3SHPA

Crystal structure of putative acetyltransferase from sphaerobacter thermophilus dsm 20745
Total Genus 40
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
40
sequence length
168
structure length
168
Chain Sequence
b'MQAVYLTGPTVYLRAMVEDDKHHAAAWFDSRFPVNAARAEAFLKEKLQGDPWDARWHLLAIVRRSDEAVVGSCRIEFGKQTASLRFHMAPWLDDADVLRAEALELVVPWLRDEHELLVITVEIAADEQRTLAAAEAAGLKAAVRMREAIARAGHRVDLLIYQAVDPKV'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Putative acetyltransferase Sthe_0691
publication title Crystal structure of putative acetyltransferase from Sphaerobacter thermophilus DSM 20745
rcsb
source organism Sphaerobacter thermophilus
molecule tags Transferase
total genus 40
structure length 168
sequence length 168
chains with identical sequence B
ec nomenclature
pdb deposition date 2011-06-16
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.630.30 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Aminopeptidase 3shpA00
2OZHA 1UFHA 4KLWA 4H6ZA 2BEIA 3F8KA 4KLVA 4KUAA 3TTHA 5EBVA 4JWPA 1XE4A 2P0WA 2ZPAA 4CAVA 4UA3A 2I79A 5I0CA 3LD2A 2ZW4A 1XIXA 1R57A 5DWMA 1YX0A 4MY3A 1S5KA 2PQ8A 4GS4A 4KUBA 4CRYB 3DDDA 4ORFA 4F0YA 2Q4VA 2J8MA 3K9UA 1YR0A 4CAWA 5C82A 4E8OA 1YLEA 4LUAA 2HV2A 4U9YA 3VWDA 3CXSA 4BMHA 2R8VA 3R1KA 3ZJ0A 2PC1A 3MGDA 3W6XA 1KUYA 3VWEA 1S7NA 2CNMA 4KOXA 4JJXA 2H5MA 2CNSA 4AVAA 1GHEA 4JXQA 2Q4YA 5F46A 4MJ8A 4AB7A 2RC4A 4DNCA 4NCZA 5F48A 1QSTA 3W91A 2B4DA 2CY2A 2FT0A 2X7BA 4F6AA 2J8RA 1MJ9A 4PK3A 2FCKA 2PSWA 3EFAA 5IV0A 4RI1A 1XMTA 3D2MA 3GY9A 3F0AA 4AG7A 1S60A 4QVTA 2VBQA 2FXFA 1QSNA 4KOSA 4JLYA 3R9EA 2B5GA 1M4DA 4Y49C 2BSWA 2D4OA 2Q7BA 4NF1A 1LRZA 1P4NA 4U9ZA 2WPWA 1N71A 3T9YA 1IYKA 2OZGA 2VZZA 3ZZIA 3S6GA 4E2AA 3H4QA 2B58A 5GCNA 1IICA 3D8PA 1IYLA 5HMNA 3S6HA 2Q44A 2ZW6A 1P0HA 4HNWB 5EC4A 5KTCA 2EUIA 4PK2A 4KOTA 3DR8A 2JDCA 4H89A 1Y9KA 3NE7A 3I3GA 1XF8A 2A4NA 1QSMA 4RS2A 2JDDA 4OLLA 3QAHA 4KOVA 4AVCA 1I12A 1Q2DA 2DXQA 2NMTA 1VHSA 3BJ7A 1RXTA 1U6MA 4YRHA 1M4IA 3I9SA 4JD6A 3KKWA 2PR1A 1M44A 4KOWA 1SQHA 1OZPA 3EXNA 2B4DB 4XNHB 1Z4RA 2D4PA 4X5KA 2ZXVA 3BLNA 4XPLA 5J8CA 5J8FA 3EY5A 2FS5A 2B3VA 5CNPA 3FYNA 4KVOE 3T90A 1KUVA 1S7KA 5E96A 2CNTA 4H6UA 3E0KA 1L0CA 4M3SA 3N7ZA 5KTAA 2B5GB 5F47A 4M85A 4UWIA 3JVNA 2PDOA 3QB8A 1CM0A 3DNSA 4R3KA 3S6FA 3TCVA 2F5IA 4HNYB 1MJBA 4R9MA 2VQYA 3TT2A 2GANA 1KUXA 2EVNA 3EC4A 2R1IA 5H84A 4I49A 3SHPA 4NEXA 3V8IA 1QSRA 4QUSA 5IB0A 3TO6A 3W6SA 4FD5A 1WK4A 4YGOA 3BJ8A 2VZYA 1S7LA 2JEVA 3B8GA 1M1DA 4OAEA 1B6BA 3TE4A 2AJ6A 4R57A 3PGPA 4IUSA 3GKRA 1MJAA 2G3AA 2B3UA 4XPKA 3R95A 5JQ4A 4R3LA 4MBUA 2VXKA 3D2PA 3R9GA 2O28A 3CXQA 4NXYA 4K30A 2FIWA 1Q2CA 2AE6A 1V0CA 4EVYA 2Z0ZA 4YFJA 4L8AA 3R96A 2R7HA 1CJWA 1IIDA 1ON0A 2GE3A 1Y9WA 3EO4A 4U5YA 4R87A 3P2FA 3PP9A 4NSQA 1YVOA 4QC6A 1WWZA 4B5PA 4XNHC 2G3TA 3IWGA 1J4JA 1IB1E 5H86A 3FNCA 1RO5A 1PUAA 4LX9A 3JUWA 2K5TA 3TOAA 5C88A 4HKFA 5FVJA 1Q2YA 2OH1A 1NMTA 2HQYA 1B87A 4KZTA 1QSOA 2B4BA 1YGHA 1Z9UA 4KVME 2OB0A 2BL1A 1S3ZA 4AVBA 2WPXA 2PRBA 1S7FA 3P2HA 3RYOA 1MK4A 2FSRA 4MHDA 2I00A 2GIVA 2ATRA 4MY0A 3D3SA 3G3SA 4II9A 3S6KA 3C26A 1FY7A 3TOBA 1BO4A 2Q04A 1YREA 2HUZA 1NSLA 4ZBGA 1YK3A 1VKCA 3FBUA 2ARHA 4PSWA 4CRZB 1PU9A 2OU2A 3TFYA 2FE7A 4UWJA 1KZFA 2P6GA 4PSXA 2Y0MA 1I21A 2VEZA 4XPDC 4KOYA 2JLMA 4HNXB 3FRMA 3GYAA 3G8WA 3TO9A 5JPHA 4FD6A 3FXTA 2R98A 4B5PB 1TIQA 2Z10A 2ZW5A 2G0BA 2P6EA 3F5BA 5HH1A 2BUEA 3OWCA 2J8NA 2P6FA 4XPDB 4KOUA 2IL4A 2Z11A 2C27A 3UY5A 2QMLA 3R9FA 4J3GA 2REEA 4B5OA 3TO7A 1YVKA 2QECA 5KTDA 5ISVA 4JXRA 3PZJA 4AG9A 3DR6A 5DWNA 4OADA 2REFA 4L89A 4ONUA 3FB3A 4IF5A 3WR7A 2KCWA 3LODA 1K4JA 2VI7A 3SXOA 4E0AA 2FL4A 2Q0YA 4FD4A 2PR8A 4KORA 3SXNA 3CXPA 1Y7RA 1BOBA 2FIAA 4UBRA 4PV6A 4Y49B 2OZUA 1I1DA 4KVXA 3FIXA 4QB9A 5F49A 4FD7A 1Z4EA 2QIRA 4CAXA 4CS0B 4MI4A 2ZW7A 3DSBA 1XEBA 1M4GA 4QBJA 5IX3A 3IGRA 1NE9A
chains in the Genus database with same CATH superfamily
2Q7SA 2OZHA 1UFHA 4PXEA 2OOTA 4KLWA 4NGTA 4H6ZA 5HXDA 2BEIA 3F8KA 4KLVA 4KUAA 4MFZA 3S9MA 1YQEA 2JEWA 4MMOA 5EBVA 3TTHA 4ZI6A 1X12A 4JWPA 1XE4A 2P0WA 2ZPAA 4CAVA 4UA3A 1Q7LA 2I79A 5I0CA 4YU9A 3LD2A 2GLJA 1CP6A 4IAVA 2HB6A 2ZW4A 3D68A 1XIXA 1R57A 2GU2A 4CPAA 5CBMA 5DWMA 4MHZA 1YX0A 2ANPA 2RFHA 4R8FA 3LACA 4HPSA 1ELMP 4MY3A 2BOAA 3KASA 1RTQA 1S5KA 2PQ8A 4ONWA 4GS4A 4KUBA 4CRYB 2Q51A 1TXRA 3DDDA 4ORFA 4F0YA 3IWEA 5DS0A 2Q4VA 3V38A 2J8MA 3K9UA 1YR0A 1YW4A 3FX6A 4CAWA 5C82A 1XBUA 4E8OA 3B3CA 3KR5A 1YLEA 5HVHA 2QYVA 4LUAA 2HV2A 4U9YA 3VWDA 3CXSA 4BMHA 2R8VA 3R1KA 2XEJA 3ZJ0A 1AUGA 2PC1A 3MGDA 3W6XA 1KUYA 4ZY2A 3VWEA 1S7NA 2CNMA 2PVVA 4KOXA 2DF5A 3PRTA 4ZY1A 4JJXA 3VH9A 4OMEA 1ARMA 1LAPA 3IC1A 1OBRA 3LMSA 2PJCA 2ZEEA 5JGFA 4WJBA 2H5MA 2CNSA 2C1CA 4A31A 2XEIA 3FH4A 3H8FA 4AVAA 3PBBA 1GHEA 1TKFA 4JXQA 1ZO0A 1LCPA 2Q4YA 2BCOA 1Z8TA 4KS9A 5F46A 4MJ8A 4AB7A 2PJ1A 4R76A 4UF4A 4A95A 4IK2A 2RC4A 4DNCA 4NFRA 4NCZA 1ARLA 1CPXA 1QSTA 3MRUA 5F48A 1AYEA 3V7ZA 2B4DA 2CY2A 3W91A 4CAEA 4EWTA 2FT0A 2X7BA 3BI0A 3NH8A 2J8RA 4TWEA 4F6AA 1MJ9A 4PK3A 4UFVA 5A28A 1BPMA 3BHXA 5LRKA 2FCKA 2PSWA 3EFAA 5K8OA 5IV0A 3D7DA 3WT4A 4CGMA 4RI1A 4MXUA 4RUHA 1XMTA 5JH9A 5HVGA 3BXMA 3D2MA 3GY9A 3F0AA 4AG7A 3SI2A 1S60A 4QVTA 3QNVA 4KSFA 4MFKA 2VBQA 1F2OA 2FXFA 3B35A 1QSNA 3BI1A 3D67A 3D7HA 4KOSA 1VHEA 4JLYA 2NSMA 3R9EA 3SJFA 2DEAA 2B5GA 4B14A 1M4DA 4P4DA 2BSWA 4Y49C 5I4MA 2D4OA 2Q7BA 4NF1A 4OC0A 3B7IA 1LRZA 4CYQA 4MHNA 1P4NA 3IEHA 4U9ZA 2WPWA 1TKHA 4NGMA 3WC7A 3KZWA 1N71A 3T9YA 1IYKA 2O53A 2ZOGA 3DGVA 2OZGA 2VZZA 2EBJA 5AG5A 3ZZIA 3RAMA 5F09A 4OP4A 3S6GA 4E2AA 2YGWA 4OIWA 4R7MA 3H4QA 2B58A 1CG2A 4C7IA 5GCNA 2ZEMA 1GYTA 1IICA 3D8PA 4UEFA 5LYFA 4P4FA 4P4IA 2CF4A 4H2KA 1IYLA 1R43A 3MN8A 5HMNA 2PRQA 3S6HA 2Q44A 2JBKA 1P0HA 1F2PA 2WYRA 2ZW6A 4HNWB 4Q36A 5EC4A 4A38A 5A27A 5KTCA 2AFUA 1BLLE 2EUIA 4PK2A 4KOTA 2EWBA 3DR8A 2JDCA 1LFWA 2CTCA 4H89A 5LRGA 2AFOA 5K8MA 1Y9KA 3NE7A 1LOKA 2YNEA 3I3GA 1XF8A 2A4NA 2OR4A 1QSMA 4RS2A 2JDDA 2PE3A 1HEEA 4OLLA 3KI9A 1QMUA 3QAHA 4KOVA 1M4LA 4AVCA 1I12A 1Q2DA 2ZOFA 4MCSA 2DXQA 2PIYA 3CPAA 2NMTA 3IIBA 2J9AA 1VHSA 3BJ7A 1RXTA 1U6MA 4GXHA 1M4IA 4YRHA 4M6HA 2HC9A 3I9SA 4JD6A 3GLJA 3KKWA 2PR1A 3CPXA 1M44A 3RBUA 4ZY0A 4KOWA 1SQHA 2ZEPA 4Q7AA 5D8NA 1UWYA 1YMEA 1OZPA 2PJ0A 2WSAA 3EXNA 2GLFA 2QJ8A 1IOFA 2B4DB 4XNHB 4A33A 1Z4RA 2D4PA 5BWAB 3B3VA 1VHOA 4X5KA 2ZXVA 3BLNA 4UEZA 4XPLA 5J8CA 5J8FA 3EY5A 3NA6A 2FS5A 2B3VA 5CNPA 4BINA 1IOIA 4IHMA 2Z3MA 2PIZA 3FYNA 3I1UA 4KVOE 3T90A 1KUVA 1S7KA 4PXCA 5E96A 4CYOA 1IY7A 2PJAA 2CNTA 4H6UA 3E0KA 1L0CA 1CP7A 4OC4A 5AG4A 4MFPA 4F8ZA 1IU8A 4M3SA 1AMPA 4P6YA 5LYLA 3N7ZA 4K3NA 2PJ5A 5KTAA 2JBJA 2B5GB 5F47A 4M85A 2I3CA 2ZELA 4UWIA 3H8EA 1VIXA 2IJZA 3JVNA 4OC1A 5K8PA 3FVLA 8CPAA 4JYWA 3D7GA 3CT9A 2PDOA 1HDUA 2AFZA 3ISZA 4UFWA 3QB8A 4UIAA 1CM0A 3DNSA 5G1ZA 3K2KA 2Z3PA 4R3KA 3FEDA 3S6FA 3TCVA 4F0XA 2F5IA 1CBXA 4HNYB 4EMEA 4W9YA 1MJBA 3PBEA 4R9MA 2F7VA 4OKOA 2VQYA 4MCQA 3TT2A 2Q4ZA 2GANA 4MCPA 1KUXA 2EVNA 2F8HA 2DPSA 4LQ6A 3EC4A 1Z8WA 2R1IA 5H84A 4A32A 5THWA 4I49A 3SHPA 2QVPA 5AG6A 4NEXA 3FMCA 3V8IA 1QSRA 4QUSA 5IB0A 3S9LA 3H8GA 3HLPA 5LYDA 3TO6A 4DJLA 3W6SA 3PB7X 2PJBA 4FD5A 1WK4A 4YGOA 3BJ8A 3IJ3A 4UEEA 4OC3A 2VZYA 5CPAA 3B2YA 1S7LA 2JEVA 4PQAA 4F9UA 3ISXA 3WC6A 4NJQA 3B8GA 1M1DA 4OAEA 3N5FA 1B6BA 4P10A 3TE4A 2AJ6A 4R57A 3PGPA 2YNCA 4CGPA 4X2TA 3IU1A 1VGYA 3KHXA 4IUSA 4FBEA 4UCMA 1HDQA 2EK8A 3GKRA 1MJAA 2G3AA 2ZEHA 1PYTB 3KQXA 4M6GA 2B3UA 4XPKA 3R95A 5JQ4A 4R3LA 1XRYA 2V8GA 4MBUA 2RB7A 2VXKA 3KQZA 2GFQA 2PJ9A 3D2PA 3QAYA 4MRIA 3R9GA 1NSAA 2CXAA 4C2ZA 6CPAA 4BD9A 2O28A 3CXQA 4NXYA 4ZX8A 3WABA 3SI0A 4K30A 3B3TA 2FIWA 4ZX9A 4NGSA 4LQGA 3PB8X 4DUKA 1DE4C 1Q2CA 2AE6A 1V0CA 4EVYA 1F57A 1XFOA 2Z0ZA 3JTKA 4P4EA 4ZYQA 4YFJA 4L8AA 3T8WA 3R96A 2BO9A 1Z8XA 2R7HA 1CJWA 1IIDA 1ON0A 2GE3A 3VARA 4C7HA 3PFOA 1Y9WA 3SJGA 4ZGYB 3EO4A 4C2YA 4U5YA 4R87A 3P2FA 3FJUA 3FF3A 3PP9A 4NSQA 1YVOA 4QC6A 2DPTA 4UCNA 1WWZA 3PB4X 4A30A 4B5PA 4RN7A 4XNHC 1CX8A 3PFEA 3S9NA 4FWUA 4NGNA 4JZ0A 5D29A 2G3TA 4A37A 3IWGA 1J4JA 1IB1E 5AG7A 5H86A 1EE3P 3FNCA 2ZEGA 1RO5A 2IMOA 4A39A 1PUAA 4P45A 4CGOA 4P44A 4LX9A 3JUWA 1XOVA 4Z65A 2FVGA 2K5TA 2IQ6A 3TOAA 5C88A 3NE8A 4NGQA 7CPAA 4HKFA 4P4BA 5FVJA 2WUUA 1LAMA 1Z2LA 2Q43A 2YNCC 1Y7EA 1Q2YA 2OH1A 1XJOA 4G1PA 2EK9A 4YWYA 1NMTA 2HQYA 1B87A 2AFWA 5K8NA 4KZTA 1QSOA 4Q38A 4B10A 2B4BA 1YGHA 1Z9UA 2V8DA 1YW6A 4KVME 5LRJA 3SJXA 2OB0A 2BL1A 1S3ZA 4AVBA 2WZNA 2WPXA 2PRBA 1S7FA 2YNDA 4A94A 3P2HA 3FECA 3RYOA 1MK4A 2FSRA 2PJ7A 1ZLIA 4MHDA 2I00A 2GIVA 4NJRA 4P4JA 2Z3KA 2ABZA 3H5ZA 2ATRA 5ELYA 1ELLP 2NYQA 4MY0A 4WWVA 2PJ6A 3D3SA 1CPSA 3G3SA 4CYPA 4MHPA 2PJ2A 1Y0YA 2AFSA 3JRUA 4NGPA 4GM5A 3S6KA 4II9A 3C26A 4MHYA 4PPZA 2ZEFA 1FY7A 3TOBA 3GB0A 1BO4A 3D66A 2Q04A 1YREA 2HUZA 2PVWA 1DTDA 4ZBGA 1YK3A 1NSLA 1VKCA 3RO0A 3FBUA 3SJEA 1Y0RA 4UFXA 4B13A 2ARHA 2XEGA 4PSWA 4UCPA 4CRZB 1IGBA 2GREA 1PU9A 2OU2A 3TFYA 2FE7A 2PJ8A 1KZFA 4UWJA 2XEFA 5EMIA 2P6GA 3IO1A 4PSXA 2Y0MA 1I21A 2ZENA 4FAIA 5JM6A 2VEZA 1Z8LA 3GIUA 4XPDC 4KOYA 2JLMA 4HNXB 2VL1A 2CIJA 3FRMA 3GYAA 3G8WA 3TO9A 5JPHA 3KHZA 4FD6A 4MFLA 2EO8A 2Z3OA 2ZEDA 1FNOA 3FXTA 2R98A 4B5PB 1PCAA 1TIQA 2ZEOA 3PB9X 1JQGA 1ZG8A 3KR4A 3IWWA 3K9TA 2Z10A 3B3SA 5G20A 3GUXA 2ZW5A 2G0BA 2P6EA 3IU2A 3F5BA 5HH1A 3TC8A 2BUEA 3B3WA 4DYOA 3OWCA 2J8NA 2P6FA 3CDXA 4XPDB 1FT7A 4KOUA 2C6PA 4KSAA 2IL4A 1LANA 2Z11A 4PXDA 4A2ZA 2AFMA 1XMBA 4M6IA 2C27A 3UY5A 2QMLA 3FEEA 3RNZA 2V77A 4X8IA 3R9FA 3SI1A 5J1QA 4J3GA 3A9LA 4O23A 2REEA 4B5OA 3L2NA 3TO7A 1YVKA 2QECA 1YLOA 4X3RA 2PCUA 5HVFA 4FUUA 5KTDA 3KL9A 1ZG9A 5ISVA 1YSJA 5G22A 3HUVA 2CTBA 4JXRA 4R6TA 3PZJA 4AG9A 3DR6A 5DWNA 3D4UA 2Z3LA 1ZG7A 4OADA 2PJ4A 2REFA 4L89A 4ONUA 3FB3A 4IF5A 5LYIA 3WR7A 4B12A 1BAVA 4OC5A 2KCWA 4AXVA 4BBHA 2POKA 3LODA 1K4JA 2VI7A 1H8LA 3SXOA 5G21A 4E0AA 2FL4A 2Q0YA 4FD4A 2PR8A 3NH4A 4OIDA 3PB6X 4UIBA 4KORA 3KGQA 4MFJA 4CGNA 4F9VA 2O4HA 5IB9A 4EFDA 3SXNA 3CXPA 2PJ3A 1BPNA 4C68A 1Y7RA 1A2ZA 1KWMA 1BOBA 2FIAA 4UBRA 1QQ9A 1X10A 3PEIA 2V8VA 2C6GA 3LWUA 2AFXA 1TF8A 4NGRA 4PV6A 4Y49B 2OZUA 3DLJA 1I1DA 2G9DA 4MFQA 4KVXA 3FIXA 2ODFA 4CGLA 4QB9A 2Z3NA 5F49A 1JWQA 3VATA 2C6CA 3NFZA 4KSIA 4B11A 4FD7A 1Z4EA 4CAFA 2QIRA 4MCRA 4TNUA 4CAXA 4CS0B 2V8HA 1Z5RA 4MI4A 3TX8A 2ZW7A 5AGEA 3IFEA 3RZAA 3DSBA 4C2XA 1XEBA 1M4GA 3CZXA 3NH5A 1TF9A 4QBJA 1TKJA 5IX3A 4OC2A 1R3NA 4PXBA 4B6ZA 3D7FA 3IGRA 3WC5A 4CYNA 1NE9A 1ZLHA
chains in the Genus database with same CATH topology
2OZHA 1UFHA 4KLWA 4H6ZA 2BEIA 3F8KA 4KLVA 4KUAA 4MFZA 3TTHA 5EBVA 4JWPA 1XE4A 2P0WA 2ZPAA 4CAVA 4UA3A 2I79A 5I0CA 3LD2A 2ZW4A 1XIXA 1R57A 5DWMA 1YX0A 4MY3A 1S5KA 2PQ8A 4GS4A 4KUBA 4CRYB 3DDDA 4ORFA 4F0YA 3IWEA 2Q4VA 2J8MA 3K9UA 1YR0A 4CAWA 5C82A 4E8OA 1YLEA 4LUAA 2HV2A 4U9YA 3VWDA 3CXSA 4BMHA 2R8VA 3R1KA 3ZJ0A 2PC1A 3MGDA 3W6XA 1KUYA 3VWEA 1S7NA 2CNMA 4KOXA 4JJXA 2H5MA 2CNSA 4A31A 4AVAA 1GHEA 4JXQA 1ZO0A 2Q4YA 4KS9A 5F46A 4MJ8A 4AB7A 4A95A 2RC4A 4DNCA 4NCZA 5F48A 1QSTA 3W91A 2B4DA 2CY2A 4CAEA 2FT0A 2X7BA 4F6AA 2J8RA 1MJ9A 4PK3A 4UFVA 5A28A 2FCKA 2PSWA 3EFAA 5IV0A 4CGMA 4RI1A 1XMTA 3D2MA 3GY9A 3F0AA 4AG7A 1S60A 4QVTA 4KSFA 4MFKA 2VBQA 2FXFA 1QSNA 4KOSA 4JLYA 3R9EA 2B5GA 4B14A 1M4DA 4Y49C 2BSWA 2D4OA 2Q7BA 4NF1A 4CYQA 1LRZA 1P4NA 4U9ZA 2WPWA 1N71A 3T9YA 1IYKA 2OZGA 2VZZA 3ZZIA 5AG5A 3S6GA 4E2AA 2YGWA 3H4QA 2B58A 4C7IA 5GCNA 1IICA 3D8PA 1IYLA 5HMNA 3S6HA 2Q44A 2ZW6A 1P0HA 4Q36A 4HNWB 5EC4A 5KTCA 5A27A 2EUIA 4PK2A 4KOTA 3DR8A 2JDCA 4H89A 1Y9KA 3NE7A 3I3GA 2YNEA 1XF8A 2A4NA 1QSMA 4RS2A 2JDDA 4OLLA 3QAHA 4KOVA 4AVCA 1I12A 1Q2DA 2DXQA 2NMTA 1VHSA 3BJ7A 1RXTA 1U6MA 4YRHA 1M4IA 4JD6A 3I9SA 3KKWA 2PR1A 1M44A 4KOWA 1SQHA 2WSAA 1OZPA 3EXNA 4A33A 2B4DB 4XNHB 1Z4RA 2D4PA 5BWAB 4X5KA 2ZXVA 3BLNA 4XPLA 5J8CA 5J8FA 3EY5A 2FS5A 2B3VA 5CNPA 2Z3MA 3FYNA 4KVOE 3T90A 1KUVA 1S7KA 5E96A 4CYOA 2CNTA 4H6UA 3E0KA 1L0CA 5AG4A 4MFPA 4M3SA 3N7ZA 5KTAA 2B5GB 5F47A 4M85A 4UWIA 3JVNA 2PDOA 4UFWA 3QB8A 1CM0A 3DNSA 5G1ZA 4R3KA 2Z3PA 3S6FA 3TCVA 4F0XA 2F5IA 4HNYB 1MJBA 4R9MA 2VQYA 3TT2A 2GANA 1KUXA 2EVNA 2DPSA 3EC4A 2R1IA 5H84A 4A32A 4I49A 3SHPA 5AG6A 4NEXA 3V8IA 1QSRA 4QUSA 5IB0A 3TO6A 3W6SA 4FD5A 1WK4A 4YGOA 3BJ8A 2VZYA 1S7LA 2JEVA 3B8GA 1M1DA 4OAEA 1B6BA 3TE4A 2AJ6A 4R57A 3PGPA 2YNCA 4CGPA 3IU1A 4IUSA 4UCMA 3GKRA 1MJAA 2G3AA 2B3UA 4XPKA 3R95A 5JQ4A 4R3LA 4MBUA 2VXKA 3D2PA 3R9GA 2CXAA 4C2ZA 2O28A 3CXQA 4NXYA 4K30A 2FIWA 1Q2CA 2AE6A 1V0CA 4EVYA 2Z0ZA 3JTKA 4YFJA 4L8AA 3R96A 2R7HA 1CJWA 1IIDA 1ON0A 2GE3A 4C7HA 1Y9WA 4ZGYB 3EO4A 4C2YA 4U5YA 4R87A 3P2FA 3PP9A 4NSQA 1YVOA 4QC6A 2DPTA 4UCNA 1WWZA 4A30A 4B5PA 4XNHC 2G3TA 3IWGA 1J4JA 1IB1E 5AG7A 5H86A 3FNCA 1RO5A 1PUAA 4CGOA 4LX9A 3JUWA 2K5TA 3TOAA 5C88A 4HKFA 5FVJA 2WUUA 2YNCC 1Q2YA 2OH1A 1NMTA 2HQYA 1B87A 4KZTA 1QSOA 4Q38A 4B10A 2B4BA 1YGHA 1Z9UA 4KVME 2OB0A 2BL1A 1S3ZA 4AVBA 2WPXA 2PRBA 1S7FA 2YNDA 3P2HA 3RYOA 1MK4A 2FSRA 4MHDA 2I00A 2GIVA 2Z3KA 3H5ZA 2ATRA 4MY0A 3D3SA 3G3SA 4CYPA 4II9A 3S6KA 3C26A 1FY7A 3TOBA 1BO4A 2Q04A 1YREA 2HUZA 1NSLA 4ZBGA 1YK3A 1VKCA 3FBUA 4UFXA 4B13A 2ARHA 4UCPA 4PSWA 4CRZB 1PU9A 2OU2A 3TFYA 2FE7A 4UWJA 1KZFA 2P6GA 4PSXA 2Y0MA 1I21A 2VEZA 4XPDC 4KOYA 2JLMA 4HNXB 3FRMA 3GYAA 3G8WA 3TO9A 5JPHA 4FD6A 4MFLA 2Z3OA 3FXTA 2R98A 4B5PB 1TIQA 2Z10A 5G20A 2ZW5A 2G0BA 2P6EA 3IU2A 3F5BA 5HH1A 2BUEA 3OWCA 2J8NA 2P6FA 4XPDB 4KOUA 4KSAA 2IL4A 2Z11A 4A2ZA 2C27A 3UY5A 2QMLA 3R9FA 4J3GA 3A9LA 2REEA 4B5OA 3TO7A 1YVKA 2QECA 5KTDA 5ISVA 5G22A 4JXRA 3PZJA 4AG9A 3DR6A 5DWNA 2Z3LA 4OADA 2REFA 4L89A 4ONUA 3FB3A 4IF5A 4B12A 3WR7A 2KCWA 4BBHA 3LODA 1K4JA 2VI7A 3SXOA 5G21A 4E0AA 2FL4A 2Q0YA 4FD4A 2PR8A 4KORA 4MFJA 4CGNA 3SXNA 3CXPA 4C68A 1Y7RA 1BOBA 2FIAA 4UBRA 4PV6A 4Y49B 2OZUA 1I1DA 4MFQA 4KVXA 3FIXA 4CGLA 4QB9A 2Z3NA 5F49A 4B11A 4CAFA 4FD7A 1Z4EA 2QIRA 4CAXA 4CS0B 4MI4A 2ZW7A 5AGEA 3DSBA 4C2XA 1XEBA 1M4GA 4QBJA 5IX3A 3IGRA 4CYNA 1NE9A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2OZH A;  1UFH A;  4KLW A;  4H6Z A;  2BEI A;  3F8K A;  4KLV A;  4KUA A;  3TTH A;  5EBV A;  4JWP A;  1XE4 A;  2P0W A;  2ZPA A;  4CAV A;  4UA3 A;  2I79 A;  5I0C A;  3LD2 A;  2ZW4 A;  1XIX A;  1R57 A;  5DWM A;  1YX0 A;  4MY3 A;  1S5K A;  2PQ8 A;  4GS4 A;  4KUB A;  4CRY B;  3DDD A;  4ORF A;  4F0Y A;  2Q4V A;  2J8M A;  3K9U A;  1YR0 A;  4CAW A;  5C82 A;  4E8O A;  1YLE A;  4LUA A;  2HV2 A;  4U9Y A;  3VWD A;  3CXS A;  4BMH A;  2R8V A;  3R1K A;  3ZJ0 A;  2PC1 A;  3MGD A;  3W6X A;  1KUY A;  3VWE A;  1S7N A;  2CNM A;  4KOX A;  4JJX A;  2H5M A;  2CNS A;  4AVA A;  1GHE A;  4JXQ A;  2Q4Y A;  5F46 A;  4MJ8 A;  4AB7 A;  2RC4 A;  4DNC A;  4NCZ A;  5F48 A;  1QST A;  3W91 A;  2B4D A;  2CY2 A;  2FT0 A;  2X7B A;  4F6A A;  2J8R A;  1MJ9 A;  4PK3 A;  2FCK A;  2PSW A;  3EFA A;  5IV0 A;  4RI1 A;  1XMT A;  3D2M A;  3GY9 A;  3F0A A;  4AG7 A;  1S60 A;  4QVT A;  2VBQ A;  2FXF A;  1QSN A;  4KOS A;  4JLY A;  3R9E A;  2B5G A;  1M4D A;  4Y49 C;  2BSW A;  2D4O A;  2Q7B A;  4NF1 A;  1LRZ A;  1P4N A;  4U9Z A;  2WPW A;  1N71 A;  3T9Y A;  1IYK A;  2OZG A;  2VZZ A;  3ZZI A;  3S6G A;  4E2A A;  3H4Q A;  2B58 A;  5GCN A;  1IIC A;  3D8P A;  1IYL A;  5HMN A;  3S6H A;  2Q44 A;  2ZW6 A;  1P0H A;  4HNW B;  5EC4 A;  5KTC A;  2EUI A;  4PK2 A;  4KOT A;  3DR8 A;  2JDC A;  4H89 A;  1Y9K A;  3NE7 A;  3I3G A;  1XF8 A;  2A4N A;  1QSM A;  4RS2 A;  2JDD A;  4OLL A;  3QAH A;  4KOV A;  4AVC A;  1I12 A;  1Q2D A;  2DXQ A;  2NMT A;  1VHS A;  3BJ7 A;  1RXT A;  1U6M A;  4YRH A;  1M4I A;  3I9S A;  4JD6 A;  3KKW A;  2PR1 A;  1M44 A;  4KOW A;  1SQH A;  1OZP A;  3EXN A;  2B4D B;  4XNH B;  1Z4R A;  2D4P A;  4X5K A;  2ZXV A;  3BLN A;  4XPL A;  5J8C A;  5J8F A;  3EY5 A;  2FS5 A;  2B3V A;  5CNP A;  3FYN A;  4KVO E;  3T90 A;  1KUV A;  1S7K A;  5E96 A;  2CNT A;  4H6U A;  3E0K A;  1L0C A;  4M3S A;  3N7Z A;  5KTA A;  2B5G B;  5F47 A;  4M85 A;  4UWI A;  3JVN A;  2PDO A;  3QB8 A;  1CM0 A;  3DNS A;  4R3K A;  3S6F A;  3TCV A;  2F5I A;  4HNY B;  1MJB A;  4R9M A;  2VQY A;  3TT2 A;  2GAN A;  1KUX A;  2EVN A;  3EC4 A;  2R1I A;  5H84 A;  4I49 A;  3SHP A;  4NEX A;  3V8I A;  1QSR A;  4QUS A;  5IB0 A;  3TO6 A;  3W6S A;  4FD5 A;  1WK4 A;  4YGO A;  3BJ8 A;  2VZY A;  1S7L A;  2JEV A;  3B8G A;  1M1D A;  4OAE A;  1B6B A;  3TE4 A;  2AJ6 A;  4R57 A;  3PGP A;  4IUS A;  3GKR A;  1MJA A;  2G3A A;  2B3U A;  4XPK A;  3R95 A;  5JQ4 A;  4R3L A;  4MBU A;  2VXK A;  3D2P A;  3R9G A;  2O28 A;  3CXQ A;  4NXY A;  4K30 A;  2FIW A;  1Q2C A;  2AE6 A;  1V0C A;  4EVY A;  2Z0Z A;  4YFJ A;  4L8A A;  3R96 A;  2R7H A;  1CJW A;  1IID A;  1ON0 A;  2GE3 A;  1Y9W A;  3EO4 A;  4U5Y A;  4R87 A;  3P2F A;  3PP9 A;  4NSQ A;  1YVO A;  4QC6 A;  1WWZ A;  4B5P A;  4XNH C;  2G3T A;  3IWG A;  1J4J A;  1IB1 E;  5H86 A;  3FNC A;  1RO5 A;  1PUA A;  4LX9 A;  3JUW A;  2K5T A;  3TOA A;  5C88 A;  4HKF A;  5FVJ A;  1Q2Y A;  2OH1 A;  1NMT A;  2HQY A;  1B87 A;  4KZT A;  1QSO A;  2B4B A;  1YGH A;  1Z9U A;  4KVM E;  2OB0 A;  2BL1 A;  1S3Z A;  4AVB A;  2WPX A;  2PRB A;  1S7F A;  3P2H A;  3RYO A;  1MK4 A;  2FSR A;  4MHD A;  2I00 A;  2GIV A;  2ATR A;  4MY0 A;  3D3S A;  3G3S A;  4II9 A;  3S6K A;  3C26 A;  1FY7 A;  3TOB A;  1BO4 A;  2Q04 A;  1YRE A;  2HUZ A;  1NSL A;  4ZBG A;  1YK3 A;  1VKC A;  3FBU A;  2ARH A;  4PSW A;  4CRZ B;  1PU9 A;  2OU2 A;  3TFY A;  2FE7 A;  4UWJ A;  1KZF A;  2P6G A;  4PSX A;  2Y0M A;  1I21 A;  2VEZ A;  4XPD C;  4KOY A;  2JLM A;  4HNX B;  3FRM A;  3GYA A;  3G8W A;  3TO9 A;  5JPH A;  4FD6 A;  3FXT A;  2R98 A;  4B5P B;  1TIQ A;  2Z10 A;  2ZW5 A;  2G0B A;  2P6E A;  3F5B A;  5HH1 A;  2BUE A;  3OWC A;  2J8N A;  2P6F A;  4XPD B;  4KOU A;  2IL4 A;  2Z11 A;  2C27 A;  3UY5 A;  2QML A;  3R9F A;  4J3G A;  2REE A;  4B5O A;  3TO7 A;  1YVK A;  2QEC A;  5KTD A;  5ISV A;  4JXR A;  3PZJ A;  4AG9 A;  3DR6 A;  5DWN A;  4OAD A;  2REF A;  4L89 A;  4ONU A;  3FB3 A;  4IF5 A;  3WR7 A;  2KCW A;  3LOD A;  1K4J A;  2VI7 A;  3SXO A;  4E0A A;  2FL4 A;  2Q0Y A;  4FD4 A;  2PR8 A;  4KOR A;  3SXN A;  3CXP A;  1Y7R A;  1BOB A;  2FIA A;  4UBR A;  4PV6 A;  4Y49 B;  2OZU A;  1I1D A;  4KVX A;  3FIX A;  4QB9 A;  5F49 A;  4FD7 A;  1Z4E A;  2QIR A;  4CAX A;  4CS0 B;  4MI4 A;  2ZW7 A;  3DSB A;  1XEB A;  1M4G A;  4QBJ A;  5IX3 A;  3IGR A;  1NE9 A; 
#chains in the Genus database with same CATH topology
 2Q7S A;  2OZH A;  1UFH A;  4PXE A;  2OOT A;  4KLW A;  4NGT A;  4H6Z A;  5HXD A;  2BEI A;  3F8K A;  4KLV A;  4KUA A;  4MFZ A;  3S9M A;  1YQE A;  2JEW A;  4MMO A;  5EBV A;  3TTH A;  4ZI6 A;  1X12 A;  4JWP A;  1XE4 A;  2P0W A;  2ZPA A;  4CAV A;  4UA3 A;  1Q7L A;  2I79 A;  5I0C A;  4YU9 A;  3LD2 A;  2GLJ A;  1CP6 A;  4IAV A;  2HB6 A;  2ZW4 A;  3D68 A;  1XIX A;  1R57 A;  2GU2 A;  4CPA A;  5CBM A;  5DWM A;  4MHZ A;  1YX0 A;  2ANP A;  2RFH A;  4R8F A;  3LAC A;  4HPS A;  1ELM P;  4MY3 A;  2BOA A;  3KAS A;  1RTQ A;  1S5K A;  2PQ8 A;  4ONW A;  4GS4 A;  4KUB A;  4CRY B;  2Q51 A;  1TXR A;  3DDD A;  4ORF A;  4F0Y A;  3IWE A;  5DS0 A;  2Q4V A;  3V38 A;  2J8M A;  3K9U A;  1YR0 A;  1YW4 A;  3FX6 A;  4CAW A;  5C82 A;  1XBU A;  4E8O A;  3B3C A;  3KR5 A;  1YLE A;  5HVH A;  2QYV A;  4LUA A;  2HV2 A;  4U9Y A;  3VWD A;  3CXS A;  4BMH A;  2R8V A;  3R1K A;  2XEJ A;  3ZJ0 A;  1AUG A;  2PC1 A;  3MGD A;  3W6X A;  1KUY A;  4ZY2 A;  3VWE A;  1S7N A;  2CNM A;  2PVV A;  4KOX A;  2DF5 A;  3PRT A;  4ZY1 A;  4JJX A;  3VH9 A;  4OME A;  1ARM A;  1LAP A;  3IC1 A;  1OBR A;  3LMS A;  2PJC A;  2ZEE A;  5JGF A;  4WJB A;  2H5M A;  2CNS A;  2C1C A;  4A31 A;  2XEI A;  3FH4 A;  3H8F A;  4AVA A;  3PBB A;  1GHE A;  1TKF A;  4JXQ A;  1ZO0 A;  1LCP A;  2Q4Y A;  2BCO A;  1Z8T A;  4KS9 A;  5F46 A;  4MJ8 A;  4AB7 A;  2PJ1 A;  4R76 A;  4UF4 A;  4A95 A;  4IK2 A;  2RC4 A;  4DNC A;  4NFR A;  4NCZ A;  1ARL A;  1CPX A;  1QST A;  3MRU A;  5F48 A;  1AYE A;  3V7Z A;  2B4D A;  2CY2 A;  3W91 A;  4CAE A;  4EWT A;  2FT0 A;  2X7B A;  3BI0 A;  3NH8 A;  2J8R A;  4TWE A;  4F6A A;  1MJ9 A;  4PK3 A;  4UFV A;  5A28 A;  1BPM A;  3BHX A;  5LRK A;  2FCK A;  2PSW A;  3EFA A;  5K8O A;  5IV0 A;  3D7D A;  3WT4 A;  4CGM A;  4RI1 A;  4MXU A;  4RUH A;  1XMT A;  5JH9 A;  5HVG A;  3BXM A;  3D2M A;  3GY9 A;  3F0A A;  4AG7 A;  3SI2 A;  1S60 A;  4QVT A;  3QNV A;  4KSF A;  4MFK A;  2VBQ A;  1F2O A;  2FXF A;  3B35 A;  1QSN A;  3BI1 A;  3D67 A;  3D7H A;  4KOS A;  1VHE A;  4JLY A;  2NSM A;  3R9E A;  3SJF A;  2DEA A;  2B5G A;  4B14 A;  1M4D A;  4P4D A;  2BSW A;  4Y49 C;  5I4M A;  2D4O A;  2Q7B A;  4NF1 A;  4OC0 A;  3B7I A;  1LRZ A;  4CYQ A;  4MHN A;  1P4N A;  3IEH A;  4U9Z A;  2WPW A;  1TKH A;  4NGM A;  3WC7 A;  3KZW A;  1N71 A;  3T9Y A;  1IYK A;  2O53 A;  2ZOG A;  3DGV A;  2OZG A;  2VZZ A;  2EBJ A;  5AG5 A;  3ZZI A;  3RAM A;  5F09 A;  4OP4 A;  3S6G A;  4E2A A;  2YGW A;  4OIW A;  4R7M A;  3H4Q A;  2B58 A;  1CG2 A;  4C7I A;  5GCN A;  2ZEM A;  1GYT A;  1IIC A;  3D8P A;  4UEF A;  5LYF A;  4P4F A;  4P4I A;  2CF4 A;  4H2K A;  1IYL A;  1R43 A;  3MN8 A;  5HMN A;  2PRQ A;  3S6H A;  2Q44 A;  2JBK A;  1P0H A;  1F2P A;  2WYR A;  2ZW6 A;  4HNW B;  4Q36 A;  5EC4 A;  4A38 A;  5A27 A;  5KTC A;  2AFU A;  1BLL E;  2EUI A;  4PK2 A;  4KOT A;  2EWB A;  3DR8 A;  2JDC A;  1LFW A;  2CTC A;  4H89 A;  5LRG A;  2AFO A;  5K8M A;  1Y9K A;  3NE7 A;  1LOK A;  2YNE A;  3I3G A;  1XF8 A;  2A4N A;  2OR4 A;  1QSM A;  4RS2 A;  2JDD A;  2PE3 A;  1HEE A;  4OLL A;  3KI9 A;  1QMU A;  3QAH A;  4KOV A;  1M4L A;  4AVC A;  1I12 A;  1Q2D A;  2ZOF A;  4MCS A;  2DXQ A;  2PIY A;  3CPA A;  2NMT A;  3IIB A;  2J9A A;  1VHS A;  3BJ7 A;  1RXT A;  1U6M A;  4GXH A;  1M4I A;  4YRH A;  4M6H A;  2HC9 A;  3I9S A;  4JD6 A;  3GLJ A;  3KKW A;  2PR1 A;  3CPX A;  1M44 A;  3RBU A;  4ZY0 A;  4KOW A;  1SQH A;  2ZEP A;  4Q7A A;  5D8N A;  1UWY A;  1YME A;  1OZP A;  2PJ0 A;  2WSA A;  3EXN A;  2GLF A;  2QJ8 A;  1IOF A;  2B4D B;  4XNH B;  4A33 A;  1Z4R A;  2D4P A;  5BWA B;  3B3V A;  1VHO A;  4X5K A;  2ZXV A;  3BLN A;  4UEZ A;  4XPL A;  5J8C A;  5J8F A;  3EY5 A;  3NA6 A;  2FS5 A;  2B3V A;  5CNP A;  4BIN A;  1IOI A;  4IHM A;  2Z3M A;  2PIZ A;  3FYN A;  3I1U A;  4KVO E;  3T90 A;  1KUV A;  1S7K A;  4PXC A;  5E96 A;  4CYO A;  1IY7 A;  2PJA A;  2CNT A;  4H6U A;  3E0K A;  1L0C A;  1CP7 A;  4OC4 A;  5AG4 A;  4MFP A;  4F8Z A;  1IU8 A;  4M3S A;  1AMP A;  4P6Y A;  5LYL A;  3N7Z A;  4K3N A;  2PJ5 A;  5KTA A;  2JBJ A;  2B5G B;  5F47 A;  4M85 A;  2I3C A;  2ZEL A;  4UWI A;  3H8E A;  1VIX A;  2IJZ A;  3JVN A;  4OC1 A;  5K8P A;  3FVL A;  8CPA A;  4JYW A;  3D7G A;  3CT9 A;  2PDO A;  1HDU A;  2AFZ A;  3ISZ A;  4UFW A;  3QB8 A;  4UIA A;  1CM0 A;  3DNS A;  5G1Z A;  3K2K A;  2Z3P A;  4R3K A;  3FED A;  3S6F A;  3TCV A;  4F0X A;  2F5I A;  1CBX A;  4HNY B;  4EME A;  4W9Y A;  1MJB A;  3PBE A;  4R9M A;  2F7V A;  4OKO A;  2VQY A;  4MCQ A;  3TT2 A;  2Q4Z A;  2GAN A;  4MCP A;  1KUX A;  2EVN A;  2F8H A;  2DPS A;  4LQ6 A;  3EC4 A;  1Z8W A;  2R1I A;  5H84 A;  4A32 A;  5THW A;  4I49 A;  3SHP A;  2QVP A;  5AG6 A;  4NEX A;  3FMC A;  3V8I A;  1QSR A;  4QUS A;  5IB0 A;  3S9L A;  3H8G A;  3HLP A;  5LYD A;  3TO6 A;  4DJL A;  3W6S A;  3PB7 X;  2PJB A;  4FD5 A;  1WK4 A;  4YGO A;  3BJ8 A;  3IJ3 A;  4UEE A;  4OC3 A;  2VZY A;  5CPA A;  3B2Y A;  1S7L A;  2JEV A;  4PQA A;  4F9U A;  3ISX A;  3WC6 A;  4NJQ A;  3B8G A;  1M1D A;  4OAE A;  3N5F A;  1B6B A;  4P10 A;  3TE4 A;  2AJ6 A;  4R57 A;  3PGP A;  2YNC A;  4CGP A;  4X2T A;  3IU1 A;  1VGY A;  3KHX A;  4IUS A;  4FBE A;  4UCM A;  1HDQ A;  2EK8 A;  3GKR A;  1MJA A;  2G3A A;  2ZEH A;  1PYT B;  3KQX A;  4M6G A;  2B3U A;  4XPK A;  3R95 A;  5JQ4 A;  4R3L A;  1XRY A;  2V8G A;  4MBU A;  2RB7 A;  2VXK A;  3KQZ A;  2GFQ A;  2PJ9 A;  3D2P A;  3QAY A;  4MRI A;  3R9G A;  1NSA A;  2CXA A;  4C2Z A;  6CPA A;  4BD9 A;  2O28 A;  3CXQ A;  4NXY A;  4ZX8 A;  3WAB A;  3SI0 A;  4K30 A;  3B3T A;  2FIW A;  4ZX9 A;  4NGS A;  4LQG A;  3PB8 X;  4DUK A;  1DE4 C;  1Q2C A;  2AE6 A;  1V0C A;  4EVY A;  1F57 A;  1XFO A;  2Z0Z A;  3JTK A;  4P4E A;  4ZYQ A;  4YFJ A;  4L8A A;  3T8W A;  3R96 A;  2BO9 A;  1Z8X A;  2R7H A;  1CJW A;  1IID A;  1ON0 A;  2GE3 A;  3VAR A;  4C7H A;  3PFO A;  1Y9W A;  3SJG A;  4ZGY B;  3EO4 A;  4C2Y A;  4U5Y A;  4R87 A;  3P2F A;  3FJU A;  3FF3 A;  3PP9 A;  4NSQ A;  1YVO A;  4QC6 A;  2DPT A;  4UCN A;  1WWZ A;  3PB4 X;  4A30 A;  4B5P A;  4RN7 A;  4XNH C;  1CX8 A;  3PFE A;  3S9N A;  4FWU A;  4NGN A;  4JZ0 A;  5D29 A;  2G3T A;  4A37 A;  3IWG A;  1J4J A;  1IB1 E;  5AG7 A;  5H86 A;  1EE3 P;  3FNC A;  2ZEG A;  1RO5 A;  2IMO A;  4A39 A;  1PUA A;  4P45 A;  4CGO A;  4P44 A;  4LX9 A;  3JUW A;  1XOV A;  4Z65 A;  2FVG A;  2K5T A;  2IQ6 A;  3TOA A;  5C88 A;  3NE8 A;  4NGQ A;  7CPA A;  4HKF A;  4P4B A;  5FVJ A;  2WUU A;  1LAM A;  1Z2L A;  2Q43 A;  2YNC C;  1Y7E A;  1Q2Y A;  2OH1 A;  1XJO A;  4G1P A;  2EK9 A;  4YWY A;  1NMT A;  2HQY A;  1B87 A;  2AFW A;  5K8N A;  4KZT A;  1QSO A;  4Q38 A;  4B10 A;  2B4B A;  1YGH A;  1Z9U A;  2V8D A;  1YW6 A;  4KVM E;  5LRJ A;  3SJX A;  2OB0 A;  2BL1 A;  1S3Z A;  4AVB A;  2WZN A;  2WPX A;  2PRB A;  1S7F A;  2YND A;  4A94 A;  3P2H A;  3FEC A;  3RYO A;  1MK4 A;  2FSR A;  2PJ7 A;  1ZLI A;  4MHD A;  2I00 A;  2GIV A;  4NJR A;  4P4J A;  2Z3K A;  2ABZ A;  3H5Z A;  2ATR A;  5ELY A;  1ELL P;  2NYQ A;  4MY0 A;  4WWV A;  2PJ6 A;  3D3S A;  1CPS A;  3G3S A;  4CYP A;  4MHP A;  2PJ2 A;  1Y0Y A;  2AFS A;  3JRU A;  4NGP A;  4GM5 A;  3S6K A;  4II9 A;  3C26 A;  4MHY A;  4PPZ A;  2ZEF A;  1FY7 A;  3TOB A;  3GB0 A;  1BO4 A;  3D66 A;  2Q04 A;  1YRE A;  2HUZ A;  2PVW A;  1DTD A;  4ZBG A;  1YK3 A;  1NSL A;  1VKC A;  3RO0 A;  3FBU A;  3SJE A;  1Y0R A;  4UFX A;  4B13 A;  2ARH A;  2XEG A;  4PSW A;  4UCP A;  4CRZ B;  1IGB A;  2GRE A;  1PU9 A;  2OU2 A;  3TFY A;  2FE7 A;  2PJ8 A;  1KZF A;  4UWJ A;  2XEF A;  5EMI A;  2P6G A;  3IO1 A;  4PSX A;  2Y0M A;  1I21 A;  2ZEN A;  4FAI A;  5JM6 A;  2VEZ A;  1Z8L A;  3GIU A;  4XPD C;  4KOY A;  2JLM A;  4HNX B;  2VL1 A;  2CIJ A;  3FRM A;  3GYA A;  3G8W A;  3TO9 A;  5JPH A;  3KHZ A;  4FD6 A;  4MFL A;  2EO8 A;  2Z3O A;  2ZED A;  1FNO A;  3FXT A;  2R98 A;  4B5P B;  1PCA A;  1TIQ A;  2ZEO A;  3PB9 X;  1JQG A;  1ZG8 A;  3KR4 A;  3IWW A;  3K9T A;  2Z10 A;  3B3S A;  5G20 A;  3GUX A;  2ZW5 A;  2G0B A;  2P6E A;  3IU2 A;  3F5B A;  5HH1 A;  3TC8 A;  2BUE A;  3B3W A;  4DYO A;  3OWC A;  2J8N A;  2P6F A;  3CDX A;  4XPD B;  1FT7 A;  4KOU A;  2C6P A;  4KSA A;  2IL4 A;  1LAN A;  2Z11 A;  4PXD A;  4A2Z A;  2AFM A;  1XMB A;  4M6I A;  2C27 A;  3UY5 A;  2QML A;  3FEE A;  3RNZ A;  2V77 A;  4X8I A;  3R9F A;  3SI1 A;  5J1Q A;  4J3G A;  3A9L A;  4O23 A;  2REE A;  4B5O A;  3L2N A;  3TO7 A;  1YVK A;  2QEC A;  1YLO A;  4X3R A;  2PCU A;  5HVF A;  4FUU A;  5KTD A;  3KL9 A;  1ZG9 A;  5ISV A;  1YSJ A;  5G22 A;  3HUV A;  2CTB A;  4JXR A;  4R6T A;  3PZJ A;  4AG9 A;  3DR6 A;  5DWN A;  3D4U A;  2Z3L A;  1ZG7 A;  4OAD A;  2PJ4 A;  2REF A;  4L89 A;  4ONU A;  3FB3 A;  4IF5 A;  5LYI A;  3WR7 A;  4B12 A;  1BAV A;  4OC5 A;  2KCW A;  4AXV A;  4BBH A;  2POK A;  3LOD A;  1K4J A;  2VI7 A;  1H8L A;  3SXO A;  5G21 A;  4E0A A;  2FL4 A;  2Q0Y A;  4FD4 A;  2PR8 A;  3NH4 A;  4OID A;  3PB6 X;  4UIB A;  4KOR A;  3KGQ A;  4MFJ A;  4CGN A;  4F9V A;  2O4H A;  5IB9 A;  4EFD A;  3SXN A;  3CXP A;  2PJ3 A;  1BPN A;  4C68 A;  1Y7R A;  1A2Z A;  1KWM A;  1BOB A;  2FIA A;  4UBR A;  1QQ9 A;  1X10 A;  3PEI A;  2V8V A;  2C6G A;  3LWU A;  2AFX A;  1TF8 A;  4NGR A;  4PV6 A;  4Y49 B;  2OZU A;  3DLJ A;  1I1D A;  2G9D A;  4MFQ A;  4KVX A;  3FIX A;  2ODF A;  4CGL A;  4QB9 A;  2Z3N A;  5F49 A;  1JWQ A;  3VAT A;  2C6C A;  3NFZ A;  4KSI A;  4B11 A;  4FD7 A;  1Z4E A;  4CAF A;  2QIR A;  4MCR A;  4TNU A;  4CAX A;  4CS0 B;  2V8H A;  1Z5R A;  4MI4 A;  3TX8 A;  2ZW7 A;  5AGE A;  3IFE A;  3RZA A;  3DSB A;  4C2X A;  1XEB A;  1M4G A;  3CZX A;  3NH5 A;  1TF9 A;  4QBJ A;  1TKJ A;  5IX3 A;  4OC2 A;  1R3N A;  4PXB A;  4B6Z A;  3D7F A;  3IGR A;  3WC5 A;  4CYN A;  1NE9 A;  1ZLH A; 
#chains in the Genus database with same CATH homology
 2OZH A;  1UFH A;  4KLW A;  4H6Z A;  2BEI A;  3F8K A;  4KLV A;  4KUA A;  4MFZ A;  3TTH A;  5EBV A;  4JWP A;  1XE4 A;  2P0W A;  2ZPA A;  4CAV A;  4UA3 A;  2I79 A;  5I0C A;  3LD2 A;  2ZW4 A;  1XIX A;  1R57 A;  5DWM A;  1YX0 A;  4MY3 A;  1S5K A;  2PQ8 A;  4GS4 A;  4KUB A;  4CRY B;  3DDD A;  4ORF A;  4F0Y A;  3IWE A;  2Q4V A;  2J8M A;  3K9U A;  1YR0 A;  4CAW A;  5C82 A;  4E8O A;  1YLE A;  4LUA A;  2HV2 A;  4U9Y A;  3VWD A;  3CXS A;  4BMH A;  2R8V A;  3R1K A;  3ZJ0 A;  2PC1 A;  3MGD A;  3W6X A;  1KUY A;  3VWE A;  1S7N A;  2CNM A;  4KOX A;  4JJX A;  2H5M A;  2CNS A;  4A31 A;  4AVA A;  1GHE A;  4JXQ A;  1ZO0 A;  2Q4Y A;  4KS9 A;  5F46 A;  4MJ8 A;  4AB7 A;  4A95 A;  2RC4 A;  4DNC A;  4NCZ A;  5F48 A;  1QST A;  3W91 A;  2B4D A;  2CY2 A;  4CAE A;  2FT0 A;  2X7B A;  4F6A A;  2J8R A;  1MJ9 A;  4PK3 A;  4UFV A;  5A28 A;  2FCK A;  2PSW A;  3EFA A;  5IV0 A;  4CGM A;  4RI1 A;  1XMT A;  3D2M A;  3GY9 A;  3F0A A;  4AG7 A;  1S60 A;  4QVT A;  4KSF A;  4MFK A;  2VBQ A;  2FXF A;  1QSN A;  4KOS A;  4JLY A;  3R9E A;  2B5G A;  4B14 A;  1M4D A;  4Y49 C;  2BSW A;  2D4O A;  2Q7B A;  4NF1 A;  4CYQ A;  1LRZ A;  1P4N A;  4U9Z A;  2WPW A;  1N71 A;  3T9Y A;  1IYK A;  2OZG A;  2VZZ A;  3ZZI A;  5AG5 A;  3S6G A;  4E2A A;  2YGW A;  3H4Q A;  2B58 A;  4C7I A;  5GCN A;  1IIC A;  3D8P A;  1IYL A;  5HMN A;  3S6H A;  2Q44 A;  2ZW6 A;  1P0H A;  4Q36 A;  4HNW B;  5EC4 A;  5KTC A;  5A27 A;  2EUI A;  4PK2 A;  4KOT A;  3DR8 A;  2JDC A;  4H89 A;  1Y9K A;  3NE7 A;  3I3G A;  2YNE A;  1XF8 A;  2A4N A;  1QSM A;  4RS2 A;  2JDD A;  4OLL A;  3QAH A;  4KOV A;  4AVC A;  1I12 A;  1Q2D A;  2DXQ A;  2NMT A;  1VHS A;  3BJ7 A;  1RXT A;  1U6M A;  4YRH A;  1M4I A;  4JD6 A;  3I9S A;  3KKW A;  2PR1 A;  1M44 A;  4KOW A;  1SQH A;  2WSA A;  1OZP A;  3EXN A;  4A33 A;  2B4D B;  4XNH B;  1Z4R A;  2D4P A;  5BWA B;  4X5K A;  2ZXV A;  3BLN A;  4XPL A;  5J8C A;  5J8F A;  3EY5 A;  2FS5 A;  2B3V A;  5CNP A;  2Z3M A;  3FYN A;  4KVO E;  3T90 A;  1KUV A;  1S7K A;  5E96 A;  4CYO A;  2CNT A;  4H6U A;  3E0K A;  1L0C A;  5AG4 A;  4MFP A;  4M3S A;  3N7Z A;  5KTA A;  2B5G B;  5F47 A;  4M85 A;  4UWI A;  3JVN A;  2PDO A;  4UFW A;  3QB8 A;  1CM0 A;  3DNS A;  5G1Z A;  4R3K A;  2Z3P A;  3S6F A;  3TCV A;  4F0X A;  2F5I A;  4HNY B;  1MJB A;  4R9M A;  2VQY A;  3TT2 A;  2GAN A;  1KUX A;  2EVN A;  2DPS A;  3EC4 A;  2R1I A;  5H84 A;  4A32 A;  4I49 A;  3SHP A;  5AG6 A;  4NEX A;  3V8I A;  1QSR A;  4QUS A;  5IB0 A;  3TO6 A;  3W6S A;  4FD5 A;  1WK4 A;  4YGO A;  3BJ8 A;  2VZY A;  1S7L A;  2JEV A;  3B8G A;  1M1D A;  4OAE A;  1B6B A;  3TE4 A;  2AJ6 A;  4R57 A;  3PGP A;  2YNC A;  4CGP A;  3IU1 A;  4IUS A;  4UCM A;  3GKR A;  1MJA A;  2G3A A;  2B3U A;  4XPK A;  3R95 A;  5JQ4 A;  4R3L A;  4MBU A;  2VXK A;  3D2P A;  3R9G A;  2CXA A;  4C2Z A;  2O28 A;  3CXQ A;  4NXY A;  4K30 A;  2FIW A;  1Q2C A;  2AE6 A;  1V0C A;  4EVY A;  2Z0Z A;  3JTK A;  4YFJ A;  4L8A A;  3R96 A;  2R7H A;  1CJW A;  1IID A;  1ON0 A;  2GE3 A;  4C7H A;  1Y9W A;  4ZGY B;  3EO4 A;  4C2Y A;  4U5Y A;  4R87 A;  3P2F A;  3PP9 A;  4NSQ A;  1YVO A;  4QC6 A;  2DPT A;  4UCN A;  1WWZ A;  4A30 A;  4B5P A;  4XNH C;  2G3T A;  3IWG A;  1J4J A;  1IB1 E;  5AG7 A;  5H86 A;  3FNC A;  1RO5 A;  1PUA A;  4CGO A;  4LX9 A;  3JUW A;  2K5T A;  3TOA A;  5C88 A;  4HKF A;  5FVJ A;  2WUU A;  2YNC C;  1Q2Y A;  2OH1 A;  1NMT A;  2HQY A;  1B87 A;  4KZT A;  1QSO A;  4Q38 A;  4B10 A;  2B4B A;  1YGH A;  1Z9U A;  4KVM E;  2OB0 A;  2BL1 A;  1S3Z A;  4AVB A;  2WPX A;  2PRB A;  1S7F A;  2YND A;  3P2H A;  3RYO A;  1MK4 A;  2FSR A;  4MHD A;  2I00 A;  2GIV A;  2Z3K A;  3H5Z A;  2ATR A;  4MY0 A;  3D3S A;  3G3S A;  4CYP A;  4II9 A;  3S6K A;  3C26 A;  1FY7 A;  3TOB A;  1BO4 A;  2Q04 A;  1YRE A;  2HUZ A;  1NSL A;  4ZBG A;  1YK3 A;  1VKC A;  3FBU A;  4UFX A;  4B13 A;  2ARH A;  4UCP A;  4PSW A;  4CRZ B;  1PU9 A;  2OU2 A;  3TFY A;  2FE7 A;  4UWJ A;  1KZF A;  2P6G A;  4PSX A;  2Y0M A;  1I21 A;  2VEZ A;  4XPD C;  4KOY A;  2JLM A;  4HNX B;  3FRM A;  3GYA A;  3G8W A;  3TO9 A;  5JPH A;  4FD6 A;  4MFL A;  2Z3O A;  3FXT A;  2R98 A;  4B5P B;  1TIQ A;  2Z10 A;  5G20 A;  2ZW5 A;  2G0B A;  2P6E A;  3IU2 A;  3F5B A;  5HH1 A;  2BUE A;  3OWC A;  2J8N A;  2P6F A;  4XPD B;  4KOU A;  4KSA A;  2IL4 A;  2Z11 A;  4A2Z A;  2C27 A;  3UY5 A;  2QML A;  3R9F A;  4J3G A;  3A9L A;  2REE A;  4B5O A;  3TO7 A;  1YVK A;  2QEC A;  5KTD A;  5ISV A;  5G22 A;  4JXR A;  3PZJ A;  4AG9 A;  3DR6 A;  5DWN A;  2Z3L A;  4OAD A;  2REF A;  4L89 A;  4ONU A;  3FB3 A;  4IF5 A;  4B12 A;  3WR7 A;  2KCW A;  4BBH A;  3LOD A;  1K4J A;  2VI7 A;  3SXO A;  5G21 A;  4E0A A;  2FL4 A;  2Q0Y A;  4FD4 A;  2PR8 A;  4KOR A;  4MFJ A;  4CGN A;  3SXN A;  3CXP A;  4C68 A;  1Y7R A;  1BOB A;  2FIA A;  4UBR A;  4PV6 A;  4Y49 B;  2OZU A;  1I1D A;  4MFQ A;  4KVX A;  3FIX A;  4CGL A;  4QB9 A;  2Z3N A;  5F49 A;  4B11 A;  4CAF A;  4FD7 A;  1Z4E A;  2QIR A;  4CAX A;  4CS0 B;  4MI4 A;  2ZW7 A;  5AGE A;  3DSB A;  4C2X A;  1XEB A;  1M4G A;  4QBJ A;  5IX3 A;  3IGR A;  4CYN A;  1NE9 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...