3PBBA

Crystal structure of human secretory glutaminyl cyclase in complex with pbd150
Total Genus 109
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
109
sequence length
329
structure length
323
Chain Sequence
ASAWPEEKNYHQPAILNSSALRQIAEGTSISEMWQNDLQPLLIERYPGSPGSYAARQHIMQRIQRLQADWVLEIDTFLSQTPYGYRSFSNIISTLNPTAKRHLVLACHYDSKYFSHWNNRVFVGATDSAVPCAMMLELARALDKKLLSLKPDLSLQLIFFDGEEAFLHWSPQDSLYGSRHLAAKMASTPHPPGARGTSQLHGMDLLVLLDLIGAPNPTFPNFFPNSARWFERLQAIEHELHELGLLKDHSLEGRYFQNYSYGGVIQDDHIPFLRRGVPVLHLIPSPFPEVWHTMDDNEENLDESTIDNLNKILQVFVLEYLHL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase/transferase inhibitor
molecule keywords Glutaminyl-peptide cyclotransferase
publication title Structures of human Golgi-resident glutaminyl cyclase and its complexes with inhibitors reveal a large loop movement upon inhibitor binding
pubmed doi rcsb
source organism Homo sapiens
total genus 109
structure length 323
sequence length 329
chains with identical sequence B
ec nomenclature ec 2.3.2.5: Glutaminyl-peptide cyclotransferase.
pdb deposition date 2010-10-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF04389 Peptidase_M28 Peptidase family M28
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.630.10 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Zn peptidases 3pbbA00
4UIAA 1CX8A 4PXEA 1YSJA 3KI9A 4OC5A 3ISZA 2JBKA 4NJQA 2O4HA 2AFOA 4PPZA 4ZY0A 2QJ8A 2IJZA 2GREA 3IC1A 3KZWA 2PE3A 4OC0A 3IJ3A 3MRUA 5J1QA 1TXRA 4YWYA 1Y0RA 1OBRA 3D7HA 1TF8A 3IO1A 1Z8LA 1ZG7A 1QMUA 4FUUA 4UIBA 3V38A 1LCPA 3B3TA 4ZYQA 1EE3P 4GM5A 4F9UA 4OC3A 4NGRA 2PJ7A 3FX6A 3PB7X 1HDQA 4KSIA 4MHPA 1TKFA 4IK2A 3VATA 5K8PA 4NGTA 2PRQA 4NJRA 2ZEMA 2J9AA 2AFWA 2XEJA 4OC1A 5K8NA 2PJ6A 2EK9A 4A94A 2JEWA 3B3CA 2ZELA 4OIWA 4X3RA 3N5FA 4P45A 3FVLA 4F8ZA 3D4UA 3LMSA 1R43A 4G1PA 4P10A 2PJ3A 1VHEA 3CPAA 3NH8A 3CDXA 3PBEA 3S9LA 4FWUA 2QYVA 3I1UA 4JYWA 5D29A 4ZI6A 1DTDA 3KQZA 1CBXA 3WC6A 4MCPA 2ZOGA 2ZEGA 4PQAA 2IQ6A 2PJ4A 1YW6A 2C6CA 2V77A 4A37A 2XEGA 5I4MA 5JGFA 4H2KA 4EWTA 3SI0A 5DS0A 2GLJA 1TKHA 4EFDA 1BLLE 4R8FA 4P4EA 3BHXA 4P44A 3T8WA 3LWUA 4X2TA 1LOKA 4DYOA 3S9NA 1Z5RA 3WT4A 5THWA 3FEEA 3PEIA 3KQXA 5F09A 2XEIA 4P4BA 1H8LA 1Q7LA 4P4FA 1BPNA 1XMBA 4YU9A 2C1CA 7CPAA 2PJBA 2EWBA 2BO9A 2V8GA 1LFWA 4TWEA 3H8EA 1PCAA 2V8HA 1YMEA 4OIDA 3QNVA 3SJGA 4MHZA 3D7GA 4MRIA 2PJ5A 3GLJA 3KHZA 3GUXA 4FBEA 1CPSA 1TF9A 3IIBA 3D67A 3D7DA 4IHMA 5LRJA 3PB9X 5LYLA 5IB9A 1HEEA 5LYIA 8CPAA 2PJ9A 5LYDA 3D68A 3L2NA 2DEAA 2FVGA 3K9TA 2AFZA 1XBUA 3IFEA 3KGQA 3MN8A 3RZAA 2BOAA 4OP4A 1IY7A 1VGYA 2QVPA 4P4JA 4P6YA 4R76A 1F2OA 1PYTB 2OOTA 2I3CA 2Q4ZA 1QQ9A 5JM6A 4AXVA 3FH4A 4ZY2A 2PJAA 4NGPA 3B2YA 4OMEA 4R7MA 3SJXA 2XEFA 4WWVA 4MXUA 2HB6A 3VARA 3B7IA 2RB7A 2RFHA 4P4DA 3PFEA 4DJLA 3SJEA 3NH5A 3DLJA 3HLPA 1TKJA 3PFOA 1ELLP 2CIJA 1XJOA 2CTCA 1DE4C 5HVFA 3B3VA 4B6ZA 4NFRA 4EMEA 4NGQA 2CF4A 4MHYA 3D66A 2IMOA 3CT9A 2G9DA 2PVWA 4WJBA 5K8OA 3VH9A 4MCRA 5LRGA 4UF4A 4MCSA 2ZEDA 3TC8A 4O23A 1ZG9A 3S9MA 4UEZA 6CPAA 3FF3A 1VHOA 1YW4A 1ZLHA 2EK8A 4JZ0A 1AYEA 2O53A 2PIZA 3NFZA 2NYQA 1LANA 2POKA 3FECA 2AFSA 4X8IA 3B3WA 4W9YA 1AMPA 2ZEHA 4UEFA 4A38A 2ZEPA 3V7ZA 4TNUA 3H8FA 1ARMA 1IGBA 1NSAA 4ZY1A 2ZEFA 3JRUA 2PIYA 4PXBA 3RAMA 3B35A 3SI2A 5CBMA 5K8MA 4MHNA 3PBBA 3SJFA 1CP6A 2ABZA 2HC9A 5HXDA 2ZEOA 4K3NA 3KASA 1ZG8A 3RBUA 2PVVA 1ARLA 5LYFA 3TX8A 3DGVA 3FMCA 4PXCA 2PJCA 1M4LA 2CTBA 4P4IA 4ZX8A 1UWYA 1FT7A 4UEEA 4MMOA 3D7FA 1R3NA 3BI1A 3HUVA 4FAIA 1XFOA 3FEDA 2VL1A 1F57A 2JBJA 2V8DA 1F2PA 2Q51A 4DUKA 1ELMP 3WC5A 2NSMA 4LQGA 1HDUA 3IWWA 4ZX9A 5CPAA 2PJ1A 2PCUA 5LRKA 4MCQA 4BD9A 3KHXA 2PJ2A 4ONWA 4R6TA 5HVGA 2F8HA 1LAPA 4OC4A 1Z2LA 1VIXA 3B3SA 2BCOA 2ZEEA 4F9VA 3WABA 3NH4A 1Y0YA 1CG2A 4IAVA 2Q43A 2GLFA 2AFXA 5HVHA 3KR4A 1CPXA 2OR4A 2V8VA 3WC7A 3IEHA 5ELYA 3NA6A 2C6GA 1JQGA 1XRYA 1FNOA 2PJ8A 3KL9A 3PB8X 3PB4X 1Y7EA 4NGNA 4RUHA 1RTQA 3BI0A 1GYTA 2GU2A 4OKOA 3BXMA 3GB0A 4Z65A 1CP7A 4OC2A 4A39A 2ZENA 3FJUA 1KWMA 3H8GA 2ZOFA 3SI1A 3KR5A 5JH9A 2AFUA 3PB6X 4Q7AA 2AFMA 1LAMA 1BPMA 2PJ0A 2WYRA 3ISXA 4CPAA 2WZNA 1ZLIA 5D8NA 4NGMA 3CPXA 4PXDA 1BAVA 1YLOA 2C6PA 3PRTA 3K2KA 4NGSA 2ANPA 2F7VA
chains in the Genus database with same CATH superfamily
2D4OA 5EMIA 1QSTA 1IOFA 4UIAA 1IICA 1CX8A 2Q4VA 4KSFA 4CYNA 4PXEA 1Y9WA 4MFLA 4CAVA 1YSJA 1YVKA 3KI9A 4OC5A 4NCZA 2Q04A 3LACA 3NE8A 3PGPA 5HMNA 3ISZA 2JBKA 4NJQA 5AGEA 2O4HA 2AFOA 1IYKA 5H84A 1QSNA 2B58A 4B10A 4XPDC 4PPZA 4JXRA 3FYNA 3TTHA 3BLNA 1AUGA 2QJ8A 4ZY0A 2IJZA 2GREA 3IC1A 5H86A 3KZWA 4CGOA 2PE3A 3SXOA 4OC0A 3IJ3A 3MRUA 4MJ8A 1YLEA 2FE7A 4A33A 1S7KA 5J1QA 1TXRA 4YWYA 1Y0RA 1OBRA 2CNSA 3D7HA 1TF8A 3IO1A 4FD5A 1Z8LA 4RI1A 1ZG7A 1IB1E 3F8KA 3H5ZA 1QMUA 4FUUA 4UIBA 3QAHA 3V38A 1LCPA 4PK3A 1CJWA 3B3TA 4ZYQA 1EE3P 3D3SA 4GM5A 4F9UA 2Q0YA 1XEBA 4OC3A 4CYPA 4NGRA 2PJ7A 5C88A 3FX6A 3PB7X 4H6ZA 1HDQA 1X12A 4KSIA 3W6SA 4MHPA 1PUAA 1TKFA 3FRMA 2B4DB 4IK2A 2GE3A 3A9LA 4B5OA 1J4JA 2WPXA 3VATA 4A2ZA 3FNCA 1YQEA 5K8PA 4NGTA 3G3SA 2PRQA 4NJRA 2ZEMA 3FXTA 2J9AA 2Q7BA 2J8MA 4MFPA 1NE9A 2AFWA 4GXHA 2XEJA 4OC1A 3I3GA 5K8NA 4U9ZA 2PJ6A 3PZJA 2EK9A 4A94A 2JDDA 2JEWA 3B3CA 2ZELA 5F49A 3LD2A 4OIWA 4X3RA 1X10A 3EFAA 3N5FA 4P45A 3FVLA 1IOIA 3K9UA 5HH1A 4F8ZA 1Z8TA 3D4UA 4R57A 3LMSA 1Q2YA 1R43A 2AE6A 3S6FA 4G1PA 4P10A 2QMLA 2EO8A 2PJ3A 1VHEA 3CPAA 2OU2A 1VHSA 3CDXA 3NH8A 3PBEA 4JWPA 4KOUA 1B87A 4FD4A 3S9LA 1TIQA 4FWUA 2QYVA 3I1UA 2JEVA 5DWMA 4JYWA 3S6KA 5D29A 2Z11A 4ZI6A 1DTDA 3KQZA 4XNHC 1MJAA 3TO9A 4CGPA 3IWEA 1CBXA 1KUXA 4BMHA 4Q38A 4MCPA 3WC6A 3R9GA 2ZOGA 2ZEGA 2DF5A 3D2PA 4KOXA 4PQAA 5ISVA 2I79A 4YRHA 2IQ6A 3JTKA 2HQYA 3IGRA 1L0CA 3KKWA 4ONUA 4E0AA 2Q7SA 4L8AA 4ZBGA 2PJ4A 2BL1A 3CZXA 4JD6A 1M4IA 4KOYA 1YW6A 2C6CA 2P0WA 3DR6A 1QSRA 3T90A 2Z3NA 2V77A 4A37A 2XEGA 1YVOA 1V0CA 1KUYA 5I4MA 4H2KA 3IWGA 5JGFA 4QC6A 4EWTA 4F0YA 2OH1A 2R1IA 2VQYA 3E0KA 3SI0A 5DS0A 2YNCA 2G3TA 4UFVA 2WSAA 2GLJA 1TKHA 3VWEA 1BLLE 2PRBA 4R8FA 4UCMA 4EFDA 3BJ8A 2O28A 4PSXA 4U9YA 4P4EA 3BHXA 4P44A 3T8WA 2DXQA 4MFJA 3EC4A 3LWUA 4X2TA 2QECA 1LOKA 4DYOA 5G21A 3S9NA 1Z5RA 2R8VA 3WT4A 4KVME 4MY0A 4HNWB 3FEEA 5THWA 3PEIA 5AG4A 2VI7A 3KQXA 5F09A 3FIXA 1WWZA 2XEIA 4IF5A 4P4BA 1H8LA 2YNCC 1Q7LA 3R95A 3TO7A 4P4FA 4AVCA 1BPNA 4M6HA 1XMBA 4YU9A 2C1CA 3QAYA 2PJBA 4M85A 7CPAA 1KZFA 1PU9A 2EWBA 2JDCA 2BO9A 2ZW5A 4HKFA 2V8GA 1LFWA 4TWEA 1IIDA 3H8EA 5DWNA 3G8WA 5IV0A 4MBUA 1OZPA 4KVOE 3CXPA 1PCAA 2V8HA 1YMEA 4OIDA 3QNVA 3SJGA 4KLVA 4MHZA 4YFJA 1Q2DA 2Z3LA 3D7GA 4MRIA 5A27A 1CM0A 2BEIA 2PJ5A 3D8PA 2VZZA 3GLJA 4RN7A 1S5KA 3KHZA 1YREA 2QIRA 3DR8A 2VXKA 1B6BA 3GUXA 2PDOA 4HNXB 4X5KA 3GKRA 4CRZB 4FBEA 1CPSA 1KUVA 1TF9A 4KVXA 3IIBA 3D67A 4CAEA 2YGWA 1A2ZA 1GHEA 3D7DA 4IHMA 4JJXA 2ZW6A 4E2AA 2ZPAA 5F47A 5LRJA 1I12A 2P6EA 4F0XA 1Z8XA 3PB9X 4ZGYB 5LYLA 5IB9A 1HEEA 3P2HA 4MY3A 3V8IA 5LYIA 8CPAA 1Z4EA 2PJ9A 5LYDA 2EUIA 3R9FA 3D68A 4KUBA 4J3GA 3EXNA 2B4DA 3BJ7A 3L2NA 5EC4A 1NMTA 1YX0A 2NMTA 2DEAA 4C2ZA 3TT2A 2FVGA 3K9TA 2AFZA 3R96A 4A30A 3CXSA 4QBJA 1XBUA 3CXQA 3IFEA 4UFXA 1P4NA 5EBVA 3TE4A 1UFHA 3KGQA 3IU2A 2J8NA 3MN8A 2G3AA 1YK3A 4UCNA 5G1ZA 3RZAA 2OZGA 4B5PA 2BOAA 4OP4A 1IY7A 1VGYA 2QVPA 1SQHA 4P4JA 4BBHA 1FY7A 4HPSA 4P6YA 4R76A 1F2OA 4BINA 4MFQA 2FIWA 2FCKA 1PYTB 1BO4A 1Z8WA 4KSAA 2OOTA 1RXTA 2I3CA 4B5PB 2Q4ZA 4M3SA 5G20A 1QQ9A 5JM6A 4AXVA 3FH4A 1ZO0A 4ZY2A 4AVBA 2PJAA 5FVJA 5C82A 4Y49B 2Y0MA 2BSWA 1R57A 4NGPA 3B2YA 4OMEA 4R7MA 4ORFA 1QSMA 3SJXA 3GIUA 4UWIA 2XEFA 4HNYB 4PV6A 4WWVA 4MFKA 3S6GA 3JUWA 4MXUA 2C27A 2HB6A 3VARA 3B7IA 3VWDA 1NSLA 3W6XA 4CGLA 4XPKA 1WK4A 3LODA 2DPSA 4C7IA 5JQ4A 2REFA 5J8FA 2OZHA 2ARHA 4C2YA 2RB7A 2RFHA 4P4DA 3PFEA 5F48A 1MK4A 4H6UA 1I1DA 4DJLA 4KLWA 1YR0A 1IYLA 3QB8A 3SJEA 2FS5A 3NH5A 4UWJA 3DLJA 3HLPA 1TKJA 3PFOA 4CAFA 4F6AA 1ELLP 2CIJA 1XJOA 3WR7A 4B12A 2OZUA 4K30A 2ATRA 2CTCA 5IX3A 2ZW7A 1DE4C 4I49A 4CRYB 5HVFA 4AVAA 3B3VA 4B6ZA 4MI4A 4JLYA 4NFRA 4EMEA 4MFZA 4NGQA 2CF4A 4MHYA 4A31A 3D66A 2IMOA 3FBUA 4R87A 3CT9A 1S7FA 1MJ9A 2G9DA 3IU1A 3C26A 2PVWA 4WJBA 5K8OA 3VH9A 4MCRA 5LRGA 4UF4A 4UCPA 4MCSA 2ZEDA 2I00A 3TC8A 4O23A 1ZG9A 2Z3OA 2CXAA 2FL4A 3S9MA 4L89A 4UEZA 3GYAA 1MJBA 2WPWA 3FF3A 4C68A 6CPAA 4CYQA 1S7NA 2FT0A 1VHOA 2R98A 4U5YA 4YGOA 2EVNA 1YW4A 4XPLA 1ZLHA 2EK8A 4JZ0A 1Z4RA 4A95A 1AYEA 2PR8A 2PSWA 4CYOA 5I0CA 2O53A 2J8RA 2PIZA 4A32A 4OLLA 4CS0B 3NFZA 2NYQA 3B8GA 1LANA 2POKA 3FECA 2AFSA 4X8IA 3B3WA 4W9YA 3TCVA 5BWAB 2Z3PA 1AMPA 3DSBA 3I9SA 1VKCA 2ZEHA 4UEFA 5KTDA 4A38A 4LQ6A 1I21A 4B14A 2ZEPA 5JPHA 2FSRA 3PP9A 3V7ZA 2KCWA 4TNUA 3H8FA 4C7HA 1ARMA 1IGBA 1NSAA 3JVNA 3R1KA 2CNMA 3N7ZA 4ZY1A 1XE4A 2ZEFA 4KOVA 3SXNA 3JRUA 2PIYA 4PXBA 3RAMA 3B35A 3SI2A 2BUEA 4UA3A 4PK2A 5CBMA 3ZZIA 2GIVA 4KORA 5K8MA 2Z3MA 4MHNA 3PBBA 2JLMA 3SJFA 3TOBA 2ZW4A 1CP6A 2ABZA 2HC9A 4XPDB 3T9YA 5HXDA 2ZEOA 4K3NA 3SHPA 3H4QA 4R9MA 1N71A 4LX9A 4Q36A 3KASA 1ZG8A 2B4BA 4AB7A 2VEZA 4NXYA 3RBUA 5KTCA 2PVVA 1ARLA 5LYFA 4PSWA 3DGVA 3FMCA 1S60A 3TX8A 1IU8A 4NF1A 3OWCA 4PXCA 3P2FA 2PJCA 2Z0ZA 1XF8A 2CNTA 4LUAA 3D2MA 1M4LA 5KTAA 2Z3KA 2D4PA 2CTBA 4P4IA 4ZX8A 1UWYA 1FT7A 5IB0A 2H5MA 4E8OA 4UEEA 5G22A 2GFQA 4MMOA 3D7FA 1R3NA 3EO4A 3BI1A 3HUVA 4FAIA 1XFOA 3FEDA 2OB0A 2VL1A 1F57A 2RC4A 3EY5A 1Y9KA 2JBJA 4FD7A 2V8DA 1F2PA 2YNEA 4KUAA 2G0BA 2PR1A 2Q51A 1RO5A 4DUKA 1ELMP 2Z10A 4M6IA 4KOWA 5AG6A 3WC5A 2NSMA 4LQGA 1BOBA 4H89A 1HDUA 3RO0A 4M6GA 3IWWA 1P0HA 1Z9UA 4ZX9A 1M4DA 2PC1A 5CPAA 4Y49C 2PJ1A 4IUSA 2PCUA 5LRKA 2F5IA 4MCQA 2B5GA 2IL4A 4NSQA 4OAEA 3TOAA 3KHXA 2PJ2A 4BD9A 4ONWA 4R3LA 4R6TA 2GANA 4FD6A 5HVGA 2F8HA 1LAPA 2Q44A 5E96A 4MHDA 2Q4YA 2REEA 4OC4A 1Z2LA 4AG9A 2B5GB 1VIXA 3B3SA 4UBRA 2BCOA 3RNZA 3TFYA 2ZEEA 5AG7A 2CY2A 4RS2A 2FIAA 5GCNA 3WABA 4F9VA 1U6MA 3NH4A 1Y0YA 1CG2A 2P6GA 2VZYA 4IAVA 4CGMA 1XMTA 5F46A 3RYOA 2WUUA 2HUZA 2HV2A 2GLFA 2Q43A 2AFXA 2AJ6A 4XNHB 5HVHA 1XIXA 3KR4A 1CPXA 2OR4A 2V8VA 3WC7A 1LRZA 3MGDA 3IEHA 5ELYA 1S7LA 3NA6A 3W91A 3F5BA 2C6GA 4AG7A 1M1DA 1JQGA 1XRYA 2A4NA 4II9A 2ZXVA 1FNOA 4GS4A 2K5TA 2PJ8A 3KL9A 4NEXA 3PB8X 4UFWA 3PB4X 1Y7EA 1S3ZA 2YNDA 4NGNA 4RUHA 1RTQA 2VBQA 4KZTA 3UY5A 4CAXA 1YGHA 3BI0A 1GYTA 4C2XA 2B3UA 2GU2A 4CGNA 1JWQA 5J8CA 3DNSA 4OKOA 3BXMA 3GB0A 3NE7A 4QUSA 4Z65A 1CP7A 1ON0A 4OC2A 2R7HA 1XOVA 2ZENA 3FJUA 5CNPA 4A39A 1KWMA 4KOSA 3DDDA 3ZJ0A 3R9EA 3H8GA 2ZOFA 4QVTA 2EBJA 3SI1A 2DPTA 3KR5A 4DNCA 2AFUA 5JH9A 1K4JA 3GY9A 3PB6X 4Q7AA 2AFMA 2P6FA 3F0AA 1LAMA 1BPMA 2PJ0A 2WYRA 3ISXA 4R3KA 4CPAA 4EVYA 1M4GA 2WZNA 1ZLIA 4JXQA 4KS9A 5D8NA 4OADA 2ODFA 3TO6A 4NGMA 2FXFA 3CPXA 4CAWA 1Y7RA 1QSOA 2PQ8A 3FB3A 4PXDA 2X7BA 1M44A 1BAVA 1YLOA 2C6PA 4KOTA 1Q2CA 5A28A 3S6HA 4QB9A 4B11A 3PRTA 2B3VA 3K2KA 4NGSA 2ANPA 4B13A 5AG5A 2F7VA
chains in the Genus database with same CATH topology
4UIAA 1CX8A 4PXEA 1YSJA 3KI9A 4OC5A 3ISZA 2JBKA 4NJQA 2O4HA 2AFOA 4PPZA 4ZY0A 2QJ8A 2IJZA 2GREA 3IC1A 3KZWA 2PE3A 4OC0A 3IJ3A 3MRUA 5J1QA 1TXRA 4YWYA 1Y0RA 1OBRA 3D7HA 1TF8A 3IO1A 1Z8LA 1ZG7A 1QMUA 4FUUA 4UIBA 3V38A 1LCPA 3B3TA 4ZYQA 1EE3P 4GM5A 4F9UA 4OC3A 4NGRA 2PJ7A 3FX6A 3PB7X 1HDQA 4KSIA 4MHPA 1TKFA 4IK2A 3VATA 5K8PA 4NGTA 2PRQA 4NJRA 2ZEMA 2J9AA 2AFWA 2XEJA 4OC1A 5K8NA 2PJ6A 2EK9A 4A94A 2JEWA 3B3CA 2ZELA 4OIWA 4X3RA 3N5FA 4P45A 3FVLA 4F8ZA 3D4UA 3LMSA 1R43A 4G1PA 4P10A 2PJ3A 1VHEA 3CPAA 3NH8A 3CDXA 3PBEA 3S9LA 4FWUA 2QYVA 3I1UA 4JYWA 5D29A 4ZI6A 1DTDA 3KQZA 1CBXA 3WC6A 4MCPA 2ZOGA 2ZEGA 4PQAA 2IQ6A 2PJ4A 1YW6A 2C6CA 2V77A 4A37A 2XEGA 5I4MA 5JGFA 4H2KA 4EWTA 3SI0A 5DS0A 2GLJA 1TKHA 4EFDA 1BLLE 4R8FA 4P4EA 3BHXA 4P44A 3T8WA 3LWUA 4X2TA 1LOKA 4DYOA 3S9NA 1Z5RA 3WT4A 5THWA 3FEEA 3PEIA 3KQXA 5F09A 2XEIA 4P4BA 1H8LA 1Q7LA 4P4FA 1BPNA 1XMBA 4YU9A 2C1CA 7CPAA 2PJBA 2EWBA 2BO9A 2V8GA 1LFWA 4TWEA 3H8EA 1PCAA 2V8HA 1YMEA 4OIDA 3QNVA 3SJGA 4MHZA 3D7GA 4MRIA 2PJ5A 3GLJA 3KHZA 3GUXA 4FBEA 1CPSA 1TF9A 3IIBA 3D67A 3D7DA 4IHMA 5LRJA 3PB9X 5LYLA 5IB9A 1HEEA 5LYIA 8CPAA 2PJ9A 5LYDA 3D68A 3L2NA 2DEAA 2FVGA 3K9TA 2AFZA 1XBUA 3IFEA 3KGQA 3MN8A 3RZAA 2BOAA 4OP4A 1IY7A 1VGYA 2QVPA 4P4JA 4P6YA 4R76A 1F2OA 1PYTB 2OOTA 2I3CA 2Q4ZA 1QQ9A 5JM6A 4AXVA 3FH4A 4ZY2A 2PJAA 4NGPA 3B2YA 4OMEA 4R7MA 3SJXA 2XEFA 4WWVA 4MXUA 2HB6A 3VARA 3B7IA 2RB7A 2RFHA 4P4DA 3PFEA 4DJLA 3SJEA 3NH5A 3DLJA 3HLPA 1TKJA 3PFOA 1ELLP 2CIJA 1XJOA 2CTCA 1DE4C 5HVFA 3B3VA 4B6ZA 4NFRA 4EMEA 4NGQA 2CF4A 4MHYA 3D66A 2IMOA 3CT9A 2G9DA 2PVWA 4WJBA 5K8OA 3VH9A 4MCRA 5LRGA 4UF4A 4MCSA 2ZEDA 3TC8A 4O23A 1ZG9A 3S9MA 4UEZA 6CPAA 3FF3A 1VHOA 1YW4A 1ZLHA 2EK8A 4JZ0A 1AYEA 2O53A 2PIZA 3NFZA 2NYQA 1LANA 2POKA 3FECA 2AFSA 4X8IA 3B3WA 4W9YA 1AMPA 2ZEHA 4UEFA 4A38A 2ZEPA 3V7ZA 4TNUA 3H8FA 1ARMA 1IGBA 1NSAA 4ZY1A 2ZEFA 3JRUA 2PIYA 4PXBA 3RAMA 3B35A 3SI2A 5CBMA 5K8MA 4MHNA 3PBBA 3SJFA 1CP6A 2ABZA 2HC9A 5HXDA 2ZEOA 4K3NA 3KASA 1ZG8A 3RBUA 2PVVA 1ARLA 5LYFA 3TX8A 3DGVA 3FMCA 4PXCA 2PJCA 1M4LA 2CTBA 4P4IA 4ZX8A 1UWYA 1FT7A 4UEEA 4MMOA 3D7FA 1R3NA 3BI1A 3HUVA 4FAIA 1XFOA 3FEDA 2VL1A 1F57A 2JBJA 2V8DA 1F2PA 2Q51A 4DUKA 1ELMP 3WC5A 2NSMA 4LQGA 1HDUA 3IWWA 4ZX9A 5CPAA 2PJ1A 2PCUA 5LRKA 4MCQA 4BD9A 3KHXA 2PJ2A 4ONWA 4R6TA 5HVGA 2F8HA 1LAPA 4OC4A 1Z2LA 1VIXA 3B3SA 2BCOA 2ZEEA 4F9VA 3WABA 3NH4A 1Y0YA 1CG2A 4IAVA 2Q43A 2GLFA 2AFXA 5HVHA 3KR4A 1CPXA 2OR4A 2V8VA 3WC7A 3IEHA 5ELYA 3NA6A 2C6GA 1JQGA 1XRYA 1FNOA 2PJ8A 3KL9A 3PB8X 3PB4X 1Y7EA 4NGNA 4RUHA 1RTQA 3BI0A 1GYTA 2GU2A 4OKOA 3BXMA 3GB0A 4Z65A 1CP7A 4OC2A 4A39A 2ZENA 3FJUA 1KWMA 3H8GA 2ZOFA 3SI1A 3KR5A 5JH9A 2AFUA 3PB6X 4Q7AA 2AFMA 1LAMA 1BPMA 2PJ0A 2WYRA 3ISXA 4CPAA 2WZNA 1ZLIA 5D8NA 4NGMA 3CPXA 4PXDA 1BAVA 1YLOA 2C6PA 3PRTA 3K2KA 4NGSA 2ANPA 2F7VA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4UIA A;  1CX8 A;  4PXE A;  1YSJ A;  3KI9 A;  4OC5 A;  3ISZ A;  2JBK A;  4NJQ A;  2O4H A;  2AFO A;  4PPZ A;  4ZY0 A;  2QJ8 A;  2IJZ A;  2GRE A;  3IC1 A;  3KZW A;  2PE3 A;  4OC0 A;  3IJ3 A;  3MRU A;  5J1Q A;  1TXR A;  4YWY A;  1Y0R A;  1OBR A;  3D7H A;  1TF8 A;  3IO1 A;  1Z8L A;  1ZG7 A;  1QMU A;  4FUU A;  4UIB A;  3V38 A;  1LCP A;  3B3T A;  4ZYQ A;  1EE3 P;  4GM5 A;  4F9U A;  4OC3 A;  4NGR A;  2PJ7 A;  3FX6 A;  3PB7 X;  1HDQ A;  4KSI A;  4MHP A;  1TKF A;  4IK2 A;  3VAT A;  5K8P A;  4NGT A;  2PRQ A;  4NJR A;  2ZEM A;  2J9A A;  2AFW A;  2XEJ A;  4OC1 A;  5K8N A;  2PJ6 A;  2EK9 A;  4A94 A;  2JEW A;  3B3C A;  2ZEL A;  4OIW A;  4X3R A;  3N5F A;  4P45 A;  3FVL A;  4F8Z A;  3D4U A;  3LMS A;  1R43 A;  4G1P A;  4P10 A;  2PJ3 A;  1VHE A;  3CPA A;  3NH8 A;  3CDX A;  3PBE A;  3S9L A;  4FWU A;  2QYV A;  3I1U A;  4JYW A;  5D29 A;  4ZI6 A;  1DTD A;  3KQZ A;  1CBX A;  3WC6 A;  4MCP A;  2ZOG A;  2ZEG A;  4PQA A;  2IQ6 A;  2PJ4 A;  1YW6 A;  2C6C A;  2V77 A;  4A37 A;  2XEG A;  5I4M A;  5JGF A;  4H2K A;  4EWT A;  3SI0 A;  5DS0 A;  2GLJ A;  1TKH A;  4EFD A;  1BLL E;  4R8F A;  4P4E A;  3BHX A;  4P44 A;  3T8W A;  3LWU A;  4X2T A;  1LOK A;  4DYO A;  3S9N A;  1Z5R A;  3WT4 A;  5THW A;  3FEE A;  3PEI A;  3KQX A;  5F09 A;  2XEI A;  4P4B A;  1H8L A;  1Q7L A;  4P4F A;  1BPN A;  1XMB A;  4YU9 A;  2C1C A;  7CPA A;  2PJB A;  2EWB A;  2BO9 A;  2V8G A;  1LFW A;  4TWE A;  3H8E A;  1PCA A;  2V8H A;  1YME A;  4OID A;  3QNV A;  3SJG A;  4MHZ A;  3D7G A;  4MRI A;  2PJ5 A;  3GLJ A;  3KHZ A;  3GUX A;  4FBE A;  1CPS A;  1TF9 A;  3IIB A;  3D67 A;  3D7D A;  4IHM A;  5LRJ A;  3PB9 X;  5LYL A;  5IB9 A;  1HEE A;  5LYI A;  8CPA A;  2PJ9 A;  5LYD A;  3D68 A;  3L2N A;  2DEA A;  2FVG A;  3K9T A;  2AFZ A;  1XBU A;  3IFE A;  3KGQ A;  3MN8 A;  3RZA A;  2BOA A;  4OP4 A;  1IY7 A;  1VGY A;  2QVP A;  4P4J A;  4P6Y A;  4R76 A;  1F2O A;  1PYT B;  2OOT A;  2I3C A;  2Q4Z A;  1QQ9 A;  5JM6 A;  4AXV A;  3FH4 A;  4ZY2 A;  2PJA A;  4NGP A;  3B2Y A;  4OME A;  4R7M A;  3SJX A;  2XEF A;  4WWV A;  4MXU A;  2HB6 A;  3VAR A;  3B7I A;  2RB7 A;  2RFH A;  4P4D A;  3PFE A;  4DJL A;  3SJE A;  3NH5 A;  3DLJ A;  3HLP A;  1TKJ A;  3PFO A;  1ELL P;  2CIJ A;  1XJO A;  2CTC A;  1DE4 C;  5HVF A;  3B3V A;  4B6Z A;  4NFR A;  4EME A;  4NGQ A;  2CF4 A;  4MHY A;  3D66 A;  2IMO A;  3CT9 A;  2G9D A;  2PVW A;  4WJB A;  5K8O A;  3VH9 A;  4MCR A;  5LRG A;  4UF4 A;  4MCS A;  2ZED A;  3TC8 A;  4O23 A;  1ZG9 A;  3S9M A;  4UEZ A;  6CPA A;  3FF3 A;  1VHO A;  1YW4 A;  1ZLH A;  2EK8 A;  4JZ0 A;  1AYE A;  2O53 A;  2PIZ A;  3NFZ A;  2NYQ A;  1LAN A;  2POK A;  3FEC A;  2AFS A;  4X8I A;  3B3W A;  4W9Y A;  1AMP A;  2ZEH A;  4UEF A;  4A38 A;  2ZEP A;  3V7Z A;  4TNU A;  3H8F A;  1ARM A;  1IGB A;  1NSA A;  4ZY1 A;  2ZEF A;  3JRU A;  2PIY A;  4PXB A;  3RAM A;  3B35 A;  3SI2 A;  5CBM A;  5K8M A;  4MHN A;  3PBB A;  3SJF A;  1CP6 A;  2ABZ A;  2HC9 A;  5HXD A;  2ZEO A;  4K3N A;  3KAS A;  1ZG8 A;  3RBU A;  2PVV A;  1ARL A;  5LYF A;  3TX8 A;  3DGV A;  3FMC A;  4PXC A;  2PJC A;  1M4L A;  2CTB A;  4P4I A;  4ZX8 A;  1UWY A;  1FT7 A;  4UEE A;  4MMO A;  3D7F A;  1R3N A;  3BI1 A;  3HUV A;  4FAI A;  1XFO A;  3FED A;  2VL1 A;  1F57 A;  2JBJ A;  2V8D A;  1F2P A;  2Q51 A;  4DUK A;  1ELM P;  3WC5 A;  2NSM A;  4LQG A;  1HDU A;  3IWW A;  4ZX9 A;  5CPA A;  2PJ1 A;  2PCU A;  5LRK A;  4MCQ A;  4BD9 A;  3KHX A;  2PJ2 A;  4ONW A;  4R6T A;  5HVG A;  2F8H A;  1LAP A;  4OC4 A;  1Z2L A;  1VIX A;  3B3S A;  2BCO A;  2ZEE A;  4F9V A;  3WAB A;  3NH4 A;  1Y0Y A;  1CG2 A;  4IAV A;  2Q43 A;  2GLF A;  2AFX A;  5HVH A;  3KR4 A;  1CPX A;  2OR4 A;  2V8V A;  3WC7 A;  3IEH A;  5ELY A;  3NA6 A;  2C6G A;  1JQG A;  1XRY A;  1FNO A;  2PJ8 A;  3KL9 A;  3PB8 X;  3PB4 X;  1Y7E A;  4NGN A;  4RUH A;  1RTQ A;  3BI0 A;  1GYT A;  2GU2 A;  4OKO A;  3BXM A;  3GB0 A;  4Z65 A;  1CP7 A;  4OC2 A;  4A39 A;  2ZEN A;  3FJU A;  1KWM A;  3H8G A;  2ZOF A;  3SI1 A;  3KR5 A;  5JH9 A;  2AFU A;  3PB6 X;  4Q7A A;  2AFM A;  1LAM A;  1BPM A;  2PJ0 A;  2WYR A;  3ISX A;  4CPA A;  2WZN A;  1ZLI A;  5D8N A;  4NGM A;  3CPX A;  4PXD A;  1BAV A;  1YLO A;  2C6P A;  3PRT A;  3K2K A;  4NGS A;  2ANP A;  2F7V A; 
#chains in the Genus database with same CATH topology
 2D4O A;  5EMI A;  1QST A;  1IOF A;  4UIA A;  1IIC A;  1CX8 A;  2Q4V A;  4KSF A;  4CYN A;  4PXE A;  1Y9W A;  4MFL A;  4CAV A;  1YSJ A;  1YVK A;  3KI9 A;  4OC5 A;  4NCZ A;  2Q04 A;  3LAC A;  3NE8 A;  3PGP A;  5HMN A;  3ISZ A;  2JBK A;  4NJQ A;  5AGE A;  2O4H A;  2AFO A;  1IYK A;  5H84 A;  1QSN A;  2B58 A;  4B10 A;  4XPD C;  4PPZ A;  4JXR A;  3FYN A;  3TTH A;  3BLN A;  1AUG A;  2QJ8 A;  4ZY0 A;  2IJZ A;  2GRE A;  3IC1 A;  5H86 A;  3KZW A;  4CGO A;  2PE3 A;  3SXO A;  4OC0 A;  3IJ3 A;  3MRU A;  4MJ8 A;  1YLE A;  2FE7 A;  4A33 A;  1S7K A;  5J1Q A;  1TXR A;  4YWY A;  1Y0R A;  1OBR A;  2CNS A;  3D7H A;  1TF8 A;  3IO1 A;  4FD5 A;  1Z8L A;  4RI1 A;  1ZG7 A;  1IB1 E;  3F8K A;  3H5Z A;  1QMU A;  4FUU A;  4UIB A;  3QAH A;  3V38 A;  1LCP A;  4PK3 A;  1CJW A;  3B3T A;  4ZYQ A;  1EE3 P;  3D3S A;  4GM5 A;  4F9U A;  2Q0Y A;  1XEB A;  4OC3 A;  4CYP A;  4NGR A;  2PJ7 A;  5C88 A;  3FX6 A;  3PB7 X;  4H6Z A;  1HDQ A;  1X12 A;  4KSI A;  3W6S A;  4MHP A;  1PUA A;  1TKF A;  3FRM A;  2B4D B;  4IK2 A;  2GE3 A;  3A9L A;  4B5O A;  1J4J A;  2WPX A;  3VAT A;  4A2Z A;  3FNC A;  1YQE A;  5K8P A;  4NGT A;  3G3S A;  2PRQ A;  4NJR A;  2ZEM A;  3FXT A;  2J9A A;  2Q7B A;  2J8M A;  4MFP A;  1NE9 A;  2AFW A;  4GXH A;  2XEJ A;  4OC1 A;  3I3G A;  5K8N A;  4U9Z A;  2PJ6 A;  3PZJ A;  2EK9 A;  4A94 A;  2JDD A;  2JEW A;  3B3C A;  2ZEL A;  5F49 A;  3LD2 A;  4OIW A;  4X3R A;  1X10 A;  3EFA A;  3N5F A;  4P45 A;  3FVL A;  1IOI A;  3K9U A;  5HH1 A;  4F8Z A;  1Z8T A;  3D4U A;  4R57 A;  3LMS A;  1Q2Y A;  1R43 A;  2AE6 A;  3S6F A;  4G1P A;  4P10 A;  2QML A;  2EO8 A;  2PJ3 A;  1VHE A;  3CPA A;  2OU2 A;  1VHS A;  3CDX A;  3NH8 A;  3PBE A;  4JWP A;  4KOU A;  1B87 A;  4FD4 A;  3S9L A;  1TIQ A;  4FWU A;  2QYV A;  3I1U A;  2JEV A;  5DWM A;  4JYW A;  3S6K A;  5D29 A;  2Z11 A;  4ZI6 A;  1DTD A;  3KQZ A;  4XNH C;  1MJA A;  3TO9 A;  4CGP A;  3IWE A;  1CBX A;  1KUX A;  4BMH A;  4Q38 A;  4MCP A;  3WC6 A;  3R9G A;  2ZOG A;  2ZEG A;  2DF5 A;  3D2P A;  4KOX A;  4PQA A;  5ISV A;  2I79 A;  4YRH A;  2IQ6 A;  3JTK A;  2HQY A;  3IGR A;  1L0C A;  3KKW A;  4ONU A;  4E0A A;  2Q7S A;  4L8A A;  4ZBG A;  2PJ4 A;  2BL1 A;  3CZX A;  4JD6 A;  1M4I A;  4KOY A;  1YW6 A;  2C6C A;  2P0W A;  3DR6 A;  1QSR A;  3T90 A;  2Z3N A;  2V77 A;  4A37 A;  2XEG A;  1YVO A;  1V0C A;  1KUY A;  5I4M A;  4H2K A;  3IWG A;  5JGF A;  4QC6 A;  4EWT A;  4F0Y A;  2OH1 A;  2R1I A;  2VQY A;  3E0K A;  3SI0 A;  5DS0 A;  2YNC A;  2G3T A;  4UFV A;  2WSA A;  2GLJ A;  1TKH A;  3VWE A;  1BLL E;  2PRB A;  4R8F A;  4UCM A;  4EFD A;  3BJ8 A;  2O28 A;  4PSX A;  4U9Y A;  4P4E A;  3BHX A;  4P44 A;  3T8W A;  2DXQ A;  4MFJ A;  3EC4 A;  3LWU A;  4X2T A;  2QEC A;  1LOK A;  4DYO A;  5G21 A;  3S9N A;  1Z5R A;  2R8V A;  3WT4 A;  4KVM E;  4MY0 A;  4HNW B;  3FEE A;  5THW A;  3PEI A;  5AG4 A;  2VI7 A;  3KQX A;  5F09 A;  3FIX A;  1WWZ A;  2XEI A;  4IF5 A;  4P4B A;  1H8L A;  2YNC C;  1Q7L A;  3R95 A;  3TO7 A;  4P4F A;  4AVC A;  1BPN A;  4M6H A;  1XMB A;  4YU9 A;  2C1C A;  3QAY A;  2PJB A;  4M85 A;  7CPA A;  1KZF A;  1PU9 A;  2EWB A;  2JDC A;  2BO9 A;  2ZW5 A;  4HKF A;  2V8G A;  1LFW A;  4TWE A;  1IID A;  3H8E A;  5DWN A;  3G8W A;  5IV0 A;  4MBU A;  1OZP A;  4KVO E;  3CXP A;  1PCA A;  2V8H A;  1YME A;  4OID A;  3QNV A;  3SJG A;  4KLV A;  4MHZ A;  4YFJ A;  1Q2D A;  2Z3L A;  3D7G A;  4MRI A;  5A27 A;  1CM0 A;  2BEI A;  2PJ5 A;  3D8P A;  2VZZ A;  3GLJ A;  4RN7 A;  1S5K A;  3KHZ A;  1YRE A;  2QIR A;  3DR8 A;  2VXK A;  1B6B A;  3GUX A;  2PDO A;  4HNX B;  4X5K A;  3GKR A;  4CRZ B;  4FBE A;  1CPS A;  1KUV A;  1TF9 A;  4KVX A;  3IIB A;  3D67 A;  4CAE A;  2YGW A;  1A2Z A;  1GHE A;  3D7D A;  4IHM A;  4JJX A;  2ZW6 A;  4E2A A;  2ZPA A;  5F47 A;  5LRJ A;  1I12 A;  2P6E A;  4F0X A;  1Z8X A;  3PB9 X;  4ZGY B;  5LYL A;  5IB9 A;  1HEE A;  3P2H A;  4MY3 A;  3V8I A;  5LYI A;  8CPA A;  1Z4E A;  2PJ9 A;  5LYD A;  2EUI A;  3R9F A;  3D68 A;  4KUB A;  4J3G A;  3EXN A;  2B4D A;  3BJ7 A;  3L2N A;  5EC4 A;  1NMT A;  1YX0 A;  2NMT A;  2DEA A;  4C2Z A;  3TT2 A;  2FVG A;  3K9T A;  2AFZ A;  3R96 A;  4A30 A;  3CXS A;  4QBJ A;  1XBU A;  3CXQ A;  3IFE A;  4UFX A;  1P4N A;  5EBV A;  3TE4 A;  1UFH A;  3KGQ A;  3IU2 A;  2J8N A;  3MN8 A;  2G3A A;  1YK3 A;  4UCN A;  5G1Z A;  3RZA A;  2OZG A;  4B5P A;  2BOA A;  4OP4 A;  1IY7 A;  1VGY A;  2QVP A;  1SQH A;  4P4J A;  4BBH A;  1FY7 A;  4HPS A;  4P6Y A;  4R76 A;  1F2O A;  4BIN A;  4MFQ A;  2FIW A;  2FCK A;  1PYT B;  1BO4 A;  1Z8W A;  4KSA A;  2OOT A;  1RXT A;  2I3C A;  4B5P B;  2Q4Z A;  4M3S A;  5G20 A;  1QQ9 A;  5JM6 A;  4AXV A;  3FH4 A;  1ZO0 A;  4ZY2 A;  4AVB A;  2PJA A;  5FVJ A;  5C82 A;  4Y49 B;  2Y0M A;  2BSW A;  1R57 A;  4NGP A;  3B2Y A;  4OME A;  4R7M A;  4ORF A;  1QSM A;  3SJX A;  3GIU A;  4UWI A;  2XEF A;  4HNY B;  4PV6 A;  4WWV A;  4MFK A;  3S6G A;  3JUW A;  4MXU A;  2C27 A;  2HB6 A;  3VAR A;  3B7I A;  3VWD A;  1NSL A;  3W6X A;  4CGL A;  4XPK A;  1WK4 A;  3LOD A;  2DPS A;  4C7I A;  5JQ4 A;  2REF A;  5J8F A;  2OZH A;  2ARH A;  4C2Y A;  2RB7 A;  2RFH A;  4P4D A;  3PFE A;  5F48 A;  1MK4 A;  4H6U A;  1I1D A;  4DJL A;  4KLW A;  1YR0 A;  1IYL A;  3QB8 A;  3SJE A;  2FS5 A;  3NH5 A;  4UWJ A;  3DLJ A;  3HLP A;  1TKJ A;  3PFO A;  4CAF A;  4F6A A;  1ELL P;  2CIJ A;  1XJO A;  3WR7 A;  4B12 A;  2OZU A;  4K30 A;  2ATR A;  2CTC A;  5IX3 A;  2ZW7 A;  1DE4 C;  4I49 A;  4CRY B;  5HVF A;  4AVA A;  3B3V A;  4B6Z A;  4MI4 A;  4JLY A;  4NFR A;  4EME A;  4MFZ A;  4NGQ A;  2CF4 A;  4MHY A;  4A31 A;  3D66 A;  2IMO A;  3FBU A;  4R87 A;  3CT9 A;  1S7F A;  1MJ9 A;  2G9D A;  3IU1 A;  3C26 A;  2PVW A;  4WJB A;  5K8O A;  3VH9 A;  4MCR A;  5LRG A;  4UF4 A;  4UCP A;  4MCS A;  2ZED A;  2I00 A;  3TC8 A;  4O23 A;  1ZG9 A;  2Z3O A;  2CXA A;  2FL4 A;  3S9M A;  4L89 A;  4UEZ A;  3GYA A;  1MJB A;  2WPW A;  3FF3 A;  4C68 A;  6CPA A;  4CYQ A;  1S7N A;  2FT0 A;  1VHO A;  2R98 A;  4U5Y A;  4YGO A;  2EVN A;  1YW4 A;  4XPL A;  1ZLH A;  2EK8 A;  4JZ0 A;  1Z4R A;  4A95 A;  1AYE A;  2PR8 A;  2PSW A;  4CYO A;  5I0C A;  2O53 A;  2J8R A;  2PIZ A;  4A32 A;  4OLL A;  4CS0 B;  3NFZ A;  2NYQ A;  3B8G A;  1LAN A;  2POK A;  3FEC A;  2AFS A;  4X8I A;  3B3W A;  4W9Y A;  3TCV A;  5BWA B;  2Z3P A;  1AMP A;  3DSB A;  3I9S A;  1VKC A;  2ZEH A;  4UEF A;  5KTD A;  4A38 A;  4LQ6 A;  1I21 A;  4B14 A;  2ZEP A;  5JPH A;  2FSR A;  3PP9 A;  3V7Z A;  2KCW A;  4TNU A;  3H8F A;  4C7H A;  1ARM A;  1IGB A;  1NSA A;  3JVN A;  3R1K A;  2CNM A;  3N7Z A;  4ZY1 A;  1XE4 A;  2ZEF A;  4KOV A;  3SXN A;  3JRU A;  2PIY A;  4PXB A;  3RAM A;  3B35 A;  3SI2 A;  2BUE A;  4UA3 A;  4PK2 A;  5CBM A;  3ZZI A;  2GIV A;  4KOR A;  5K8M A;  2Z3M A;  4MHN A;  3PBB A;  2JLM A;  3SJF A;  3TOB A;  2ZW4 A;  1CP6 A;  2ABZ A;  2HC9 A;  4XPD B;  3T9Y A;  5HXD A;  2ZEO A;  4K3N A;  3SHP A;  3H4Q A;  4R9M A;  1N71 A;  4LX9 A;  4Q36 A;  3KAS A;  1ZG8 A;  2B4B A;  4AB7 A;  2VEZ A;  4NXY A;  3RBU A;  5KTC A;  2PVV A;  1ARL A;  5LYF A;  4PSW A;  3DGV A;  3FMC A;  1S60 A;  3TX8 A;  1IU8 A;  4NF1 A;  3OWC A;  4PXC A;  3P2F A;  2PJC A;  2Z0Z A;  1XF8 A;  2CNT A;  4LUA A;  3D2M A;  1M4L A;  5KTA A;  2Z3K A;  2D4P A;  2CTB A;  4P4I A;  4ZX8 A;  1UWY A;  1FT7 A;  5IB0 A;  2H5M A;  4E8O A;  4UEE A;  5G22 A;  2GFQ A;  4MMO A;  3D7F A;  1R3N A;  3EO4 A;  3BI1 A;  3HUV A;  4FAI A;  1XFO A;  3FED A;  2OB0 A;  2VL1 A;  1F57 A;  2RC4 A;  3EY5 A;  1Y9K A;  2JBJ A;  4FD7 A;  2V8D A;  1F2P A;  2YNE A;  4KUA A;  2G0B A;  2PR1 A;  2Q51 A;  1RO5 A;  4DUK A;  1ELM P;  2Z10 A;  4M6I A;  4KOW A;  5AG6 A;  3WC5 A;  2NSM A;  4LQG A;  1BOB A;  4H89 A;  1HDU A;  3RO0 A;  4M6G A;  3IWW A;  1P0H A;  1Z9U A;  4ZX9 A;  1M4D A;  2PC1 A;  5CPA A;  4Y49 C;  2PJ1 A;  4IUS A;  2PCU A;  5LRK A;  2F5I A;  4MCQ A;  2B5G A;  2IL4 A;  4NSQ A;  4OAE A;  3TOA A;  3KHX A;  2PJ2 A;  4BD9 A;  4ONW A;  4R3L A;  4R6T A;  2GAN A;  4FD6 A;  5HVG A;  2F8H A;  1LAP A;  2Q44 A;  5E96 A;  4MHD A;  2Q4Y A;  2REE A;  4OC4 A;  1Z2L A;  4AG9 A;  2B5G B;  1VIX A;  3B3S A;  4UBR A;  2BCO A;  3RNZ A;  3TFY A;  2ZEE A;  5AG7 A;  2CY2 A;  4RS2 A;  2FIA A;  5GCN A;  3WAB A;  4F9V A;  1U6M A;  3NH4 A;  1Y0Y A;  1CG2 A;  2P6G A;  2VZY A;  4IAV A;  4CGM A;  1XMT A;  5F46 A;  3RYO A;  2WUU A;  2HUZ A;  2HV2 A;  2GLF A;  2Q43 A;  2AFX A;  2AJ6 A;  4XNH B;  5HVH A;  1XIX A;  3KR4 A;  1CPX A;  2OR4 A;  2V8V A;  3WC7 A;  1LRZ A;  3MGD A;  3IEH A;  5ELY A;  1S7L A;  3NA6 A;  3W91 A;  3F5B A;  2C6G A;  4AG7 A;  1M1D A;  1JQG A;  1XRY A;  2A4N A;  4II9 A;  2ZXV A;  1FNO A;  4GS4 A;  2K5T A;  2PJ8 A;  3KL9 A;  4NEX A;  3PB8 X;  4UFW A;  3PB4 X;  1Y7E A;  1S3Z A;  2YND A;  4NGN A;  4RUH A;  1RTQ A;  2VBQ A;  4KZT A;  3UY5 A;  4CAX A;  1YGH A;  3BI0 A;  1GYT A;  4C2X A;  2B3U A;  2GU2 A;  4CGN A;  1JWQ A;  5J8C A;  3DNS A;  4OKO A;  3BXM A;  3GB0 A;  3NE7 A;  4QUS A;  4Z65 A;  1CP7 A;  1ON0 A;  4OC2 A;  2R7H A;  1XOV A;  2ZEN A;  3FJU A;  5CNP A;  4A39 A;  1KWM A;  4KOS A;  3DDD A;  3ZJ0 A;  3R9E A;  3H8G A;  2ZOF A;  4QVT A;  2EBJ A;  3SI1 A;  2DPT A;  3KR5 A;  4DNC A;  2AFU A;  5JH9 A;  1K4J A;  3GY9 A;  3PB6 X;  4Q7A A;  2AFM A;  2P6F A;  3F0A A;  1LAM A;  1BPM A;  2PJ0 A;  2WYR A;  3ISX A;  4R3K A;  4CPA A;  4EVY A;  1M4G A;  2WZN A;  1ZLI A;  4JXQ A;  4KS9 A;  5D8N A;  4OAD A;  2ODF A;  3TO6 A;  4NGM A;  2FXF A;  3CPX A;  4CAW A;  1Y7R A;  1QSO A;  2PQ8 A;  3FB3 A;  4PXD A;  2X7B A;  1M44 A;  1BAV A;  1YLO A;  2C6P A;  4KOT A;  1Q2C A;  5A28 A;  3S6H A;  4QB9 A;  4B11 A;  3PRT A;  2B3V A;  3K2K A;  4NGS A;  2ANP A;  4B13 A;  5AG5 A;  2F7V A; 
#chains in the Genus database with same CATH homology
 4UIA A;  1CX8 A;  4PXE A;  1YSJ A;  3KI9 A;  4OC5 A;  3ISZ A;  2JBK A;  4NJQ A;  2O4H A;  2AFO A;  4PPZ A;  4ZY0 A;  2QJ8 A;  2IJZ A;  2GRE A;  3IC1 A;  3KZW A;  2PE3 A;  4OC0 A;  3IJ3 A;  3MRU A;  5J1Q A;  1TXR A;  4YWY A;  1Y0R A;  1OBR A;  3D7H A;  1TF8 A;  3IO1 A;  1Z8L A;  1ZG7 A;  1QMU A;  4FUU A;  4UIB A;  3V38 A;  1LCP A;  3B3T A;  4ZYQ A;  1EE3 P;  4GM5 A;  4F9U A;  4OC3 A;  4NGR A;  2PJ7 A;  3FX6 A;  3PB7 X;  1HDQ A;  4KSI A;  4MHP A;  1TKF A;  4IK2 A;  3VAT A;  5K8P A;  4NGT A;  2PRQ A;  4NJR A;  2ZEM A;  2J9A A;  2AFW A;  2XEJ A;  4OC1 A;  5K8N A;  2PJ6 A;  2EK9 A;  4A94 A;  2JEW A;  3B3C A;  2ZEL A;  4OIW A;  4X3R A;  3N5F A;  4P45 A;  3FVL A;  4F8Z A;  3D4U A;  3LMS A;  1R43 A;  4G1P A;  4P10 A;  2PJ3 A;  1VHE A;  3CPA A;  3NH8 A;  3CDX A;  3PBE A;  3S9L A;  4FWU A;  2QYV A;  3I1U A;  4JYW A;  5D29 A;  4ZI6 A;  1DTD A;  3KQZ A;  1CBX A;  3WC6 A;  4MCP A;  2ZOG A;  2ZEG A;  4PQA A;  2IQ6 A;  2PJ4 A;  1YW6 A;  2C6C A;  2V77 A;  4A37 A;  2XEG A;  5I4M A;  5JGF A;  4H2K A;  4EWT A;  3SI0 A;  5DS0 A;  2GLJ A;  1TKH A;  4EFD A;  1BLL E;  4R8F A;  4P4E A;  3BHX A;  4P44 A;  3T8W A;  3LWU A;  4X2T A;  1LOK A;  4DYO A;  3S9N A;  1Z5R A;  3WT4 A;  5THW A;  3FEE A;  3PEI A;  3KQX A;  5F09 A;  2XEI A;  4P4B A;  1H8L A;  1Q7L A;  4P4F A;  1BPN A;  1XMB A;  4YU9 A;  2C1C A;  7CPA A;  2PJB A;  2EWB A;  2BO9 A;  2V8G A;  1LFW A;  4TWE A;  3H8E A;  1PCA A;  2V8H A;  1YME A;  4OID A;  3QNV A;  3SJG A;  4MHZ A;  3D7G A;  4MRI A;  2PJ5 A;  3GLJ A;  3KHZ A;  3GUX A;  4FBE A;  1CPS A;  1TF9 A;  3IIB A;  3D67 A;  3D7D A;  4IHM A;  5LRJ A;  3PB9 X;  5LYL A;  5IB9 A;  1HEE A;  5LYI A;  8CPA A;  2PJ9 A;  5LYD A;  3D68 A;  3L2N A;  2DEA A;  2FVG A;  3K9T A;  2AFZ A;  1XBU A;  3IFE A;  3KGQ A;  3MN8 A;  3RZA A;  2BOA A;  4OP4 A;  1IY7 A;  1VGY A;  2QVP A;  4P4J A;  4P6Y A;  4R76 A;  1F2O A;  1PYT B;  2OOT A;  2I3C A;  2Q4Z A;  1QQ9 A;  5JM6 A;  4AXV A;  3FH4 A;  4ZY2 A;  2PJA A;  4NGP A;  3B2Y A;  4OME A;  4R7M A;  3SJX A;  2XEF A;  4WWV A;  4MXU A;  2HB6 A;  3VAR A;  3B7I A;  2RB7 A;  2RFH A;  4P4D A;  3PFE A;  4DJL A;  3SJE A;  3NH5 A;  3DLJ A;  3HLP A;  1TKJ A;  3PFO A;  1ELL P;  2CIJ A;  1XJO A;  2CTC A;  1DE4 C;  5HVF A;  3B3V A;  4B6Z A;  4NFR A;  4EME A;  4NGQ A;  2CF4 A;  4MHY A;  3D66 A;  2IMO A;  3CT9 A;  2G9D A;  2PVW A;  4WJB A;  5K8O A;  3VH9 A;  4MCR A;  5LRG A;  4UF4 A;  4MCS A;  2ZED A;  3TC8 A;  4O23 A;  1ZG9 A;  3S9M A;  4UEZ A;  6CPA A;  3FF3 A;  1VHO A;  1YW4 A;  1ZLH A;  2EK8 A;  4JZ0 A;  1AYE A;  2O53 A;  2PIZ A;  3NFZ A;  2NYQ A;  1LAN A;  2POK A;  3FEC A;  2AFS A;  4X8I A;  3B3W A;  4W9Y A;  1AMP A;  2ZEH A;  4UEF A;  4A38 A;  2ZEP A;  3V7Z A;  4TNU A;  3H8F A;  1ARM A;  1IGB A;  1NSA A;  4ZY1 A;  2ZEF A;  3JRU A;  2PIY A;  4PXB A;  3RAM A;  3B35 A;  3SI2 A;  5CBM A;  5K8M A;  4MHN A;  3PBB A;  3SJF A;  1CP6 A;  2ABZ A;  2HC9 A;  5HXD A;  2ZEO A;  4K3N A;  3KAS A;  1ZG8 A;  3RBU A;  2PVV A;  1ARL A;  5LYF A;  3TX8 A;  3DGV A;  3FMC A;  4PXC A;  2PJC A;  1M4L A;  2CTB A;  4P4I A;  4ZX8 A;  1UWY A;  1FT7 A;  4UEE A;  4MMO A;  3D7F A;  1R3N A;  3BI1 A;  3HUV A;  4FAI A;  1XFO A;  3FED A;  2VL1 A;  1F57 A;  2JBJ A;  2V8D A;  1F2P A;  2Q51 A;  4DUK A;  1ELM P;  3WC5 A;  2NSM A;  4LQG A;  1HDU A;  3IWW A;  4ZX9 A;  5CPA A;  2PJ1 A;  2PCU A;  5LRK A;  4MCQ A;  4BD9 A;  3KHX A;  2PJ2 A;  4ONW A;  4R6T A;  5HVG A;  2F8H A;  1LAP A;  4OC4 A;  1Z2L A;  1VIX A;  3B3S A;  2BCO A;  2ZEE A;  4F9V A;  3WAB A;  3NH4 A;  1Y0Y A;  1CG2 A;  4IAV A;  2Q43 A;  2GLF A;  2AFX A;  5HVH A;  3KR4 A;  1CPX A;  2OR4 A;  2V8V A;  3WC7 A;  3IEH A;  5ELY A;  3NA6 A;  2C6G A;  1JQG A;  1XRY A;  1FNO A;  2PJ8 A;  3KL9 A;  3PB8 X;  3PB4 X;  1Y7E A;  4NGN A;  4RUH A;  1RTQ A;  3BI0 A;  1GYT A;  2GU2 A;  4OKO A;  3BXM A;  3GB0 A;  4Z65 A;  1CP7 A;  4OC2 A;  4A39 A;  2ZEN A;  3FJU A;  1KWM A;  3H8G A;  2ZOF A;  3SI1 A;  3KR5 A;  5JH9 A;  2AFU A;  3PB6 X;  4Q7A A;  2AFM A;  1LAM A;  1BPM A;  2PJ0 A;  2WYR A;  3ISX A;  4CPA A;  2WZN A;  1ZLI A;  5D8N A;  4NGM A;  3CPX A;  4PXD A;  1BAV A;  1YLO A;  2C6P A;  3PRT A;  3K2K A;  4NGS A;  2ANP A;  2F7V A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...