4KLVA

Crystal structure of a gnat superfamily acetyltransferase pa4794 in complex with 4-methylumbelliferyl phosphate
Total Genus 42
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
42
sequence length
159
structure length
159
Chain Sequence
MQLSHRPAETGDLETVAGFPQDRDELFYCYPKAIWPFSVAQLAAAIAERRGSTVAVHDGQVLGFANFYQWQHGDFCALGNMMVAPAARGLGVARYLIGVMENLAREQYKARLMKISCFNANAAGLLLYTQLGYQPRAIAERHDPDGRRVALIQMDKPLE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Uncharacterized protein
publication title Structural, Functional, and Inhibition Studies of a Gcn5-related N-Acetyltransferase (GNAT) Superfamily Protein PA4794: A NEW C-TERMINAL LYSINE PROTEIN ACETYLTRANSFERASE FROM PSEUDOMONAS AERUGINOSA.
pubmed doi rcsb
source organism Pseudomonas aeruginosa
molecule tags Transferase
total genus 42
structure length 159
sequence length 159
ec nomenclature
pdb deposition date 2013-05-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00583 Acetyltransf_1 Acetyltransferase (GNAT) family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.630.30 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Aminopeptidase 4klvA00
2P6GA 1YVOA 4JLYA 1Y7RA 3B8GA 4FD5A 3S6FA 2Y0MA 2VZYA 4ONUA 1CM0A 4RS2A 2ATRA 3EC4A 3FIXA 5J8FA 2FXFA 1YLEA 5EC4A 2KCWA 5C88A 3D8PA 4CAXA 2Z0ZA 4H6ZA 4AG7A 4QBJA 4NCZA 4DNCA 4U9ZA 1MK4A 2OU2A 4YGOA 4OAEA 3DR6A 2K5TA 2OZUA 2B3VA 3TO7A 1FY7A 2REFA 2B3UA 3TO9A 4KUBA 5F48A 1B6BA 4LUAA 4FD6A 2BUEA 2OZGA 1P4NA 3KKWA 2EVNA 1N71A 1KUXA 1R57A 4MJ8A 1PUAA 3R9GA 4HNYB 4B5PA 2Q04A 2EUIA 2GIVA 5H84A 1I21A 1S3ZA 3PGPA 3ZZIA 2ZW7A 4L8AA 3JUWA 4L89A 1XMTA 5F49A 5CNPA 1Q2YA 2VI7A 2C27A 2GANA 1QSMA 1Z4EA 4Y49B 1MJ9A 1IB1E 2Z10A 2VZZA 3VWEA 4M85A 4U5YA 4UWJA 3ZJ0A 3MGDA 2FE7A 4EVYA 3R9EA 4QVTA 2B4DA 3N7ZA 2I79A 3GKRA 2QIRA 4NXYA 3QAHA 1WK4A 3T9YA 2OH1A 4PV6A 1IYLA 4OADA 3T90A 2H5MA 1M4GA 1S60A 3EFAA 2F5IA 2BSWA 4M3SA 3W6XA 4Y49C 2WPXA 1YX0A 1I1DA 2GE3A 2CNMA 3DNSA 2QMLA 4MY0A 4U9YA 4CAWA 1XIXA 1LRZA 3BJ7A 2FIAA 3FB3A 4JWPA 4AB7A 5KTAA 4B5PB 4CS0B 3EO4A 1J4JA 3W6SA 1MJBA 3OWCA 4OLLA 3R9FA 1V0CA 1L0CA 2HV2A 1YVKA 2VEZA 4ORFA 3QB8A 4KZTA 3D2PA 5C82A 4XPDC 4HKFA 2Q4YA 4UA3A 3UY5A 3P2FA 4R87A 2QECA 1YK3A 4MHDA 1VKCA 3SXNA 2ZW4A 4FD4A 3TT2A 2B4DB 2ZW5A 2Z11A 2J8NA 1S7FA 2ZXVA 4MY3A 2ZPAA 2P6EA 1UFHA 4KOXA 3I9SA 2P0WA 4XNHB 5IB0A 4UWIA 2J8MA 1TIQA 2NMTA 2R8VA 3S6KA 2IL4A 3F0AA 2I00A 3IGRA 4NEXA 4F0YA 5ISVA 4JJXA 3TTHA 3PP9A 2OZHA 4KVOE 4MBUA 2VQYA 2ZW6A 2BL1A 2JEVA 4YFJA 4RI1A 3DDDA 2G0BA 4XPKA 4AVAA 4KVME 3D3SA 3G8WA 4XNHC 1M4IA 1Z9UA 4YRHA 5DWMA 2CNSA 2PQ8A 4X5KA 3CXSA 2X7BA 1BO4A 4QC6A 4H6UA 1XF8A 4JXQA 2G3AA 4KOYA 4II9A 2VXKA 1GHEA 1S7KA 3SXOA 2JDDA 4R3LA 4E0AA 2FT0A 4KLVA 2Q0YA 4BMHA 4R3KA 5H86A 1P0HA 2FIWA 1S7NA 3G3SA 4PK3A 4JXRA 2D4OA 1NSLA 1MJAA 1IIDA 3LODA 3TOAA 3PZJA 4XPDB 3FYNA 1M4DA 2CY2A 2PDOA 2O28A 5JQ4A 2BEIA 3H4QA 1YREA 4B5OA 1S5KA 3RYOA 1RXTA 1B87A 2ARHA 3FNCA 3CXQA 4E8OA 5JPHA 5F47A 1KUYA 4AVBA 1QSOA 3FXTA 1BOBA 4R9MA 4F6AA 2A4NA 2RC4A 4QUSA 5J8CA 5I0CA 2FSRA 1M1DA 1Z4RA 1XEBA 2HQYA 3C26A 5KTCA 5FVJA 2HUZA 4IF5A 4I49A 3EY5A 5GCNA 3NE7A 1VHSA 4IUSA 4KUAA 3R95A 4K30A 4KOWA 3F5BA 3BJ8A 2Q44A 4JD6A 2VBQA 2PRBA 3DR8A 4HNXB 1YR0A 2JDCA 2R1IA 1YGHA 1Y9KA 3F8KA 4KLWA 1SQHA 3R1KA 2R98A 5EBVA 2P6FA 2Q4VA 4E2AA 3DSBA 3LD2A 4PSXA 3R96A 4CAVA 1CJWA 5HMNA 2AJ6A 4NSQA 4KOVA 1M44A 3BLNA 4PSWA 4H89A 2JLMA 3EXNA 4LX9A 2FCKA 2B5GA 4KOTA 4KOSA 2FL4A 4UBRA 3V8IA 2R7HA 1QSNA 2WPWA 4QB9A 3SHPA 4NF1A 3TFYA 1QSRA 3TOBA 3S6HA 1NE9A 1U6MA 5DWNA 4KVXA 5IV0A 1Q2DA 3WR7A 1WWZA 1NMTA 1K4JA 2PR8A 4XPLA 5HH1A 2J8RA 3FBUA 3FRMA 1KZFA 3TO6A 2PR1A 3JVNA 2AE6A 5IX3A 4CRYB 3I3GA 1IYKA 2G3TA 2B4BA 3E0KA 3P2HA 1PU9A 2Q7BA 4HNWB 1I12A 1OZPA 4R57A 1ON0A 4J3GA 4KOUA 4CRZB 3VWDA 4AVCA 2CNTA 2D4PA 2DXQA 2PSWA 1Y9WA 4GS4A 3W91A 3S6GA 2REEA 3GYAA 3IWGA 3K9UA 1S7LA 4FD7A 5KTDA 3TCVA 1XE4A 2OB0A 4ZBGA 1IICA 4MI4A 4PK2A 3CXPA 3GY9A 2B5GB 3D2MA 5F46A 3TE4A 1RO5A 2PC1A 1Q2CA 5E96A 4AG9A 1QSTA 4KORA 2FS5A 2B58A 1KUVA
chains in the Genus database with same CATH superfamily
3SI2A 4P10A 2P6GA 5A27A 3RO0A 4EMEA 1XOVA 1YVOA 4JLYA 1LAPA 1Y7RA 3B8GA 4A39A 4FD5A 3IWWA 1H8LA 3S6FA 3IC1A 2Y0MA 4OKOA 3B35A 2VZYA 4ONUA 5K8PA 1AYEA 4P6YA 3ISXA 1CM0A 4RS2A 1PYTB 2ATRA 4Z65A 3EC4A 2PJ5A 3FIXA 2QYVA 4NJRA 5J8FA 2PJ6A 2FXFA 1YLEA 4C2XA 1TKHA 1EE3P 5EC4A 4AXVA 2AFWA 2KCWA 5C88A 4B13A 3D8PA 2PJ0A 4CAXA 2Z0ZA 4H6ZA 4BINA 4AG7A 4QBJA 4NCZA 4DNCA 4U9ZA 1MK4A 2OU2A 4OC0A 4YGOA 4MCSA 2FVGA 4OAEA 3DR6A 3S9LA 2K5TA 2OZUA 2B3VA 2Z3LA 3B2YA 1F2OA 3TO7A 1FY7A 5D8NA 2REFA 4NFRA 4NGQA 1Z2LA 2B3UA 3TO9A 3WT4A 4KUBA 2AFZA 5F48A 1IOIA 1B6BA 2NSMA 4LUAA 3B3TA 4FD6A 1ZG7A 2BUEA 2OZGA 1P4NA 3KKWA 2EVNA 3H8GA 1N71A 2C1CA 1KUXA 3KASA 1R57A 5I4MA 4MHZA 3IJ3A 1PUAA 4MJ8A 1CPSA 3R9GA 4HNYB 4B5PA 1TKFA 3PB7X 2Q04A 2EUIA 2GIVA 4X2TA 5H84A 3S9NA 1I21A 2XEFA 4CGOA 4R7MA 4NGMA 1S3ZA 3PGPA 4UEFA 2C6PA 2ZW7A 4L8AA 3LACA 3ZZIA 5K8MA 3JUWA 4L89A 1AUGA 1XMTA 5F49A 4C7HA 5CNPA 2YGWA 1CP6A 1Q2YA 2VI7A 4B12A 1TKJA 2C27A 4CYPA 2AFXA 2GANA 4P4EA 1QSMA 2CXAA 4MFJA 1Z4EA 4Y49B 1MJ9A 1IB1E 2Z10A 4GM5A 2VZZA 1JQGA 2O53A 1IU8A 1F2PA 2PJ9A 2JBJA 4M85A 2OOTA 3VWEA 2PJBA 4U5YA 4UWJA 3SI1A 3ZJ0A 4A94A 3MGDA 2FE7A 4EVYA 1BLLE 1VIXA 1Y0RA 3R9EA 4QVTA 2POKA 2B4DA 2RB7A 4WJBA 3DGVA 2BO9A 3N7ZA 1CP7A 2ZEFA 4K3NA 2I79A 2IQ6A 2AFUA 3GKRA 3KZWA 2QIRA 4NXYA 3QAHA 5EMIA 2PJ3A 1WK4A 3T9YA 2OH1A 4PV6A 1IYLA 4OADA 3T8WA 3T90A 2H5MA 2NYQA 4OIWA 5AG4A 4MRIA 1M4GA 3PFEA 3NE8A 4ZY0A 1S60A 1QMUA 3EFAA 2F5IA 3IIBA 2BSWA 3D7GA 1F57A 4M3SA 3W6XA 1ELLP 4A2ZA 2DEAA 2CTCA 2QVPA 3KGQA 3GLJA 1XFOA 4Y49C 4A95A 2WPXA 4A33A 1YX0A 1I1DA 4CGMA 3N5FA 4PXDA 2GE3A 2CNMA 3NFZA 4RN7A 5C82A 7CPAA 2EBJA 4M6HA 3DNSA 2QMLA 3H8FA 4MY0A 4U9YA 3PB4X 4CAWA 4A32A 2RFHA 1XIXA 1LRZA 3BJ7A 4R8FA 2FIAA 2WSAA 4B11A 3FB3A 3VATA 2EWBA 4JWPA 5BWAB 4AB7A 1LFWA 5KTAA 1Q7LA 4M6IA 4B5PB 4CS0B 3EO4A 1J4JA 2PJCA 1RTQA 2PVWA 4ZY2A 3BHXA 1TXRA 3W6SA 3B3CA 4ZX8A 1MJBA 5CBMA 4X3RA 5LRKA 4PXEA 2Q43A 3JRUA 3OWCA 4OLLA 3R9FA 1OBRA 1V0CA 1L0CA 3KHXA 2HV2A 2XEIA 4F0XA 2BOAA 1YVKA 4MHNA 2VEZA 2V8HA 3QB8A 4ORFA 4UCNA 3A9LA 3D2PA 4H2KA 4KZTA 1Z8XA 4XPDC 4C68A 4HKFA 4FAIA 2Q4YA 4UA3A 3UY5A 4MFKA 3P2FA 3S9MA 3KI9A 4MCRA 2QECA 4R87A 1YK3A 4MHDA 2GLJA 2J9AA 3D7HA 4JZ0A 1VKCA 1M4LA 3D7FA 5G22A 3SXNA 2PJ4A 4NJQA 1DTDA 2ZW4A 3B3SA 4FD4A 1BPMA 3TT2A 4CAEA 4P4IA 2B4DB 2AFOA 3CPXA 4BBHA 1Z8LA 2ABZA 2ZW5A 4KSIA 2F7VA 2Z11A 2J8NA 4NGTA 1S7FA 5LRJA 2ZXVA 4MY3A 4C2YA 1GYTA 2ZPAA 2ZOGA 2P6EA 5LYLA 1UFHA 2PJ2A 2I3CA 4KOXA 1IGBA 2HC9A 4EWTA 3WC7A 2PJ8A 3I9SA 4MMOA 1YQEA 4ONWA 2P0WA 4XNHB 5IB0A 2ZEEA 4UWIA 2J8MA 1TIQA 2NMTA 1PCAA 2R8VA 3S6KA 2IL4A 2WYRA 3F0AA 5LYIA 2F8HA 2I00A 4ZYQA 4C2ZA 1YW4A 2CTBA 4UIAA 3IGRA 1VGYA 3QAYA 2AFMA 4NEXA 3VARA 4F0YA 5ISVA 4JJXA 3TTHA 3PP9A 1FT7A 3FF3A 3JTKA 2OZHA 4KVOE 4MBUA 3B7IA 3D4UA 2G9DA 3NH8A 2PIZA 2VQYA 2ZW6A 4UEZA 1ARLA 2EO8A 4P4JA 2BL1A 3D67A 2JEVA 3PBEA 4YFJA 4RI1A 4MHPA 3DDDA 4NGRA 2G0BA 4WWVA 4XPKA 4AVAA 4KVME 3D3SA 3G8WA 2ANPA 4UEEA 4XNHC 2ZEHA 4OC1A 1M4IA 3V38A 2XEJA 2O4HA 1ARMA 1Z9UA 4G1PA 2CIJA 4NGNA 4UCPA 4YRHA 3ISZA 4M6GA 2BCOA 4FWUA 5DWMA 3I1UA 2CNSA 2PQ8A 4X5KA 1ZO0A 3CXSA 2X7BA 1BO4A 4IK2A 4QC6A 4KSFA 4NGSA 3B3VA 2DPSA 4H6UA 1XF8A 4MFQA 4JXQA 4OC3A 4OC4A 2G3AA 1HDQA 4KOYA 2EK8A 4II9A 3RAMA 2VXKA 1GHEA 5G21A 1S7KA 3SXOA 2JDDA 4R3LA 4CGLA 1IOFA 2CF4A 1LAMA 4RUHA 4KS9A 3B3WA 2Q4ZA 4B6ZA 4CPAA 2DF5A 2FT0A 3H8EA 4E0AA 4KLVA 2Q0YA 4BMHA 3IU2A 2YNCA 2PIYA 3DLJA 4R3KA 4UIBA 5H86A 3MN8A 1P0HA 1Y7EA 5JGFA 5HVHA 2FIWA 5HVGA 1S7NA 3G3SA 4PK3A 4JXRA 4OC5A 4DUKA 2ODFA 5JH9A 3RBUA 2D4OA 1NSLA 4A30A 3IWEA 1Z5RA 4IAVA 4P44A 1ELMP 4OMEA 2ZENA 1MJAA 1IIDA 1X10A 1ZG9A 4UFWA 4CGPA 4B10A 1LCPA 1Z8TA 2JBKA 3LODA 3PZJA 1CPXA 3TOAA 4XPDB 3FYNA 1M4DA 2PCUA 2CY2A 2PDOA 3BI0A 2O28A 3CZXA 3D7DA 3SJEA 5JQ4A 2GFQA 2BEIA 3PBBA 3H4QA 1YREA 2V8DA 4B5OA 1BPNA 3HLPA 1S5KA 4YU9A 3IU1A 1YLOA 1VHOA 1RXTA 1B87A 3RYOA 2ARHA 4C7IA 1A2ZA 3FNCA 3CXQA 4LQGA 1LOKA 1IY7A 1XBUA 4E8OA 5JPHA 5F47A 4F9UA 4MFPA 1R3NA 1KUYA 4LQ6A 4AVBA 1DE4C 1QSOA 5AGEA 3BXMA 3FXTA 3D68A 1BOBA 4CGNA 2Z3OA 1BAVA 4R9MA 5AG7A 3LWUA 3NA6A 4F6AA 3KQXA 5HVFA 2A4NA 4R76A 2RC4A 2VL1A 3GUXA 3K2KA 4P4DA 4QUSA 4DYOA 1KWMA 2FSRA 5I0CA 4B14A 5J8CA 1M1DA 1Z4RA 1XEBA 2HQYA 3C26A 4MCPA 4Q38A 3V7ZA 1CX8A 4Q7AA 5KTCA 5AG6A 2ZELA 3FH4A 4HPSA 4PXBA 5LRGA 3BI1A 3KL9A 4GXHA 4NGPA 5FVJA 4A38A 4OP4A 3FEDA 4OIDA 2HUZA 2PRQA 4IF5A 2ZEOA 1HEEA 3CDXA 1CG2A 4I49A 3EY5A 5GCNA 3NE7A 1VHSA 1XMBA 3QNVA 3PB8X 4IUSA 4KUAA 3PB6X 3R95A 4K30A 1X12A 1NSAA 1ZLIA 1TF8A 1YW6A 3HUVA 1CBXA 4KOWA 3K9TA 2PE3A 5DS0A 4UFXA 2Z3KA 4Q36A 3PFOA 2IMOA 5LYDA 2JEWA 3F5BA 3KHZA 4DJLA 2HB6A 2C6CA 4X8IA 3BJ8A 2Q44A 1UWYA 3NH4A 4JD6A 5ELYA 3SI0A 3SJFA 4CAFA 2VBQA 2PJ7A 1XJOA 5A28A 2PRBA 3DR8A 4W9YA 4HNXB 1YR0A 4ZX9A 3KR4A 2JDCA 2R1IA 3MRUA 4P4BA 1YGHA 3IFEA 1AMPA 2PJ1A 3GIUA 2YNCC 1Y9KA 2Z3PA 2ZEMA 3F8KA 2Z3NA 3GB0A 4KLWA 1SQHA 2GU2A 3R1KA 4ZGYB 2R98A 5EBVA 2P6FA 2Q4VA 4E2AA 3DSBA 2GLFA 3WC5A 3LD2A 2PJAA 4CYQA 4MFZA 3RNZA 3FEEA 4PSXA 4ZI6A 1JWQA 3R96A 3PRTA 3TX8A 4CAVA 5JM6A 1CJWA 2ZEGA 5HMNA 3D66A 2AJ6A 3KQZA 4R6TA 4NSQA 5AG5A 3WABA 4KOVA 4KSAA 1M44A 2EK9A 3BLNA 4P4FA 4PSWA 4H89A 2JLMA 5THWA 2WUUA 3EXNA 3PEIA 3FECA 4LX9A 2FCKA 2B5GA 2Z3MA 1FNOA 2OR4A 4CYOA 4KOTA 4KOSA 2Q51A 3NH5A 2FL4A 4UBRA 4JYWA 5CPAA 3H5ZA 5K8OA 1QQ9A 3V8IA 4PXCA 1VHEA 5HXDA 2R7HA 1QSNA 1ZG8A 1Y0YA 2WPWA 4QB9A 3SHPA 4O23A 1ZLHA 4NF1A 3TFYA 1QSRA 3TOBA 3S6HA 1NE9A 1U6MA 5IB9A 5DWNA 4KVXA 4UCMA 1R43A 4TWEA 5IV0A 5K8NA 2V77A 4FUUA 1Q2DA 4PPZA 3WR7A 4MCQA 1WWZA 3L2NA 1NMTA 1K4JA 1XRYA 2PR8A 4XPLA 5HH1A 2J8RA 3FBUA 3FRMA 4TNUA 1KZFA 2V8VA 2AFSA 2XEGA 2WZNA 2YNDA 2PR1A 3TO6A 4FBEA 3TC8A 4P45A 4A37A 3JVNA 2AE6A 3SJGA 2ZOFA 3WC6A 1YMEA 5IX3A 4F9VA 4MFLA 3IEHA 2V8GA 4CRYB 3I3GA 6CPAA 4MHYA 1IYKA 2G3TA 2B4BA 3E0KA 1TF9A 2IJZA 5LYFA 1YSJA 3P2HA 1PU9A 2Q7BA 4HNWB 1I12A 1OZPA 4R57A 3FJUA 1ON0A 3FMCA 8CPAA 4J3GA 3FVLA 4KOUA 4UFVA 4CRZB 2ZEPA 3IO1A 3SJXA 1HDUA 3PB9X 3VWDA 4AVCA 2GREA 2CNTA 2D4PA 2DXQA 2PSWA 4UF4A 4F8ZA 1Y9WA 2Q7SA 4GS4A 3W91A 3S6GA 2REEA 3KR5A 4YWYA 4ZY1A 3GYAA 3IWGA 3K9UA 5G1ZA 1S7LA 2PVVA 3VH9A 2C6GA 4BD9A 4FD7A 5KTDA 5G20A 3TCVA 1XE4A 2ZEDA 4A31A 2OB0A 3CPAA 2QJ8A 3FX6A 5F09A 4ZBGA 1IICA 1LANA 2DPTA 4MXUA 4CYNA 4MI4A 4PK2A 4OC2A 5D29A 3CT9A 3CXPA 3GY9A 2B5GB 2YNEA 3LMSA 3RZAA 3D2MA 4PQAA 4EFDA 5F46A 3TE4A 1RO5A 4IHMA 2PC1A 1Q2CA 5E96A 4AG9A 5J1QA 1QSTA 4KORA 1Z8WA 2FS5A 2B58A 1KUVA
chains in the Genus database with same CATH topology
2P6GA 5A27A 1YVOA 4JLYA 1Y7RA 3B8GA 4FD5A 3S6FA 2Y0MA 2VZYA 4ONUA 1CM0A 4RS2A 2ATRA 3EC4A 3FIXA 5J8FA 2FXFA 1YLEA 4C2XA 5EC4A 2KCWA 5C88A 4B13A 3D8PA 4CAXA 2Z0ZA 4H6ZA 4AG7A 4QBJA 4NCZA 4DNCA 4U9ZA 1MK4A 2OU2A 4YGOA 4OAEA 3DR6A 2K5TA 2OZUA 2B3VA 2Z3LA 3TO7A 1FY7A 2REFA 2B3UA 3TO9A 4KUBA 5F48A 1B6BA 4LUAA 4FD6A 2BUEA 2OZGA 1P4NA 3KKWA 2EVNA 1N71A 1KUXA 1R57A 4MJ8A 1PUAA 3R9GA 4HNYB 4B5PA 2Q04A 2EUIA 2GIVA 5H84A 1I21A 4CGOA 1S3ZA 3PGPA 3ZZIA 2ZW7A 4L8AA 3JUWA 4L89A 1XMTA 5F49A 4C7HA 5CNPA 2YGWA 1Q2YA 2VI7A 4B12A 2C27A 4CYPA 2GANA 1QSMA 2CXAA 4MFJA 1Z4EA 4Y49B 1MJ9A 1IB1E 2Z10A 2VZZA 3VWEA 4M85A 4U5YA 4UWJA 3ZJ0A 3MGDA 2FE7A 4EVYA 3R9EA 4QVTA 2B4DA 3N7ZA 2I79A 3GKRA 2QIRA 4NXYA 3QAHA 1WK4A 3T9YA 2OH1A 4PV6A 1IYLA 4OADA 3T90A 2H5MA 5AG4A 1M4GA 1S60A 3EFAA 2F5IA 2BSWA 4M3SA 3W6XA 4A2ZA 4Y49C 4A95A 2WPXA 4A33A 1YX0A 1I1DA 4CGMA 2GE3A 2CNMA 3DNSA 2QMLA 4MY0A 4U9YA 4CAWA 4A32A 1XIXA 1LRZA 3BJ7A 4B11A 2FIAA 2WSAA 3FB3A 4JWPA 5BWAB 4AB7A 5KTAA 4B5PB 4CS0B 3EO4A 1J4JA 3W6SA 1MJBA 3OWCA 4OLLA 3R9FA 1V0CA 1L0CA 2HV2A 4F0XA 1YVKA 4UCNA 2VEZA 4ORFA 3QB8A 3A9LA 3D2PA 4KZTA 5C82A 4C68A 4XPDC 4HKFA 2Q4YA 4UA3A 3UY5A 4MFKA 3P2FA 4R87A 2QECA 1YK3A 4MHDA 1VKCA 5G22A 3SXNA 2ZW4A 4FD4A 3TT2A 4CAEA 2B4DB 4BBHA 2ZW5A 2Z11A 2J8NA 1S7FA 2ZXVA 4MY3A 4C2YA 2ZPAA 2P6EA 1UFHA 4KOXA 3I9SA 2P0WA 4XNHB 5IB0A 4UWIA 2J8MA 1TIQA 2NMTA 2R8VA 3S6KA 2IL4A 3F0AA 2I00A 4C2ZA 3IGRA 4NEXA 4F0YA 5ISVA 4JJXA 3TTHA 3PP9A 3JTKA 2OZHA 4KVOE 4MBUA 2VQYA 2ZW6A 2BL1A 2JEVA 4YFJA 4RI1A 3DDDA 2G0BA 4XPKA 4AVAA 4KVME 3D3SA 3G8WA 4XNHC 1M4IA 1Z9UA 4UCPA 4YRHA 5DWMA 2CNSA 2PQ8A 4X5KA 1ZO0A 3CXSA 2X7BA 1BO4A 4QC6A 4KSFA 2DPSA 4H6UA 1XF8A 4MFQA 4JXQA 2G3AA 4KOYA 4II9A 2VXKA 1GHEA 5G21A 1S7KA 3SXOA 2JDDA 4R3LA 4CGLA 4KS9A 4E0AA 2FT0A 4KLVA 2Q0YA 4BMHA 3IU2A 2YNCA 4R3KA 5H86A 1P0HA 2FIWA 1S7NA 3G3SA 4PK3A 4JXRA 2D4OA 1NSLA 4A30A 3IWEA 1MJAA 1IIDA 4UFWA 4CGPA 4B10A 3LODA 3TOAA 3PZJA 4XPDB 3FYNA 1M4DA 2CY2A 2PDOA 2O28A 5JQ4A 2BEIA 3H4QA 1YREA 4B5OA 1S5KA 3IU1A 3RYOA 1RXTA 1B87A 2ARHA 4C7IA 3FNCA 3CXQA 4E8OA 5JPHA 5F47A 4MFPA 1KUYA 4AVBA 1QSOA 5AGEA 3FXTA 4CGNA 1BOBA 2Z3OA 4R9MA 5AG7A 4F6AA 2A4NA 2RC4A 4QUSA 5J8CA 5I0CA 2FSRA 4B14A 1M1DA 1Z4RA 1XEBA 2HQYA 3C26A 4Q38A 5KTCA 5AG6A 5FVJA 2HUZA 4IF5A 4I49A 3EY5A 5GCNA 3NE7A 1VHSA 4IUSA 4KUAA 3R95A 4K30A 4KOWA 4UFXA 2Z3KA 4Q36A 3F5BA 3BJ8A 2Q44A 4JD6A 4CAFA 2VBQA 5A28A 2PRBA 3DR8A 4HNXB 1YR0A 2JDCA 2R1IA 1YGHA 2YNCC 1Y9KA 2Z3PA 3F8KA 2Z3NA 4KLWA 1SQHA 3R1KA 4ZGYB 2R98A 5EBVA 2P6FA 2Q4VA 4E2AA 3DSBA 3LD2A 4CYQA 4MFZA 4PSXA 3R96A 4CAVA 1CJWA 5HMNA 2AJ6A 4NSQA 5AG5A 4KOVA 4KSAA 1M44A 3BLNA 4PSWA 4H89A 2JLMA 2WUUA 3EXNA 4LX9A 2FCKA 2B5GA 2Z3MA 4CYOA 4KOTA 4KOSA 2FL4A 4UBRA 3H5ZA 3V8IA 2R7HA 1QSNA 2WPWA 4QB9A 3SHPA 4NF1A 3TFYA 1QSRA 3TOBA 3S6HA 1NE9A 1U6MA 5DWNA 4KVXA 4UCMA 5IV0A 1Q2DA 3WR7A 1WWZA 1NMTA 1K4JA 2PR8A 4XPLA 5HH1A 2J8RA 3FBUA 3FRMA 1KZFA 2YNDA 2PR1A 3TO6A 3JVNA 2AE6A 5IX3A 4MFLA 4CRYB 3I3GA 1IYKA 2G3TA 2B4BA 3E0KA 3P2HA 1PU9A 2Q7BA 4HNWB 1I12A 1OZPA 4R57A 1ON0A 4J3GA 4UFVA 4KOUA 4CRZB 3VWDA 4AVCA 2CNTA 2D4PA 2DXQA 2PSWA 1Y9WA 4GS4A 3W91A 3S6GA 2REEA 3GYAA 3IWGA 3K9UA 5G1ZA 1S7LA 4FD7A 5KTDA 5G20A 3TCVA 1XE4A 4A31A 2OB0A 4ZBGA 1IICA 2DPTA 4CYNA 4MI4A 4PK2A 3CXPA 3GY9A 2B5GB 2YNEA 3D2MA 5F46A 3TE4A 1RO5A 2PC1A 1Q2CA 5E96A 4AG9A 1QSTA 4KORA 2FS5A 2B58A 1KUVA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2P6G A;  1YVO A;  4JLY A;  1Y7R A;  3B8G A;  4FD5 A;  3S6F A;  2Y0M A;  2VZY A;  4ONU A;  1CM0 A;  4RS2 A;  2ATR A;  3EC4 A;  3FIX A;  5J8F A;  2FXF A;  1YLE A;  5EC4 A;  2KCW A;  5C88 A;  3D8P A;  4CAX A;  2Z0Z A;  4H6Z A;  4AG7 A;  4QBJ A;  4NCZ A;  4DNC A;  4U9Z A;  1MK4 A;  2OU2 A;  4YGO A;  4OAE A;  3DR6 A;  2K5T A;  2OZU A;  2B3V A;  3TO7 A;  1FY7 A;  2REF A;  2B3U A;  3TO9 A;  4KUB A;  5F48 A;  1B6B A;  4LUA A;  4FD6 A;  2BUE A;  2OZG A;  1P4N A;  3KKW A;  2EVN A;  1N71 A;  1KUX A;  1R57 A;  4MJ8 A;  1PUA A;  3R9G A;  4HNY B;  4B5P A;  2Q04 A;  2EUI A;  2GIV A;  5H84 A;  1I21 A;  1S3Z A;  3PGP A;  3ZZI A;  2ZW7 A;  4L8A A;  3JUW A;  4L89 A;  1XMT A;  5F49 A;  5CNP A;  1Q2Y A;  2VI7 A;  2C27 A;  2GAN A;  1QSM A;  1Z4E A;  4Y49 B;  1MJ9 A;  1IB1 E;  2Z10 A;  2VZZ A;  3VWE A;  4M85 A;  4U5Y A;  4UWJ A;  3ZJ0 A;  3MGD A;  2FE7 A;  4EVY A;  3R9E A;  4QVT A;  2B4D A;  3N7Z A;  2I79 A;  3GKR A;  2QIR A;  4NXY A;  3QAH A;  1WK4 A;  3T9Y A;  2OH1 A;  4PV6 A;  1IYL A;  4OAD A;  3T90 A;  2H5M A;  1M4G A;  1S60 A;  3EFA A;  2F5I A;  2BSW A;  4M3S A;  3W6X A;  4Y49 C;  2WPX A;  1YX0 A;  1I1D A;  2GE3 A;  2CNM A;  3DNS A;  2QML A;  4MY0 A;  4U9Y A;  4CAW A;  1XIX A;  1LRZ A;  3BJ7 A;  2FIA A;  3FB3 A;  4JWP A;  4AB7 A;  5KTA A;  4B5P B;  4CS0 B;  3EO4 A;  1J4J A;  3W6S A;  1MJB A;  3OWC A;  4OLL A;  3R9F A;  1V0C A;  1L0C A;  2HV2 A;  1YVK A;  2VEZ A;  4ORF A;  3QB8 A;  4KZT A;  3D2P A;  5C82 A;  4XPD C;  4HKF A;  2Q4Y A;  4UA3 A;  3UY5 A;  3P2F A;  4R87 A;  2QEC A;  1YK3 A;  4MHD A;  1VKC A;  3SXN A;  2ZW4 A;  4FD4 A;  3TT2 A;  2B4D B;  2ZW5 A;  2Z11 A;  2J8N A;  1S7F A;  2ZXV A;  4MY3 A;  2ZPA A;  2P6E A;  1UFH A;  4KOX A;  3I9S A;  2P0W A;  4XNH B;  5IB0 A;  4UWI A;  2J8M A;  1TIQ A;  2NMT A;  2R8V A;  3S6K A;  2IL4 A;  3F0A A;  2I00 A;  3IGR A;  4NEX A;  4F0Y A;  5ISV A;  4JJX A;  3TTH A;  3PP9 A;  2OZH A;  4KVO E;  4MBU A;  2VQY A;  2ZW6 A;  2BL1 A;  2JEV A;  4YFJ A;  4RI1 A;  3DDD A;  2G0B A;  4XPK A;  4AVA A;  4KVM E;  3D3S A;  3G8W A;  4XNH C;  1M4I A;  1Z9U A;  4YRH A;  5DWM A;  2CNS A;  2PQ8 A;  4X5K A;  3CXS A;  2X7B A;  1BO4 A;  4QC6 A;  4H6U A;  1XF8 A;  4JXQ A;  2G3A A;  4KOY A;  4II9 A;  2VXK A;  1GHE A;  1S7K A;  3SXO A;  2JDD A;  4R3L A;  4E0A A;  2FT0 A;  4KLV A;  2Q0Y A;  4BMH A;  4R3K A;  5H86 A;  1P0H A;  2FIW A;  1S7N A;  3G3S A;  4PK3 A;  4JXR A;  2D4O A;  1NSL A;  1MJA A;  1IID A;  3LOD A;  3TOA A;  3PZJ A;  4XPD B;  3FYN A;  1M4D A;  2CY2 A;  2PDO A;  2O28 A;  5JQ4 A;  2BEI A;  3H4Q A;  1YRE A;  4B5O A;  1S5K A;  3RYO A;  1RXT A;  1B87 A;  2ARH A;  3FNC A;  3CXQ A;  4E8O A;  5JPH A;  5F47 A;  1KUY A;  4AVB A;  1QSO A;  3FXT A;  1BOB A;  4R9M A;  4F6A A;  2A4N A;  2RC4 A;  4QUS A;  5J8C A;  5I0C A;  2FSR A;  1M1D A;  1Z4R A;  1XEB A;  2HQY A;  3C26 A;  5KTC A;  5FVJ A;  2HUZ A;  4IF5 A;  4I49 A;  3EY5 A;  5GCN A;  3NE7 A;  1VHS A;  4IUS A;  4KUA A;  3R95 A;  4K30 A;  4KOW A;  3F5B A;  3BJ8 A;  2Q44 A;  4JD6 A;  2VBQ A;  2PRB A;  3DR8 A;  4HNX B;  1YR0 A;  2JDC A;  2R1I A;  1YGH A;  1Y9K A;  3F8K A;  4KLW A;  1SQH A;  3R1K A;  2R98 A;  5EBV A;  2P6F A;  2Q4V A;  4E2A A;  3DSB A;  3LD2 A;  4PSX A;  3R96 A;  4CAV A;  1CJW A;  5HMN A;  2AJ6 A;  4NSQ A;  4KOV A;  1M44 A;  3BLN A;  4PSW A;  4H89 A;  2JLM A;  3EXN A;  4LX9 A;  2FCK A;  2B5G A;  4KOT A;  4KOS A;  2FL4 A;  4UBR A;  3V8I A;  2R7H A;  1QSN A;  2WPW A;  4QB9 A;  3SHP A;  4NF1 A;  3TFY A;  1QSR A;  3TOB A;  3S6H A;  1NE9 A;  1U6M A;  5DWN A;  4KVX A;  5IV0 A;  1Q2D A;  3WR7 A;  1WWZ A;  1NMT A;  1K4J A;  2PR8 A;  4XPL A;  5HH1 A;  2J8R A;  3FBU A;  3FRM A;  1KZF A;  3TO6 A;  2PR1 A;  3JVN A;  2AE6 A;  5IX3 A;  4CRY B;  3I3G A;  1IYK A;  2G3T A;  2B4B A;  3E0K A;  3P2H A;  1PU9 A;  2Q7B A;  4HNW B;  1I12 A;  1OZP A;  4R57 A;  1ON0 A;  4J3G A;  4KOU A;  4CRZ B;  3VWD A;  4AVC A;  2CNT A;  2D4P A;  2DXQ A;  2PSW A;  1Y9W A;  4GS4 A;  3W91 A;  3S6G A;  2REE A;  3GYA A;  3IWG A;  3K9U A;  1S7L A;  4FD7 A;  5KTD A;  3TCV A;  1XE4 A;  2OB0 A;  4ZBG A;  1IIC A;  4MI4 A;  4PK2 A;  3CXP A;  3GY9 A;  2B5G B;  3D2M A;  5F46 A;  3TE4 A;  1RO5 A;  2PC1 A;  1Q2C A;  5E96 A;  4AG9 A;  1QST A;  4KOR A;  2FS5 A;  2B58 A;  1KUV A; 
#chains in the Genus database with same CATH topology
 3SI2 A;  4P10 A;  2P6G A;  5A27 A;  3RO0 A;  4EME A;  1XOV A;  1YVO A;  4JLY A;  1LAP A;  1Y7R A;  3B8G A;  4A39 A;  4FD5 A;  3IWW A;  1H8L A;  3S6F A;  3IC1 A;  2Y0M A;  4OKO A;  3B35 A;  2VZY A;  4ONU A;  5K8P A;  1AYE A;  4P6Y A;  3ISX A;  1CM0 A;  4RS2 A;  1PYT B;  2ATR A;  4Z65 A;  3EC4 A;  2PJ5 A;  3FIX A;  2QYV A;  4NJR A;  5J8F A;  2PJ6 A;  2FXF A;  1YLE A;  4C2X A;  1TKH A;  1EE3 P;  5EC4 A;  4AXV A;  2AFW A;  2KCW A;  5C88 A;  4B13 A;  3D8P A;  2PJ0 A;  4CAX A;  2Z0Z A;  4H6Z A;  4BIN A;  4AG7 A;  4QBJ A;  4NCZ A;  4DNC A;  4U9Z A;  1MK4 A;  2OU2 A;  4OC0 A;  4YGO A;  4MCS A;  2FVG A;  4OAE A;  3DR6 A;  3S9L A;  2K5T A;  2OZU A;  2B3V A;  2Z3L A;  3B2Y A;  1F2O A;  3TO7 A;  1FY7 A;  5D8N A;  2REF A;  4NFR A;  4NGQ A;  1Z2L A;  2B3U A;  3TO9 A;  3WT4 A;  4KUB A;  2AFZ A;  5F48 A;  1IOI A;  1B6B A;  2NSM A;  4LUA A;  3B3T A;  4FD6 A;  1ZG7 A;  2BUE A;  2OZG A;  1P4N A;  3KKW A;  2EVN A;  3H8G A;  1N71 A;  2C1C A;  1KUX A;  3KAS A;  1R57 A;  5I4M A;  4MHZ A;  3IJ3 A;  1PUA A;  4MJ8 A;  1CPS A;  3R9G A;  4HNY B;  4B5P A;  1TKF A;  3PB7 X;  2Q04 A;  2EUI A;  2GIV A;  4X2T A;  5H84 A;  3S9N A;  1I21 A;  2XEF A;  4CGO A;  4R7M A;  4NGM A;  1S3Z A;  3PGP A;  4UEF A;  2C6P A;  2ZW7 A;  4L8A A;  3LAC A;  3ZZI A;  5K8M A;  3JUW A;  4L89 A;  1AUG A;  1XMT A;  5F49 A;  4C7H A;  5CNP A;  2YGW A;  1CP6 A;  1Q2Y A;  2VI7 A;  4B12 A;  1TKJ A;  2C27 A;  4CYP A;  2AFX A;  2GAN A;  4P4E A;  1QSM A;  2CXA A;  4MFJ A;  1Z4E A;  4Y49 B;  1MJ9 A;  1IB1 E;  2Z10 A;  4GM5 A;  2VZZ A;  1JQG A;  2O53 A;  1IU8 A;  1F2P A;  2PJ9 A;  2JBJ A;  4M85 A;  2OOT A;  3VWE A;  2PJB A;  4U5Y A;  4UWJ A;  3SI1 A;  3ZJ0 A;  4A94 A;  3MGD A;  2FE7 A;  4EVY A;  1BLL E;  1VIX A;  1Y0R A;  3R9E A;  4QVT A;  2POK A;  2B4D A;  2RB7 A;  4WJB A;  3DGV A;  2BO9 A;  3N7Z A;  1CP7 A;  2ZEF A;  4K3N A;  2I79 A;  2IQ6 A;  2AFU A;  3GKR A;  3KZW A;  2QIR A;  4NXY A;  3QAH A;  5EMI A;  2PJ3 A;  1WK4 A;  3T9Y A;  2OH1 A;  4PV6 A;  1IYL A;  4OAD A;  3T8W A;  3T90 A;  2H5M A;  2NYQ A;  4OIW A;  5AG4 A;  4MRI A;  1M4G A;  3PFE A;  3NE8 A;  4ZY0 A;  1S60 A;  1QMU A;  3EFA A;  2F5I A;  3IIB A;  2BSW A;  3D7G A;  1F57 A;  4M3S A;  3W6X A;  1ELL P;  4A2Z A;  2DEA A;  2CTC A;  2QVP A;  3KGQ A;  3GLJ A;  1XFO A;  4Y49 C;  4A95 A;  2WPX A;  4A33 A;  1YX0 A;  1I1D A;  4CGM A;  3N5F A;  4PXD A;  2GE3 A;  2CNM A;  3NFZ A;  4RN7 A;  5C82 A;  7CPA A;  2EBJ A;  4M6H A;  3DNS A;  2QML A;  3H8F A;  4MY0 A;  4U9Y A;  3PB4 X;  4CAW A;  4A32 A;  2RFH A;  1XIX A;  1LRZ A;  3BJ7 A;  4R8F A;  2FIA A;  2WSA A;  4B11 A;  3FB3 A;  3VAT A;  2EWB A;  4JWP A;  5BWA B;  4AB7 A;  1LFW A;  5KTA A;  1Q7L A;  4M6I A;  4B5P B;  4CS0 B;  3EO4 A;  1J4J A;  2PJC A;  1RTQ A;  2PVW A;  4ZY2 A;  3BHX A;  1TXR A;  3W6S A;  3B3C A;  4ZX8 A;  1MJB A;  5CBM A;  4X3R A;  5LRK A;  4PXE A;  2Q43 A;  3JRU A;  3OWC A;  4OLL A;  3R9F A;  1OBR A;  1V0C A;  1L0C A;  3KHX A;  2HV2 A;  2XEI A;  4F0X A;  2BOA A;  1YVK A;  4MHN A;  2VEZ A;  2V8H A;  3QB8 A;  4ORF A;  4UCN A;  3A9L A;  3D2P A;  4H2K A;  4KZT A;  1Z8X A;  4XPD C;  4C68 A;  4HKF A;  4FAI A;  2Q4Y A;  4UA3 A;  3UY5 A;  4MFK A;  3P2F A;  3S9M A;  3KI9 A;  4MCR A;  2QEC A;  4R87 A;  1YK3 A;  4MHD A;  2GLJ A;  2J9A A;  3D7H A;  4JZ0 A;  1VKC A;  1M4L A;  3D7F A;  5G22 A;  3SXN A;  2PJ4 A;  4NJQ A;  1DTD A;  2ZW4 A;  3B3S A;  4FD4 A;  1BPM A;  3TT2 A;  4CAE A;  4P4I A;  2B4D B;  2AFO A;  3CPX A;  4BBH A;  1Z8L A;  2ABZ A;  2ZW5 A;  4KSI A;  2F7V A;  2Z11 A;  2J8N A;  4NGT A;  1S7F A;  5LRJ A;  2ZXV A;  4MY3 A;  4C2Y A;  1GYT A;  2ZPA A;  2ZOG A;  2P6E A;  5LYL A;  1UFH A;  2PJ2 A;  2I3C A;  4KOX A;  1IGB A;  2HC9 A;  4EWT A;  3WC7 A;  2PJ8 A;  3I9S A;  4MMO A;  1YQE A;  4ONW A;  2P0W A;  4XNH B;  5IB0 A;  2ZEE A;  4UWI A;  2J8M A;  1TIQ A;  2NMT A;  1PCA A;  2R8V A;  3S6K A;  2IL4 A;  2WYR A;  3F0A A;  5LYI A;  2F8H A;  2I00 A;  4ZYQ A;  4C2Z A;  1YW4 A;  2CTB A;  4UIA A;  3IGR A;  1VGY A;  3QAY A;  2AFM A;  4NEX A;  3VAR A;  4F0Y A;  5ISV A;  4JJX A;  3TTH A;  3PP9 A;  1FT7 A;  3FF3 A;  3JTK A;  2OZH A;  4KVO E;  4MBU A;  3B7I A;  3D4U A;  2G9D A;  3NH8 A;  2PIZ A;  2VQY A;  2ZW6 A;  4UEZ A;  1ARL A;  2EO8 A;  4P4J A;  2BL1 A;  3D67 A;  2JEV A;  3PBE A;  4YFJ A;  4RI1 A;  4MHP A;  3DDD A;  4NGR A;  2G0B A;  4WWV A;  4XPK A;  4AVA A;  4KVM E;  3D3S A;  3G8W A;  2ANP A;  4UEE A;  4XNH C;  2ZEH A;  4OC1 A;  1M4I A;  3V38 A;  2XEJ A;  2O4H A;  1ARM A;  1Z9U A;  4G1P A;  2CIJ A;  4NGN A;  4UCP A;  4YRH A;  3ISZ A;  4M6G A;  2BCO A;  4FWU A;  5DWM A;  3I1U A;  2CNS A;  2PQ8 A;  4X5K A;  1ZO0 A;  3CXS A;  2X7B A;  1BO4 A;  4IK2 A;  4QC6 A;  4KSF A;  4NGS A;  3B3V A;  2DPS A;  4H6U A;  1XF8 A;  4MFQ A;  4JXQ A;  4OC3 A;  4OC4 A;  2G3A A;  1HDQ A;  4KOY A;  2EK8 A;  4II9 A;  3RAM A;  2VXK A;  1GHE A;  5G21 A;  1S7K A;  3SXO A;  2JDD A;  4R3L A;  4CGL A;  1IOF A;  2CF4 A;  1LAM A;  4RUH A;  4KS9 A;  3B3W A;  2Q4Z A;  4B6Z A;  4CPA A;  2DF5 A;  2FT0 A;  3H8E A;  4E0A A;  4KLV A;  2Q0Y A;  4BMH A;  3IU2 A;  2YNC A;  2PIY A;  3DLJ A;  4R3K A;  4UIB A;  5H86 A;  3MN8 A;  1P0H A;  1Y7E A;  5JGF A;  5HVH A;  2FIW A;  5HVG A;  1S7N A;  3G3S A;  4PK3 A;  4JXR A;  4OC5 A;  4DUK A;  2ODF A;  5JH9 A;  3RBU A;  2D4O A;  1NSL A;  4A30 A;  3IWE A;  1Z5R A;  4IAV A;  4P44 A;  1ELM P;  4OME A;  2ZEN A;  1MJA A;  1IID A;  1X10 A;  1ZG9 A;  4UFW A;  4CGP A;  4B10 A;  1LCP A;  1Z8T A;  2JBK A;  3LOD A;  3PZJ A;  1CPX A;  3TOA A;  4XPD B;  3FYN A;  1M4D A;  2PCU A;  2CY2 A;  2PDO A;  3BI0 A;  2O28 A;  3CZX A;  3D7D A;  3SJE A;  5JQ4 A;  2GFQ A;  2BEI A;  3PBB A;  3H4Q A;  1YRE A;  2V8D A;  4B5O A;  1BPN A;  3HLP A;  1S5K A;  4YU9 A;  3IU1 A;  1YLO A;  1VHO A;  1RXT A;  1B87 A;  3RYO A;  2ARH A;  4C7I A;  1A2Z A;  3FNC A;  3CXQ A;  4LQG A;  1LOK A;  1IY7 A;  1XBU A;  4E8O A;  5JPH A;  5F47 A;  4F9U A;  4MFP A;  1R3N A;  1KUY A;  4LQ6 A;  4AVB A;  1DE4 C;  1QSO A;  5AGE A;  3BXM A;  3FXT A;  3D68 A;  1BOB A;  4CGN A;  2Z3O A;  1BAV A;  4R9M A;  5AG7 A;  3LWU A;  3NA6 A;  4F6A A;  3KQX A;  5HVF A;  2A4N A;  4R76 A;  2RC4 A;  2VL1 A;  3GUX A;  3K2K A;  4P4D A;  4QUS A;  4DYO A;  1KWM A;  2FSR A;  5I0C A;  4B14 A;  5J8C A;  1M1D A;  1Z4R A;  1XEB A;  2HQY A;  3C26 A;  4MCP A;  4Q38 A;  3V7Z A;  1CX8 A;  4Q7A A;  5KTC A;  5AG6 A;  2ZEL A;  3FH4 A;  4HPS A;  4PXB A;  5LRG A;  3BI1 A;  3KL9 A;  4GXH A;  4NGP A;  5FVJ A;  4A38 A;  4OP4 A;  3FED A;  4OID A;  2HUZ A;  2PRQ A;  4IF5 A;  2ZEO A;  1HEE A;  3CDX A;  1CG2 A;  4I49 A;  3EY5 A;  5GCN A;  3NE7 A;  1VHS A;  1XMB A;  3QNV A;  3PB8 X;  4IUS A;  4KUA A;  3PB6 X;  3R95 A;  4K30 A;  1X12 A;  1NSA A;  1ZLI A;  1TF8 A;  1YW6 A;  3HUV A;  1CBX A;  4KOW A;  3K9T A;  2PE3 A;  5DS0 A;  4UFX A;  2Z3K A;  4Q36 A;  3PFO A;  2IMO A;  5LYD A;  2JEW A;  3F5B A;  3KHZ A;  4DJL A;  2HB6 A;  2C6C A;  4X8I A;  3BJ8 A;  2Q44 A;  1UWY A;  3NH4 A;  4JD6 A;  5ELY A;  3SI0 A;  3SJF A;  4CAF A;  2VBQ A;  2PJ7 A;  1XJO A;  5A28 A;  2PRB A;  3DR8 A;  4W9Y A;  4HNX B;  1YR0 A;  4ZX9 A;  3KR4 A;  2JDC A;  2R1I A;  3MRU A;  4P4B A;  1YGH A;  3IFE A;  1AMP A;  2PJ1 A;  3GIU A;  2YNC C;  1Y9K A;  2Z3P A;  2ZEM A;  3F8K A;  2Z3N A;  3GB0 A;  4KLW A;  1SQH A;  2GU2 A;  3R1K A;  4ZGY B;  2R98 A;  5EBV A;  2P6F A;  2Q4V A;  4E2A A;  3DSB A;  2GLF A;  3WC5 A;  3LD2 A;  2PJA A;  4CYQ A;  4MFZ A;  3RNZ A;  3FEE A;  4PSX A;  4ZI6 A;  1JWQ A;  3R96 A;  3PRT A;  3TX8 A;  4CAV A;  5JM6 A;  1CJW A;  2ZEG A;  5HMN A;  3D66 A;  2AJ6 A;  3KQZ A;  4R6T A;  4NSQ A;  5AG5 A;  3WAB A;  4KOV A;  4KSA A;  1M44 A;  2EK9 A;  3BLN A;  4P4F A;  4PSW A;  4H89 A;  2JLM A;  5THW A;  2WUU A;  3EXN A;  3PEI A;  3FEC A;  4LX9 A;  2FCK A;  2B5G A;  2Z3M A;  1FNO A;  2OR4 A;  4CYO A;  4KOT A;  4KOS A;  2Q51 A;  3NH5 A;  2FL4 A;  4UBR A;  4JYW A;  5CPA A;  3H5Z A;  5K8O A;  1QQ9 A;  3V8I A;  4PXC A;  1VHE A;  5HXD A;  2R7H A;  1QSN A;  1ZG8 A;  1Y0Y A;  2WPW A;  4QB9 A;  3SHP A;  4O23 A;  1ZLH A;  4NF1 A;  3TFY A;  1QSR A;  3TOB A;  3S6H A;  1NE9 A;  1U6M A;  5IB9 A;  5DWN A;  4KVX A;  4UCM A;  1R43 A;  4TWE A;  5IV0 A;  5K8N A;  2V77 A;  4FUU A;  1Q2D A;  4PPZ A;  3WR7 A;  4MCQ A;  1WWZ A;  3L2N A;  1NMT A;  1K4J A;  1XRY A;  2PR8 A;  4XPL A;  5HH1 A;  2J8R A;  3FBU A;  3FRM A;  4TNU A;  1KZF A;  2V8V A;  2AFS A;  2XEG A;  2WZN A;  2YND A;  2PR1 A;  3TO6 A;  4FBE A;  3TC8 A;  4P45 A;  4A37 A;  3JVN A;  2AE6 A;  3SJG A;  2ZOF A;  3WC6 A;  1YME A;  5IX3 A;  4F9V A;  4MFL A;  3IEH A;  2V8G A;  4CRY B;  3I3G A;  6CPA A;  4MHY A;  1IYK A;  2G3T A;  2B4B A;  3E0K A;  1TF9 A;  2IJZ A;  5LYF A;  1YSJ A;  3P2H A;  1PU9 A;  2Q7B A;  4HNW B;  1I12 A;  1OZP A;  4R57 A;  3FJU A;  1ON0 A;  3FMC A;  8CPA A;  4J3G A;  3FVL A;  4KOU A;  4UFV A;  4CRZ B;  2ZEP A;  3IO1 A;  3SJX A;  1HDU A;  3PB9 X;  3VWD A;  4AVC A;  2GRE A;  2CNT A;  2D4P A;  2DXQ A;  2PSW A;  4UF4 A;  4F8Z A;  1Y9W A;  2Q7S A;  4GS4 A;  3W91 A;  3S6G A;  2REE A;  3KR5 A;  4YWY A;  4ZY1 A;  3GYA A;  3IWG A;  3K9U A;  5G1Z A;  1S7L A;  2PVV A;  3VH9 A;  2C6G A;  4BD9 A;  4FD7 A;  5KTD A;  5G20 A;  3TCV A;  1XE4 A;  2ZED A;  4A31 A;  2OB0 A;  3CPA A;  2QJ8 A;  3FX6 A;  5F09 A;  4ZBG A;  1IIC A;  1LAN A;  2DPT A;  4MXU A;  4CYN A;  4MI4 A;  4PK2 A;  4OC2 A;  5D29 A;  3CT9 A;  3CXP A;  3GY9 A;  2B5G B;  2YNE A;  3LMS A;  3RZA A;  3D2M A;  4PQA A;  4EFD A;  5F46 A;  3TE4 A;  1RO5 A;  4IHM A;  2PC1 A;  1Q2C A;  5E96 A;  4AG9 A;  5J1Q A;  1QST A;  4KOR A;  1Z8W A;  2FS5 A;  2B58 A;  1KUV A; 
#chains in the Genus database with same CATH homology
 2P6G A;  5A27 A;  1YVO A;  4JLY A;  1Y7R A;  3B8G A;  4FD5 A;  3S6F A;  2Y0M A;  2VZY A;  4ONU A;  1CM0 A;  4RS2 A;  2ATR A;  3EC4 A;  3FIX A;  5J8F A;  2FXF A;  1YLE A;  4C2X A;  5EC4 A;  2KCW A;  5C88 A;  4B13 A;  3D8P A;  4CAX A;  2Z0Z A;  4H6Z A;  4AG7 A;  4QBJ A;  4NCZ A;  4DNC A;  4U9Z A;  1MK4 A;  2OU2 A;  4YGO A;  4OAE A;  3DR6 A;  2K5T A;  2OZU A;  2B3V A;  2Z3L A;  3TO7 A;  1FY7 A;  2REF A;  2B3U A;  3TO9 A;  4KUB A;  5F48 A;  1B6B A;  4LUA A;  4FD6 A;  2BUE A;  2OZG A;  1P4N A;  3KKW A;  2EVN A;  1N71 A;  1KUX A;  1R57 A;  4MJ8 A;  1PUA A;  3R9G A;  4HNY B;  4B5P A;  2Q04 A;  2EUI A;  2GIV A;  5H84 A;  1I21 A;  4CGO A;  1S3Z A;  3PGP A;  3ZZI A;  2ZW7 A;  4L8A A;  3JUW A;  4L89 A;  1XMT A;  5F49 A;  4C7H A;  5CNP A;  2YGW A;  1Q2Y A;  2VI7 A;  4B12 A;  2C27 A;  4CYP A;  2GAN A;  1QSM A;  2CXA A;  4MFJ A;  1Z4E A;  4Y49 B;  1MJ9 A;  1IB1 E;  2Z10 A;  2VZZ A;  3VWE A;  4M85 A;  4U5Y A;  4UWJ A;  3ZJ0 A;  3MGD A;  2FE7 A;  4EVY A;  3R9E A;  4QVT A;  2B4D A;  3N7Z A;  2I79 A;  3GKR A;  2QIR A;  4NXY A;  3QAH A;  1WK4 A;  3T9Y A;  2OH1 A;  4PV6 A;  1IYL A;  4OAD A;  3T90 A;  2H5M A;  5AG4 A;  1M4G A;  1S60 A;  3EFA A;  2F5I A;  2BSW A;  4M3S A;  3W6X A;  4A2Z A;  4Y49 C;  4A95 A;  2WPX A;  4A33 A;  1YX0 A;  1I1D A;  4CGM A;  2GE3 A;  2CNM A;  3DNS A;  2QML A;  4MY0 A;  4U9Y A;  4CAW A;  4A32 A;  1XIX A;  1LRZ A;  3BJ7 A;  4B11 A;  2FIA A;  2WSA A;  3FB3 A;  4JWP A;  5BWA B;  4AB7 A;  5KTA A;  4B5P B;  4CS0 B;  3EO4 A;  1J4J A;  3W6S A;  1MJB A;  3OWC A;  4OLL A;  3R9F A;  1V0C A;  1L0C A;  2HV2 A;  4F0X A;  1YVK A;  4UCN A;  2VEZ A;  4ORF A;  3QB8 A;  3A9L A;  3D2P A;  4KZT A;  5C82 A;  4C68 A;  4XPD C;  4HKF A;  2Q4Y A;  4UA3 A;  3UY5 A;  4MFK A;  3P2F A;  4R87 A;  2QEC A;  1YK3 A;  4MHD A;  1VKC A;  5G22 A;  3SXN A;  2ZW4 A;  4FD4 A;  3TT2 A;  4CAE A;  2B4D B;  4BBH A;  2ZW5 A;  2Z11 A;  2J8N A;  1S7F A;  2ZXV A;  4MY3 A;  4C2Y A;  2ZPA A;  2P6E A;  1UFH A;  4KOX A;  3I9S A;  2P0W A;  4XNH B;  5IB0 A;  4UWI A;  2J8M A;  1TIQ A;  2NMT A;  2R8V A;  3S6K A;  2IL4 A;  3F0A A;  2I00 A;  4C2Z A;  3IGR A;  4NEX A;  4F0Y A;  5ISV A;  4JJX A;  3TTH A;  3PP9 A;  3JTK A;  2OZH A;  4KVO E;  4MBU A;  2VQY A;  2ZW6 A;  2BL1 A;  2JEV A;  4YFJ A;  4RI1 A;  3DDD A;  2G0B A;  4XPK A;  4AVA A;  4KVM E;  3D3S A;  3G8W A;  4XNH C;  1M4I A;  1Z9U A;  4UCP A;  4YRH A;  5DWM A;  2CNS A;  2PQ8 A;  4X5K A;  1ZO0 A;  3CXS A;  2X7B A;  1BO4 A;  4QC6 A;  4KSF A;  2DPS A;  4H6U A;  1XF8 A;  4MFQ A;  4JXQ A;  2G3A A;  4KOY A;  4II9 A;  2VXK A;  1GHE A;  5G21 A;  1S7K A;  3SXO A;  2JDD A;  4R3L A;  4CGL A;  4KS9 A;  4E0A A;  2FT0 A;  4KLV A;  2Q0Y A;  4BMH A;  3IU2 A;  2YNC A;  4R3K A;  5H86 A;  1P0H A;  2FIW A;  1S7N A;  3G3S A;  4PK3 A;  4JXR A;  2D4O A;  1NSL A;  4A30 A;  3IWE A;  1MJA A;  1IID A;  4UFW A;  4CGP A;  4B10 A;  3LOD A;  3TOA A;  3PZJ A;  4XPD B;  3FYN A;  1M4D A;  2CY2 A;  2PDO A;  2O28 A;  5JQ4 A;  2BEI A;  3H4Q A;  1YRE A;  4B5O A;  1S5K A;  3IU1 A;  3RYO A;  1RXT A;  1B87 A;  2ARH A;  4C7I A;  3FNC A;  3CXQ A;  4E8O A;  5JPH A;  5F47 A;  4MFP A;  1KUY A;  4AVB A;  1QSO A;  5AGE A;  3FXT A;  4CGN A;  1BOB A;  2Z3O A;  4R9M A;  5AG7 A;  4F6A A;  2A4N A;  2RC4 A;  4QUS A;  5J8C A;  5I0C A;  2FSR A;  4B14 A;  1M1D A;  1Z4R A;  1XEB A;  2HQY A;  3C26 A;  4Q38 A;  5KTC A;  5AG6 A;  5FVJ A;  2HUZ A;  4IF5 A;  4I49 A;  3EY5 A;  5GCN A;  3NE7 A;  1VHS A;  4IUS A;  4KUA A;  3R95 A;  4K30 A;  4KOW A;  4UFX A;  2Z3K A;  4Q36 A;  3F5B A;  3BJ8 A;  2Q44 A;  4JD6 A;  4CAF A;  2VBQ A;  5A28 A;  2PRB A;  3DR8 A;  4HNX B;  1YR0 A;  2JDC A;  2R1I A;  1YGH A;  2YNC C;  1Y9K A;  2Z3P A;  3F8K A;  2Z3N A;  4KLW A;  1SQH A;  3R1K A;  4ZGY B;  2R98 A;  5EBV A;  2P6F A;  2Q4V A;  4E2A A;  3DSB A;  3LD2 A;  4CYQ A;  4MFZ A;  4PSX A;  3R96 A;  4CAV A;  1CJW A;  5HMN A;  2AJ6 A;  4NSQ A;  5AG5 A;  4KOV A;  4KSA A;  1M44 A;  3BLN A;  4PSW A;  4H89 A;  2JLM A;  2WUU A;  3EXN A;  4LX9 A;  2FCK A;  2B5G A;  2Z3M A;  4CYO A;  4KOT A;  4KOS A;  2FL4 A;  4UBR A;  3H5Z A;  3V8I A;  2R7H A;  1QSN A;  2WPW A;  4QB9 A;  3SHP A;  4NF1 A;  3TFY A;  1QSR A;  3TOB A;  3S6H A;  1NE9 A;  1U6M A;  5DWN A;  4KVX A;  4UCM A;  5IV0 A;  1Q2D A;  3WR7 A;  1WWZ A;  1NMT A;  1K4J A;  2PR8 A;  4XPL A;  5HH1 A;  2J8R A;  3FBU A;  3FRM A;  1KZF A;  2YND A;  2PR1 A;  3TO6 A;  3JVN A;  2AE6 A;  5IX3 A;  4MFL A;  4CRY B;  3I3G A;  1IYK A;  2G3T A;  2B4B A;  3E0K A;  3P2H A;  1PU9 A;  2Q7B A;  4HNW B;  1I12 A;  1OZP A;  4R57 A;  1ON0 A;  4J3G A;  4UFV A;  4KOU A;  4CRZ B;  3VWD A;  4AVC A;  2CNT A;  2D4P A;  2DXQ A;  2PSW A;  1Y9W A;  4GS4 A;  3W91 A;  3S6G A;  2REE A;  3GYA A;  3IWG A;  3K9U A;  5G1Z A;  1S7L A;  4FD7 A;  5KTD A;  5G20 A;  3TCV A;  1XE4 A;  4A31 A;  2OB0 A;  4ZBG A;  1IIC A;  2DPT A;  4CYN A;  4MI4 A;  4PK2 A;  3CXP A;  3GY9 A;  2B5G B;  2YNE A;  3D2M A;  5F46 A;  3TE4 A;  1RO5 A;  2PC1 A;  1Q2C A;  5E96 A;  4AG9 A;  1QST A;  4KOR A;  2FS5 A;  2B58 A;  1KUV A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...