4KLVA

Crystal structure of a gnat superfamily acetyltransferase pa4794 in complex with 4-methylumbelliferyl phosphate
Total Genus 42
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
42
sequence length
159
structure length
159
Chain Sequence
MQLSHRPAETGDLETVAGFPQDRDELFYCYPKAIWPFSVAQLAAAIAERRGSTVAVHDGQVLGFANFYQWQHGDFCALGNMMVAPAARGLGVARYLIGVMENLAREQYKARLMKISCFNANAAGLLLYTQLGYQPRAIAERHDPDGRRVALIQMDKPLE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords Uncharacterized protein
publication title Structural, Functional, and Inhibition Studies of a Gcn5-related N-Acetyltransferase (GNAT) Superfamily Protein PA4794: A NEW C-TERMINAL LYSINE PROTEIN ACETYLTRANSFERASE FROM PSEUDOMONAS AERUGINOSA.
pubmed doi rcsb
source organism Pseudomonas aeruginosa
total genus 42
structure length 159
sequence length 159
ec nomenclature
pdb deposition date 2013-05-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00583 Acetyltransf_1 Acetyltransferase (GNAT) family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.630.30 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Aminopeptidase 4klvA00
1YVKA 1S60A 4J3GA 4NXYA 2JLMA 2ZW7A 1OZPA 1KUXA 1I21A 4F6AA 4AVBA 2REFA 3CXPA 1QSMA 4E2AA 3SHPA 3EXNA 3FRMA 3WR7A 1KUYA 3D8PA 5EBVA 2Q0YA 3S6FA 5IX3A 4QC6A 4BMHA 4XPDC 3JVNA 4XPKA 1YREA 1L0CA 4PSWA 2B4DB 1N71A 4M3SA 4M85A 5F46A 2REEA 2B5GA 1XMTA 4K30A 2B3VA 3UY5A 4Y49C 2NMTA 4CAXA 4RS2A 4KOXA 2ZW6A 2Z10A 3JUWA 4KUBA 2PQ8A 4PK3A 4XNHC 2BUEA 2CNTA 3DR8A 5J8FA 5ISVA 2F5IA 4R3KA 2GE3A 1MJBA 2OZUA 2Q4YA 2EUIA 2R1IA 4YRHA 4AG9A 1LRZA 5I0CA 4UWIA 2VEZA 4CAVA 1MJAA 3V8IA 5F48A 2J8NA 4B5PA 4XPLA 2J8MA 3EC4A 1TIQA 2HQYA 3TO6A 2AJ6A 5EC4A 1YGHA 1P0HA 4KVOE 1YK3A 5H84A 4AVCA 5H86A 1Z9UA 3W6SA 4R57A 1PUAA 2VBQA 1FY7A 2CNMA 2JEVA 2DXQA 4UA3A 2O28A 4U9YA 1MJ9A 2PRBA 3P2HA 4QVTA 4H6UA 3TCVA 1CJWA 2P6FA 5HH1A 2RC4A 2B4DA 1IYLA 2D4PA 3TO7A 3MGDA 1KUVA 3DNSA 4NSQA 4AVAA 1M4IA 3W91A 1YR0A 3BLNA 5GCNA 3B8GA 2CNSA 3TTHA 3ZJ0A 4QB9A 2A4NA 4KUAA 5J8CA 4YFJA 2IL4A 4ZBGA 3S6HA 1YVOA 2WPXA 1Y9KA 2PR8A 2GANA 3TOAA 1QSRA 4H89A 4UBRA 2R98A 3W6XA 1P4NA 5C88A 3G3SA 1MK4A 3GKRA 5JQ4A 4MY3A 5IV0A 3R9GA 4KVXA 2Q44A 2FXFA 4HNWB 5F47A 4RI1A 2Z11A 4IUSA 4YGOA 3E0KA 2Q7BA 4Y49B 2P0WA 2KCWA 2FL4A 3R95A 4MY0A 2HUZA 1KZFA 2QECA 4XNHB 1Z4EA 2JDCA 4PK2A 5CNPA 1YX0A 4KOTA 4KZTA 1IYKA 1M4DA 3D2MA 3CXSA 4JWPA 3ZZIA 4I49A 2Q4VA 4FD6A 2Y0MA 4R87A 4KOWA 4JD6A 3PP9A 1PU9A 1Q2YA 1IICA 5E96A 2QMLA 1ON0A 5F49A 1NMTA 3SXNA 4OADA 2FIWA 1M1DA 2G3TA 3FYNA 3VWEA 1Y7RA 1UFHA 2R8VA 4PSXA 1WK4A 4KOYA 3BJ8A 4HNYB 2JDDA 3R1KA 1QSNA 1SQHA 2AE6A 2VI7A 1XF8A 5JPHA 1WWZA 3TT2A 2CY2A 4E0AA 2B4BA 4ORFA 2J8RA 3R96A 1XEBA 4KORA 3F8KA 3DDDA 3FXTA 5KTCA 4CAWA 4X5KA 2FE7A 3T9YA 3CXQA 4OAEA 3I9SA 4KLVA 4AG7A 3QAHA 3KKWA 3SXOA 4MI4A 2PC1A 3QB8A 2OU2A 2BEIA 1Q2DA 1VKCA 5IB0A 3D3SA 2ZXVA 2X7BA 2I00A 4FD5A 1RXTA 3DSBA 2VZZA 1CM0A 5DWMA 1S7LA 2BL1A 4MJ8A 4U5YA 3K9UA 2HV2A 2B5GB 3TO9A 2GIVA 1NSLA 3TOBA 1BOBA 3DR6A 1K4JA 4ONUA 1XIXA 2OZHA 3PGPA 1QSTA 4EVYA 2C27A 3D2PA 3BJ7A 4H6ZA 2D4OA 3FNCA 5DWNA 1B87A 4GS4A 3EO4A 2OB0A 5FVJA 3EY5A 1B6BA 1S7NA 2PSWA 4XPDB 4HKFA 1IIDA 1J4JA 3G8WA 2EVNA 4B5PB 2PDOA 1NE9A 3VWDA 2OZGA 1V0CA 4JXQA 2FS5A 2I79A 1QSOA 2ZW5A 5KTDA 3LD2A 2PR1A 3S6GA 4B5OA 2B3UA 1GHEA 4KOVA 5HMNA 3GY9A 2K5TA 1Y9WA 2VXKA 4IF5A 4NF1A 3TE4A 4R9MA 2BSWA 4NEXA 1IB1E 3P2FA 4CRYB 4E8OA 1M4GA 2P6GA 3RYOA 3F5BA 1YLEA 3TFYA 4FD7A 3R9EA 1Q2CA 3PZJA 3F0AA 4HNXB 1S7FA 3EFAA 3FIXA 4MHDA 3LODA 1I12A 4KOUA 2G3AA 3I3GA 3NE7A 4OLLA 1VHSA 1S3ZA 4JJXA 5KTAA 1U6MA 4FD4A 2H5MA 3IWGA 1R57A 4KVME 3FB3A 4R3LA 3C26A 3N7ZA 4CRZB 2QIRA 3IGRA 2Q04A 3OWCA 4QBJA 3R9FA 4LX9A 2Z0ZA 2ARHA 3S6KA 4UWJA 2VQYA 4U9ZA 4L89A 4PV6A 2R7HA 2FSRA 4MBUA 5C82A 4NCZA 2ZPAA 2B58A 2WPWA 4DNCA 2VZYA 3GYAA 1S5KA 1S7KA 2FIAA 4KOSA 1XE4A 2ZW4A 3H4QA 3T90A 4CS0B 1BO4A 4F0YA 4AB7A 4JLYA 2FCKA 4KLWA 2FT0A 2G0BA 2P6EA 2ATRA 3FBUA 1I1DA 4L8AA 4LUAA 1RO5A 4QUSA 1M44A 1Z4RA 4II9A 4JXRA 2OH1A
chains in the Genus database with same CATH superfamily
1YVKA 1S60A 3MRUA 4P10A 2IJZA 1PCAA 4X2TA 4J3GA 3RZAA 1TKHA 1JWQA 1ZO0A 3PB7X 4NXYA 2JLMA 2ZW7A 2I3CA 4MRIA 5J1QA 1OZPA 1KUXA 5K8MA 1I21A 4F6AA 4TNUA 2AFWA 4AVBA 3FVLA 4C2YA 2AFUA 1LOKA 3GLJA 4ZY0A 4B13A 4DYOA 4MHZA 2REFA 4OIWA 3CXPA 4EFDA 1QSMA 2ZELA 4OC0A 4E2AA 5DS0A 3ISXA 3PB4X 4NGSA 4R6TA 4WWVA 3SHPA 3EXNA 3FRMA 3WR7A 1KUYA 2V8DA 3D8PA 5EBVA 1H8LA 2Q0YA 2PJ4A 3S6FA 3LMSA 4OMEA 5IX3A 5I4MA 1CG2A 4QC6A 3PFOA 4BMHA 4XPDC 3JVNA 3KASA 5LRJA 3KHXA 4XPKA 1YREA 1L0CA 3B2YA 2B4DB 1HEEA 4PSWA 1N71A 2ZEMA 4M3SA 1VHEA 4M85A 4GXHA 4MMOA 5F46A 1Y7EA 2REEA 2B5GA 1XMTA 1XBUA 4K30A 2B3VA 3KL9A 3UY5A 4Y49C 4CYNA 2NMTA 4A30A 4CAXA 1X10A 4C7HA 4RS2A 1DE4C 4G1PA 2ZW6A 4KOXA 4CGLA 5A27A 4MCSA 2Z10A 3JUWA 4C2XA 2GLJA 2PQ8A 2HC9A 4FUUA 4KUBA 4PK3A 1AYEA 2BUEA 2CNTA 3DR8A 4MFPA 4NGQA 4XNHC 4R76A 5ELYA 5J8FA 2RFHA 5ISVA 2F5IA 4P4IA 3KZWA 5G20A 2IMOA 3CPAA 4R3KA 2GE3A 1MJBA 4AXVA 2OZUA 3V38A 2Q4YA 1X12A 2EUIA 2R1IA 2ODFA 2XEFA 4YRHA 4AG9A 3SI2A 4O23A 1LRZA 1Z5RA 2ZEGA 5F09A 1YMEA 4PXEA 5I0CA 4UWIA 2VEZA 4CAVA 1MJAA 3IIBA 3V8IA 5F48A 2J8NA 4B5PA 4RUHA 1ARMA 3PBEA 2J8MA 4XPLA 4F0XA 1BAVA 3EC4A 1TIQA 2HQYA 2PIYA 4KSAA 4BBHA 2J9AA 1CP6A 2ZEEA 2NYQA 3TO6A 4KS9A 3DLJA 1F57A 1Z8WA 1HDQA 2AJ6A 4P44A 1YGHA 5EC4A 4CAFA 4B12A 1P0HA 4KVOE 1YK3A 5H84A 3D7HA 2ZEHA 5H86A 1Z9UA 4AVCA 3W6SA 4R57A 4KSIA 1AUGA 1PUAA 4NFRA 2VBQA 2WSAA 1FY7A 2EO8A 4Q7AA 4UFWA 3K2KA 5AG6A 4K3NA 4Q36A 2CNMA 2JEVA 3D7GA 4NGNA 4YU9A 2DXQA 4UA3A 4CPAA 2PJCA 1Z8TA 3GUXA 3KGQA 2O28A 4B11A 4U9YA 1MJ9A 2Z3MA 2PRBA 3P2HA 4QVTA 4TWEA 3B3SA 4H6UA 1CJWA 3TCVA 4A94A 2P6FA 5HH1A 2ZEOA 3PBBA 2RC4A 1AMPA 2B4DA 1IYLA 2D4PA 3TO7A 3MGDA 4F8ZA 1KUVA 2GU2A 1FNOA 3DNSA 4NSQA 4UCNA 4AVAA 2BO9A 1M4IA 3W91A 1YR0A 3BLNA 4M6IA 1ZLHA 3IU1A 3BI0A 1BLLE 3B8GA 4IHMA 5GCNA 2CNSA 1NSAA 3TTHA 4P45A 4JZ0A 2QVPA 4FWUA 4QB9A 3ZJ0A 3D67A 3KI9A 2A4NA 4KUAA 4C2ZA 3HUVA 5J8CA 4YFJA 2IL4A 2F7VA 4ZBGA 3S6HA 3VARA 1VHOA 5D29A 1YVOA 2WPXA 1Y9KA 2PR8A 2GLFA 8CPAA 2OR4A 3CDXA 3T8WA 2GANA 1ARLA 3CT9A 3TOAA 2V77A 5LYFA 1XFOA 2V8VA 1QSRA 4H89A 1HDUA 3FECA 1R43A 2ZEFA 4NGTA 4UBRA 5AG5A 2BCOA 2O53A 1LCPA 2R98A 2G9DA 3PRTA 3W6XA 3BXMA 1P4NA 5C88A 3G3SA 2POKA 1MK4A 3B7IA 2PJAA 3GKRA 5JQ4A 3D66A 4MY3A 3FF3A 5IV0A 3R9GA 5JM6A 4KVXA 4ZGYB 2Q44A 4YWYA 2FXFA 4HNWB 5F47A 4RI1A 2HB6A 3DGVA 1KWMA 2ZEDA 3PB8X 4OP4A 4X8IA 2Z11A 2YGWA 4DJLA 4IUSA 2DPSA 4M6GA 1YW4A 2PJ1A 3FH4A 4YGOA 3E0KA 5CPAA 1YLOA 2Q7BA 4Y49B 1PYTB 2P0WA 1IU8A 6CPAA 2KCWA 3NH4A 1FT7A 3FEEA 2FL4A 3R95A 3VH9A 4MY0A 2PJ7A 4PXDA 4ZY1A 3VATA 4A2ZA 2HUZA 1KZFA 1TF9A 2QECA 2EK9A 4XNHB 4BD9A 2GREA 1LFWA 3WT4A 3K9TA 1IY7A 1Z4EA 4B10A 2JDCA 4PK2A 5CNPA 3S9MA 1YX0A 4KOTA 4KZTA 4CAEA 1IYKA 1M4DA 3RBUA 3D2MA 3CXSA 4JWPA 3ZZIA 5D8NA 4MXUA 4I49A 2Q4VA 2XEIA 4FD6A 4OC2A 2CTCA 3PEIA 4EWTA 2Y0MA 4R87A 3H8EA 4KOWA 5LRKA 4JD6A 3PP9A 2CTBA 3A9LA 4ZI6A 1PU9A 2PE3A 5EMIA 1M4LA 1Q2YA 1IICA 5E96A 3MN8A 2PRQA 2QMLA 1ON0A 5F49A 1NMTA 4M6HA 3SXNA 4OADA 2FIWA 1M1DA 2G3TA 2Z3PA 3D7DA 3FYNA 1Y7RA 4MFLA 4OC4A 3VWEA 1UFHA 3SJEA 2R8VA 4PSXA 1WK4A 1XRYA 1ELLP 4KOYA 4UCPA 4ZX8A 4B6ZA 3BJ8A 1YW6A 2AFSA 2EBJA 1CBXA 2JDDA 3D7FA 3R1KA 1QSNA 4HNYB 4MCQA 1SQHA 4A95A 2AE6A 2VI7A 3HLPA 4P4FA 1XF8A 7CPAA 3GIUA 2DEAA 5JPHA 2CIJA 4MFKA 1EE3P 3NH5A 1WWZA 3TT2A 4ZYQA 2CY2A 2PJ9A 5IB9A 2O4HA 1TKJA 2B4BA 4ORFA 4E0AA 2J8RA 3R96A 3TC8A 3S9NA 1F2OA 1XEBA 3NH8A 4KORA 4X3RA 1Z8LA 3F8KA 3DDDA 3SJGA 1VGYA 3FXTA 1ZG9A 3SI0A 3V7ZA 5KTCA 2PIZA 3B3CA 4CAWA 4X5KA 4UIBA 2Z3KA 2FE7A 3T9YA 3CXQA 2ZEPA 4OAEA 2YNCA 3I9SA 4KLVA 4AG7A 3LWUA 2EWBA 3QAHA 3KKWA 1TF8A 3SXOA 3KR4A 3QAYA 4MI4A 2PC1A 4C68A 4Z65A 1QQ9A 3QB8A 2OU2A 4CGMA 2BEIA 4JYWA 2PJ6A 1Q2DA 1VKCA 5IB0A 4MHYA 3D3SA 2ZXVA 2C6GA 2X7BA 2I00A 4FD5A 1RXTA 3DSBA 4LQGA 2VZZA 4GM5A 4MHPA 1CM0A 4NJRA 5DWMA 2YNEA 4MCPA 1S7LA 2BL1A 4MJ8A 3H8GA 1CX8A 2ZENA 4U5YA 3K9UA 2V8HA 2HV2A 2PCUA 2B5GB 3TO9A 2GIVA 4WJBA 1NSLA 3TOBA 3IEHA 5K8OA 1BOBA 3DR6A 3IWEA 1VIXA 1K4JA 3NA6A 4IAVA 4KSFA 2AFZA 2IQ6A 4ONUA 5HVGA 1XIXA 1Y0YA 1QMUA 2OZHA 3B35A 4MCRA 3PGPA 1QSTA 3QNVA 2ZOFA 2ANPA 4EVYA 2C27A 2C6PA 3D2PA 3D4UA 2VL1A 3BJ7A 4H6ZA 4CYOA 2D4OA 3KQZA 2PJBA 3FNCA 1BPMA 3IU2A 1B87A 5DWNA 5LRGA 2C6CA 3LACA 4GS4A 3SJXA 3EO4A 2OB0A 5FVJA 3EY5A 4OIDA 4OC5A 4LQ6A 2Z3LA 1B6BA 1S7NA 2WZNA 4A39A 2DF5A 2PSWA 1BPNA 4CGOA 1DTDA 4HKFA 4XPDB 3JRUA 1IIDA 1J4JA 3KHZA 3BHXA 2C1CA 3G8WA 2EVNA 4P4JA 4B5PB 5BWAB 2PDOA 3WABA 4A32A 1NE9A 4UIAA 3VWDA 2OZGA 5CBMA 2FVGA 1V0CA 4UEEA 4JXQA 2Q43A 1ZG7A 2FS5A 1JQGA 2I79A 4OC1A 4R7MA 1QSOA 4W9YA 2ZW5A 5KTDA 1CPSA 2F8HA 1GYTA 4NJQA 2PJ2A 4P4EA 4UFXA 4FAIA 3B3WA 3ISZA 3LD2A 2PR1A 3S6GA 3N5FA 4B5OA 2B3UA 4BINA 1GHEA 2CF4A 4UCMA 4KOVA 5HMNA 5AGEA 2AFOA 3L2NA 4A37A 3GY9A 4B14A 2K5TA 3SI1A 1Y9WA 1Z2LA 1XJOA 2VXKA 4IF5A 3NE8A 3RNZA 4NF1A 4PXCA 4A31A 5AG4A 1RTQA 3TE4A 4R9MA 5LYIA 2AFXA 2DPTA 1YQEA 1LAPA 2BSWA 3CZXA 2BOAA 3H8FA 1IGBA 4NEXA 1IB1E 3P2FA 4CRYB 4E8OA 4MFZA 1OBRA 3NFZA 1M4GA 2P6GA 3RYOA 3F5BA 3FEDA 4UFVA 4A38A 1YLEA 3TFYA 4FD7A 3R9EA 5JH9A 1Q2CA 2PVVA 3S9LA 1Q7LA 3D68A 3PZJA 4NGMA 5G21A 3F0AA 4HNXB 5G22A 3B3VA 3GB0A 5HXDA 1ELMP 1S7FA 3EFAA 3FIXA 4MHDA 2Z3OA 4PXBA 3IC1A 2YNCC 2RB7A 3PB9X 4CGPA 5A28A 3LODA 4CGNA 1I12A 2V8GA 3B3TA 4KOUA 2G3AA 3WC7A 4H2KA 2Q7SA 3I3GA 3NE7A 4MFJA 4OLLA 5JGFA 1VHSA 2QYVA 3H5ZA 1S3ZA 4JJXA 4NGRA 1A2ZA 5KTAA 1U6MA 5HVFA 5AG7A 4FD4A 5THWA 4P4BA 2H5MA 5LYDA 2XEJA 3I1UA 1R57A 3IWGA 5G1ZA 2GFQA 4PQAA 1IOFA 2CXAA 2JBKA 4UF4A 1ZLIA 4KVME 4CYQA 1LAMA 3FB3A 2JBJA 2PVWA 4R3LA 1TXRA 3CPXA 4RN7A 2NSMA 2PJ5A 3JTKA 4P4DA 3IJ3A 3C26A 3N7ZA 4CRZB 3IO1A 2QIRA 2Z3NA 2QJ8A 4PPZA 3IGRA 4UEFA 4UEZA 2Q04A 3OWCA 4CYPA 4F9UA 4QBJA 1CPXA 3R9FA 4LX9A 4EMEA 4P6YA 2Z0ZA 2ARHA 3S6KA 3WC6A 4C7IA 4UWJA 2WUUA 2VQYA 2PJ3A 4U9ZA 3RO0A 4L89A 4PV6A 1TKFA 2R7HA 2FSRA 3PFEA 1XMBA 4FBEA 4MBUA 3TX8A 2YNDA 3WC5A 4NCZA 5C82A 1UWYA 3IFEA 4R8FA 5K8NA 4ZY2A 2ZPAA 2B58A 2WPWA 4DNCA 2VZYA 3GYAA 1S5KA 1S7KA 2FIAA 2ZOGA 3FMCA 4KOSA 1XE4A 4Q38A 2ZW4A 3H4QA 4ZX9A 1Z8XA 2PJ8A 3PB6X 4MFQA 3KQXA 3T90A 4CS0B 1R3NA 1BO4A 4F0YA 4AB7A 4JLYA 1IOIA 1CP7A 1XOVA 1ZG8A 2AFMA 2FCKA 4KLWA 4NGPA 2Q4ZA 4OC3A 2OOTA 2ABZA 2FT0A 4MHNA 3RAMA 2G0BA 1LANA 4IK2A 4OKOA 2JEWA 2P6EA 2Q51A 2ATRA 4HPSA 4A33A 3FBUA 1YSJA 1I1DA 3FJUA 4L8AA 4LUAA 1RO5A 2WYRA 4DUKA 4QUSA 2XEGA 5LYLA 3FX6A 5HVHA 1F2PA 3KR5A 4F9VA 1M44A 3SJFA 1Z4RA 4II9A 4JXRA 5K8PA 2PJ0A 4ONWA 3BI1A 1Y0RA 2OH1A 3IWWA 2EK8A
chains in the Genus database with same CATH topology
1YVKA 1S60A 4J3GA 1ZO0A 4NXYA 2JLMA 2ZW7A 1OZPA 1KUXA 1I21A 4F6AA 4AVBA 4C2YA 4B13A 2REFA 3CXPA 1QSMA 4E2AA 3SHPA 3EXNA 3FRMA 3WR7A 1KUYA 3D8PA 5EBVA 2Q0YA 3S6FA 5IX3A 4QC6A 4BMHA 4XPDC 3JVNA 4XPKA 1YREA 1L0CA 4PSWA 2B4DB 1N71A 4M3SA 4M85A 5F46A 2REEA 2B5GA 1XMTA 4K30A 2B3VA 3UY5A 4Y49C 4CYNA 2NMTA 4A30A 4CAXA 4C7HA 4RS2A 4KOXA 2ZW6A 4CGLA 5A27A 2Z10A 3JUWA 4C2XA 4KUBA 2PQ8A 4CGPA 4PK3A 4XNHC 2BUEA 2CNTA 3DR8A 4MFPA 5J8FA 5ISVA 2F5IA 5G20A 4R3KA 2GE3A 1MJBA 2OZUA 2Q4YA 2EUIA 2R1IA 4YRHA 4AG9A 1LRZA 5I0CA 4UWIA 2VEZA 4CAVA 1MJAA 3V8IA 5F48A 2J8NA 4B5PA 4XPLA 2J8MA 4F0XA 3EC4A 1TIQA 2HQYA 4KSAA 4BBHA 3TO6A 4KS9A 2AJ6A 5EC4A 4CAFA 1YGHA 4B12A 1P0HA 4KVOE 1YK3A 5H84A 4AVCA 5H86A 1Z9UA 3W6SA 4R57A 1PUAA 2VBQA 2WSAA 1FY7A 4UFWA 5AG6A 4Q36A 2CNMA 2JEVA 2DXQA 4UA3A 2O28A 4B11A 4U9YA 1MJ9A 2Z3MA 2PRBA 3P2HA 4QVTA 4H6UA 3TCVA 1CJWA 2P6FA 5HH1A 2RC4A 2B4DA 1IYLA 2D4PA 3TO7A 3MGDA 1KUVA 3DNSA 4NSQA 4UCNA 4AVAA 1M4IA 3W91A 1YR0A 3BLNA 3IU1A 5GCNA 3B8GA 2CNSA 3TTHA 3ZJ0A 4QB9A 2A4NA 4KUAA 4C2ZA 5J8CA 4YFJA 2IL4A 4ZBGA 3S6HA 1YVOA 2WPXA 1Y9KA 2PR8A 2GANA 3TOAA 1QSRA 4H89A 4UBRA 5AG5A 2R98A 3W6XA 1P4NA 5C88A 3G3SA 1MK4A 3GKRA 5JQ4A 4MY3A 5IV0A 3R9GA 4KVXA 4ZGYB 2Q44A 2FXFA 4HNWB 5F47A 4RI1A 2Z11A 2YGWA 4IUSA 2DPSA 4YGOA 3E0KA 2Q7BA 4Y49B 2P0WA 2KCWA 2FL4A 3R95A 4MY0A 4A2ZA 2HUZA 1KZFA 2QECA 4XNHB 1Z4EA 4B10A 2JDCA 4PK2A 5CNPA 1YX0A 4KOTA 4KZTA 4CAEA 1IYKA 1M4DA 3D2MA 3CXSA 4JWPA 3ZZIA 4I49A 2Q4VA 4FD6A 2Y0MA 4R87A 4KOWA 4JD6A 3PP9A 3A9LA 1PU9A 1Q2YA 1IICA 5E96A 2QMLA 1ON0A 5F49A 1NMTA 3SXNA 4OADA 2FIWA 1M1DA 2G3TA 2Z3PA 3FYNA 4MFLA 1Y7RA 3VWEA 1UFHA 2R8VA 4PSXA 1WK4A 4KOYA 4UCPA 3BJ8A 4HNYB 2JDDA 3R1KA 1QSNA 1SQHA 4A95A 2AE6A 2VI7A 1XF8A 5JPHA 4MFKA 1WWZA 3TT2A 2CY2A 4E0AA 2B4BA 4ORFA 2J8RA 3R96A 1XEBA 4KORA 3F8KA 3DDDA 3FXTA 5KTCA 4CAWA 4X5KA 2Z3KA 2FE7A 3T9YA 3CXQA 4OAEA 2YNCA 3I9SA 4KLVA 4AG7A 3QAHA 3KKWA 3SXOA 4MI4A 2PC1A 4C68A 4CGMA 3QB8A 2OU2A 2BEIA 1Q2DA 1VKCA 5IB0A 3D3SA 2ZXVA 2X7BA 2I00A 4FD5A 1RXTA 3DSBA 2VZZA 1CM0A 5DWMA 2YNEA 1S7LA 2BL1A 4MJ8A 4U5YA 3K9UA 2HV2A 2B5GB 3TO9A 2GIVA 1NSLA 3TOBA 1BOBA 3DR6A 3IWEA 1K4JA 4KSFA 4ONUA 1XIXA 2OZHA 3PGPA 1QSTA 4EVYA 2C27A 3D2PA 3BJ7A 4H6ZA 4CYOA 2D4OA 3FNCA 5DWNA 3IU2A 1B87A 4GS4A 3EO4A 2OB0A 5FVJA 3EY5A 2Z3LA 1B6BA 1S7NA 2PSWA 4CGOA 4XPDB 4HKFA 1IIDA 1J4JA 3G8WA 2EVNA 4B5PB 5BWAB 2PDOA 4A32A 1NE9A 3VWDA 2OZGA 1V0CA 4JXQA 2FS5A 2I79A 1QSOA 2ZW5A 5KTDA 4UFXA 3LD2A 2PR1A 3S6GA 4B5OA 2B3UA 1GHEA 4UCMA 4KOVA 5HMNA 5AGEA 3GY9A 4B14A 2K5TA 1Y9WA 2VXKA 4IF5A 4NF1A 4A31A 5AG4A 3TE4A 4R9MA 2BSWA 2DPTA 4NEXA 1IB1E 3P2FA 4CRYB 4E8OA 4MFZA 1M4GA 2P6GA 3RYOA 3F5BA 4UFVA 1YLEA 3TFYA 4FD7A 3R9EA 1Q2CA 3PZJA 5G21A 3F0AA 4HNXB 5G22A 1S7FA 3EFAA 3FIXA 4MHDA 2Z3OA 2YNCC 5A28A 3LODA 4CGNA 1I12A 4KOUA 2G3AA 3I3GA 3NE7A 4MFJA 4OLLA 1VHSA 3H5ZA 1S3ZA 4JJXA 5KTAA 1U6MA 5AG7A 4FD4A 2H5MA 3IWGA 1R57A 5G1ZA 2CXAA 4KVME 4CYQA 3FB3A 4R3LA 3JTKA 3C26A 3N7ZA 4CRZB 2QIRA 2Z3NA 3IGRA 2Q04A 3OWCA 4CYPA 4QBJA 3R9FA 4LX9A 2Z0ZA 2ARHA 3S6KA 4C7IA 4UWJA 2WUUA 2VQYA 4U9ZA 4L89A 4PV6A 2R7HA 2FSRA 4MBUA 2YNDA 5C82A 4NCZA 2ZPAA 2B58A 2WPWA 4DNCA 2VZYA 3GYAA 1S5KA 1S7KA 2FIAA 4KOSA 1XE4A 4Q38A 2ZW4A 3H4QA 4MFQA 3T90A 4CS0B 1BO4A 4F0YA 4AB7A 4JLYA 2FCKA 4KLWA 2FT0A 2G0BA 2P6EA 2ATRA 4A33A 3FBUA 1I1DA 4L8AA 4LUAA 1RO5A 4QUSA 1M44A 1Z4RA 4II9A 4JXRA 2OH1A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1YVK A;  1S60 A;  4J3G A;  4NXY A;  2JLM A;  2ZW7 A;  1OZP A;  1KUX A;  1I21 A;  4F6A A;  4AVB A;  2REF A;  3CXP A;  1QSM A;  4E2A A;  3SHP A;  3EXN A;  3FRM A;  3WR7 A;  1KUY A;  3D8P A;  5EBV A;  2Q0Y A;  3S6F A;  5IX3 A;  4QC6 A;  4BMH A;  4XPD C;  3JVN A;  4XPK A;  1YRE A;  1L0C A;  4PSW A;  2B4D B;  1N71 A;  4M3S A;  4M85 A;  5F46 A;  2REE A;  2B5G A;  1XMT A;  4K30 A;  2B3V A;  3UY5 A;  4Y49 C;  2NMT A;  4CAX A;  4RS2 A;  4KOX A;  2ZW6 A;  2Z10 A;  3JUW A;  4KUB A;  2PQ8 A;  4PK3 A;  4XNH C;  2BUE A;  2CNT A;  3DR8 A;  5J8F A;  5ISV A;  2F5I A;  4R3K A;  2GE3 A;  1MJB A;  2OZU A;  2Q4Y A;  2EUI A;  2R1I A;  4YRH A;  4AG9 A;  1LRZ A;  5I0C A;  4UWI A;  2VEZ A;  4CAV A;  1MJA A;  3V8I A;  5F48 A;  2J8N A;  4B5P A;  4XPL A;  2J8M A;  3EC4 A;  1TIQ A;  2HQY A;  3TO6 A;  2AJ6 A;  5EC4 A;  1YGH A;  1P0H A;  4KVO E;  1YK3 A;  5H84 A;  4AVC A;  5H86 A;  1Z9U A;  3W6S A;  4R57 A;  1PUA A;  2VBQ A;  1FY7 A;  2CNM A;  2JEV A;  2DXQ A;  4UA3 A;  2O28 A;  4U9Y A;  1MJ9 A;  2PRB A;  3P2H A;  4QVT A;  4H6U A;  3TCV A;  1CJW A;  2P6F A;  5HH1 A;  2RC4 A;  2B4D A;  1IYL A;  2D4P A;  3TO7 A;  3MGD A;  1KUV A;  3DNS A;  4NSQ A;  4AVA A;  1M4I A;  3W91 A;  1YR0 A;  3BLN A;  5GCN A;  3B8G A;  2CNS A;  3TTH A;  3ZJ0 A;  4QB9 A;  2A4N A;  4KUA A;  5J8C A;  4YFJ A;  2IL4 A;  4ZBG A;  3S6H A;  1YVO A;  2WPX A;  1Y9K A;  2PR8 A;  2GAN A;  3TOA A;  1QSR A;  4H89 A;  4UBR A;  2R98 A;  3W6X A;  1P4N A;  5C88 A;  3G3S A;  1MK4 A;  3GKR A;  5JQ4 A;  4MY3 A;  5IV0 A;  3R9G A;  4KVX A;  2Q44 A;  2FXF A;  4HNW B;  5F47 A;  4RI1 A;  2Z11 A;  4IUS A;  4YGO A;  3E0K A;  2Q7B A;  4Y49 B;  2P0W A;  2KCW A;  2FL4 A;  3R95 A;  4MY0 A;  2HUZ A;  1KZF A;  2QEC A;  4XNH B;  1Z4E A;  2JDC A;  4PK2 A;  5CNP A;  1YX0 A;  4KOT A;  4KZT A;  1IYK A;  1M4D A;  3D2M A;  3CXS A;  4JWP A;  3ZZI A;  4I49 A;  2Q4V A;  4FD6 A;  2Y0M A;  4R87 A;  4KOW A;  4JD6 A;  3PP9 A;  1PU9 A;  1Q2Y A;  1IIC A;  5E96 A;  2QML A;  1ON0 A;  5F49 A;  1NMT A;  3SXN A;  4OAD A;  2FIW A;  1M1D A;  2G3T A;  3FYN A;  3VWE A;  1Y7R A;  1UFH A;  2R8V A;  4PSX A;  1WK4 A;  4KOY A;  3BJ8 A;  4HNY B;  2JDD A;  3R1K A;  1QSN A;  1SQH A;  2AE6 A;  2VI7 A;  1XF8 A;  5JPH A;  1WWZ A;  3TT2 A;  2CY2 A;  4E0A A;  2B4B A;  4ORF A;  2J8R A;  3R96 A;  1XEB A;  4KOR A;  3F8K A;  3DDD A;  3FXT A;  5KTC A;  4CAW A;  4X5K A;  2FE7 A;  3T9Y A;  3CXQ A;  4OAE A;  3I9S A;  4KLV A;  4AG7 A;  3QAH A;  3KKW A;  3SXO A;  4MI4 A;  2PC1 A;  3QB8 A;  2OU2 A;  2BEI A;  1Q2D A;  1VKC A;  5IB0 A;  3D3S A;  2ZXV A;  2X7B A;  2I00 A;  4FD5 A;  1RXT A;  3DSB A;  2VZZ A;  1CM0 A;  5DWM A;  1S7L A;  2BL1 A;  4MJ8 A;  4U5Y A;  3K9U A;  2HV2 A;  2B5G B;  3TO9 A;  2GIV A;  1NSL A;  3TOB A;  1BOB A;  3DR6 A;  1K4J A;  4ONU A;  1XIX A;  2OZH A;  3PGP A;  1QST A;  4EVY A;  2C27 A;  3D2P A;  3BJ7 A;  4H6Z A;  2D4O A;  3FNC A;  5DWN A;  1B87 A;  4GS4 A;  3EO4 A;  2OB0 A;  5FVJ A;  3EY5 A;  1B6B A;  1S7N A;  2PSW A;  4XPD B;  4HKF A;  1IID A;  1J4J A;  3G8W A;  2EVN A;  4B5P B;  2PDO A;  1NE9 A;  3VWD A;  2OZG A;  1V0C A;  4JXQ A;  2FS5 A;  2I79 A;  1QSO A;  2ZW5 A;  5KTD A;  3LD2 A;  2PR1 A;  3S6G A;  4B5O A;  2B3U A;  1GHE A;  4KOV A;  5HMN A;  3GY9 A;  2K5T A;  1Y9W A;  2VXK A;  4IF5 A;  4NF1 A;  3TE4 A;  4R9M A;  2BSW A;  4NEX A;  1IB1 E;  3P2F A;  4CRY B;  4E8O A;  1M4G A;  2P6G A;  3RYO A;  3F5B A;  1YLE A;  3TFY A;  4FD7 A;  3R9E A;  1Q2C A;  3PZJ A;  3F0A A;  4HNX B;  1S7F A;  3EFA A;  3FIX A;  4MHD A;  3LOD A;  1I12 A;  4KOU A;  2G3A A;  3I3G A;  3NE7 A;  4OLL A;  1VHS A;  1S3Z A;  4JJX A;  5KTA A;  1U6M A;  4FD4 A;  2H5M A;  3IWG A;  1R57 A;  4KVM E;  3FB3 A;  4R3L A;  3C26 A;  3N7Z A;  4CRZ B;  2QIR A;  3IGR A;  2Q04 A;  3OWC A;  4QBJ A;  3R9F A;  4LX9 A;  2Z0Z A;  2ARH A;  3S6K A;  4UWJ A;  2VQY A;  4U9Z A;  4L89 A;  4PV6 A;  2R7H A;  2FSR A;  4MBU A;  5C82 A;  4NCZ A;  2ZPA A;  2B58 A;  2WPW A;  4DNC A;  2VZY A;  3GYA A;  1S5K A;  1S7K A;  2FIA A;  4KOS A;  1XE4 A;  2ZW4 A;  3H4Q A;  3T90 A;  4CS0 B;  1BO4 A;  4F0Y A;  4AB7 A;  4JLY A;  2FCK A;  4KLW A;  2FT0 A;  2G0B A;  2P6E A;  2ATR A;  3FBU A;  1I1D A;  4L8A A;  4LUA A;  1RO5 A;  4QUS A;  1M44 A;  1Z4R A;  4II9 A;  4JXR A;  2OH1 A; 
#chains in the Genus database with same CATH topology
 1YVK A;  1S60 A;  3MRU A;  4P10 A;  2IJZ A;  1PCA A;  4X2T A;  4J3G A;  3RZA A;  1TKH A;  1JWQ A;  1ZO0 A;  3PB7 X;  4NXY A;  2JLM A;  2ZW7 A;  2I3C A;  4MRI A;  5J1Q A;  1OZP A;  1KUX A;  5K8M A;  1I21 A;  4F6A A;  4TNU A;  2AFW A;  4AVB A;  3FVL A;  4C2Y A;  2AFU A;  1LOK A;  3GLJ A;  4ZY0 A;  4B13 A;  4DYO A;  4MHZ A;  2REF A;  4OIW A;  3CXP A;  4EFD A;  1QSM A;  2ZEL A;  4OC0 A;  4E2A A;  5DS0 A;  3ISX A;  3PB4 X;  4NGS A;  4R6T A;  4WWV A;  3SHP A;  3EXN A;  3FRM A;  3WR7 A;  1KUY A;  2V8D A;  3D8P A;  5EBV A;  1H8L A;  2Q0Y A;  2PJ4 A;  3S6F A;  3LMS A;  4OME A;  5IX3 A;  5I4M A;  1CG2 A;  4QC6 A;  3PFO A;  4BMH A;  4XPD C;  3JVN A;  3KAS A;  5LRJ A;  3KHX A;  4XPK A;  1YRE A;  1L0C A;  3B2Y A;  2B4D B;  1HEE A;  4PSW A;  1N71 A;  2ZEM A;  4M3S A;  1VHE A;  4M85 A;  4GXH A;  4MMO A;  5F46 A;  1Y7E A;  2REE A;  2B5G A;  1XMT A;  1XBU A;  4K30 A;  2B3V A;  3KL9 A;  3UY5 A;  4Y49 C;  4CYN A;  2NMT A;  4A30 A;  4CAX A;  1X10 A;  4C7H A;  4RS2 A;  1DE4 C;  4G1P A;  2ZW6 A;  4KOX A;  4CGL A;  5A27 A;  4MCS A;  2Z10 A;  3JUW A;  4C2X A;  2GLJ A;  2PQ8 A;  2HC9 A;  4FUU A;  4KUB A;  4PK3 A;  1AYE A;  2BUE A;  2CNT A;  3DR8 A;  4MFP A;  4NGQ A;  4XNH C;  4R76 A;  5ELY A;  5J8F A;  2RFH A;  5ISV A;  2F5I A;  4P4I A;  3KZW A;  5G20 A;  2IMO A;  3CPA A;  4R3K A;  2GE3 A;  1MJB A;  4AXV A;  2OZU A;  3V38 A;  2Q4Y A;  1X12 A;  2EUI A;  2R1I A;  2ODF A;  2XEF A;  4YRH A;  4AG9 A;  3SI2 A;  4O23 A;  1LRZ A;  1Z5R A;  2ZEG A;  5F09 A;  1YME A;  4PXE A;  5I0C A;  4UWI A;  2VEZ A;  4CAV A;  1MJA A;  3IIB A;  3V8I A;  5F48 A;  2J8N A;  4B5P A;  4RUH A;  1ARM A;  3PBE A;  2J8M A;  4XPL A;  4F0X A;  1BAV A;  3EC4 A;  1TIQ A;  2HQY A;  2PIY A;  4KSA A;  4BBH A;  2J9A A;  1CP6 A;  2ZEE A;  2NYQ A;  3TO6 A;  4KS9 A;  3DLJ A;  1F57 A;  1Z8W A;  1HDQ A;  2AJ6 A;  4P44 A;  1YGH A;  5EC4 A;  4CAF A;  4B12 A;  1P0H A;  4KVO E;  1YK3 A;  5H84 A;  3D7H A;  2ZEH A;  5H86 A;  1Z9U A;  4AVC A;  3W6S A;  4R57 A;  4KSI A;  1AUG A;  1PUA A;  4NFR A;  2VBQ A;  2WSA A;  1FY7 A;  2EO8 A;  4Q7A A;  4UFW A;  3K2K A;  5AG6 A;  4K3N A;  4Q36 A;  2CNM A;  2JEV A;  3D7G A;  4NGN A;  4YU9 A;  2DXQ A;  4UA3 A;  4CPA A;  2PJC A;  1Z8T A;  3GUX A;  3KGQ A;  2O28 A;  4B11 A;  4U9Y A;  1MJ9 A;  2Z3M A;  2PRB A;  3P2H A;  4QVT A;  4TWE A;  3B3S A;  4H6U A;  1CJW A;  3TCV A;  4A94 A;  2P6F A;  5HH1 A;  2ZEO A;  3PBB A;  2RC4 A;  1AMP A;  2B4D A;  1IYL A;  2D4P A;  3TO7 A;  3MGD A;  4F8Z A;  1KUV A;  2GU2 A;  1FNO A;  3DNS A;  4NSQ A;  4UCN A;  4AVA A;  2BO9 A;  1M4I A;  3W91 A;  1YR0 A;  3BLN A;  4M6I A;  1ZLH A;  3IU1 A;  3BI0 A;  1BLL E;  3B8G A;  4IHM A;  5GCN A;  2CNS A;  1NSA A;  3TTH A;  4P45 A;  4JZ0 A;  2QVP A;  4FWU A;  4QB9 A;  3ZJ0 A;  3D67 A;  3KI9 A;  2A4N A;  4KUA A;  4C2Z A;  3HUV A;  5J8C A;  4YFJ A;  2IL4 A;  2F7V A;  4ZBG A;  3S6H A;  3VAR A;  1VHO A;  5D29 A;  1YVO A;  2WPX A;  1Y9K A;  2PR8 A;  2GLF A;  8CPA A;  2OR4 A;  3CDX A;  3T8W A;  2GAN A;  1ARL A;  3CT9 A;  3TOA A;  2V77 A;  5LYF A;  1XFO A;  2V8V A;  1QSR A;  4H89 A;  1HDU A;  3FEC A;  1R43 A;  2ZEF A;  4NGT A;  4UBR A;  5AG5 A;  2BCO A;  2O53 A;  1LCP A;  2R98 A;  2G9D A;  3PRT A;  3W6X A;  3BXM A;  1P4N A;  5C88 A;  3G3S A;  2POK A;  1MK4 A;  3B7I A;  2PJA A;  3GKR A;  5JQ4 A;  3D66 A;  4MY3 A;  3FF3 A;  5IV0 A;  3R9G A;  5JM6 A;  4KVX A;  4ZGY B;  2Q44 A;  4YWY A;  2FXF A;  4HNW B;  5F47 A;  4RI1 A;  2HB6 A;  3DGV A;  1KWM A;  2ZED A;  3PB8 X;  4OP4 A;  4X8I A;  2Z11 A;  2YGW A;  4DJL A;  4IUS A;  2DPS A;  4M6G A;  1YW4 A;  2PJ1 A;  3FH4 A;  4YGO A;  3E0K A;  5CPA A;  1YLO A;  2Q7B A;  4Y49 B;  1PYT B;  2P0W A;  1IU8 A;  6CPA A;  2KCW A;  3NH4 A;  1FT7 A;  3FEE A;  2FL4 A;  3R95 A;  3VH9 A;  4MY0 A;  2PJ7 A;  4PXD A;  4ZY1 A;  3VAT A;  4A2Z A;  2HUZ A;  1KZF A;  1TF9 A;  2QEC A;  2EK9 A;  4XNH B;  4BD9 A;  2GRE A;  1LFW A;  3WT4 A;  3K9T A;  1IY7 A;  1Z4E A;  4B10 A;  2JDC A;  4PK2 A;  5CNP A;  3S9M A;  1YX0 A;  4KOT A;  4KZT A;  4CAE A;  1IYK A;  1M4D A;  3RBU A;  3D2M A;  3CXS A;  4JWP A;  3ZZI A;  5D8N A;  4MXU A;  4I49 A;  2Q4V A;  2XEI A;  4FD6 A;  4OC2 A;  2CTC A;  3PEI A;  4EWT A;  2Y0M A;  4R87 A;  3H8E A;  4KOW A;  5LRK A;  4JD6 A;  3PP9 A;  2CTB A;  3A9L A;  4ZI6 A;  1PU9 A;  2PE3 A;  5EMI A;  1M4L A;  1Q2Y A;  1IIC A;  5E96 A;  3MN8 A;  2PRQ A;  2QML A;  1ON0 A;  5F49 A;  1NMT A;  4M6H A;  3SXN A;  4OAD A;  2FIW A;  1M1D A;  2G3T A;  2Z3P A;  3D7D A;  3FYN A;  1Y7R A;  4MFL A;  4OC4 A;  3VWE A;  1UFH A;  3SJE A;  2R8V A;  4PSX A;  1WK4 A;  1XRY A;  1ELL P;  4KOY A;  4UCP A;  4ZX8 A;  4B6Z A;  3BJ8 A;  1YW6 A;  2AFS A;  2EBJ A;  1CBX A;  2JDD A;  3D7F A;  3R1K A;  1QSN A;  4HNY B;  4MCQ A;  1SQH A;  4A95 A;  2AE6 A;  2VI7 A;  3HLP A;  4P4F A;  1XF8 A;  7CPA A;  3GIU A;  2DEA A;  5JPH A;  2CIJ A;  4MFK A;  1EE3 P;  3NH5 A;  1WWZ A;  3TT2 A;  4ZYQ A;  2CY2 A;  2PJ9 A;  5IB9 A;  2O4H A;  1TKJ A;  2B4B A;  4ORF A;  4E0A A;  2J8R A;  3R96 A;  3TC8 A;  3S9N A;  1F2O A;  1XEB A;  3NH8 A;  4KOR A;  4X3R A;  1Z8L A;  3F8K A;  3DDD A;  3SJG A;  1VGY A;  3FXT A;  1ZG9 A;  3SI0 A;  3V7Z A;  5KTC A;  2PIZ A;  3B3C A;  4CAW A;  4X5K A;  4UIB A;  2Z3K A;  2FE7 A;  3T9Y A;  3CXQ A;  2ZEP A;  4OAE A;  2YNC A;  3I9S A;  4KLV A;  4AG7 A;  3LWU A;  2EWB A;  3QAH A;  3KKW A;  1TF8 A;  3SXO A;  3KR4 A;  3QAY A;  4MI4 A;  2PC1 A;  4C68 A;  4Z65 A;  1QQ9 A;  3QB8 A;  2OU2 A;  4CGM A;  2BEI A;  4JYW A;  2PJ6 A;  1Q2D A;  1VKC A;  5IB0 A;  4MHY A;  3D3S A;  2ZXV A;  2C6G A;  2X7B A;  2I00 A;  4FD5 A;  1RXT A;  3DSB A;  4LQG A;  2VZZ A;  4GM5 A;  4MHP A;  1CM0 A;  4NJR A;  5DWM A;  2YNE A;  4MCP A;  1S7L A;  2BL1 A;  4MJ8 A;  3H8G A;  1CX8 A;  2ZEN A;  4U5Y A;  3K9U A;  2V8H A;  2HV2 A;  2PCU A;  2B5G B;  3TO9 A;  2GIV A;  4WJB A;  1NSL A;  3TOB A;  3IEH A;  5K8O A;  1BOB A;  3DR6 A;  3IWE A;  1VIX A;  1K4J A;  3NA6 A;  4IAV A;  4KSF A;  2AFZ A;  2IQ6 A;  4ONU A;  5HVG A;  1XIX A;  1Y0Y A;  1QMU A;  2OZH A;  3B35 A;  4MCR A;  3PGP A;  1QST A;  3QNV A;  2ZOF A;  2ANP A;  4EVY A;  2C27 A;  2C6P A;  3D2P A;  3D4U A;  2VL1 A;  3BJ7 A;  4H6Z A;  4CYO A;  2D4O A;  3KQZ A;  2PJB A;  3FNC A;  1BPM A;  3IU2 A;  1B87 A;  5DWN A;  5LRG A;  2C6C A;  3LAC A;  4GS4 A;  3SJX A;  3EO4 A;  2OB0 A;  5FVJ A;  3EY5 A;  4OID A;  4OC5 A;  4LQ6 A;  2Z3L A;  1B6B A;  1S7N A;  2WZN A;  4A39 A;  2DF5 A;  2PSW A;  1BPN A;  4CGO A;  1DTD A;  4HKF A;  4XPD B;  3JRU A;  1IID A;  1J4J A;  3KHZ A;  3BHX A;  2C1C A;  3G8W A;  2EVN A;  4P4J A;  4B5P B;  5BWA B;  2PDO A;  3WAB A;  4A32 A;  1NE9 A;  4UIA A;  3VWD A;  2OZG A;  5CBM A;  2FVG A;  1V0C A;  4UEE A;  4JXQ A;  2Q43 A;  1ZG7 A;  2FS5 A;  1JQG A;  2I79 A;  4OC1 A;  4R7M A;  1QSO A;  4W9Y A;  2ZW5 A;  5KTD A;  1CPS A;  2F8H A;  1GYT A;  4NJQ A;  2PJ2 A;  4P4E A;  4UFX A;  4FAI A;  3B3W A;  3ISZ A;  3LD2 A;  2PR1 A;  3S6G A;  3N5F A;  4B5O A;  2B3U A;  4BIN A;  1GHE A;  2CF4 A;  4UCM A;  4KOV A;  5HMN A;  5AGE A;  2AFO A;  3L2N A;  4A37 A;  3GY9 A;  4B14 A;  2K5T A;  3SI1 A;  1Y9W A;  1Z2L A;  1XJO A;  2VXK A;  4IF5 A;  3NE8 A;  3RNZ A;  4NF1 A;  4PXC A;  4A31 A;  5AG4 A;  1RTQ A;  3TE4 A;  4R9M A;  5LYI A;  2AFX A;  2DPT A;  1YQE A;  1LAP A;  2BSW A;  3CZX A;  2BOA A;  3H8F A;  1IGB A;  4NEX A;  1IB1 E;  3P2F A;  4CRY B;  4E8O A;  4MFZ A;  1OBR A;  3NFZ A;  1M4G A;  2P6G A;  3RYO A;  3F5B A;  3FED A;  4UFV A;  4A38 A;  1YLE A;  3TFY A;  4FD7 A;  3R9E A;  5JH9 A;  1Q2C A;  2PVV A;  3S9L A;  1Q7L A;  3D68 A;  3PZJ A;  4NGM A;  5G21 A;  3F0A A;  4HNX B;  5G22 A;  3B3V A;  3GB0 A;  5HXD A;  1ELM P;  1S7F A;  3EFA A;  3FIX A;  4MHD A;  2Z3O A;  4PXB A;  3IC1 A;  2YNC C;  2RB7 A;  3PB9 X;  4CGP A;  5A28 A;  3LOD A;  4CGN A;  1I12 A;  2V8G A;  3B3T A;  4KOU A;  2G3A A;  3WC7 A;  4H2K A;  2Q7S A;  3I3G A;  3NE7 A;  4MFJ A;  4OLL A;  5JGF A;  1VHS A;  2QYV A;  3H5Z A;  1S3Z A;  4JJX A;  4NGR A;  1A2Z A;  5KTA A;  1U6M A;  5HVF A;  5AG7 A;  4FD4 A;  5THW A;  4P4B A;  2H5M A;  5LYD A;  2XEJ A;  3I1U A;  1R57 A;  3IWG A;  5G1Z A;  2GFQ A;  4PQA A;  1IOF A;  2CXA A;  2JBK A;  4UF4 A;  1ZLI A;  4KVM E;  4CYQ A;  1LAM A;  3FB3 A;  2JBJ A;  2PVW A;  4R3L A;  1TXR A;  3CPX A;  4RN7 A;  2NSM A;  2PJ5 A;  3JTK A;  4P4D A;  3IJ3 A;  3C26 A;  3N7Z A;  4CRZ B;  3IO1 A;  2QIR A;  2Z3N A;  2QJ8 A;  4PPZ A;  3IGR A;  4UEF A;  4UEZ A;  2Q04 A;  3OWC A;  4CYP A;  4F9U A;  4QBJ A;  1CPX A;  3R9F A;  4LX9 A;  4EME A;  4P6Y A;  2Z0Z A;  2ARH A;  3S6K A;  3WC6 A;  4C7I A;  4UWJ A;  2WUU A;  2VQY A;  2PJ3 A;  4U9Z A;  3RO0 A;  4L89 A;  4PV6 A;  1TKF A;  2R7H A;  2FSR A;  3PFE A;  1XMB A;  4FBE A;  4MBU A;  3TX8 A;  2YND A;  3WC5 A;  4NCZ A;  5C82 A;  1UWY A;  3IFE A;  4R8F A;  5K8N A;  4ZY2 A;  2ZPA A;  2B58 A;  2WPW A;  4DNC A;  2VZY A;  3GYA A;  1S5K A;  1S7K A;  2FIA A;  2ZOG A;  3FMC A;  4KOS A;  1XE4 A;  4Q38 A;  2ZW4 A;  3H4Q A;  4ZX9 A;  1Z8X A;  2PJ8 A;  3PB6 X;  4MFQ A;  3KQX A;  3T90 A;  4CS0 B;  1R3N A;  1BO4 A;  4F0Y A;  4AB7 A;  4JLY A;  1IOI A;  1CP7 A;  1XOV A;  1ZG8 A;  2AFM A;  2FCK A;  4KLW A;  4NGP A;  2Q4Z A;  4OC3 A;  2OOT A;  2ABZ A;  2FT0 A;  4MHN A;  3RAM A;  2G0B A;  1LAN A;  4IK2 A;  4OKO A;  2JEW A;  2P6E A;  2Q51 A;  2ATR A;  4HPS A;  4A33 A;  3FBU A;  1YSJ A;  1I1D A;  3FJU A;  4L8A A;  4LUA A;  1RO5 A;  2WYR A;  4DUK A;  4QUS A;  2XEG A;  5LYL A;  3FX6 A;  5HVH A;  1F2P A;  3KR5 A;  4F9V A;  1M44 A;  3SJF A;  1Z4R A;  4II9 A;  4JXR A;  5K8P A;  2PJ0 A;  4ONW A;  3BI1 A;  1Y0R A;  2OH1 A;  3IWW A;  2EK8 A; 
#chains in the Genus database with same CATH homology
 1YVK A;  1S60 A;  4J3G A;  1ZO0 A;  4NXY A;  2JLM A;  2ZW7 A;  1OZP A;  1KUX A;  1I21 A;  4F6A A;  4AVB A;  4C2Y A;  4B13 A;  2REF A;  3CXP A;  1QSM A;  4E2A A;  3SHP A;  3EXN A;  3FRM A;  3WR7 A;  1KUY A;  3D8P A;  5EBV A;  2Q0Y A;  3S6F A;  5IX3 A;  4QC6 A;  4BMH A;  4XPD C;  3JVN A;  4XPK A;  1YRE A;  1L0C A;  4PSW A;  2B4D B;  1N71 A;  4M3S A;  4M85 A;  5F46 A;  2REE A;  2B5G A;  1XMT A;  4K30 A;  2B3V A;  3UY5 A;  4Y49 C;  4CYN A;  2NMT A;  4A30 A;  4CAX A;  4C7H A;  4RS2 A;  4KOX A;  2ZW6 A;  4CGL A;  5A27 A;  2Z10 A;  3JUW A;  4C2X A;  4KUB A;  2PQ8 A;  4CGP A;  4PK3 A;  4XNH C;  2BUE A;  2CNT A;  3DR8 A;  4MFP A;  5J8F A;  5ISV A;  2F5I A;  5G20 A;  4R3K A;  2GE3 A;  1MJB A;  2OZU A;  2Q4Y A;  2EUI A;  2R1I A;  4YRH A;  4AG9 A;  1LRZ A;  5I0C A;  4UWI A;  2VEZ A;  4CAV A;  1MJA A;  3V8I A;  5F48 A;  2J8N A;  4B5P A;  4XPL A;  2J8M A;  4F0X A;  3EC4 A;  1TIQ A;  2HQY A;  4KSA A;  4BBH A;  3TO6 A;  4KS9 A;  2AJ6 A;  5EC4 A;  4CAF A;  1YGH A;  4B12 A;  1P0H A;  4KVO E;  1YK3 A;  5H84 A;  4AVC A;  5H86 A;  1Z9U A;  3W6S A;  4R57 A;  1PUA A;  2VBQ A;  2WSA A;  1FY7 A;  4UFW A;  5AG6 A;  4Q36 A;  2CNM A;  2JEV A;  2DXQ A;  4UA3 A;  2O28 A;  4B11 A;  4U9Y A;  1MJ9 A;  2Z3M A;  2PRB A;  3P2H A;  4QVT A;  4H6U A;  3TCV A;  1CJW A;  2P6F A;  5HH1 A;  2RC4 A;  2B4D A;  1IYL A;  2D4P A;  3TO7 A;  3MGD A;  1KUV A;  3DNS A;  4NSQ A;  4UCN A;  4AVA A;  1M4I A;  3W91 A;  1YR0 A;  3BLN A;  3IU1 A;  5GCN A;  3B8G A;  2CNS A;  3TTH A;  3ZJ0 A;  4QB9 A;  2A4N A;  4KUA A;  4C2Z A;  5J8C A;  4YFJ A;  2IL4 A;  4ZBG A;  3S6H A;  1YVO A;  2WPX A;  1Y9K A;  2PR8 A;  2GAN A;  3TOA A;  1QSR A;  4H89 A;  4UBR A;  5AG5 A;  2R98 A;  3W6X A;  1P4N A;  5C88 A;  3G3S A;  1MK4 A;  3GKR A;  5JQ4 A;  4MY3 A;  5IV0 A;  3R9G A;  4KVX A;  4ZGY B;  2Q44 A;  2FXF A;  4HNW B;  5F47 A;  4RI1 A;  2Z11 A;  2YGW A;  4IUS A;  2DPS A;  4YGO A;  3E0K A;  2Q7B A;  4Y49 B;  2P0W A;  2KCW A;  2FL4 A;  3R95 A;  4MY0 A;  4A2Z A;  2HUZ A;  1KZF A;  2QEC A;  4XNH B;  1Z4E A;  4B10 A;  2JDC A;  4PK2 A;  5CNP A;  1YX0 A;  4KOT A;  4KZT A;  4CAE A;  1IYK A;  1M4D A;  3D2M A;  3CXS A;  4JWP A;  3ZZI A;  4I49 A;  2Q4V A;  4FD6 A;  2Y0M A;  4R87 A;  4KOW A;  4JD6 A;  3PP9 A;  3A9L A;  1PU9 A;  1Q2Y A;  1IIC A;  5E96 A;  2QML A;  1ON0 A;  5F49 A;  1NMT A;  3SXN A;  4OAD A;  2FIW A;  1M1D A;  2G3T A;  2Z3P A;  3FYN A;  4MFL A;  1Y7R A;  3VWE A;  1UFH A;  2R8V A;  4PSX A;  1WK4 A;  4KOY A;  4UCP A;  3BJ8 A;  4HNY B;  2JDD A;  3R1K A;  1QSN A;  1SQH A;  4A95 A;  2AE6 A;  2VI7 A;  1XF8 A;  5JPH A;  4MFK A;  1WWZ A;  3TT2 A;  2CY2 A;  4E0A A;  2B4B A;  4ORF A;  2J8R A;  3R96 A;  1XEB A;  4KOR A;  3F8K A;  3DDD A;  3FXT A;  5KTC A;  4CAW A;  4X5K A;  2Z3K A;  2FE7 A;  3T9Y A;  3CXQ A;  4OAE A;  2YNC A;  3I9S A;  4KLV A;  4AG7 A;  3QAH A;  3KKW A;  3SXO A;  4MI4 A;  2PC1 A;  4C68 A;  4CGM A;  3QB8 A;  2OU2 A;  2BEI A;  1Q2D A;  1VKC A;  5IB0 A;  3D3S A;  2ZXV A;  2X7B A;  2I00 A;  4FD5 A;  1RXT A;  3DSB A;  2VZZ A;  1CM0 A;  5DWM A;  2YNE A;  1S7L A;  2BL1 A;  4MJ8 A;  4U5Y A;  3K9U A;  2HV2 A;  2B5G B;  3TO9 A;  2GIV A;  1NSL A;  3TOB A;  1BOB A;  3DR6 A;  3IWE A;  1K4J A;  4KSF A;  4ONU A;  1XIX A;  2OZH A;  3PGP A;  1QST A;  4EVY A;  2C27 A;  3D2P A;  3BJ7 A;  4H6Z A;  4CYO A;  2D4O A;  3FNC A;  5DWN A;  3IU2 A;  1B87 A;  4GS4 A;  3EO4 A;  2OB0 A;  5FVJ A;  3EY5 A;  2Z3L A;  1B6B A;  1S7N A;  2PSW A;  4CGO A;  4XPD B;  4HKF A;  1IID A;  1J4J A;  3G8W A;  2EVN A;  4B5P B;  5BWA B;  2PDO A;  4A32 A;  1NE9 A;  3VWD A;  2OZG A;  1V0C A;  4JXQ A;  2FS5 A;  2I79 A;  1QSO A;  2ZW5 A;  5KTD A;  4UFX A;  3LD2 A;  2PR1 A;  3S6G A;  4B5O A;  2B3U A;  1GHE A;  4UCM A;  4KOV A;  5HMN A;  5AGE A;  3GY9 A;  4B14 A;  2K5T A;  1Y9W A;  2VXK A;  4IF5 A;  4NF1 A;  4A31 A;  5AG4 A;  3TE4 A;  4R9M A;  2BSW A;  2DPT A;  4NEX A;  1IB1 E;  3P2F A;  4CRY B;  4E8O A;  4MFZ A;  1M4G A;  2P6G A;  3RYO A;  3F5B A;  4UFV A;  1YLE A;  3TFY A;  4FD7 A;  3R9E A;  1Q2C A;  3PZJ A;  5G21 A;  3F0A A;  4HNX B;  5G22 A;  1S7F A;  3EFA A;  3FIX A;  4MHD A;  2Z3O A;  2YNC C;  5A28 A;  3LOD A;  4CGN A;  1I12 A;  4KOU A;  2G3A A;  3I3G A;  3NE7 A;  4MFJ A;  4OLL A;  1VHS A;  3H5Z A;  1S3Z A;  4JJX A;  5KTA A;  1U6M A;  5AG7 A;  4FD4 A;  2H5M A;  3IWG A;  1R57 A;  5G1Z A;  2CXA A;  4KVM E;  4CYQ A;  3FB3 A;  4R3L A;  3JTK A;  3C26 A;  3N7Z A;  4CRZ B;  2QIR A;  2Z3N A;  3IGR A;  2Q04 A;  3OWC A;  4CYP A;  4QBJ A;  3R9F A;  4LX9 A;  2Z0Z A;  2ARH A;  3S6K A;  4C7I A;  4UWJ A;  2WUU A;  2VQY A;  4U9Z A;  4L89 A;  4PV6 A;  2R7H A;  2FSR A;  4MBU A;  2YND A;  5C82 A;  4NCZ A;  2ZPA A;  2B58 A;  2WPW A;  4DNC A;  2VZY A;  3GYA A;  1S5K A;  1S7K A;  2FIA A;  4KOS A;  1XE4 A;  4Q38 A;  2ZW4 A;  3H4Q A;  4MFQ A;  3T90 A;  4CS0 B;  1BO4 A;  4F0Y A;  4AB7 A;  4JLY A;  2FCK A;  4KLW A;  2FT0 A;  2G0B A;  2P6E A;  2ATR A;  4A33 A;  3FBU A;  1I1D A;  4L8A A;  4LUA A;  1RO5 A;  4QUS A;  1M44 A;  1Z4R A;  4II9 A;  4JXR A;  2OH1 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...