3PBBA

Crystal structure of human secretory glutaminyl cyclase in complex with pbd150
Total Genus 109
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
109
sequence length
329
structure length
323
Chain Sequence
ASAWPEEKNYHQPAILNSSALRQIAEGTSISEMWQNDLQPLLIERYPGSPGSYAARQHIMQRIQRLQADWVLEIDTFLSQTPYGYRSFSNIISTLNPTAKRHLVLACHYDSKYFSHWNNRVFVGATDSAVPCAMMLELARALDKKLLSLKPDLSLQLIFFDGEEAFLHWSPQDSLYGSRHLAAKMASTPHPPGARGTSQLHGMDLLVLLDLIGAPNPTFPNFFPNSARWFERLQAIEHELHELGLLKDHSLEGRYFQNYSYGGVIQDDHIPFLRRGVPVLHLIPSPFPEVWHTMDDNEENLDESTIDNLNKILQVFVLEYLHL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structures of human Golgi-resident glutaminyl cyclase and its complexes with inhibitors reveal a large loop movement upon inhibitor binding
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase/transferase inhibitor
molecule keywords Glutaminyl-peptide cyclotransferase
total genus 109
structure length 323
sequence length 329
chains with identical sequence B
ec nomenclature ec 2.3.2.5: Glutaminyl-peptide cyclotransferase.
pdb deposition date 2010-10-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF04389 Peptidase_M28 Peptidase family M28
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.630.10 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Zn peptidases 3pbbA00
3FECA 4R8FA 4FBEA 4O23A 4UEFA 1KWMA 2QJ8A 4YU9A 4G1PA 4JZ0A 1Z8LA 2C6CA 1CX8A 5K8NA 1F2OA 2NSMA 5LYDA 1H8LA 5IB9A 1ARLA 4MHYA 4MCPA 2C1CA 2AFZA 1JQGA 4EFDA 3B3TA 3V7ZA 5F09A 2PJ2A 3GLJA 1EE3P 3B3VA 3IFEA 3NFZA 2AFXA 2C6PA 3IWWA 2FVGA 1ELLP 1LANA 2XEJA 1VIXA 1FNOA 2JEWA 2ZENA 5LRKA 3WC5A 3ISZA 1AYEA 3D67A 1LOKA 3BI1A 2PE3A 4ONWA 2NYQA 3FX6A 3SI1A 4UEEA 3PB4X 5LRJA 3HUVA 4MHPA 3PBEA 2GU2A 2PJ6A 1ZG7A 3IJ3A 1IY7A 3LWUA 4R76A 2PJ4A 3FMCA 4RUHA 1ZG8A 4EWTA 5JGFA 4OC2A 2ZEGA 2ZEEA 1XMBA 3KQXA 1OBRA 1TKFA 3SJEA 3TX8A 2IJZA 2VL1A 4MHNA 2F7VA 4PXDA 2CIJA 4IAVA 1LAPA 8CPAA 1NSAA 3VH9A 1LFWA 3WC6A 4F8ZA 1HEEA 1VGYA 2PJ9A 3IO1A 4R7MA 4ZY0A 2AFSA 2BCOA 3KHZA 1CPXA 5D8NA 2Q43A 1VHEA 4PPZA 4NGRA 4OC5A 3VARA 2ANPA 5I4MA 4H2KA 4NGTA 4NFRA 2O4HA 3WT4A 1CPSA 4P4EA 4AXVA 1PYTB 4ZI6A 3RZAA 2RFHA 3PB9X 3BXMA 1ELMP 2PCUA 5K8OA 4NGMA 1F57A 2RB7A 4MCRA 3ISXA 4OC3A 2G9DA 3S9MA 3S9LA 2O53A 1QMUA 3HLPA 1IGBA 1VHOA 3PB6X 3D7DA 4UEZA 1BPNA 3IEHA 2ZEFA 1AMPA 2POKA 4TWEA 3SI0A 1TKJA 5HVHA 4DUKA 4A37A 2GREA 1RTQA 2ZOGA 2WYRA 4MRIA 1QQ9A 4OC4A 2Q4ZA 3NH5A 3QNVA 3B7IA 2EWBA 4BD9A 2WZNA 1DTDA 2AFUA 3KL9A 1TKHA 2ZEOA 1Y0RA 3KR4A 3VATA 3FVLA 1CP6A 5LRGA 1Q7LA 4X8IA 4X3RA 2DEAA 2AFMA 4DYOA 1TXRA 5ELYA 5LYLA 2PJ5A 1LCPA 3SJFA 3NH4A 3MRUA 1YSJA 1CBXA 2ZEMA 3NH8A 5HVFA 3IC1A 3D68A 2PVWA 4TNUA 1ZG9A 4P45A 2QVPA 2V8VA 1GYTA 3K9TA 3D4UA 4MCSA 1LAMA 1Y0YA 2ABZA 2PIZA 2Q51A 3BHXA 4F9VA 2PJ3A 3MN8A 4FAIA 2V8DA 4W9YA 7CPAA 2GLJA 3LMSA 3D7FA 5HXDA 3TC8A 4MXUA 4IHMA 4UIBA 1R3NA 3PB7X 4P4DA 3CPAA 2CF4A 1BLLE 2IMOA 1CP7A 1XFOA 4KSIA 4A39A 4OP4A 4LQGA 1YMEA 4UIAA 1Z5RA 1BAVA 1HDUA 2EK9A 3WC7A 3H8GA 3KQZA 1R43A 4MCQA 3PFEA 3DLJA 3D66A 4PXCA 4PXBA 2PJ1A 2XEGA 1XBUA 3B3SA 2PJAA 4P4JA 4PQAA 4Q7AA 2C6GA 5CPAA 4MMOA 2PJ0A 4R6TA 2CTCA 1CG2A 2HB6A 4UF4A 4P6YA 4FUUA 4OC0A 3SI2A 1FT7A 4ZYQA 5K8PA 2ZEDA 2CTBA 2PJCA 4WWVA 2V8HA 3D7GA 3SJGA 1ZLHA 1Z2LA 2EK8A 3PEIA 5DS0A 3H8FA 4ZY2A 2HC9A 3PBBA 1ARMA 4NGQA 3RAMA 2BO9A 1TF8A 2IQ6A 3CT9A 3DGVA 2PJ7A 2GLFA 4NJRA 3KI9A 3WABA 3CDXA 3BI0A 3FEDA 6CPAA 3KASA 2PIYA 2ZOFA 5LYFA 1TF9A 3PB8X 4OIDA 1XRYA 2JBJA 5JM6A 1Y7EA 1F2PA 2J9AA 1XJOA 2ZELA 4CPAA 2ZEPA 1UWYA 1HDQA 4P4IA 2PVVA 4FWUA 3L2NA 2V77A 3CPXA 3S9NA 2PJ8A 3FEEA 3PRTA 3B3CA 4YWYA 2AFOA 3FH4A 2F8HA 3H8EA 1YLOA 4GM5A 3RBUA 4P10A 4P44A 3FJUA 5THWA 3GUXA 1ZLIA 3IIBA 4P4BA 2PJBA 3K2KA 2BOAA 3NA6A 4A94A 5HVGA 3KGQA 4NJQA 4P4FA 5K8MA 3B2YA 2I3CA 2QYVA 3N5FA 4K3NA 4ZX9A 4F9UA 2ZEHA 3V38A 5LYIA 2OOTA 4NGSA 4ZX8A 4MHZA 4WJBA 5CBMA 5J1QA 1YW6A 3KZWA 4X2TA 3KR5A 4NGNA 3SJXA 4OMEA 4A38A 2OR4A 2JBKA 2PRQA 3D7HA 4DJLA 2V8GA 1YW4A 3KHXA 1DE4C 4B6ZA 4EMEA 4PXEA 5D29A 3B3WA 1PCAA 4IK2A 4ZY1A 3T8WA 4OIWA 2AFWA 2XEFA 4OKOA 2XEIA 4OC1A 3GB0A 4JYWA 3JRUA 3PFOA 4NGPA 3B35A 1BPMA 3FF3A 5JH9A 4Z65A 3I1UA 1M4LA
chains in the Genus database with same CATH superfamily
3FECA 1VHSA 2R8VA 4R8FA 4FBEA 4O23A 2Z3LA 1GHEA 4J3GA 4UEFA 3TO6A 2B5GB 4UBRA 1KWMA 2QJ8A 4YU9A 4G1PA 4JZ0A 1Q2CA 2G3TA 3BJ8A 1Z8LA 4CAXA 2C6CA 2ZW4A 3I9SA 2JEVA 1CX8A 4Y49C 5K8NA 4GS4A 1Y7RA 2JDDA 1F2OA 2Z11A 4L8AA 4A95A 2ZW7A 5AG4A 2NSMA 5LYDA 1H8LA 4LQ6A 5IB9A 1ARLA 4MHYA 4ONUA 4MCPA 5HH1A 2C1CA 3H5ZA 4A33A 1MJAA 2AFZA 2P6GA 1JQGA 4EFDA 3B3TA 3V7ZA 4ZBGA 3IGRA 5F09A 5EMIA 2PJ2A 3GLJA 1EE3P 3B3VA 4MFQA 4JXQA 3IFEA 3D3SA 1Z4EA 4PK2A 5C82A 3NFZA 2AFXA 2DF5A 2PC1A 4FD7A 4M6IA 2FL4A 2I00A 2C6PA 2CNSA 4KSAA 3IWWA 3G8WA 5I0CA 2FVGA 5G20A 2K5TA 1ELLP 2ARHA 1LANA 4XPDB 3S6KA 3T90A 2RC4A 5EC4A 4HNWB 3IWGA 4U9ZA 3R95A 3CXQA 4RN7A 2D4OA 2XEJA 5ISVA 4CGNA 1VIXA 1FNOA 2JEWA 3BJ7A 3FBUA 2ZENA 3GIUA 3GYAA 3S6HA 3WC5A 3ISZA 5LRKA 2YGWA 1AYEA 3PP9A 4CGLA 3D67A 1LOKA 3BI1A 2PE3A 3IU2A 2NYQA 3FX6A 4ONWA 4MFJA 3SI1A 4JD6A 3JUWA 4UEEA 3PB4X 4MFLA 4C7HA 5LRJA 3HUVA 4MHPA 3PBEA 5G1ZA 2GU2A 3RO0A 2B3UA 2PJ6A 3TTHA 4KVXA 1ZG7A 2G3AA 3IJ3A 3SXOA 1IY7A 3LWUA 4R76A 2PJ4A 5E96A 2ZXVA 2FIAA 2BL1A 3FMCA 4RUHA 1ZG8A 4EWTA 2WUUA 5F49A 5JGFA 4OC2A 2ZW5A 1I1DA 4M6HA 2FCKA 2ZEGA 2ZEEA 1WWZA 2Z3PA 3EC4A 1XMBA 3KQXA 3MGDA 1OBRA 1TKFA 2YNCC 3SJEA 1B87A 3CXSA 3TX8A 2IJZA 5JPHA 2Q7SA 5FVJA 5BWAB 2VL1A 2AE6A 3JTKA 4CYPA 4MHNA 2FIWA 2F7VA 1RXTA 2EO8A 3IU1A 4Q38A 1J4JA 1TIQA 4PXDA 5J8CA 1M44A 2CIJA 4MJ8A 4XPKA 1LRZA 4IAVA 1LAPA 8CPAA 1NSAA 2VI7A 3VH9A 4EVYA 1LFWA 3WC6A 3GY9A 4F8ZA 4ZGYB 4IUSA 1HEEA 1VGYA 2PR1A 3LODA 5JQ4A 2PJ9A 5AG7A 1JWQA 1M4IA 4NEXA 5DWMA 3IO1A 4R7MA 4ZY0A 3TO9A 1Y9WA 2AFSA 1X10A 3PGPA 2BCOA 1M4GA 2OH1A 3KHZA 1CPXA 1S7KA 2CY2A 4F6AA 3C26A 1L0CA 5CNPA 5D8NA 3F5BA 3KKWA 2REEA 2Q43A 4MFPA 5AG5A 1VHEA 4YFJA 4II9A 2A4NA 3BLNA 4PPZA 2Q04A 4NGRA 4OC5A 3ZZIA 4KOYA 5KTCA 4Y49B 2PQ8A 4U5YA 3VARA 3TT2A 1S7NA 2ANPA 5I4MA 4H2KA 3DDDA 4NGTA 4NFRA 2O4HA 3WT4A 2QIRA 4R57A 4MFZA 1CPSA 4C7IA 4JLYA 1CM0A 1X12A 3DR6A 3EY5A 4M6GA 4BBHA 1IOIA 1KUVA 1KZFA 2DXQA 3LACA 2C27A 4HNYB 1PYTB 4P4EA 4AXVA 4ZI6A 1YREA 1SQHA 2VZZA 3G3SA 3RZAA 1QSRA 2RFHA 3PB9X 1NE9A 4CGPA 4QVTA 1IYKA 2OB0A 2REFA 2P6FA 3P2FA 3BXMA 4L89A 4E8OA 2EUIA 4KOXA 1ELMP 1MK4A 2PCUA 3ZJ0A 3FB3A 5K8OA 4NGMA 4B14A 1F57A 2RB7A 4MCRA 3ISXA 4OC3A 4R3KA 2ZPAA 4B10A 4A30A 2G9DA 3I3GA 4E2AA 2FSRA 1S7LA 3DNSA 3R96A 3S9MA 2O53A 1QMUA 3R9GA 2JLMA 4PSXA 3HLPA 4RS2A 4A32A 3S9LA 1IGBA 4KUAA 1VHOA 1YLEA 3OWCA 3PB6X 3D7DA 4KSFA 2PSWA 4PV6A 4UEZA 1BPNA 4LX9A 4B5OA 4NXYA 3D8PA 3IEHA 2CNMA 2ZEFA 4CYNA 3B8GA 3DR8A 1AMPA 2POKA 2FT0A 4TWEA 3SI0A 1TKJA 2VBQA 5HVHA 4DUKA 4UWIA 1YVOA 4OADA 1R57A 5DWNA 4A37A 4AVCA 2GREA 1RTQA 1NSLA 3TCVA 4CYQA 5A28A 2ZOGA 2DPSA 3IWEA 3EXNA 1Z9UA 2WYRA 4BMHA 4MRIA 4AVAA 1QQ9A 1BOBA 4OC4A 1YK3A 3FYNA 4CAFA 2Q4ZA 3NH5A 1S7FA 2D4PA 3QNVA 3B7IA 2EWBA 4UCMA 4MBUA 4BD9A 4CYOA 2YNEA 3P2HA 4QUSA 4E0AA 2WZNA 1DTDA 2Q4VA 4C2YA 4KVOE 2AFUA 3KL9A 1IICA 2B5GA 4MI4A 1S5KA 4YRHA 1QSMA 4R9MA 2O28A 4F0XA 2BUEA 1TKHA 2P0WA 4JWPA 2ZEOA 1Y0RA 3KR4A 5C88A 2FXFA 2ODFA 3VATA 4XNHC 3FVLA 3R9FA 2AJ6A 1CP6A 4UFVA 5LRGA 1I12A 1Q7LA 1YR0A 2HUZA 4X8IA 4X3RA 2DEAA 1XIXA 5J8FA 2AFMA 4DYOA 1TXRA 2HV2A 1XMTA 4B5PB 4ORFA 2B4BA 2I79A 3D2MA 5ELYA 5LYLA 2PJ5A 1LCPA 2R1IA 2Z3NA 3QB8A 3SJFA 3V8IA 4PK3A 3S6FA 3DSBA 3NH4A 3MRUA 1YSJA 1CBXA 2B4DA 2ZEMA 4GXHA 3NH8A 2J8NA 4KZTA 5HVFA 3IC1A 3SXNA 4H6ZA 2CXAA 4UA3A 2P6EA 4NSQA 2Y0MA 3D68A 4KOUA 4BINA 2EBJA 2PVWA 4TNUA 2G0BA 3EO4A 1ZG9A 4P45A 1IOFA 2B58A 2QVPA 2V8VA 2ATRA 4KORA 3VWDA 3W91A 1GYTA 4A2ZA 2YNCA 3K9TA 3D4UA 4MCSA 1LAMA 1Q2YA 3H4QA 1Y0YA 2ABZA 2PIZA 2Q51A 2VEZA 3CZXA 4KVME 4UCPA 4XNHB 5IV0A 3BHXA 4KOTA 4F9VA 2PJ3A 3MN8A 1ON0A 4FAIA 4AB7A 2V8DA 4W9YA 4QC6A 7CPAA 2GLJA 3LMSA 1K4JA 4CS0B 1A2ZA 3D7FA 5HXDA 3TC8A 4MXUA 4IHMA 4UIBA 4KUBA 2FE7A 2CNTA 4MHDA 2R7HA 1R3NA 1BO4A 1RO5A 3PB7X 4P4DA 2FS5A 3CPAA 4C68A 2CF4A 1BLLE 2QMLA 2IMOA 4R3LA 1CP7A 1XFOA 3QAYA 4KSIA 1YGHA 4A39A 4OP4A 2J8MA 4LQGA 3TFYA 1YMEA 4RI1A 4UIAA 2PDOA 1Z5RA 2PRBA 2BEIA 2Q0YA 4HPSA 1B6BA 1CJWA 5KTAA 1BAVA 1N71A 1HDUA 3W6SA 2EK9A 2QECA 3WC7A 3H8GA 3KQZA 4UFWA 1R43A 4MCQA 2B3VA 3PFEA 3N7ZA 5F48A 2OZGA 3DLJA 3D66A 2NMTA 4PXCA 4PXBA 5G21A 4CAWA 4X5KA 2PJ1A 2XEGA 1S3ZA 1XBUA 1XE4A 3B3SA 4F0YA 2PJAA 4P4JA 4PQAA 4Q7AA 4JJXA 1AUGA 2C6GA 2F5IA 5CPAA 4MMOA 4HNXB 5IX3A 1P4NA 2PJ0A 4R6TA 2CTCA 1CG2A 4CRZB 2HB6A 2Z3MA 4UF4A 4P6YA 4FUUA 3PZJA 3LD2A 1QSTA 1FT7A 1KUYA 2WPWA 4OC0A 4UWJA 3SI2A 4KOVA 4AVBA 2ZEDA 4ZYQA 3A9LA 5K8PA 2CTBA 2PJCA 4C2ZA 1M1DA 4WWVA 2V8HA 3D7GA 3SJGA 1ZLHA 3GKRA 1Z2LA 4UCNA 2EK8A 3W6XA 3PEIA 5DS0A 3H8FA 4ZY2A 4CRYB 3K9UA 4YGOA 2HC9A 1Z8TA 4QB9A 3PBBA 1ARMA 4NGQA 5H84A 3RAMA 2BO9A 3RNZA 4KLWA 4FD4A 1U6MA 1FY7A 1TF8A 4NF1A 2IQ6A 3CT9A 1P0HA 3FNCA 4OLLA 3DGVA 2GANA 4H6UA 2PJ7A 3UY5A 2GLFA 1XEBA 3D2PA 2H5MA 4M3SA 4AG7A 2R98A 2OU2A 3R9EA 4NJRA 2Q4YA 1Q2DA 1Z8XA 4M85A 3KI9A 2OZHA 3WABA 1ZO0A 1IB1E 3CDXA 3BI0A 3FEDA 3TO7A 5IB0A 6CPAA 3KASA 2PIYA 4DNCA 4CGMA 4MFKA 2ZOFA 5LYFA 2GE3A 1I21A 1TF9A 3JVNA 2GFQA 1XRYA 3PB8X 4OIDA 2JBJA 5H86A 4MY0A 4C2XA 5JM6A 2KCWA 1VKCA 2GIVA 1XF8A 1F2PA 1Y7EA 3F0AA 2J9AA 1XJOA 4K30A 2ZELA 1IU8A 2DPTA 4CPAA 3F8KA 2ZEPA 3S6GA 2J8RA 1UWYA 1QSOA 1HDQA 2Z10A 4A31A 4KOWA 4P4IA 2BSWA 2PVVA 2WPXA 3L2NA 4FWUA 2V77A 3CPXA 3S9NA 2PJ8A 1QSNA 3FEEA 3PRTA 1M4DA 3B3CA 2VXKA 4YWYA 4FD5A 1UFHA 2ZW6A 1XOVA 2AFOA 4XPDC 4CAEA 3FH4A 2F8HA 3H8EA 1YLOA 2Q44A 2WSAA 4GM5A 4P10A 4P44A 5G22A 3RBUA 3RYOA 3FJUA 5F46A 5AG6A 2OZUA 2JDCA 2PR8A 5THWA 3NE7A 3SHPA 3GUXA 1ZLIA 3IIBA 3FXTA 4P4BA 1IIDA 2PJBA 3FRMA 3K2KA 2BOAA 3TOBA 1MJBA 3NA6A 4A94A 5HVGA 3CXPA 3R1KA 5GCNA 3KGQA 4NJQA 4P4FA 5K8MA 3B2YA 1Y9KA 2I3CA 2QYVA 3N5FA 4KOSA 4U9YA 4XPLA 4K3NA 4ZX9A 4KS9A 1MJ9A 3TE4A 4CGOA 4F9UA 4MY3A 2VQYA 3T9YA 2ZEHA 3V38A 5LYIA 2IL4A 3WR7A 2OOTA 1YQEA 2Z0ZA 4NGSA 2HQYA 4ZX8A 4JXRA 4MHZA 4WJBA 5EBVA 3E0KA 4LUAA 4AG9A 4B11A 4KLVA 4QBJA 1YVKA 5CBMA 1YW6A 5J1QA 2EVNA 4CAVA 3KZWA 5A27A 4X2TA 2YNDA 4NCZA 4OAEA 4H89A 3KR5A 5F47A 4NGNA 1PUAA 3SJXA 5HMNA 4R87A 4IF5A 4OMEA 4A38A 2OR4A 5KTDA 2JBKA 1NMTA 2PRQA 3D7HA 4DJLA 2V8GA 1YW4A 4B13A 3KHXA 1DE4C 4UFXA 4B6ZA 4EMEA 4PXEA 5D29A 4I49A 1KUXA 3B3WA 4PSWA 3EFAA 1PCAA 5AGEA 1Z8WA 1WK4A 4IK2A 4ZY1A 3T8WA 4OIWA 2AFWA 3FIXA 2VZYA 1V0CA 4FD6A 3TOAA 2XEFA 4OKOA 2XEIA 1PU9A 4B5PA 4B12A 4OC1A 2B4DB 3GB0A 4JYWA 3VWEA 1S60A 1Z4RA 3JRUA 3NE8A 1OZPA 4Q36A 2Q7BA 1IYLA 3PFOA 2X7BA 4NGPA 2Z3OA 3B35A 3QAHA 1BPMA 3FF3A 5JH9A 2Z3KA 4Z65A 4HKFA 3I1UA 1M4LA 1YX0A
chains in the Genus database with same CATH topology
3FECA 4R8FA 4FBEA 4O23A 4UEFA 1KWMA 2QJ8A 4YU9A 4G1PA 4JZ0A 1Z8LA 2C6CA 1CX8A 5K8NA 1F2OA 2NSMA 5LYDA 1H8LA 5IB9A 1ARLA 4MHYA 4MCPA 2C1CA 2AFZA 1JQGA 4EFDA 3B3TA 3V7ZA 5F09A 2PJ2A 3GLJA 1EE3P 3B3VA 3IFEA 3NFZA 2AFXA 2C6PA 3IWWA 2FVGA 1ELLP 1LANA 2XEJA 1VIXA 1FNOA 2JEWA 2ZENA 5LRKA 3WC5A 3ISZA 1AYEA 3D67A 1LOKA 3BI1A 2PE3A 4ONWA 2NYQA 3FX6A 3SI1A 4UEEA 3PB4X 5LRJA 3HUVA 4MHPA 3PBEA 2GU2A 2PJ6A 1ZG7A 3IJ3A 1IY7A 3LWUA 4R76A 2PJ4A 3FMCA 4RUHA 1ZG8A 4EWTA 5JGFA 4OC2A 2ZEGA 2ZEEA 1XMBA 3KQXA 1OBRA 1TKFA 3SJEA 3TX8A 2IJZA 2VL1A 4MHNA 2F7VA 4PXDA 2CIJA 4IAVA 1LAPA 8CPAA 1NSAA 3VH9A 1LFWA 3WC6A 4F8ZA 1HEEA 1VGYA 2PJ9A 3IO1A 4R7MA 4ZY0A 2AFSA 2BCOA 3KHZA 1CPXA 5D8NA 2Q43A 1VHEA 4PPZA 4NGRA 4OC5A 3VARA 2ANPA 5I4MA 4H2KA 4NGTA 4NFRA 2O4HA 3WT4A 1CPSA 4P4EA 4AXVA 1PYTB 4ZI6A 3RZAA 2RFHA 3PB9X 3BXMA 1ELMP 2PCUA 5K8OA 4NGMA 1F57A 2RB7A 4MCRA 3ISXA 4OC3A 2G9DA 3S9MA 3S9LA 2O53A 1QMUA 3HLPA 1IGBA 1VHOA 3PB6X 3D7DA 4UEZA 1BPNA 3IEHA 2ZEFA 1AMPA 2POKA 4TWEA 3SI0A 1TKJA 5HVHA 4DUKA 4A37A 2GREA 1RTQA 2ZOGA 2WYRA 4MRIA 1QQ9A 4OC4A 2Q4ZA 3NH5A 3QNVA 3B7IA 2EWBA 4BD9A 2WZNA 1DTDA 2AFUA 3KL9A 1TKHA 2ZEOA 1Y0RA 3KR4A 3VATA 3FVLA 1CP6A 5LRGA 1Q7LA 4X8IA 4X3RA 2DEAA 2AFMA 4DYOA 1TXRA 5ELYA 5LYLA 2PJ5A 1LCPA 3SJFA 3NH4A 3MRUA 1YSJA 1CBXA 2ZEMA 3NH8A 5HVFA 3IC1A 3D68A 2PVWA 4TNUA 1ZG9A 4P45A 2QVPA 2V8VA 1GYTA 3K9TA 3D4UA 4MCSA 1LAMA 1Y0YA 2ABZA 2PIZA 2Q51A 3BHXA 4F9VA 2PJ3A 3MN8A 4FAIA 2V8DA 4W9YA 7CPAA 2GLJA 3LMSA 3D7FA 5HXDA 3TC8A 4MXUA 4IHMA 4UIBA 1R3NA 3PB7X 4P4DA 3CPAA 2CF4A 1BLLE 2IMOA 1CP7A 1XFOA 4KSIA 4A39A 4OP4A 4LQGA 1YMEA 4UIAA 1Z5RA 1BAVA 1HDUA 2EK9A 3WC7A 3H8GA 3KQZA 1R43A 4MCQA 3PFEA 3DLJA 3D66A 4PXCA 4PXBA 2PJ1A 2XEGA 1XBUA 3B3SA 2PJAA 4P4JA 4PQAA 4Q7AA 2C6GA 5CPAA 4MMOA 2PJ0A 4R6TA 2CTCA 1CG2A 2HB6A 4UF4A 4P6YA 4FUUA 4OC0A 3SI2A 1FT7A 4ZYQA 5K8PA 2ZEDA 2CTBA 2PJCA 4WWVA 2V8HA 3D7GA 3SJGA 1ZLHA 1Z2LA 2EK8A 3PEIA 5DS0A 3H8FA 4ZY2A 2HC9A 3PBBA 1ARMA 4NGQA 3RAMA 2BO9A 1TF8A 2IQ6A 3CT9A 3DGVA 2PJ7A 2GLFA 4NJRA 3KI9A 3WABA 3CDXA 3BI0A 3FEDA 6CPAA 3KASA 2PIYA 2ZOFA 5LYFA 1TF9A 3PB8X 4OIDA 1XRYA 2JBJA 5JM6A 1Y7EA 1F2PA 2J9AA 1XJOA 2ZELA 4CPAA 2ZEPA 1UWYA 1HDQA 4P4IA 2PVVA 4FWUA 3L2NA 2V77A 3CPXA 3S9NA 2PJ8A 3FEEA 3PRTA 3B3CA 4YWYA 2AFOA 3FH4A 2F8HA 3H8EA 1YLOA 4GM5A 3RBUA 4P10A 4P44A 3FJUA 5THWA 3GUXA 1ZLIA 3IIBA 4P4BA 2PJBA 3K2KA 2BOAA 3NA6A 4A94A 5HVGA 3KGQA 4NJQA 4P4FA 5K8MA 3B2YA 2I3CA 2QYVA 3N5FA 4K3NA 4ZX9A 4F9UA 2ZEHA 3V38A 5LYIA 2OOTA 4NGSA 4ZX8A 4MHZA 4WJBA 5CBMA 5J1QA 1YW6A 3KZWA 4X2TA 3KR5A 4NGNA 3SJXA 4OMEA 4A38A 2OR4A 2JBKA 2PRQA 3D7HA 4DJLA 2V8GA 1YW4A 3KHXA 1DE4C 4B6ZA 4EMEA 4PXEA 5D29A 3B3WA 1PCAA 4IK2A 4ZY1A 3T8WA 4OIWA 2AFWA 2XEFA 4OKOA 2XEIA 4OC1A 3GB0A 4JYWA 3JRUA 3PFOA 4NGPA 3B35A 1BPMA 3FF3A 5JH9A 4Z65A 3I1UA 1M4LA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3FEC A;  4R8F A;  4FBE A;  4O23 A;  4UEF A;  1KWM A;  2QJ8 A;  4YU9 A;  4G1P A;  4JZ0 A;  1Z8L A;  2C6C A;  1CX8 A;  5K8N A;  1F2O A;  2NSM A;  5LYD A;  1H8L A;  5IB9 A;  1ARL A;  4MHY A;  4MCP A;  2C1C A;  2AFZ A;  1JQG A;  4EFD A;  3B3T A;  3V7Z A;  5F09 A;  2PJ2 A;  3GLJ A;  1EE3 P;  3B3V A;  3IFE A;  3NFZ A;  2AFX A;  2C6P A;  3IWW A;  2FVG A;  1ELL P;  1LAN A;  2XEJ A;  1VIX A;  1FNO A;  2JEW A;  2ZEN A;  5LRK A;  3WC5 A;  3ISZ A;  1AYE A;  3D67 A;  1LOK A;  3BI1 A;  2PE3 A;  4ONW A;  2NYQ A;  3FX6 A;  3SI1 A;  4UEE A;  3PB4 X;  5LRJ A;  3HUV A;  4MHP A;  3PBE A;  2GU2 A;  2PJ6 A;  1ZG7 A;  3IJ3 A;  1IY7 A;  3LWU A;  4R76 A;  2PJ4 A;  3FMC A;  4RUH A;  1ZG8 A;  4EWT A;  5JGF A;  4OC2 A;  2ZEG A;  2ZEE A;  1XMB A;  3KQX A;  1OBR A;  1TKF A;  3SJE A;  3TX8 A;  2IJZ A;  2VL1 A;  4MHN A;  2F7V A;  4PXD A;  2CIJ A;  4IAV A;  1LAP A;  8CPA A;  1NSA A;  3VH9 A;  1LFW A;  3WC6 A;  4F8Z A;  1HEE A;  1VGY A;  2PJ9 A;  3IO1 A;  4R7M A;  4ZY0 A;  2AFS A;  2BCO A;  3KHZ A;  1CPX A;  5D8N A;  2Q43 A;  1VHE A;  4PPZ A;  4NGR A;  4OC5 A;  3VAR A;  2ANP A;  5I4M A;  4H2K A;  4NGT A;  4NFR A;  2O4H A;  3WT4 A;  1CPS A;  4P4E A;  4AXV A;  1PYT B;  4ZI6 A;  3RZA A;  2RFH A;  3PB9 X;  3BXM A;  1ELM P;  2PCU A;  5K8O A;  4NGM A;  1F57 A;  2RB7 A;  4MCR A;  3ISX A;  4OC3 A;  2G9D A;  3S9M A;  3S9L A;  2O53 A;  1QMU A;  3HLP A;  1IGB A;  1VHO A;  3PB6 X;  3D7D A;  4UEZ A;  1BPN A;  3IEH A;  2ZEF A;  1AMP A;  2POK A;  4TWE A;  3SI0 A;  1TKJ A;  5HVH A;  4DUK A;  4A37 A;  2GRE A;  1RTQ A;  2ZOG A;  2WYR A;  4MRI A;  1QQ9 A;  4OC4 A;  2Q4Z A;  3NH5 A;  3QNV A;  3B7I A;  2EWB A;  4BD9 A;  2WZN A;  1DTD A;  2AFU A;  3KL9 A;  1TKH A;  2ZEO A;  1Y0R A;  3KR4 A;  3VAT A;  3FVL A;  1CP6 A;  5LRG A;  1Q7L A;  4X8I A;  4X3R A;  2DEA A;  2AFM A;  4DYO A;  1TXR A;  5ELY A;  5LYL A;  2PJ5 A;  1LCP A;  3SJF A;  3NH4 A;  3MRU A;  1YSJ A;  1CBX A;  2ZEM A;  3NH8 A;  5HVF A;  3IC1 A;  3D68 A;  2PVW A;  4TNU A;  1ZG9 A;  4P45 A;  2QVP A;  2V8V A;  1GYT A;  3K9T A;  3D4U A;  4MCS A;  1LAM A;  1Y0Y A;  2ABZ A;  2PIZ A;  2Q51 A;  3BHX A;  4F9V A;  2PJ3 A;  3MN8 A;  4FAI A;  2V8D A;  4W9Y A;  7CPA A;  2GLJ A;  3LMS A;  3D7F A;  5HXD A;  3TC8 A;  4MXU A;  4IHM A;  4UIB A;  1R3N A;  3PB7 X;  4P4D A;  3CPA A;  2CF4 A;  1BLL E;  2IMO A;  1CP7 A;  1XFO A;  4KSI A;  4A39 A;  4OP4 A;  4LQG A;  1YME A;  4UIA A;  1Z5R A;  1BAV A;  1HDU A;  2EK9 A;  3WC7 A;  3H8G A;  3KQZ A;  1R43 A;  4MCQ A;  3PFE A;  3DLJ A;  3D66 A;  4PXC A;  4PXB A;  2PJ1 A;  2XEG A;  1XBU A;  3B3S A;  2PJA A;  4P4J A;  4PQA A;  4Q7A A;  2C6G A;  5CPA A;  4MMO A;  2PJ0 A;  4R6T A;  2CTC A;  1CG2 A;  2HB6 A;  4UF4 A;  4P6Y A;  4FUU A;  4OC0 A;  3SI2 A;  1FT7 A;  4ZYQ A;  5K8P A;  2ZED A;  2CTB A;  2PJC A;  4WWV A;  2V8H A;  3D7G A;  3SJG A;  1ZLH A;  1Z2L A;  2EK8 A;  3PEI A;  5DS0 A;  3H8F A;  4ZY2 A;  2HC9 A;  3PBB A;  1ARM A;  4NGQ A;  3RAM A;  2BO9 A;  1TF8 A;  2IQ6 A;  3CT9 A;  3DGV A;  2PJ7 A;  2GLF A;  4NJR A;  3KI9 A;  3WAB A;  3CDX A;  3BI0 A;  3FED A;  6CPA A;  3KAS A;  2PIY A;  2ZOF A;  5LYF A;  1TF9 A;  3PB8 X;  4OID A;  1XRY A;  2JBJ A;  5JM6 A;  1Y7E A;  1F2P A;  2J9A A;  1XJO A;  2ZEL A;  4CPA A;  2ZEP A;  1UWY A;  1HDQ A;  4P4I A;  2PVV A;  4FWU A;  3L2N A;  2V77 A;  3CPX A;  3S9N A;  2PJ8 A;  3FEE A;  3PRT A;  3B3C A;  4YWY A;  2AFO A;  3FH4 A;  2F8H A;  3H8E A;  1YLO A;  4GM5 A;  3RBU A;  4P10 A;  4P44 A;  3FJU A;  5THW A;  3GUX A;  1ZLI A;  3IIB A;  4P4B A;  2PJB A;  3K2K A;  2BOA A;  3NA6 A;  4A94 A;  5HVG A;  3KGQ A;  4NJQ A;  4P4F A;  5K8M A;  3B2Y A;  2I3C A;  2QYV A;  3N5F A;  4K3N A;  4ZX9 A;  4F9U A;  2ZEH A;  3V38 A;  5LYI A;  2OOT A;  4NGS A;  4ZX8 A;  4MHZ A;  4WJB A;  5CBM A;  5J1Q A;  1YW6 A;  3KZW A;  4X2T A;  3KR5 A;  4NGN A;  3SJX A;  4OME A;  4A38 A;  2OR4 A;  2JBK A;  2PRQ A;  3D7H A;  4DJL A;  2V8G A;  1YW4 A;  3KHX A;  1DE4 C;  4B6Z A;  4EME A;  4PXE A;  5D29 A;  3B3W A;  1PCA A;  4IK2 A;  4ZY1 A;  3T8W A;  4OIW A;  2AFW A;  2XEF A;  4OKO A;  2XEI A;  4OC1 A;  3GB0 A;  4JYW A;  3JRU A;  3PFO A;  4NGP A;  3B35 A;  1BPM A;  3FF3 A;  5JH9 A;  4Z65 A;  3I1U A;  1M4L A; 
#chains in the Genus database with same CATH topology
 3FEC A;  1VHS A;  2R8V A;  4R8F A;  4FBE A;  4O23 A;  2Z3L A;  1GHE A;  4J3G A;  4UEF A;  3TO6 A;  2B5G B;  4UBR A;  1KWM A;  2QJ8 A;  4YU9 A;  4G1P A;  4JZ0 A;  1Q2C A;  2G3T A;  3BJ8 A;  1Z8L A;  4CAX A;  2C6C A;  2ZW4 A;  3I9S A;  2JEV A;  1CX8 A;  4Y49 C;  5K8N A;  4GS4 A;  1Y7R A;  2JDD A;  1F2O A;  2Z11 A;  4L8A A;  4A95 A;  2ZW7 A;  5AG4 A;  2NSM A;  5LYD A;  1H8L A;  4LQ6 A;  5IB9 A;  1ARL A;  4MHY A;  4ONU A;  4MCP A;  5HH1 A;  2C1C A;  3H5Z A;  4A33 A;  1MJA A;  2AFZ A;  2P6G A;  1JQG A;  4EFD A;  3B3T A;  3V7Z A;  4ZBG A;  3IGR A;  5F09 A;  5EMI A;  2PJ2 A;  3GLJ A;  1EE3 P;  3B3V A;  4MFQ A;  4JXQ A;  3IFE A;  3D3S A;  1Z4E A;  4PK2 A;  5C82 A;  3NFZ A;  2AFX A;  2DF5 A;  2PC1 A;  4FD7 A;  4M6I A;  2FL4 A;  2I00 A;  2C6P A;  2CNS A;  4KSA A;  3IWW A;  3G8W A;  5I0C A;  2FVG A;  5G20 A;  2K5T A;  1ELL P;  2ARH A;  1LAN A;  4XPD B;  3S6K A;  3T90 A;  2RC4 A;  5EC4 A;  4HNW B;  3IWG A;  4U9Z A;  3R95 A;  3CXQ A;  4RN7 A;  2D4O A;  2XEJ A;  5ISV A;  4CGN A;  1VIX A;  1FNO A;  2JEW A;  3BJ7 A;  3FBU A;  2ZEN A;  3GIU A;  3GYA A;  3S6H A;  3WC5 A;  3ISZ A;  5LRK A;  2YGW A;  1AYE A;  3PP9 A;  4CGL A;  3D67 A;  1LOK A;  3BI1 A;  2PE3 A;  3IU2 A;  2NYQ A;  3FX6 A;  4ONW A;  4MFJ A;  3SI1 A;  4JD6 A;  3JUW A;  4UEE A;  3PB4 X;  4MFL A;  4C7H A;  5LRJ A;  3HUV A;  4MHP A;  3PBE A;  5G1Z A;  2GU2 A;  3RO0 A;  2B3U A;  2PJ6 A;  3TTH A;  4KVX A;  1ZG7 A;  2G3A A;  3IJ3 A;  3SXO A;  1IY7 A;  3LWU A;  4R76 A;  2PJ4 A;  5E96 A;  2ZXV A;  2FIA A;  2BL1 A;  3FMC A;  4RUH A;  1ZG8 A;  4EWT A;  2WUU A;  5F49 A;  5JGF A;  4OC2 A;  2ZW5 A;  1I1D A;  4M6H A;  2FCK A;  2ZEG A;  2ZEE A;  1WWZ A;  2Z3P A;  3EC4 A;  1XMB A;  3KQX A;  3MGD A;  1OBR A;  1TKF A;  2YNC C;  3SJE A;  1B87 A;  3CXS A;  3TX8 A;  2IJZ A;  5JPH A;  2Q7S A;  5FVJ A;  5BWA B;  2VL1 A;  2AE6 A;  3JTK A;  4CYP A;  4MHN A;  2FIW A;  2F7V A;  1RXT A;  2EO8 A;  3IU1 A;  4Q38 A;  1J4J A;  1TIQ A;  4PXD A;  5J8C A;  1M44 A;  2CIJ A;  4MJ8 A;  4XPK A;  1LRZ A;  4IAV A;  1LAP A;  8CPA A;  1NSA A;  2VI7 A;  3VH9 A;  4EVY A;  1LFW A;  3WC6 A;  3GY9 A;  4F8Z A;  4ZGY B;  4IUS A;  1HEE A;  1VGY A;  2PR1 A;  3LOD A;  5JQ4 A;  2PJ9 A;  5AG7 A;  1JWQ A;  1M4I A;  4NEX A;  5DWM A;  3IO1 A;  4R7M A;  4ZY0 A;  3TO9 A;  1Y9W A;  2AFS A;  1X10 A;  3PGP A;  2BCO A;  1M4G A;  2OH1 A;  3KHZ A;  1CPX A;  1S7K A;  2CY2 A;  4F6A A;  3C26 A;  1L0C A;  5CNP A;  5D8N A;  3F5B A;  3KKW A;  2REE A;  2Q43 A;  4MFP A;  5AG5 A;  1VHE A;  4YFJ A;  4II9 A;  2A4N A;  3BLN A;  4PPZ A;  2Q04 A;  4NGR A;  4OC5 A;  3ZZI A;  4KOY A;  5KTC A;  4Y49 B;  2PQ8 A;  4U5Y A;  3VAR A;  3TT2 A;  1S7N A;  2ANP A;  5I4M A;  4H2K A;  3DDD A;  4NGT A;  4NFR A;  2O4H A;  3WT4 A;  2QIR A;  4R57 A;  4MFZ A;  1CPS A;  4C7I A;  4JLY A;  1CM0 A;  1X12 A;  3DR6 A;  3EY5 A;  4M6G A;  4BBH A;  1IOI A;  1KUV A;  1KZF A;  2DXQ A;  3LAC A;  2C27 A;  4HNY B;  1PYT B;  4P4E A;  4AXV A;  4ZI6 A;  1YRE A;  1SQH A;  2VZZ A;  3G3S A;  3RZA A;  1QSR A;  2RFH A;  3PB9 X;  1NE9 A;  4CGP A;  4QVT A;  1IYK A;  2OB0 A;  2REF A;  2P6F A;  3P2F A;  3BXM A;  4L89 A;  4E8O A;  2EUI A;  4KOX A;  1ELM P;  1MK4 A;  2PCU A;  3ZJ0 A;  3FB3 A;  5K8O A;  4NGM A;  4B14 A;  1F57 A;  2RB7 A;  4MCR A;  3ISX A;  4OC3 A;  4R3K A;  2ZPA A;  4B10 A;  4A30 A;  2G9D A;  3I3G A;  4E2A A;  2FSR A;  1S7L A;  3DNS A;  3R96 A;  3S9M A;  2O53 A;  1QMU A;  3R9G A;  2JLM A;  4PSX A;  3HLP A;  4RS2 A;  4A32 A;  3S9L A;  1IGB A;  4KUA A;  1VHO A;  1YLE A;  3OWC A;  3PB6 X;  3D7D A;  4KSF A;  2PSW A;  4PV6 A;  4UEZ A;  1BPN A;  4LX9 A;  4B5O A;  4NXY A;  3D8P A;  3IEH A;  2CNM A;  2ZEF A;  4CYN A;  3B8G A;  3DR8 A;  1AMP A;  2POK A;  2FT0 A;  4TWE A;  3SI0 A;  1TKJ A;  2VBQ A;  5HVH A;  4DUK A;  4UWI A;  1YVO A;  4OAD A;  1R57 A;  5DWN A;  4A37 A;  4AVC A;  2GRE A;  1RTQ A;  1NSL A;  3TCV A;  4CYQ A;  5A28 A;  2ZOG A;  2DPS A;  3IWE A;  3EXN A;  1Z9U A;  2WYR A;  4BMH A;  4MRI A;  4AVA A;  1QQ9 A;  1BOB A;  4OC4 A;  1YK3 A;  3FYN A;  4CAF A;  2Q4Z A;  3NH5 A;  1S7F A;  2D4P A;  3QNV A;  3B7I A;  2EWB A;  4UCM A;  4MBU A;  4BD9 A;  4CYO A;  2YNE A;  3P2H A;  4QUS A;  4E0A A;  2WZN A;  1DTD A;  2Q4V A;  4C2Y A;  4KVO E;  2AFU A;  3KL9 A;  1IIC A;  2B5G A;  4MI4 A;  1S5K A;  4YRH A;  1QSM A;  4R9M A;  2O28 A;  4F0X A;  2BUE A;  1TKH A;  2P0W A;  4JWP A;  2ZEO A;  1Y0R A;  3KR4 A;  5C88 A;  2FXF A;  2ODF A;  3VAT A;  4XNH C;  3FVL A;  3R9F A;  2AJ6 A;  1CP6 A;  4UFV A;  5LRG A;  1I12 A;  1Q7L A;  1YR0 A;  2HUZ A;  4X8I A;  4X3R A;  2DEA A;  1XIX A;  5J8F A;  2AFM A;  4DYO A;  1TXR A;  2HV2 A;  1XMT A;  4B5P B;  4ORF A;  2B4B A;  2I79 A;  3D2M A;  5ELY A;  5LYL A;  2PJ5 A;  1LCP A;  2R1I A;  2Z3N A;  3QB8 A;  3SJF A;  3V8I A;  4PK3 A;  3S6F A;  3DSB A;  3NH4 A;  3MRU A;  1YSJ A;  1CBX A;  2B4D A;  2ZEM A;  4GXH A;  3NH8 A;  2J8N A;  4KZT A;  5HVF A;  3IC1 A;  3SXN A;  4H6Z A;  2CXA A;  4UA3 A;  2P6E A;  4NSQ A;  2Y0M A;  3D68 A;  4KOU A;  4BIN A;  2EBJ A;  2PVW A;  4TNU A;  2G0B A;  3EO4 A;  1ZG9 A;  4P45 A;  1IOF A;  2B58 A;  2QVP A;  2V8V A;  2ATR A;  4KOR A;  3VWD A;  3W91 A;  1GYT A;  4A2Z A;  2YNC A;  3K9T A;  3D4U A;  4MCS A;  1LAM A;  1Q2Y A;  3H4Q A;  1Y0Y A;  2ABZ A;  2PIZ A;  2Q51 A;  2VEZ A;  3CZX A;  4KVM E;  4UCP A;  4XNH B;  5IV0 A;  3BHX A;  4KOT A;  4F9V A;  2PJ3 A;  3MN8 A;  1ON0 A;  4FAI A;  4AB7 A;  2V8D A;  4W9Y A;  4QC6 A;  7CPA A;  2GLJ A;  3LMS A;  1K4J A;  4CS0 B;  1A2Z A;  3D7F A;  5HXD A;  3TC8 A;  4MXU A;  4IHM A;  4UIB A;  4KUB A;  2FE7 A;  2CNT A;  4MHD A;  2R7H A;  1R3N A;  1BO4 A;  1RO5 A;  3PB7 X;  4P4D A;  2FS5 A;  3CPA A;  4C68 A;  2CF4 A;  1BLL E;  2QML A;  2IMO A;  4R3L A;  1CP7 A;  1XFO A;  3QAY A;  4KSI A;  1YGH A;  4A39 A;  4OP4 A;  2J8M A;  4LQG A;  3TFY A;  1YME A;  4RI1 A;  4UIA A;  2PDO A;  1Z5R A;  2PRB A;  2BEI A;  2Q0Y A;  4HPS A;  1B6B A;  1CJW A;  5KTA A;  1BAV A;  1N71 A;  1HDU A;  3W6S A;  2EK9 A;  2QEC A;  3WC7 A;  3H8G A;  3KQZ A;  4UFW A;  1R43 A;  4MCQ A;  2B3V A;  3PFE A;  3N7Z A;  5F48 A;  2OZG A;  3DLJ A;  3D66 A;  2NMT A;  4PXC A;  4PXB A;  5G21 A;  4CAW A;  4X5K A;  2PJ1 A;  2XEG A;  1S3Z A;  1XBU A;  1XE4 A;  3B3S A;  4F0Y A;  2PJA A;  4P4J A;  4PQA A;  4Q7A A;  4JJX A;  1AUG A;  2C6G A;  2F5I A;  5CPA A;  4MMO A;  4HNX B;  5IX3 A;  1P4N A;  2PJ0 A;  4R6T A;  2CTC A;  1CG2 A;  4CRZ B;  2HB6 A;  2Z3M A;  4UF4 A;  4P6Y A;  4FUU A;  3PZJ A;  3LD2 A;  1QST A;  1FT7 A;  1KUY A;  2WPW A;  4OC0 A;  4UWJ A;  3SI2 A;  4KOV A;  4AVB A;  2ZED A;  4ZYQ A;  3A9L A;  5K8P A;  2CTB A;  2PJC A;  4C2Z A;  1M1D A;  4WWV A;  2V8H A;  3D7G A;  3SJG A;  1ZLH A;  3GKR A;  1Z2L A;  4UCN A;  2EK8 A;  3W6X A;  3PEI A;  5DS0 A;  3H8F A;  4ZY2 A;  4CRY B;  3K9U A;  4YGO A;  2HC9 A;  1Z8T A;  4QB9 A;  3PBB A;  1ARM A;  4NGQ A;  5H84 A;  3RAM A;  2BO9 A;  3RNZ A;  4KLW A;  4FD4 A;  1U6M A;  1FY7 A;  1TF8 A;  4NF1 A;  2IQ6 A;  3CT9 A;  1P0H A;  3FNC A;  4OLL A;  3DGV A;  2GAN A;  4H6U A;  2PJ7 A;  3UY5 A;  2GLF A;  1XEB A;  3D2P A;  2H5M A;  4M3S A;  4AG7 A;  2R98 A;  2OU2 A;  3R9E A;  4NJR A;  2Q4Y A;  1Q2D A;  1Z8X A;  4M85 A;  3KI9 A;  2OZH A;  3WAB A;  1ZO0 A;  1IB1 E;  3CDX A;  3BI0 A;  3FED A;  3TO7 A;  5IB0 A;  6CPA A;  3KAS A;  2PIY A;  4DNC A;  4CGM A;  4MFK A;  2ZOF A;  5LYF A;  2GE3 A;  1I21 A;  1TF9 A;  3JVN A;  2GFQ A;  1XRY A;  3PB8 X;  4OID A;  2JBJ A;  5H86 A;  4MY0 A;  4C2X A;  5JM6 A;  2KCW A;  1VKC A;  2GIV A;  1XF8 A;  1F2P A;  1Y7E A;  3F0A A;  2J9A A;  1XJO A;  4K30 A;  2ZEL A;  1IU8 A;  2DPT A;  4CPA A;  3F8K A;  2ZEP A;  3S6G A;  2J8R A;  1UWY A;  1QSO A;  1HDQ A;  2Z10 A;  4A31 A;  4KOW A;  4P4I A;  2BSW A;  2PVV A;  2WPX A;  3L2N A;  4FWU A;  2V77 A;  3CPX A;  3S9N A;  2PJ8 A;  1QSN A;  3FEE A;  3PRT A;  1M4D A;  3B3C A;  2VXK A;  4YWY A;  4FD5 A;  1UFH A;  2ZW6 A;  1XOV A;  2AFO A;  4XPD C;  4CAE A;  3FH4 A;  2F8H A;  3H8E A;  1YLO A;  2Q44 A;  2WSA A;  4GM5 A;  4P10 A;  4P44 A;  5G22 A;  3RBU A;  3RYO A;  3FJU A;  5F46 A;  5AG6 A;  2OZU A;  2JDC A;  2PR8 A;  5THW A;  3NE7 A;  3SHP A;  3GUX A;  1ZLI A;  3IIB A;  3FXT A;  4P4B A;  1IID A;  2PJB A;  3FRM A;  3K2K A;  2BOA A;  3TOB A;  1MJB A;  3NA6 A;  4A94 A;  5HVG A;  3CXP A;  3R1K A;  5GCN A;  3KGQ A;  4NJQ A;  4P4F A;  5K8M A;  3B2Y A;  1Y9K A;  2I3C A;  2QYV A;  3N5F A;  4KOS A;  4U9Y A;  4XPL A;  4K3N A;  4ZX9 A;  4KS9 A;  1MJ9 A;  3TE4 A;  4CGO A;  4F9U A;  4MY3 A;  2VQY A;  3T9Y A;  2ZEH A;  3V38 A;  5LYI A;  2IL4 A;  3WR7 A;  2OOT A;  1YQE A;  2Z0Z A;  4NGS A;  2HQY A;  4ZX8 A;  4JXR A;  4MHZ A;  4WJB A;  5EBV A;  3E0K A;  4LUA A;  4AG9 A;  4B11 A;  4KLV A;  4QBJ A;  1YVK A;  5CBM A;  1YW6 A;  5J1Q A;  2EVN A;  4CAV A;  3KZW A;  5A27 A;  4X2T A;  2YND A;  4NCZ A;  4OAE A;  4H89 A;  3KR5 A;  5F47 A;  4NGN A;  1PUA A;  3SJX A;  5HMN A;  4R87 A;  4IF5 A;  4OME A;  4A38 A;  2OR4 A;  5KTD A;  2JBK A;  1NMT A;  2PRQ A;  3D7H A;  4DJL A;  2V8G A;  1YW4 A;  4B13 A;  3KHX A;  1DE4 C;  4UFX A;  4B6Z A;  4EME A;  4PXE A;  5D29 A;  4I49 A;  1KUX A;  3B3W A;  4PSW A;  3EFA A;  1PCA A;  5AGE A;  1Z8W A;  1WK4 A;  4IK2 A;  4ZY1 A;  3T8W A;  4OIW A;  2AFW A;  3FIX A;  2VZY A;  1V0C A;  4FD6 A;  3TOA A;  2XEF A;  4OKO A;  2XEI A;  1PU9 A;  4B5P A;  4B12 A;  4OC1 A;  2B4D B;  3GB0 A;  4JYW A;  3VWE A;  1S60 A;  1Z4R A;  3JRU A;  3NE8 A;  1OZP A;  4Q36 A;  2Q7B A;  1IYL A;  3PFO A;  2X7B A;  4NGP A;  2Z3O A;  3B35 A;  3QAH A;  1BPM A;  3FF3 A;  5JH9 A;  2Z3K A;  4Z65 A;  4HKF A;  3I1U A;  1M4L A;  1YX0 A; 
#chains in the Genus database with same CATH homology
 3FEC A;  4R8F A;  4FBE A;  4O23 A;  4UEF A;  1KWM A;  2QJ8 A;  4YU9 A;  4G1P A;  4JZ0 A;  1Z8L A;  2C6C A;  1CX8 A;  5K8N A;  1F2O A;  2NSM A;  5LYD A;  1H8L A;  5IB9 A;  1ARL A;  4MHY A;  4MCP A;  2C1C A;  2AFZ A;  1JQG A;  4EFD A;  3B3T A;  3V7Z A;  5F09 A;  2PJ2 A;  3GLJ A;  1EE3 P;  3B3V A;  3IFE A;  3NFZ A;  2AFX A;  2C6P A;  3IWW A;  2FVG A;  1ELL P;  1LAN A;  2XEJ A;  1VIX A;  1FNO A;  2JEW A;  2ZEN A;  5LRK A;  3WC5 A;  3ISZ A;  1AYE A;  3D67 A;  1LOK A;  3BI1 A;  2PE3 A;  4ONW A;  2NYQ A;  3FX6 A;  3SI1 A;  4UEE A;  3PB4 X;  5LRJ A;  3HUV A;  4MHP A;  3PBE A;  2GU2 A;  2PJ6 A;  1ZG7 A;  3IJ3 A;  1IY7 A;  3LWU A;  4R76 A;  2PJ4 A;  3FMC A;  4RUH A;  1ZG8 A;  4EWT A;  5JGF A;  4OC2 A;  2ZEG A;  2ZEE A;  1XMB A;  3KQX A;  1OBR A;  1TKF A;  3SJE A;  3TX8 A;  2IJZ A;  2VL1 A;  4MHN A;  2F7V A;  4PXD A;  2CIJ A;  4IAV A;  1LAP A;  8CPA A;  1NSA A;  3VH9 A;  1LFW A;  3WC6 A;  4F8Z A;  1HEE A;  1VGY A;  2PJ9 A;  3IO1 A;  4R7M A;  4ZY0 A;  2AFS A;  2BCO A;  3KHZ A;  1CPX A;  5D8N A;  2Q43 A;  1VHE A;  4PPZ A;  4NGR A;  4OC5 A;  3VAR A;  2ANP A;  5I4M A;  4H2K A;  4NGT A;  4NFR A;  2O4H A;  3WT4 A;  1CPS A;  4P4E A;  4AXV A;  1PYT B;  4ZI6 A;  3RZA A;  2RFH A;  3PB9 X;  3BXM A;  1ELM P;  2PCU A;  5K8O A;  4NGM A;  1F57 A;  2RB7 A;  4MCR A;  3ISX A;  4OC3 A;  2G9D A;  3S9M A;  3S9L A;  2O53 A;  1QMU A;  3HLP A;  1IGB A;  1VHO A;  3PB6 X;  3D7D A;  4UEZ A;  1BPN A;  3IEH A;  2ZEF A;  1AMP A;  2POK A;  4TWE A;  3SI0 A;  1TKJ A;  5HVH A;  4DUK A;  4A37 A;  2GRE A;  1RTQ A;  2ZOG A;  2WYR A;  4MRI A;  1QQ9 A;  4OC4 A;  2Q4Z A;  3NH5 A;  3QNV A;  3B7I A;  2EWB A;  4BD9 A;  2WZN A;  1DTD A;  2AFU A;  3KL9 A;  1TKH A;  2ZEO A;  1Y0R A;  3KR4 A;  3VAT A;  3FVL A;  1CP6 A;  5LRG A;  1Q7L A;  4X8I A;  4X3R A;  2DEA A;  2AFM A;  4DYO A;  1TXR A;  5ELY A;  5LYL A;  2PJ5 A;  1LCP A;  3SJF A;  3NH4 A;  3MRU A;  1YSJ A;  1CBX A;  2ZEM A;  3NH8 A;  5HVF A;  3IC1 A;  3D68 A;  2PVW A;  4TNU A;  1ZG9 A;  4P45 A;  2QVP A;  2V8V A;  1GYT A;  3K9T A;  3D4U A;  4MCS A;  1LAM A;  1Y0Y A;  2ABZ A;  2PIZ A;  2Q51 A;  3BHX A;  4F9V A;  2PJ3 A;  3MN8 A;  4FAI A;  2V8D A;  4W9Y A;  7CPA A;  2GLJ A;  3LMS A;  3D7F A;  5HXD A;  3TC8 A;  4MXU A;  4IHM A;  4UIB A;  1R3N A;  3PB7 X;  4P4D A;  3CPA A;  2CF4 A;  1BLL E;  2IMO A;  1CP7 A;  1XFO A;  4KSI A;  4A39 A;  4OP4 A;  4LQG A;  1YME A;  4UIA A;  1Z5R A;  1BAV A;  1HDU A;  2EK9 A;  3WC7 A;  3H8G A;  3KQZ A;  1R43 A;  4MCQ A;  3PFE A;  3DLJ A;  3D66 A;  4PXC A;  4PXB A;  2PJ1 A;  2XEG A;  1XBU A;  3B3S A;  2PJA A;  4P4J A;  4PQA A;  4Q7A A;  2C6G A;  5CPA A;  4MMO A;  2PJ0 A;  4R6T A;  2CTC A;  1CG2 A;  2HB6 A;  4UF4 A;  4P6Y A;  4FUU A;  4OC0 A;  3SI2 A;  1FT7 A;  4ZYQ A;  5K8P A;  2ZED A;  2CTB A;  2PJC A;  4WWV A;  2V8H A;  3D7G A;  3SJG A;  1ZLH A;  1Z2L A;  2EK8 A;  3PEI A;  5DS0 A;  3H8F A;  4ZY2 A;  2HC9 A;  3PBB A;  1ARM A;  4NGQ A;  3RAM A;  2BO9 A;  1TF8 A;  2IQ6 A;  3CT9 A;  3DGV A;  2PJ7 A;  2GLF A;  4NJR A;  3KI9 A;  3WAB A;  3CDX A;  3BI0 A;  3FED A;  6CPA A;  3KAS A;  2PIY A;  2ZOF A;  5LYF A;  1TF9 A;  3PB8 X;  4OID A;  1XRY A;  2JBJ A;  5JM6 A;  1Y7E A;  1F2P A;  2J9A A;  1XJO A;  2ZEL A;  4CPA A;  2ZEP A;  1UWY A;  1HDQ A;  4P4I A;  2PVV A;  4FWU A;  3L2N A;  2V77 A;  3CPX A;  3S9N A;  2PJ8 A;  3FEE A;  3PRT A;  3B3C A;  4YWY A;  2AFO A;  3FH4 A;  2F8H A;  3H8E A;  1YLO A;  4GM5 A;  3RBU A;  4P10 A;  4P44 A;  3FJU A;  5THW A;  3GUX A;  1ZLI A;  3IIB A;  4P4B A;  2PJB A;  3K2K A;  2BOA A;  3NA6 A;  4A94 A;  5HVG A;  3KGQ A;  4NJQ A;  4P4F A;  5K8M A;  3B2Y A;  2I3C A;  2QYV A;  3N5F A;  4K3N A;  4ZX9 A;  4F9U A;  2ZEH A;  3V38 A;  5LYI A;  2OOT A;  4NGS A;  4ZX8 A;  4MHZ A;  4WJB A;  5CBM A;  5J1Q A;  1YW6 A;  3KZW A;  4X2T A;  3KR5 A;  4NGN A;  3SJX A;  4OME A;  4A38 A;  2OR4 A;  2JBK A;  2PRQ A;  3D7H A;  4DJL A;  2V8G A;  1YW4 A;  3KHX A;  1DE4 C;  4B6Z A;  4EME A;  4PXE A;  5D29 A;  3B3W A;  1PCA A;  4IK2 A;  4ZY1 A;  3T8W A;  4OIW A;  2AFW A;  2XEF A;  4OKO A;  2XEI A;  4OC1 A;  3GB0 A;  4JYW A;  3JRU A;  3PFO A;  4NGP A;  3B35 A;  1BPM A;  3FF3 A;  5JH9 A;  4Z65 A;  3I1U A;  1M4L A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...