 A;  4UIA A;  4P4F A;  3GLJ A;  4MCQ A;  4OIW A;  5CPA A;  2AFO A;  3SI1 A;  4FWU A;  3TX8 A;  4OID A;  3KL9 A;  2PRQ A;  4MHP A;  3B2Y A;  4R76 A;  4FBE A;  1ZLH A;  3K2K A;  2GLJ A;  2JBJ A;  2C6P A;  1TXR A;  5JM6 A;  1CPS A;  4ZYQ A;  3B3W A;  1TKH A;  2ABZ A;  3IEH A;  3KHZ A;  2RFH A;  4P44 A;  3PB9 X;  4OKO A;  3JRU A;  2IQ6 A;  1R43 A;  1PCA A;  4YWY A;  3L2N A;  4R6T A;  3RAM A;  1VHO A;  5D29 A;  5LRJ A;  3FED A;  3T8W A;  4OC5 A;  3D7D A;  1LCP A;  4DJL A;  3B35 A;  5HXD A;  2BO9 A;  2AFU A;  6CPA A;  5D8N A;  2PJ2 A;  4A94 A;  5CBM A;  5ELY A;  3D7F A;  4JYW A;  2PE3 A;  4P4I A;  3NH5 A;  1H8L A;  2POK A;  2DEA A;  2ZEF A;  3ISZ A;  4DYO A;  2C6G A;  1XBU A;  1XFO A;  3D67 A;  5DS0 A;  4OME A;  1Z5R A;  3KGQ A;  4PXB A;  3IFE A;  2AFZ A;  3V38 A;  4A38 A;  2V8V A;  3SJE A;  5LYL A;  1HEE A;  2NYQ A;  4Z65 A;  1Q7L A;  1ZG9 A;  2PJA A;  4Q7A A;  2VL1 A; 
#chains in the Genus database with same CATH topology
 4E0A A;  1BLL E;  4FAI A;  1KUX A;  4C68 A;  2ZW5 A;  1Y7R A;  4H2K A;  4NGN A;  1CM0 A;  1VHS A;  2Z3P A;  3RNZ A;  3NFZ A;  2FS5 A;  3KR4 A;  2OR4 A;  2PJB A;  4KLV A;  2H5M A;  2PJ7 A;  3PFE A;  3TC8 A;  1ELM P;  1Q2D A;  4DUK A;  3KI9 A;  3I1U A;  4KOR A;  1CX8 A;  2B3V A;  2C6C A;  1S7N A;  2PJ3 A;  4AVA A;  4L8A A;  4XPD B;  4NF1 A;  3TCV A;  4KLW A;  2PSW A;  4QVT A;  1XF8 A;  3N5F A;  4P4E A;  1R57 A;  2HUZ A;  1VHE A;  2PVV A;  5JGF A;  5EC4 A;  3CXP A;  3D2P A;  1ZG7 A;  3MRU A;  2PR1 A;  4KZT A;  4JZ0 A;  4OLL A;  4EWT A;  1M4G A;  3IC1 A;  4KOT A;  4A30 A;  5LYD A;  2G3A A;  3FJU A;  4B12 A;  2JLM A;  4MXU A;  4F9U A;  1Y0Y A;  3KAS A;  4KOW A;  4MY0 A;  3B7I A;  3ZZI A;  3F0A A;  4FD7 A;  1M1D A;  3VH9 A;  4CYP A;  3TOB A;  2BOA A;  4X8I A;  5HVG A;  4G1P A;  4P4B A;  4XNH B;  1Z2L A;  3FRM A;  4M6H A;  1XMB A;  5AG5 A;  2I00 A;  2PIY A;  4YFJ A;  3WC6 A;  2HQY A;  1LFW A;  4YGO A;  2GE3 A;  2AFS A;  2R1I A;  2OOT A;  2B4B A;  2V8H A;  4F0Y A;  3W6X A;  5A28 A;  2ZEO A;  4P6Y A;  4BIN A;  2Z3L A;  4OAD A;  4ZI6 A;  1Q2Y A;  2AFW A;  2QIR A;  2ZEM A;  3FNC A;  2V8G A;  4KSA A;  4OC2 A;  4P45 A;  4MFJ A;  2BEI A;  4W9Y A;  4BMH A;  4C7I A;  4DNC A;  2ODF A;  2PJ1 A;  4XNH C;  2F7V A;  4R9M A;  2A4N A;  4P4D A;  1ARM A;  4CRY B;  1TF8 A;  1IID A;  2HV2 A;  1FNO A;  2OB0 A;  2WZN A;  4AG9 A;  4AB7 A;  2EWB A;  2Z0Z A;  2QVP A;  3S9M A;  4CYQ A;  4CYO A;  3CZX A;  4MHN A;  1CJW A;  2GFQ A;  4MCP A;  5IB9 A;  4WJB A;  3K9U A;  1S60 A;  5HH1 A;  3QAY A;  5C88 A;  4U9Z A;  4CS0 B;  2VEZ A;  4K3N A;  4B6Z A;  4C2Z A;  4UF4 A;  4Q36 A;  1PU9 A;  2Z10 A;  4ZX9 A;  1QSM A;  2VXK A;  1S7F A;  4RI1 A;  4QUS A;  5F48 A;  1KWM A;  2Z3M A;  2OZH A;  4X3R A;  3WC7 A;  3BJ7 A;  3UY5 A;  3D7H A;  1ZO0 A;  2XEF A;  1XEB A;  1IYL A;  3B3C A;  4BD9 A;  4X2T A;  3B8G A;  2YNC A;  3PFO A;  2ZEN A;  2EO8 A;  4JWP A;  3B3T A;  4A31 A;  1ARL A;  4IHM A;  4CGO A;  3TOA A;  3S9N A;  4JLY A;  5K8O A;  2AFX A;  3IWG A;  3DLJ A;  3D2M A;  1VGY A;  3S6H A;  2OZG A;  4MRI A;  4UWI A;  1YLO A;  1BPN A;  2AE6 A;  4ORF A;  5LRG A;  1DE4 C;  4RUH A;  2ZW7 A;  2BCO A;  1LOK A;  8CPA A;  4C2X A;  2ZEE A;  1N71 A;  1I1D A;  2B5G B;  1XIX A;  2ZED A;  5J8C A;  5KTA A;  3FEE A;  4MHD A;  4UCN A;  3IU1 A;  4XPD C;  3W91 A;  3PZJ A;  2FIA A;  3B3V A;  3S6G A;  1PYT B;  3CPA A;  2GLF A;  2FL4 A;  4P10 A;  4GXH A;  4XPK A;  2FSR A;  2Z3O A;  2GAN A;  1HDU A;  4NEX A;  2PCU A;  3D68 A;  3TO7 A;  3DSB A;  1B87 A;  4QBJ A;  2Q7S A;  4M3S A;  4B5P B;  3EO4 A;  3K9T A;  3WC5 A;  2Z3N A;  4A37 A;  5K8P A;  2ZXV A;  3RZA A;  5EBV A;  1Z8X A;  4KOX A;  3DR8 A;  2WSA A;  3PGP A;  3PBB A;  4KUB A;  3MGD A;  3IU2 A;  3FXT A;  3BHX A;  2Q4Y A;  3H8E A;  1YGH A;  1GYT A;  3KR5 A;  1P0H A;  3CT9 A;  3N7Z A;  4F6A A;  5F09 A;  2ZPA A;  4NGS A;  1L0C A;  2JBK A;  4H6Z A;  5E96 A;  4E2A A;  4B5P A;  3DNS A;  2Q04 A;  3A9L A;  1Q2C A;  1M4L A;  4UFX A;  5JPH A;  4PQA A;  4ZX8 A;  2XEG A;  2PJ9 A;  2NMT A;  1NE9 A;  3RBU A;  4PK2 A;  2WPW A;  2PJC A;  3D7G A;  4UBR A;  2FVG A;  2IL4 A;  3H8G A;  2IJZ A;  2V8D A;  2BL1 A;  1QSR A;  3D8P A;  1XMT A;  1QQ9 A;  3P2H A;  4UEF A;  4Y49 C;  2FXF A;  5I4M A;  4NGR A;  3PRT A;  5G20 A;  5IB0 A;  3C26 A;  4ZGY B;  2ATR A;  3FX6 A;  4A32 A;  3R9F A;  4B14 A;  1AMP A;  4CAV A;  5A27 A;  2ZOG A;  3KQZ A;  4H89 A;  1CP7 A;  2HC9 A;  2KCW A;  3TO9 A;  1YSJ A;  1S5K A;  2Q4V A;  2R8V A;  4FD4 A;  1WWZ A;  3IWW A;  3IWE A;  1LAN A;  4CGN A;  1MJB A;  4ZY2 A;  1P4N A;  3KKW A;  2Q7B A;  2RB7 A;  1XE4 A;  3GB0 A;  4MI4 A;  4LQG A;  1X10 A;  3FVL A;  4F8Z A;  3NH8 A;  3SHP A;  2QJ8 A;  2PJ4 A;  1LAM A;  3SJX A;  2ZEL A;  3BXM A;  4NJQ A;  2FT0 A;  1IU8 A;  2ZOF A;  4MBU A;  4MCS A;  2REE A;  4R8F A;  5CNP A;  2BUE A;  2PC1 A;  1DTD A;  3H8F A;  2EUI A;  3R1K A;  5G22 A;  4B13 A;  2GU2 A;  3EFA A;  3WT4 A;  1JQG A;  1SQH A;  4EME A;  2R7H A;  5JQ4 A;  1YR0 A;  1ZLI A;  3IO1 A;  4KUA A;  4UFW A;  5AG7 A;  3VWD A;  1XJO A;  2G0B A;  2WUU A;  1EE3 P;  3FMC A;  1ELL P;  1TIQ A;  3PB8 X;  4IF5 A;  4NXY A;  5DWN A;  1OZP A;  4MFP A;  1I12 A;  2PJ6 A;  2B5G A;  3WAB A;  4KOS A;  2Y0M A;  5LRK A;  4ZY1 A;  2REF A;  4AXV A;  1TKF A;  1Z9U A;  2ANP A;  4RS2 A;  1WK4 A;  3QB8 A;  1NSA A;  4LX9 A;  4RN7 A;  4UIB A;  2NSM A;  4HPS A;  4AG7 A;  4B10 A;  2IMO A;  3W6S A;  3G8W A;  1IB1 E;  3FBU A;  1XOV A;  3BI0 A;  2XEI A;  3GIU A;  3GY9 A;  1AUG A;  4L89 A;  1B6B A;  4BBH A;  3R9E A;  4CAF A;  2BSW A;  1UWY A;  2B4D B;  4KSI A;  1CP6 A;  4HNX B;  2PJ5 A;  2QYV A;  1R3N A;  4MMO A;  4A33 A;  1GHE A;  3ISX A;  4PXD A;  4E8O A;  1S3Z A;  4KS9 A;  4O23 A;  5H84 A;  4FUU A;  1NMT A;  4CAX A;  2J8M A;  5K8M A;  4GS4 A;  2F8H A;  4M6G A;  3T90 A;  3IIB A;  4NGM A;  1IIC A;  3SI0 A;  2VBQ A;  2OU2 A;  1TF9 A;  4CAE A;  2JDD A;  4F9V A;  3IJ3 A;  3VAR A;  4WWV A;  4KSF A;  3FEC A;  4EFD A;  4NSQ A;  4YU9 A;  1FT7 A;  4GM5 A;  1OBR A;  4UEZ A;  1BOB A;  4KVX A;  3NH4 A;  3BLN A;  2QML A;  3F8K A;  4IK2 A;  4M85 A;  4NGQ A;  1CG2 A;  3MN8 A;  1YLE A;  4MCR A;  3E0K A;  2CTC A;  4MHY A;  4FD5 A;  1A2Z A;  3RYO A;  4R7M A;  4ONU A;  3D4U A;  4QC6 A;  2X7B A;  3D66 A;  3PB7 X;  1IOI A;  2ZEH A;  3D3S A;  1IGB A;  4NJR A;  3FIX A;  1CBX A;  1VIX A;  2D4P A;  2Q43 A;  2V77 A;  3CDX A;  4PXC A;  2OZU A;  2ZW4 A;  2R98 A;  3CXQ A;  3GYA A;  4OC3 A;  2B4D A;  3B3S A;  2J9A A;  3S6F A;  5K8N A;  2HB6 A;  3SJG A;  2ZEG A;  4R3K A;  1KUV A;  2B58 A;  1YRE A;  2CF4 A;  4U9Y A;  2ZW6 A;  4MFZ A;  3SJF A;  2AFM A;  2Q51 A;  1S7K A;  3TFY A;  5DWM A;  2J8R A;  4OP4 A;  7CPA A;  5JH9 A;  2WYR A;  1CPX A;  3KQX A;  1LAP A;  1I21 A;  3I3G A;  3R95 A;  4C7H A;  4B11 A;  2O28 A;  5HVH A;  3PBE A;  3HLP A;  1RTQ A;  3FF3 A;  1KUY A;  2AJ6 A;  1F2O A;  4JXR A;  1X12 A;  4A95 A;  3GUX A;  3LMS A;  2Q0Y A;  2JDC A;  2VZY A;  3H5Z A;  1YVO A;  2VI7 A;  3NE7 A;  3VAT A;  1YVK A;  1QSN A;  2EVN A;  2D4O A;  2CTB A;  2I3C A;  3DGV A;  5J8F A;  4ZBG A;  1YK3 A;  4PPZ A;  1PUA A;  1FY7 A;  2PQ8 A;  3CXS A;  4IUS A;  4CAW A;  3FH4 A;  2PJ0 A;  2JEV A;  4A39 A;  3JUW A;  3LWU A;  3NA6 A;  3S6K A;  4AVB A;  4QB9 A;  2WPX A;  1M4I A;  5HVF A;  2EK9 A;  4ONW A;  1BO4 A;  3G3S A;  4OC0 A;  4C2Y A;  3BI1 A;  1YW6 A;  1QST A;  1YW4 A;  3I9S A;  3H4Q A;  4X5K A;  4XPL A;  5IX3 A;  2ARH A;  1QMU A;  5AG6 A;  1V0C A;  2GIV A;  2XEJ A;  4ZY0 A;  5KTD A;  3KZW A;  3SXO A;  4UA3 A;  5F49 A;  4MFK A;  2Q4Z A;  1YQE A;  2PDO A;  1Y9W A;  4PXE A;  3PEI A;  4OC4 A;  2I79 A;  2PJ8 A;  3KHX A;  3PP9 A;  3V8I A;  5F46 A;  4NFR A;  4CYN A;  1Y7E A;  3PB6 X;  2PVW A;  3BJ8 A;  3LD2 A;  1IOF A;  3HUV A;  5F47 A;  3TO6 A;  3TTH A;  4TWE A;  2O53 A;  1XRY A;  4IAV A;  4MHZ A;  1ZG8 A;  3EXN A;  1TKJ A;  3SI2 A;  3WR7 A;  2P6G A;  3QAH A;  2P6F A;  4HNW B;  1IY7 A;  2VQY A;  4NCZ A;  5G21 A;  5LYI A;  1BAV A;  4EVY A;  3PB4 X;  4UEE A;  4CGL A;  2PIZ A;  4MFL A;  2O4H A;  4P4J A;  4PV6 A;  3ZJ0 A;  1KZF A;  1AYE A;  4PK3 A;  4JD6 A;  2JEW A;  4OC1 A;  4R57 A;  2CY2 A;  2CIJ A;  3QNV A;  5THW A;  4TNU A;  3TT2 A;  4CGM A;  4YRH A;  2EK8 A;  1J4J A;  1YME A;  4CPA A;  5LYF A;  3S9L A;  2FCK A;  2ZEP A;  1JWQ A;  1Y9K A;  4NGP A;  4U5Y A;  4LUA A;  4PSW A;  1Z4R A;  2G9D A;  1F2P A;  1Y0R A;  1BPM A;  4MY3 A;  3CPX A;  1MJA A;  5J1Q A;  2Q44 A;  3V7Z A;  1HDQ A;  1Z8L A;  2C1C A;  5FVJ A;  2GRE A;  3GKR A;  3JTK A;  4NGT A;  1F57 A;  1QSO A;  3OWC A;  2CNT A;  4J3G A;  4MFQ A;  4R87 A;  2PR8 A;  1UFH A;  4CGP A;  2YND A;  4KVM E;  4UIA A;  2FE7 A;  4P4F A;  3GLJ A;  4MCQ A;  4OIW A;  4UCP A;  1RO5 A;  5CPA A;  2AFO A;  3T9Y A;  5KTC A;  3SI1 A;  2YNE A;  2DPT A;  4FWU A;  4K30 A;  3TX8 A;  5HMN A;  2DPS A;  4KVO E;  4OID A;  5H86 A;  3KL9 A;  5IV0 A;  1K4J A;  2PRQ A;  4MHP A;  5AG4 A;  3B2Y A;  4R76 A;  4FBE A;  5BWA B;  5ISV A;  1ZLH A;  3K2K A;  2GLJ A;  2B3U A;  2JBJ A;  2C6P A;  2OH1 A;  1TXR A;  3DR6 A;  5G1Z A;  5JM6 A;  1CPS A;  4ZYQ A;  3B3W A;  2CXA A;  4JJX A;  2YGW A;  4II9 A;  1TKH A;  2ABZ A;  3IEH A;  3KHZ A;  4M6I A;  2RFH A;  4P44 A;  3PB9 X;  5C82 A;  2DXQ A;  4HKF A;  2VZZ A;  1M44 A;  4F0X A;  2FIW A;  4OKO A;  4HNY B;  3JRU A;  2IQ6 A;  1R43 A;  1PCA A;  1Z4E A;  1YX0 A;  4YWY A;  2CNM A;  3L2N A;  4R6T A;  3RAM A;  4KOY A;  1VHO A;  2Z3K A;  4AVC A;  5D29 A;  5LRJ A;  3FED A;  3R96 A;  3FB3 A;  3T8W A;  2J8N A;  4OC5 A;  3D7D A;  1LCP A;  1Z8T A;  2P0W A;  3FYN A;  4JXQ A;  4DJL A;  5EMI A;  3B35 A;  2F5I A;  2C27 A;  4Q7A A;  1U6M A;  3F5B A;  1MK4 A;  3JVN A;  5HXD A;  2BO9 A;  3TE4 A;  2AFU A;  1Z8W A;  1RXT A;  6CPA A;  5D8N A;  4CRZ B;  2EBJ A;  2PJ2 A;  5GCN A;  2PRB A;  2Z11 A;  4A94 A;  1M4D A;  5CBM A;  5ELY A;  3SXN A;  2K5T A;  3D7F A;  4JYW A;  3LAC A;  2PE3 A;  3EY5 A;  4UCM A;  4P4I A;  4Y49 B;  3NH5 A;  1H8L A;  1MJ9 A;  2POK A;  1S7L A;  2DEA A;  2ZEF A;  3EC4 A;  3ISZ A;  3NE8 A;  4H6U A;  3IGR A;  4DYO A;  4Q38 A;  2C6G A;  4I49 A;  1XBU A;  2G3T A;  3RO0 A;  1XFO A;  3P2F A;  3D67 A;  5DS0 A;  1NSL A;  3R9G A;  1VKC A;  4OME A;  4LQ6 A;  1Z5R A;  5AGE A;  3KGQ A;  2DF5 A;  4PXB A;  3IFE A;  2AFZ A;  3V38 A;  2QEC A;  4KOU A;  4A38 A;  4OAE A;  3VWE A;  2V8V A;  3LOD A;  4KOV A;  4UFV A;  1IYK A;  3SJE A;  4R3L A;  2RC4 A;  1LRZ A;  5LYL A;  1HEE A;  2NYQ A;  4Z65 A;  2YNC C;  4FD6 A;  1Q7L A;  4MJ8 A;  1ON0 A;  2P6E A;  4PSX A;  1ZG9 A;  5I0C A;  4UWJ A;  3DDD A;  2PJA A;  4A2Z A;  4B5O A;  2CNS A;  2VL1 A; 
#chains in the Genus database with same CATH homology
 1BLL E;  4FAI A;  4NGN A;  4H2K A;  3NFZ A;  3KR4 A;  2OR4 A;  2PJB A;  2PJ7 A;  3PFE A;  3TC8 A;  1ELM P;  4DUK A;  3KI9 A;  3I1U A;  1CX8 A;  2C6C A;  2PJ3 A;  3N5F A;  4P4E A;  5JGF A;  1VHE A;  2PVV A;  1ZG7 A;  3MRU A;  4EWT A;  4JZ0 A;  3IC1 A;  5LYD A;  3FJU A;  4F9U A;  4MXU A;  1Y0Y A;  3KAS A;  3B7I A;  3VH9 A;  2BOA A;  4X8I A;  5HVG A;  4G1P A;  4P4B A;  1Z2L A;  1XMB A;  2PIY A;  3WC6 A;  1LFW A;  2AFS A;  2OOT A;  2V8H A;  2ZEO A;  4P6Y A;  4ZI6 A;  2AFW A;  2ZEM A;  4P45 A;  2V8G A;  4OC2 A;  4W9Y A;  2PJ1 A;  2F7V A;  4P4D A;  1ARM A;  1TF8 A;  1FNO A;  2WZN A;  2EWB A;  2QVP A;  3S9M A;  4MHN A;  4MCP A;  5IB9 A;  4WJB A;  4K3N A;  4B6Z A;  4UF4 A;  4ZX9 A;  1KWM A;  3WC7 A;  4X3R A;  3D7H A;  2XEF A;  3B3C A;  4BD9 A;  4X2T A;  3PFO A;  2ZEN A;  3B3T A;  1ARL A;  4IHM A;  3S9N A;  5K8O A;  2AFX A;  3DLJ A;  1VGY A;  4MRI A;  1YLO A;  1BPN A;  4RUH A;  5LRG A;  1DE4 C;  2BCO A;  1LOK A;  8CPA A;  2ZEE A;  2ZED A;  3FEE A;  3B3V A;  1PYT B;  3CPA A;  2GLF A;  4P10 A;  1HDU A;  2PCU A;  3D68 A;  3K9T A;  3WC5 A;  4A37 A;  5K8P A;  3RZA A;  3PBB A;  3BHX A;  3H8E A;  1GYT A;  3KR5 A;  3CT9 A;  5F09 A;  4NGS A;  2JBK A;  1M4L A;  4PQA A;  4ZX8 A;  2XEG A;  2PJ9 A;  2PJC A;  3D7G A;  2FVG A;  3H8G A;  2IJZ A;  2V8D A;  1QQ9 A;  4UEF A;  5I4M A;  4NGR A;  3PRT A;  3FX6 A;  1AMP A;  2ZOG A;  3KQZ A;  1CP7 A;  2HC9 A;  1YSJ A;  3IWW A;  1LAN A;  4ZY2 A;  2RB7 A;  3GB0 A;  4LQG A;  3FVL A;  4F8Z A;  3NH8 A;  2QJ8 A;  2PJ4 A;  1LAM A;  3SJX A;  2ZEL A;  3BXM A;  4NJQ A;  4R8F A;  4MCS A;  2ZOF A;  1DTD A;  3H8F A;  2GU2 A;  3WT4 A;  1JQG A;  4EME A;  1ZLI A;  3IO1 A;  1XJO A;  1EE3 P;  3FMC A;  1ELL P;  3PB8 X;  2PJ6 A;  3WAB A;  5LRK A;  4ZY1 A;  4AXV A;  1TKF A;  2ANP A;  3RBU A;  4UIB A;  1NSA A;  2NSM A;  2IMO A;  3BI0 A;  2XEI A;  1UWY A;  4KSI A;  1CP6 A;  2PJ5 A;  2QYV A;  1R3N A;  4MMO A;  3ISX A;  4PXD A;  4O23 A;  4FUU A;  5K8M A;  2F8H A;  3IIB A;  4NGM A;  3SI0 A;  1TF9 A;  4F9V A;  3IJ3 A;  3VAR A;  4WWV A;  3FEC A;  4EFD A;  4YU9 A;  1FT7 A;  4GM5 A;  1OBR A;  4UEZ A;  3NH4 A;  4IK2 A;  4NGQ A;  1CG2 A;  3MN8 A;  4MCR A;  2CTC A;  4MHY A;  4R7M A;  3D4U A;  3D66 A;  3PB7 X;  2ZEH A;  1IGB A;  4NJR A;  1CBX A;  1VIX A;  2Q43 A;  2V77 A;  3CDX A;  4PXC A;  4OC3 A;  3B3S A;  2J9A A;  5K8N A;  2HB6 A;  3SJG A;  2ZEG A;  2CF4 A;  3SJF A;  2AFM A;  2Q51 A;  5JH9 A;  4OP4 A;  7CPA A;  2WYR A;  1CPX A;  3KQX A;  1LAP A;  5HVH A;  3PBE A;  3HLP A;  1RTQ A;  3FF3 A;  1F2O A;  3GUX A;  3LMS A;  3VAT A;  2CTB A;  2I3C A;  3DGV A;  4PPZ A;  3FH4 A;  2PJ0 A;  4A39 A;  3NA6 A;  3LWU A;  5HVF A;  2EK9 A;  4ONW A;  4OC0 A;  3BI1 A;  1YW6 A;  1YW4 A;  1QMU A;  2XEJ A;  4ZY0 A;  3KZW A;  2Q4Z A;  4PXE A;  3PEI A;  4OC4 A;  2PJ8 A;  3KHX A;  4NFR A;  1Y7E A;  3PB6 X;  2PVW A;  3HUV A;  4TWE A;  2O53 A;  1XRY A;  4IAV A;  4MHZ A;  1ZG8 A;  1TKJ A;  3SI2 A;  1IY7 A;  5LYI A;  1BAV A;  3PB4 X;  4UEE A;  2PIZ A;  2O4H A;  4P4J A;  1AYE A;  4OC1 A;  2JEW A;  2CIJ A;  3QNV A;  5THW A;  4TNU A;  4CPA A;  2EK8 A;  3S9L A;  1YME A;  5LYF A;  2ZEP A;  4NGP A;  2G9D A;  1F2P A;  1Y0R A;  1BPM A;  3CPX A;  5J1Q A;  3V7Z A;  1HDQ A;  1Z8L A;  2C1C A;  2GRE A;  4NGT A;  1F57 A;  4UIA A;  4P4F A;  3GLJ A;  4MCQ A;  4OIW A;  5CPA A;  2AFO A;  3SI1 A;  4FWU A;  3TX8 A;  4OID A;  3KL9 A;  2PRQ A;  4MHP A;  3B2Y A;  4R76 A;  4FBE A;  1ZLH A;  3K2K A;  2GLJ A;  2JBJ A;  2C6P A;  1TXR A;  5JM6 A;  1CPS A;  4ZYQ A;  3B3W A;  1TKH A;  2ABZ A;  3IEH A;  3KHZ A;  2RFH A;  4P44 A;  3PB9 X;  4OKO A;  3JRU A;  2IQ6 A;  1R43 A;  1PCA A;  4YWY A;  3L2N A;  4R6T A;  3RAM A;  1VHO A;  5D29 A;  5LRJ A;  3FED A;  3T8W A;  4OC5 A;  3D7D A;  1LCP A;  4DJL A;  3B35 A;  5HXD A;  2BO9 A;  2AFU A;  6CPA A;  5D8N A;  2PJ2 A;  4A94 A;  5CBM A;  5ELY A;  3D7F A;  4JYW A;  2PE3 A;  4P4I A;  3NH5 A;  1H8L A;  2POK A;  2DEA A;  2ZEF A;  3ISZ A;  4DYO A;  2C6G A;  1XBU A;  1XFO A;  3D67 A;  5DS0 A;  4OME A;  1Z5R A;  3KGQ A;  4PXB A;  3IFE A;  2AFZ A;  3V38 A;  4A38 A;  2V8V A;  3SJE A;  5LYL A;  1HEE A;  2NYQ A;  4Z65 A;  1Q7L A;  1ZG9 A;  2PJA A;  4Q7A A;  2VL1 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...