3BJ8A

Spermine/spermidine n1-acetyltransferase from mouse: crystal structure of a ternary complex reveals solvent-mediated spermine binding
Total Genus 42
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
42
sequence length
167
structure length
163
Chain Sequence
KFKIRPATASDCSDILRLIKELAKYEYMEDQVILTEKDLQEDGFGEHPFYHCLVAEVPKEHWTPEGHSIVGFAMYYFTYDPWIGKLLYLEDFFVMSDYRGFGIGSEILKNLSQVAMKCRCSSMHFLVAEWNEPSINFYKRRGASDLGWRLFKIDKEYLLKMAA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords Diamine acetyltransferase 1
publication title The crystal structure of spermidine/spermine N1-acetyltransferase in complex with spermine provides insights into substrate binding and catalysis.
pubmed doi rcsb
source organism Mus musculus
total genus 42
structure length 163
sequence length 167
chains with identical sequence B, C, D
ec nomenclature ec 2.3.1.57: Diamine N-acetyltransferase.
pdb deposition date 2007-12-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00583 Acetyltransf_1 Acetyltransferase (GNAT) family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.630.30 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Aminopeptidase 3bj8A00
1IYKA 5C82A 3CXPA 1NMTA 1XE4A 5F46A 1R57A 3K9UA 3TO6A 4R87A 1IB1E 3ZJ0A 4U9YA 2R8VA 2J8MA 5J8CA 1WK4A 4XPLA 4KOYA 3RYOA 2P0WA 5F49A 1KUXA 4HNYB 1KUVA 1B6BA 2CNMA 1OZPA 4PK3A 3SHPA 1QSTA 1M1DA 3GY9A 3FBUA 4B5OA 5F48A 4E2AA 1YR0A 4NF1A 1BO4A 4II9A 3GYAA 3P2HA 5EBVA 4H6ZA 2Z11A 4YGOA 3V8IA 3B8GA 2R1IA 3FXTA 2ATRA 4XPDB 4R57A 1UFHA 3QAHA 4MHDA 5H84A 2D4OA 3P2FA 4H89A 2HUZA 1KUYA 2I79A 2B4DA 4UWJA 4KLWA 2CNSA 1M44A 4RS2A 5H86A 4KOXA 4KOUA 2FXFA 3DNSA 2PRBA 3I3GA 4AVBA 1CM0A 2B3VA 2FIWA 2PDOA 4KVME 3TO7A 4QUSA 3F5BA 1YGHA 3IGRA 1QSNA 2GE3A 1RXTA 4NSQA 2HV2A 1VHSA 4KZTA 4KUBA 4JXQA 1YVKA 4IUSA 3R1KA 1S5KA 1PU9A 4KORA 3ZZIA 1YX0A 4PSWA 5KTDA 4QBJA 3PP9A 3W6SA 1I1DA 1XF8A 2B5GA 3BJ8A 3FRMA 1Q2CA 2AE6A 4CS0B 2Z10A 1S7LA 2BL1A 2Q04A 3N7ZA 3W91A 2WPXA 2P6EA 1VKCA 4U9ZA 4FD4A 2PR8A 1ON0A 3F0AA 3R9FA 3CXSA 3D2PA 2I00A 3JVNA 2VXKA 2HQYA 3S6FA 4CRZB 5IB0A 2VI7A 4QC6A 3TOBA 3EO4A 5IX3A 5C88A 1KZFA 2J8RA 4KOWA 1BOBA 2ZW6A 3UY5A 2OH1A 3MGDA 2OB0A 2ZW7A 2ARHA 4KOVA 3FNCA 3D2MA 1M4GA 4L8AA 2EVNA 4L89A 4JWPA 1MJBA 2VZZA 2R7HA 2QMLA 1MK4A 2CNTA 4ZBGA 2PQ8A 4U5YA 2P6GA 4K30A 2Q4VA 4HNWB 4GS4A 2JDDA 1SQHA 2CY2A 2PR1A 4XPKA 4OAEA 1XIXA 1QSRA 2PC1A 4JJXA 5FVJA 3TCVA 1S60A 2QIRA 4H6UA 5E96A 3D8PA 4ORFA 2X7BA 1IIDA 4KVXA 1S7FA 3D3SA 1Y7RA 2A4NA 4XPDC 1S3ZA 3DR8A 2REFA 3KKWA 3F8KA 4EVYA 4MJ8A 1YLEA 4KUAA 3WR7A 2O28A 4CAXA 1TIQA 5GCNA 3TOAA 4F0YA 2FE7A 1PUAA 2RC4A 2FL4A 4JXRA 3BLNA 4UBRA 3G8WA 4R9MA 1L0CA 2G3AA 4F6AA 2VQYA 4XNHB 4IF5A 3SXOA 4YRHA 2Q44A 4UA3A 1Z4RA 2OZHA 1MJAA 2KCWA 1Y9KA 1MJ9A 4R3LA 1QSMA 4MBUA 4MY0A 2R98A 3TE4A 4AG7A 1N71A 2Q0YA 1S7NA 2OZGA 3R95A 1I21A 3R96A 3JUWA 4Y49B 3R9GA 4B5PB 1K4JA 3NE7A 4QB9A 2Q4YA 5F47A 3SXNA 1P0HA 4KVOE 4X5KA 4FD6A 2BEIA 2IL4A 1S7KA 1M4IA 4BMHA 3PGPA 4AVAA 2EUIA 1J4JA 3TFYA 3LD2A 2AJ6A 1B87A 4HKFA 2FCKA 2D4PA 2DXQA 2C27A 4NEXA 3FB3A 4KLVA 2VZYA 3S6HA 5J8FA 1RO5A 3S6KA 1XEBA 5DWNA 3FIXA 2G3TA 4R3KA 4QVTA 3PZJA 2BSWA 4J3GA 3T9YA 4FD7A 3QB8A 2BUEA 3I9SA 4LUAA 4M3SA 5DWMA 2G0BA 2JLMA 2QECA 1GHEA 4RI1A 2ZXVA 3TT2A 1QSOA 2WPWA 3R9EA 3TTHA 1Q2YA 2Y0MA 1IICA 2B3UA 4E8OA 3DR6A 4MY3A 4AG9A 2GANA 3EY5A 3VWDA 2B58A 1NE9A 4M85A 1Z4EA 4AVCA 2OU2A 3EC4A 3H4QA 4CAVA 1IYLA 1Y9WA 5HH1A 4CAWA 2B4DB 4JLYA 2B4BA 1V0CA 5KTCA 4KOSA 4HNXB 3E0KA 3G3SA 3C26A 1Q2DA 4PK2A 4AB7A 2REEA 2Z0ZA 2JEVA 4E0AA 2ZW5A 1LRZA 4DNCA 1YREA 1M4DA 4UWIA 1I12A 4ONUA 3T90A 4OADA 4KOTA 2NMTA 1FY7A 2ZPAA 3OWCA 3LODA 4XNHC 4FD5A 3EXNA 2ZW4A 5JQ4A 4NXYA 3VWEA 3IWGA 5EC4A 2JDCA 2B5GB 2F5IA 2Q7BA 2K5TA 2H5MA 3GKRA 1U6MA 5KTAA 2FT0A 2FS5A 3W6XA 5ISVA 1YVOA 5I0CA 2PSWA 4Y49C 4LX9A 1XMTA 2FIAA 2VBQA 4MI4A 4PV6A 3S6GA 2OZUA 2FSRA 1CJWA 4CRYB 3FYNA 4PSXA 4B5PA 5IV0A 3BJ7A 1YK3A 2GIVA 2VEZA 2J8NA 3DSBA 4YFJA 1P4NA 5CNPA 3DDDA 2P6FA 1NSLA 4NCZA 4OLLA 3EFAA 4JD6A 3TO9A 1Z9UA 5JPHA 3CXQA 4I49A 1WWZA 5HMNA
chains in the Genus database with same CATH superfamily
1IYKA 5C82A 2EBJA 5EMIA 3CXPA 1BPNA 1NMTA 1XE4A 4MFKA 5F46A 1ZG7A 3PB6X 4X2TA 2Q7SA 1R57A 3K9UA 2ZEMA 3TO6A 4MFQA 3KHXA 1Q7LA 1AYEA 4MFJA 1HEEA 1LCPA 3TC8A 4R87A 3PBBA 3B3TA 2ZEHA 4OP4A 1IB1E 3ZJ0A 4NGMA 4U9YA 8CPAA 2PJ4A 2R8VA 2J8MA 3S9NA 3B3WA 2XEIA 5J8CA 2PVVA 2ZEGA 2DEAA 1YW4A 1ZG8A 1WK4A 4XPLA 4P44A 4OC4A 5AG6A 2Q51A 5AG4A 4KOYA 2C1CA 2WZNA 3FJUA 3RYOA 4CGLA 2P0WA 5F49A 4A94A 5ELYA 3D7FA 2JBKA 3RAMA 1KUXA 2IJZA 2XEFA 3SJEA 3KHZA 4HNYB 1KUVA 1B6BA 3MN8A 3PB8X 2CNMA 3NE8A 1TF9A 1OZPA 4PK3A 3SHPA 3WC7A 4B6ZA 5HMNA 1F57A 1M1DA 1QSTA 3BI1A 3GY9A 4BD9A 4ZY1A 3FBUA 1BPMA 2ZEPA 3GB0A 4B5OA 5F48A 4E2AA 2ODFA 1YR0A 5LYLA 4NF1A 2F8HA 4M6HA 1Z8XA 1BO4A 3MRUA 4II9A 2PJ2A 3GYAA 1JWQA 3P2HA 2BCOA 5EBVA 3VARA 4H6ZA 2HC9A 2Z11A 5JH9A 4YGOA 3V8IA 3B8GA 2R1IA 1TF8A 3FXTA 2ATRA 4XPDB 4R57A 1UFHA 3QAHA 4MHDA 5H84A 4KSFA 5HVFA 2G9DA 3L2NA 3LACA 2D4OA 2YNEA 4B13A 3KR4A 3P2FA 2HUZA 1ZO0A 4H89A 3V7ZA 2EK9A 4G1PA 4UF4A 1KUYA 2I79A 4OMEA 2Z3KA 4EMEA 2B4DA 1XBUA 4UWJA 4KLWA 2CNSA 1M44A 2IQ6A 4Z65A 4RS2A 2ZEEA 4KOXA 5H86A 4KOUA 2FXFA 3DNSA 3H5ZA 4R76A 2PRBA 3I3GA 3IWWA 4Q38A 4AVBA 1CM0A 2B3VA 3SI1A 5LRGA 2YNCC 2FIWA 4RN7A 2AFXA 2PDOA 3KZWA 4KVME 3SJFA 4MHNA 3TO7A 3D7DA 4PXCA 4QUSA 2BOAA 4UEFA 3F5BA 1YGHA 3IGRA 2WSAA 1QSNA 2GE3A 1RXTA 4A2ZA 4NSQA 1ZG9A 2WUUA 2YNCA 2HV2A 5BWAB 4F9VA 1VHSA 3K2KA 2PCUA 2PJ8A 4KZTA 4UEEA 3IEHA 4CYOA 4KUBA 6CPAA 4JXQA 2Z3OA 4F9UA 4A33A 1YVKA 4IUSA 1TKJA 5LRJA 3R1KA 1CG2A 1PU9A 1S5KA 4OC1A 5G21A 4KORA 3ZZIA 5K8PA 1YX0A 4LQ6A 4PSWA 3SJGA 4QBJA 1X12A 1X10A 3PP9A 3W6SA 3IWEA 1CPXA 4DUKA 5AGEA 5KTDA 4A30A 1I1DA 4C7IA 5J1QA 1XF8A 2B5GA 3BJ8A 1TKFA 3FRMA 1Z8LA 1Q2CA 2AE6A 4CS0B 2ZENA 4OKOA 2Z10A 5A27A 2YNDA 3FX6A 1PCAA 1S7LA 2PJBA 2BL1A 2PJ3A 2Q04A 2V77A 4A31A 3N7ZA 3H8FA 3IU1A 3W91A 4CGOA 1VGYA 5F09A 4P4BA 4ZX8A 2PIYA 2NSMA 2CXAA 2WPXA 5G1ZA 2P6EA 4W9YA 1VKCA 2AFWA 4NGPA 4U9ZA 4FD4A 4IAVA 2GLJA 2PR8A 1ON0A 3F0AA 4NGNA 3FEEA 3R9FA 3CXSA 4OC0A 4R6TA 4UFWA 4A95A 3D2PA 2I00A 4ZY0A 3JVNA 4OIDA 2RB7A 2Q4ZA 2VXKA 1EE3P 2HQYA 2CTBA 3IO1A 4NJRA 1IY7A 1CX8A 3S6FA 3TX8A 4CRZB 1TKHA 2VI7A 4QC6A 2ZELA 3TOBA 5IB0A 3EO4A 2AFUA 5IX3A 5LRKA 5C88A 1KZFA 2J8RA 2DPSA 4KOWA 1BOBA 2ZW6A 4CYQA 3UY5A 1AUGA 2OH1A 2OB0A 2ZW7A 2ARHA 3MGDA 2FVGA 4KOVA 4H2KA 3FNCA 4NGSA 4PPZA 3D2MA 5LYDA 2C6CA 4C2YA 4CYPA 5A28A 1M4GA 4L8AA 2EVNA 4L89A 4UCPA 4JWPA 1ELLP 2J9AA 1MJBA 2VZZA 1GYTA 2R7HA 2QMLA 1MK4A 1ZLIA 2CNTA 2PQ8A 4U5YA 4ZBGA 2QYVA 4DJLA 4ZX9A 4P4DA 4P4JA 3S9LA 2P6GA 1VHOA 3FF3A 4K30A 2Q4VA 4HNWB 2ZEFA 4GS4A 4TNUA 4FBEA 2JDDA 1SQHA 1BLLE 3VATA 2CY2A 3QNVA 2PR1A 4XPKA 2GFQA 2AFZA 2JBJA 1ARLA 4OAEA 3WC6A 1XIXA 5G22A 4B11A 1QSRA 4CGPA 1CBXA 2PC1A 4JJXA 4P6YA 1Z2LA 2CTCA 1FT7A 4WWVA 4MFPA 5FVJA 3TCVA 1A2ZA 4ZI6A 4EFDA 1S60A 2QIRA 4H6UA 5E96A 2PJ0A 2PIZA 3B3CA 3D8PA 4ORFA 1ELMP 2X7BA 3PFEA 1IIDA 4M6GA 4WJBA 4KVXA 3FMCA 5D8NA 1S7FA 3D3SA 1Y7RA 4BINA 3HLPA 4X8IA 4MFZA 2A4NA 5JGFA 1DTDA 2WYRA 2Z3PA 5CBMA 3K9TA 4P45A 3JTKA 3PB4X 1FNOA 1S3ZA 1YSJA 3D7GA 4XPDC 3DR8A 3WT4A 4MCRA 4EWTA 5LYFA 1YLOA 2PE3A 2REFA 3KKWA 3F8KA 4EVYA 4F8ZA 4MRIA 4MJ8A 3KL9A 1YLEA 4KUAA 3WR7A 2EO8A 2O28A 2AFMA 4CAXA 4JYWA 5HXDA 1TIQA 3IIBA 4UEZA 1XFOA 2O53A 5GCNA 3TOAA 4F0YA 3NH5A 4NGQA 2HB6A 2FE7A 2ZEOA 4F0XA 1PUAA 2RC4A 2I3CA 4MCQA 1F2OA 2FL4A 4JXRA 1IU8A 3BLNA 3FVLA 3I1UA 4UBRA 3G8WA 4NJQA 1L0CA 2G3AA 4R9MA 4F6AA 2VQYA 4XNHB 4IF5A 3SXOA 4YRHA 2Q44A 2V8GA 4UA3A 1Z4RA 2OZHA 2AFSA 1MJAA 2KCWA 3GIUA 4MMOA 4ZYQA 7CPAA 3QAYA 1Y9KA 5K8MA 1MJ9A 4R3LA 2QJ8A 3NH8A 2F7VA 1QSMA 3SI0A 5IB9A 4MBUA 4MY0A 3N5FA 4MHPA 2R98A 3TE4A 4AG7A 2CF4A 1N71A 2Q0YA 4B10A 2ABZA 1S7NA 2POKA 4GM5A 3FH4A 2OZGA 1F2PA 4CAFA 3R95A 1YMEA 3NH4A 3KR5A 1I21A 4LQGA 3R96A 3FECA 3JUWA 4Y49B 2AFOA 3R9GA 3SJXA 2PJ7A 4A39A 3IFEA 4B5PB 4FAIA 1K4JA 3DGVA 4TWEA 4CGMA 1DE4C 2PJ5A 3NE7A 3B7IA 3T8WA 2Q43A 2VL1A 4PXBA 3GUXA 3KI9A 2Q4YA 4QB9A 5F47A 4UFXA 3SXNA 4CAEA 1P0HA 2Z3MA 3CPXA 4DYOA 4KVOE 4X5KA 4FD6A 2BEIA 2IL4A 1M4IA 1S7KA 1XMBA 3RZAA 4BMHA 3PGPA 4AVAA 2EUIA 1J4JA 3CZXA 3TFYA 1HDQA 4OC2A 4C68A 2PJ1A 1XRYA 3IC1A 2V8VA 2AJ6A 3LD2A 1B87A 5THWA 3WC5A 4A32A 1Z5RA 4HKFA 2FCKA 2D4PA 3D67A 2DXQA 3IJ3A 2C27A 3VH9A 4NEXA 3FB3A 4FWUA 3BHXA 4KLVA 2VZYA 1IOFA 3S6HA 2ZOFA 3LWUA 5J8FA 1KWMA 1RO5A 4MHZA 3S6KA 4B12A 1IGBA 1LOKA 2Z3LA 3D4UA 4FUUA 3GLJA 1YW6A 1XEBA 4A37A 3KGQA 2DPTA 5DWNA 1M4LA 4PQAA 1CPSA 3FIXA 2G3TA 4NGRA 4PXEA 1LAPA 4R3KA 4RUHA 4QVTA 2GU2A 3PZJA 2BSWA 4J3GA 1RTQA 3T9YA 2GLFA 4PXDA 4FD7A 3QB8A 5CPAA 2PJ6A 4OIWA 4P4EA 4YU9A 3RO0A 2BUEA 3I9SA 4LUAA 3V38A 2OOTA 3H8EA 4M3SA 5DWMA 2G0BA 4X3RA 2JLMA 2QECA 1GHEA 1YQEA 4RI1A 2O4HA 2ZXVA 2JEWA 3DLJA 3D7HA 5DS0A 3KASA 3TT2A 4MFLA 3IU2A 1QSOA 4MXUA 1NSAA 2WPWA 5G20A 3R9EA 3TTHA 1Q2YA 4B14A 5LYIA 4R8FA 2Y0MA 1IICA 2B3UA 4P4FA 2PRQA 4E8OA 3DR6A 4MY3A 4P10A 4AG9A 4CYNA 4P4IA 2GANA 3BXMA 3EY5A 3VWDA 2B58A 3D68A 2XEJA 1NE9A 1Y0YA 1LANA 1XJOA 4M85A 4JZ0A 5HVGA 1Z4EA 4AVCA 4IK2A 2OU2A 4UIBA 3CPAA 3NFZA 4C2ZA 3EC4A 3H4QA 1OBRA 3NA6A 1ARMA 4CAVA 4KSIA 4O23A 1IYLA 1Y9WA 2NYQA 4HPSA 5HH1A 4CAWA 2B4DB 3PRTA 2QVPA 4JLYA 1VHEA 2B4BA 4OC5A 3RBUA 5K8OA 3PBEA 4Q7AA 3ISXA 3CT9A 1V0CA 4ZGYB 5KTCA 4MCSA 1PYTB 4KOSA 4HNXB 3E0KA 3G3SA 3C26A 1Q2DA 3D66A 4OC3A 2XEGA 4PK2A 4NFRA 4BBHA 4K3NA 1Z8TA 4AB7A 2V8DA 3S9MA 5JM6A 2REEA 1R3NA 2Z0ZA 3WABA 2JEVA 2PJCA 2GREA 3BI0A 4E0AA 3SI2A 2ZW5A 2PJAA 4Q36A 1LRZA 1JQGA 4DNCA 4M6IA 1LAMA 1YREA 1M4DA 4UWIA 1I12A 4ONUA 3T90A 4OADA 3KQXA 4KOTA 2RFHA 1ZLHA 4C2XA 4CPAA 1R43A 2NMTA 1FY7A 2ZPAA 3OWCA 3LODA 2BO9A 1VIXA 1BAVA 4XNHC 3PB7X 3HUVA 4FD5A 3EXNA 1IOIA 1HDUA 2V8HA 2ZW4A 5AG5A 2EWBA 4NGTA 5JQ4A 4NXYA 3VWEA 1Y0RA 2DF5A 1UWYA 3FEDA 4UCNA 2CIJA 4A38A 3B2YA 3IWGA 5EC4A 4KS9A 2JDCA 2B5GB 3LMSA 2F5IA 2PVWA 3JRUA 2Q7BA 2K5TA 1LFWA 1QQ9A 4CGNA 2H5MA 2PJ9A 4ONWA 3GKRA 4GXHA 1H8LA 4AXVA 1U6MA 3KQZA 2OR4A 5D29A 5KTAA 2FT0A 2FS5A 3W6XA 5ISVA 1YVOA 5I0CA 2PSWA 3PB9X 1CP6A 4LX9A 1TXRA 4Y49C 3B3SA 1XMTA 3ISZA 2FIAA 2EK8A 3H8GA 4MHYA 4UFVA 2VBQA 3B35A 4MI4A 4PV6A 3RNZA 3S6GA 3PEIA 2OZUA 4IHMA 2IMOA 2FSRA 1Z8WA 3CDXA 4C7HA 1CJWA 1XOVA 4CRYB 3FYNA 4PSXA 4B5PA 4ZY2A 5IV0A 2C6PA 2ANPA 2ZOGA 3BJ7A 1YK3A 4UIAA 2GIVA 2VEZA 4KSAA 2J8NA 4UCMA 3DSBA 3PFOA 4YFJA 1QMUA 1P4NA 5CNPA 3A9LA 1Y7EA 1CP7A 3DDDA 2P6FA 2Z3NA 5I4MA 1NSLA 1AMPA 2ZEDA 4NCZA 4OLLA 3EFAA 4JD6A 3B3VA 3TO9A 1Z9UA 5JPHA 4R7MA 3CXQA 5HVHA 4I49A 2C6GA 1WWZA 4MCPA 5K8NA 4YWYA 5AG7A 2YGWA
chains in the Genus database with same CATH topology
1IYKA 5C82A 3CXPA 1NMTA 1XE4A 4MFKA 5F46A 1R57A 3K9UA 3TO6A 4MFQA 4MFJA 4R87A 1IB1E 3ZJ0A 4U9YA 2R8VA 2J8MA 5J8CA 1WK4A 4XPLA 5AG4A 5AG6A 4KOYA 3RYOA 4CGLA 2P0WA 5F49A 1KUXA 4HNYB 1KUVA 1B6BA 2CNMA 1OZPA 4PK3A 3SHPA 1QSTA 1M1DA 3GY9A 3FBUA 4B5OA 5F48A 4E2AA 1YR0A 4NF1A 1BO4A 4II9A 3GYAA 3P2HA 5EBVA 4H6ZA 2Z11A 4YGOA 3V8IA 3B8GA 2R1IA 3FXTA 2ATRA 4XPDB 4R57A 1UFHA 3QAHA 4MHDA 5H84A 4KSFA 2D4OA 2YNEA 4B13A 3P2FA 4H89A 2HUZA 1ZO0A 1KUYA 2I79A 2Z3KA 2B4DA 4UWJA 4KLWA 2CNSA 1M44A 4RS2A 5H86A 4KOXA 4KOUA 2FXFA 3DNSA 3H5ZA 2PRBA 3I3GA 4Q38A 4AVBA 1CM0A 2B3VA 2YNCC 2FIWA 2PDOA 4KVME 3TO7A 4QUSA 3F5BA 1YGHA 3IGRA 2WSAA 1QSNA 2GE3A 1RXTA 4A2ZA 4NSQA 2WUUA 2YNCA 2HV2A 5BWAB 1VHSA 4KZTA 4CYOA 4KUBA 4JXQA 2Z3OA 4A33A 1YVKA 4IUSA 3R1KA 1S5KA 1PU9A 5G21A 4KORA 3ZZIA 1YX0A 4PSWA 5KTDA 4QBJA 3PP9A 3W6SA 3IWEA 5AGEA 4A30A 1I1DA 4C7IA 1XF8A 2B5GA 3BJ8A 3FRMA 1Q2CA 2AE6A 4CS0B 2Z10A 5A27A 2YNDA 1S7LA 2BL1A 2Q04A 4A31A 3N7ZA 3IU1A 3W91A 4CGOA 2WPXA 2CXAA 5G1ZA 2P6EA 1VKCA 4U9ZA 4FD4A 2PR8A 1ON0A 3F0AA 3R9FA 3CXSA 4UFWA 4A95A 3D2PA 2I00A 3JVNA 2VXKA 2HQYA 3S6FA 4CRZB 5IB0A 2VI7A 4QC6A 3TOBA 3EO4A 5IX3A 5C88A 1KZFA 2J8RA 2DPSA 4KOWA 1BOBA 2ZW6A 4CYQA 3UY5A 2OH1A 3MGDA 2OB0A 2ZW7A 2ARHA 4KOVA 3FNCA 3D2MA 4CYPA 4C2YA 1M4GA 4L8AA 2EVNA 4L89A 4UCPA 4JWPA 1MJBA 2VZZA 2R7HA 2QMLA 1MK4A 2CNTA 4ZBGA 2PQ8A 4U5YA 2P6GA 4K30A 2Q4VA 4HNWB 4GS4A 2JDDA 1SQHA 2CY2A 2PR1A 4XPKA 4OAEA 1XIXA 5G22A 4B11A 1QSRA 4CGPA 2PC1A 4JJXA 4MFPA 5FVJA 3TCVA 1S60A 2QIRA 4H6UA 5E96A 5A28A 3D8PA 4ORFA 2X7BA 1IIDA 4KVXA 1S7FA 3D3SA 1Y7RA 4MFZA 2A4NA 2Z3PA 3JTKA 4XPDC 1S3ZA 3DR8A 2REFA 3KKWA 3F8KA 4EVYA 4MJ8A 1YLEA 4KUAA 3WR7A 2O28A 4CAXA 1TIQA 5GCNA 3TOAA 4F0YA 2FE7A 4F0XA 1PUAA 2RC4A 2FL4A 4JXRA 3BLNA 4UBRA 3G8WA 4R9MA 1L0CA 2G3AA 4F6AA 2VQYA 4XNHB 4IF5A 3SXOA 4YRHA 2Q44A 4UA3A 1Z4RA 2OZHA 1MJAA 2KCWA 1Y9KA 1MJ9A 4R3LA 1QSMA 4MBUA 4MY0A 2R98A 3TE4A 4AG7A 1N71A 2Q0YA 4B10A 1S7NA 2OZGA 4CAFA 3R95A 1I21A 3R96A 3JUWA 4Y49B 3R9GA 4B5PB 1K4JA 4CGMA 3NE7A 4QB9A 2Q4YA 5F47A 4UFXA 3SXNA 4CAEA 1P0HA 2Z3MA 4KVOE 4X5KA 4FD6A 2BEIA 2IL4A 1S7KA 1M4IA 4BMHA 3PGPA 4AVAA 2EUIA 1J4JA 3TFYA 4C68A 3LD2A 2AJ6A 1B87A 4A32A 4HKFA 2FCKA 2D4PA 2DXQA 2C27A 4NEXA 3FB3A 4KLVA 2VZYA 3S6HA 5J8FA 1RO5A 3S6KA 4B12A 2Z3LA 1XEBA 2DPTA 5DWNA 3FIXA 2G3TA 4R3KA 4QVTA 3PZJA 4J3GA 2BSWA 3T9YA 4FD7A 3QB8A 2BUEA 3I9SA 4LUAA 4M3SA 5DWMA 2G0BA 2JLMA 2QECA 1GHEA 4RI1A 2ZXVA 3TT2A 4MFLA 3IU2A 1QSOA 2WPWA 5G20A 3R9EA 3TTHA 1Q2YA 4B14A 2Y0MA 1IICA 2B3UA 4E8OA 3DR6A 4MY3A 4AG9A 4CYNA 2GANA 3EY5A 3VWDA 2B58A 1NE9A 4M85A 1Z4EA 4AVCA 2OU2A 4C2ZA 3EC4A 3H4QA 4CAVA 1IYLA 1Y9WA 5HH1A 4CAWA 2B4DB 4JLYA 2B4BA 1V0CA 4ZGYB 5KTCA 4KOSA 4HNXB 3E0KA 3G3SA 3C26A 1Q2DA 4PK2A 4BBHA 4AB7A 2REEA 2Z0ZA 2JEVA 4E0AA 2ZW5A 4Q36A 1LRZA 4DNCA 1YREA 1M4DA 4UWIA 1I12A 4ONUA 3T90A 4OADA 4KOTA 4C2XA 2NMTA 1FY7A 2ZPAA 3OWCA 3LODA 4XNHC 4FD5A 3EXNA 5AG5A 2ZW4A 5JQ4A 4NXYA 3VWEA 4UCNA 3IWGA 5EC4A 4KS9A 2JDCA 2B5GB 2F5IA 2Q7BA 2K5TA 4CGNA 2H5MA 3GKRA 1U6MA 5KTAA 2FT0A 2FS5A 3W6XA 5ISVA 1YVOA 5I0CA 2PSWA 4Y49C 4LX9A 1XMTA 2FIAA 4UFVA 2VBQA 4MI4A 4PV6A 3S6GA 2OZUA 4C7HA 2FSRA 1CJWA 4CRYB 3FYNA 4PSXA 4B5PA 5IV0A 3BJ7A 1YK3A 2GIVA 2VEZA 4KSAA 2J8NA 4UCMA 3DSBA 4YFJA 1P4NA 5CNPA 3A9LA 3DDDA 2P6FA 2Z3NA 1NSLA 4NCZA 4OLLA 3EFAA 4JD6A 3TO9A 1Z9UA 5JPHA 3CXQA 4I49A 1WWZA 5HMNA 5AG7A 2YGWA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1IYK A;  5C82 A;  3CXP A;  1NMT A;  1XE4 A;  5F46 A;  1R57 A;  3K9U A;  3TO6 A;  4R87 A;  1IB1 E;  3ZJ0 A;  4U9Y A;  2R8V A;  2J8M A;  5J8C A;  1WK4 A;  4XPL A;  4KOY A;  3RYO A;  2P0W A;  5F49 A;  1KUX A;  4HNY B;  1KUV A;  1B6B A;  2CNM A;  1OZP A;  4PK3 A;  3SHP A;  1QST A;  1M1D A;  3GY9 A;  3FBU A;  4B5O A;  5F48 A;  4E2A A;  1YR0 A;  4NF1 A;  1BO4 A;  4II9 A;  3GYA A;  3P2H A;  5EBV A;  4H6Z A;  2Z11 A;  4YGO A;  3V8I A;  3B8G A;  2R1I A;  3FXT A;  2ATR A;  4XPD B;  4R57 A;  1UFH A;  3QAH A;  4MHD A;  5H84 A;  2D4O A;  3P2F A;  4H89 A;  2HUZ A;  1KUY A;  2I79 A;  2B4D A;  4UWJ A;  4KLW A;  2CNS A;  1M44 A;  4RS2 A;  5H86 A;  4KOX A;  4KOU A;  2FXF A;  3DNS A;  2PRB A;  3I3G A;  4AVB A;  1CM0 A;  2B3V A;  2FIW A;  2PDO A;  4KVM E;  3TO7 A;  4QUS A;  3F5B A;  1YGH A;  3IGR A;  1QSN A;  2GE3 A;  1RXT A;  4NSQ A;  2HV2 A;  1VHS A;  4KZT A;  4KUB A;  4JXQ A;  1YVK A;  4IUS A;  3R1K A;  1S5K A;  1PU9 A;  4KOR A;  3ZZI A;  1YX0 A;  4PSW A;  5KTD A;  4QBJ A;  3PP9 A;  3W6S A;  1I1D A;  1XF8 A;  2B5G A;  3BJ8 A;  3FRM A;  1Q2C A;  2AE6 A;  4CS0 B;  2Z10 A;  1S7L A;  2BL1 A;  2Q04 A;  3N7Z A;  3W91 A;  2WPX A;  2P6E A;  1VKC A;  4U9Z A;  4FD4 A;  2PR8 A;  1ON0 A;  3F0A A;  3R9F A;  3CXS A;  3D2P A;  2I00 A;  3JVN A;  2VXK A;  2HQY A;  3S6F A;  4CRZ B;  5IB0 A;  2VI7 A;  4QC6 A;  3TOB A;  3EO4 A;  5IX3 A;  5C88 A;  1KZF A;  2J8R A;  4KOW A;  1BOB A;  2ZW6 A;  3UY5 A;  2OH1 A;  3MGD A;  2OB0 A;  2ZW7 A;  2ARH A;  4KOV A;  3FNC A;  3D2M A;  1M4G A;  4L8A A;  2EVN A;  4L89 A;  4JWP A;  1MJB A;  2VZZ A;  2R7H A;  2QML A;  1MK4 A;  2CNT A;  4ZBG A;  2PQ8 A;  4U5Y A;  2P6G A;  4K30 A;  2Q4V A;  4HNW B;  4GS4 A;  2JDD A;  1SQH A;  2CY2 A;  2PR1 A;  4XPK A;  4OAE A;  1XIX A;  1QSR A;  2PC1 A;  4JJX A;  5FVJ A;  3TCV A;  1S60 A;  2QIR A;  4H6U A;  5E96 A;  3D8P A;  4ORF A;  2X7B A;  1IID A;  4KVX A;  1S7F A;  3D3S A;  1Y7R A;  2A4N A;  4XPD C;  1S3Z A;  3DR8 A;  2REF A;  3KKW A;  3F8K A;  4EVY A;  4MJ8 A;  1YLE A;  4KUA A;  3WR7 A;  2O28 A;  4CAX A;  1TIQ A;  5GCN A;  3TOA A;  4F0Y A;  2FE7 A;  1PUA A;  2RC4 A;  2FL4 A;  4JXR A;  3BLN A;  4UBR A;  3G8W A;  4R9M A;  1L0C A;  2G3A A;  4F6A A;  2VQY A;  4XNH B;  4IF5 A;  3SXO A;  4YRH A;  2Q44 A;  4UA3 A;  1Z4R A;  2OZH A;  1MJA A;  2KCW A;  1Y9K A;  1MJ9 A;  4R3L A;  1QSM A;  4MBU A;  4MY0 A;  2R98 A;  3TE4 A;  4AG7 A;  1N71 A;  2Q0Y A;  1S7N A;  2OZG A;  3R95 A;  1I21 A;  3R96 A;  3JUW A;  4Y49 B;  3R9G A;  4B5P B;  1K4J A;  3NE7 A;  4QB9 A;  2Q4Y A;  5F47 A;  3SXN A;  1P0H A;  4KVO E;  4X5K A;  4FD6 A;  2BEI A;  2IL4 A;  1S7K A;  1M4I A;  4BMH A;  3PGP A;  4AVA A;  2EUI A;  1J4J A;  3TFY A;  3LD2 A;  2AJ6 A;  1B87 A;  4HKF A;  2FCK A;  2D4P A;  2DXQ A;  2C27 A;  4NEX A;  3FB3 A;  4KLV A;  2VZY A;  3S6H A;  5J8F A;  1RO5 A;  3S6K A;  1XEB A;  5DWN A;  3FIX A;  2G3T A;  4R3K A;  4QVT A;  3PZJ A;  2BSW A;  4J3G A;  3T9Y A;  4FD7 A;  3QB8 A;  2BUE A;  3I9S A;  4LUA A;  4M3S A;  5DWM A;  2G0B A;  2JLM A;  2QEC A;  1GHE A;  4RI1 A;  2ZXV A;  3TT2 A;  1QSO A;  2WPW A;  3R9E A;  3TTH A;  1Q2Y A;  2Y0M A;  1IIC A;  2B3U A;  4E8O A;  3DR6 A;  4MY3 A;  4AG9 A;  2GAN A;  3EY5 A;  3VWD A;  2B58 A;  1NE9 A;  4M85 A;  1Z4E A;  4AVC A;  2OU2 A;  3EC4 A;  3H4Q A;  4CAV A;  1IYL A;  1Y9W A;  5HH1 A;  4CAW A;  2B4D B;  4JLY A;  2B4B A;  1V0C A;  5KTC A;  4KOS A;  4HNX B;  3E0K A;  3G3S A;  3C26 A;  1Q2D A;  4PK2 A;  4AB7 A;  2REE A;  2Z0Z A;  2JEV A;  4E0A A;  2ZW5 A;  1LRZ A;  4DNC A;  1YRE A;  1M4D A;  4UWI A;  1I12 A;  4ONU A;  3T90 A;  4OAD A;  4KOT A;  2NMT A;  1FY7 A;  2ZPA A;  3OWC A;  3LOD A;  4XNH C;  4FD5 A;  3EXN A;  2ZW4 A;  5JQ4 A;  4NXY A;  3VWE A;  3IWG A;  5EC4 A;  2JDC A;  2B5G B;  2F5I A;  2Q7B A;  2K5T A;  2H5M A;  3GKR A;  1U6M A;  5KTA A;  2FT0 A;  2FS5 A;  3W6X A;  5ISV A;  1YVO A;  5I0C A;  2PSW A;  4Y49 C;  4LX9 A;  1XMT A;  2FIA A;  2VBQ A;  4MI4 A;  4PV6 A;  3S6G A;  2OZU A;  2FSR A;  1CJW A;  4CRY B;  3FYN A;  4PSX A;  4B5P A;  5IV0 A;  3BJ7 A;  1YK3 A;  2GIV A;  2VEZ A;  2J8N A;  3DSB A;  4YFJ A;  1P4N A;  5CNP A;  3DDD A;  2P6F A;  1NSL A;  4NCZ A;  4OLL A;  3EFA A;  4JD6 A;  3TO9 A;  1Z9U A;  5JPH A;  3CXQ A;  4I49 A;  1WWZ A;  5HMN A; 
#chains in the Genus database with same CATH topology
 1IYK A;  5C82 A;  2EBJ A;  5EMI A;  3CXP A;  1BPN A;  1NMT A;  1XE4 A;  4MFK A;  5F46 A;  1ZG7 A;  3PB6 X;  4X2T A;  2Q7S A;  1R57 A;  3K9U A;  2ZEM A;  3TO6 A;  4MFQ A;  3KHX A;  1Q7L A;  1AYE A;  4MFJ A;  1HEE A;  1LCP A;  3TC8 A;  4R87 A;  3PBB A;  3B3T A;  2ZEH A;  4OP4 A;  1IB1 E;  3ZJ0 A;  4NGM A;  4U9Y A;  8CPA A;  2PJ4 A;  2R8V A;  2J8M A;  3S9N A;  3B3W A;  2XEI A;  5J8C A;  2PVV A;  2ZEG A;  2DEA A;  1YW4 A;  1ZG8 A;  1WK4 A;  4XPL A;  4P44 A;  4OC4 A;  5AG6 A;  2Q51 A;  5AG4 A;  4KOY A;  2C1C A;  2WZN A;  3FJU A;  3RYO A;  4CGL A;  2P0W A;  5F49 A;  4A94 A;  5ELY A;  3D7F A;  2JBK A;  3RAM A;  1KUX A;  2IJZ A;  2XEF A;  3SJE A;  3KHZ A;  4HNY B;  1KUV A;  1B6B A;  3MN8 A;  3PB8 X;  2CNM A;  3NE8 A;  1TF9 A;  1OZP A;  4PK3 A;  3SHP A;  3WC7 A;  4B6Z A;  5HMN A;  1F57 A;  1M1D A;  1QST A;  3BI1 A;  3GY9 A;  4BD9 A;  4ZY1 A;  3FBU A;  1BPM A;  2ZEP A;  3GB0 A;  4B5O A;  5F48 A;  4E2A A;  2ODF A;  1YR0 A;  5LYL A;  4NF1 A;  2F8H A;  4M6H A;  1Z8X A;  1BO4 A;  3MRU A;  4II9 A;  2PJ2 A;  3GYA A;  1JWQ A;  3P2H A;  2BCO A;  5EBV A;  3VAR A;  4H6Z A;  2HC9 A;  2Z11 A;  5JH9 A;  4YGO A;  3V8I A;  3B8G A;  2R1I A;  1TF8 A;  3FXT A;  2ATR A;  4XPD B;  4R57 A;  1UFH A;  3QAH A;  4MHD A;  5H84 A;  4KSF A;  5HVF A;  2G9D A;  3L2N A;  3LAC A;  2D4O A;  2YNE A;  4B13 A;  3KR4 A;  3P2F A;  2HUZ A;  1ZO0 A;  4H89 A;  3V7Z A;  2EK9 A;  4G1P A;  4UF4 A;  1KUY A;  2I79 A;  4OME A;  2Z3K A;  4EME A;  2B4D A;  1XBU A;  4UWJ A;  4KLW A;  2CNS A;  1M44 A;  2IQ6 A;  4Z65 A;  4RS2 A;  2ZEE A;  4KOX A;  5H86 A;  4KOU A;  2FXF A;  3DNS A;  3H5Z A;  4R76 A;  2PRB A;  3I3G A;  3IWW A;  4Q38 A;  4AVB A;  1CM0 A;  2B3V A;  3SI1 A;  5LRG A;  2YNC C;  2FIW A;  4RN7 A;  2AFX A;  2PDO A;  3KZW A;  4KVM E;  3SJF A;  4MHN A;  3TO7 A;  3D7D A;  4PXC A;  4QUS A;  2BOA A;  4UEF A;  3F5B A;  1YGH A;  3IGR A;  2WSA A;  1QSN A;  2GE3 A;  1RXT A;  4A2Z A;  4NSQ A;  1ZG9 A;  2WUU A;  2YNC A;  2HV2 A;  5BWA B;  4F9V A;  1VHS A;  3K2K A;  2PCU A;  2PJ8 A;  4KZT A;  4UEE A;  3IEH A;  4CYO A;  4KUB A;  6CPA A;  4JXQ A;  2Z3O A;  4F9U A;  4A33 A;  1YVK A;  4IUS A;  1TKJ A;  5LRJ A;  3R1K A;  1CG2 A;  1PU9 A;  1S5K A;  4OC1 A;  5G21 A;  4KOR A;  3ZZI A;  5K8P A;  1YX0 A;  4LQ6 A;  4PSW A;  3SJG A;  4QBJ A;  1X12 A;  1X10 A;  3PP9 A;  3W6S A;  3IWE A;  1CPX A;  4DUK A;  5AGE A;  5KTD A;  4A30 A;  1I1D A;  4C7I A;  5J1Q A;  1XF8 A;  2B5G A;  3BJ8 A;  1TKF A;  3FRM A;  1Z8L A;  1Q2C A;  2AE6 A;  4CS0 B;  2ZEN A;  4OKO A;  2Z10 A;  5A27 A;  2YND A;  3FX6 A;  1PCA A;  1S7L A;  2PJB A;  2BL1 A;  2PJ3 A;  2Q04 A;  2V77 A;  4A31 A;  3N7Z A;  3H8F A;  3IU1 A;  3W91 A;  4CGO A;  1VGY A;  5F09 A;  4P4B A;  4ZX8 A;  2PIY A;  2NSM A;  2CXA A;  2WPX A;  5G1Z A;  2P6E A;  4W9Y A;  1VKC A;  2AFW A;  4NGP A;  4U9Z A;  4FD4 A;  4IAV A;  2GLJ A;  2PR8 A;  1ON0 A;  3F0A A;  4NGN A;  3FEE A;  3R9F A;  3CXS A;  4OC0 A;  4R6T A;  4UFW A;  4A95 A;  3D2P A;  2I00 A;  4ZY0 A;  3JVN A;  4OID A;  2RB7 A;  2Q4Z A;  2VXK A;  1EE3 P;  2HQY A;  2CTB A;  3IO1 A;  4NJR A;  1IY7 A;  1CX8 A;  3S6F A;  3TX8 A;  4CRZ B;  1TKH A;  2VI7 A;  4QC6 A;  2ZEL A;  3TOB A;  5IB0 A;  3EO4 A;  2AFU A;  5IX3 A;  5LRK A;  5C88 A;  1KZF A;  2J8R A;  2DPS A;  4KOW A;  1BOB A;  2ZW6 A;  4CYQ A;  3UY5 A;  1AUG A;  2OH1 A;  2OB0 A;  2ZW7 A;  2ARH A;  3MGD A;  2FVG A;  4KOV A;  4H2K A;  3FNC A;  4NGS A;  4PPZ A;  3D2M A;  5LYD A;  2C6C A;  4C2Y A;  4CYP A;  5A28 A;  1M4G A;  4L8A A;  2EVN A;  4L89 A;  4UCP A;  4JWP A;  1ELL P;  2J9A A;  1MJB A;  2VZZ A;  1GYT A;  2R7H A;  2QML A;  1MK4 A;  1ZLI A;  2CNT A;  2PQ8 A;  4U5Y A;  4ZBG A;  2QYV A;  4DJL A;  4ZX9 A;  4P4D A;  4P4J A;  3S9L A;  2P6G A;  1VHO A;  3FF3 A;  4K30 A;  2Q4V A;  4HNW B;  2ZEF A;  4GS4 A;  4TNU A;  4FBE A;  2JDD A;  1SQH A;  1BLL E;  3VAT A;  2CY2 A;  3QNV A;  2PR1 A;  4XPK A;  2GFQ A;  2AFZ A;  2JBJ A;  1ARL A;  4OAE A;  3WC6 A;  1XIX A;  5G22 A;  4B11 A;  1QSR A;  4CGP A;  1CBX A;  2PC1 A;  4JJX A;  4P6Y A;  1Z2L A;  2CTC A;  1FT7 A;  4WWV A;  4MFP A;  5FVJ A;  3TCV A;  1A2Z A;  4ZI6 A;  4EFD A;  1S60 A;  2QIR A;  4H6U A;  5E96 A;  2PJ0 A;  2PIZ A;  3B3C A;  3D8P A;  4ORF A;  1ELM P;  2X7B A;  3PFE A;  1IID A;  4M6G A;  4WJB A;  4KVX A;  3FMC A;  5D8N A;  1S7F A;  3D3S A;  1Y7R A;  4BIN A;  3HLP A;  4X8I A;  4MFZ A;  2A4N A;  5JGF A;  1DTD A;  2WYR A;  2Z3P A;  5CBM A;  3K9T A;  4P45 A;  3JTK A;  3PB4 X;  1FNO A;  1S3Z A;  1YSJ A;  3D7G A;  4XPD C;  3DR8 A;  3WT4 A;  4MCR A;  4EWT A;  5LYF A;  1YLO A;  2PE3 A;  2REF A;  3KKW A;  3F8K A;  4EVY A;  4F8Z A;  4MRI A;  4MJ8 A;  3KL9 A;  1YLE A;  4KUA A;  3WR7 A;  2EO8 A;  2O28 A;  2AFM A;  4CAX A;  4JYW A;  5HXD A;  1TIQ A;  3IIB A;  4UEZ A;  1XFO A;  2O53 A;  5GCN A;  3TOA A;  4F0Y A;  3NH5 A;  4NGQ A;  2HB6 A;  2FE7 A;  2ZEO A;  4F0X A;  1PUA A;  2RC4 A;  2I3C A;  4MCQ A;  1F2O A;  2FL4 A;  4JXR A;  1IU8 A;  3BLN A;  3FVL A;  3I1U A;  4UBR A;  3G8W A;  4NJQ A;  1L0C A;  2G3A A;  4R9M A;  4F6A A;  2VQY A;  4XNH B;  4IF5 A;  3SXO A;  4YRH A;  2Q44 A;  2V8G A;  4UA3 A;  1Z4R A;  2OZH A;  2AFS A;  1MJA A;  2KCW A;  3GIU A;  4MMO A;  4ZYQ A;  7CPA A;  3QAY A;  1Y9K A;  5K8M A;  1MJ9 A;  4R3L A;  2QJ8 A;  3NH8 A;  2F7V A;  1QSM A;  3SI0 A;  5IB9 A;  4MBU A;  4MY0 A;  3N5F A;  4MHP A;  2R98 A;  3TE4 A;  4AG7 A;  2CF4 A;  1N71 A;  2Q0Y A;  4B10 A;  2ABZ A;  1S7N A;  2POK A;  4GM5 A;  3FH4 A;  2OZG A;  1F2P A;  4CAF A;  3R95 A;  1YME A;  3NH4 A;  3KR5 A;  1I21 A;  4LQG A;  3R96 A;  3FEC A;  3JUW A;  4Y49 B;  2AFO A;  3R9G A;  3SJX A;  2PJ7 A;  4A39 A;  3IFE A;  4B5P B;  4FAI A;  1K4J A;  3DGV A;  4TWE A;  4CGM A;  1DE4 C;  2PJ5 A;  3NE7 A;  3B7I A;  3T8W A;  2Q43 A;  2VL1 A;  4PXB A;  3GUX A;  3KI9 A;  2Q4Y A;  4QB9 A;  5F47 A;  4UFX A;  3SXN A;  4CAE A;  1P0H A;  2Z3M A;  3CPX A;  4DYO A;  4KVO E;  4X5K A;  4FD6 A;  2BEI A;  2IL4 A;  1M4I A;  1S7K A;  1XMB A;  3RZA A;  4BMH A;  3PGP A;  4AVA A;  2EUI A;  1J4J A;  3CZX A;  3TFY A;  1HDQ A;  4OC2 A;  4C68 A;  2PJ1 A;  1XRY A;  3IC1 A;  2V8V A;  2AJ6 A;  3LD2 A;  1B87 A;  5THW A;  3WC5 A;  4A32 A;  1Z5R A;  4HKF A;  2FCK A;  2D4P A;  3D67 A;  2DXQ A;  3IJ3 A;  2C27 A;  3VH9 A;  4NEX A;  3FB3 A;  4FWU A;  3BHX A;  4KLV A;  2VZY A;  1IOF A;  3S6H A;  2ZOF A;  3LWU A;  5J8F A;  1KWM A;  1RO5 A;  4MHZ A;  3S6K A;  4B12 A;  1IGB A;  1LOK A;  2Z3L A;  3D4U A;  4FUU A;  3GLJ A;  1YW6 A;  1XEB A;  4A37 A;  3KGQ A;  2DPT A;  5DWN A;  1M4L A;  4PQA A;  1CPS A;  3FIX A;  2G3T A;  4NGR A;  4PXE A;  1LAP A;  4R3K A;  4RUH A;  4QVT A;  2GU2 A;  3PZJ A;  2BSW A;  4J3G A;  1RTQ A;  3T9Y A;  2GLF A;  4PXD A;  4FD7 A;  3QB8 A;  5CPA A;  2PJ6 A;  4OIW A;  4P4E A;  4YU9 A;  3RO0 A;  2BUE A;  3I9S A;  4LUA A;  3V38 A;  2OOT A;  3H8E A;  4M3S A;  5DWM A;  2G0B A;  4X3R A;  2JLM A;  2QEC A;  1GHE A;  1YQE A;  4RI1 A;  2O4H A;  2ZXV A;  2JEW A;  3DLJ A;  3D7H A;  5DS0 A;  3KAS A;  3TT2 A;  4MFL A;  3IU2 A;  1QSO A;  4MXU A;  1NSA A;  2WPW A;  5G20 A;  3R9E A;  3TTH A;  1Q2Y A;  4B14 A;  5LYI A;  4R8F A;  2Y0M A;  1IIC A;  2B3U A;  4P4F A;  2PRQ A;  4E8O A;  3DR6 A;  4MY3 A;  4P10 A;  4AG9 A;  4CYN A;  4P4I A;  2GAN A;  3BXM A;  3EY5 A;  3VWD A;  2B58 A;  3D68 A;  2XEJ A;  1NE9 A;  1Y0Y A;  1LAN A;  1XJO A;  4M85 A;  4JZ0 A;  5HVG A;  1Z4E A;  4AVC A;  4IK2 A;  2OU2 A;  4UIB A;  3CPA A;  3NFZ A;  4C2Z A;  3EC4 A;  3H4Q A;  1OBR A;  3NA6 A;  1ARM A;  4CAV A;  4KSI A;  4O23 A;  1IYL A;  1Y9W A;  2NYQ A;  4HPS A;  5HH1 A;  4CAW A;  2B4D B;  3PRT A;  2QVP A;  4JLY A;  1VHE A;  2B4B A;  4OC5 A;  3RBU A;  5K8O A;  3PBE A;  4Q7A A;  3ISX A;  3CT9 A;  1V0C A;  4ZGY B;  5KTC A;  4MCS A;  1PYT B;  4KOS A;  4HNX B;  3E0K A;  3G3S A;  3C26 A;  1Q2D A;  3D66 A;  4OC3 A;  2XEG A;  4PK2 A;  4NFR A;  4BBH A;  4K3N A;  1Z8T A;  4AB7 A;  2V8D A;  3S9M A;  5JM6 A;  2REE A;  1R3N A;  2Z0Z A;  3WAB A;  2JEV A;  2PJC A;  2GRE A;  3BI0 A;  4E0A A;  3SI2 A;  2ZW5 A;  2PJA A;  4Q36 A;  1LRZ A;  1JQG A;  4DNC A;  4M6I A;  1LAM A;  1YRE A;  1M4D A;  4UWI A;  1I12 A;  4ONU A;  3T90 A;  4OAD A;  3KQX A;  4KOT A;  2RFH A;  1ZLH A;  4C2X A;  4CPA A;  1R43 A;  2NMT A;  1FY7 A;  2ZPA A;  3OWC A;  3LOD A;  2BO9 A;  1VIX A;  1BAV A;  4XNH C;  3PB7 X;  3HUV A;  4FD5 A;  3EXN A;  1IOI A;  1HDU A;  2V8H A;  2ZW4 A;  5AG5 A;  2EWB A;  4NGT A;  5JQ4 A;  4NXY A;  3VWE A;  1Y0R A;  2DF5 A;  1UWY A;  3FED A;  4UCN A;  2CIJ A;  4A38 A;  3B2Y A;  3IWG A;  5EC4 A;  4KS9 A;  2JDC A;  2B5G B;  3LMS A;  2F5I A;  2PVW A;  3JRU A;  2Q7B A;  2K5T A;  1LFW A;  1QQ9 A;  4CGN A;  2H5M A;  2PJ9 A;  4ONW A;  3GKR A;  4GXH A;  1H8L A;  4AXV A;  1U6M A;  3KQZ A;  2OR4 A;  5D29 A;  5KTA A;  2FT0 A;  2FS5 A;  3W6X A;  5ISV A;  1YVO A;  5I0C A;  2PSW A;  3PB9 X;  1CP6 A;  4LX9 A;  1TXR A;  4Y49 C;  3B3S A;  1XMT A;  3ISZ A;  2FIA A;  2EK8 A;  3H8G A;  4MHY A;  4UFV A;  2VBQ A;  3B35 A;  4MI4 A;  4PV6 A;  3RNZ A;  3S6G A;  3PEI A;  2OZU A;  4IHM A;  2IMO A;  2FSR A;  1Z8W A;  3CDX A;  4C7H A;  1CJW A;  1XOV A;  4CRY B;  3FYN A;  4PSX A;  4B5P A;  4ZY2 A;  5IV0 A;  2C6P A;  2ANP A;  2ZOG A;  3BJ7 A;  1YK3 A;  4UIA A;  2GIV A;  2VEZ A;  4KSA A;  2J8N A;  4UCM A;  3DSB A;  3PFO A;  4YFJ A;  1QMU A;  1P4N A;  5CNP A;  3A9L A;  1Y7E A;  1CP7 A;  3DDD A;  2P6F A;  2Z3N A;  5I4M A;  1NSL A;  1AMP A;  2ZED A;  4NCZ A;  4OLL A;  3EFA A;  4JD6 A;  3B3V A;  3TO9 A;  1Z9U A;  5JPH A;  4R7M A;  3CXQ A;  5HVH A;  4I49 A;  2C6G A;  1WWZ A;  4MCP A;  5K8N A;  4YWY A;  5AG7 A;  2YGW A; 
#chains in the Genus database with same CATH homology
 1IYK A;  5C82 A;  3CXP A;  1NMT A;  1XE4 A;  4MFK A;  5F46 A;  1R57 A;  3K9U A;  3TO6 A;  4MFQ A;  4MFJ A;  4R87 A;  1IB1 E;  3ZJ0 A;  4U9Y A;  2R8V A;  2J8M A;  5J8C A;  1WK4 A;  4XPL A;  5AG4 A;  5AG6 A;  4KOY A;  3RYO A;  4CGL A;  2P0W A;  5F49 A;  1KUX A;  4HNY B;  1KUV A;  1B6B A;  2CNM A;  1OZP A;  4PK3 A;  3SHP A;  1QST A;  1M1D A;  3GY9 A;  3FBU A;  4B5O A;  5F48 A;  4E2A A;  1YR0 A;  4NF1 A;  1BO4 A;  4II9 A;  3GYA A;  3P2H A;  5EBV A;  4H6Z A;  2Z11 A;  4YGO A;  3V8I A;  3B8G A;  2R1I A;  3FXT A;  2ATR A;  4XPD B;  4R57 A;  1UFH A;  3QAH A;  4MHD A;  5H84 A;  4KSF A;  2D4O A;  2YNE A;  4B13 A;  3P2F A;  4H89 A;  2HUZ A;  1ZO0 A;  1KUY A;  2I79 A;  2Z3K A;  2B4D A;  4UWJ A;  4KLW A;  2CNS A;  1M44 A;  4RS2 A;  5H86 A;  4KOX A;  4KOU A;  2FXF A;  3DNS A;  3H5Z A;  2PRB A;  3I3G A;  4Q38 A;  4AVB A;  1CM0 A;  2B3V A;  2YNC C;  2FIW A;  2PDO A;  4KVM E;  3TO7 A;  4QUS A;  3F5B A;  1YGH A;  3IGR A;  2WSA A;  1QSN A;  2GE3 A;  1RXT A;  4A2Z A;  4NSQ A;  2WUU A;  2YNC A;  2HV2 A;  5BWA B;  1VHS A;  4KZT A;  4CYO A;  4KUB A;  4JXQ A;  2Z3O A;  4A33 A;  1YVK A;  4IUS A;  3R1K A;  1S5K A;  1PU9 A;  5G21 A;  4KOR A;  3ZZI A;  1YX0 A;  4PSW A;  5KTD A;  4QBJ A;  3PP9 A;  3W6S A;  3IWE A;  5AGE A;  4A30 A;  1I1D A;  4C7I A;  1XF8 A;  2B5G A;  3BJ8 A;  3FRM A;  1Q2C A;  2AE6 A;  4CS0 B;  2Z10 A;  5A27 A;  2YND A;  1S7L A;  2BL1 A;  2Q04 A;  4A31 A;  3N7Z A;  3IU1 A;  3W91 A;  4CGO A;  2WPX A;  2CXA A;  5G1Z A;  2P6E A;  1VKC A;  4U9Z A;  4FD4 A;  2PR8 A;  1ON0 A;  3F0A A;  3R9F A;  3CXS A;  4UFW A;  4A95 A;  3D2P A;  2I00 A;  3JVN A;  2VXK A;  2HQY A;  3S6F A;  4CRZ B;  5IB0 A;  2VI7 A;  4QC6 A;  3TOB A;  3EO4 A;  5IX3 A;  5C88 A;  1KZF A;  2J8R A;  2DPS A;  4KOW A;  1BOB A;  2ZW6 A;  4CYQ A;  3UY5 A;  2OH1 A;  3MGD A;  2OB0 A;  2ZW7 A;  2ARH A;  4KOV A;  3FNC A;  3D2M A;  4CYP A;  4C2Y A;  1M4G A;  4L8A A;  2EVN A;  4L89 A;  4UCP A;  4JWP A;  1MJB A;  2VZZ A;  2R7H A;  2QML A;  1MK4 A;  2CNT A;  4ZBG A;  2PQ8 A;  4U5Y A;  2P6G A;  4K30 A;  2Q4V A;  4HNW B;  4GS4 A;  2JDD A;  1SQH A;  2CY2 A;  2PR1 A;  4XPK A;  4OAE A;  1XIX A;  5G22 A;  4B11 A;  1QSR A;  4CGP A;  2PC1 A;  4JJX A;  4MFP A;  5FVJ A;  3TCV A;  1S60 A;  2QIR A;  4H6U A;  5E96 A;  5A28 A;  3D8P A;  4ORF A;  2X7B A;  1IID A;  4KVX A;  1S7F A;  3D3S A;  1Y7R A;  4MFZ A;  2A4N A;  2Z3P A;  3JTK A;  4XPD C;  1S3Z A;  3DR8 A;  2REF A;  3KKW A;  3F8K A;  4EVY A;  4MJ8 A;  1YLE A;  4KUA A;  3WR7 A;  2O28 A;  4CAX A;  1TIQ A;  5GCN A;  3TOA A;  4F0Y A;  2FE7 A;  4F0X A;  1PUA A;  2RC4 A;  2FL4 A;  4JXR A;  3BLN A;  4UBR A;  3G8W A;  4R9M A;  1L0C A;  2G3A A;  4F6A A;  2VQY A;  4XNH B;  4IF5 A;  3SXO A;  4YRH A;  2Q44 A;  4UA3 A;  1Z4R A;  2OZH A;  1MJA A;  2KCW A;  1Y9K A;  1MJ9 A;  4R3L A;  1QSM A;  4MBU A;  4MY0 A;  2R98 A;  3TE4 A;  4AG7 A;  1N71 A;  2Q0Y A;  4B10 A;  1S7N A;  2OZG A;  4CAF A;  3R95 A;  1I21 A;  3R96 A;  3JUW A;  4Y49 B;  3R9G A;  4B5P B;  1K4J A;  4CGM A;  3NE7 A;  4QB9 A;  2Q4Y A;  5F47 A;  4UFX A;  3SXN A;  4CAE A;  1P0H A;  2Z3M A;  4KVO E;  4X5K A;  4FD6 A;  2BEI A;  2IL4 A;  1S7K A;  1M4I A;  4BMH A;  3PGP A;  4AVA A;  2EUI A;  1J4J A;  3TFY A;  4C68 A;  3LD2 A;  2AJ6 A;  1B87 A;  4A32 A;  4HKF A;  2FCK A;  2D4P A;  2DXQ A;  2C27 A;  4NEX A;  3FB3 A;  4KLV A;  2VZY A;  3S6H A;  5J8F A;  1RO5 A;  3S6K A;  4B12 A;  2Z3L A;  1XEB A;  2DPT A;  5DWN A;  3FIX A;  2G3T A;  4R3K A;  4QVT A;  3PZJ A;  4J3G A;  2BSW A;  3T9Y A;  4FD7 A;  3QB8 A;  2BUE A;  3I9S A;  4LUA A;  4M3S A;  5DWM A;  2G0B A;  2JLM A;  2QEC A;  1GHE A;  4RI1 A;  2ZXV A;  3TT2 A;  4MFL A;  3IU2 A;  1QSO A;  2WPW A;  5G20 A;  3R9E A;  3TTH A;  1Q2Y A;  4B14 A;  2Y0M A;  1IIC A;  2B3U A;  4E8O A;  3DR6 A;  4MY3 A;  4AG9 A;  4CYN A;  2GAN A;  3EY5 A;  3VWD A;  2B58 A;  1NE9 A;  4M85 A;  1Z4E A;  4AVC A;  2OU2 A;  4C2Z A;  3EC4 A;  3H4Q A;  4CAV A;  1IYL A;  1Y9W A;  5HH1 A;  4CAW A;  2B4D B;  4JLY A;  2B4B A;  1V0C A;  4ZGY B;  5KTC A;  4KOS A;  4HNX B;  3E0K A;  3G3S A;  3C26 A;  1Q2D A;  4PK2 A;  4BBH A;  4AB7 A;  2REE A;  2Z0Z A;  2JEV A;  4E0A A;  2ZW5 A;  4Q36 A;  1LRZ A;  4DNC A;  1YRE A;  1M4D A;  4UWI A;  1I12 A;  4ONU A;  3T90 A;  4OAD A;  4KOT A;  4C2X A;  2NMT A;  1FY7 A;  2ZPA A;  3OWC A;  3LOD A;  4XNH C;  4FD5 A;  3EXN A;  5AG5 A;  2ZW4 A;  5JQ4 A;  4NXY A;  3VWE A;  4UCN A;  3IWG A;  5EC4 A;  4KS9 A;  2JDC A;  2B5G B;  2F5I A;  2Q7B A;  2K5T A;  4CGN A;  2H5M A;  3GKR A;  1U6M A;  5KTA A;  2FT0 A;  2FS5 A;  3W6X A;  5ISV A;  1YVO A;  5I0C A;  2PSW A;  4Y49 C;  4LX9 A;  1XMT A;  2FIA A;  4UFV A;  2VBQ A;  4MI4 A;  4PV6 A;  3S6G A;  2OZU A;  4C7H A;  2FSR A;  1CJW A;  4CRY B;  3FYN A;  4PSX A;  4B5P A;  5IV0 A;  3BJ7 A;  1YK3 A;  2GIV A;  2VEZ A;  4KSA A;  2J8N A;  4UCM A;  3DSB A;  4YFJ A;  1P4N A;  5CNP A;  3A9L A;  3DDD A;  2P6F A;  2Z3N A;  1NSL A;  4NCZ A;  4OLL A;  3EFA A;  4JD6 A;  3TO9 A;  1Z9U A;  5JPH A;  3CXQ A;  4I49 A;  1WWZ A;  5HMN A;  5AG7 A;  2YGW A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...