4KLVA

Crystal structure of a gnat superfamily acetyltransferase pa4794 in complex with 4-methylumbelliferyl phosphate
Total Genus 42
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
42
sequence length
159
structure length
159
Chain Sequence
MQLSHRPAETGDLETVAGFPQDRDELFYCYPKAIWPFSVAQLAAAIAERRGSTVAVHDGQVLGFANFYQWQHGDFCALGNMMVAPAARGLGVARYLIGVMENLAREQYKARLMKISCFNANAAGLLLYTQLGYQPRAIAERHDPDGRRVALIQMDKPLE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Uncharacterized protein
publication title Structural, Functional, and Inhibition Studies of a Gcn5-related N-Acetyltransferase (GNAT) Superfamily Protein PA4794: A NEW C-TERMINAL LYSINE PROTEIN ACETYLTRANSFERASE FROM PSEUDOMONAS AERUGINOSA.
pubmed doi rcsb
source organism Pseudomonas aeruginosa
molecule tags Transferase
total genus 42
structure length 159
sequence length 159
ec nomenclature
pdb deposition date 2013-05-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00583 Acetyltransf_1 Acetyltransferase (GNAT) family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.630.30 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Aminopeptidase 4klvA00
4R3LA 3EY5A 3I9SA 4YGOA 1Z9UA 3PGPA 2JEVA 2I79A 4H89A 3EO4A 4IUSA 3CXPA 3TE4A 3UY5A 4XPDC 4XPKA 3B8GA 4Y49C 4KOTA 1U6MA 4FD5A 4R3KA 2EUIA 1ON0A 2Z0ZA 4FD4A 4HNWB 3VWDA 4KZTA 2ATRA 4F0YA 4M85A 1S7NA 2Q7BA 2QECA 4PSWA 1QSMA 2KCWA 2OH1A 1QSNA 1PU9A 1NMTA 2ZW6A 2K5TA 2REFA 3TTHA 5HH1A 4QB9A 2ARHA 2WPXA 1V0CA 1XMTA 4LUAA 5IB0A 2OZGA 3BLNA 1M1DA 4R9MA 3VWEA 2FIAA 5C82A 5KTAA 2VI7A 1MJBA 5KTCA 4BMHA 1RO5A 2Q04A 1TIQA 3DSBA 3D2PA 3R95A 1YLEA 3P2HA 3V8IA 4GS4A 4RI1A 2BL1A 4KLVA 4ONUA 2AJ6A 5EC4A 4X5KA 1M44A 4KVOE 3R9GA 1Q2DA 1MJ9A 2J8RA 4AG7A 1XIXA 5EBVA 3W6XA 4YRHA 1KZFA 4KUAA 4R57A 1Y9KA 2P6FA 2ZW4A 4CAXA 5F48A 4AG9A 3I3GA 2ZW7A 4B5PA 3R9FA 1QSTA 2PRBA 3RYOA 1YR0A 4PK3A 3CXSA 3FB3A 4KOYA 1S7FA 2B3UA 4QUSA 1KUVA 2QMLA 2FCKA 2I00A 3SXOA 1YREA 1I1DA 4OADA 4UWIA 1OZPA 1SQHA 2B4DB 2FSRA 1MK4A 3KKWA 4KOSA 3TO9A 1IB1E 1QSOA 5E96A 4XPLA 3S6KA 4CAWA 4CAVA 4KOUA 4II9A 4AVCA 2FT0A 1S60A 2O28A 2ZPAA 3R96A 3S6GA 4XPDB 4Y49B 4UWJA 4IF5A 2B5GB 5F49A 3EC4A 2OB0A 5IV0A 4JXQA 4L8AA 3R9EA 2ZXVA 4U9ZA 3ZJ0A 4U9YA 4QC6A 4JD6A 2BEIA 1N71A 2VEZA 2PDOA 3C26A 4KLWA 4R87A 3S6HA 1VKCA 1Q2YA 4I49A 1S3ZA 5FVJA 4RS2A 2D4PA 2NMTA 5C88A 3TOAA 1B6BA 4UA3A 5DWMA 2ZW5A 1XEBA 3FNCA 1M4GA 2R1IA 1IYKA 2CNSA 4JJXA 3T9YA 3TFYA 4H6UA 1WWZA 2FS5A 1R57A 5I0CA 2AE6A 2HQYA 3F8KA 4MY0A 1M4IA 2X7BA 2CNTA 1IICA 1L0CA 4B5PB 4AVAA 3TO6A 1CJWA 3F0AA 2VZZA 1B87A 3IWGA 2VXKA 2H5MA 2CY2A 3PP9A 3QB8A 1Q2CA 2JLMA 2Q0YA 4B5OA 2Y0MA 3S6FA 4J3GA 2DXQA 3LD2A 3K9UA 4E8OA 2P6GA 4PK2A 5GCNA 4JWPA 2GANA 4OLLA 2F5IA 3EXNA 4MHDA 3E0KA 5H84A 1Y7RA 2GE3A 3W91A 2IL4A 1XE4A 2R7HA 2VZYA 2WPWA 3P2FA 3FYNA 1YVOA 1J4JA 4OAEA 5HMNA 5JQ4A 3G8WA 2PSWA 4KORA 4MJ8A 5J8FA 4H6ZA 3EFAA 2FL4A 4XNHC 2B3VA 1I21A 5ISVA 4KOVA 3FBUA 3T90A 2BUEA 4AVBA 2VBQA 4CRYB 4HKFA 3SXNA 3GYAA 1FY7A 3DR8A 3FRMA 3D2MA 4HNXB 1S7LA 1RXTA 1YK3A 3MGDA 4M3SA 3G3SA 4NXYA 2J8MA 4NF1A 2R98A 3D8PA 4CS0B 4EVYA 4FD7A 1IIDA 2GIVA 3TCVA 3TT2A 5DWNA 2PR1A 2HUZA 2REEA 1VHSA 4MBUA 5CNPA 4JLYA 1P4NA 4KOWA 3D3SA 2A4NA 1LRZA 2B58A 2FXFA 3QAHA 2B4DA 4KVXA 1YX0A 3NE7A 2HV2A 2OZUA 2VQYA 5F47A 4NEXA 4MI4A 5IX3A 3JVNA 2FIWA 2P0WA 3JUWA 2G3AA 3ZZIA 2D4OA 2J8NA 3LODA 4E0AA 2B4BA 2C27A 3W6SA 4NCZA 3TO7A 1PUAA 3R1KA 2G3TA 4L89A 5JPHA 2PQ8A 2Q44A 2B5GA 4AB7A 5KTDA 4ZBGA 2OU2A 2CNMA 4KOXA 1XF8A 4ORFA 2Q4YA 1NSLA 4F6AA 4FD6A 2PR8A 1CM0A 1YVKA 2BSWA 2EVNA 3IGRA 3DNSA 4K30A 1IYLA 4PSXA 1UFHA 3DR6A 2PC1A 2Z11A 1P0HA 2FE7A 4MY3A 5F46A 1NE9A 4U5YA 4QBJA 4DNCA 1BO4A 1YGHA 3CXQA 4XNHB 3H4QA 4NSQA 3DDDA 4UBRA 1GHEA 1Y9WA 3GKRA 3SHPA 1KUXA 2Z10A 3GY9A 4E2AA 5H86A 2JDCA 3BJ7A 4KVME 4LX9A 4HNYB 1M4DA 3WR7A 1Z4EA 3N7ZA 1Z4RA 2RC4A 2OZHA 1S5KA 5J8CA 1WK4A 3F5BA 4YFJA 3BJ8A 1I12A 4JXRA 3FXTA 1BOBA 2QIRA 4KUBA 1KUYA 4PV6A 3TOBA 1S7KA 4QVTA 2R8VA 3OWCA 1MJAA 3PZJA 2Q4VA 2G0BA 1K4JA 1QSRA 2P6EA 2JDDA 4CRZB 3FIXA
chains in the Genus database with same CATH superfamily
1YQEA 2J9AA 4R3LA 3WC5A 3EY5A 3I9SA 4YGOA 4A94A 1Z9UA 3PGPA 1XMBA 2JEVA 1TF8A 1Y7EA 2I79A 2V8VA 2F7VA 3D7HA 3EO4A 3CXPA 4H89A 4IUSA 4MCPA 1YW6A 4XPDC 4XPKA 2VL1A 3B8GA 3UY5A 2AFXA 4Y49C 4KOTA 2ZEGA 1RTQA 4OC1A 3VATA 1ZLHA 4NGRA 3FF3A 1Z8XA 3D66A 4CGLA 1U6MA 2Z3MA 4FD5A 5HVGA 3IU1A 2C6GA 4R3KA 3V7ZA 2EUIA 6CPAA 1LCPA 1ON0A 2IJZA 2Z0ZA 4FD4A 4HNWB 4H2KA 1LAPA 4KZTA 2PJ6A 2ATRA 1JQGA 2C6PA 3VWDA 4CGPA 4FUUA 4F0YA 1QQ9A 4M85A 4A2ZA 1S7NA 1QMUA 3IO1A 2QECA 2Q7BA 3NE8A 4IHMA 4PSWA 1Q7LA 1LAMA 1EE3P 3SJGA 1QSMA 2V8HA 4C2YA 1CPSA 3SJXA 2KCWA 3D7FA 4NGNA 4W9YA 2OH1A 1QSNA 1PU9A 4P4IA 1NMTA 2ZOGA 2ZW6A 4OP4A 2K5TA 3PB8X 2REFA 4F8ZA 3TTHA 3SI1A 5HH1A 4QB9A 3IWWA 1PCAA 2ARHA 2WPXA 4NJQA 4PXCA 1V0CA 1XMTA 4LUAA 4MHZA 2YGWA 5IB0A 2OZGA 3BLNA 4MCQA 1F2PA 3RBUA 3IC1A 4B11A 2HC9A 1M1DA 4P6YA 4C2XA 4R9MA 5G20A 3VWEA 2FIAA 5C82A 2ODFA 2NSMA 5G1ZA 5KTAA 2VI7A 1MJBA 2ANPA 5KTCA 4BMHA 4MHNA 4A37A 1RO5A 2ZEDA 2Q04A 1TIQA 4CYNA 2CTBA 3DSBA 5D29A 3D2PA 3R95A 1CBXA 2CXAA 4UCMA 2PJCA 1YLEA 3KZWA 1CP7A 3P2HA 2IMOA 3JRUA 4KS9A 1CX8A 4NJRA 4GS4A 3V8IA 5THWA 2PE3A 4RI1A 4F9VA 2BL1A 2Q4ZA 4KLVA 2AJ6A 4ONUA 4CYOA 3K9TA 5EC4A 4EFDA 1FNOA 4KSIA 4UF4A 4P4FA 3H8GA 4B14A 5HVHA 4X5KA 4OC2A 1M44A 4KVOE 3R9GA 1Q2DA 2DPSA 1YW4A 3PFEA 1MJ9A 4A33A 3NA6A 2BOAA 2J8RA 4AG7A 1XIXA 1BPNA 5EBVA 3GLJA 2PJ5A 3W6XA 5F09A 3PBBA 5A27A 4YRHA 1KZFA 4UEEA 4P45A 4KUAA 4R57A 2V8DA 4UCNA 1Y9KA 4X3RA 2P6FA 2ZW4A 3KGQA 4CAXA 5F48A 4AG9A 4CGMA 3I3GA 2ZW7A 2CF4A 4F9UA 3PEIA 4B5PA 4MFJA 3PB9X 3R9FA 1QSTA 2PRBA 3RYOA 1ZG7A 3DLJA 3ISXA 1YR0A 2PRQA 4KSFA 2Z3KA 4UEZA 4PK3A 2Z3NA 4X2TA 5JGFA 5LRJA 3CXSA 4NGPA 3FB3A 4KOYA 1S7FA 4UIBA 2B3UA 4QUSA 2AFWA 1KUVA 1YSJA 2QMLA 2FCKA 2I00A 4ONWA 3SXOA 2GFQA 4MFZA 1YREA 1I1DA 4OADA 4UWIA 8CPAA 1IOFA 3B3TA 4OIWA 1PYTB 4UFWA 1OZPA 1SQHA 2B4DB 2ZEMA 3NFZA 2FSRA 4F0XA 1MK4A 4K3NA 2YNDA 1ZLIA 3KKWA 2PJ3A 2QYVA 3HLPA 4Q38A 4P4EA 4KOSA 3TO9A 1IB1E 4A30A 1QSOA 2EK8A 4XPLA 3GIUA 5E96A 4ZX9A 3S6KA 3WT4A 4EMEA 1TXRA 1CPXA 2AFSA 4CAWA 4CAVA 1FT7A 4KOUA 2ZEFA 1KWMA 3SJFA 1Y0YA 3PRTA 4II9A 3H8FA 4P4BA 1ELMP 2ZEOA 4AVCA 1HDUA 2FT0A 1S60A 2O28A 3I1UA 4DJLA 2ZPAA 3B3VA 4Q7AA 3R96A 4E2AA 3S6GA 4XPDB 4FAIA 4ZGYB 3KL9A 4Y49B 4UWJA 4RUHA 4A31A 2ZELA 4IF5A 2B5GB 2DF5A 3FEDA 5F49A 3EC4A 2OB0A 4PPZA 5IV0A 4CPAA 1R3NA 2AFZA 4JXQA 4L8AA 3R9EA 2ZXVA 4R8FA 2XEGA 4U9ZA 3ZJ0A 4UIAA 4U9YA 4QC6A 3KR5A 4JD6A 2BEIA 1N71A 3V38A 2JBJA 4OC3A 2VEZA 3BI0A 3KHZA 2PDOA 3C26A 2BCOA 5AGEA 4KLWA 1Z8WA 4R87A 3KHXA 3S6HA 3ISZA 3CPXA 1VKCA 5K8MA 1Q2YA 2YNEA 4Z65A 4I49A 1S3ZA 5FVJA 2PJ0A 4P44A 2D4PA 4RS2A 2NMTA 5C88A 4OKOA 1LFWA 3TOAA 1TKJA 1B6BA 4UA3A 3B3SA 4M6IA 4OC5A 1AUGA 4OMEA 2CTCA 5LYDA 5DWMA 2ZW5A 4HPSA 1XEBA 3FNCA 1M4GA 5ELYA 3QNVA 2R1IA 1IYKA 3D7DA 4A39A 3DGVA 2CNSA 1DTDA 1VHOA 4JJXA 4O23A 3T9YA 1CG2A 1X10A 4JYWA 1XFOA 3TFYA 2POKA 4ZY0A 4H6UA 5DS0A 1WWZA 2FS5A 3IEHA 4R6TA 1LANA 1R57A 1GYTA 2AE6A 4MXUA 5I0CA 2HQYA 4OC4A 3F8KA 5CBMA 2JEWA 4MY0A 1M4IA 2GREA 2X7BA 4GM5A 2CNTA 1IICA 1L0CA 4B5PB 4AVAA 3TO6A 1CJWA 3F0AA 2VZZA 3MN8A 1B87A 1JWQA 3IWGA 2AFOA 2EK9A 5AG5A 2XEFA 2VXKA 2H5MA 2CY2A 3PP9A 3LACA 1A2ZA 3QB8A 1Q2CA 2WYRA 2I3CA 2JLMA 3KQXA 4P10A 2Q0YA 4C68A 4B5OA 2Y0MA 3S6FA 3CPAA 4J3GA 2DXQA 3LD2A 3VH9A 3K9UA 4E8OA 1BPMA 2P6GA 4PK2A 1HDQA 2PJBA 2RB7A 5GCNA 5J1QA 4JWPA 2BO9A 3CZXA 2GANA 4OLLA 2F5IA 4OC0A 3EXNA 3MRUA 3TE4A 5G21A 2WSAA 1VGYA 4FBEA 4MHDA 3E0KA 5H84A 1Y7RA 2GE3A 3PB6X 3W91A 4ZY1A 2IL4A 1XE4A 2R7HA 2VZYA 2PVVA 2WPWA 3B35A 3FYNA 3P2FA 5AG7A 1YVOA 3FH4A 1CP6A 1J4JA 4OAEA 2C1CA 2PJAA 5HMNA 5JQ4A 1XOVA 3WC7A 3G8WA 4MFLA 2PSWA 2RFHA 3D68A 4FWUA 4X8IA 4KORA 4MJ8A 5BWAB 3PB4X 5J8FA 4BINA 4H6ZA 2PVWA 3EFAA 2FL4A 4ZX8A 4XNHC 4TNUA 2B3VA 2GLFA 2F8HA 1I21A 1NSAA 2C6CA 2V8GA 3GB0A 4KOVA 5G22A 3FBUA 3SI0A 3FJUA 5ISVA 4M6GA 3RAMA 3HUVA 3T90A 2BUEA 4AVBA 5K8NA 1IGBA 2VBQA 4CRYB 4HKFA 3S9NA 3SXNA 3GYAA 5EMIA 2YNCA 1FY7A 3DR8A 3FRMA 4NGQA 4DUKA 2CIJA 3D2MA 4MFPA 4HNXB 1BLLE 1S7LA 1RXTA 1YK3A 3MGDA 4KSAA 4M3SA 3G3SA 4NXYA 2J8MA 2O4HA 1F2OA 4CAFA 4NF1A 4NFRA 2O53A 5K8PA 2R98A 3D8PA 4CS0B 4EVYA 4CYPA 2ZEEA 3S9MA 3IU2A 2DEAA 4FD7A 1IIDA 7CPAA 2GIVA 3TCVA 3TT2A 2EWBA 4PXBA 3K2KA 5DWNA 3BI1A 2FVGA 2PR1A 2HUZA 2REEA 2EO8A 4MCSA 1VHSA 5IB9A 4MBUA 5CNPA 5I4MA 3D7GA 4JLYA 2DPTA 1P4NA 3PB7X 3TC8A 4KOWA 3D3SA 2PJ9A 1ZG9A 4YWYA 2A4NA 1LRZA 4NGTA 2ZENA 3RZAA 4C2ZA 2B58A 2PJ4A 3FVLA 3KQZA 2FXFA 3QAHA 2B4DA 1TF9A 4KVXA 1YX0A 2ABZA 3NE7A 4PQAA 4RN7A 5LYFA 2HV2A 2OZUA 3RNZA 2VQYA 1Y0RA 4R76A 1IU8A 3IFEA 2Z3LA 4NEXA 2PIYA 5F47A 4UFXA 4UEFA 4MI4A 5IX3A 3JVNA 3BHXA 4P4JA 2OOTA 2FIWA 4A38A 2P0WA 4ZI6A 4MMOA 1ZG8A 5JH9A 3JUWA 2G3AA 3TX8A 3ZZIA 4BBHA 2D4OA 2NYQA 2J8NA 3SI2A 5HXDA 3LODA 4E0AA 2B4BA 2C27A 3W6SA 4CGNA 1DE4C 3IIBA 4NCZA 3TO7A 5K8OA 1PUAA 2QVPA 3VARA 3R1KA 2G3TA 4L89A 5JPHA 2PQ8A 4B6ZA 2Q44A 4MCRA 2B5GA 5HVFA 3RO0A 1H8LA 4AXVA 4M6HA 4AB7A 3KR4A 2GLJA 4C7IA 5KTDA 4ZBGA 1OBRA 2OU2A 2CNMA 1Z8TA 1IOIA 1XF8A 2G9DA 2Q4YA 1VIXA 1YMEA 4KOXA 4ORFA 1NSLA 4A95A 4CAEA 4F6AA 4FD6A 2PR8A 3LMSA 5LYLA 3B3CA 2EBJA 4ZYQA 1CM0A 1YVKA 4DYOA 3FMCA 2BSWA 5D8NA 2PIZA 2EVNA 4OIDA 2XEIA 4GXHA 3GUXA 2JBKA 3KI9A 3IGRA 4B12A 3DNSA 4K30A 1IYLA 4MHYA 4JZ0A 4C7HA 4PSXA 1UFHA 5A28A 3CDXA 3QAYA 4Q36A 2ZOFA 3B7IA 4NGSA 5LRGA 1BAVA 3DR6A 5LYIA 2PC1A 3PFOA 2WUUA 5LRKA 2Z11A 2PCUA 1P0HA 3IJ3A 2WZNA 1HEEA 2FE7A 1IY7A 4MY3A 3KASA 4LQGA 5F46A 2PJ7A 1NE9A 1ARLA 3H8EA 3JTKA 4WWVA 3FX6A 4U5YA 4QBJA 1ELLP 4DNCA 1BO4A 1YGHA 4B13A 4MRIA 5CPAA 1LOKA 3CXQA 4PXDA 4PXEA 4XNHB 3H4QA 1ARMA 3FECA 3B2YA 2YNCC 4NSQA 3DDDA 4WJBA 1TKHA 3SJEA 4UBRA 4A32A 1GHEA 1Y9WA 3GKRA 3SHPA 4B10A 1XJOA 1KUXA 2Z10A 3FEEA 1R43A 1UWYA 3B3WA 3GY9A 3NH5A 4IAVA 4NGMA 2JDCA 5H86A 3BJ7A 4KVME 2QJ8A 3IWEA 2AFUA 4LX9A 4HNYB 1M4DA 2AFMA 3N5FA 1Z5RA 4MHPA 4P4DA 3WC6A 3H5ZA 1Z2LA 3WR7A 1Z4EA 3PBEA 1Z8LA 3N7ZA 1TKFA 1Z4RA 4MFQA 4LQ6A 1M4LA 4UCPA 2RC4A 2OZHA 1S5KA 2Q43A 3D67A 3L2NA 5AG6A 2Z3PA 2Q7SA 2PJ2A 5J8CA 3A9LA 1WK4A 3LWUA 4MFKA 3F5BA 4YFJA 4TWEA 4IK2A 3BJ8A 2PJ1A 4CYQA 3T8WA 1I12A 4JXRA 1AMPA 4YU9A 3FXTA 1BOBA 2QIRA 1F57A 4KUBA 4UFVA 1KUYA 2Z3OA 3D4UA 4PV6A 1AYEA 2IQ6A 1ZO0A 5JM6A 4BD9A 3BXMA 2GU2A 3CT9A 3NH8A 2OR4A 2HB6A 3TOBA 3WABA 3S9LA 1S7KA 4QVTA 2R8VA 1YLOA 1XRYA 2V77A 4ZY2A 2ZEHA 2Q51A 2ZEPA 3OWCA 1MJAA 3PZJA 4G1PA 4R7MA 5AG4A 3NH4A 2PJ8A 2Q4VA 2G0BA 1XBUA 2XEJA 1VHEA 4EWTA 1X12A 1K4JA 1QSRA 2P6EA 2JDDA 4CRZB 4CGOA 3FIXA
chains in the Genus database with same CATH topology
4R3LA 3EY5A 3I9SA 4YGOA 1Z9UA 3PGPA 2JEVA 2I79A 4H89A 3EO4A 4IUSA 3CXPA 3TE4A 3UY5A 4XPDC 4XPKA 3B8GA 4Y49C 4KOTA 4CGLA 1U6MA 2Z3MA 4FD5A 3IU1A 4R3KA 2EUIA 1ON0A 2Z0ZA 4FD4A 4HNWB 3VWDA 4KZTA 2ATRA 4CGPA 4F0YA 4M85A 4A2ZA 1S7NA 2Q7BA 2QECA 4PSWA 4C2YA 1QSMA 2KCWA 2OH1A 1QSNA 1PU9A 1NMTA 2ZW6A 2K5TA 2REFA 3TTHA 5HH1A 4QB9A 2ARHA 2WPXA 1V0CA 1XMTA 4LUAA 5IB0A 2YGWA 2OZGA 3BLNA 4B11A 1M1DA 4C2XA 4R9MA 5G20A 3VWEA 2FIAA 5C82A 5G1ZA 5KTAA 2VI7A 1MJBA 5KTCA 4BMHA 1RO5A 2Q04A 1TIQA 4CYNA 3DSBA 3D2PA 3R95A 2CXAA 4UCMA 1YLEA 3P2HA 4KS9A 3V8IA 4GS4A 4RI1A 2BL1A 4KLVA 4ONUA 2AJ6A 4CYOA 5EC4A 4B14A 4X5KA 1M44A 4KVOE 3R9GA 1Q2DA 2DPSA 1MJ9A 4A33A 2J8RA 4AG7A 1XIXA 5EBVA 3W6XA 5A27A 4YRHA 1KZFA 4KUAA 4R57A 4UCNA 1Y9KA 2P6FA 2ZW4A 4CAXA 5F48A 4AG9A 4CGMA 3I3GA 2ZW7A 4B5PA 4MFJA 3R9FA 1QSTA 2PRBA 3RYOA 4KSFA 1YR0A 2Z3KA 4PK3A 2Z3NA 3CXSA 3FB3A 4KOYA 1S7FA 2B3UA 4QUSA 1KUVA 2QMLA 2FCKA 2I00A 3SXOA 4MFZA 1YREA 1I1DA 4OADA 4UWIA 4UFWA 1OZPA 1SQHA 2B4DB 2FSRA 4F0XA 1MK4A 2YNDA 3KKWA 4Q38A 4KOSA 3TO9A 1IB1E 4A30A 1QSOA 5E96A 4XPLA 3S6KA 4CAWA 4CAVA 4KOUA 4II9A 4AVCA 2FT0A 1S60A 2O28A 2ZPAA 3R96A 3S6GA 4XPDB 4ZGYB 4Y49B 4UWJA 4A31A 4IF5A 2B5GB 5F49A 3EC4A 2OB0A 5IV0A 4JXQA 4L8AA 3R9EA 2ZXVA 4U9ZA 3ZJ0A 4U9YA 4QC6A 4JD6A 2BEIA 1N71A 2VEZA 2PDOA 3C26A 5AGEA 4KLWA 4R87A 3S6HA 1VKCA 1Q2YA 2YNEA 4I49A 1S3ZA 5FVJA 4RS2A 2D4PA 2NMTA 5C88A 3TOAA 1B6BA 4UA3A 5DWMA 2ZW5A 1XEBA 3FNCA 1M4GA 2R1IA 1IYKA 2CNSA 4JJXA 3T9YA 3TFYA 4H6UA 1WWZA 2FS5A 1R57A 5I0CA 2AE6A 2HQYA 3F8KA 4MY0A 1M4IA 2X7BA 2CNTA 1IICA 1L0CA 4B5PB 4AVAA 3TO6A 1CJWA 3F0AA 2VZZA 1B87A 3IWGA 5AG5A 2VXKA 2H5MA 2CY2A 3PP9A 3QB8A 1Q2CA 2JLMA 2Q0YA 4C68A 4B5OA 2Y0MA 3S6FA 4J3GA 2DXQA 3LD2A 3K9UA 4E8OA 2P6GA 4PK2A 5GCNA 4JWPA 2GANA 4OLLA 2F5IA 3EXNA 5G21A 2WSAA 4MHDA 3E0KA 5H84A 1Y7RA 2GE3A 3W91A 2IL4A 1XE4A 2R7HA 2VZYA 2WPWA 3P2FA 3FYNA 5AG7A 1YVOA 1J4JA 4OAEA 5HMNA 5JQ4A 3G8WA 4MFLA 2PSWA 4KORA 4MJ8A 5BWAB 5J8FA 4H6ZA 3EFAA 2FL4A 4XNHC 2B3VA 1I21A 5ISVA 4KOVA 5G22A 3FBUA 3T90A 2BUEA 4AVBA 2VBQA 4CRYB 4HKFA 3SXNA 3GYAA 2YNCA 1FY7A 3DR8A 3FRMA 3D2MA 4MFPA 4HNXB 4KSAA 1S7LA 1RXTA 1YK3A 3MGDA 4M3SA 3G3SA 4NXYA 2J8MA 4CAFA 4NF1A 2R98A 3D8PA 4CS0B 4EVYA 4CYPA 3IU2A 4FD7A 1IIDA 2GIVA 3TCVA 3TT2A 5DWNA 2PR1A 2HUZA 2REEA 1VHSA 4MBUA 5CNPA 4JLYA 2DPTA 1P4NA 4KOWA 3D3SA 2A4NA 1LRZA 4C2ZA 2B58A 2FXFA 3QAHA 2B4DA 4KVXA 1YX0A 3NE7A 2HV2A 2OZUA 2VQYA 2Z3LA 4NEXA 5F47A 4UFXA 4MI4A 5IX3A 3JVNA 2FIWA 2P0WA 3JUWA 2G3AA 3ZZIA 4BBHA 2D4OA 2J8NA 3LODA 4E0AA 2B4BA 2C27A 3W6SA 4CGNA 4NCZA 3TO7A 1PUAA 3R1KA 2G3TA 4L89A 5JPHA 2PQ8A 2Q44A 2B5GA 4AB7A 4C7IA 5KTDA 4ZBGA 2OU2A 2CNMA 4KOXA 1XF8A 4ORFA 4A95A 2Q4YA 4CAEA 1NSLA 4F6AA 4FD6A 2PR8A 1CM0A 1YVKA 2BSWA 2EVNA 3IGRA 4B12A 3DNSA 4K30A 1IYLA 4C7HA 4PSXA 1UFHA 5A28A 4Q36A 3DR6A 2PC1A 2WUUA 2Z11A 1P0HA 2FE7A 4MY3A 5F46A 1NE9A 3JTKA 4U5YA 4QBJA 4DNCA 1BO4A 1YGHA 4B13A 3CXQA 4XNHB 3H4QA 2YNCC 4NSQA 3DDDA 4UBRA 4A32A 1GHEA 1Y9WA 3GKRA 3SHPA 4B10A 1KUXA 2Z10A 3GY9A 4E2AA 5H86A 2JDCA 3BJ7A 4KVME 3IWEA 4LX9A 4HNYB 1M4DA 3WR7A 3H5ZA 1Z4EA 3N7ZA 1Z4RA 4UCPA 4MFQA 2RC4A 2OZHA 1S5KA 5AG6A 2Z3PA 5J8CA 3A9LA 1WK4A 4MFKA 3F5BA 4YFJA 3BJ8A 4CYQA 1I12A 4JXRA 3FXTA 1BOBA 2QIRA 4KUBA 4UFVA 1KUYA 2Z3OA 4PV6A 1ZO0A 3TOBA 1S7KA 4QVTA 2R8VA 3OWCA 1MJAA 3PZJA 5AG4A 2Q4VA 2G0BA 1K4JA 1QSRA 2P6EA 2JDDA 4CRZB 4CGOA 3FIXA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4R3L A;  3EY5 A;  3I9S A;  4YGO A;  1Z9U A;  3PGP A;  2JEV A;  2I79 A;  4H89 A;  3EO4 A;  4IUS A;  3CXP A;  3TE4 A;  3UY5 A;  4XPD C;  4XPK A;  3B8G A;  4Y49 C;  4KOT A;  1U6M A;  4FD5 A;  4R3K A;  2EUI A;  1ON0 A;  2Z0Z A;  4FD4 A;  4HNW B;  3VWD A;  4KZT A;  2ATR A;  4F0Y A;  4M85 A;  1S7N A;  2Q7B A;  2QEC A;  4PSW A;  1QSM A;  2KCW A;  2OH1 A;  1QSN A;  1PU9 A;  1NMT A;  2ZW6 A;  2K5T A;  2REF A;  3TTH A;  5HH1 A;  4QB9 A;  2ARH A;  2WPX A;  1V0C A;  1XMT A;  4LUA A;  5IB0 A;  2OZG A;  3BLN A;  1M1D A;  4R9M A;  3VWE A;  2FIA A;  5C82 A;  5KTA A;  2VI7 A;  1MJB A;  5KTC A;  4BMH A;  1RO5 A;  2Q04 A;  1TIQ A;  3DSB A;  3D2P A;  3R95 A;  1YLE A;  3P2H A;  3V8I A;  4GS4 A;  4RI1 A;  2BL1 A;  4KLV A;  4ONU A;  2AJ6 A;  5EC4 A;  4X5K A;  1M44 A;  4KVO E;  3R9G A;  1Q2D A;  1MJ9 A;  2J8R A;  4AG7 A;  1XIX A;  5EBV A;  3W6X A;  4YRH A;  1KZF A;  4KUA A;  4R57 A;  1Y9K A;  2P6F A;  2ZW4 A;  4CAX A;  5F48 A;  4AG9 A;  3I3G A;  2ZW7 A;  4B5P A;  3R9F A;  1QST A;  2PRB A;  3RYO A;  1YR0 A;  4PK3 A;  3CXS A;  3FB3 A;  4KOY A;  1S7F A;  2B3U A;  4QUS A;  1KUV A;  2QML A;  2FCK A;  2I00 A;  3SXO A;  1YRE A;  1I1D A;  4OAD A;  4UWI A;  1OZP A;  1SQH A;  2B4D B;  2FSR A;  1MK4 A;  3KKW A;  4KOS A;  3TO9 A;  1IB1 E;  1QSO A;  5E96 A;  4XPL A;  3S6K A;  4CAW A;  4CAV A;  4KOU A;  4II9 A;  4AVC A;  2FT0 A;  1S60 A;  2O28 A;  2ZPA A;  3R96 A;  3S6G A;  4XPD B;  4Y49 B;  4UWJ A;  4IF5 A;  2B5G B;  5F49 A;  3EC4 A;  2OB0 A;  5IV0 A;  4JXQ A;  4L8A A;  3R9E A;  2ZXV A;  4U9Z A;  3ZJ0 A;  4U9Y A;  4QC6 A;  4JD6 A;  2BEI A;  1N71 A;  2VEZ A;  2PDO A;  3C26 A;  4KLW A;  4R87 A;  3S6H A;  1VKC A;  1Q2Y A;  4I49 A;  1S3Z A;  5FVJ A;  4RS2 A;  2D4P A;  2NMT A;  5C88 A;  3TOA A;  1B6B A;  4UA3 A;  5DWM A;  2ZW5 A;  1XEB A;  3FNC A;  1M4G A;  2R1I A;  1IYK A;  2CNS A;  4JJX A;  3T9Y A;  3TFY A;  4H6U A;  1WWZ A;  2FS5 A;  1R57 A;  5I0C A;  2AE6 A;  2HQY A;  3F8K A;  4MY0 A;  1M4I A;  2X7B A;  2CNT A;  1IIC A;  1L0C A;  4B5P B;  4AVA A;  3TO6 A;  1CJW A;  3F0A A;  2VZZ A;  1B87 A;  3IWG A;  2VXK A;  2H5M A;  2CY2 A;  3PP9 A;  3QB8 A;  1Q2C A;  2JLM A;  2Q0Y A;  4B5O A;  2Y0M A;  3S6F A;  4J3G A;  2DXQ A;  3LD2 A;  3K9U A;  4E8O A;  2P6G A;  4PK2 A;  5GCN A;  4JWP A;  2GAN A;  4OLL A;  2F5I A;  3EXN A;  4MHD A;  3E0K A;  5H84 A;  1Y7R A;  2GE3 A;  3W91 A;  2IL4 A;  1XE4 A;  2R7H A;  2VZY A;  2WPW A;  3P2F A;  3FYN A;  1YVO A;  1J4J A;  4OAE A;  5HMN A;  5JQ4 A;  3G8W A;  2PSW A;  4KOR A;  4MJ8 A;  5J8F A;  4H6Z A;  3EFA A;  2FL4 A;  4XNH C;  2B3V A;  1I21 A;  5ISV A;  4KOV A;  3FBU A;  3T90 A;  2BUE A;  4AVB A;  2VBQ A;  4CRY B;  4HKF A;  3SXN A;  3GYA A;  1FY7 A;  3DR8 A;  3FRM A;  3D2M A;  4HNX B;  1S7L A;  1RXT A;  1YK3 A;  3MGD A;  4M3S A;  3G3S A;  4NXY A;  2J8M A;  4NF1 A;  2R98 A;  3D8P A;  4CS0 B;  4EVY A;  4FD7 A;  1IID A;  2GIV A;  3TCV A;  3TT2 A;  5DWN A;  2PR1 A;  2HUZ A;  2REE A;  1VHS A;  4MBU A;  5CNP A;  4JLY A;  1P4N A;  4KOW A;  3D3S A;  2A4N A;  1LRZ A;  2B58 A;  2FXF A;  3QAH A;  2B4D A;  4KVX A;  1YX0 A;  3NE7 A;  2HV2 A;  2OZU A;  2VQY A;  5F47 A;  4NEX A;  4MI4 A;  5IX3 A;  3JVN A;  2FIW A;  2P0W A;  3JUW A;  2G3A A;  3ZZI A;  2D4O A;  2J8N A;  3LOD A;  4E0A A;  2B4B A;  2C27 A;  3W6S A;  4NCZ A;  3TO7 A;  1PUA A;  3R1K A;  2G3T A;  4L89 A;  5JPH A;  2PQ8 A;  2Q44 A;  2B5G A;  4AB7 A;  5KTD A;  4ZBG A;  2OU2 A;  2CNM A;  4KOX A;  1XF8 A;  4ORF A;  2Q4Y A;  1NSL A;  4F6A A;  4FD6 A;  2PR8 A;  1CM0 A;  1YVK A;  2BSW A;  2EVN A;  3IGR A;  3DNS A;  4K30 A;  1IYL A;  4PSX A;  1UFH A;  3DR6 A;  2PC1 A;  2Z11 A;  1P0H A;  2FE7 A;  4MY3 A;  5F46 A;  1NE9 A;  4U5Y A;  4QBJ A;  4DNC A;  1BO4 A;  1YGH A;  3CXQ A;  4XNH B;  3H4Q A;  4NSQ A;  3DDD A;  4UBR A;  1GHE A;  1Y9W A;  3GKR A;  3SHP A;  1KUX A;  2Z10 A;  3GY9 A;  4E2A A;  5H86 A;  2JDC A;  3BJ7 A;  4KVM E;  4LX9 A;  4HNY B;  1M4D A;  3WR7 A;  1Z4E A;  3N7Z A;  1Z4R A;  2RC4 A;  2OZH A;  1S5K A;  5J8C A;  1WK4 A;  3F5B A;  4YFJ A;  3BJ8 A;  1I12 A;  4JXR A;  3FXT A;  1BOB A;  2QIR A;  4KUB A;  1KUY A;  4PV6 A;  3TOB A;  1S7K A;  4QVT A;  2R8V A;  3OWC A;  1MJA A;  3PZJ A;  2Q4V A;  2G0B A;  1K4J A;  1QSR A;  2P6E A;  2JDD A;  4CRZ B;  3FIX A; 
#chains in the Genus database with same CATH topology
 1YQE A;  2J9A A;  4R3L A;  3WC5 A;  3EY5 A;  3I9S A;  4YGO A;  4A94 A;  1Z9U A;  3PGP A;  1XMB A;  2JEV A;  1TF8 A;  1Y7E A;  2I79 A;  2V8V A;  2F7V A;  3D7H A;  3EO4 A;  3CXP A;  4H89 A;  4IUS A;  4MCP A;  1YW6 A;  4XPD C;  4XPK A;  2VL1 A;  3B8G A;  3UY5 A;  2AFX A;  4Y49 C;  4KOT A;  2ZEG A;  1RTQ A;  4OC1 A;  3VAT A;  1ZLH A;  4NGR A;  3FF3 A;  1Z8X A;  3D66 A;  4CGL A;  1U6M A;  2Z3M A;  4FD5 A;  5HVG A;  3IU1 A;  2C6G A;  4R3K A;  3V7Z A;  2EUI A;  6CPA A;  1LCP A;  1ON0 A;  2IJZ A;  2Z0Z A;  4FD4 A;  4HNW B;  4H2K A;  1LAP A;  4KZT A;  2PJ6 A;  2ATR A;  1JQG A;  2C6P A;  3VWD A;  4CGP A;  4FUU A;  4F0Y A;  1QQ9 A;  4M85 A;  4A2Z A;  1S7N A;  1QMU A;  3IO1 A;  2QEC A;  2Q7B A;  3NE8 A;  4IHM A;  4PSW A;  1Q7L A;  1LAM A;  1EE3 P;  3SJG A;  1QSM A;  2V8H A;  4C2Y A;  1CPS A;  3SJX A;  2KCW A;  3D7F A;  4NGN A;  4W9Y A;  2OH1 A;  1QSN A;  1PU9 A;  4P4I A;  1NMT A;  2ZOG A;  2ZW6 A;  4OP4 A;  2K5T A;  3PB8 X;  2REF A;  4F8Z A;  3TTH A;  3SI1 A;  5HH1 A;  4QB9 A;  3IWW A;  1PCA A;  2ARH A;  2WPX A;  4NJQ A;  4PXC A;  1V0C A;  1XMT A;  4LUA A;  4MHZ A;  2YGW A;  5IB0 A;  2OZG A;  3BLN A;  4MCQ A;  1F2P A;  3RBU A;  3IC1 A;  4B11 A;  2HC9 A;  1M1D A;  4P6Y A;  4C2X A;  4R9M A;  5G20 A;  3VWE A;  2FIA A;  5C82 A;  2ODF A;  2NSM A;  5G1Z A;  5KTA A;  2VI7 A;  1MJB A;  2ANP A;  5KTC A;  4BMH A;  4MHN A;  4A37 A;  1RO5 A;  2ZED A;  2Q04 A;  1TIQ A;  4CYN A;  2CTB A;  3DSB A;  5D29 A;  3D2P A;  3R95 A;  1CBX A;  2CXA A;  4UCM A;  2PJC A;  1YLE A;  3KZW A;  1CP7 A;  3P2H A;  2IMO A;  3JRU A;  4KS9 A;  1CX8 A;  4NJR A;  4GS4 A;  3V8I A;  5THW A;  2PE3 A;  4RI1 A;  4F9V A;  2BL1 A;  2Q4Z A;  4KLV A;  2AJ6 A;  4ONU A;  4CYO A;  3K9T A;  5EC4 A;  4EFD A;  1FNO A;  4KSI A;  4UF4 A;  4P4F A;  3H8G A;  4B14 A;  5HVH A;  4X5K A;  4OC2 A;  1M44 A;  4KVO E;  3R9G A;  1Q2D A;  2DPS A;  1YW4 A;  3PFE A;  1MJ9 A;  4A33 A;  3NA6 A;  2BOA A;  2J8R A;  4AG7 A;  1XIX A;  1BPN A;  5EBV A;  3GLJ A;  2PJ5 A;  3W6X A;  5F09 A;  3PBB A;  5A27 A;  4YRH A;  1KZF A;  4UEE A;  4P45 A;  4KUA A;  4R57 A;  2V8D A;  4UCN A;  1Y9K A;  4X3R A;  2P6F A;  2ZW4 A;  3KGQ A;  4CAX A;  5F48 A;  4AG9 A;  4CGM A;  3I3G A;  2ZW7 A;  2CF4 A;  4F9U A;  3PEI A;  4B5P A;  4MFJ A;  3PB9 X;  3R9F A;  1QST A;  2PRB A;  3RYO A;  1ZG7 A;  3DLJ A;  3ISX A;  1YR0 A;  2PRQ A;  4KSF A;  2Z3K A;  4UEZ A;  4PK3 A;  2Z3N A;  4X2T A;  5JGF A;  5LRJ A;  3CXS A;  4NGP A;  3FB3 A;  4KOY A;  1S7F A;  4UIB A;  2B3U A;  4QUS A;  2AFW A;  1KUV A;  1YSJ A;  2QML A;  2FCK A;  2I00 A;  4ONW A;  3SXO A;  2GFQ A;  4MFZ A;  1YRE A;  1I1D A;  4OAD A;  4UWI A;  8CPA A;  1IOF A;  3B3T A;  4OIW A;  1PYT B;  4UFW A;  1OZP A;  1SQH A;  2B4D B;  2ZEM A;  3NFZ A;  2FSR A;  4F0X A;  1MK4 A;  4K3N A;  2YND A;  1ZLI A;  3KKW A;  2PJ3 A;  2QYV A;  3HLP A;  4Q38 A;  4P4E A;  4KOS A;  3TO9 A;  1IB1 E;  4A30 A;  1QSO A;  2EK8 A;  4XPL A;  3GIU A;  5E96 A;  4ZX9 A;  3S6K A;  3WT4 A;  4EME A;  1TXR A;  1CPX A;  2AFS A;  4CAW A;  4CAV A;  1FT7 A;  4KOU A;  2ZEF A;  1KWM A;  3SJF A;  1Y0Y A;  3PRT A;  4II9 A;  3H8F A;  4P4B A;  1ELM P;  2ZEO A;  4AVC A;  1HDU A;  2FT0 A;  1S60 A;  2O28 A;  3I1U A;  4DJL A;  2ZPA A;  3B3V A;  4Q7A A;  3R96 A;  4E2A A;  3S6G A;  4XPD B;  4FAI A;  4ZGY B;  3KL9 A;  4Y49 B;  4UWJ A;  4RUH A;  4A31 A;  2ZEL A;  4IF5 A;  2B5G B;  2DF5 A;  3FED A;  5F49 A;  3EC4 A;  2OB0 A;  4PPZ A;  5IV0 A;  4CPA A;  1R3N A;  2AFZ A;  4JXQ A;  4L8A A;  3R9E A;  2ZXV A;  4R8F A;  2XEG A;  4U9Z A;  3ZJ0 A;  4UIA A;  4U9Y A;  4QC6 A;  3KR5 A;  4JD6 A;  2BEI A;  1N71 A;  3V38 A;  2JBJ A;  4OC3 A;  2VEZ A;  3BI0 A;  3KHZ A;  2PDO A;  3C26 A;  2BCO A;  5AGE A;  4KLW A;  1Z8W A;  4R87 A;  3KHX A;  3S6H A;  3ISZ A;  3CPX A;  1VKC A;  5K8M A;  1Q2Y A;  2YNE A;  4Z65 A;  4I49 A;  1S3Z A;  5FVJ A;  2PJ0 A;  4P44 A;  2D4P A;  4RS2 A;  2NMT A;  5C88 A;  4OKO A;  1LFW A;  3TOA A;  1TKJ A;  1B6B A;  4UA3 A;  3B3S A;  4M6I A;  4OC5 A;  1AUG A;  4OME A;  2CTC A;  5LYD A;  5DWM A;  2ZW5 A;  4HPS A;  1XEB A;  3FNC A;  1M4G A;  5ELY A;  3QNV A;  2R1I A;  1IYK A;  3D7D A;  4A39 A;  3DGV A;  2CNS A;  1DTD A;  1VHO A;  4JJX A;  4O23 A;  3T9Y A;  1CG2 A;  1X10 A;  4JYW A;  1XFO A;  3TFY A;  2POK A;  4ZY0 A;  4H6U A;  5DS0 A;  1WWZ A;  2FS5 A;  3IEH A;  4R6T A;  1LAN A;  1R57 A;  1GYT A;  2AE6 A;  4MXU A;  5I0C A;  2HQY A;  4OC4 A;  3F8K A;  5CBM A;  2JEW A;  4MY0 A;  1M4I A;  2GRE A;  2X7B A;  4GM5 A;  2CNT A;  1IIC A;  1L0C A;  4B5P B;  4AVA A;  3TO6 A;  1CJW A;  3F0A A;  2VZZ A;  3MN8 A;  1B87 A;  1JWQ A;  3IWG A;  2AFO A;  2EK9 A;  5AG5 A;  2XEF A;  2VXK A;  2H5M A;  2CY2 A;  3PP9 A;  3LAC A;  1A2Z A;  3QB8 A;  1Q2C A;  2WYR A;  2I3C A;  2JLM A;  3KQX A;  4P10 A;  2Q0Y A;  4C68 A;  4B5O A;  2Y0M A;  3S6F A;  3CPA A;  4J3G A;  2DXQ A;  3LD2 A;  3VH9 A;  3K9U A;  4E8O A;  1BPM A;  2P6G A;  4PK2 A;  1HDQ A;  2PJB A;  2RB7 A;  5GCN A;  5J1Q A;  4JWP A;  2BO9 A;  3CZX A;  2GAN A;  4OLL A;  2F5I A;  4OC0 A;  3EXN A;  3MRU A;  3TE4 A;  5G21 A;  2WSA A;  1VGY A;  4FBE A;  4MHD A;  3E0K A;  5H84 A;  1Y7R A;  2GE3 A;  3PB6 X;  3W91 A;  4ZY1 A;  2IL4 A;  1XE4 A;  2R7H A;  2VZY A;  2PVV A;  2WPW A;  3B35 A;  3FYN A;  3P2F A;  5AG7 A;  1YVO A;  3FH4 A;  1CP6 A;  1J4J A;  4OAE A;  2C1C A;  2PJA A;  5HMN A;  5JQ4 A;  1XOV A;  3WC7 A;  3G8W A;  4MFL A;  2PSW A;  2RFH A;  3D68 A;  4FWU A;  4X8I A;  4KOR A;  4MJ8 A;  5BWA B;  3PB4 X;  5J8F A;  4BIN A;  4H6Z A;  2PVW A;  3EFA A;  2FL4 A;  4ZX8 A;  4XNH C;  4TNU A;  2B3V A;  2GLF A;  2F8H A;  1I21 A;  1NSA A;  2C6C A;  2V8G A;  3GB0 A;  4KOV A;  5G22 A;  3FBU A;  3SI0 A;  3FJU A;  5ISV A;  4M6G A;  3RAM A;  3HUV A;  3T90 A;  2BUE A;  4AVB A;  5K8N A;  1IGB A;  2VBQ A;  4CRY B;  4HKF A;  3S9N A;  3SXN A;  3GYA A;  5EMI A;  2YNC A;  1FY7 A;  3DR8 A;  3FRM A;  4NGQ A;  4DUK A;  2CIJ A;  3D2M A;  4MFP A;  4HNX B;  1BLL E;  1S7L A;  1RXT A;  1YK3 A;  3MGD A;  4KSA A;  4M3S A;  3G3S A;  4NXY A;  2J8M A;  2O4H A;  1F2O A;  4CAF A;  4NF1 A;  4NFR A;  2O53 A;  5K8P A;  2R98 A;  3D8P A;  4CS0 B;  4EVY A;  4CYP A;  2ZEE A;  3S9M A;  3IU2 A;  2DEA A;  4FD7 A;  1IID A;  7CPA A;  2GIV A;  3TCV A;  3TT2 A;  2EWB A;  4PXB A;  3K2K A;  5DWN A;  3BI1 A;  2FVG A;  2PR1 A;  2HUZ A;  2REE A;  2EO8 A;  4MCS A;  1VHS A;  5IB9 A;  4MBU A;  5CNP A;  5I4M A;  3D7G A;  4JLY A;  2DPT A;  1P4N A;  3PB7 X;  3TC8 A;  4KOW A;  3D3S A;  2PJ9 A;  1ZG9 A;  4YWY A;  2A4N A;  1LRZ A;  4NGT A;  2ZEN A;  3RZA A;  4C2Z A;  2B58 A;  2PJ4 A;  3FVL A;  3KQZ A;  2FXF A;  3QAH A;  2B4D A;  1TF9 A;  4KVX A;  1YX0 A;  2ABZ A;  3NE7 A;  4PQA A;  4RN7 A;  5LYF A;  2HV2 A;  2OZU A;  3RNZ A;  2VQY A;  1Y0R A;  4R76 A;  1IU8 A;  3IFE A;  2Z3L A;  4NEX A;  2PIY A;  5F47 A;  4UFX A;  4UEF A;  4MI4 A;  5IX3 A;  3JVN A;  3BHX A;  4P4J A;  2OOT A;  2FIW A;  4A38 A;  2P0W A;  4ZI6 A;  4MMO A;  1ZG8 A;  5JH9 A;  3JUW A;  2G3A A;  3TX8 A;  3ZZI A;  4BBH A;  2D4O A;  2NYQ A;  2J8N A;  3SI2 A;  5HXD A;  3LOD A;  4E0A A;  2B4B A;  2C27 A;  3W6S A;  4CGN A;  1DE4 C;  3IIB A;  4NCZ A;  3TO7 A;  5K8O A;  1PUA A;  2QVP A;  3VAR A;  3R1K A;  2G3T A;  4L89 A;  5JPH A;  2PQ8 A;  4B6Z A;  2Q44 A;  4MCR A;  2B5G A;  5HVF A;  3RO0 A;  1H8L A;  4AXV A;  4M6H A;  4AB7 A;  3KR4 A;  2GLJ A;  4C7I A;  5KTD A;  4ZBG A;  1OBR A;  2OU2 A;  2CNM A;  1Z8T A;  1IOI A;  1XF8 A;  2G9D A;  2Q4Y A;  1VIX A;  1YME A;  4KOX A;  4ORF A;  1NSL A;  4A95 A;  4CAE A;  4F6A A;  4FD6 A;  2PR8 A;  3LMS A;  5LYL A;  3B3C A;  2EBJ A;  4ZYQ A;  1CM0 A;  1YVK A;  4DYO A;  3FMC A;  2BSW A;  5D8N A;  2PIZ A;  2EVN A;  4OID A;  2XEI A;  4GXH A;  3GUX A;  2JBK A;  3KI9 A;  3IGR A;  4B12 A;  3DNS A;  4K30 A;  1IYL A;  4MHY A;  4JZ0 A;  4C7H A;  4PSX A;  1UFH A;  5A28 A;  3CDX A;  3QAY A;  4Q36 A;  2ZOF A;  3B7I A;  4NGS A;  5LRG A;  1BAV A;  3DR6 A;  5LYI A;  2PC1 A;  3PFO A;  2WUU A;  5LRK A;  2Z11 A;  2PCU A;  1P0H A;  3IJ3 A;  2WZN A;  1HEE A;  2FE7 A;  1IY7 A;  4MY3 A;  3KAS A;  4LQG A;  5F46 A;  2PJ7 A;  1NE9 A;  1ARL A;  3H8E A;  3JTK A;  4WWV A;  3FX6 A;  4U5Y A;  4QBJ A;  1ELL P;  4DNC A;  1BO4 A;  1YGH A;  4B13 A;  4MRI A;  5CPA A;  1LOK A;  3CXQ A;  4PXD A;  4PXE A;  4XNH B;  3H4Q A;  1ARM A;  3FEC A;  3B2Y A;  2YNC C;  4NSQ A;  3DDD A;  4WJB A;  1TKH A;  3SJE A;  4UBR A;  4A32 A;  1GHE A;  1Y9W A;  3GKR A;  3SHP A;  4B10 A;  1XJO A;  1KUX A;  2Z10 A;  3FEE A;  1R43 A;  1UWY A;  3B3W A;  3GY9 A;  3NH5 A;  4IAV A;  4NGM A;  2JDC A;  5H86 A;  3BJ7 A;  4KVM E;  2QJ8 A;  3IWE A;  2AFU A;  4LX9 A;  4HNY B;  1M4D A;  2AFM A;  3N5F A;  1Z5R A;  4MHP A;  4P4D A;  3WC6 A;  3H5Z A;  1Z2L A;  3WR7 A;  1Z4E A;  3PBE A;  1Z8L A;  3N7Z A;  1TKF A;  1Z4R A;  4MFQ A;  4LQ6 A;  1M4L A;  4UCP A;  2RC4 A;  2OZH A;  1S5K A;  2Q43 A;  3D67 A;  3L2N A;  5AG6 A;  2Z3P A;  2Q7S A;  2PJ2 A;  5J8C A;  3A9L A;  1WK4 A;  3LWU A;  4MFK A;  3F5B A;  4YFJ A;  4TWE A;  4IK2 A;  3BJ8 A;  2PJ1 A;  4CYQ A;  3T8W A;  1I12 A;  4JXR A;  1AMP A;  4YU9 A;  3FXT A;  1BOB A;  2QIR A;  1F57 A;  4KUB A;  4UFV A;  1KUY A;  2Z3O A;  3D4U A;  4PV6 A;  1AYE A;  2IQ6 A;  1ZO0 A;  5JM6 A;  4BD9 A;  3BXM A;  2GU2 A;  3CT9 A;  3NH8 A;  2OR4 A;  2HB6 A;  3TOB A;  3WAB A;  3S9L A;  1S7K A;  4QVT A;  2R8V A;  1YLO A;  1XRY A;  2V77 A;  4ZY2 A;  2ZEH A;  2Q51 A;  2ZEP A;  3OWC A;  1MJA A;  3PZJ A;  4G1P A;  4R7M A;  5AG4 A;  3NH4 A;  2PJ8 A;  2Q4V A;  2G0B A;  1XBU A;  2XEJ A;  1VHE A;  4EWT A;  1X12 A;  1K4J A;  1QSR A;  2P6E A;  2JDD A;  4CRZ B;  4CGO A;  3FIX A; 
#chains in the Genus database with same CATH homology
 4R3L A;  3EY5 A;  3I9S A;  4YGO A;  1Z9U A;  3PGP A;  2JEV A;  2I79 A;  4H89 A;  3EO4 A;  4IUS A;  3CXP A;  3TE4 A;  3UY5 A;  4XPD C;  4XPK A;  3B8G A;  4Y49 C;  4KOT A;  4CGL A;  1U6M A;  2Z3M A;  4FD5 A;  3IU1 A;  4R3K A;  2EUI A;  1ON0 A;  2Z0Z A;  4FD4 A;  4HNW B;  3VWD A;  4KZT A;  2ATR A;  4CGP A;  4F0Y A;  4M85 A;  4A2Z A;  1S7N A;  2Q7B A;  2QEC A;  4PSW A;  4C2Y A;  1QSM A;  2KCW A;  2OH1 A;  1QSN A;  1PU9 A;  1NMT A;  2ZW6 A;  2K5T A;  2REF A;  3TTH A;  5HH1 A;  4QB9 A;  2ARH A;  2WPX A;  1V0C A;  1XMT A;  4LUA A;  5IB0 A;  2YGW A;  2OZG A;  3BLN A;  4B11 A;  1M1D A;  4C2X A;  4R9M A;  5G20 A;  3VWE A;  2FIA A;  5C82 A;  5G1Z A;  5KTA A;  2VI7 A;  1MJB A;  5KTC A;  4BMH A;  1RO5 A;  2Q04 A;  1TIQ A;  4CYN A;  3DSB A;  3D2P A;  3R95 A;  2CXA A;  4UCM A;  1YLE A;  3P2H A;  4KS9 A;  3V8I A;  4GS4 A;  4RI1 A;  2BL1 A;  4KLV A;  4ONU A;  2AJ6 A;  4CYO A;  5EC4 A;  4B14 A;  4X5K A;  1M44 A;  4KVO E;  3R9G A;  1Q2D A;  2DPS A;  1MJ9 A;  4A33 A;  2J8R A;  4AG7 A;  1XIX A;  5EBV A;  3W6X A;  5A27 A;  4YRH A;  1KZF A;  4KUA A;  4R57 A;  4UCN A;  1Y9K A;  2P6F A;  2ZW4 A;  4CAX A;  5F48 A;  4AG9 A;  4CGM A;  3I3G A;  2ZW7 A;  4B5P A;  4MFJ A;  3R9F A;  1QST A;  2PRB A;  3RYO A;  4KSF A;  1YR0 A;  2Z3K A;  4PK3 A;  2Z3N A;  3CXS A;  3FB3 A;  4KOY A;  1S7F A;  2B3U A;  4QUS A;  1KUV A;  2QML A;  2FCK A;  2I00 A;  3SXO A;  4MFZ A;  1YRE A;  1I1D A;  4OAD A;  4UWI A;  4UFW A;  1OZP A;  1SQH A;  2B4D B;  2FSR A;  4F0X A;  1MK4 A;  2YND A;  3KKW A;  4Q38 A;  4KOS A;  3TO9 A;  1IB1 E;  4A30 A;  1QSO A;  5E96 A;  4XPL A;  3S6K A;  4CAW A;  4CAV A;  4KOU A;  4II9 A;  4AVC A;  2FT0 A;  1S60 A;  2O28 A;  2ZPA A;  3R96 A;  3S6G A;  4XPD B;  4ZGY B;  4Y49 B;  4UWJ A;  4A31 A;  4IF5 A;  2B5G B;  5F49 A;  3EC4 A;  2OB0 A;  5IV0 A;  4JXQ A;  4L8A A;  3R9E A;  2ZXV A;  4U9Z A;  3ZJ0 A;  4U9Y A;  4QC6 A;  4JD6 A;  2BEI A;  1N71 A;  2VEZ A;  2PDO A;  3C26 A;  5AGE A;  4KLW A;  4R87 A;  3S6H A;  1VKC A;  1Q2Y A;  2YNE A;  4I49 A;  1S3Z A;  5FVJ A;  4RS2 A;  2D4P A;  2NMT A;  5C88 A;  3TOA A;  1B6B A;  4UA3 A;  5DWM A;  2ZW5 A;  1XEB A;  3FNC A;  1M4G A;  2R1I A;  1IYK A;  2CNS A;  4JJX A;  3T9Y A;  3TFY A;  4H6U A;  1WWZ A;  2FS5 A;  1R57 A;  5I0C A;  2AE6 A;  2HQY A;  3F8K A;  4MY0 A;  1M4I A;  2X7B A;  2CNT A;  1IIC A;  1L0C A;  4B5P B;  4AVA A;  3TO6 A;  1CJW A;  3F0A A;  2VZZ A;  1B87 A;  3IWG A;  5AG5 A;  2VXK A;  2H5M A;  2CY2 A;  3PP9 A;  3QB8 A;  1Q2C A;  2JLM A;  2Q0Y A;  4C68 A;  4B5O A;  2Y0M A;  3S6F A;  4J3G A;  2DXQ A;  3LD2 A;  3K9U A;  4E8O A;  2P6G A;  4PK2 A;  5GCN A;  4JWP A;  2GAN A;  4OLL A;  2F5I A;  3EXN A;  5G21 A;  2WSA A;  4MHD A;  3E0K A;  5H84 A;  1Y7R A;  2GE3 A;  3W91 A;  2IL4 A;  1XE4 A;  2R7H A;  2VZY A;  2WPW A;  3P2F A;  3FYN A;  5AG7 A;  1YVO A;  1J4J A;  4OAE A;  5HMN A;  5JQ4 A;  3G8W A;  4MFL A;  2PSW A;  4KOR A;  4MJ8 A;  5BWA B;  5J8F A;  4H6Z A;  3EFA A;  2FL4 A;  4XNH C;  2B3V A;  1I21 A;  5ISV A;  4KOV A;  5G22 A;  3FBU A;  3T90 A;  2BUE A;  4AVB A;  2VBQ A;  4CRY B;  4HKF A;  3SXN A;  3GYA A;  2YNC A;  1FY7 A;  3DR8 A;  3FRM A;  3D2M A;  4MFP A;  4HNX B;  4KSA A;  1S7L A;  1RXT A;  1YK3 A;  3MGD A;  4M3S A;  3G3S A;  4NXY A;  2J8M A;  4CAF A;  4NF1 A;  2R98 A;  3D8P A;  4CS0 B;  4EVY A;  4CYP A;  3IU2 A;  4FD7 A;  1IID A;  2GIV A;  3TCV A;  3TT2 A;  5DWN A;  2PR1 A;  2HUZ A;  2REE A;  1VHS A;  4MBU A;  5CNP A;  4JLY A;  2DPT A;  1P4N A;  4KOW A;  3D3S A;  2A4N A;  1LRZ A;  4C2Z A;  2B58 A;  2FXF A;  3QAH A;  2B4D A;  4KVX A;  1YX0 A;  3NE7 A;  2HV2 A;  2OZU A;  2VQY A;  2Z3L A;  4NEX A;  5F47 A;  4UFX A;  4MI4 A;  5IX3 A;  3JVN A;  2FIW A;  2P0W A;  3JUW A;  2G3A A;  3ZZI A;  4BBH A;  2D4O A;  2J8N A;  3LOD A;  4E0A A;  2B4B A;  2C27 A;  3W6S A;  4CGN A;  4NCZ A;  3TO7 A;  1PUA A;  3R1K A;  2G3T A;  4L89 A;  5JPH A;  2PQ8 A;  2Q44 A;  2B5G A;  4AB7 A;  4C7I A;  5KTD A;  4ZBG A;  2OU2 A;  2CNM A;  4KOX A;  1XF8 A;  4ORF A;  4A95 A;  2Q4Y A;  4CAE A;  1NSL A;  4F6A A;  4FD6 A;  2PR8 A;  1CM0 A;  1YVK A;  2BSW A;  2EVN A;  3IGR A;  4B12 A;  3DNS A;  4K30 A;  1IYL A;  4C7H A;  4PSX A;  1UFH A;  5A28 A;  4Q36 A;  3DR6 A;  2PC1 A;  2WUU A;  2Z11 A;  1P0H A;  2FE7 A;  4MY3 A;  5F46 A;  1NE9 A;  3JTK A;  4U5Y A;  4QBJ A;  4DNC A;  1BO4 A;  1YGH A;  4B13 A;  3CXQ A;  4XNH B;  3H4Q A;  2YNC C;  4NSQ A;  3DDD A;  4UBR A;  4A32 A;  1GHE A;  1Y9W A;  3GKR A;  3SHP A;  4B10 A;  1KUX A;  2Z10 A;  3GY9 A;  4E2A A;  5H86 A;  2JDC A;  3BJ7 A;  4KVM E;  3IWE A;  4LX9 A;  4HNY B;  1M4D A;  3WR7 A;  3H5Z A;  1Z4E A;  3N7Z A;  1Z4R A;  4UCP A;  4MFQ A;  2RC4 A;  2OZH A;  1S5K A;  5AG6 A;  2Z3P A;  5J8C A;  3A9L A;  1WK4 A;  4MFK A;  3F5B A;  4YFJ A;  3BJ8 A;  4CYQ A;  1I12 A;  4JXR A;  3FXT A;  1BOB A;  2QIR A;  4KUB A;  4UFV A;  1KUY A;  2Z3O A;  4PV6 A;  1ZO0 A;  3TOB A;  1S7K A;  4QVT A;  2R8V A;  3OWC A;  1MJA A;  3PZJ A;  5AG4 A;  2Q4V A;  2G0B A;  1K4J A;  1QSR A;  2P6E A;  2JDD A;  4CRZ B;  4CGO A;  3FIX A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...