5AG4A

Crystal structure of leishmania major n-myristoyltransferase (nmt) with bound myristoyl-coa and a thiazolidinone ligand
Total Genus 120
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
120
sequence length
411
structure length
411
Chain Sequence
b'AHAFWSTQPVPQTEDETEKIVFAGPMDEPKTVADIPEEPYPIASTFEWWTPNMEAADDIHAIYELLRDNYVEDDDSMFRFNYSEEFLQWALCPPNYIPDWHVAVRRKADKKLLAFIAGVPVTLRMGTPKYMKVKAQEKGEGEEAAKYDEPRHICEINFLCVHKQLREKRLAPILIKEATRRVNRTNVWQAVYTAGVLLPTPYASGQYFHRSLNPEKLVEIRFSGIPAQYQKFQNPMAMLKRNYQLPSAPKNSGLREMKPSDVPQVRRILMNYLDSFDVGPVFSDAEISHYLLPRDGVVFTYVVENDKKVTDFFSFYRIPSTVIGNSNYNLLNAAYVHYYAATSIPLHQLILDLLIVAHSRGFDVCNMVEILDNRSFVEQLKFGAGDGHLRYYFYNWAYPKIKPSQVALVML'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords GLYCYLPEPTIDE N-TETRADECANOYLTRANSFERASE
publication title Development of Small-Molecule Trypanosoma Brucei N-Myristoyltransferase Inhibitors: Discovery and Optimisation of a Novel Binding Mode.
pubmed doi rcsb
source organism Leishmania major
molecule tags Transferase
total genus 120
structure length 411
sequence length 411
ec nomenclature ec 2.3.1.97: Glycylpeptide N-tetradecanoyltransferase.
pdb deposition date 2015-01-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01233 NMT Myristoyl-CoA:protein N-myristoyltransferase, N-terminal domain
A PF02799 NMT_C Myristoyl-CoA:protein N-myristoyltransferase, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.630.170 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Aminopeptidase 5ag4A00
4UCPA 2YNDA 2YNEA 4CGMA 4B12A 3IWEA 4CGOA 5G20A 4CAFA 5AG5A 4CYNA 4B11A 4B13A 2WUUA 4CAEA 5A27A 4CYPA 4C7IA 4A33A 3IU2A 4C2XA 4C7HA 5G1ZA 5A28A 4CGLA 4UFVA 5AG6A 4A32A 3IU1A 5G21A 4C2ZA 5G22A 3JTKA 5AG7A 4C2YA 4A31A 4CGPA 2YNCA 5AG4A 4BBHA 4UFWA 4B10A 4UCMA 4C68A 2WSAA 3H5ZA 4A30A 4CGNA 4A95A 4B14A 4CYQA 4CYOA 2YNCC 4UFXA 4UCNA 4A2ZA 5AGEA
chains in the Genus database with same CATH superfamily
4MCSA 2C27A 2EK8A 1YQEA 2EO8A 2PIYA 2JEWA 4JJXA 4OADA 4NGRA 1CP6A 2ZW5A 3WR7A 2AFWA 2POKA 5JM6A 2BUEA 1A2ZA 3TO9A 2OU2A 3PZJA 5A27A 4CYPA 4C7IA 1HDQA 4ZI6A 2GU2A 4UFVA 5AG6A 2GREA 2B5GB 2CY2A 2CIJA 4R9MA 2AE6A 2DEAA 5J8CA 2REEA 1VHSA 2CNMA 3FIXA 3D66A 3MRUA 3VATA 4A39A 4EFDA 2DF5A 1SQHA 2PVVA 3MGDA 4KVOE 1K4JA 4NEXA 3R95A 5BWAB 3K9UA 3PFOA 1S7NA 4KSFA 4G1PA 4UFWA 3VWDA 5JPHA 4QUSA 2WSAA 3KR4A 1I12A 4M6HA 3S6HA 4YRHA 2AFZA 1YR0A 3SJXA 1LANA 2F5IA 2AJ6A 5D29A 3EO4A 3CPXA 1TF9A 3IC1A 4TWEA 3FNCA 2ANPA 1WK4A 5F47A 3KR5A 4A37A 1JWQA 4P4IA 1BPMA 3LODA 1Z8TA 4PSWA 2PJ1A 3IU2A 1MJBA 1KZFA 1S7LA 4MI4A 3DGVA 3GKRA 2J8NA 1ZLIA 2PRQA 1CM0A 1YK3A 2RB7A 3TE4A 5AG7A 2R7HA 4L8AA 4MHNA 5EBVA 1TKFA 1ARLA 2I00A 3R9EA 4B5PA 3D7DA 2D4OA 1U6MA 2ZEHA 4R8FA 4C68A 3KQZA 3IIBA 4FWUA 3ZZIA 3SJEA 3DR6A 3VWEA 5IV0A 3FEEA 1IOFA 5LYIA 3E0KA 3TC8A 2Z3NA 4X3RA 1VHOA 2B4DB 2YNDA 3KGQA 4MCQA 4CYNA 2ZEMA 4F0XA 3P2HA 4Z65A 3QNVA 4MMOA 5DWNA 4MHPA 4XNHB 5K8OA 4R3LA 4R3KA 3RNZA 4JXRA 1MJAA 1XIXA 2P0WA 4R6TA 6CPAA 1S7FA 1B87A 3FRMA 4AVBA 2JDDA 5K8PA 1CX8A 1XOVA 5I4MA 1ZG9A 3H8EA 1Y7RA 2K5TA 1Z8LA 1IU8A 1GYTA 1I1DA 2C6PA 4GXHA 4H89A 1FY7A 3PP9A 5LRJA 3S6GA 4OC5A 1YVKA 1YW4A 4FAIA 4I49A 4P4EA 4B10A 5CPAA 4EVYA 3CZXA 3FH4A 2PR1A 4II9A 3F5BA 3BJ7A 4CAXA 2PIZA 4UFXA 4F8ZA 1Z8XA 1YLEA 3FXTA 3RO0A 3LD2A 2ZW4A 4QVTA 4ONWA 1NSAA 1IB1E 3TO6A 3VH9A 5KTAA 1YW6A 2Z3MA 2V8GA 1OZPA 2GLFA 1M4LA 1AYEA 1CPXA 4E0AA 2WUUA 2AFOA 4CRZB 2QECA 2PJAA 2PSWA 2Z11A 3LWUA 3FVLA 3T8WA 2Q51A 4P6YA 3BI0A 2FVGA 3TOAA 3PB8X 3UY5A 3B8GA 3IWWA 4NSQA 2WZNA 4PXCA 4X2TA 2BL1A 4Y49B 2GANA 2JBKA 2JBJA 1Y9WA 4OIWA 4BBHA 5AG4A 1XBUA 4UCMA 4GM5A 5FVJA 4CGNA 1PCAA 1J4JA 4AG7A 5KTDA 2OB0A 1BAVA 4FD5A 5AGEA 2FE7A 3S6FA 1KUXA 4CGMA 4B12A 3IWEA 3JRUA 1Q2YA 2B4BA 4B11A 5ELYA 4H6ZA 1DTDA 5H84A 3ZJ0A 4A33A 4MFZA 1NSLA 4CAVA 1HDUA 2ZELA 3R9FA 2VZYA 4NGPA 3DSBA 1S7KA 2Z0ZA 5DWMA 3SI0A 8CPAA 1BLLE 3DR8A 3IWGA 4NFRA 4A31A 4KUAA 4QB9A 4X8IA 4L89A 2J8RA 3NE8A 1VHEA 2EWBA 2R8VA 3KI9A 4R7MA 4P45A 4A30A 2Q0YA 1PU9A 2BSWA 2B3UA 3GUXA 4MXUA 1XFOA 1YMEA 2AFXA 2PRBA 2OZUA 2V8DA 3NH8A 3RZAA 3B3TA 5EMIA 3B3VA 1R57A 2PJ0A 3B2YA 4CGOA 1IIDA 4AVAA 4MHZA 4ZY2A 4B13A 3B3SA 4PXEA 1IGBA 1NMTA 2ZPAA 2Q04A 4LUAA 3D3SA 2RFHA 2F7VA 4M3SA 4F6AA 3CDXA 4UEEA 4KSIA 4P4BA 1F2PA 2OR4A 2QYVA 3EC4A 2NMTA 3H4QA 4FD4A 2C6CA 4KORA 4KOTA 4UBRA 2G0BA 2VEZA 4KOUA 4R87A 2FIWA 4CYOA 4M85A 3B3CA 2XEIA 1NE9A 2J8MA 4FUUA 4MFLA 4E8OA 3FX6A 3IFEA 4B5PB 4PPZA 4FD6A 5EC4A 4KVME 4XNHC 3PGPA 2XEGA 4QC6A 3JVNA 3SJGA 1S3ZA 4PK2A 5JGFA 5J8FA 4P10A 3KASA 5A28A 2B3VA 4W9YA 1I21A 5ISVA 3IGRA 2R98A 2QJ8A 4F9UA 4ORFA 4KOXA 4O23A 1TKHA 3QAYA 3R1KA 2FIAA 2FSRA 1Y0YA 2CNSA 1YREA 2V8HA 2DPSA 2Z3PA 4YU9A 4KOWA 3S6KA 2GFQA 2ZOGA 1R43A 4P4JA 2REFA 2HQYA 3LMSA 2XEFA 2ODFA 4OC2A 1FT7A 2Q7BA 2D4PA 2GLJA 5K8MA 1Z9UA 3I3GA 3B3WA 2HUZA 3KHZA 1LRZA 5IB0A 2IMOA 2YNEA 2CNTA 1ZLHA 1IY7A 2IQ6A 4NCZA 4A38A 4AVCA 4R57A 3CT9A 3GB0A 4P4DA 5HVFA 2VZZA 1HEEA 2C6GA 2VI7A 3K2KA 5I0CA 3HLPA 5JQ4A 3D7FA 2HB6A 4UEZA 2DPTA 4A32A 4UEFA 2PJCA 2PC1A 1UWYA 1CPSA 1YLOA 3QAHA 4NXYA 2BO9A 1MJ9A 2FT0A 4Y49C 1Z4RA 4C2YA 3FJUA 3GYAA 4CAWA 3D2MA 4ONUA 1BO4A 5K8NA 2Y0MA 2NYQA 2ZEOA 1LFWA 3BXMA 1CJWA 1Y0RA 3VARA 1PUAA 2PJBA 1XRYA 3DLJA 4RN7A 2OH1A 3H8GA 4F0YA 4HNXB 4FBEA 1RTQA 4MHDA 2Q4VA 4UA3A 2ZENA 4NJRA 3S9NA 2H5MA 1QSRA 3G8WA 4OIDA 4X5KA 4ZY1A 2BCOA 2ATRA 3GIUA 3NFZA 3DDDA 3FYNA 2QIRA 4MFJA 4MJ8A 2JDCA 5LYDA 1F57A 4F9VA 2PJ3A 1Q7LA 2OZGA 3LACA 4HNWB 4CPAA 1ELLP 1M44A 2RC4A 4JLYA 1BOBA 3V7ZA 3TTHA 1FNOA 5G22A 4EMEA 1WWZA 2ZEGA 4KLVA 2BOAA 2Z10A 3PBBA 1RXTA 3FBUA 4P44A 4MFPA 4RI1A 3KL9A 3CXQA 2DXQA 3KZWA 3NH4A 5F49A 5F48A 4M6IA 1LAMA 3NH5A 2Q44A 2I3CA 4LQGA 3G3SA 2P6FA 4A95A 1TKJA 1QMUA 1LOKA 1KUVA 4UCPA 5HVGA 4U9YA 5J1QA 4IK2A 3ISZA 4HKFA 5GCNA 1QSNA 5HXDA 1R3NA 4C2XA 1XE4A 4BD9A 2Q7SA 4HNYB 2XEJA 2Z3KA 5THWA 1N71A 2VL1A 1Y9KA 1CG2A 4OC1A 3TX8A 3KHXA 3DNSA 4BMHA 2FCKA 3V8IA 4KUBA 4AG9A 4DYOA 4CGPA 4MY0A 3D7GA 4H6UA 3W6SA 4U9ZA 4MBUA 4DUKA 4ZGYB 1XEBA 2A4NA 2O53A 4KVXA 4PXDA 5IX3A 4CYQA 1L0CA 2Z3LA 3PRTA 4KOVA 2EK9A 2V77A 4M6GA 3H8FA 1ARMA 3D67A 4IUSA 4OP4A 2PJ8A 1RO5A 4Q36A 5HH1A 2PJ7A 4JZ0A 5F09A 3BLNA 3WC7A 1YSJA 4ZX8A 4XPLA 1XMBA 4TNUA 2PQ8A 2KCWA 2G3AA 4PQAA 1ZG7A 2Q43A 4JWPA 3D68A 4P4FA 3RAMA 2YNCA 2IJZA 2HV2A 1LCPA 1YGHA 4K3NA 2ZEPA 3H5ZA 3PFEA 4FD7A 3SJFA 3NE7A 1CBXA 2PDOA 2PJ2A 4A2ZA 4LQ6A 2PE3A 2OOTA 3IEHA 3R9GA 3SI2A 3TT2A 3WC5A 1XMTA 4YWYA 2CXAA 5C88A 3L2NA 2AFMA 2ZW6A 2ZW7A 4OAEA 5AG5A 5G20A 4B6ZA 2EUIA 3A9LA 4GS4A 4UWJA 1IYLA 2AFUA 2X7BA 1EE3P 2FXFA 4CGLA 3PB6X 3IU1A 5G21A 1YVOA 2HC9A 3TOBA 3JTKA 2C1CA 3D8PA 4NGSA 3N7ZA 1ELMP 2FS5A 3TCVA 1B6BA 4XPKA 2GE3A 3GLJA 1AMPA 4DJLA 5LRKA 2PJ6A 5LYLA 2VBQA 2O4HA 3SI1A 3BHXA 2QVPA 1BPNA 4RS2A 1CP7A 3KQXA 3PB9X 2VXKA 2WYRA 3FECA 1V0CA 4LX9A 2B5GA 2G3TA 1Z2LA 2F8HA 3F0AA 5LYFA 2ZEEA 3HUVA 1M4DA 4KSAA 5D8NA 3W6XA 2WPXA 4PK3A 4MY3A 5C82A 4AB7A 4J3GA 5F46A 2PJ5A 3SXNA 1AUGA 1TXRA 4DNCA 3I9SA 1Q2CA 1VGYA 1GHEA 3PB7X 3F8KA 3P2FA 2OZHA 4E2AA 3BI1A 2B58A 5LRGA 4MFKA 4OLLA 2VQYA 1PYTB 4OC4A 3SXOA 2GIVA 4MCPA 1XF8A 3ISXA 4NJQA 4UF4A 4QBJA 4PXBA 2EVNA 2JLMA 4NGTA 5KTCA 2AFSA 2YGWA 4MFQA 4UIBA 1P0HA 1QSMA 4BINA 4CAFA 2PCUA 3EXNA 1KWMA 1M1DA 1ON0A 3WC6A 1IYKA 2CTCA 1LAPA 2FL4A 2Z3OA 5G1ZA 3SHPA 3TO7A 1TIQA 4ZYQA 3MN8A 4Q38A 4UWIA 1VKCA 1X12A 4R76A 3W91A 3QB8A 4NGQA 1XJOA 3WT4A 2ZEDA 3FMCA 1H8LA 2J9AA 2B4DA 3RBUA 5DS0A 1Y7EA 2JEVA 3T90A 3N5FA 4MRIA 3CXPA 3S9LA 4NGMA 3K9TA 4NF1A 4JD6A 4NGNA 1TF8A 5H86A 1S60A 4KS9A 2ZEFA 4Q7AA 3BJ8A 2YNCC 1F2OA 4IAVA 1ZO0A 4UCNA 3B35A 2CTBA 4OKOA 3S9MA 3R96A 4XPDC 1KUYA 2O28A 4PSXA 2EBJA 3NA6A 3FEDA 2WPWA 3FF3A 3IJ3A 1DE4C 4IF5A 1ZG8A 2Q4YA 3D2PA 4ZX9A 1MK4A 7CPAA 3KKWA 4C7HA 4KZTA 4ZBGA 2I79A 4KOSA 2QMLA 2PJ4A 4WWVA 3RYOA 4KOYA 5E96A 4C2ZA 2ZXVA 2CF4A 3CXSA 4JYWA 4OC3A 1IICA 4OMEA 4MCRA 1VIXA 1S5KA 3V38A 5HVHA 1Z8WA 4RUHA 3FB3A 5CBMA 3D7HA 3PBEA 1IOIA 4YFJA 3I1UA 1JQGA 2PVWA 3EFAA 4MHYA 1P4NA 2Q4ZA 1Q2DA 3C26A 3IO1A 3GY9A 5JH9A 4HPSA 4KLWA 2R1IA 3JUWA 1M4IA 3WABA 4PV6A 1Z4EA 3PEIA 3B7IA 1QSOA 2PJ9A 4EWTA 4AXVA 2NSMA 5IB9A 4CAEA 3OWCA 4K30A 3CPAA 1Z5RA 4XPDB 3T9YA 2ABZA 4A94A 4B5OA 5HMNA 2PR8A 4H2KA 1QSTA 3TFYA 4IHMA 3EY5A 4CRYB 2G9DA 2ARHA 4JXQA 4UIAA 4OC0A 1UFHA 2P6EA 2BEIA 4CS0B 2ZOFA 1OBRA 1X10A 4ZY0A 1M4GA 4WJBA 5CNPA 4B14A 1YX0A 1QQ9A 3D4UA 3PB4X 2P6GA 4U5YA 2V8VA 2IL4A 4YGOA
chains in the Genus database with same CATH topology
2C27A 4OADA 4JJXA 2ZW5A 3WR7A 2BUEA 3TO9A 2OU2A 3PZJA 5A27A 4CYPA 4C7IA 4UFVA 5AG6A 2B5GB 2CY2A 4R9MA 2AE6A 5J8CA 2REEA 1VHSA 2CNMA 3FIXA 1SQHA 3MGDA 4NEXA 4KVOE 1K4JA 3R95A 5BWAB 3K9UA 1S7NA 4KSFA 4UFWA 3VWDA 5JPHA 4QUSA 2WSAA 1I12A 3S6HA 4YRHA 1YR0A 2F5IA 2AJ6A 3EO4A 3FNCA 5F47A 1WK4A 3LODA 4PSWA 3IU2A 1MJBA 1KZFA 1S7LA 4MI4A 3GKRA 2J8NA 1CM0A 1YK3A 3TE4A 5AG7A 2R7HA 4L8AA 5EBVA 2I00A 3R9EA 4B5PA 2D4OA 1U6MA 4C68A 3ZZIA 3DR6A 3VWEA 5IV0A 3E0KA 2Z3NA 2B4DB 2YNDA 4CYNA 4F0XA 3P2HA 5DWNA 4XNHB 4R3LA 4R3KA 4JXRA 1MJAA 1XIXA 2P0WA 1S7FA 1B87A 3FRMA 4AVBA 2JDDA 1Y7RA 2K5TA 4H89A 1I1DA 1FY7A 3PP9A 3S6GA 1YVKA 4I49A 4B10A 4EVYA 2PR1A 4II9A 3F5BA 3BJ7A 4CAXA 4UFXA 1YLEA 3FXTA 3LD2A 2ZW4A 4QVTA 3TO6A 5KTAA 1IB1E 2Z3MA 1OZPA 4E0AA 2WUUA 4CRZB 2QECA 2PSWA 2Z11A 3TOAA 3UY5A 3B8GA 4NSQA 2BL1A 4Y49B 2GANA 5AG4A 4BBHA 1Y9WA 4UCMA 5FVJA 4CGNA 5KTDA 1J4JA 4AG7A 2OB0A 4FD5A 5AGEA 2FE7A 3S6FA 1KUXA 4CGMA 4B12A 3IWEA 1Q2YA 2B4BA 4B11A 4H6ZA 3ZJ0A 4A33A 4MFZA 1NSLA 4CAVA 3R9FA 2VZYA 3DSBA 1S7KA 2Z0ZA 5DWMA 3DR8A 3IWGA 4A31A 4KUAA 4QB9A 4L89A 2J8RA 2R8VA 4A30A 2Q0YA 1PU9A 2BSWA 2B3UA 5H84A 2PRBA 2OZUA 1R57A 4CGOA 1IIDA 4AVAA 4B13A 1NMTA 2ZPAA 2Q04A 4LUAA 3D3SA 4M3SA 4F6AA 3EC4A 2NMTA 3H4QA 4FD4A 4KORA 4KOTA 4UBRA 2G0BA 2VEZA 4KOUA 4R87A 2FIWA 4CYOA 4M85A 1NE9A 2J8MA 4MFLA 4E8OA 4B5PB 4FD6A 5EC4A 4KVME 4XNHC 3PGPA 4QC6A 3JVNA 1S3ZA 4PK2A 5J8FA 5A28A 2B3VA 1I21A 5ISVA 3IGRA 2R98A 4ORFA 4KOXA 3R1KA 2FIAA 2CNSA 2FSRA 1YREA 2DPSA 2Z3PA 4KOWA 3S6KA 2REFA 2HQYA 2Q7BA 2D4PA 1Z9UA 3I3GA 2HUZA 1LRZA 5IB0A 2YNEA 2CNTA 4NCZA 4AVCA 4R57A 2VZZA 2VI7A 5I0CA 5JQ4A 2DPTA 4A32A 2PC1A 4NXYA 3QAHA 4C2YA 1MJ9A 2FT0A 4Y49C 1Z4RA 3GYAA 4CAWA 3D2MA 4ONUA 1BO4A 2Y0MA 1CJWA 1PUAA 2OH1A 4F0YA 4HNXB 4MHDA 2Q4VA 4UA3A 2H5MA 1QSRA 3G8WA 4X5KA 2ATRA 3DDDA 3FYNA 2QIRA 4MFJA 4MJ8A 2JDCA 2OZGA 4HNWB 1M44A 2RC4A 4JLYA 1BOBA 3TTHA 5G22A 1WWZA 4KLVA 2Z10A 1RXTA 3FBUA 4RI1A 4MFPA 3CXQA 2DXQA 5F49A 5F48A 2Q44A 4A95A 3G3SA 2P6FA 1KUVA 4UCPA 4U9YA 4HKFA 5GCNA 1QSNA 4C2XA 1XE4A 4HNYB 2Z3KA 1N71A 1Y9KA 3DNSA 4BMHA 2FCKA 3V8IA 4KUBA 4AG9A 4CGPA 4MY0A 4H6UA 3W6SA 4U9ZA 4MBUA 4ZGYB 1XEBA 2A4NA 4KVXA 5IX3A 4CYQA 1L0CA 2Z3LA 4KOVA 4IUSA 1RO5A 4Q36A 5HH1A 3BLNA 4XPLA 2PQ8A 2KCWA 2G3AA 4JWPA 2YNCA 2HV2A 1YGHA 3H5ZA 4FD7A 3NE7A 2PDOA 4A2ZA 3R9GA 3TT2A 1XMTA 2CXAA 5C88A 2ZW6A 2ZW7A 5AG5A 4OAEA 5G20A 4GS4A 2EUIA 3A9LA 4UWJA 1IYLA 2X7BA 2FXFA 4CGLA 3IU1A 5G21A 1YVOA 3TOBA 3JTKA 3D8PA 3N7ZA 2FS5A 3TCVA 1B6BA 4XPKA 2GE3A 2VBQA 4RS2A 2VXKA 1V0CA 4LX9A 2B5GA 2G3TA 3F0AA 1M4DA 4KSAA 3W6XA 2WPXA 4PK3A 4MY3A 5C82A 4AB7A 4J3GA 5F46A 3SXNA 4DNCA 3I9SA 1Q2CA 1GHEA 3F8KA 3P2FA 2OZHA 4E2AA 2B58A 4MFKA 4OLLA 2VQYA 3SXOA 2GIVA 1XF8A 4QBJA 2EVNA 2JLMA 5KTCA 2YGWA 4MFQA 1P0HA 1QSMA 4CAFA 3EXNA 1M1DA 1ON0A 1IYKA 2FL4A 2Z3OA 5G1ZA 3SHPA 3TO7A 1TIQA 4Q38A 4UWIA 1VKCA 3W91A 3QB8A 2B4DA 2JEVA 3T90A 3CXPA 4NF1A 4JD6A 5H86A 1S60A 4KS9A 3BJ8A 2YNCC 4UCNA 1ZO0A 3R96A 4XPDC 1KUYA 2O28A 4PSXA 2WPWA 4IF5A 2Q4YA 3D2PA 1MK4A 3KKWA 4C7HA 4KZTA 4ZBGA 2I79A 4KOSA 2QMLA 3RYOA 4KOYA 5E96A 4C2ZA 2ZXVA 3CXSA 1IICA 1S5KA 3FB3A 4YFJA 3EFAA 1P4NA 1Q2DA 3C26A 3GY9A 4KLWA 2R1IA 3JUWA 1M4IA 1Z4EA 1QSOA 4CAEA 3OWCA 4K30A 3T9YA 4B5OA 4XPDB 5HMNA 2PR8A 1QSTA 3TFYA 3EY5A 4CRYB 2ARHA 4JXQA 1UFHA 2P6EA 2BEIA 4CS0B 1M4GA 5CNPA 4B14A 1YX0A 4U5YA 4PV6A 2P6GA 2IL4A 4YGOA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4UCP A;  2YND A;  2YNE A;  4CGM A;  4B12 A;  3IWE A;  4CGO A;  5G20 A;  4CAF A;  5AG5 A;  4CYN A;  4B11 A;  4B13 A;  2WUU A;  4CAE A;  5A27 A;  4CYP A;  4C7I A;  4A33 A;  3IU2 A;  4C2X A;  4C7H A;  5G1Z A;  5A28 A;  4CGL A;  4UFV A;  5AG6 A;  4A32 A;  3IU1 A;  5G21 A;  4C2Z A;  5G22 A;  3JTK A;  5AG7 A;  4C2Y A;  4A31 A;  4CGP A;  2YNC A;  5AG4 A;  4BBH A;  4UFW A;  4B10 A;  4UCM A;  4C68 A;  2WSA A;  3H5Z A;  4A30 A;  4CGN A;  4A95 A;  4B14 A;  4CYQ A;  4CYO A;  2YNC C;  4UFX A;  4UCN A;  4A2Z A;  5AGE A; 
#chains in the Genus database with same CATH topology
 4MCS A;  2C27 A;  2EK8 A;  1YQE A;  2EO8 A;  2PIY A;  2JEW A;  4JJX A;  4OAD A;  4NGR A;  1CP6 A;  2ZW5 A;  3WR7 A;  2AFW A;  2POK A;  5JM6 A;  2BUE A;  1A2Z A;  3TO9 A;  2OU2 A;  3PZJ A;  5A27 A;  4CYP A;  4C7I A;  1HDQ A;  4ZI6 A;  2GU2 A;  4UFV A;  5AG6 A;  2GRE A;  2B5G B;  2CY2 A;  2CIJ A;  4R9M A;  2AE6 A;  2DEA A;  5J8C A;  2REE A;  1VHS A;  2CNM A;  3FIX A;  3D66 A;  3MRU A;  3VAT A;  4A39 A;  4EFD A;  2DF5 A;  1SQH A;  2PVV A;  3MGD A;  4KVO E;  1K4J A;  4NEX A;  3R95 A;  5BWA B;  3K9U A;  3PFO A;  1S7N A;  4KSF A;  4G1P A;  4UFW A;  3VWD A;  5JPH A;  4QUS A;  2WSA A;  3KR4 A;  1I12 A;  4M6H A;  3S6H A;  4YRH A;  2AFZ A;  1YR0 A;  3SJX A;  1LAN A;  2F5I A;  2AJ6 A;  5D29 A;  3EO4 A;  3CPX A;  1TF9 A;  3IC1 A;  4TWE A;  3FNC A;  2ANP A;  1WK4 A;  5F47 A;  3KR5 A;  4A37 A;  1JWQ A;  4P4I A;  1BPM A;  3LOD A;  1Z8T A;  4PSW A;  2PJ1 A;  3IU2 A;  1MJB A;  1KZF A;  1S7L A;  4MI4 A;  3DGV A;  3GKR A;  2J8N A;  1ZLI A;  2PRQ A;  1CM0 A;  1YK3 A;  2RB7 A;  3TE4 A;  5AG7 A;  2R7H A;  4L8A A;  4MHN A;  5EBV A;  1TKF A;  1ARL A;  2I00 A;  3R9E A;  4B5P A;  3D7D A;  2D4O A;  1U6M A;  2ZEH A;  4R8F A;  4C68 A;  3KQZ A;  3IIB A;  4FWU A;  3ZZI A;  3SJE A;  3DR6 A;  3VWE A;  5IV0 A;  3FEE A;  1IOF A;  5LYI A;  3E0K A;  3TC8 A;  2Z3N A;  4X3R A;  1VHO A;  2B4D B;  2YND A;  3KGQ A;  4MCQ A;  4CYN A;  2ZEM A;  4F0X A;  3P2H A;  4Z65 A;  3QNV A;  4MMO A;  5DWN A;  4MHP A;  4XNH B;  5K8O A;  4R3L A;  4R3K A;  3RNZ A;  4JXR A;  1MJA A;  1XIX A;  2P0W A;  4R6T A;  6CPA A;  1S7F A;  1B87 A;  3FRM A;  4AVB A;  2JDD A;  5K8P A;  1CX8 A;  1XOV A;  5I4M A;  1ZG9 A;  3H8E A;  1Y7R A;  2K5T A;  1Z8L A;  1IU8 A;  1GYT A;  1I1D A;  2C6P A;  4GXH A;  4H89 A;  1FY7 A;  3PP9 A;  5LRJ A;  3S6G A;  4OC5 A;  1YVK A;  1YW4 A;  4FAI A;  4I49 A;  4P4E A;  4B10 A;  5CPA A;  4EVY A;  3CZX A;  3FH4 A;  2PR1 A;  4II9 A;  3F5B A;  3BJ7 A;  4CAX A;  2PIZ A;  4UFX A;  4F8Z A;  1Z8X A;  1YLE A;  3FXT A;  3RO0 A;  3LD2 A;  2ZW4 A;  4QVT A;  4ONW A;  1NSA A;  1IB1 E;  3TO6 A;  3VH9 A;  5KTA A;  1YW6 A;  2Z3M A;  2V8G A;  1OZP A;  2GLF A;  1M4L A;  1AYE A;  1CPX A;  4E0A A;  2WUU A;  2AFO A;  4CRZ B;  2QEC A;  2PJA A;  2PSW A;  2Z11 A;  3LWU A;  3FVL A;  3T8W A;  2Q51 A;  4P6Y A;  3BI0 A;  2FVG A;  3TOA A;  3PB8 X;  3UY5 A;  3B8G A;  3IWW A;  4NSQ A;  2WZN A;  4PXC A;  4X2T A;  2BL1 A;  4Y49 B;  2GAN A;  2JBK A;  2JBJ A;  1Y9W A;  4OIW A;  4BBH A;  5AG4 A;  1XBU A;  4UCM A;  4GM5 A;  5FVJ A;  4CGN A;  1PCA A;  1J4J A;  4AG7 A;  5KTD A;  2OB0 A;  1BAV A;  4FD5 A;  5AGE A;  2FE7 A;  3S6F A;  1KUX A;  4CGM A;  4B12 A;  3IWE A;  3JRU A;  1Q2Y A;  2B4B A;  4B11 A;  5ELY A;  4H6Z A;  1DTD A;  5H84 A;  3ZJ0 A;  4A33 A;  4MFZ A;  1NSL A;  4CAV A;  1HDU A;  2ZEL A;  3R9F A;  2VZY A;  4NGP A;  3DSB A;  1S7K A;  2Z0Z A;  5DWM A;  3SI0 A;  8CPA A;  1BLL E;  3DR8 A;  3IWG A;  4NFR A;  4A31 A;  4KUA A;  4QB9 A;  4X8I A;  4L89 A;  2J8R A;  3NE8 A;  1VHE A;  2EWB A;  2R8V A;  3KI9 A;  4R7M A;  4P45 A;  4A30 A;  2Q0Y A;  1PU9 A;  2BSW A;  2B3U A;  3GUX A;  4MXU A;  1XFO A;  1YME A;  2AFX A;  2PRB A;  2OZU A;  2V8D A;  3NH8 A;  3RZA A;  3B3T A;  5EMI A;  3B3V A;  1R57 A;  2PJ0 A;  3B2Y A;  4CGO A;  1IID A;  4AVA A;  4MHZ A;  4ZY2 A;  4B13 A;  3B3S A;  4PXE A;  1IGB A;  1NMT A;  2ZPA A;  2Q04 A;  4LUA A;  3D3S A;  2RFH A;  2F7V A;  4M3S A;  4F6A A;  3CDX A;  4UEE A;  4KSI A;  4P4B A;  1F2P A;  2OR4 A;  2QYV A;  3EC4 A;  2NMT A;  3H4Q A;  4FD4 A;  2C6C A;  4KOR A;  4KOT A;  4UBR A;  2G0B A;  2VEZ A;  4KOU A;  4R87 A;  2FIW A;  4CYO A;  4M85 A;  3B3C A;  2XEI A;  1NE9 A;  2J8M A;  4FUU A;  4MFL A;  4E8O A;  3FX6 A;  3IFE A;  4B5P B;  4PPZ A;  4FD6 A;  5EC4 A;  4KVM E;  4XNH C;  3PGP A;  2XEG A;  4QC6 A;  3JVN A;  3SJG A;  1S3Z A;  4PK2 A;  5JGF A;  5J8F A;  4P10 A;  3KAS A;  5A28 A;  2B3V A;  4W9Y A;  1I21 A;  5ISV A;  3IGR A;  2R98 A;  2QJ8 A;  4F9U A;  4ORF A;  4KOX A;  4O23 A;  1TKH A;  3QAY A;  3R1K A;  2FIA A;  2FSR A;  1Y0Y A;  2CNS A;  1YRE A;  2V8H A;  2DPS A;  2Z3P A;  4YU9 A;  4KOW A;  3S6K A;  2GFQ A;  2ZOG A;  1R43 A;  4P4J A;  2REF A;  2HQY A;  3LMS A;  2XEF A;  2ODF A;  4OC2 A;  1FT7 A;  2Q7B A;  2D4P A;  2GLJ A;  5K8M A;  1Z9U A;  3I3G A;  3B3W A;  2HUZ A;  3KHZ A;  1LRZ A;  5IB0 A;  2IMO A;  2YNE A;  2CNT A;  1ZLH A;  1IY7 A;  2IQ6 A;  4NCZ A;  4A38 A;  4AVC A;  4R57 A;  3CT9 A;  3GB0 A;  4P4D A;  5HVF A;  2VZZ A;  1HEE A;  2C6G A;  2VI7 A;  3K2K A;  5I0C A;  3HLP A;  5JQ4 A;  3D7F A;  2HB6 A;  4UEZ A;  2DPT A;  4A32 A;  4UEF A;  2PJC A;  2PC1 A;  1UWY A;  1CPS A;  1YLO A;  3QAH A;  4NXY A;  2BO9 A;  1MJ9 A;  2FT0 A;  4Y49 C;  1Z4R A;  4C2Y A;  3FJU A;  3GYA A;  4CAW A;  3D2M A;  4ONU A;  1BO4 A;  5K8N A;  2Y0M A;  2NYQ A;  2ZEO A;  1LFW A;  3BXM A;  1CJW A;  1Y0R A;  3VAR A;  1PUA A;  2PJB A;  1XRY A;  3DLJ A;  4RN7 A;  2OH1 A;  3H8G A;  4F0Y A;  4HNX B;  4FBE A;  1RTQ A;  4MHD A;  2Q4V A;  4UA3 A;  2ZEN A;  4NJR A;  3S9N A;  2H5M A;  1QSR A;  3G8W A;  4OID A;  4X5K A;  4ZY1 A;  2BCO A;  2ATR A;  3GIU A;  3NFZ A;  3DDD A;  3FYN A;  2QIR A;  4MFJ A;  4MJ8 A;  2JDC A;  5LYD A;  1F57 A;  4F9V A;  2PJ3 A;  1Q7L A;  2OZG A;  3LAC A;  4HNW B;  4CPA A;  1ELL P;  1M44 A;  2RC4 A;  4JLY A;  1BOB A;  3V7Z A;  3TTH A;  1FNO A;  5G22 A;  4EME A;  1WWZ A;  2ZEG A;  4KLV A;  2BOA A;  2Z10 A;  3PBB A;  1RXT A;  3FBU A;  4P44 A;  4MFP A;  4RI1 A;  3KL9 A;  3CXQ A;  2DXQ A;  3KZW A;  3NH4 A;  5F49 A;  5F48 A;  4M6I A;  1LAM A;  3NH5 A;  2Q44 A;  2I3C A;  4LQG A;  3G3S A;  2P6F A;  4A95 A;  1TKJ A;  1QMU A;  1LOK A;  1KUV A;  4UCP A;  5HVG A;  4U9Y A;  5J1Q A;  4IK2 A;  3ISZ A;  4HKF A;  5GCN A;  1QSN A;  5HXD A;  1R3N A;  4C2X A;  1XE4 A;  4BD9 A;  2Q7S A;  4HNY B;  2XEJ A;  2Z3K A;  5THW A;  1N71 A;  2VL1 A;  1Y9K A;  1CG2 A;  4OC1 A;  3TX8 A;  3KHX A;  3DNS A;  4BMH A;  2FCK A;  3V8I A;  4KUB A;  4AG9 A;  4DYO A;  4CGP A;  4MY0 A;  3D7G A;  4H6U A;  3W6S A;  4U9Z A;  4MBU A;  4DUK A;  4ZGY B;  1XEB A;  2A4N A;  2O53 A;  4KVX A;  4PXD A;  5IX3 A;  4CYQ A;  1L0C A;  2Z3L A;  3PRT A;  4KOV A;  2EK9 A;  2V77 A;  4M6G A;  3H8F A;  1ARM A;  3D67 A;  4IUS A;  4OP4 A;  2PJ8 A;  1RO5 A;  4Q36 A;  5HH1 A;  2PJ7 A;  4JZ0 A;  5F09 A;  3BLN A;  3WC7 A;  1YSJ A;  4ZX8 A;  4XPL A;  1XMB A;  4TNU A;  2PQ8 A;  2KCW A;  2G3A A;  4PQA A;  1ZG7 A;  2Q43 A;  4JWP A;  3D68 A;  4P4F A;  3RAM A;  2YNC A;  2IJZ A;  2HV2 A;  1LCP A;  1YGH A;  4K3N A;  2ZEP A;  3H5Z A;  3PFE A;  4FD7 A;  3SJF A;  3NE7 A;  1CBX A;  2PDO A;  2PJ2 A;  4A2Z A;  4LQ6 A;  2PE3 A;  2OOT A;  3IEH A;  3R9G A;  3SI2 A;  3TT2 A;  3WC5 A;  1XMT A;  4YWY A;  2CXA A;  5C88 A;  3L2N A;  2AFM A;  2ZW6 A;  2ZW7 A;  4OAE A;  5AG5 A;  5G20 A;  4B6Z A;  2EUI A;  3A9L A;  4GS4 A;  4UWJ A;  1IYL A;  2AFU A;  2X7B A;  1EE3 P;  2FXF A;  4CGL A;  3PB6 X;  3IU1 A;  5G21 A;  1YVO A;  2HC9 A;  3TOB A;  3JTK A;  2C1C A;  3D8P A;  4NGS A;  3N7Z A;  1ELM P;  2FS5 A;  3TCV A;  1B6B A;  4XPK A;  2GE3 A;  3GLJ A;  1AMP A;  4DJL A;  5LRK A;  2PJ6 A;  5LYL A;  2VBQ A;  2O4H A;  3SI1 A;  3BHX A;  2QVP A;  1BPN A;  4RS2 A;  1CP7 A;  3KQX A;  3PB9 X;  2VXK A;  2WYR A;  3FEC A;  1V0C A;  4LX9 A;  2B5G A;  2G3T A;  1Z2L A;  2F8H A;  3F0A A;  5LYF A;  2ZEE A;  3HUV A;  1M4D A;  4KSA A;  5D8N A;  3W6X A;  2WPX A;  4PK3 A;  4MY3 A;  5C82 A;  4AB7 A;  4J3G A;  5F46 A;  2PJ5 A;  3SXN A;  1AUG A;  1TXR A;  4DNC A;  3I9S A;  1Q2C A;  1VGY A;  1GHE A;  3PB7 X;  3F8K A;  3P2F A;  2OZH A;  4E2A A;  3BI1 A;  2B58 A;  5LRG A;  4MFK A;  4OLL A;  2VQY A;  1PYT B;  4OC4 A;  3SXO A;  2GIV A;  4MCP A;  1XF8 A;  3ISX A;  4NJQ A;  4UF4 A;  4QBJ A;  4PXB A;  2EVN A;  2JLM A;  4NGT A;  5KTC A;  2AFS A;  2YGW A;  4MFQ A;  4UIB A;  1P0H A;  1QSM A;  4BIN A;  4CAF A;  2PCU A;  3EXN A;  1KWM A;  1M1D A;  1ON0 A;  3WC6 A;  1IYK A;  2CTC A;  1LAP A;  2FL4 A;  2Z3O A;  5G1Z A;  3SHP A;  3TO7 A;  1TIQ A;  4ZYQ A;  3MN8 A;  4Q38 A;  4UWI A;  1VKC A;  1X12 A;  4R76 A;  3W91 A;  3QB8 A;  4NGQ A;  1XJO A;  3WT4 A;  2ZED A;  3FMC A;  1H8L A;  2J9A A;  2B4D A;  3RBU A;  5DS0 A;  1Y7E A;  2JEV A;  3T90 A;  3N5F A;  4MRI A;  3CXP A;  3S9L A;  4NGM A;  3K9T A;  4NF1 A;  4JD6 A;  4NGN A;  1TF8 A;  5H86 A;  1S60 A;  4KS9 A;  2ZEF A;  4Q7A A;  3BJ8 A;  2YNC C;  1F2O A;  4IAV A;  1ZO0 A;  4UCN A;  3B35 A;  2CTB A;  4OKO A;  3S9M A;  3R96 A;  4XPD C;  1KUY A;  2O28 A;  4PSX A;  2EBJ A;  3NA6 A;  3FED A;  2WPW A;  3FF3 A;  3IJ3 A;  1DE4 C;  4IF5 A;  1ZG8 A;  2Q4Y A;  3D2P A;  4ZX9 A;  1MK4 A;  7CPA A;  3KKW A;  4C7H A;  4KZT A;  4ZBG A;  2I79 A;  4KOS A;  2QML A;  2PJ4 A;  4WWV A;  3RYO A;  4KOY A;  5E96 A;  4C2Z A;  2ZXV A;  2CF4 A;  3CXS A;  4JYW A;  4OC3 A;  1IIC A;  4OME A;  4MCR A;  1VIX A;  1S5K A;  3V38 A;  5HVH A;  1Z8W A;  4RUH A;  3FB3 A;  5CBM A;  3D7H A;  3PBE A;  1IOI A;  4YFJ A;  3I1U A;  1JQG A;  2PVW A;  3EFA A;  4MHY A;  1P4N A;  2Q4Z A;  1Q2D A;  3C26 A;  3IO1 A;  3GY9 A;  5JH9 A;  4HPS A;  4KLW A;  2R1I A;  3JUW A;  1M4I A;  3WAB A;  4PV6 A;  1Z4E A;  3PEI A;  3B7I A;  1QSO A;  2PJ9 A;  4EWT A;  4AXV A;  2NSM A;  5IB9 A;  4CAE A;  3OWC A;  4K30 A;  3CPA A;  1Z5R A;  4XPD B;  3T9Y A;  2ABZ A;  4A94 A;  4B5O A;  5HMN A;  2PR8 A;  4H2K A;  1QST A;  3TFY A;  4IHM A;  3EY5 A;  4CRY B;  2G9D A;  2ARH A;  4JXQ A;  4UIA A;  4OC0 A;  1UFH A;  2P6E A;  2BEI A;  4CS0 B;  2ZOF A;  1OBR A;  1X10 A;  4ZY0 A;  1M4G A;  4WJB A;  5CNP A;  4B14 A;  1YX0 A;  1QQ9 A;  3D4U A;  3PB4 X;  2P6G A;  4U5Y A;  2V8V A;  2IL4 A;  4YGO A; 
#chains in the Genus database with same CATH homology
 2C27 A;  4OAD A;  4JJX A;  2ZW5 A;  3WR7 A;  2BUE A;  3TO9 A;  2OU2 A;  3PZJ A;  5A27 A;  4CYP A;  4C7I A;  4UFV A;  5AG6 A;  2B5G B;  2CY2 A;  4R9M A;  2AE6 A;  5J8C A;  2REE A;  1VHS A;  2CNM A;  3FIX A;  1SQH A;  3MGD A;  4NEX A;  4KVO E;  1K4J A;  3R95 A;  5BWA B;  3K9U A;  1S7N A;  4KSF A;  4UFW A;  3VWD A;  5JPH A;  4QUS A;  2WSA A;  1I12 A;  3S6H A;  4YRH A;  1YR0 A;  2F5I A;  2AJ6 A;  3EO4 A;  3FNC A;  5F47 A;  1WK4 A;  3LOD A;  4PSW A;  3IU2 A;  1MJB A;  1KZF A;  1S7L A;  4MI4 A;  3GKR A;  2J8N A;  1CM0 A;  1YK3 A;  3TE4 A;  5AG7 A;  2R7H A;  4L8A A;  5EBV A;  2I00 A;  3R9E A;  4B5P A;  2D4O A;  1U6M A;  4C68 A;  3ZZI A;  3DR6 A;  3VWE A;  5IV0 A;  3E0K A;  2Z3N A;  2B4D B;  2YND A;  4CYN A;  4F0X A;  3P2H A;  5DWN A;  4XNH B;  4R3L A;  4R3K A;  4JXR A;  1MJA A;  1XIX A;  2P0W A;  1S7F A;  1B87 A;  3FRM A;  4AVB A;  2JDD A;  1Y7R A;  2K5T A;  4H89 A;  1I1D A;  1FY7 A;  3PP9 A;  3S6G A;  1YVK A;  4I49 A;  4B10 A;  4EVY A;  2PR1 A;  4II9 A;  3F5B A;  3BJ7 A;  4CAX A;  4UFX A;  1YLE A;  3FXT A;  3LD2 A;  2ZW4 A;  4QVT A;  3TO6 A;  5KTA A;  1IB1 E;  2Z3M A;  1OZP A;  4E0A A;  2WUU A;  4CRZ B;  2QEC A;  2PSW A;  2Z11 A;  3TOA A;  3UY5 A;  3B8G A;  4NSQ A;  2BL1 A;  4Y49 B;  2GAN A;  5AG4 A;  4BBH A;  1Y9W A;  4UCM A;  5FVJ A;  4CGN A;  5KTD A;  1J4J A;  4AG7 A;  2OB0 A;  4FD5 A;  5AGE A;  2FE7 A;  3S6F A;  1KUX A;  4CGM A;  4B12 A;  3IWE A;  1Q2Y A;  2B4B A;  4B11 A;  4H6Z A;  3ZJ0 A;  4A33 A;  4MFZ A;  1NSL A;  4CAV A;  3R9F A;  2VZY A;  3DSB A;  1S7K A;  2Z0Z A;  5DWM A;  3DR8 A;  3IWG A;  4A31 A;  4KUA A;  4QB9 A;  4L89 A;  2J8R A;  2R8V A;  4A30 A;  2Q0Y A;  1PU9 A;  2BSW A;  2B3U A;  5H84 A;  2PRB A;  2OZU A;  1R57 A;  4CGO A;  1IID A;  4AVA A;  4B13 A;  1NMT A;  2ZPA A;  2Q04 A;  4LUA A;  3D3S A;  4M3S A;  4F6A A;  3EC4 A;  2NMT A;  3H4Q A;  4FD4 A;  4KOR A;  4KOT A;  4UBR A;  2G0B A;  2VEZ A;  4KOU A;  4R87 A;  2FIW A;  4CYO A;  4M85 A;  1NE9 A;  2J8M A;  4MFL A;  4E8O A;  4B5P B;  4FD6 A;  5EC4 A;  4KVM E;  4XNH C;  3PGP A;  4QC6 A;  3JVN A;  1S3Z A;  4PK2 A;  5J8F A;  5A28 A;  2B3V A;  1I21 A;  5ISV A;  3IGR A;  2R98 A;  4ORF A;  4KOX A;  3R1K A;  2FIA A;  2CNS A;  2FSR A;  1YRE A;  2DPS A;  2Z3P A;  4KOW A;  3S6K A;  2REF A;  2HQY A;  2Q7B A;  2D4P A;  1Z9U A;  3I3G A;  2HUZ A;  1LRZ A;  5IB0 A;  2YNE A;  2CNT A;  4NCZ A;  4AVC A;  4R57 A;  2VZZ A;  2VI7 A;  5I0C A;  5JQ4 A;  2DPT A;  4A32 A;  2PC1 A;  4NXY A;  3QAH A;  4C2Y A;  1MJ9 A;  2FT0 A;  4Y49 C;  1Z4R A;  3GYA A;  4CAW A;  3D2M A;  4ONU A;  1BO4 A;  2Y0M A;  1CJW A;  1PUA A;  2OH1 A;  4F0Y A;  4HNX B;  4MHD A;  2Q4V A;  4UA3 A;  2H5M A;  1QSR A;  3G8W A;  4X5K A;  2ATR A;  3DDD A;  3FYN A;  2QIR A;  4MFJ A;  4MJ8 A;  2JDC A;  2OZG A;  4HNW B;  1M44 A;  2RC4 A;  4JLY A;  1BOB A;  3TTH A;  5G22 A;  1WWZ A;  4KLV A;  2Z10 A;  1RXT A;  3FBU A;  4RI1 A;  4MFP A;  3CXQ A;  2DXQ A;  5F49 A;  5F48 A;  2Q44 A;  4A95 A;  3G3S A;  2P6F A;  1KUV A;  4UCP A;  4U9Y A;  4HKF A;  5GCN A;  1QSN A;  4C2X A;  1XE4 A;  4HNY B;  2Z3K A;  1N71 A;  1Y9K A;  3DNS A;  4BMH A;  2FCK A;  3V8I A;  4KUB A;  4AG9 A;  4CGP A;  4MY0 A;  4H6U A;  3W6S A;  4U9Z A;  4MBU A;  4ZGY B;  1XEB A;  2A4N A;  4KVX A;  5IX3 A;  4CYQ A;  1L0C A;  2Z3L A;  4KOV A;  4IUS A;  1RO5 A;  4Q36 A;  5HH1 A;  3BLN A;  4XPL A;  2PQ8 A;  2KCW A;  2G3A A;  4JWP A;  2YNC A;  2HV2 A;  1YGH A;  3H5Z A;  4FD7 A;  3NE7 A;  2PDO A;  4A2Z A;  3R9G A;  3TT2 A;  1XMT A;  2CXA A;  5C88 A;  2ZW6 A;  2ZW7 A;  5AG5 A;  4OAE A;  5G20 A;  4GS4 A;  2EUI A;  3A9L A;  4UWJ A;  1IYL A;  2X7B A;  2FXF A;  4CGL A;  3IU1 A;  5G21 A;  1YVO A;  3TOB A;  3JTK A;  3D8P A;  3N7Z A;  2FS5 A;  3TCV A;  1B6B A;  4XPK A;  2GE3 A;  2VBQ A;  4RS2 A;  2VXK A;  1V0C A;  4LX9 A;  2B5G A;  2G3T A;  3F0A A;  1M4D A;  4KSA A;  3W6X A;  2WPX A;  4PK3 A;  4MY3 A;  5C82 A;  4AB7 A;  4J3G A;  5F46 A;  3SXN A;  4DNC A;  3I9S A;  1Q2C A;  1GHE A;  3F8K A;  3P2F A;  2OZH A;  4E2A A;  2B58 A;  4MFK A;  4OLL A;  2VQY A;  3SXO A;  2GIV A;  1XF8 A;  4QBJ A;  2EVN A;  2JLM A;  5KTC A;  2YGW A;  4MFQ A;  1P0H A;  1QSM A;  4CAF A;  3EXN A;  1M1D A;  1ON0 A;  1IYK A;  2FL4 A;  2Z3O A;  5G1Z A;  3SHP A;  3TO7 A;  1TIQ A;  4Q38 A;  4UWI A;  1VKC A;  3W91 A;  3QB8 A;  2B4D A;  2JEV A;  3T90 A;  3CXP A;  4NF1 A;  4JD6 A;  5H86 A;  1S60 A;  4KS9 A;  3BJ8 A;  2YNC C;  4UCN A;  1ZO0 A;  3R96 A;  4XPD C;  1KUY A;  2O28 A;  4PSX A;  2WPW A;  4IF5 A;  2Q4Y A;  3D2P A;  1MK4 A;  3KKW A;  4C7H A;  4KZT A;  4ZBG A;  2I79 A;  4KOS A;  2QML A;  3RYO A;  4KOY A;  5E96 A;  4C2Z A;  2ZXV A;  3CXS A;  1IIC A;  1S5K A;  3FB3 A;  4YFJ A;  3EFA A;  1P4N A;  1Q2D A;  3C26 A;  3GY9 A;  4KLW A;  2R1I A;  3JUW A;  1M4I A;  1Z4E A;  1QSO A;  4CAE A;  3OWC A;  4K30 A;  3T9Y A;  4B5O A;  4XPD B;  5HMN A;  2PR8 A;  1QST A;  3TFY A;  3EY5 A;  4CRY B;  2ARH A;  4JXQ A;  1UFH A;  2P6E A;  2BEI A;  4CS0 B;  1M4G A;  5CNP A;  4B14 A;  1YX0 A;  4U5Y A;  4PV6 A;  2P6G A;  2IL4 A;  4YGO A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...