3BJ8A

Spermine/spermidine n1-acetyltransferase from mouse: crystal structure of a ternary complex reveals solvent-mediated spermine binding
Total Genus 42
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
42
sequence length
167
structure length
163
Chain Sequence
KFKIRPATASDCSDILRLIKELAKYEYMEDQVILTEKDLQEDGFGEHPFYHCLVAEVPKEHWTPEGHSIVGFAMYYFTYDPWIGKLLYLEDFFVMSDYRGFGIGSEILKNLSQVAMKCRCSSMHFLVAEWNEPSINFYKRRGASDLGWRLFKIDKEYLLKMAA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Diamine acetyltransferase 1
publication title The crystal structure of spermidine/spermine N1-acetyltransferase in complex with spermine provides insights into substrate binding and catalysis.
pubmed doi rcsb
source organism Mus musculus
molecule tags Transferase
total genus 42
structure length 163
sequence length 167
chains with identical sequence B, C, D
ec nomenclature ec 2.3.1.57: Diamine N-acetyltransferase.
pdb deposition date 2007-12-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00583 Acetyltransf_1 Acetyltransferase (GNAT) family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.630.30 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Aminopeptidase 3bj8A00
3SXNA 4KVXA 1M44A 2ZW5A 1KUXA 3FB3A 1IIDA 2FT0A 1VHSA 4ONUA 3F0AA 2FS5A 1MJ9A 3EXNA 4H6UA 4LX9A 4YFJA 4R87A 1FY7A 2DXQA 4OAEA 2PQ8A 3OWCA 3VWEA 3GYAA 1YLEA 3DDDA 1MJAA 4E0AA 3E0KA 2VI7A 3G3SA 4JJXA 1S7LA 3TT2A 4AG9A 1WK4A 2Q4VA 5J8CA 2Q04A 4HNWB 3T9YA 4U9ZA 1PUAA 3EY5A 2NMTA 4U9YA 2FIWA 4M85A 2JEVA 4HNXB 5GCNA 3SXOA 1Y7RA 4UA3A 1QSTA 2J8MA 3CXSA 4CAVA 1M1DA 1S3ZA 4QVTA 1L0CA 5H84A 4EVYA 4XPLA 2ATRA 1V0CA 4QC6A 3IGRA 4Y49B 2Z10A 4KOWA 1SQHA 1Q2DA 3F5BA 1VKCA 1Q2CA 2OZGA 2GANA 3R9GA 4MHDA 2R7HA 3LD2A 3FRMA 4JLYA 3TFYA 3G8WA 2AJ6A 1KUYA 1NSLA 3MGDA 4HKFA 3BJ7A 3DSBA 2EVNA 3S6HA 1XEBA 2FIAA 3ZZIA 3WR7A 1YREA 5KTAA 3TO7A 1J4JA 1GHEA 1S60A 3FXTA 3F8KA 2VBQA 2ZW6A 4DNCA 1MJBA 2Z11A 4OLLA 3FBUA 2B5GA 4RS2A 2Y0MA 2CY2A 5JQ4A 3TO6A 4QUSA 4KVME 2WPWA 2EUIA 4ZBGA 4NF1A 4R3LA 3P2FA 3IWGA 2PRBA 2BUEA 4ORFA 2HQYA 1YR0A 2QMLA 3V8IA 2VZYA 2QIRA 2G3AA 2RC4A 4IF5A 5IV0A 4MI4A 1TIQA 1M4GA 4PK2A 1S7NA 4KVOE 5KTDA 3H4QA 2VXKA 4PV6A 3TOAA 2B5GB 4AVBA 2P6GA 4UBRA 5HMNA 4JXRA 4NEXA 3I3GA 4IUSA 5JPHA 3R9FA 2PR1A 1XE4A 3VWDA 4L8AA 4KLVA 3CXQA 3K9UA 1U6MA 1YK3A 1I21A 2PC1A 3S6FA 4L89A 4YRHA 5F48A 3B8GA 4KOVA 4K30A 4KOXA 3LODA 5C82A 2VQYA 2B3VA 2JDDA 1YVOA 2VEZA 2FCKA 2Q0YA 2CNMA 1KUVA 4U5YA 4CRYB 3W6XA 4AG7A 2JDCA 5J8FA 3R95A 1B6BA 2VZZA 3GKRA 5IB0A 5C88A 5DWNA 2QECA 5H86A 1XIXA 3DR8A 3S6GA 3TTHA 1CM0A 2R8VA 2R98A 3T90A 5F46A 2FL4A 1M4DA 1OZPA 2FE7A 2J8RA 2ZW7A 4XPDB 5F49A 3QB8A 4CAXA 1IYLA 3GY9A 5KTCA 5CNPA 2B4BA 3FNCA 1MK4A 4NSQA 2J8NA 1M4IA 5EC4A 1YVKA 3QAHA 1IICA 3BLNA 5F47A 2BSWA 4KOTA 1Y9WA 3R9EA 1R57A 3C26A 4XNHC 2X7BA 2WPXA 4QB9A 4MBUA 1UFHA 2I00A 2B58A 1Q2YA 2B4DA 5FVJA 1LRZA 2GIVA 1KZFA 3D2MA 1S7KA 2FXFA 4F6AA 2ZXVA 2GE3A 4B5PA 2Q44A 4MY3A 4J3GA 3FIXA 1Y9KA 3TOBA 2IL4A 1BOBA 3R1KA 2R1IA 2FSRA 5ISVA 2ARHA 1PU9A 4B5OA 1B87A 2PR8A 2B4DB 3DNSA 3D3SA 2A4NA 4H6ZA 2REEA 3TCVA 2OZHA 4B5PB 1RO5A 1N71A 1S5KA 1XMTA 2PSWA 2B3UA 4KOYA 1XF8A 3S6KA 3BJ8A 4RI1A 3R96A 3JVNA 3DR6A 4KUAA 2Q7BA 2D4PA 1YX0A 2H5MA 3CXPA 2OB0A 4PSXA 4LUAA 2O28A 4FD4A 1IYKA 4PK3A 2OZUA 4GS4A 4R3KA 5DWMA 3W6SA 5I0CA 1K4JA 1NMTA 3EC4A 1Z4EA 2P6FA 4XPKA 2HUZA 1QSRA 3TE4A 4HNYB 2BEIA 4FD7A 1S7FA 4YGOA 1Z9UA 3RYOA 1IB1E 4UWJA 3PZJA 3SHPA 4JWPA 4R9MA 2PDOA 4E8OA 1Z4RA 4JXQA 4CAWA 3EFAA 2CNSA 4MJ8A 5IX3A 4XNHB 2ZPAA 2HV2A 3PGPA 4I49A 5E96A 4KLWA 4BMHA 3D8PA 2ZW4A 4X5KA 2K5TA 4AVCA 4MY0A 3W91A 4OADA 4KUBA 2OH1A 4UWIA 2P6EA 1QSNA 4QBJA 4KORA 1CJWA 3NE7A 4JD6A 4II9A 5HH1A 4CRZB 3PP9A 1NE9A 2OU2A 3I9SA 1P4NA 2Q4YA 3TO9A 1P0HA 2C27A 4Y49C 3KKWA 4AB7A 3ZJ0A 2AE6A 4KOUA 4KOSA 2CNTA 1I1DA 4NCZA 4F0YA 1YGHA 2I79A 4FD6A 4CS0B 3EO4A 1WWZA 2Z0ZA 1BO4A 1QSMA 2G3TA 2KCWA 2G0BA 1QSOA 1ON0A 2D4OA 3N7ZA 3P2HA 3FYNA 4R57A 4XPDC 1I12A 4PSWA 2P0WA 4AVAA 2BL1A 4E2AA 2JLMA 2F5IA 5EBVA 3JUWA 4H89A 3UY5A 4NXYA 4KZTA 1RXTA 3D2PA 2REFA 4FD5A 4M3SA
chains in the Genus database with same CATH superfamily
2VL1A 1ZG9A 4FBEA 3WC5A 3DGVA 3SXNA 2RFHA 4CPAA 4KVXA 2XEFA 2NSMA 1OBRA 1VGYA 1M44A 2ZW5A 1KUXA 3FB3A 3B3VA 1IIDA 4OC1A 4ZX9A 2ODFA 5IB9A 4KSAA 2FT0A 1TKJA 1VHSA 2ZEGA 3WABA 4BINA 4ONUA 4IK2A 3F0AA 2FS5A 2Q51A 2WZNA 3IC1A 4OMEA 2PJ4A 3B2YA 4OC5A 3RO0A 4NGMA 4Q36A 4C7HA 4ZI6A 1MJ9A 3EXNA 4GXHA 3RAMA 5HXDA 4H6UA 4LX9A 3TC8A 4MCQA 4R87A 4YFJA 1FY7A 2DXQA 4HPSA 4OAEA 2PQ8A 4DYOA 3OWCA 4UCMA 3VWEA 3GYAA 1YLEA 4P6YA 3DDDA 1MJAA 3V38A 4UCPA 4CAEA 4E0AA 3E0KA 4P4DA 2VI7A 2O4HA 3KL9A 2XEIA 1IOFA 3K9TA 3G3SA 4MCRA 4JJXA 1S7LA 3TT2A 4AG9A 4NJRA 1WK4A 4A95A 5AG5A 2Q4VA 2ZEHA 3KHXA 5J8CA 2Q04A 5HVFA 3CDXA 4HNWB 3FEDA 3T9YA 4U9ZA 3S9LA 1BLLE 1PUAA 3EY5A 2NMTA 4U9YA 4MHYA 2FIWA 1KWMA 3HLPA 4R6TA 1Z8WA 2DF5A 4M85A 2JEVA 3SJXA 4OKOA 1Z2LA 4LQ6A 3BI1A 4HNXB 4R76A 5GCNA 3SXOA 4BBHA 4MCPA 1Y7RA 4UA3A 3PB9X 1QSTA 3IEHA 4EMEA 2BOAA 2J8MA 2JBJA 2PJAA 3KGQA 3CXSA 4CAVA 1M1DA 1S3ZA 4QVTA 1L0CA 2Z3OA 2PJ0A 2YNCA 2I3CA 2Q7SA 5AG6A 5H84A 4UEEA 4XPLA 4EVYA 2V8DA 2ATRA 4P45A 1V0CA 4QC6A 5G22A 2C6GA 4OC2A 6CPAA 3L2NA 3IGRA 5LRJA 4Y49B 4P4FA 2Z10A 1LCPA 3KHZA 4KOWA 5D29A 1SQHA 1X10A 1Q2DA 3F5BA 3VH9A 1FT7A 1VKCA 1Q2CA 2OZGA 2GANA 2PCUA 3IU1A 4P10A 4UFWA 3R9GA 1ELLP 2EWBA 4C68A 1TXRA 4MHDA 2R7HA 5LYDA 3SJGA 3LD2A 3FRMA 4NGQA 3NH5A 1Z8LA 4JLYA 3TFYA 2ZEPA 3G8WA 3IFEA 4TNUA 2AJ6A 3LWUA 1KUYA 3IU2A 4C2XA 1NSLA 2CXAA 3MGDA 1TF8A 2WYRA 4HKFA 3BJ7A 4MXUA 5D8NA 1CPXA 3DSBA 2GLJA 2EVNA 3S6HA 1XEBA 2FIAA 3HUVA 3NH4A 3ZZIA 3WR7A 3PB8X 1YREA 5KTAA 5AG4A 3TO7A 3B35A 1J4JA 3B3TA 4BD9A 2OR4A 3IIBA 1GHEA 1S60A 4IAVA 2F7VA 3DLJA 3FXTA 3F8KA 2QYVA 1X12A 2VBQA 2ZW6A 4YWYA 4DNCA 4IHMA 1ZLIA 1TF9A 1MJBA 1HEEA 2PVVA 2PJ1A 1Y0RA 4C2ZA 3BI0A 2Z11A 4OLLA 3FBUA 1NSAA 2B5GA 4RS2A 2Y0MA 2CY2A 1ZG8A 4C7IA 3TO6A 1YW6A 5JQ4A 1HDQA 2AFWA 2V8GA 4QUSA 1IY7A 4KVME 2C6CA 5F09A 2WPWA 2EUIA 4MMOA 4ZY1A 1FNOA 4A32A 3PBEA 4ZY2A 4ZBGA 4NF1A 2ZEEA 3FMCA 4R3LA 2ZOGA 3P2FA 3IWGA 2PRBA 2BUEA 4ORFA 2C6PA 5G1ZA 4A33A 2HQYA 3KI9A 4R7MA 1YR0A 3PB6X 4UF4A 1GYTA 2PJ6A 2QMLA 5JGFA 3V8IA 1YSJA 2VZYA 4ZY0A 2QIRA 2G3AA 2RC4A 3K2KA 4IF5A 4MI4A 3PBBA 4UEZA 1YMEA 5IV0A 1TIQA 3WC6A 1M4GA 3NE8A 4AXVA 3KQXA 1LAPA 3ISZA 4PK2A 1S7NA 3ISXA 4KVOE 3KR4A 2CTBA 2YNEA 1IU8A 1LAMA 1YQEA 4F9UA 5JM6A 5KTDA 1BPNA 3H4QA 4A37A 2VXKA 4PV6A 5AGEA 5G20A 3TOAA 5K8MA 2B5GB 1R3NA 4AVBA 2P6GA 3PEIA 4UBRA 5HMNA 1AUGA 4JXRA 4P4EA 3RBUA 4NEXA 3I3GA 2G9DA 4IUSA 2RB7A 4FUUA 4UCNA 5JPHA 3R9FA 3BXMA 2PR1A 1XE4A 3IJ3A 3VWDA 5LYIA 4L8AA 4KLVA 1LOKA 3CXQA 3K9UA 1JWQA 3A9LA 1U6MA 1YK3A 4NFRA 2PJ9A 1I21A 2PC1A 7CPAA 3S6FA 4L89A 3LACA 1YLOA 3H8EA 4O23A 2PIZA 3SI1A 4YRHA 3D7HA 5F48A 3B8GA 5K8OA 2PE3A 1CBXA 2JBKA 4KOVA 5THWA 4K30A 2WUUA 4KOXA 4KS9A 4B10A 4P44A 3LODA 5C82A 3KASA 4B11A 2AFZA 1CP7A 2VQYA 3B7IA 2B3VA 2JDDA 3CT9A 4A38A 1ARLA 4TWEA 1YVOA 4YU9A 2Z3NA 2VEZA 3FF3A 4H2KA 3PFOA 2FVGA 1Z8XA 2FCKA 2Q0YA 4MFPA 2CNMA 2Z3LA 1KUVA 4M6IA 4U5YA 4CRYB 5CBMA 3B3WA 3W6XA 2JDCA 3PB4X 2CTCA 4AG7A 4A39A 2PRQA 5LYFA 2JEWA 4MRIA 4RUHA 2XEGA 5J8FA 1TKFA 2PJ7A 3R95A 1B6BA 2VZZA 2ANPA 3GKRA 1XBUA 2BO9A 5C88A 5IB0A 3KR5A 1F57A 5DWNA 2QECA 4P4BA 4FAIA 5H86A 1XIXA 3DR8A 4X8IA 3S6GA 4KSFA 1UWYA 2F8HA 4Z65A 3TTHA 3SJEA 1CM0A 4NGTA 2R8VA 2R98A 3T90A 3D66A 2AFMA 4PPZA 1DE4C 5F46A 1Z8TA 2FL4A 1M4DA 5LRGA 1OZPA 2O53A 3D7FA 2IJZA 3D4UA 3SI0A 2FE7A 2J8RA 3FVLA 2IMOA 1RTQA 3CZXA 4MHZA 2ZW7A 4XPDB 5F49A 3KZWA 1VIXA 2NYQA 4EFDA 3QB8A 3H8GA 4CYNA 4CAXA 2XEJA 1ZLHA 1IYLA 3GY9A 3MRUA 4MFJA 1AYEA 1ELMP 5KTCA 2Q4ZA 4OIDA 3T8WA 4NGSA 2EBJA 5CNPA 1ZG7A 4JZ0A 4EWTA 2B4BA 3FNCA 1MK4A 4PQAA 4B14A 3NA6A 4NSQA 2J8NA 1M4IA 3BHXA 5EC4A 2GREA 4MHPA 1F2OA 1YVKA 1IICA 3QAHA 3BLNA 4RN7A 2BSWA 5F47A 4KOTA 4CGOA 2PVWA 1Y9WA 3QAYA 4ZYQA 1CP6A 3B3CA 3R9EA 1R57A 3WT4A 4CGPA 3C26A 1XMBA 4XNHC 2CIJA 2X7BA 4ONWA 1CG2A 2PJ3A 2WPXA 4QB9A 3CPXA 1UFHA 4MBUA 2I00A 2B58A 1Q2YA 4Q7AA 2HC9A 2B4DA 1XJOA 1LRZA 4UIBA 5FVJA 4A2ZA 2GIVA 4Q38A 3CPAA 1KZFA 5CPAA 5AG7A 2Z3PA 2AFOA 1Y0YA 2Q43A 3D2MA 1S7KA 2FXFA 1IGBA 3H8FA 2ZXVA 2GE3A 4F6AA 4B5PA 4C2YA 2Q44A 4MY3A 4CGMA 2EO8A 4J3GA 3FIXA 2PJBA 3WC7A 2AFXA 1Y9KA 2QVPA 4CAFA 2PIYA 4A31A 3RZAA 1BAVA 2ZEMA 3TOBA 2IL4A 4CYPA 1BOBA 2PJCA 3R1KA 4DJLA 3GB0A 5ELYA 2GU2A 2GLFA 4A30A 3SI2A 5A27A 2R1IA 2POKA 2FSRA 4PXBA 1AMPA 5ISVA 4JYWA 5K8PA 2BCOA 4B13A 2ZOFA 4M6HA 2ARHA 1PU9A 3S9NA 4B5OA 1B87A 2PR8A 1XOVA 3D67A 4NGNA 2C1CA 3TX8A 2B4DB 3DNSA 1TKHA 5J1QA 2YNDA 2YGWA 3D3SA 2ZENA 2A4NA 2J9AA 3QNVA 1F2PA 4H6ZA 4R8FA 3IO1A 3MN8A 2REEA 3TCVA 2OZHA 2AFSA 4GM5A 1RO5A 4B5PB 4DUKA 1EE3P 5A28A 1N71A 1S5KA 1XFOA 1XMTA 4UFVA 2PSWA 2B3UA 3FEEA 4KOYA 1XF8A 3S6KA 3FH4A 3BJ8A 4RI1A 3D68A 3R96A 3JVNA 4OC3A 4PXCA 3D7GA 3DR6A 4KUAA 5EMIA 2ZEOA 2Q7BA 2D4PA 1YX0A 2GFQA 2H5MA 3CXPA 3FJUA 2OB0A 4F8ZA 2ZELA 2DPTA 4PSXA 3RNZA 4LUAA 2O28A 4FD4A 2V77A 1IYKA 4PK3A 2OZUA 4GS4A 1PYTB 5BWAB 4R3KA 5DWMA 3W6SA 5I0CA 5K8NA 5LYLA 8CPAA 1K4JA 1NMTA 3PB7X 3EC4A 2PJ8A 1VHOA 1Z4EA 4X2TA 3KQZA 2V8HA 3B3SA 1ZO0A 3GIUA 2P6FA 4CGNA 4ZX8A 4XPKA 2HUZA 1QSRA 4P4IA 3VATA 2ZEDA 3IWWA 3TE4A 3N5FA 4HNYB 2BEIA 4FD7A 1S7FA 4YGOA 1Z9UA 3RYOA 1IB1E 4UWJA 3PZJA 5HVHA 4K3NA 3SHPA 4JWPA 2ABZA 4MFQA 1LANA 2V8VA 3SJFA 3GLJA 4R9MA 2PDOA 4E8OA 3PFEA 1Z4RA 4JXQA 2Z3MA 4CAWA 3EFAA 2CNSA 1IOIA 4G1PA 4MJ8A 2OOTA 1Y7EA 4XNHB 1Q7LA 5IX3A 2ZPAA 2HV2A 3PGPA 4I49A 4CGLA 5E96A 4KLWA 4CYQA 4BMHA 3V7ZA 3D8PA 1QMUA 2DEAA 1HDUA 1VHEA 2ZW4A 4NJQA 4MFZA 2AFUA 4X5KA 2K5TA 4OP4A 4AVCA 2PJ5A 4MY0A 3W91A 4OADA 4KUBA 3PRTA 2OH1A 4OC0A 4UWIA 1PCAA 4B12A 4MHNA 3H5ZA 4UFXA 2P6EA 5LRKA 4F0XA 3VARA 1QSNA 3IWEA 4UIAA 4QBJA 4KORA 4X3RA 1CJWA 3NE7A 4JD6A 4II9A 5HH1A 4OIWA 4CRZB 3PP9A 2ZEFA 4WWVA 1NE9A 1CX8A 5JH9A 2OU2A 2QJ8A 2Z3KA 3I9SA 1P4NA 4KSIA 4A94A 3I1UA 2HB6A 2Q4YA 3TO9A 4PXDA 1P0HA 1R43A 2C27A 2WSAA 1H8LA 4Y49C 3KKWA 4AB7A 2IQ6A 4WJBA 3ZJ0A 4CYOA 2AE6A 4KOUA 4KOSA 3D7DA 2CNTA 4LQGA 1I1DA 2EK8A 4NCZA 3NH8A 4P4JA 4PXEA 4F0YA 1XRYA 3NFZA 1YGHA 3GUXA 1A2ZA 1ARMA 4UEFA 2CF4A 5I4MA 2I79A 4FD6A 4CS0B 3EO4A 1WWZA 2DPSA 4MCSA 1DTDA 2Z0ZA 1BO4A 1QSMA 2G3TA 2KCWA 2G0BA 1QSOA 1BPMA 1ON0A 4F9VA 2D4OA 2PJ2A 3N7ZA 3P2HA 4NGPA 3FYNA 4R57A 4XPDC 1M4LA 1QQ9A 4W9YA 1I12A 4PSWA 5G21A 2P0WA 1CPSA 4OC4A 4AVAA 4M6GA 2BL1A 4E2AA 2JLMA 2F5IA 4B6ZA 2YNCC 4NGRA 5EBVA 4FWUA 3JRUA 3JUWA 3JTKA 3LMSA 3FECA 3FX6A 4MFLA 4H89A 3UY5A 4NXYA 4KZTA 1RXTA 3D2PA 2REFA 3S9MA 5DS0A 1Z5RA 2EK9A 4FD5A 5HVGA 4MFKA 4ZGYB 1LFWA 1YW4A 1JQGA 4M3SA
chains in the Genus database with same CATH topology
3SXNA 4KVXA 1M44A 2ZW5A 1KUXA 3FB3A 1IIDA 4KSAA 2FT0A 1VHSA 4ONUA 3F0AA 2FS5A 4Q36A 4C7HA 1MJ9A 3EXNA 4H6UA 4LX9A 4YFJA 4R87A 1FY7A 2DXQA 4OAEA 2PQ8A 3OWCA 4UCMA 3VWEA 3GYAA 1YLEA 3DDDA 1MJAA 4UCPA 4CAEA 4E0AA 3E0KA 2VI7A 3G3SA 4JJXA 1S7LA 3TT2A 4AG9A 1WK4A 4A95A 5AG5A 2Q4VA 5J8CA 2Q04A 4HNWB 3T9YA 4U9ZA 1PUAA 3EY5A 2NMTA 4U9YA 2FIWA 4M85A 2JEVA 4HNXB 5GCNA 4BBHA 3SXOA 1Y7RA 4UA3A 1QSTA 2J8MA 3CXSA 4CAVA 1M1DA 1S3ZA 4QVTA 1L0CA 2Z3OA 2YNCA 5AG6A 5H84A 4EVYA 4XPLA 2ATRA 1V0CA 4QC6A 5G22A 3IGRA 4Y49B 2Z10A 4KOWA 1SQHA 1Q2DA 3F5BA 1VKCA 1Q2CA 2OZGA 2GANA 3IU1A 3R9GA 4UFWA 4C68A 4MHDA 2R7HA 3LD2A 3FRMA 4JLYA 3TFYA 3G8WA 2AJ6A 1KUYA 3IU2A 4C2XA 1NSLA 2CXAA 3MGDA 4HKFA 3BJ7A 3DSBA 2EVNA 3S6HA 1XEBA 2FIAA 3ZZIA 3WR7A 1YREA 5KTAA 3TO7A 1J4JA 1GHEA 1S60A 3FXTA 3F8KA 2VBQA 2ZW6A 4DNCA 1MJBA 4C2ZA 2Z11A 4OLLA 3FBUA 2B5GA 4RS2A 2Y0MA 2CY2A 4C7IA 5JQ4A 3TO6A 4QUSA 4KVME 2WPWA 2EUIA 4A32A 4ZBGA 4NF1A 4R3LA 3P2FA 3IWGA 2PRBA 2BUEA 4ORFA 5G1ZA 4A33A 2HQYA 1YR0A 2QMLA 3V8IA 2VZYA 2QIRA 2G3AA 2RC4A 4IF5A 5IV0A 4MI4A 1TIQA 1M4GA 4PK2A 1S7NA 4KVOE 2YNEA 5KTDA 3H4QA 2VXKA 4PV6A 5AGEA 5G20A 3TOAA 2B5GB 4AVBA 2P6GA 4UBRA 5HMNA 4JXRA 4NEXA 3I3GA 4IUSA 4UCNA 5JPHA 3R9FA 2PR1A 1XE4A 3VWDA 4L8AA 4KLVA 3CXQA 3K9UA 3A9LA 1U6MA 1YK3A 1I21A 2PC1A 3S6FA 4L89A 4YRHA 5F48A 3B8GA 4KOVA 4K30A 2WUUA 4KOXA 4KS9A 4B10A 3LODA 5C82A 4B11A 2VQYA 2B3VA 2JDDA 1YVOA 2Z3NA 2VEZA 2FCKA 2Q0YA 4MFPA 2CNMA 2Z3LA 1KUVA 4U5YA 4CRYB 3W6XA 4AG7A 2JDCA 5J8FA 3R95A 1B6BA 2VZZA 3GKRA 5IB0A 5C88A 5DWNA 2QECA 5H86A 1XIXA 3DR8A 3S6GA 4KSFA 3TTHA 1CM0A 2R8VA 2R98A 3T90A 5F46A 2FL4A 1M4DA 1OZPA 2FE7A 2J8RA 2ZW7A 4XPDB 5F49A 3QB8A 4CYNA 4CAXA 1IYLA 3GY9A 4MFJA 5KTCA 5CNPA 2B4BA 3FNCA 1MK4A 4B14A 4NSQA 2J8NA 1M4IA 5EC4A 5AG4A 1YVKA 3QAHA 1IICA 3BLNA 5F47A 2BSWA 4KOTA 4CGOA 1Y9WA 3R9EA 1R57A 4CGPA 3C26A 4XNHC 2X7BA 2WPXA 4QB9A 4MBUA 1UFHA 2I00A 2B58A 1Q2YA 2B4DA 5FVJA 1LRZA 4A2ZA 2GIVA 4Q38A 1KZFA 5AG7A 2Z3PA 3D2MA 1S7KA 2FXFA 4F6AA 2ZXVA 2GE3A 4B5PA 4C2YA 2Q44A 4MY3A 4CGMA 4J3GA 3FIXA 1Y9KA 4CAFA 4A31A 3TOBA 2IL4A 4CYPA 1BOBA 3R1KA 4A30A 5A27A 2R1IA 2FSRA 5ISVA 4B13A 2ARHA 1PU9A 4B5OA 1B87A 2PR8A 2B4DB 3DNSA 2YNDA 2YGWA 3D3SA 2A4NA 4H6ZA 2REEA 3TCVA 2OZHA 4B5PB 1RO5A 5A28A 1N71A 1S5KA 1XMTA 4UFVA 2PSWA 2B3UA 4KOYA 1XF8A 3S6KA 3BJ8A 4RI1A 3R96A 3JVNA 3DR6A 4KUAA 2Q7BA 2D4PA 1YX0A 2H5MA 3CXPA 2OB0A 2DPTA 4PSXA 4LUAA 2O28A 4FD4A 1IYKA 4PK3A 2OZUA 4GS4A 5BWAB 4R3KA 5DWMA 3W6SA 5I0CA 1K4JA 1NMTA 3EC4A 1Z4EA 1ZO0A 2P6FA 4CGNA 4XPKA 2HUZA 1QSRA 3TE4A 4HNYB 2BEIA 4FD7A 1S7FA 4YGOA 1Z9UA 3RYOA 1IB1E 4UWJA 3PZJA 3SHPA 4JWPA 4MFQA 4R9MA 2PDOA 4E8OA 1Z4RA 4JXQA 2Z3MA 4CAWA 3EFAA 2CNSA 4MJ8A 5IX3A 4XNHB 2ZPAA 2HV2A 3PGPA 4I49A 4CGLA 5E96A 4KLWA 4CYQA 4BMHA 3D8PA 2ZW4A 4MFZA 4X5KA 2K5TA 4AVCA 4MY0A 3W91A 4OADA 4KUBA 2OH1A 4UWIA 4B12A 3H5ZA 4UFXA 2P6EA 4F0XA 1QSNA 3IWEA 4QBJA 4KORA 1CJWA 3NE7A 4JD6A 4II9A 5HH1A 4CRZB 3PP9A 1NE9A 2OU2A 2Z3KA 3I9SA 1P4NA 2Q4YA 3TO9A 1P0HA 2C27A 2WSAA 4Y49C 3KKWA 4AB7A 3ZJ0A 4CYOA 2AE6A 4KOUA 4KOSA 2CNTA 1I1DA 4NCZA 4F0YA 1YGHA 2I79A 4FD6A 4CS0B 3EO4A 1WWZA 2DPSA 2Z0ZA 1BO4A 1QSMA 2G3TA 2KCWA 2G0BA 1QSOA 1ON0A 2D4OA 3N7ZA 3P2HA 3FYNA 4R57A 4XPDC 1I12A 4PSWA 5G21A 2P0WA 4AVAA 2BL1A 4E2AA 2JLMA 2F5IA 2YNCC 5EBVA 3JUWA 3JTKA 4MFLA 4H89A 3UY5A 4NXYA 4KZTA 1RXTA 3D2PA 2REFA 4FD5A 4MFKA 4ZGYB 4M3SA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3SXN A;  4KVX A;  1M44 A;  2ZW5 A;  1KUX A;  3FB3 A;  1IID A;  2FT0 A;  1VHS A;  4ONU A;  3F0A A;  2FS5 A;  1MJ9 A;  3EXN A;  4H6U A;  4LX9 A;  4YFJ A;  4R87 A;  1FY7 A;  2DXQ A;  4OAE A;  2PQ8 A;  3OWC A;  3VWE A;  3GYA A;  1YLE A;  3DDD A;  1MJA A;  4E0A A;  3E0K A;  2VI7 A;  3G3S A;  4JJX A;  1S7L A;  3TT2 A;  4AG9 A;  1WK4 A;  2Q4V A;  5J8C A;  2Q04 A;  4HNW B;  3T9Y A;  4U9Z A;  1PUA A;  3EY5 A;  2NMT A;  4U9Y A;  2FIW A;  4M85 A;  2JEV A;  4HNX B;  5GCN A;  3SXO A;  1Y7R A;  4UA3 A;  1QST A;  2J8M A;  3CXS A;  4CAV A;  1M1D A;  1S3Z A;  4QVT A;  1L0C A;  5H84 A;  4EVY A;  4XPL A;  2ATR A;  1V0C A;  4QC6 A;  3IGR A;  4Y49 B;  2Z10 A;  4KOW A;  1SQH A;  1Q2D A;  3F5B A;  1VKC A;  1Q2C A;  2OZG A;  2GAN A;  3R9G A;  4MHD A;  2R7H A;  3LD2 A;  3FRM A;  4JLY A;  3TFY A;  3G8W A;  2AJ6 A;  1KUY A;  1NSL A;  3MGD A;  4HKF A;  3BJ7 A;  3DSB A;  2EVN A;  3S6H A;  1XEB A;  2FIA A;  3ZZI A;  3WR7 A;  1YRE A;  5KTA A;  3TO7 A;  1J4J A;  1GHE A;  1S60 A;  3FXT A;  3F8K A;  2VBQ A;  2ZW6 A;  4DNC A;  1MJB A;  2Z11 A;  4OLL A;  3FBU A;  2B5G A;  4RS2 A;  2Y0M A;  2CY2 A;  5JQ4 A;  3TO6 A;  4QUS A;  4KVM E;  2WPW A;  2EUI A;  4ZBG A;  4NF1 A;  4R3L A;  3P2F A;  3IWG A;  2PRB A;  2BUE A;  4ORF A;  2HQY A;  1YR0 A;  2QML A;  3V8I A;  2VZY A;  2QIR A;  2G3A A;  2RC4 A;  4IF5 A;  5IV0 A;  4MI4 A;  1TIQ A;  1M4G A;  4PK2 A;  1S7N A;  4KVO E;  5KTD A;  3H4Q A;  2VXK A;  4PV6 A;  3TOA A;  2B5G B;  4AVB A;  2P6G A;  4UBR A;  5HMN A;  4JXR A;  4NEX A;  3I3G A;  4IUS A;  5JPH A;  3R9F A;  2PR1 A;  1XE4 A;  3VWD A;  4L8A A;  4KLV A;  3CXQ A;  3K9U A;  1U6M A;  1YK3 A;  1I21 A;  2PC1 A;  3S6F A;  4L89 A;  4YRH A;  5F48 A;  3B8G A;  4KOV A;  4K30 A;  4KOX A;  3LOD A;  5C82 A;  2VQY A;  2B3V A;  2JDD A;  1YVO A;  2VEZ A;  2FCK A;  2Q0Y A;  2CNM A;  1KUV A;  4U5Y A;  4CRY B;  3W6X A;  4AG7 A;  2JDC A;  5J8F A;  3R95 A;  1B6B A;  2VZZ A;  3GKR A;  5IB0 A;  5C88 A;  5DWN A;  2QEC A;  5H86 A;  1XIX A;  3DR8 A;  3S6G A;  3TTH A;  1CM0 A;  2R8V A;  2R98 A;  3T90 A;  5F46 A;  2FL4 A;  1M4D A;  1OZP A;  2FE7 A;  2J8R A;  2ZW7 A;  4XPD B;  5F49 A;  3QB8 A;  4CAX A;  1IYL A;  3GY9 A;  5KTC A;  5CNP A;  2B4B A;  3FNC A;  1MK4 A;  4NSQ A;  2J8N A;  1M4I A;  5EC4 A;  1YVK A;  3QAH A;  1IIC A;  3BLN A;  5F47 A;  2BSW A;  4KOT A;  1Y9W A;  3R9E A;  1R57 A;  3C26 A;  4XNH C;  2X7B A;  2WPX A;  4QB9 A;  4MBU A;  1UFH A;  2I00 A;  2B58 A;  1Q2Y A;  2B4D A;  5FVJ A;  1LRZ A;  2GIV A;  1KZF A;  3D2M A;  1S7K A;  2FXF A;  4F6A A;  2ZXV A;  2GE3 A;  4B5P A;  2Q44 A;  4MY3 A;  4J3G A;  3FIX A;  1Y9K A;  3TOB A;  2IL4 A;  1BOB A;  3R1K A;  2R1I A;  2FSR A;  5ISV A;  2ARH A;  1PU9 A;  4B5O A;  1B87 A;  2PR8 A;  2B4D B;  3DNS A;  3D3S A;  2A4N A;  4H6Z A;  2REE A;  3TCV A;  2OZH A;  4B5P B;  1RO5 A;  1N71 A;  1S5K A;  1XMT A;  2PSW A;  2B3U A;  4KOY A;  1XF8 A;  3S6K A;  3BJ8 A;  4RI1 A;  3R96 A;  3JVN A;  3DR6 A;  4KUA A;  2Q7B A;  2D4P A;  1YX0 A;  2H5M A;  3CXP A;  2OB0 A;  4PSX A;  4LUA A;  2O28 A;  4FD4 A;  1IYK A;  4PK3 A;  2OZU A;  4GS4 A;  4R3K A;  5DWM A;  3W6S A;  5I0C A;  1K4J A;  1NMT A;  3EC4 A;  1Z4E A;  2P6F A;  4XPK A;  2HUZ A;  1QSR A;  3TE4 A;  4HNY B;  2BEI A;  4FD7 A;  1S7F A;  4YGO A;  1Z9U A;  3RYO A;  1IB1 E;  4UWJ A;  3PZJ A;  3SHP A;  4JWP A;  4R9M A;  2PDO A;  4E8O A;  1Z4R A;  4JXQ A;  4CAW A;  3EFA A;  2CNS A;  4MJ8 A;  5IX3 A;  4XNH B;  2ZPA A;  2HV2 A;  3PGP A;  4I49 A;  5E96 A;  4KLW A;  4BMH A;  3D8P A;  2ZW4 A;  4X5K A;  2K5T A;  4AVC A;  4MY0 A;  3W91 A;  4OAD A;  4KUB A;  2OH1 A;  4UWI A;  2P6E A;  1QSN A;  4QBJ A;  4KOR A;  1CJW A;  3NE7 A;  4JD6 A;  4II9 A;  5HH1 A;  4CRZ B;  3PP9 A;  1NE9 A;  2OU2 A;  3I9S A;  1P4N A;  2Q4Y A;  3TO9 A;  1P0H A;  2C27 A;  4Y49 C;  3KKW A;  4AB7 A;  3ZJ0 A;  2AE6 A;  4KOU A;  4KOS A;  2CNT A;  1I1D A;  4NCZ A;  4F0Y A;  1YGH A;  2I79 A;  4FD6 A;  4CS0 B;  3EO4 A;  1WWZ A;  2Z0Z A;  1BO4 A;  1QSM A;  2G3T A;  2KCW A;  2G0B A;  1QSO A;  1ON0 A;  2D4O A;  3N7Z A;  3P2H A;  3FYN A;  4R57 A;  4XPD C;  1I12 A;  4PSW A;  2P0W A;  4AVA A;  2BL1 A;  4E2A A;  2JLM A;  2F5I A;  5EBV A;  3JUW A;  4H89 A;  3UY5 A;  4NXY A;  4KZT A;  1RXT A;  3D2P A;  2REF A;  4FD5 A;  4M3S A; 
#chains in the Genus database with same CATH topology
 2VL1 A;  1ZG9 A;  4FBE A;  3WC5 A;  3DGV A;  3SXN A;  2RFH A;  4CPA A;  4KVX A;  2XEF A;  2NSM A;  1OBR A;  1VGY A;  1M44 A;  2ZW5 A;  1KUX A;  3FB3 A;  3B3V A;  1IID A;  4OC1 A;  4ZX9 A;  2ODF A;  5IB9 A;  4KSA A;  2FT0 A;  1TKJ A;  1VHS A;  2ZEG A;  3WAB A;  4BIN A;  4ONU A;  4IK2 A;  3F0A A;  2FS5 A;  2Q51 A;  2WZN A;  3IC1 A;  4OME A;  2PJ4 A;  3B2Y A;  4OC5 A;  3RO0 A;  4NGM A;  4Q36 A;  4C7H A;  4ZI6 A;  1MJ9 A;  3EXN A;  4GXH A;  3RAM A;  5HXD A;  4H6U A;  4LX9 A;  3TC8 A;  4MCQ A;  4R87 A;  4YFJ A;  1FY7 A;  2DXQ A;  4HPS A;  4OAE A;  2PQ8 A;  4DYO A;  3OWC A;  4UCM A;  3VWE A;  3GYA A;  1YLE A;  4P6Y A;  3DDD A;  1MJA A;  3V38 A;  4UCP A;  4CAE A;  4E0A A;  3E0K A;  4P4D A;  2VI7 A;  2O4H A;  3KL9 A;  2XEI A;  1IOF A;  3K9T A;  3G3S A;  4MCR A;  4JJX A;  1S7L A;  3TT2 A;  4AG9 A;  4NJR A;  1WK4 A;  4A95 A;  5AG5 A;  2Q4V A;  2ZEH A;  3KHX A;  5J8C A;  2Q04 A;  5HVF A;  3CDX A;  4HNW B;  3FED A;  3T9Y A;  4U9Z A;  3S9L A;  1BLL E;  1PUA A;  3EY5 A;  2NMT A;  4U9Y A;  4MHY A;  2FIW A;  1KWM A;  3HLP A;  4R6T A;  1Z8W A;  2DF5 A;  4M85 A;  2JEV A;  3SJX A;  4OKO A;  1Z2L A;  4LQ6 A;  3BI1 A;  4HNX B;  4R76 A;  5GCN A;  3SXO A;  4BBH A;  4MCP A;  1Y7R A;  4UA3 A;  3PB9 X;  1QST A;  3IEH A;  4EME A;  2BOA A;  2J8M A;  2JBJ A;  2PJA A;  3KGQ A;  3CXS A;  4CAV A;  1M1D A;  1S3Z A;  4QVT A;  1L0C A;  2Z3O A;  2PJ0 A;  2YNC A;  2I3C A;  2Q7S A;  5AG6 A;  5H84 A;  4UEE A;  4XPL A;  4EVY A;  2V8D A;  2ATR A;  4P45 A;  1V0C A;  4QC6 A;  5G22 A;  2C6G A;  4OC2 A;  6CPA A;  3L2N A;  3IGR A;  5LRJ A;  4Y49 B;  4P4F A;  2Z10 A;  1LCP A;  3KHZ A;  4KOW A;  5D29 A;  1SQH A;  1X10 A;  1Q2D A;  3F5B A;  3VH9 A;  1FT7 A;  1VKC A;  1Q2C A;  2OZG A;  2GAN A;  2PCU A;  3IU1 A;  4P10 A;  4UFW A;  3R9G A;  1ELL P;  2EWB A;  4C68 A;  1TXR A;  4MHD A;  2R7H A;  5LYD A;  3SJG A;  3LD2 A;  3FRM A;  4NGQ A;  3NH5 A;  1Z8L A;  4JLY A;  3TFY A;  2ZEP A;  3G8W A;  3IFE A;  4TNU A;  2AJ6 A;  3LWU A;  1KUY A;  3IU2 A;  4C2X A;  1NSL A;  2CXA A;  3MGD A;  1TF8 A;  2WYR A;  4HKF A;  3BJ7 A;  4MXU A;  5D8N A;  1CPX A;  3DSB A;  2GLJ A;  2EVN A;  3S6H A;  1XEB A;  2FIA A;  3HUV A;  3NH4 A;  3ZZI A;  3WR7 A;  3PB8 X;  1YRE A;  5KTA A;  5AG4 A;  3TO7 A;  3B35 A;  1J4J A;  3B3T A;  4BD9 A;  2OR4 A;  3IIB A;  1GHE A;  1S60 A;  4IAV A;  2F7V A;  3DLJ A;  3FXT A;  3F8K A;  2QYV A;  1X12 A;  2VBQ A;  2ZW6 A;  4YWY A;  4DNC A;  4IHM A;  1ZLI A;  1TF9 A;  1MJB A;  1HEE A;  2PVV A;  2PJ1 A;  1Y0R A;  4C2Z A;  3BI0 A;  2Z11 A;  4OLL A;  3FBU A;  1NSA A;  2B5G A;  4RS2 A;  2Y0M A;  2CY2 A;  1ZG8 A;  4C7I A;  3TO6 A;  1YW6 A;  5JQ4 A;  1HDQ A;  2AFW A;  2V8G A;  4QUS A;  1IY7 A;  4KVM E;  2C6C A;  5F09 A;  2WPW A;  2EUI A;  4MMO A;  4ZY1 A;  1FNO A;  4A32 A;  3PBE A;  4ZY2 A;  4ZBG A;  4NF1 A;  2ZEE A;  3FMC A;  4R3L A;  2ZOG A;  3P2F A;  3IWG A;  2PRB A;  2BUE A;  4ORF A;  2C6P A;  5G1Z A;  4A33 A;  2HQY A;  3KI9 A;  4R7M A;  1YR0 A;  3PB6 X;  4UF4 A;  1GYT A;  2PJ6 A;  2QML A;  5JGF A;  3V8I A;  1YSJ A;  2VZY A;  4ZY0 A;  2QIR A;  2G3A A;  2RC4 A;  3K2K A;  4IF5 A;  4MI4 A;  3PBB A;  4UEZ A;  1YME A;  5IV0 A;  1TIQ A;  3WC6 A;  1M4G A;  3NE8 A;  4AXV A;  3KQX A;  1LAP A;  3ISZ A;  4PK2 A;  1S7N A;  3ISX A;  4KVO E;  3KR4 A;  2CTB A;  2YNE A;  1IU8 A;  1LAM A;  1YQE A;  4F9U A;  5JM6 A;  5KTD A;  1BPN A;  3H4Q A;  4A37 A;  2VXK A;  4PV6 A;  5AGE A;  5G20 A;  3TOA A;  5K8M A;  2B5G B;  1R3N A;  4AVB A;  2P6G A;  3PEI A;  4UBR A;  5HMN A;  1AUG A;  4JXR A;  4P4E A;  3RBU A;  4NEX A;  3I3G A;  2G9D A;  4IUS A;  2RB7 A;  4FUU A;  4UCN A;  5JPH A;  3R9F A;  3BXM A;  2PR1 A;  1XE4 A;  3IJ3 A;  3VWD A;  5LYI A;  4L8A A;  4KLV A;  1LOK A;  3CXQ A;  3K9U A;  1JWQ A;  3A9L A;  1U6M A;  1YK3 A;  4NFR A;  2PJ9 A;  1I21 A;  2PC1 A;  7CPA A;  3S6F A;  4L89 A;  3LAC A;  1YLO A;  3H8E A;  4O23 A;  2PIZ A;  3SI1 A;  4YRH A;  3D7H A;  5F48 A;  3B8G A;  5K8O A;  2PE3 A;  1CBX A;  2JBK A;  4KOV A;  5THW A;  4K30 A;  2WUU A;  4KOX A;  4KS9 A;  4B10 A;  4P44 A;  3LOD A;  5C82 A;  3KAS A;  4B11 A;  2AFZ A;  1CP7 A;  2VQY A;  3B7I A;  2B3V A;  2JDD A;  3CT9 A;  4A38 A;  1ARL A;  4TWE A;  1YVO A;  4YU9 A;  2Z3N A;  2VEZ A;  3FF3 A;  4H2K A;  3PFO A;  2FVG A;  1Z8X A;  2FCK A;  2Q0Y A;  4MFP A;  2CNM A;  2Z3L A;  1KUV A;  4M6I A;  4U5Y A;  4CRY B;  5CBM A;  3B3W A;  3W6X A;  2JDC A;  3PB4 X;  2CTC A;  4AG7 A;  4A39 A;  2PRQ A;  5LYF A;  2JEW A;  4MRI A;  4RUH A;  2XEG A;  5J8F A;  1TKF A;  2PJ7 A;  3R95 A;  1B6B A;  2VZZ A;  2ANP A;  3GKR A;  1XBU A;  2BO9 A;  5C88 A;  5IB0 A;  3KR5 A;  1F57 A;  5DWN A;  2QEC A;  4P4B A;  4FAI A;  5H86 A;  1XIX A;  3DR8 A;  4X8I A;  3S6G A;  4KSF A;  1UWY A;  2F8H A;  4Z65 A;  3TTH A;  3SJE A;  1CM0 A;  4NGT A;  2R8V A;  2R98 A;  3T90 A;  3D66 A;  2AFM A;  4PPZ A;  1DE4 C;  5F46 A;  1Z8T A;  2FL4 A;  1M4D A;  5LRG A;  1OZP A;  2O53 A;  3D7F A;  2IJZ A;  3D4U A;  3SI0 A;  2FE7 A;  2J8R A;  3FVL A;  2IMO A;  1RTQ A;  3CZX A;  4MHZ A;  2ZW7 A;  4XPD B;  5F49 A;  3KZW A;  1VIX A;  2NYQ A;  4EFD A;  3QB8 A;  3H8G A;  4CYN A;  4CAX A;  2XEJ A;  1ZLH A;  1IYL A;  3GY9 A;  3MRU A;  4MFJ A;  1AYE A;  1ELM P;  5KTC A;  2Q4Z A;  4OID A;  3T8W A;  4NGS A;  2EBJ A;  5CNP A;  1ZG7 A;  4JZ0 A;  4EWT A;  2B4B A;  3FNC A;  1MK4 A;  4PQA A;  4B14 A;  3NA6 A;  4NSQ A;  2J8N A;  1M4I A;  3BHX A;  5EC4 A;  2GRE A;  4MHP A;  1F2O A;  1YVK A;  1IIC A;  3QAH A;  3BLN A;  4RN7 A;  2BSW A;  5F47 A;  4KOT A;  4CGO A;  2PVW A;  1Y9W A;  3QAY A;  4ZYQ A;  1CP6 A;  3B3C A;  3R9E A;  1R57 A;  3WT4 A;  4CGP A;  3C26 A;  1XMB A;  4XNH C;  2CIJ A;  2X7B A;  4ONW A;  1CG2 A;  2PJ3 A;  2WPX A;  4QB9 A;  3CPX A;  1UFH A;  4MBU A;  2I00 A;  2B58 A;  1Q2Y A;  4Q7A A;  2HC9 A;  2B4D A;  1XJO A;  1LRZ A;  4UIB A;  5FVJ A;  4A2Z A;  2GIV A;  4Q38 A;  3CPA A;  1KZF A;  5CPA A;  5AG7 A;  2Z3P A;  2AFO A;  1Y0Y A;  2Q43 A;  3D2M A;  1S7K A;  2FXF A;  1IGB A;  3H8F A;  2ZXV A;  2GE3 A;  4F6A A;  4B5P A;  4C2Y A;  2Q44 A;  4MY3 A;  4CGM A;  2EO8 A;  4J3G A;  3FIX A;  2PJB A;  3WC7 A;  2AFX A;  1Y9K A;  2QVP A;  4CAF A;  2PIY A;  4A31 A;  3RZA A;  1BAV A;  2ZEM A;  3TOB A;  2IL4 A;  4CYP A;  1BOB A;  2PJC A;  3R1K A;  4DJL A;  3GB0 A;  5ELY A;  2GU2 A;  2GLF A;  4A30 A;  3SI2 A;  5A27 A;  2R1I A;  2POK A;  2FSR A;  4PXB A;  1AMP A;  5ISV A;  4JYW A;  5K8P A;  2BCO A;  4B13 A;  2ZOF A;  4M6H A;  2ARH A;  1PU9 A;  3S9N A;  4B5O A;  1B87 A;  2PR8 A;  1XOV A;  3D67 A;  4NGN A;  2C1C A;  3TX8 A;  2B4D B;  3DNS A;  1TKH A;  5J1Q A;  2YND A;  2YGW A;  3D3S A;  2ZEN A;  2A4N A;  2J9A A;  3QNV A;  1F2P A;  4H6Z A;  4R8F A;  3IO1 A;  3MN8 A;  2REE A;  3TCV A;  2OZH A;  2AFS A;  4GM5 A;  1RO5 A;  4B5P B;  4DUK A;  1EE3 P;  5A28 A;  1N71 A;  1S5K A;  1XFO A;  1XMT A;  4UFV A;  2PSW A;  2B3U A;  3FEE A;  4KOY A;  1XF8 A;  3S6K A;  3FH4 A;  3BJ8 A;  4RI1 A;  3D68 A;  3R96 A;  3JVN A;  4OC3 A;  4PXC A;  3D7G A;  3DR6 A;  4KUA A;  5EMI A;  2ZEO A;  2Q7B A;  2D4P A;  1YX0 A;  2GFQ A;  2H5M A;  3CXP A;  3FJU A;  2OB0 A;  4F8Z A;  2ZEL A;  2DPT A;  4PSX A;  3RNZ A;  4LUA A;  2O28 A;  4FD4 A;  2V77 A;  1IYK A;  4PK3 A;  2OZU A;  4GS4 A;  1PYT B;  5BWA B;  4R3K A;  5DWM A;  3W6S A;  5I0C A;  5K8N A;  5LYL A;  8CPA A;  1K4J A;  1NMT A;  3PB7 X;  3EC4 A;  2PJ8 A;  1VHO A;  1Z4E A;  4X2T A;  3KQZ A;  2V8H A;  3B3S A;  1ZO0 A;  3GIU A;  2P6F A;  4CGN A;  4ZX8 A;  4XPK A;  2HUZ A;  1QSR A;  4P4I A;  3VAT A;  2ZED A;  3IWW A;  3TE4 A;  3N5F A;  4HNY B;  2BEI A;  4FD7 A;  1S7F A;  4YGO A;  1Z9U A;  3RYO A;  1IB1 E;  4UWJ A;  3PZJ A;  5HVH A;  4K3N A;  3SHP A;  4JWP A;  2ABZ A;  4MFQ A;  1LAN A;  2V8V A;  3SJF A;  3GLJ A;  4R9M A;  2PDO A;  4E8O A;  3PFE A;  1Z4R A;  4JXQ A;  2Z3M A;  4CAW A;  3EFA A;  2CNS A;  1IOI A;  4G1P A;  4MJ8 A;  2OOT A;  1Y7E A;  4XNH B;  1Q7L A;  5IX3 A;  2ZPA A;  2HV2 A;  3PGP A;  4I49 A;  4CGL A;  5E96 A;  4KLW A;  4CYQ A;  4BMH A;  3V7Z A;  3D8P A;  1QMU A;  2DEA A;  1HDU A;  1VHE A;  2ZW4 A;  4NJQ A;  4MFZ A;  2AFU A;  4X5K A;  2K5T A;  4OP4 A;  4AVC A;  2PJ5 A;  4MY0 A;  3W91 A;  4OAD A;  4KUB A;  3PRT A;  2OH1 A;  4OC0 A;  4UWI A;  1PCA A;  4B12 A;  4MHN A;  3H5Z A;  4UFX A;  2P6E A;  5LRK A;  4F0X A;  3VAR A;  1QSN A;  3IWE A;  4UIA A;  4QBJ A;  4KOR A;  4X3R A;  1CJW A;  3NE7 A;  4JD6 A;  4II9 A;  5HH1 A;  4OIW A;  4CRZ B;  3PP9 A;  2ZEF A;  4WWV A;  1NE9 A;  1CX8 A;  5JH9 A;  2OU2 A;  2QJ8 A;  2Z3K A;  3I9S A;  1P4N A;  4KSI A;  4A94 A;  3I1U A;  2HB6 A;  2Q4Y A;  3TO9 A;  4PXD A;  1P0H A;  1R43 A;  2C27 A;  2WSA A;  1H8L A;  4Y49 C;  3KKW A;  4AB7 A;  2IQ6 A;  4WJB A;  3ZJ0 A;  4CYO A;  2AE6 A;  4KOU A;  4KOS A;  3D7D A;  2CNT A;  4LQG A;  1I1D A;  2EK8 A;  4NCZ A;  3NH8 A;  4P4J A;  4PXE A;  4F0Y A;  1XRY A;  3NFZ A;  1YGH A;  3GUX A;  1A2Z A;  1ARM A;  4UEF A;  2CF4 A;  5I4M A;  2I79 A;  4FD6 A;  4CS0 B;  3EO4 A;  1WWZ A;  2DPS A;  4MCS A;  1DTD A;  2Z0Z A;  1BO4 A;  1QSM A;  2G3T A;  2KCW A;  2G0B A;  1QSO A;  1BPM A;  1ON0 A;  4F9V A;  2D4O A;  2PJ2 A;  3N7Z A;  3P2H A;  4NGP A;  3FYN A;  4R57 A;  4XPD C;  1M4L A;  1QQ9 A;  4W9Y A;  1I12 A;  4PSW A;  5G21 A;  2P0W A;  1CPS A;  4OC4 A;  4AVA A;  4M6G A;  2BL1 A;  4E2A A;  2JLM A;  2F5I A;  4B6Z A;  2YNC C;  4NGR A;  5EBV A;  4FWU A;  3JRU A;  3JUW A;  3JTK A;  3LMS A;  3FEC A;  3FX6 A;  4MFL A;  4H89 A;  3UY5 A;  4NXY A;  4KZT A;  1RXT A;  3D2P A;  2REF A;  3S9M A;  5DS0 A;  1Z5R A;  2EK9 A;  4FD5 A;  5HVG A;  4MFK A;  4ZGY B;  1LFW A;  1YW4 A;  1JQG A;  4M3S A; 
#chains in the Genus database with same CATH homology
 3SXN A;  4KVX A;  1M44 A;  2ZW5 A;  1KUX A;  3FB3 A;  1IID A;  4KSA A;  2FT0 A;  1VHS A;  4ONU A;  3F0A A;  2FS5 A;  4Q36 A;  4C7H A;  1MJ9 A;  3EXN A;  4H6U A;  4LX9 A;  4YFJ A;  4R87 A;  1FY7 A;  2DXQ A;  4OAE A;  2PQ8 A;  3OWC A;  4UCM A;  3VWE A;  3GYA A;  1YLE A;  3DDD A;  1MJA A;  4UCP A;  4CAE A;  4E0A A;  3E0K A;  2VI7 A;  3G3S A;  4JJX A;  1S7L A;  3TT2 A;  4AG9 A;  1WK4 A;  4A95 A;  5AG5 A;  2Q4V A;  5J8C A;  2Q04 A;  4HNW B;  3T9Y A;  4U9Z A;  1PUA A;  3EY5 A;  2NMT A;  4U9Y A;  2FIW A;  4M85 A;  2JEV A;  4HNX B;  5GCN A;  4BBH A;  3SXO A;  1Y7R A;  4UA3 A;  1QST A;  2J8M A;  3CXS A;  4CAV A;  1M1D A;  1S3Z A;  4QVT A;  1L0C A;  2Z3O A;  2YNC A;  5AG6 A;  5H84 A;  4EVY A;  4XPL A;  2ATR A;  1V0C A;  4QC6 A;  5G22 A;  3IGR A;  4Y49 B;  2Z10 A;  4KOW A;  1SQH A;  1Q2D A;  3F5B A;  1VKC A;  1Q2C A;  2OZG A;  2GAN A;  3IU1 A;  3R9G A;  4UFW A;  4C68 A;  4MHD A;  2R7H A;  3LD2 A;  3FRM A;  4JLY A;  3TFY A;  3G8W A;  2AJ6 A;  1KUY A;  3IU2 A;  4C2X A;  1NSL A;  2CXA A;  3MGD A;  4HKF A;  3BJ7 A;  3DSB A;  2EVN A;  3S6H A;  1XEB A;  2FIA A;  3ZZI A;  3WR7 A;  1YRE A;  5KTA A;  3TO7 A;  1J4J A;  1GHE A;  1S60 A;  3FXT A;  3F8K A;  2VBQ A;  2ZW6 A;  4DNC A;  1MJB A;  4C2Z A;  2Z11 A;  4OLL A;  3FBU A;  2B5G A;  4RS2 A;  2Y0M A;  2CY2 A;  4C7I A;  5JQ4 A;  3TO6 A;  4QUS A;  4KVM E;  2WPW A;  2EUI A;  4A32 A;  4ZBG A;  4NF1 A;  4R3L A;  3P2F A;  3IWG A;  2PRB A;  2BUE A;  4ORF A;  5G1Z A;  4A33 A;  2HQY A;  1YR0 A;  2QML A;  3V8I A;  2VZY A;  2QIR A;  2G3A A;  2RC4 A;  4IF5 A;  5IV0 A;  4MI4 A;  1TIQ A;  1M4G A;  4PK2 A;  1S7N A;  4KVO E;  2YNE A;  5KTD A;  3H4Q A;  2VXK A;  4PV6 A;  5AGE A;  5G20 A;  3TOA A;  2B5G B;  4AVB A;  2P6G A;  4UBR A;  5HMN A;  4JXR A;  4NEX A;  3I3G A;  4IUS A;  4UCN A;  5JPH A;  3R9F A;  2PR1 A;  1XE4 A;  3VWD A;  4L8A A;  4KLV A;  3CXQ A;  3K9U A;  3A9L A;  1U6M A;  1YK3 A;  1I21 A;  2PC1 A;  3S6F A;  4L89 A;  4YRH A;  5F48 A;  3B8G A;  4KOV A;  4K30 A;  2WUU A;  4KOX A;  4KS9 A;  4B10 A;  3LOD A;  5C82 A;  4B11 A;  2VQY A;  2B3V A;  2JDD A;  1YVO A;  2Z3N A;  2VEZ A;  2FCK A;  2Q0Y A;  4MFP A;  2CNM A;  2Z3L A;  1KUV A;  4U5Y A;  4CRY B;  3W6X A;  4AG7 A;  2JDC A;  5J8F A;  3R95 A;  1B6B A;  2VZZ A;  3GKR A;  5IB0 A;  5C88 A;  5DWN A;  2QEC A;  5H86 A;  1XIX A;  3DR8 A;  3S6G A;  4KSF A;  3TTH A;  1CM0 A;  2R8V A;  2R98 A;  3T90 A;  5F46 A;  2FL4 A;  1M4D A;  1OZP A;  2FE7 A;  2J8R A;  2ZW7 A;  4XPD B;  5F49 A;  3QB8 A;  4CYN A;  4CAX A;  1IYL A;  3GY9 A;  4MFJ A;  5KTC A;  5CNP A;  2B4B A;  3FNC A;  1MK4 A;  4B14 A;  4NSQ A;  2J8N A;  1M4I A;  5EC4 A;  5AG4 A;  1YVK A;  3QAH A;  1IIC A;  3BLN A;  5F47 A;  2BSW A;  4KOT A;  4CGO A;  1Y9W A;  3R9E A;  1R57 A;  4CGP A;  3C26 A;  4XNH C;  2X7B A;  2WPX A;  4QB9 A;  4MBU A;  1UFH A;  2I00 A;  2B58 A;  1Q2Y A;  2B4D A;  5FVJ A;  1LRZ A;  4A2Z A;  2GIV A;  4Q38 A;  1KZF A;  5AG7 A;  2Z3P A;  3D2M A;  1S7K A;  2FXF A;  4F6A A;  2ZXV A;  2GE3 A;  4B5P A;  4C2Y A;  2Q44 A;  4MY3 A;  4CGM A;  4J3G A;  3FIX A;  1Y9K A;  4CAF A;  4A31 A;  3TOB A;  2IL4 A;  4CYP A;  1BOB A;  3R1K A;  4A30 A;  5A27 A;  2R1I A;  2FSR A;  5ISV A;  4B13 A;  2ARH A;  1PU9 A;  4B5O A;  1B87 A;  2PR8 A;  2B4D B;  3DNS A;  2YND A;  2YGW A;  3D3S A;  2A4N A;  4H6Z A;  2REE A;  3TCV A;  2OZH A;  4B5P B;  1RO5 A;  5A28 A;  1N71 A;  1S5K A;  1XMT A;  4UFV A;  2PSW A;  2B3U A;  4KOY A;  1XF8 A;  3S6K A;  3BJ8 A;  4RI1 A;  3R96 A;  3JVN A;  3DR6 A;  4KUA A;  2Q7B A;  2D4P A;  1YX0 A;  2H5M A;  3CXP A;  2OB0 A;  2DPT A;  4PSX A;  4LUA A;  2O28 A;  4FD4 A;  1IYK A;  4PK3 A;  2OZU A;  4GS4 A;  5BWA B;  4R3K A;  5DWM A;  3W6S A;  5I0C A;  1K4J A;  1NMT A;  3EC4 A;  1Z4E A;  1ZO0 A;  2P6F A;  4CGN A;  4XPK A;  2HUZ A;  1QSR A;  3TE4 A;  4HNY B;  2BEI A;  4FD7 A;  1S7F A;  4YGO A;  1Z9U A;  3RYO A;  1IB1 E;  4UWJ A;  3PZJ A;  3SHP A;  4JWP A;  4MFQ A;  4R9M A;  2PDO A;  4E8O A;  1Z4R A;  4JXQ A;  2Z3M A;  4CAW A;  3EFA A;  2CNS A;  4MJ8 A;  5IX3 A;  4XNH B;  2ZPA A;  2HV2 A;  3PGP A;  4I49 A;  4CGL A;  5E96 A;  4KLW A;  4CYQ A;  4BMH A;  3D8P A;  2ZW4 A;  4MFZ A;  4X5K A;  2K5T A;  4AVC A;  4MY0 A;  3W91 A;  4OAD A;  4KUB A;  2OH1 A;  4UWI A;  4B12 A;  3H5Z A;  4UFX A;  2P6E A;  4F0X A;  1QSN A;  3IWE A;  4QBJ A;  4KOR A;  1CJW A;  3NE7 A;  4JD6 A;  4II9 A;  5HH1 A;  4CRZ B;  3PP9 A;  1NE9 A;  2OU2 A;  2Z3K A;  3I9S A;  1P4N A;  2Q4Y A;  3TO9 A;  1P0H A;  2C27 A;  2WSA A;  4Y49 C;  3KKW A;  4AB7 A;  3ZJ0 A;  4CYO A;  2AE6 A;  4KOU A;  4KOS A;  2CNT A;  1I1D A;  4NCZ A;  4F0Y A;  1YGH A;  2I79 A;  4FD6 A;  4CS0 B;  3EO4 A;  1WWZ A;  2DPS A;  2Z0Z A;  1BO4 A;  1QSM A;  2G3T A;  2KCW A;  2G0B A;  1QSO A;  1ON0 A;  2D4O A;  3N7Z A;  3P2H A;  3FYN A;  4R57 A;  4XPD C;  1I12 A;  4PSW A;  5G21 A;  2P0W A;  4AVA A;  2BL1 A;  4E2A A;  2JLM A;  2F5I A;  2YNC C;  5EBV A;  3JUW A;  3JTK A;  4MFL A;  4H89 A;  3UY5 A;  4NXY A;  4KZT A;  1RXT A;  3D2P A;  2REF A;  4FD5 A;  4MFK A;  4ZGY B;  4M3S A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...