3SHPA

Crystal structure of putative acetyltransferase from sphaerobacter thermophilus dsm 20745
Total Genus 40
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
40
sequence length
168
structure length
168
Chain Sequence
MQAVYLTGPTVYLRAMVEDDKHHAAAWFDSRFPVNAARAEAFLKEKLQGDPWDARWHLLAIVRRSDEAVVGSCRIEFGKQTASLRFHMAPWLDDADVLRAEALELVVPWLRDEHELLVITVEIAADEQRTLAAAEAAGLKAAVRMREAIARAGHRVDLLIYQAVDPKV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of putative acetyltransferase from Sphaerobacter thermophilus DSM 20745
rcsb
source organism Sphaerobacter thermophilus
molecule tags Transferase
molecule keywords Putative acetyltransferase Sthe_0691
total genus 40
structure length 168
sequence length 168
chains with identical sequence B
ec nomenclature
pdb deposition date 2011-06-16
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.630.30 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Aminopeptidase 3shpA00
2Q4YA 4QC6A 5IB0A 1XMTA 2QIRA 5ISVA 2B5GB 3I3GA 3GY9A 2AJ6A 4AG9A 5IV0A 4NXYA 4OADA 2GANA 3DDDA 1QSNA 2ZW5A 1M44A 5GCNA 3D3SA 3PZJA 2Q0YA 1Y9WA 2FCKA 5I0CA 1LRZA 1Q2YA 5FVJA 1S7LA 4ORFA 2FE7A 4MHDA 1NMTA 2Q44A 5E96A 3FB3A 2Z11A 3WR7A 2CNMA 4UWIA 4YGOA 4HNYB 3EY5A 4KLVA 1VKCA 1QSTA 4RI1A 2ARHA 1BO4A 4CAXA 2JEVA 4QBJA 3VWEA 4KOSA 1QSOA 4AB7A 2R1IA 2ZPAA 3CXQA 1K4JA 3PP9A 2ZXVA 3SHPA 2GIVA 2Z10A 2HV2A 2JLMA 4UA3A 2O28A 3P2HA 2D4PA 4H89A 2B3VA 1QSRA 3R9EA 2QECA 2J8NA 2Q7BA 1YVOA 3GKRA 3DSBA 3F8KA 4E0AA 4H6UA 3DR8A 4CRZB 2CY2A 2VZYA 4FD5A 4B5PA 4KLWA 4M85A 5DWNA 3W91A 1ON0A 4R9MA 1RXTA 2GE3A 1KUXA 4MBUA 1MJAA 4NSQA 2FT0A 3W6XA 2EUIA 3OWCA 1BOBA 3FRMA 3TOAA 3H4QA 4KVOE 1PU9A 4UBRA 4GS4A 4YRHA 2NMTA 5J8CA 3TO7A 2K5TA 4II9A 1B6BA 3LODA 3SXNA 4KOVA 2I00A 3GYAA 4B5OA 4F0YA 4E2AA 1WWZA 2CNSA 2B3UA 1N71A 3S6FA 3P2FA 2QMLA 2ZW6A 3QB8A 3VWDA 1PUAA 2OZHA 2G3TA 4YFJA 4KVME 1B87A 3SXOA 3TCVA 4JWPA 4E8OA 5HMNA 5H84A 3I9SA 1WK4A 1IIDA 2REFA 1XE4A 2PSWA 4NCZA 4CAWA 4FD6A 2B4DB 2Q4VA 4Y49C 1XF8A 2JDDA 1J4JA 4CAVA 3G3SA 1MJBA 2VBQA 2BUEA 4LX9A 2CNTA 5CNPA 4DNCA 4AVCA 5DWMA 4KZTA 1NE9A 4KUAA 4U9ZA 1UFHA 3B8GA 1KUYA 4L8AA 3CXSA 5H86A 4NF1A 2B5GA 2IL4A 2A4NA 3R1KA 5JQ4A 2R98A 3ZJ0A 2OB0A 4Y49B 3BJ7A 4QB9A 2P6GA 4KOWA 3D2MA 3W6SA 1S3ZA 1Y9KA 4PK3A 3S6HA 4QVTA 4JXQA 1I12A 1CM0A 3S6KA 1M1DA 2EVNA 1GHEA 4LUAA 4JXRA 5KTCA 5IX3A 3R9FA 1S60A 4FD4A 4KOUA 1YGHA 1P4NA 1Q2CA 4U9YA 2PR1A 3TOBA 3PGPA 2WPWA 4UWJA 1Z4EA 2PRBA 4JLYA 4XPDB 3S6GA 2PQ8A 2FSRA 2G3AA 2G0BA 4OAEA 3TTHA 2BL1A 3FYNA 5F46A 1YREA 4XPDC 1TIQA 2J8MA 5F49A 2VI7A 4MY0A 4R3KA 2OU2A 1M4GA 5KTAA 3R96A 5J8FA 2DXQA 1M4DA 4B5PB 4AVBA 4H6ZA 1I1DA 4R3LA 3CXPA 1S7FA 2F5IA 2R8VA 4R87A 1YLEA 2R7HA 4CS0B 2PR8A 3ZZIA 2Q04A 3C26A 3JVNA 2BSWA 1OZPA 2D4OA 3RYOA 4OLLA 4R57A 3DR6A 3K9UA 3MGDA 5C82A 5C88A 4I49A 4KOTA 2H5MA 4PV6A 1NSLA 4MY3A 2OH1A 1SQHA 5EBVA 1Y7RA 2P6FA 4J3GA 2KCWA 3JUWA 1YVKA 1MK4A 3FIXA 1IICA 2ATRA 3TE4A 2VZZA 1XEBA 4F6AA 4XPLA 1L0CA 4U5YA 2Y0MA 3KKWA 1P0HA 1V0CA 2HUZA 4MJ8A 4AVAA 1CJWA 2J8RA 3LD2A 1Z9UA 3N7ZA 3E0KA 2C27A 1I21A 1IYKA 1KUVA 3TO9A 4IUSA 5EC4A 2HQYA 1Q2DA 3EXNA 4XPKA 1QSMA 1MJ9A 1IYLA 2B4DA 4IF5A 2FL4A 5HH1A 5F47A 2REEA 2ZW4A 2B4BA 4HNXB 4JJXA 3BLNA 1M4IA 4MI4A 5JPHA 2RC4A 3FNCA 1YX0A 4ONUA 2FIAA 4JD6A 4X5KA 4EVYA 2VEZA 1XIXA 4PSWA 1U6MA 3R95A 4XNHB 4M3SA 4RS2A 3TO6A 2FIWA 4HKFA 1IB1E 4HNWB 1S7KA 4KORA 3BJ8A 2Z0ZA 1VHSA 5KTDA 2WPXA 4ZBGA 3T90A 3UY5A 4XNHC 4KOYA 4AG7A 3FXTA 1RO5A 3NE7A 3V8IA 1KZFA 3G8WA 4L89A 4CRYB 3F0AA 3TFYA 2AE6A 3TT2A 2OZUA 2P6EA 2P0WA 2JDCA 2OZGA 2VXKA 4PSXA 3F5BA 3EFAA 3D8PA 4KOXA 4BMHA 3EO4A 1FY7A 2ZW7A 4NEXA 3D2PA 1YR0A 2PC1A 3T9YA 2PDOA 1R57A 2VQYA 1S5KA 3QAHA 4PK2A 2B58A 3IGRA 2X7BA 2BEIA 4K30A 5F48A 1Z4RA 3R9GA 1YK3A 2FXFA 2FS5A 3EC4A 3DNSA 2I79A 4FD7A 1S7NA 3FBUA 3IWGA 4KVXA 4QUSA 4KUBA
chains in the Genus database with same CATH superfamily
3CT9A 3LACA 2V8HA 2Q4YA 4QC6A 3S9MA 5IB0A 1F2PA 1XMTA 4A32A 3KHZA 2QIRA 2DF5A 1CPSA 4MCSA 2C6PA 5ISVA 2B5GB 3I3GA 3GY9A 4P4DA 2AJ6A 4AG9A 5IV0A 4NXYA 4OADA 3HLPA 4OC4A 3B7IA 4CYQA 4OIDA 2GANA 3DDDA 1QSNA 4OC5A 2ZW5A 1M44A 2I3CA 4UFVA 5GCNA 3D3SA 3PZJA 2Q0YA 4M6IA 1YW6A 1TXRA 4LQ6A 1Y9WA 2FCKA 1XJOA 1F2OA 2NSMA 3TC8A 5I0CA 1LRZA 4MFPA 1Q2YA 1FT7A 5FVJA 4BD9A 1S7LA 4ORFA 3NH5A 3PFOA 2FE7A 4MRIA 4MHDA 2F8HA 1NMTA 4OP4A 2Q44A 5E96A 3FB3A 2Z11A 2QYVA 3PEIA 1YLOA 3WR7A 2ZEFA 2CNMA 1CPXA 4CAEA 3PB4X 4UWIA 4YGOA 2VL1A 5IB9A 4LQGA 4HNYB 3EY5A 3QAYA 4KLVA 1VKCA 4M6GA 3WT4A 4CGMA 1QSTA 4RI1A 2ARHA 2F7VA 1BO4A 4KSFA 2JEVA 4CAXA 4QBJA 1F57A 3A9LA 5AG7A 3D68A 5K8NA 4WJBA 2YNDA 3KR5A 3RNZA 3D7GA 2ANPA 4FAIA 2ODFA 2ZEGA 3VWEA 4KOSA 1TF9A 2YGWA 1QSOA 4AB7A 2R1IA 3SI2A 1CX8A 3DLJA 4X3RA 2Q4ZA 2ZPAA 3HUVA 1TKHA 2G9DA 4BBHA 2V77A 2YNCC 3CXQA 1BLLE 1K4JA 3KQXA 3GIUA 3PP9A 2ZXVA 3ISXA 3SHPA 2GIVA 2Z10A 1AMPA 2HV2A 2JLMA 4UA3A 1FNOA 2O28A 3P2HA 3PBEA 2D4PA 1UWYA 4H89A 3IEHA 4RN7A 2B3VA 3LWUA 1QSRA 3R9EA 2XEFA 2QECA 2J8NA 4M6HA 3IJ3A 4MXUA 4NJRA 2ZOFA 2Q7BA 5BWAB 1YVOA 4BINA 2CTBA 3GKRA 3KL9A 3GUXA 1YW4A 2PJ4A 3DSBA 3B2YA 2EK9A 2AFXA 3F8KA 3JRUA 4P4BA 1AUGA 4E0AA 4H6UA 3DR8A 4CRZB 4MFKA 2CY2A 2PRQA 2VZYA 2HB6A 4FD5A 4B5PA 4KLWA 4M85A 5DWNA 3W91A 1ON0A 4R9MA 1RXTA 2PJAA 2GE3A 1IU8A 1KUXA 3PFEA 5D8NA 2OOTA 4MBUA 2Z3NA 1IGBA 1MJAA 4NSQA 2FT0A 5ELYA 5THWA 3W6XA 4G1PA 4B6ZA 2EUIA 5G22A 1CP6A 6CPAA 4B10A 1BOBA 3FRMA 3OWCA 3GB0A 2DEAA 3TOAA 3H4QA 4KVOE 1PU9A 4UBRA 3IIBA 4C2XA 3L2NA 4GS4A 4MCRA 4YRHA 2NMTA 2PJBA 1PYTB 5J8CA 1IY7A 2JEWA 3TO7A 2K5TA 4X2TA 3KR4A 2Q43A 4II9A 1B6BA 1XFOA 1GYTA 3B3VA 3RZAA 3S9NA 3KZWA 4FBEA 3LODA 3SXNA 4KOVA 4PQAA 2FVGA 4EMEA 2I00A 4MFLA 3GYAA 4B5OA 2EBJA 2ZENA 4E2AA 4F0YA 4UIBA 1WWZA 4Z65A 2CNSA 2B3UA 1N71A 1CG2A 4A38A 2AFZA 5HVGA 2AFOA 2EO8A 2Z3PA 3S6FA 4F0XA 3P2FA 2QMLA 2ZW6A 3B3SA 3IU1A 3QB8A 4UIAA 3VWDA 5LRGA 4X8IA 1PUAA 2OZHA 2G3TA 4YFJA 4IAVA 4KVME 1B87A 3SXOA 5JM6A 3H8EA 3TCVA 4JWPA 4P4IA 4E8OA 5HMNA 5H84A 3I9SA 2Z3OA 5JGFA 1WK4A 2Q51A 1IIDA 3B3TA 2RFHA 3D4UA 2REFA 1XE4A 4ZYQA 2PSWA 4OIWA 4NCZA 3FEEA 1DTDA 4CAWA 4FD6A 2ZEMA 2B4DB 2ZELA 4Q38A 2Q4VA 3KGQA 4Y49C 1XF8A 8CPAA 1Y0YA 1XBUA 1Z5RA 2WSAA 5A28A 2JDDA 2PIZA 4ZX9A 4NGNA 4A39A 4R8FA 1LOKA 1J4JA 4Q36A 5AG5A 4CAVA 1PCAA 2DPTA 3FH4A 1ELMP 3G3SA 1MJBA 2QVPA 3PRTA 4ZY0A 2VBQA 2BUEA 4NFRA 2WUUA 4LX9A 2CNTA 5CNPA 4DNCA 4W9YA 5DWMA 2NYQA 3SJFA 4AVCA 4CYOA 2YNEA 2PJ6A 3T8WA 1AYEA 4KZTA 1NE9A 4ZI6A 4KUAA 4U9ZA 2O53A 1R3NA 3CDXA 3SJGA 3WC7A 2XEJA 5D29A 1UFHA 2GLFA 5LYDA 3B8GA 2DPSA 1TF8A 1KUYA 4P4JA 3BXMA 1R43A 4L8AA 3CXSA 5G21A 2PJCA 5H86A 4NF1A 2B5GA 5LRJA 2IL4A 2A4NA 3R1KA 3IWWA 4B11A 1Z8LA 4C7HA 5JQ4A 4CGOA 2R98A 3ZJ0A 3V38A 5LYFA 2OB0A 3ISZA 3BJ7A 2JBKA 2P6GA 3I1UA 1LCPA 4QB9A 1KWMA 4Y49B 4KOWA 3TX8A 2Z3MA 3D2MA 3FVLA 3GLJA 1S3ZA 1Y9KA 3NA6A 3W6SA 4ONWA 3B3WA 3H5ZA 4PK3A 4ZX8A 3S6HA 4QVTA 4JXQA 5HVHA 1I12A 2IMOA 1CM0A 3S6KA 1EE3P 2BCOA 1M1DA 4ZY1A 2GLJA 2EVNA 4Q7AA 1GHEA 1LFWA 1LAMA 5HVFA 4LUAA 3SJEA 4UEZA 4JXRA 4NGTA 5IX3A 4A33A 5KTCA 4OC1A 4B12A 3R9FA 1S60A 4FD4A 4KOUA 1YGHA 4UEEA 3DGVA 5F09A 1P4NA 1Q2CA 4U9YA 5K8OA 2PR1A 3V7ZA 3FX6A 5AGEA 1ZG9A 3TOBA 3NE8A 2WPWA 1ZO0A 1Z4EA 3PGPA 4UWJA 2PRBA 4JLYA 1TKFA 4XPDB 3S6GA 2PQ8A 2FSRA 2OR4A 3B3CA 4K3NA 4JYWA 3IWEA 1HEEA 2G3AA 1ELLP 2G0BA 4OAEA 3TTHA 1H8LA 2BL1A 3FYNA 3D7FA 4ZY2A 2J9AA 2ZOGA 5F46A 3IFEA 3D67A 1OBRA 4H2KA 4JZ0A 4A2ZA 1YREA 1VGYA 4UCMA 4HPSA 2PVWA 1JWQA 2PJ5A 1TIQA 4XPDC 5CPAA 2J8MA 5F49A 2VI7A 4MY0A 4R3KA 4OMEA 2OU2A 1M4GA 5KTAA 1VHOA 4C2YA 3VH9A 2Q7SA 3R96A 5J8FA 3CZXA 2ZEEA 2DXQA 3K9TA 1ZG7A 1M4DA 2V8VA 4P45A 4UEFA 1BPMA 4AVBA 4B5PB 4H6ZA 1I1DA 4R3LA 3NH8A 3CXPA 4IHMA 4B14A 3MN8A 4MCPA 4TNUA 1LANA 2PCUA 1S7FA 2F5IA 2R8VA 4R87A 4MHNA 1YLEA 2CF4A 2R7HA 1BPNA 1IOIA 4CGNA 4CGPA 4CS0B 1HDUA 2PR8A 4YU9A 3ZZIA 2Q04A 5K8PA 3S9LA 3C26A 3JVNA 4MHPA 4PXCA 2BSWA 3QNVA 2HC9A 1OZPA 2D4OA 2EK8A 2PJ2A 4UFXA 4OLLA 3RYOA 3SI0A 2PJ1A 5CBMA 4OC0A 1YSJA 3DR6A 3K9UA 1BAVA 3BI0A 4MHZA 4R57A 5DS0A 3WABA 4AXVA 2C6GA 3MGDA 4NGMA 4NGRA 5C82A 5C88A 1VHEA 4I49A 1ARMA 4KOTA 2H5MA 4UFWA 2O4HA 3FEDA 3KASA 4C7IA 4PV6A 1NSLA 4MY3A 5A27A 2OH1A 1ARLA 4UF4A 4NGSA 1SQHA 1XMBA 5EBVA 1VIXA 4B13A 1Y7RA 2XEGA 2P6FA 4J3GA 2KCWA 2PJ3A 3JUWA 4GM5A 1XOVA 1YVKA 5JH9A 1MK4A 3D66A 2C1CA 2PIYA 3FIXA 1IICA 2ATRA 3TE4A 2VZZA 1IOFA 2AFUA 1YQEA 1XEBA 4OKOA 1Z8TA 4CGLA 4NGQA 4F8ZA 4F6AA 4RUHA 4XPLA 3VATA 1L0CA 1M4LA 1RTQA 4MMOA 4U5YA 2Y0MA 4GXHA 3N5FA 3KKWA 1Y7EA 4P4EA 1P0HA 2V8DA 2C6CA 1V0CA 3H8FA 2HUZA 4MHYA 4MJ8A 4C68A 4KSAA 4AVAA 1LAPA 2PJ0A 1CJWA 1ZLHA 2J8RA 1Z9UA 3B35A 3LD2A 3N7ZA 3VARA 1CBXA 3E0KA 2C27A 3BHXA 3IU2A 1I21A 1IYKA 1KUVA 3PB7X 4IUSA 5EC4A 2HQYA 4PXBA 1Q2DA 3EXNA 4XPKA 3TO9A 3NH4A 3IO1A 1QSMA 1MJ9A 4F9UA 1IYLA 3PB9X 4UCNA 4DYOA 2B4DA 2ZEDA 4IF5A 4P6YA 4DJLA 2FL4A 2EWBA 5G1ZA 1TKJA 5F47A 5HH1A 2ZEOA 2AFMA 4R76A 2REEA 1A2ZA 1DE4C 4ZGYB 2ZW4A 2PJ8A 2B4BA 2ZEPA 3PB8X 4HNXB 3BLNA 4JJXA 1M4IA 4PXDA 2QJ8A 2ABZA 4MI4A 5JPHA 5K8MA 2PE3A 2RC4A 3FNCA 4KSIA 4NGPA 3FMCA 1NSAA 1YX0A 4ONUA 2FIAA 4JD6A 4X5KA 4EVYA 2VEZA 1XIXA 1JQGA 3KQZA 2RB7A 3RBUA 2BOAA 2JBJA 4PSWA 1U6MA 1Z8WA 4O23A 3R95A 4EWTA 3WC5A 4R6TA 4XNHB 1Y0RA 4M3SA 4R7MA 4RS2A 3TO6A 2FIWA 3KHXA 2GFQA 4HKFA 1IB1E 4P44A 1YMEA 1ZLIA 1S7KA 4HNWB 4KORA 4PPZA 4NJQA 4A30A 7CPAA 3BJ8A 2Z0ZA 1VHSA 5KTDA 3D7HA 2WPXA 3KI9A 4ZBGA 2PJ7A 3JTKA 1QMUA 3T90A 3CPXA 4A37A 4PXEA 3UY5A 4XNHC 5J1QA 4KOYA 3FECA 3FXTA 4AG7A 3LMSA 4P10A 2YNCA 1RO5A 5LRKA 3NE7A 2GU2A 3V8IA 2Z3LA 4A95A 4EFDA 4CYNA 2CTCA 1KZFA 2CXAA 1Z2LA 2XEIA 3G8WA 4OC2A 5G20A 3CPAA 4L89A 3F0AA 4CRYB 3TFYA 3H8GA 2AE6A 2IJZA 3TT2A 2OZUA 2P6EA 1CP7A 2P0WA 4CPAA 4CYPA 3BI1A 2JDCA 2OZGA 2VXKA 4PSXA 4TWEA 1Z8XA 4FUUA 3F5BA 3EFAA 2Z3KA 3D8PA 4MFJA 4KOXA 4A31A 4BMHA 5LYIA 1X10A 2BO9A 3EO4A 3FF3A 1FY7A 2ZW7A 4MFZA 4NEXA 2AFWA 4KS9A 3D2PA 1YR0A 3WC6A 4WWVA 3RAMA 2PC1A 5EMIA 2ZEHA 2PVVA 3T9YA 1XRYA 1R57A 2PDOA 2VQYA 1S5KA 3QAHA 4PK2A 4DUKA 2B58A 2WYRA 4C2ZA 5HXDA 5I4MA 5LYLA 2PJ9A 3IGRA 1HDQA 4P4FA 3PB6X 2X7BA 4OC3A 3RO0A 4IK2A 2BEIA 2IQ6A 3FJUA 3MRUA 4K30A 2WZNA 4FWUA 4YWYA 5F48A 1Z4RA 3R9GA 4CAFA 5AG6A 2POKA 1YK3A 4F9VA 2FXFA 4UCPA 3NFZA 3SI1A 5AG4A 2FS5A 1Q7LA 3EC4A 3DNSA 2I79A 4FD7A 4MCQA 1X12A 2AFSA 1S7NA 3D7DA 3FBUA 3IC1A 4MFQA 2V8GA 3IWGA 4KVXA 1QQ9A 2GREA 3K2KA 4QUSA 3SJXA 1ZG8A 2CIJA 3PBBA 4A94A 4KUBA
chains in the Genus database with same CATH topology
2Q4YA 4QC6A 5IB0A 1XMTA 4A32A 2QIRA 5ISVA 2B5GB 3I3GA 3GY9A 2AJ6A 4AG9A 5IV0A 4NXYA 4OADA 4CYQA 2GANA 3DDDA 1QSNA 2ZW5A 1M44A 4UFVA 5GCNA 3D3SA 3PZJA 2Q0YA 1Y9WA 2FCKA 5I0CA 1LRZA 4MFPA 1Q2YA 5FVJA 1S7LA 4ORFA 2FE7A 4MHDA 1NMTA 2Q44A 5E96A 3FB3A 2Z11A 3WR7A 2CNMA 4CAEA 4UWIA 4YGOA 4HNYB 3EY5A 4KLVA 1VKCA 4CGMA 1QSTA 4RI1A 2ARHA 1BO4A 4KSFA 2JEVA 4CAXA 4QBJA 5AG7A 3A9LA 2YNDA 3VWEA 4KOSA 2YGWA 1QSOA 4AB7A 2R1IA 2ZPAA 4BBHA 2YNCC 3CXQA 1K4JA 3PP9A 2ZXVA 3SHPA 2GIVA 2Z10A 2HV2A 2JLMA 4UA3A 2O28A 3P2HA 2D4PA 4H89A 2B3VA 1QSRA 3R9EA 2QECA 2J8NA 2Q7BA 5BWAB 1YVOA 3GKRA 3DSBA 3F8KA 4E0AA 4H6UA 3DR8A 4CRZB 4MFKA 2CY2A 2VZYA 4FD5A 4B5PA 4KLWA 4M85A 5DWNA 3W91A 1ON0A 4R9MA 1RXTA 2GE3A 1KUXA 4MBUA 2Z3NA 1MJAA 4NSQA 2FT0A 3W6XA 2EUIA 5G22A 4B10A 3OWCA 1BOBA 3FRMA 3TOAA 3H4QA 4KVOE 1PU9A 4UBRA 4C2XA 4GS4A 4YRHA 2NMTA 5J8CA 3TO7A 2K5TA 4II9A 1B6BA 3LODA 3SXNA 4KOVA 2I00A 4MFLA 3GYAA 4B5OA 4F0YA 4E2AA 1WWZA 2CNSA 2B3UA 1N71A 2Z3PA 4F0XA 3S6FA 3P2FA 2QMLA 2ZW6A 3IU1A 3QB8A 3VWDA 1PUAA 2OZHA 2G3TA 4YFJA 4KVME 1B87A 3SXOA 3TCVA 4JWPA 4E8OA 5HMNA 5H84A 3I9SA 2Z3OA 1WK4A 1IIDA 2REFA 1XE4A 2PSWA 4NCZA 4CAWA 4FD6A 2B4DB 4Q38A 2Q4VA 4Y49C 1XF8A 2WSAA 5A28A 2JDDA 1J4JA 4Q36A 5AG5A 4CAVA 2DPTA 3G3SA 1MJBA 2VBQA 2BUEA 2WUUA 4LX9A 2CNTA 5CNPA 4DNCA 4AVCA 5DWMA 4CYOA 2YNEA 4KZTA 1NE9A 4KUAA 4U9ZA 1UFHA 3B8GA 2DPSA 1KUYA 5G21A 4L8AA 3CXSA 5H86A 4NF1A 2B5GA 2IL4A 2A4NA 3R1KA 4B11A 4C7HA 5JQ4A 4CGOA 2R98A 3ZJ0A 2OB0A 4Y49B 3BJ7A 4QB9A 2P6GA 4KOWA 2Z3MA 3D2MA 3W6SA 5AG4A 1S3ZA 1Y9KA 3H5ZA 4PK3A 3S6HA 4QVTA 4JXQA 1I12A 1CM0A 3S6KA 1M1DA 2EVNA 1GHEA 4LUAA 4JXRA 5KTCA 5IX3A 4A33A 4B12A 3R9FA 1S60A 4FD4A 4KOUA 1YGHA 1P4NA 1Q2CA 4U9YA 2PR1A 5AGEA 3TOBA 3PGPA 2WPWA 1ZO0A 1Z4EA 4UWJA 2PRBA 4JLYA 4XPDB 3S6GA 2PQ8A 2FSRA 3IWEA 2G3AA 2G0BA 4OAEA 3TTHA 2BL1A 3FYNA 5F46A 4A2ZA 1YREA 4UCMA 4XPDC 1TIQA 2J8MA 5F49A 2VI7A 4MY0A 4R3KA 2OU2A 1M4GA 5KTAA 4C2YA 3R96A 5J8FA 2DXQA 1M4DA 4B5PB 4AVBA 4H6ZA 1I1DA 4R3LA 3CXPA 4B14A 1S7FA 2F5IA 2R8VA 4R87A 1YLEA 2R7HA 4CGNA 4CGPA 4CS0B 2PR8A 3ZZIA 2Q04A 3C26A 3JVNA 2BSWA 1OZPA 2D4OA 3RYOA 4UFXA 4OLLA 4R57A 3DR6A 3K9UA 3MGDA 5C82A 5C88A 4I49A 4KOTA 2H5MA 4UFWA 4C7IA 4PV6A 1NSLA 4MY3A 5A27A 2OH1A 1SQHA 5EBVA 4B13A 1Y7RA 2P6FA 4J3GA 2KCWA 3JUWA 1YVKA 1MK4A 3FIXA 1IICA 2ATRA 3TE4A 2VZZA 1XEBA 4CGLA 4F6AA 4XPLA 1L0CA 4U5YA 2Y0MA 3KKWA 1P0HA 1V0CA 2HUZA 4MJ8A 4C68A 4KSAA 4AVAA 1CJWA 2J8RA 3LD2A 1Z9UA 3N7ZA 3E0KA 2C27A 3IU2A 1I21A 1IYKA 1KUVA 3TO9A 4IUSA 5EC4A 2HQYA 1Q2DA 3EXNA 4XPKA 1QSMA 1MJ9A 1IYLA 4UCNA 2B4DA 4IF5A 2FL4A 5G1ZA 5HH1A 5F47A 2REEA 4ZGYB 2ZW4A 2B4BA 4HNXB 4JJXA 3BLNA 1M4IA 4MI4A 5JPHA 2RC4A 3FNCA 1YX0A 4ONUA 2FIAA 4JD6A 4X5KA 4EVYA 2VEZA 1XIXA 4PSWA 1U6MA 3R95A 4XNHB 4M3SA 4RS2A 3TO6A 2FIWA 4HKFA 1IB1E 4HNWB 1S7KA 4KORA 4A30A 3BJ8A 2Z0ZA 1VHSA 5KTDA 2WPXA 4ZBGA 3JTKA 3T90A 3UY5A 4XNHC 4KOYA 4AG7A 3FXTA 2YNCA 1RO5A 3NE7A 3V8IA 2Z3LA 4A95A 4CYNA 1KZFA 2CXAA 3G8WA 5G20A 4L89A 4CRYB 3F0AA 3TFYA 2AE6A 3TT2A 2OZUA 2P6EA 2P0WA 4CYPA 2JDCA 2OZGA 2VXKA 4PSXA 3F5BA 3EFAA 2Z3KA 3D8PA 4MFJA 4KOXA 4A31A 4BMHA 3EO4A 1FY7A 4MFZA 2ZW7A 4NEXA 4KS9A 3D2PA 1YR0A 2PC1A 3T9YA 2PDOA 1R57A 2VQYA 1S5KA 3QAHA 4PK2A 2B58A 4C2ZA 3IGRA 2X7BA 2BEIA 4K30A 5F48A 1Z4RA 3R9GA 4CAFA 5AG6A 1YK3A 2FXFA 4UCPA 2FS5A 3EC4A 3DNSA 2I79A 4FD7A 1S7NA 3FBUA 4MFQA 3IWGA 4KVXA 4QUSA 4KUBA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2Q4Y A;  4QC6 A;  5IB0 A;  1XMT A;  2QIR A;  5ISV A;  2B5G B;  3I3G A;  3GY9 A;  2AJ6 A;  4AG9 A;  5IV0 A;  4NXY A;  4OAD A;  2GAN A;  3DDD A;  1QSN A;  2ZW5 A;  1M44 A;  5GCN A;  3D3S A;  3PZJ A;  2Q0Y A;  1Y9W A;  2FCK A;  5I0C A;  1LRZ A;  1Q2Y A;  5FVJ A;  1S7L A;  4ORF A;  2FE7 A;  4MHD A;  1NMT A;  2Q44 A;  5E96 A;  3FB3 A;  2Z11 A;  3WR7 A;  2CNM A;  4UWI A;  4YGO A;  4HNY B;  3EY5 A;  4KLV A;  1VKC A;  1QST A;  4RI1 A;  2ARH A;  1BO4 A;  4CAX A;  2JEV A;  4QBJ A;  3VWE A;  4KOS A;  1QSO A;  4AB7 A;  2R1I A;  2ZPA A;  3CXQ A;  1K4J A;  3PP9 A;  2ZXV A;  3SHP A;  2GIV A;  2Z10 A;  2HV2 A;  2JLM A;  4UA3 A;  2O28 A;  3P2H A;  2D4P A;  4H89 A;  2B3V A;  1QSR A;  3R9E A;  2QEC A;  2J8N A;  2Q7B A;  1YVO A;  3GKR A;  3DSB A;  3F8K A;  4E0A A;  4H6U A;  3DR8 A;  4CRZ B;  2CY2 A;  2VZY A;  4FD5 A;  4B5P A;  4KLW A;  4M85 A;  5DWN A;  3W91 A;  1ON0 A;  4R9M A;  1RXT A;  2GE3 A;  1KUX A;  4MBU A;  1MJA A;  4NSQ A;  2FT0 A;  3W6X A;  2EUI A;  3OWC A;  1BOB A;  3FRM A;  3TOA A;  3H4Q A;  4KVO E;  1PU9 A;  4UBR A;  4GS4 A;  4YRH A;  2NMT A;  5J8C A;  3TO7 A;  2K5T A;  4II9 A;  1B6B A;  3LOD A;  3SXN A;  4KOV A;  2I00 A;  3GYA A;  4B5O A;  4F0Y A;  4E2A A;  1WWZ A;  2CNS A;  2B3U A;  1N71 A;  3S6F A;  3P2F A;  2QML A;  2ZW6 A;  3QB8 A;  3VWD A;  1PUA A;  2OZH A;  2G3T A;  4YFJ A;  4KVM E;  1B87 A;  3SXO A;  3TCV A;  4JWP A;  4E8O A;  5HMN A;  5H84 A;  3I9S A;  1WK4 A;  1IID A;  2REF A;  1XE4 A;  2PSW A;  4NCZ A;  4CAW A;  4FD6 A;  2B4D B;  2Q4V A;  4Y49 C;  1XF8 A;  2JDD A;  1J4J A;  4CAV A;  3G3S A;  1MJB A;  2VBQ A;  2BUE A;  4LX9 A;  2CNT A;  5CNP A;  4DNC A;  4AVC A;  5DWM A;  4KZT A;  1NE9 A;  4KUA A;  4U9Z A;  1UFH A;  3B8G A;  1KUY A;  4L8A A;  3CXS A;  5H86 A;  4NF1 A;  2B5G A;  2IL4 A;  2A4N A;  3R1K A;  5JQ4 A;  2R98 A;  3ZJ0 A;  2OB0 A;  4Y49 B;  3BJ7 A;  4QB9 A;  2P6G A;  4KOW A;  3D2M A;  3W6S A;  1S3Z A;  1Y9K A;  4PK3 A;  3S6H A;  4QVT A;  4JXQ A;  1I12 A;  1CM0 A;  3S6K A;  1M1D A;  2EVN A;  1GHE A;  4LUA A;  4JXR A;  5KTC A;  5IX3 A;  3R9F A;  1S60 A;  4FD4 A;  4KOU A;  1YGH A;  1P4N A;  1Q2C A;  4U9Y A;  2PR1 A;  3TOB A;  3PGP A;  2WPW A;  4UWJ A;  1Z4E A;  2PRB A;  4JLY A;  4XPD B;  3S6G A;  2PQ8 A;  2FSR A;  2G3A A;  2G0B A;  4OAE A;  3TTH A;  2BL1 A;  3FYN A;  5F46 A;  1YRE A;  4XPD C;  1TIQ A;  2J8M A;  5F49 A;  2VI7 A;  4MY0 A;  4R3K A;  2OU2 A;  1M4G A;  5KTA A;  3R96 A;  5J8F A;  2DXQ A;  1M4D A;  4B5P B;  4AVB A;  4H6Z A;  1I1D A;  4R3L A;  3CXP A;  1S7F A;  2F5I A;  2R8V A;  4R87 A;  1YLE A;  2R7H A;  4CS0 B;  2PR8 A;  3ZZI A;  2Q04 A;  3C26 A;  3JVN A;  2BSW A;  1OZP A;  2D4O A;  3RYO A;  4OLL A;  4R57 A;  3DR6 A;  3K9U A;  3MGD A;  5C82 A;  5C88 A;  4I49 A;  4KOT A;  2H5M A;  4PV6 A;  1NSL A;  4MY3 A;  2OH1 A;  1SQH A;  5EBV A;  1Y7R A;  2P6F A;  4J3G A;  2KCW A;  3JUW A;  1YVK A;  1MK4 A;  3FIX A;  1IIC A;  2ATR A;  3TE4 A;  2VZZ A;  1XEB A;  4F6A A;  4XPL A;  1L0C A;  4U5Y A;  2Y0M A;  3KKW A;  1P0H A;  1V0C A;  2HUZ A;  4MJ8 A;  4AVA A;  1CJW A;  2J8R A;  3LD2 A;  1Z9U A;  3N7Z A;  3E0K A;  2C27 A;  1I21 A;  1IYK A;  1KUV A;  3TO9 A;  4IUS A;  5EC4 A;  2HQY A;  1Q2D A;  3EXN A;  4XPK A;  1QSM A;  1MJ9 A;  1IYL A;  2B4D A;  4IF5 A;  2FL4 A;  5HH1 A;  5F47 A;  2REE A;  2ZW4 A;  2B4B A;  4HNX B;  4JJX A;  3BLN A;  1M4I A;  4MI4 A;  5JPH A;  2RC4 A;  3FNC A;  1YX0 A;  4ONU A;  2FIA A;  4JD6 A;  4X5K A;  4EVY A;  2VEZ A;  1XIX A;  4PSW A;  1U6M A;  3R95 A;  4XNH B;  4M3S A;  4RS2 A;  3TO6 A;  2FIW A;  4HKF A;  1IB1 E;  4HNW B;  1S7K A;  4KOR A;  3BJ8 A;  2Z0Z A;  1VHS A;  5KTD A;  2WPX A;  4ZBG A;  3T90 A;  3UY5 A;  4XNH C;  4KOY A;  4AG7 A;  3FXT A;  1RO5 A;  3NE7 A;  3V8I A;  1KZF A;  3G8W A;  4L89 A;  4CRY B;  3F0A A;  3TFY A;  2AE6 A;  3TT2 A;  2OZU A;  2P6E A;  2P0W A;  2JDC A;  2OZG A;  2VXK A;  4PSX A;  3F5B A;  3EFA A;  3D8P A;  4KOX A;  4BMH A;  3EO4 A;  1FY7 A;  2ZW7 A;  4NEX A;  3D2P A;  1YR0 A;  2PC1 A;  3T9Y A;  2PDO A;  1R57 A;  2VQY A;  1S5K A;  3QAH A;  4PK2 A;  2B58 A;  3IGR A;  2X7B A;  2BEI A;  4K30 A;  5F48 A;  1Z4R A;  3R9G A;  1YK3 A;  2FXF A;  2FS5 A;  3EC4 A;  3DNS A;  2I79 A;  4FD7 A;  1S7N A;  3FBU A;  3IWG A;  4KVX A;  4QUS A;  4KUB A; 
#chains in the Genus database with same CATH topology
 3CT9 A;  3LAC A;  2V8H A;  2Q4Y A;  4QC6 A;  3S9M A;  5IB0 A;  1F2P A;  1XMT A;  4A32 A;  3KHZ A;  2QIR A;  2DF5 A;  1CPS A;  4MCS A;  2C6P A;  5ISV A;  2B5G B;  3I3G A;  3GY9 A;  4P4D A;  2AJ6 A;  4AG9 A;  5IV0 A;  4NXY A;  4OAD A;  3HLP A;  4OC4 A;  3B7I A;  4CYQ A;  4OID A;  2GAN A;  3DDD A;  1QSN A;  4OC5 A;  2ZW5 A;  1M44 A;  2I3C A;  4UFV A;  5GCN A;  3D3S A;  3PZJ A;  2Q0Y A;  4M6I A;  1YW6 A;  1TXR A;  4LQ6 A;  1Y9W A;  2FCK A;  1XJO A;  1F2O A;  2NSM A;  3TC8 A;  5I0C A;  1LRZ A;  4MFP A;  1Q2Y A;  1FT7 A;  5FVJ A;  4BD9 A;  1S7L A;  4ORF A;  3NH5 A;  3PFO A;  2FE7 A;  4MRI A;  4MHD A;  2F8H A;  1NMT A;  4OP4 A;  2Q44 A;  5E96 A;  3FB3 A;  2Z11 A;  2QYV A;  3PEI A;  1YLO A;  3WR7 A;  2ZEF A;  2CNM A;  1CPX A;  4CAE A;  3PB4 X;  4UWI A;  4YGO A;  2VL1 A;  5IB9 A;  4LQG A;  4HNY B;  3EY5 A;  3QAY A;  4KLV A;  1VKC A;  4M6G A;  3WT4 A;  4CGM A;  1QST A;  4RI1 A;  2ARH A;  2F7V A;  1BO4 A;  4KSF A;  2JEV A;  4CAX A;  4QBJ A;  1F57 A;  3A9L A;  5AG7 A;  3D68 A;  5K8N A;  4WJB A;  2YND A;  3KR5 A;  3RNZ A;  3D7G A;  2ANP A;  4FAI A;  2ODF A;  2ZEG A;  3VWE A;  4KOS A;  1TF9 A;  2YGW A;  1QSO A;  4AB7 A;  2R1I A;  3SI2 A;  1CX8 A;  3DLJ A;  4X3R A;  2Q4Z A;  2ZPA A;  3HUV A;  1TKH A;  2G9D A;  4BBH A;  2V77 A;  2YNC C;  3CXQ A;  1BLL E;  1K4J A;  3KQX A;  3GIU A;  3PP9 A;  2ZXV A;  3ISX A;  3SHP A;  2GIV A;  2Z10 A;  1AMP A;  2HV2 A;  2JLM A;  4UA3 A;  1FNO A;  2O28 A;  3P2H A;  3PBE A;  2D4P A;  1UWY A;  4H89 A;  3IEH A;  4RN7 A;  2B3V A;  3LWU A;  1QSR A;  3R9E A;  2XEF A;  2QEC A;  2J8N A;  4M6H A;  3IJ3 A;  4MXU A;  4NJR A;  2ZOF A;  2Q7B A;  5BWA B;  1YVO A;  4BIN A;  2CTB A;  3GKR A;  3KL9 A;  3GUX A;  1YW4 A;  2PJ4 A;  3DSB A;  3B2Y A;  2EK9 A;  2AFX A;  3F8K A;  3JRU A;  4P4B A;  1AUG A;  4E0A A;  4H6U A;  3DR8 A;  4CRZ B;  4MFK A;  2CY2 A;  2PRQ A;  2VZY A;  2HB6 A;  4FD5 A;  4B5P A;  4KLW A;  4M85 A;  5DWN A;  3W91 A;  1ON0 A;  4R9M A;  1RXT A;  2PJA A;  2GE3 A;  1IU8 A;  1KUX A;  3PFE A;  5D8N A;  2OOT A;  4MBU A;  2Z3N A;  1IGB A;  1MJA A;  4NSQ A;  2FT0 A;  5ELY A;  5THW A;  3W6X A;  4G1P A;  4B6Z A;  2EUI A;  5G22 A;  1CP6 A;  6CPA A;  4B10 A;  1BOB A;  3FRM A;  3OWC A;  3GB0 A;  2DEA A;  3TOA A;  3H4Q A;  4KVO E;  1PU9 A;  4UBR A;  3IIB A;  4C2X A;  3L2N A;  4GS4 A;  4MCR A;  4YRH A;  2NMT A;  2PJB A;  1PYT B;  5J8C A;  1IY7 A;  2JEW A;  3TO7 A;  2K5T A;  4X2T A;  3KR4 A;  2Q43 A;  4II9 A;  1B6B A;  1XFO A;  1GYT A;  3B3V A;  3RZA A;  3S9N A;  3KZW A;  4FBE A;  3LOD A;  3SXN A;  4KOV A;  4PQA A;  2FVG A;  4EME A;  2I00 A;  4MFL A;  3GYA A;  4B5O A;  2EBJ A;  2ZEN A;  4E2A A;  4F0Y A;  4UIB A;  1WWZ A;  4Z65 A;  2CNS A;  2B3U A;  1N71 A;  1CG2 A;  4A38 A;  2AFZ A;  5HVG A;  2AFO A;  2EO8 A;  2Z3P A;  3S6F A;  4F0X A;  3P2F A;  2QML A;  2ZW6 A;  3B3S A;  3IU1 A;  3QB8 A;  4UIA A;  3VWD A;  5LRG A;  4X8I A;  1PUA A;  2OZH A;  2G3T A;  4YFJ A;  4IAV A;  4KVM E;  1B87 A;  3SXO A;  5JM6 A;  3H8E A;  3TCV A;  4JWP A;  4P4I A;  4E8O A;  5HMN A;  5H84 A;  3I9S A;  2Z3O A;  5JGF A;  1WK4 A;  2Q51 A;  1IID A;  3B3T A;  2RFH A;  3D4U A;  2REF A;  1XE4 A;  4ZYQ A;  2PSW A;  4OIW A;  4NCZ A;  3FEE A;  1DTD A;  4CAW A;  4FD6 A;  2ZEM A;  2B4D B;  2ZEL A;  4Q38 A;  2Q4V A;  3KGQ A;  4Y49 C;  1XF8 A;  8CPA A;  1Y0Y A;  1XBU A;  1Z5R A;  2WSA A;  5A28 A;  2JDD A;  2PIZ A;  4ZX9 A;  4NGN A;  4A39 A;  4R8F A;  1LOK A;  1J4J A;  4Q36 A;  5AG5 A;  4CAV A;  1PCA A;  2DPT A;  3FH4 A;  1ELM P;  3G3S A;  1MJB A;  2QVP A;  3PRT A;  4ZY0 A;  2VBQ A;  2BUE A;  4NFR A;  2WUU A;  4LX9 A;  2CNT A;  5CNP A;  4DNC A;  4W9Y A;  5DWM A;  2NYQ A;  3SJF A;  4AVC A;  4CYO A;  2YNE A;  2PJ6 A;  3T8W A;  1AYE A;  4KZT A;  1NE9 A;  4ZI6 A;  4KUA A;  4U9Z A;  2O53 A;  1R3N A;  3CDX A;  3SJG A;  3WC7 A;  2XEJ A;  5D29 A;  1UFH A;  2GLF A;  5LYD A;  3B8G A;  2DPS A;  1TF8 A;  1KUY A;  4P4J A;  3BXM A;  1R43 A;  4L8A A;  3CXS A;  5G21 A;  2PJC A;  5H86 A;  4NF1 A;  2B5G A;  5LRJ A;  2IL4 A;  2A4N A;  3R1K A;  3IWW A;  4B11 A;  1Z8L A;  4C7H A;  5JQ4 A;  4CGO A;  2R98 A;  3ZJ0 A;  3V38 A;  5LYF A;  2OB0 A;  3ISZ A;  3BJ7 A;  2JBK A;  2P6G A;  3I1U A;  1LCP A;  4QB9 A;  1KWM A;  4Y49 B;  4KOW A;  3TX8 A;  2Z3M A;  3D2M A;  3FVL A;  3GLJ A;  1S3Z A;  1Y9K A;  3NA6 A;  3W6S A;  4ONW A;  3B3W A;  3H5Z A;  4PK3 A;  4ZX8 A;  3S6H A;  4QVT A;  4JXQ A;  5HVH A;  1I12 A;  2IMO A;  1CM0 A;  3S6K A;  1EE3 P;  2BCO A;  1M1D A;  4ZY1 A;  2GLJ A;  2EVN A;  4Q7A A;  1GHE A;  1LFW A;  1LAM A;  5HVF A;  4LUA A;  3SJE A;  4UEZ A;  4JXR A;  4NGT A;  5IX3 A;  4A33 A;  5KTC A;  4OC1 A;  4B12 A;  3R9F A;  1S60 A;  4FD4 A;  4KOU A;  1YGH A;  4UEE A;  3DGV A;  5F09 A;  1P4N A;  1Q2C A;  4U9Y A;  5K8O A;  2PR1 A;  3V7Z A;  3FX6 A;  5AGE A;  1ZG9 A;  3TOB A;  3NE8 A;  2WPW A;  1ZO0 A;  1Z4E A;  3PGP A;  4UWJ A;  2PRB A;  4JLY A;  1TKF A;  4XPD B;  3S6G A;  2PQ8 A;  2FSR A;  2OR4 A;  3B3C A;  4K3N A;  4JYW A;  3IWE A;  1HEE A;  2G3A A;  1ELL P;  2G0B A;  4OAE A;  3TTH A;  1H8L A;  2BL1 A;  3FYN A;  3D7F A;  4ZY2 A;  2J9A A;  2ZOG A;  5F46 A;  3IFE A;  3D67 A;  1OBR A;  4H2K A;  4JZ0 A;  4A2Z A;  1YRE A;  1VGY A;  4UCM A;  4HPS A;  2PVW A;  1JWQ A;  2PJ5 A;  1TIQ A;  4XPD C;  5CPA A;  2J8M A;  5F49 A;  2VI7 A;  4MY0 A;  4R3K A;  4OME A;  2OU2 A;  1M4G A;  5KTA A;  1VHO A;  4C2Y A;  3VH9 A;  2Q7S A;  3R96 A;  5J8F A;  3CZX A;  2ZEE A;  2DXQ A;  3K9T A;  1ZG7 A;  1M4D A;  2V8V A;  4P45 A;  4UEF A;  1BPM A;  4AVB A;  4B5P B;  4H6Z A;  1I1D A;  4R3L A;  3NH8 A;  3CXP A;  4IHM A;  4B14 A;  3MN8 A;  4MCP A;  4TNU A;  1LAN A;  2PCU A;  1S7F A;  2F5I A;  2R8V A;  4R87 A;  4MHN A;  1YLE A;  2CF4 A;  2R7H A;  1BPN A;  1IOI A;  4CGN A;  4CGP A;  4CS0 B;  1HDU A;  2PR8 A;  4YU9 A;  3ZZI A;  2Q04 A;  5K8P A;  3S9L A;  3C26 A;  3JVN A;  4MHP A;  4PXC A;  2BSW A;  3QNV A;  2HC9 A;  1OZP A;  2D4O A;  2EK8 A;  2PJ2 A;  4UFX A;  4OLL A;  3RYO A;  3SI0 A;  2PJ1 A;  5CBM A;  4OC0 A;  1YSJ A;  3DR6 A;  3K9U A;  1BAV A;  3BI0 A;  4MHZ A;  4R57 A;  5DS0 A;  3WAB A;  4AXV A;  2C6G A;  3MGD A;  4NGM A;  4NGR A;  5C82 A;  5C88 A;  1VHE A;  4I49 A;  1ARM A;  4KOT A;  2H5M A;  4UFW A;  2O4H A;  3FED A;  3KAS A;  4C7I A;  4PV6 A;  1NSL A;  4MY3 A;  5A27 A;  2OH1 A;  1ARL A;  4UF4 A;  4NGS A;  1SQH A;  1XMB A;  5EBV A;  1VIX A;  4B13 A;  1Y7R A;  2XEG A;  2P6F A;  4J3G A;  2KCW A;  2PJ3 A;  3JUW A;  4GM5 A;  1XOV A;  1YVK A;  5JH9 A;  1MK4 A;  3D66 A;  2C1C A;  2PIY A;  3FIX A;  1IIC A;  2ATR A;  3TE4 A;  2VZZ A;  1IOF A;  2AFU A;  1YQE A;  1XEB A;  4OKO A;  1Z8T A;  4CGL A;  4NGQ A;  4F8Z A;  4F6A A;  4RUH A;  4XPL A;  3VAT A;  1L0C A;  1M4L A;  1RTQ A;  4MMO A;  4U5Y A;  2Y0M A;  4GXH A;  3N5F A;  3KKW A;  1Y7E A;  4P4E A;  1P0H A;  2V8D A;  2C6C A;  1V0C A;  3H8F A;  2HUZ A;  4MHY A;  4MJ8 A;  4C68 A;  4KSA A;  4AVA A;  1LAP A;  2PJ0 A;  1CJW A;  1ZLH A;  2J8R A;  1Z9U A;  3B35 A;  3LD2 A;  3N7Z A;  3VAR A;  1CBX A;  3E0K A;  2C27 A;  3BHX A;  3IU2 A;  1I21 A;  1IYK A;  1KUV A;  3PB7 X;  4IUS A;  5EC4 A;  2HQY A;  4PXB A;  1Q2D A;  3EXN A;  4XPK A;  3TO9 A;  3NH4 A;  3IO1 A;  1QSM A;  1MJ9 A;  4F9U A;  1IYL A;  3PB9 X;  4UCN A;  4DYO A;  2B4D A;  2ZED A;  4IF5 A;  4P6Y A;  4DJL A;  2FL4 A;  2EWB A;  5G1Z A;  1TKJ A;  5F47 A;  5HH1 A;  2ZEO A;  2AFM A;  4R76 A;  2REE A;  1A2Z A;  1DE4 C;  4ZGY B;  2ZW4 A;  2PJ8 A;  2B4B A;  2ZEP A;  3PB8 X;  4HNX B;  3BLN A;  4JJX A;  1M4I A;  4PXD A;  2QJ8 A;  2ABZ A;  4MI4 A;  5JPH A;  5K8M A;  2PE3 A;  2RC4 A;  3FNC A;  4KSI A;  4NGP A;  3FMC A;  1NSA A;  1YX0 A;  4ONU A;  2FIA A;  4JD6 A;  4X5K A;  4EVY A;  2VEZ A;  1XIX A;  1JQG A;  3KQZ A;  2RB7 A;  3RBU A;  2BOA A;  2JBJ A;  4PSW A;  1U6M A;  1Z8W A;  4O23 A;  3R95 A;  4EWT A;  3WC5 A;  4R6T A;  4XNH B;  1Y0R A;  4M3S A;  4R7M A;  4RS2 A;  3TO6 A;  2FIW A;  3KHX A;  2GFQ A;  4HKF A;  1IB1 E;  4P44 A;  1YME A;  1ZLI A;  1S7K A;  4HNW B;  4KOR A;  4PPZ A;  4NJQ A;  4A30 A;  7CPA A;  3BJ8 A;  2Z0Z A;  1VHS A;  5KTD A;  3D7H A;  2WPX A;  3KI9 A;  4ZBG A;  2PJ7 A;  3JTK A;  1QMU A;  3T90 A;  3CPX A;  4A37 A;  4PXE A;  3UY5 A;  4XNH C;  5J1Q A;  4KOY A;  3FEC A;  3FXT A;  4AG7 A;  3LMS A;  4P10 A;  2YNC A;  1RO5 A;  5LRK A;  3NE7 A;  2GU2 A;  3V8I A;  2Z3L A;  4A95 A;  4EFD A;  4CYN A;  2CTC A;  1KZF A;  2CXA A;  1Z2L A;  2XEI A;  3G8W A;  4OC2 A;  5G20 A;  3CPA A;  4L89 A;  3F0A A;  4CRY B;  3TFY A;  3H8G A;  2AE6 A;  2IJZ A;  3TT2 A;  2OZU A;  2P6E A;  1CP7 A;  2P0W A;  4CPA A;  4CYP A;  3BI1 A;  2JDC A;  2OZG A;  2VXK A;  4PSX A;  4TWE A;  1Z8X A;  4FUU A;  3F5B A;  3EFA A;  2Z3K A;  3D8P A;  4MFJ A;  4KOX A;  4A31 A;  4BMH A;  5LYI A;  1X10 A;  2BO9 A;  3EO4 A;  3FF3 A;  1FY7 A;  2ZW7 A;  4MFZ A;  4NEX A;  2AFW A;  4KS9 A;  3D2P A;  1YR0 A;  3WC6 A;  4WWV A;  3RAM A;  2PC1 A;  5EMI A;  2ZEH A;  2PVV A;  3T9Y A;  1XRY A;  1R57 A;  2PDO A;  2VQY A;  1S5K A;  3QAH A;  4PK2 A;  4DUK A;  2B58 A;  2WYR A;  4C2Z A;  5HXD A;  5I4M A;  5LYL A;  2PJ9 A;  3IGR A;  1HDQ A;  4P4F A;  3PB6 X;  2X7B A;  4OC3 A;  3RO0 A;  4IK2 A;  2BEI A;  2IQ6 A;  3FJU A;  3MRU A;  4K30 A;  2WZN A;  4FWU A;  4YWY A;  5F48 A;  1Z4R A;  3R9G A;  4CAF A;  5AG6 A;  2POK A;  1YK3 A;  4F9V A;  2FXF A;  4UCP A;  3NFZ A;  3SI1 A;  5AG4 A;  2FS5 A;  1Q7L A;  3EC4 A;  3DNS A;  2I79 A;  4FD7 A;  4MCQ A;  1X12 A;  2AFS A;  1S7N A;  3D7D A;  3FBU A;  3IC1 A;  4MFQ A;  2V8G A;  3IWG A;  4KVX A;  1QQ9 A;  2GRE A;  3K2K A;  4QUS A;  3SJX A;  1ZG8 A;  2CIJ A;  3PBB A;  4A94 A;  4KUB A; 
#chains in the Genus database with same CATH homology
 2Q4Y A;  4QC6 A;  5IB0 A;  1XMT A;  4A32 A;  2QIR A;  5ISV A;  2B5G B;  3I3G A;  3GY9 A;  2AJ6 A;  4AG9 A;  5IV0 A;  4NXY A;  4OAD A;  4CYQ A;  2GAN A;  3DDD A;  1QSN A;  2ZW5 A;  1M44 A;  4UFV A;  5GCN A;  3D3S A;  3PZJ A;  2Q0Y A;  1Y9W A;  2FCK A;  5I0C A;  1LRZ A;  4MFP A;  1Q2Y A;  5FVJ A;  1S7L A;  4ORF A;  2FE7 A;  4MHD A;  1NMT A;  2Q44 A;  5E96 A;  3FB3 A;  2Z11 A;  3WR7 A;  2CNM A;  4CAE A;  4UWI A;  4YGO A;  4HNY B;  3EY5 A;  4KLV A;  1VKC A;  4CGM A;  1QST A;  4RI1 A;  2ARH A;  1BO4 A;  4KSF A;  2JEV A;  4CAX A;  4QBJ A;  5AG7 A;  3A9L A;  2YND A;  3VWE A;  4KOS A;  2YGW A;  1QSO A;  4AB7 A;  2R1I A;  2ZPA A;  4BBH A;  2YNC C;  3CXQ A;  1K4J A;  3PP9 A;  2ZXV A;  3SHP A;  2GIV A;  2Z10 A;  2HV2 A;  2JLM A;  4UA3 A;  2O28 A;  3P2H A;  2D4P A;  4H89 A;  2B3V A;  1QSR A;  3R9E A;  2QEC A;  2J8N A;  2Q7B A;  5BWA B;  1YVO A;  3GKR A;  3DSB A;  3F8K A;  4E0A A;  4H6U A;  3DR8 A;  4CRZ B;  4MFK A;  2CY2 A;  2VZY A;  4FD5 A;  4B5P A;  4KLW A;  4M85 A;  5DWN A;  3W91 A;  1ON0 A;  4R9M A;  1RXT A;  2GE3 A;  1KUX A;  4MBU A;  2Z3N A;  1MJA A;  4NSQ A;  2FT0 A;  3W6X A;  2EUI A;  5G22 A;  4B10 A;  3OWC A;  1BOB A;  3FRM A;  3TOA A;  3H4Q A;  4KVO E;  1PU9 A;  4UBR A;  4C2X A;  4GS4 A;  4YRH A;  2NMT A;  5J8C A;  3TO7 A;  2K5T A;  4II9 A;  1B6B A;  3LOD A;  3SXN A;  4KOV A;  2I00 A;  4MFL A;  3GYA A;  4B5O A;  4F0Y A;  4E2A A;  1WWZ A;  2CNS A;  2B3U A;  1N71 A;  2Z3P A;  4F0X A;  3S6F A;  3P2F A;  2QML A;  2ZW6 A;  3IU1 A;  3QB8 A;  3VWD A;  1PUA A;  2OZH A;  2G3T A;  4YFJ A;  4KVM E;  1B87 A;  3SXO A;  3TCV A;  4JWP A;  4E8O A;  5HMN A;  5H84 A;  3I9S A;  2Z3O A;  1WK4 A;  1IID A;  2REF A;  1XE4 A;  2PSW A;  4NCZ A;  4CAW A;  4FD6 A;  2B4D B;  4Q38 A;  2Q4V A;  4Y49 C;  1XF8 A;  2WSA A;  5A28 A;  2JDD A;  1J4J A;  4Q36 A;  5AG5 A;  4CAV A;  2DPT A;  3G3S A;  1MJB A;  2VBQ A;  2BUE A;  2WUU A;  4LX9 A;  2CNT A;  5CNP A;  4DNC A;  4AVC A;  5DWM A;  4CYO A;  2YNE A;  4KZT A;  1NE9 A;  4KUA A;  4U9Z A;  1UFH A;  3B8G A;  2DPS A;  1KUY A;  5G21 A;  4L8A A;  3CXS A;  5H86 A;  4NF1 A;  2B5G A;  2IL4 A;  2A4N A;  3R1K A;  4B11 A;  4C7H A;  5JQ4 A;  4CGO A;  2R98 A;  3ZJ0 A;  2OB0 A;  4Y49 B;  3BJ7 A;  4QB9 A;  2P6G A;  4KOW A;  2Z3M A;  3D2M A;  3W6S A;  5AG4 A;  1S3Z A;  1Y9K A;  3H5Z A;  4PK3 A;  3S6H A;  4QVT A;  4JXQ A;  1I12 A;  1CM0 A;  3S6K A;  1M1D A;  2EVN A;  1GHE A;  4LUA A;  4JXR A;  5KTC A;  5IX3 A;  4A33 A;  4B12 A;  3R9F A;  1S60 A;  4FD4 A;  4KOU A;  1YGH A;  1P4N A;  1Q2C A;  4U9Y A;  2PR1 A;  5AGE A;  3TOB A;  3PGP A;  2WPW A;  1ZO0 A;  1Z4E A;  4UWJ A;  2PRB A;  4JLY A;  4XPD B;  3S6G A;  2PQ8 A;  2FSR A;  3IWE A;  2G3A A;  2G0B A;  4OAE A;  3TTH A;  2BL1 A;  3FYN A;  5F46 A;  4A2Z A;  1YRE A;  4UCM A;  4XPD C;  1TIQ A;  2J8M A;  5F49 A;  2VI7 A;  4MY0 A;  4R3K A;  2OU2 A;  1M4G A;  5KTA A;  4C2Y A;  3R96 A;  5J8F A;  2DXQ A;  1M4D A;  4B5P B;  4AVB A;  4H6Z A;  1I1D A;  4R3L A;  3CXP A;  4B14 A;  1S7F A;  2F5I A;  2R8V A;  4R87 A;  1YLE A;  2R7H A;  4CGN A;  4CGP A;  4CS0 B;  2PR8 A;  3ZZI A;  2Q04 A;  3C26 A;  3JVN A;  2BSW A;  1OZP A;  2D4O A;  3RYO A;  4UFX A;  4OLL A;  4R57 A;  3DR6 A;  3K9U A;  3MGD A;  5C82 A;  5C88 A;  4I49 A;  4KOT A;  2H5M A;  4UFW A;  4C7I A;  4PV6 A;  1NSL A;  4MY3 A;  5A27 A;  2OH1 A;  1SQH A;  5EBV A;  4B13 A;  1Y7R A;  2P6F A;  4J3G A;  2KCW A;  3JUW A;  1YVK A;  1MK4 A;  3FIX A;  1IIC A;  2ATR A;  3TE4 A;  2VZZ A;  1XEB A;  4CGL A;  4F6A A;  4XPL A;  1L0C A;  4U5Y A;  2Y0M A;  3KKW A;  1P0H A;  1V0C A;  2HUZ A;  4MJ8 A;  4C68 A;  4KSA A;  4AVA A;  1CJW A;  2J8R A;  3LD2 A;  1Z9U A;  3N7Z A;  3E0K A;  2C27 A;  3IU2 A;  1I21 A;  1IYK A;  1KUV A;  3TO9 A;  4IUS A;  5EC4 A;  2HQY A;  1Q2D A;  3EXN A;  4XPK A;  1QSM A;  1MJ9 A;  1IYL A;  4UCN A;  2B4D A;  4IF5 A;  2FL4 A;  5G1Z A;  5HH1 A;  5F47 A;  2REE A;  4ZGY B;  2ZW4 A;  2B4B A;  4HNX B;  4JJX A;  3BLN A;  1M4I A;  4MI4 A;  5JPH A;  2RC4 A;  3FNC A;  1YX0 A;  4ONU A;  2FIA A;  4JD6 A;  4X5K A;  4EVY A;  2VEZ A;  1XIX A;  4PSW A;  1U6M A;  3R95 A;  4XNH B;  4M3S A;  4RS2 A;  3TO6 A;  2FIW A;  4HKF A;  1IB1 E;  4HNW B;  1S7K A;  4KOR A;  4A30 A;  3BJ8 A;  2Z0Z A;  1VHS A;  5KTD A;  2WPX A;  4ZBG A;  3JTK A;  3T90 A;  3UY5 A;  4XNH C;  4KOY A;  4AG7 A;  3FXT A;  2YNC A;  1RO5 A;  3NE7 A;  3V8I A;  2Z3L A;  4A95 A;  4CYN A;  1KZF A;  2CXA A;  3G8W A;  5G20 A;  4L89 A;  4CRY B;  3F0A A;  3TFY A;  2AE6 A;  3TT2 A;  2OZU A;  2P6E A;  2P0W A;  4CYP A;  2JDC A;  2OZG A;  2VXK A;  4PSX A;  3F5B A;  3EFA A;  2Z3K A;  3D8P A;  4MFJ A;  4KOX A;  4A31 A;  4BMH A;  3EO4 A;  1FY7 A;  4MFZ A;  2ZW7 A;  4NEX A;  4KS9 A;  3D2P A;  1YR0 A;  2PC1 A;  3T9Y A;  2PDO A;  1R57 A;  2VQY A;  1S5K A;  3QAH A;  4PK2 A;  2B58 A;  4C2Z A;  3IGR A;  2X7B A;  2BEI A;  4K30 A;  5F48 A;  1Z4R A;  3R9G A;  4CAF A;  5AG6 A;  1YK3 A;  2FXF A;  4UCP A;  2FS5 A;  3EC4 A;  3DNS A;  2I79 A;  4FD7 A;  1S7N A;  3FBU A;  4MFQ A;  3IWG A;  4KVX A;  4QUS A;  4KUB A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...