3BJ8A

Spermine/spermidine n1-acetyltransferase from mouse: crystal structure of a ternary complex reveals solvent-mediated spermine binding
Total Genus 42
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
42
sequence length
167
structure length
163
Chain Sequence
b'KFKIRPATASDCSDILRLIKELAKYEYMEDQVILTEKDLQEDGFGEHPFYHCLVAEVPKEHWTPEGHSIVGFAMYYFTYDPWIGKLLYLEDFFVMSDYRGFGIGSEILKNLSQVAMKCRCSSMHFLVAEWNEPSINFYKRRGASDLGWRLFKIDKEYLLKMAA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Diamine acetyltransferase 1
publication title The crystal structure of spermidine/spermine N1-acetyltransferase in complex with spermine provides insights into substrate binding and catalysis.
pubmed doi rcsb
source organism Mus musculus
molecule tags Transferase
total genus 42
structure length 163
sequence length 167
chains with identical sequence B, C, D
ec nomenclature ec 2.3.1.57: Diamine N-acetyltransferase.
pdb deposition date 2007-12-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00583 Acetyltransf_1 Acetyltransferase (GNAT) family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.630.30 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Aminopeptidase 3bj8A00
5IV0A 3W91A 4Y49B 4L8AA 2P6EA 3UY5A 1Z4EA 3D8PA 3KKWA 3BLNA 4AVBA 2C27A 5F49A 1M1DA 4J3GA 3QB8A 3N7ZA 1QSTA 4AG9A 1SQHA 3SXNA 5C82A 5IB0A 1XMTA 5F46A 4U5YA 1S7NA 5JPHA 4KUBA 2VXKA 3E0KA 2RC4A 4KOTA 3SXOA 2FXFA 2OU2A 2ZPAA 5CNPA 3IWGA 4RI1A 4DNCA 3EC4A 3H4QA 3QAHA 1BO4A 1M4IA 1YK3A 3S6GA 3I9SA 2ARHA 4AVAA 3MGDA 5KTCA 4NXYA 1IIDA 3FXTA 2HQYA 4H6UA 2PDOA 4JWPA 4FD4A 5F48A 1IICA 1Z4RA 3EY5A 2G3TA 4BMHA 3TOAA 2Z10A 1J4JA 4KUAA 3G8WA 2J8NA 1VKCA 2CNMA 2IL4A 3B8GA 4HNXB 2P6GA 2B58A 1YGHA 2PR1A 1KZFA 4LUAA 5IX3A 5E96A 4ORFA 4CS0B 5KTAA 5GCNA 4OADA 3TTHA 1P4NA 3PGPA 3T90A 4HNYB 1Q2YA 4AVCA 2X7BA 3DDDA 4YFJA 5J8FA 2WPXA 2R1IA 4ONUA 4E8OA 3S6FA 4NSQA 4KOVA 1NE9A 3R95A 2BUEA 2BSWA 4UA3A 5DWNA 4QB9A 2VZZA 4XNHC 3CXQA 3GY9A 2GIVA 4IF5A 1S3ZA 2Q4VA 3F8KA 1VHSA 4AG7A 4B5PB 1N71A 4Y49C 4HKFA 1U6MA 1IYKA 1MJAA 1IB1E 2D4OA 2PQ8A 2JDCA 5ISVA 1QSNA 4R9MA 5DWMA 3DR6A 4JXRA 3CXPA 4MHDA 2VBQA 3DSBA 1I21A 1S7FA 4F6AA 2VEZA 4R3KA 2JDDA 4GS4A 4XPLA 3R96A 3LODA 4CAXA 3EO4A 2Q0YA 2G3AA 2WPWA 1Y7RA 1K4JA 2K5TA 3WR7A 1NMTA 4E0AA 5JQ4A 2AE6A 4UWJA 3DNSA 4KOYA 2JEVA 3FBUA 3TCVA 1FY7A 4YRHA 5F47A 1WWZA 2ZXVA 4CRYB 3CXSA 4OAEA 4RS2A 4AB7A 4H6ZA 2PSWA 3FYNA 1Q2CA 1TIQA 1XIXA 2OB0A 1YREA 1I12A 3FIXA 4PV6A 2B5GB 4M3SA 4UWIA 4UBRA 4XPDB 2ZW6A 2GANA 2I79A 3NE7A 1M44A 1M4GA 3ZJ0A 2Q44A 1RXTA 3PP9A 2QMLA 4JJXA 2B4DA 4B5PA 3FB3A 3PZJA 1Z9UA 3C26A 4KVME 4E2AA 1S7LA 4KOSA 2ATRA 1PU9A 2HV2A 1B6BA 2JLMA 4PK2A 2O28A 2CNSA 2B3UA 2D4PA 3W6XA 1MK4A 2GE3A 4K30A 1GHEA 2OZUA 1KUXA 3TFYA 2ZW5A 1KUYA 1V0CA 3ZZIA 2R98A 4JLYA 1IYLA 1XF8A 2J8RA 1MJBA 2A4NA 4KVXA 4LX9A 3RYOA 3P2FA 3TT2A 5HMNA 3F0AA 5HH1A 4CRZB 3V8IA 1CJWA 3D2PA 2P6FA 3LD2A 4R3LA 3G3SA 2Q04A 1M4DA 4KOXA 4MBUA 1I1DA 2AJ6A 2B5GA 2FT0A 3JUWA 5KTDA 4FD6A 3TE4A 2ZW7A 1PUAA 4YGOA 2CY2A 3TO9A 4ZBGA 4QVTA 2I00A 3VWDA 2G0BA 2BEIA 2BL1A 2FL4A 4KZTA 2FIAA 2Q4YA 1KUVA 2PC1A 4XNHB 4KLVA 1Q2DA 3EXNA 2Q7BA 1XE4A 4B5OA 3BJ7A 3TO7A 2Z11A 4EVYA 2DXQA 2QECA 4CAVA 3FNCA 4CAWA 4XPDC 1ON0A 4MI4A 5H86A 3IGRA 4U9ZA 4H89A 2H5MA 3FRMA 4L89A 4QUSA 2FE7A 2PR8A 3P2HA 2KCWA 1L0CA 5C88A 5EC4A 4FD5A 4U9YA 3R9FA 2EVNA 1XEBA 1OZPA 4IUSA 2J8MA 2NMTA 1LRZA 1Y9KA 2B3VA 4MY3A 4MJ8A 3R9GA 3OWCA 2F5IA 2VQYA 4NF1A 3W6SA 3S6HA 4XPKA 3BJ8A 2ZW4A 2OZGA 5H84A 3D2MA 2CNTA 2Y0MA 2PRBA 3JVNA 4R57A 1R57A 3I3GA 2VI7A 3VWEA 1B87A 2FCKA 1YVKA 4X5KA 2FIWA 1YLEA 3TOBA 1NSLA 1YVOA 2P0WA 4I49A 1S5KA 2EUIA 3SHPA 1UFHA 1S7KA 4PSXA 2VZYA 3GKRA 2FSRA 2FS5A 3F5BA 4FD7A 2OH1A 3S6KA 4JXQA 2OZHA 4KLWA 1QSRA 3DR8A 3GYAA 1P0HA 5I0CA 2R7HA 2QIRA 3D3SA 4QC6A 2REFA 4KVOE 1BOBA 1CM0A 4PSWA 4KOWA 4NEXA 3K9UA 5J8CA 2HUZA 4F0YA 3T9YA 4KORA 3R9EA 1Y9WA 1YR0A 1QSOA 4R87A 4HNWB 4II9A 5FVJA 4OLLA 4PK3A 4M85A 3EFAA 1YX0A 4KOUA 1RO5A 4NCZA 2B4BA 2B4DB 4QBJA 2R8VA 2REEA 1WK4A 1MJ9A 5EBVA 3R1KA 4MY0A 1QSMA 2Z0ZA 4JD6A 1S60A 3TO6A
chains in the Genus database with same CATH superfamily
5IV0A 2CIJA 4MCQA 3W91A 4Y49B 4L8AA 2P6EA 3UY5A 4A37A 2Z3NA 1Z4EA 3CDXA 3D8PA 3KKWA 3BLNA 2ZEFA 4TWEA 4PQAA 4AVBA 2C27A 2QJ8A 4KS9A 2PJ8A 5F49A 2PJCA 4KSAA 4R6TA 1M1DA 4J3GA 4C68A 3QB8A 4ZYQA 3VARA 2PJ0A 4P4BA 1TXRA 3N7ZA 4P6YA 2YNCA 1QSTA 3B3WA 1SQHA 4UCMA 4A95A 3SXNA 4AG9A 5C82A 5IB0A 1XMTA 5F46A 2GLFA 1S7NA 2PJ1A 4U5YA 4KUBA 5JPHA 2VXKA 3E0KA 2RC4A 3FH4A 5AG5A 4KOTA 4MFKA 3SXOA 2FXFA 2OU2A 4NJRA 2ZPAA 5CNPA 3IWGA 4EMEA 1XOVA 3CT9A 4RI1A 4DNCA 3EC4A 3PB4X 3H4QA 1ARLA 3K2KA 3QAHA 4PXBA 1BO4A 4OC1A 1F2PA 1M4IA 2PJ5A 1YK3A 3S6GA 3I9SA 4CGNA 2ARHA 4Q38A 4AVAA 4YU9A 5K8MA 3WC6A 1FNOA 3BHXA 3FJUA 4O23A 3MGDA 5KTCA 3H5ZA 4NXYA 1IIDA 4PPZA 3FXTA 1Y0YA 2HQYA 3D68A 4WJBA 3ISXA 4H6UA 1R3NA 2PDOA 4JWPA 4Q36A 5HVGA 4FD4A 5F48A 1IICA 1Z4RA 2YNCC 3EY5A 3TO6A 1UWYA 3RAMA 4MFQA 2ZELA 2G3TA 3JTKA 4MHPA 4BMHA 3IEHA 3KI9A 1LAMA 3TOAA 2Z10A 1XMBA 1CP7A 2PJAA 3B3TA 1J4JA 3PEIA 4OP4A 1IGBA 4MXUA 5BWAB 1Z8WA 3FEDA 2PJ9A 4KUAA 3G8WA 4JYWA 2J8NA 2QYVA 1VKCA 2HC9A 4TNUA 4ZGYB 2CNMA 2IL4A 3FF3A 3B8GA 4HNXB 4MCSA 5K8PA 2OR4A 2P6GA 2B58A 3PFOA 1YGHA 2PR1A 4NGSA 1KZFA 4NGPA 4LUAA 5IX3A 5E96A 4ORFA 4CS0B 4OIDA 5KTAA 2Z3MA 5GCNA 4OADA 3TTHA 5G22A 1YLOA 1P4NA 3NH5A 3PGPA 3KGQA 3T90A 3IWWA 1Q2YA 4HNYB 2GLJA 2X7BA 4AVCA 1VHOA 3DDDA 4YFJA 1JQGA 5J8FA 2WPXA 5JM6A 2POKA 2R1IA 4ONUA 5HVFA 2Z3PA 4YWYA 2RB7A 4E8OA 1CP6A 4MCPA 4CYOA 2WYRA 1Z8TA 1Z5RA 3S6FA 2BCOA 3I1UA 3IO1A 3IIBA 4NSQA 2Q51A 3WABA 4KOVA 1NE9A 3R95A 2BUEA 2BSWA 1LFWA 4UA3A 5DWNA 4MMOA 4C2XA 4KSFA 2ZOGA 1Z8LA 4QB9A 2VZZA 4NGNA 2PJ6A 4LQ6A 4XNHC 3CXQA 3GY9A 4B14A 1Z2LA 2GIVA 1XJOA 4IF5A 1S3ZA 4P4JA 3CZXA 3BI1A 2F8HA 2Q4VA 1ZG8A 1LAPA 3F8KA 3GUXA 1VHSA 3VH9A 4AG7A 4B5PB 1N71A 4UF4A 2VL1A 3D66A 4Y49C 4C2YA 4MRIA 4HKFA 1U6MA 1IYKA 1MJAA 1IB1E 5HVHA 2D4OA 3PB7X 1JWQA 4UFVA 5K8OA 3MRUA 2PQ8A 5G21A 2JDCA 1QMUA 4ONWA 3HLPA 4DJLA 1QSNA 4R9MA 5DWMA 5ISVA 2ZEOA 3DR6A 2EK8A 1AMPA 2ZOFA 1ELMP 4JXRA 3CXPA 4MHDA 2V77A 3SJEA 5J1QA 2VBQA 5LYDA 3DSBA 4ZI6A 1I21A 1S7FA 4A2ZA 4ZX9A 3IC1A 3PFEA 2VEZA 4F6AA 4R3KA 2JDDA 2EO8A 4GS4A 4FAIA 2XEGA 4UFWA 2ABZA 4XPLA 1X10A 4ZY2A 3LODA 3R96A 2PVVA 3EO4A 4P44A 1HEEA 1Y0RA 2Q0YA 1IOFA 4CAXA 2G3AA 2WPWA 2YNEA 3PRTA 1Y7RA 4P10A 3WC5A 1K4JA 5A27A 2K5TA 2Z3LA 3WR7A 4ZY0A 3D7DA 1NMTA 4E0AA 5JQ4A 2GFQA 3H8EA 2J9AA 3SI1A 1F57A 2AE6A 4OC2A 3VATA 4F9VA 4UWJA 3DNSA 4KOYA 4NGMA 3QAYA 2JEVA 3FBUA 2IMOA 1FY7A 4YRHA 3KR4A 3TCVA 5F47A 4CGOA 2CTBA 2Z3KA 3IWEA 2CF4A 4F0XA 4A94A 2PRQA 2O53A 1WWZA 5AG6A 2ZXVA 2DF5A 4CRYB 1AYEA 1FT7A 1NSAA 3CXSA 4OAEA 4RS2A 2Q7SA 4AB7A 4H6ZA 5CBMA 2PSWA 3FYNA 1Q2CA 1TIQA 1XIXA 2OB0A 1YREA 2PIZA 2WUUA 1I12A 3FIXA 3IFEA 4M6GA 4PV6A 2B5GB 4M3SA 2V8DA 3GIUA 4UWIA 4UBRA 4XPDB 4RUHA 1ZG9A 2ZW6A 3D67A 3B7IA 2GANA 3KR5A 3K9TA 2I79A 3NE7A 2IJZA 1CG2A 4P4IA 4CPAA 3DGVA 5EMIA 1M44A 1M4GA 3LMSA 3ZJ0A 4OMEA 2Q44A 3IU2A 1RXTA 2ZEEA 8CPAA 3NE8A 5LRKA 4B6ZA 3L2NA 1CBXA 2QMLA 3A9LA 3PP9A 3FMCA 2CXAA 4JJXA 2B4DA 2AFMA 3FB3A 4A31A 3PZJA 4B5PA 1Z9UA 1TF8A 3C26A 4CGLA 2NYQA 1BPMA 4NFRA 2PE3A 3KASA 4KVME 4R8FA 4DYOA 1HDQA 4E2AA 4HPSA 1S7LA 2Q43A 1YQEA 4KOSA 3GB0A 1LCPA 4OKOA 2ATRA 1PU9A 2ZEDA 2HV2A 4MCRA 2EBJA 4UIBA 1B6BA 2JLMA 1YW4A 2ANPA 4PK2A 2O28A 4C7IA 2CNSA 4PXCA 2AFUA 4KSIA 4NGQA 4UFXA 1IY7A 3D4UA 1CPXA 1ZG7A 5K8NA 3D7HA 1DTDA 5THWA 2WSAA 3S9MA 2WZNA 4CAFA 3H8GA 2B3UA 2D4PA 4X2TA 4MHYA 3W6XA 1MK4A 2GE3A 4K30A 1GHEA 2ZEHA 1TF9A 2OZUA 1KUXA 1GYTA 1TKHA 1IOIA 4MHNA 3TFYA 1XFOA 1KWMA 1KUYA 1V0CA 2YGWA 2ZW5A 4UEZA 4UEFA 3ZZIA 4OC5A 2DPSA 2R98A 3GLJA 4JLYA 1IYLA 3JRUA 3BI0A 1XF8A 1M4LA 2J8RA 2GREA 1VHEA 1MJBA 2A4NA 3CPXA 4KVXA 4LX9A 3RYOA 3P2FA 4X3RA 5JH9A 4OC4A 3TT2A 5HMNA 3F0AA 5HH1A 1VIXA 4CRZB 1H8LA 5ELYA 1LOKA 4FWUA 3V8IA 1CJWA 3D2PA 1ZLHA 4ZY1A 2P6FA 3B3SA 3LD2A 4R3LA 1CPSA 3G3SA 3N5FA 2Q04A 1LANA 4P4EA 2OOTA 1ARMA 4B11A 3V38A 1M4DA 2PJ7A 4KOXA 3D7GA 3KQXA 4MBUA 1I1DA 4OC0A 2AJ6A 2AFWA 2B5GA 1PCAA 2FT0A 1XRYA 2FVGA 3PBBA 3JUWA 3WC7A 4B13A 5KTDA 4PXEA 4FD6A 4P4DA 3TE4A 4G1PA 1ELLP 2ZW7A 1PUAA 4YGOA 2YNDA 4JZ0A 2CY2A 3TO9A 3NH8A 4ZBGA 4QVTA 3MN8A 2I00A 4ZX8A 3VWDA 2G0BA 2XEJA 2BEIA 2BL1A 2FL4A 3ISZA 1YMEA 4KZTA 2FIAA 2Q4YA 4MFJA 3SJFA 4F9UA 5F09A 1KUVA 4CGMA 1VGYA 2PC1A 2Q4ZA 4XNHB 4KLVA 3RO0A 1Q2DA 3EXNA 2Q7BA 5LRGA 3B35A 1XE4A 5G1ZA 4B5OA 3NA6A 3BJ7A 3TO7A 5JGFA 2Z11A 4MFZA 4EVYA 4M6HA 2G9DA 3B3CA 2C6PA 4PXDA 3RBUA 3D7FA 2DXQA 2AFOA 4OIWA 4RN7A 2QECA 4CAVA 3FNCA 2I3CA 4CAWA 3BXMA 4W9YA 1PYTB 4XPDC 1ON0A 4MI4A 5H86A 5A28A 3IGRA 4U9ZA 6CPAA 4H89A 2H5MA 3FRMA 4L89A 4Q7AA 4QUSA 2FE7A 2PR8A 4NJQA 3B2YA 3P2HA 4IAVA 2KCWA 2C6GA 3WT4A 1L0CA 3KHZA 5C88A 2AFXA 1XBUA 3PB8X 5EC4A 4FD5A 4U9YA 2IQ6A 5LYFA 2V8HA 2F7VA 3PB6X 3R9FA 2C6CA 4WWVA 3SJXA 2EVNA 1XEBA 1OZPA 4IUSA 3V7ZA 4DUKA 1Q7LA 1ZO0A 2C1CA 2J8MA 2NMTA 3NFZA 5LYIA 4A30A 1LRZA 3LWUA 1Y9KA 2B3VA 4IHMA 5LYLA 1EE3P 2QVPA 2V8GA 1Z8XA 3KQZA 4MJ8A 4MY3A 3R9GA 3OWCA 4H2KA 4EFDA 2F5IA 2VQYA 5AGEA 4NF1A 2PJ4A 4BD9A 3W6SA 2PJ2A 4CYPA 3S6HA 4XPKA 4X8IA 4B12A 3BJ8A 2ZW4A 5LRJA 4Z65A 5HXDA 2OZGA 4LQGA 5H84A 2RFHA 3D2MA 3FX6A 4R76A 2CNTA 2XEIA 2Y0MA 2PRBA 3JVNA 4R57A 4CYQA 1R57A 3I3GA 2PVWA 2VI7A 3VWEA 1B87A 2FCKA 1AUGA 1YVKA 2ZEMA 2FIWA 1YLEA 3PB9X 4P45A 4X5KA 3TOBA 4A33A 2PCUA 5AG7A 2JEWA 4UCNA 2V8VA 1NSLA 1YVOA 2CTCA 2P0WA 3HUVA 4A32A 4I49A 5AG4A 1S5KA 3TC8A 2EUIA 3SHPA 1UFHA 1S7KA 4PSXA 3SI2A 2VZYA 3GKRA 2PJ3A 3SJGA 2FSRA 3S9LA 1CX8A 5DS0A 2FS5A 1R43A 2ZENA 2OH1A 3F5BA 4FD7A 2DPTA 4NGRA 3CPAA 4UIAA 3DLJA 3S6KA 1BLLE 2ZEGA 4JXQA 4AXVA 2OZHA 4IK2A 1QQ9A 4KLWA 1QSRA 3T8WA 3DR8A 4UEEA 4C2ZA 2EK9A 1P0HA 3GYAA 1IU8A 5I0CA 1X12A 2R7HA 4UCPA 2GU2A 2QIRA 3D3SA 2PJBA 2XEFA 4QC6A 3RNZA 4GM5A 5G20A 2BO9A 4CAEA 5D29A 3LACA 2REFA 4C7HA 4KVOE 3IU1A 1BOBA 4BBHA 1CM0A 1YSJA 4FBEA 4PSWA 4KOWA 1HDUA 3K9UA 4NEXA 4BINA 5J8CA 4P4FA 4F8ZA 2HUZA 4MFLA 3T9YA 4F0YA 1A2ZA 4KORA 3R9EA 1OBRA 1YW6A 4NGTA 1Y9WA 2ODFA 2JBJA 1YR0A 4OC3A 3QNVA 4M6IA 3B3VA 5CPAA 2DEAA 3KHXA 4EWTA 1QSOA 1BPNA 3H8FA 4R87A 2JBKA 4HNWB 1TKJA 1RTQA 2HB6A 4MHZA 4CGPA 4CYNA 5FVJA 4II9A 1ZLIA 2O4HA 4OLLA 3FEEA 5IB9A 4PK3A 2Z3OA 4M85A 3EFAA 3S9NA 1BAVA 1YX0A 2ZEPA 4KOUA 1RO5A 4MFPA 4NCZA 1DE4C 2BOAA 2B4BA 2AFZA 3FECA 2B4DB 4QBJA 2R8VA 2REEA 3PBEA 3NH4A 2EWBA 1TKFA 4A39A 2PIYA 1WK4A 3IJ3A 4GXHA 2NSMA 3KL9A 3FVLA 3RZAA 1MJ9A 1Y7EA 5EBVA 3R1KA 4A38A 7CPAA 4FUUA 4R7MA 1F2OA 3SI0A 4MY0A 5I4MA 1QSMA 4B10A 2AFSA 2Z0ZA 4JD6A 5D8NA 4K3NA 1S60A 3KZWA 3TX8A
chains in the Genus database with same CATH topology
5IV0A 3W91A 4Y49B 4L8AA 2P6EA 3UY5A 2Z3NA 1Z4EA 3D8PA 3KKWA 3BLNA 4AVBA 2C27A 4KS9A 5F49A 4KSAA 1M1DA 4J3GA 4C68A 3QB8A 3N7ZA 2YNCA 1QSTA 4UCMA 1SQHA 4A95A 4AG9A 3SXNA 5C82A 5IB0A 1XMTA 5F46A 4U5YA 1S7NA 5JPHA 4KUBA 2VXKA 3E0KA 2RC4A 5AG5A 4KOTA 4MFKA 3SXOA 2FXFA 2OU2A 2ZPAA 5CNPA 3IWGA 4RI1A 4DNCA 3EC4A 3H4QA 3QAHA 1BO4A 1M4IA 1YK3A 3S6GA 3I9SA 4CGNA 2ARHA 4Q38A 4AVAA 3MGDA 5KTCA 3H5ZA 4NXYA 1IIDA 3FXTA 2HQYA 4H6UA 2PDOA 4JWPA 4Q36A 4FD4A 5F48A 1IICA 1Z4RA 2YNCC 3EY5A 4MFQA 2G3TA 3JTKA 4BMHA 3TOAA 2Z10A 1J4JA 5BWAB 4KUAA 3G8WA 2J8NA 1VKCA 4ZGYB 2CNMA 2IL4A 3B8GA 4HNXB 2P6GA 2B58A 1YGHA 2PR1A 1KZFA 4LUAA 5IX3A 5E96A 4ORFA 4CS0B 5KTAA 2Z3MA 5GCNA 4OADA 3TTHA 5G22A 1P4NA 3PGPA 3T90A 4HNYB 1Q2YA 4AVCA 2X7BA 3DDDA 4YFJA 5J8FA 2WPXA 2R1IA 4ONUA 2Z3PA 4E8OA 4CYOA 3S6FA 4NSQA 4KOVA 1NE9A 3R95A 2BUEA 2BSWA 4UA3A 5DWNA 4C2XA 4KSFA 4QB9A 2VZZA 4XNHC 3CXQA 3GY9A 4B14A 2GIVA 4IF5A 1S3ZA 2Q4VA 3F8KA 1VHSA 4AG7A 4B5PB 1N71A 4Y49C 4C2YA 4HKFA 1U6MA 1IYKA 1MJAA 1IB1E 2D4OA 4UFVA 2PQ8A 5G21A 2JDCA 5ISVA 1QSNA 4R9MA 5DWMA 3DR6A 4JXRA 3CXPA 4MHDA 2VBQA 3DSBA 1I21A 1S7FA 4A2ZA 4F6AA 2VEZA 4R3KA 2JDDA 4GS4A 4UFWA 4XPLA 3R96A 3LODA 4CAXA 3EO4A 2Q0YA 2G3AA 2WPWA 2YNEA 5A27A 1Y7RA 1K4JA 2K5TA 2Z3LA 3WR7A 1NMTA 4E0AA 5JQ4A 2AE6A 4UWJA 3DNSA 4KOYA 2JEVA 3FBUA 3TCVA 1FY7A 4YRHA 5F47A 4CGOA 2Z3KA 3IWEA 4F0XA 1WWZA 5AG6A 2ZXVA 4CRYB 3CXSA 4OAEA 4RS2A 4AB7A 4H6ZA 2PSWA 3FYNA 1Q2CA 1TIQA 1XIXA 2OB0A 1YREA 2WUUA 1I12A 3FIXA 4PV6A 2B5GB 4M3SA 4UWIA 4UBRA 4XPDB 2ZW6A 2GANA 2I79A 3NE7A 1M44A 1M4GA 3ZJ0A 2Q44A 3IU2A 1RXTA 3A9LA 2QMLA 3PP9A 2CXAA 4JJXA 2B4DA 4A31A 3FB3A 4B5PA 3PZJA 1Z9UA 3C26A 4CGLA 4KVME 4E2AA 1S7LA 4KOSA 2ATRA 1PU9A 2HV2A 1B6BA 2JLMA 4PK2A 2O28A 4C7IA 2CNSA 4UFXA 2WSAA 4CAFA 2B3UA 2D4PA 3W6XA 1MK4A 2GE3A 4K30A 1GHEA 2OZUA 1KUXA 3TFYA 2ZW5A 1KUYA 1V0CA 2YGWA 3ZZIA 2DPSA 2R98A 4JLYA 1IYLA 1XF8A 2J8RA 1MJBA 2A4NA 4KVXA 4LX9A 3RYOA 3P2FA 3TT2A 5HMNA 3F0AA 5HH1A 4CRZB 3V8IA 1CJWA 3D2PA 2P6FA 3LD2A 4R3LA 3G3SA 2Q04A 4B11A 1M4DA 4KOXA 4MBUA 1I1DA 2AJ6A 2B5GA 2FT0A 3JUWA 4B13A 5KTDA 4FD6A 3TE4A 2ZW7A 1PUAA 4YGOA 2YNDA 2CY2A 3TO9A 4ZBGA 4QVTA 2I00A 3VWDA 2G0BA 2BEIA 2BL1A 2FL4A 4KZTA 2FIAA 2Q4YA 4MFJA 1KUVA 4CGMA 2PC1A 4XNHB 4KLVA 1Q2DA 3EXNA 2Q7BA 1XE4A 5G1ZA 4B5OA 3BJ7A 3TO7A 2Z11A 4MFZA 4EVYA 2DXQA 2QECA 4CAVA 3FNCA 4CAWA 4XPDC 1ON0A 4MI4A 5H86A 5A28A 3IGRA 4U9ZA 4H89A 2H5MA 3FRMA 4L89A 4QUSA 2FE7A 2PR8A 3P2HA 2KCWA 1L0CA 5C88A 5EC4A 4FD5A 4U9YA 3R9FA 2EVNA 1XEBA 1OZPA 4IUSA 1ZO0A 2J8MA 2NMTA 4A30A 1LRZA 1Y9KA 2B3VA 4MY3A 4MJ8A 3R9GA 3OWCA 2F5IA 2VQYA 5AGEA 4NF1A 3W6SA 4CYPA 3S6HA 4XPKA 4B12A 3BJ8A 2ZW4A 2OZGA 5H84A 3D2MA 2CNTA 2Y0MA 2PRBA 3JVNA 4R57A 4CYQA 1R57A 3I3GA 2VI7A 3VWEA 1B87A 2FCKA 1YVKA 4X5KA 2FIWA 1YLEA 3TOBA 4A33A 5AG7A 4UCNA 1NSLA 1YVOA 2P0WA 4A32A 4I49A 5AG4A 1S5KA 2EUIA 3SHPA 1UFHA 1S7KA 4PSXA 2VZYA 3GKRA 2FSRA 2FS5A 3F5BA 4FD7A 2OH1A 2DPTA 3S6KA 4JXQA 2OZHA 4KLWA 1QSRA 3DR8A 4C2ZA 3GYAA 1P0HA 5I0CA 2R7HA 4UCPA 2QIRA 3D3SA 4QC6A 4CAEA 5G20A 2REFA 4C7HA 4KVOE 3IU1A 1BOBA 4BBHA 1CM0A 4PSWA 4KOWA 4NEXA 3K9UA 5J8CA 2HUZA 4MFLA 3T9YA 4F0YA 4KORA 3R9EA 1Y9WA 1YR0A 1QSOA 4R87A 4HNWB 4CGPA 4II9A 4CYNA 5FVJA 4OLLA 4PK3A 2Z3OA 4M85A 3EFAA 4MFPA 1YX0A 4KOUA 1RO5A 4NCZA 2B4BA 2B4DB 4QBJA 2R8VA 2REEA 1WK4A 1MJ9A 5EBVA 3R1KA 4MY0A 1QSMA 4B10A 2Z0ZA 4JD6A 1S60A 3TO6A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5IV0 A;  3W91 A;  4Y49 B;  4L8A A;  2P6E A;  3UY5 A;  1Z4E A;  3D8P A;  3KKW A;  3BLN A;  4AVB A;  2C27 A;  5F49 A;  1M1D A;  4J3G A;  3QB8 A;  3N7Z A;  1QST A;  4AG9 A;  1SQH A;  3SXN A;  5C82 A;  5IB0 A;  1XMT A;  5F46 A;  4U5Y A;  1S7N A;  5JPH A;  4KUB A;  2VXK A;  3E0K A;  2RC4 A;  4KOT A;  3SXO A;  2FXF A;  2OU2 A;  2ZPA A;  5CNP A;  3IWG A;  4RI1 A;  4DNC A;  3EC4 A;  3H4Q A;  3QAH A;  1BO4 A;  1M4I A;  1YK3 A;  3S6G A;  3I9S A;  2ARH A;  4AVA A;  3MGD A;  5KTC A;  4NXY A;  1IID A;  3FXT A;  2HQY A;  4H6U A;  2PDO A;  4JWP A;  4FD4 A;  5F48 A;  1IIC A;  1Z4R A;  3EY5 A;  2G3T A;  4BMH A;  3TOA A;  2Z10 A;  1J4J A;  4KUA A;  3G8W A;  2J8N A;  1VKC A;  2CNM A;  2IL4 A;  3B8G A;  4HNX B;  2P6G A;  2B58 A;  1YGH A;  2PR1 A;  1KZF A;  4LUA A;  5IX3 A;  5E96 A;  4ORF A;  4CS0 B;  5KTA A;  5GCN A;  4OAD A;  3TTH A;  1P4N A;  3PGP A;  3T90 A;  4HNY B;  1Q2Y A;  4AVC A;  2X7B A;  3DDD A;  4YFJ A;  5J8F A;  2WPX A;  2R1I A;  4ONU A;  4E8O A;  3S6F A;  4NSQ A;  4KOV A;  1NE9 A;  3R95 A;  2BUE A;  2BSW A;  4UA3 A;  5DWN A;  4QB9 A;  2VZZ A;  4XNH C;  3CXQ A;  3GY9 A;  2GIV A;  4IF5 A;  1S3Z A;  2Q4V A;  3F8K A;  1VHS A;  4AG7 A;  4B5P B;  1N71 A;  4Y49 C;  4HKF A;  1U6M A;  1IYK A;  1MJA A;  1IB1 E;  2D4O A;  2PQ8 A;  2JDC A;  5ISV A;  1QSN A;  4R9M A;  5DWM A;  3DR6 A;  4JXR A;  3CXP A;  4MHD A;  2VBQ A;  3DSB A;  1I21 A;  1S7F A;  4F6A A;  2VEZ A;  4R3K A;  2JDD A;  4GS4 A;  4XPL A;  3R96 A;  3LOD A;  4CAX A;  3EO4 A;  2Q0Y A;  2G3A A;  2WPW A;  1Y7R A;  1K4J A;  2K5T A;  3WR7 A;  1NMT A;  4E0A A;  5JQ4 A;  2AE6 A;  4UWJ A;  3DNS A;  4KOY A;  2JEV A;  3FBU A;  3TCV A;  1FY7 A;  4YRH A;  5F47 A;  1WWZ A;  2ZXV A;  4CRY B;  3CXS A;  4OAE A;  4RS2 A;  4AB7 A;  4H6Z A;  2PSW A;  3FYN A;  1Q2C A;  1TIQ A;  1XIX A;  2OB0 A;  1YRE A;  1I12 A;  3FIX A;  4PV6 A;  2B5G B;  4M3S A;  4UWI A;  4UBR A;  4XPD B;  2ZW6 A;  2GAN A;  2I79 A;  3NE7 A;  1M44 A;  1M4G A;  3ZJ0 A;  2Q44 A;  1RXT A;  3PP9 A;  2QML A;  4JJX A;  2B4D A;  4B5P A;  3FB3 A;  3PZJ A;  1Z9U A;  3C26 A;  4KVM E;  4E2A A;  1S7L A;  4KOS A;  2ATR A;  1PU9 A;  2HV2 A;  1B6B A;  2JLM A;  4PK2 A;  2O28 A;  2CNS A;  2B3U A;  2D4P A;  3W6X A;  1MK4 A;  2GE3 A;  4K30 A;  1GHE A;  2OZU A;  1KUX A;  3TFY A;  2ZW5 A;  1KUY A;  1V0C A;  3ZZI A;  2R98 A;  4JLY A;  1IYL A;  1XF8 A;  2J8R A;  1MJB A;  2A4N A;  4KVX A;  4LX9 A;  3RYO A;  3P2F A;  3TT2 A;  5HMN A;  3F0A A;  5HH1 A;  4CRZ B;  3V8I A;  1CJW A;  3D2P A;  2P6F A;  3LD2 A;  4R3L A;  3G3S A;  2Q04 A;  1M4D A;  4KOX A;  4MBU A;  1I1D A;  2AJ6 A;  2B5G A;  2FT0 A;  3JUW A;  5KTD A;  4FD6 A;  3TE4 A;  2ZW7 A;  1PUA A;  4YGO A;  2CY2 A;  3TO9 A;  4ZBG A;  4QVT A;  2I00 A;  3VWD A;  2G0B A;  2BEI A;  2BL1 A;  2FL4 A;  4KZT A;  2FIA A;  2Q4Y A;  1KUV A;  2PC1 A;  4XNH B;  4KLV A;  1Q2D A;  3EXN A;  2Q7B A;  1XE4 A;  4B5O A;  3BJ7 A;  3TO7 A;  2Z11 A;  4EVY A;  2DXQ A;  2QEC A;  4CAV A;  3FNC A;  4CAW A;  4XPD C;  1ON0 A;  4MI4 A;  5H86 A;  3IGR A;  4U9Z A;  4H89 A;  2H5M A;  3FRM A;  4L89 A;  4QUS A;  2FE7 A;  2PR8 A;  3P2H A;  2KCW A;  1L0C A;  5C88 A;  5EC4 A;  4FD5 A;  4U9Y A;  3R9F A;  2EVN A;  1XEB A;  1OZP A;  4IUS A;  2J8M A;  2NMT A;  1LRZ A;  1Y9K A;  2B3V A;  4MY3 A;  4MJ8 A;  3R9G A;  3OWC A;  2F5I A;  2VQY A;  4NF1 A;  3W6S A;  3S6H A;  4XPK A;  3BJ8 A;  2ZW4 A;  2OZG A;  5H84 A;  3D2M A;  2CNT A;  2Y0M A;  2PRB A;  3JVN A;  4R57 A;  1R57 A;  3I3G A;  2VI7 A;  3VWE A;  1B87 A;  2FCK A;  1YVK A;  4X5K A;  2FIW A;  1YLE A;  3TOB A;  1NSL A;  1YVO A;  2P0W A;  4I49 A;  1S5K A;  2EUI A;  3SHP A;  1UFH A;  1S7K A;  4PSX A;  2VZY A;  3GKR A;  2FSR A;  2FS5 A;  3F5B A;  4FD7 A;  2OH1 A;  3S6K A;  4JXQ A;  2OZH A;  4KLW A;  1QSR A;  3DR8 A;  3GYA A;  1P0H A;  5I0C A;  2R7H A;  2QIR A;  3D3S A;  4QC6 A;  2REF A;  4KVO E;  1BOB A;  1CM0 A;  4PSW A;  4KOW A;  4NEX A;  3K9U A;  5J8C A;  2HUZ A;  4F0Y A;  3T9Y A;  4KOR A;  3R9E A;  1Y9W A;  1YR0 A;  1QSO A;  4R87 A;  4HNW B;  4II9 A;  5FVJ A;  4OLL A;  4PK3 A;  4M85 A;  3EFA A;  1YX0 A;  4KOU A;  1RO5 A;  4NCZ A;  2B4B A;  2B4D B;  4QBJ A;  2R8V A;  2REE A;  1WK4 A;  1MJ9 A;  5EBV A;  3R1K A;  4MY0 A;  1QSM A;  2Z0Z A;  4JD6 A;  1S60 A;  3TO6 A; 
#chains in the Genus database with same CATH topology
 5IV0 A;  2CIJ A;  4MCQ A;  3W91 A;  4Y49 B;  4L8A A;  2P6E A;  3UY5 A;  4A37 A;  2Z3N A;  1Z4E A;  3CDX A;  3D8P A;  3KKW A;  3BLN A;  2ZEF A;  4TWE A;  4PQA A;  4AVB A;  2C27 A;  2QJ8 A;  4KS9 A;  2PJ8 A;  5F49 A;  2PJC A;  4KSA A;  4R6T A;  1M1D A;  4J3G A;  4C68 A;  3QB8 A;  4ZYQ A;  3VAR A;  2PJ0 A;  4P4B A;  1TXR A;  3N7Z A;  4P6Y A;  2YNC A;  1QST A;  3B3W A;  1SQH A;  4UCM A;  4A95 A;  3SXN A;  4AG9 A;  5C82 A;  5IB0 A;  1XMT A;  5F46 A;  2GLF A;  1S7N A;  2PJ1 A;  4U5Y A;  4KUB A;  5JPH A;  2VXK A;  3E0K A;  2RC4 A;  3FH4 A;  5AG5 A;  4KOT A;  4MFK A;  3SXO A;  2FXF A;  2OU2 A;  4NJR A;  2ZPA A;  5CNP A;  3IWG A;  4EME A;  1XOV A;  3CT9 A;  4RI1 A;  4DNC A;  3EC4 A;  3PB4 X;  3H4Q A;  1ARL A;  3K2K A;  3QAH A;  4PXB A;  1BO4 A;  4OC1 A;  1F2P A;  1M4I A;  2PJ5 A;  1YK3 A;  3S6G A;  3I9S A;  4CGN A;  2ARH A;  4Q38 A;  4AVA A;  4YU9 A;  5K8M A;  3WC6 A;  1FNO A;  3BHX A;  3FJU A;  4O23 A;  3MGD A;  5KTC A;  3H5Z A;  4NXY A;  1IID A;  4PPZ A;  3FXT A;  1Y0Y A;  2HQY A;  3D68 A;  4WJB A;  3ISX A;  4H6U A;  1R3N A;  2PDO A;  4JWP A;  4Q36 A;  5HVG A;  4FD4 A;  5F48 A;  1IIC A;  1Z4R A;  2YNC C;  3EY5 A;  3TO6 A;  1UWY A;  3RAM A;  4MFQ A;  2ZEL A;  2G3T A;  3JTK A;  4MHP A;  4BMH A;  3IEH A;  3KI9 A;  1LAM A;  3TOA A;  2Z10 A;  1XMB A;  1CP7 A;  2PJA A;  3B3T A;  1J4J A;  3PEI A;  4OP4 A;  1IGB A;  4MXU A;  5BWA B;  1Z8W A;  3FED A;  2PJ9 A;  4KUA A;  3G8W A;  4JYW A;  2J8N A;  2QYV A;  1VKC A;  2HC9 A;  4TNU A;  4ZGY B;  2CNM A;  2IL4 A;  3FF3 A;  3B8G A;  4HNX B;  4MCS A;  5K8P A;  2OR4 A;  2P6G A;  2B58 A;  3PFO A;  1YGH A;  2PR1 A;  4NGS A;  1KZF A;  4NGP A;  4LUA A;  5IX3 A;  5E96 A;  4ORF A;  4CS0 B;  4OID A;  5KTA A;  2Z3M A;  5GCN A;  4OAD A;  3TTH A;  5G22 A;  1YLO A;  1P4N A;  3NH5 A;  3PGP A;  3KGQ A;  3T90 A;  3IWW A;  1Q2Y A;  4HNY B;  2GLJ A;  2X7B A;  4AVC A;  1VHO A;  3DDD A;  4YFJ A;  1JQG A;  5J8F A;  2WPX A;  5JM6 A;  2POK A;  2R1I A;  4ONU A;  5HVF A;  2Z3P A;  4YWY A;  2RB7 A;  4E8O A;  1CP6 A;  4MCP A;  4CYO A;  2WYR A;  1Z8T A;  1Z5R A;  3S6F A;  2BCO A;  3I1U A;  3IO1 A;  3IIB A;  4NSQ A;  2Q51 A;  3WAB A;  4KOV A;  1NE9 A;  3R95 A;  2BUE A;  2BSW A;  1LFW A;  4UA3 A;  5DWN A;  4MMO A;  4C2X A;  4KSF A;  2ZOG A;  1Z8L A;  4QB9 A;  2VZZ A;  4NGN A;  2PJ6 A;  4LQ6 A;  4XNH C;  3CXQ A;  3GY9 A;  4B14 A;  1Z2L A;  2GIV A;  1XJO A;  4IF5 A;  1S3Z A;  4P4J A;  3CZX A;  3BI1 A;  2F8H A;  2Q4V A;  1ZG8 A;  1LAP A;  3F8K A;  3GUX A;  1VHS A;  3VH9 A;  4AG7 A;  4B5P B;  1N71 A;  4UF4 A;  2VL1 A;  3D66 A;  4Y49 C;  4C2Y A;  4MRI A;  4HKF A;  1U6M A;  1IYK A;  1MJA A;  1IB1 E;  5HVH A;  2D4O A;  3PB7 X;  1JWQ A;  4UFV A;  5K8O A;  3MRU A;  2PQ8 A;  5G21 A;  2JDC A;  1QMU A;  4ONW A;  3HLP A;  4DJL A;  1QSN A;  4R9M A;  5DWM A;  5ISV A;  2ZEO A;  3DR6 A;  2EK8 A;  1AMP A;  2ZOF A;  1ELM P;  4JXR A;  3CXP A;  4MHD A;  2V77 A;  3SJE A;  5J1Q A;  2VBQ A;  5LYD A;  3DSB A;  4ZI6 A;  1I21 A;  1S7F A;  4A2Z A;  4ZX9 A;  3IC1 A;  3PFE A;  2VEZ A;  4F6A A;  4R3K A;  2JDD A;  2EO8 A;  4GS4 A;  4FAI A;  2XEG A;  4UFW A;  2ABZ A;  4XPL A;  1X10 A;  4ZY2 A;  3LOD A;  3R96 A;  2PVV A;  3EO4 A;  4P44 A;  1HEE A;  1Y0R A;  2Q0Y A;  1IOF A;  4CAX A;  2G3A A;  2WPW A;  2YNE A;  3PRT A;  1Y7R A;  4P10 A;  3WC5 A;  1K4J A;  5A27 A;  2K5T A;  2Z3L A;  3WR7 A;  4ZY0 A;  3D7D A;  1NMT A;  4E0A A;  5JQ4 A;  2GFQ A;  3H8E A;  2J9A A;  3SI1 A;  1F57 A;  2AE6 A;  4OC2 A;  3VAT A;  4F9V A;  4UWJ A;  3DNS A;  4KOY A;  4NGM A;  3QAY A;  2JEV A;  3FBU A;  2IMO A;  1FY7 A;  4YRH A;  3KR4 A;  3TCV A;  5F47 A;  4CGO A;  2CTB A;  2Z3K A;  3IWE A;  2CF4 A;  4F0X A;  4A94 A;  2PRQ A;  2O53 A;  1WWZ A;  5AG6 A;  2ZXV A;  2DF5 A;  4CRY B;  1AYE A;  1FT7 A;  1NSA A;  3CXS A;  4OAE A;  4RS2 A;  2Q7S A;  4AB7 A;  4H6Z A;  5CBM A;  2PSW A;  3FYN A;  1Q2C A;  1TIQ A;  1XIX A;  2OB0 A;  1YRE A;  2PIZ A;  2WUU A;  1I12 A;  3FIX A;  3IFE A;  4M6G A;  4PV6 A;  2B5G B;  4M3S A;  2V8D A;  3GIU A;  4UWI A;  4UBR A;  4XPD B;  4RUH A;  1ZG9 A;  2ZW6 A;  3D67 A;  3B7I A;  2GAN A;  3KR5 A;  3K9T A;  2I79 A;  3NE7 A;  2IJZ A;  1CG2 A;  4P4I A;  4CPA A;  3DGV A;  5EMI A;  1M44 A;  1M4G A;  3LMS A;  3ZJ0 A;  4OME A;  2Q44 A;  3IU2 A;  1RXT A;  2ZEE A;  8CPA A;  3NE8 A;  5LRK A;  4B6Z A;  3L2N A;  1CBX A;  2QML A;  3A9L A;  3PP9 A;  3FMC A;  2CXA A;  4JJX A;  2B4D A;  2AFM A;  3FB3 A;  4A31 A;  3PZJ A;  4B5P A;  1Z9U A;  1TF8 A;  3C26 A;  4CGL A;  2NYQ A;  1BPM A;  4NFR A;  2PE3 A;  3KAS A;  4KVM E;  4R8F A;  4DYO A;  1HDQ A;  4E2A A;  4HPS A;  1S7L A;  2Q43 A;  1YQE A;  4KOS A;  3GB0 A;  1LCP A;  4OKO A;  2ATR A;  1PU9 A;  2ZED A;  2HV2 A;  4MCR A;  2EBJ A;  4UIB A;  1B6B A;  2JLM A;  1YW4 A;  2ANP A;  4PK2 A;  2O28 A;  4C7I A;  2CNS A;  4PXC A;  2AFU A;  4KSI A;  4NGQ A;  4UFX A;  1IY7 A;  3D4U A;  1CPX A;  1ZG7 A;  5K8N A;  3D7H A;  1DTD A;  5THW A;  2WSA A;  3S9M A;  2WZN A;  4CAF A;  3H8G A;  2B3U A;  2D4P A;  4X2T A;  4MHY A;  3W6X A;  1MK4 A;  2GE3 A;  4K30 A;  1GHE A;  2ZEH A;  1TF9 A;  2OZU A;  1KUX A;  1GYT A;  1TKH A;  1IOI A;  4MHN A;  3TFY A;  1XFO A;  1KWM A;  1KUY A;  1V0C A;  2YGW A;  2ZW5 A;  4UEZ A;  4UEF A;  3ZZI A;  4OC5 A;  2DPS A;  2R98 A;  3GLJ A;  4JLY A;  1IYL A;  3JRU A;  3BI0 A;  1XF8 A;  1M4L A;  2J8R A;  2GRE A;  1VHE A;  1MJB A;  2A4N A;  3CPX A;  4KVX A;  4LX9 A;  3RYO A;  3P2F A;  4X3R A;  5JH9 A;  4OC4 A;  3TT2 A;  5HMN A;  3F0A A;  5HH1 A;  1VIX A;  4CRZ B;  1H8L A;  5ELY A;  1LOK A;  4FWU A;  3V8I A;  1CJW A;  3D2P A;  1ZLH A;  4ZY1 A;  2P6F A;  3B3S A;  3LD2 A;  4R3L A;  1CPS A;  3G3S A;  3N5F A;  2Q04 A;  1LAN A;  4P4E A;  2OOT A;  1ARM A;  4B11 A;  3V38 A;  1M4D A;  2PJ7 A;  4KOX A;  3D7G A;  3KQX A;  4MBU A;  1I1D A;  4OC0 A;  2AJ6 A;  2AFW A;  2B5G A;  1PCA A;  2FT0 A;  1XRY A;  2FVG A;  3PBB A;  3JUW A;  3WC7 A;  4B13 A;  5KTD A;  4PXE A;  4FD6 A;  4P4D A;  3TE4 A;  4G1P A;  1ELL P;  2ZW7 A;  1PUA A;  4YGO A;  2YND A;  4JZ0 A;  2CY2 A;  3TO9 A;  3NH8 A;  4ZBG A;  4QVT A;  3MN8 A;  2I00 A;  4ZX8 A;  3VWD A;  2G0B A;  2XEJ A;  2BEI A;  2BL1 A;  2FL4 A;  3ISZ A;  1YME A;  4KZT A;  2FIA A;  2Q4Y A;  4MFJ A;  3SJF A;  4F9U A;  5F09 A;  1KUV A;  4CGM A;  1VGY A;  2PC1 A;  2Q4Z A;  4XNH B;  4KLV A;  3RO0 A;  1Q2D A;  3EXN A;  2Q7B A;  5LRG A;  3B35 A;  1XE4 A;  5G1Z A;  4B5O A;  3NA6 A;  3BJ7 A;  3TO7 A;  5JGF A;  2Z11 A;  4MFZ A;  4EVY A;  4M6H A;  2G9D A;  3B3C A;  2C6P A;  4PXD A;  3RBU A;  3D7F A;  2DXQ A;  2AFO A;  4OIW A;  4RN7 A;  2QEC A;  4CAV A;  3FNC A;  2I3C A;  4CAW A;  3BXM A;  4W9Y A;  1PYT B;  4XPD C;  1ON0 A;  4MI4 A;  5H86 A;  5A28 A;  3IGR A;  4U9Z A;  6CPA A;  4H89 A;  2H5M A;  3FRM A;  4L89 A;  4Q7A A;  4QUS A;  2FE7 A;  2PR8 A;  4NJQ A;  3B2Y A;  3P2H A;  4IAV A;  2KCW A;  2C6G A;  3WT4 A;  1L0C A;  3KHZ A;  5C88 A;  2AFX A;  1XBU A;  3PB8 X;  5EC4 A;  4FD5 A;  4U9Y A;  2IQ6 A;  5LYF A;  2V8H A;  2F7V A;  3PB6 X;  3R9F A;  2C6C A;  4WWV A;  3SJX A;  2EVN A;  1XEB A;  1OZP A;  4IUS A;  3V7Z A;  4DUK A;  1Q7L A;  1ZO0 A;  2C1C A;  2J8M A;  2NMT A;  3NFZ A;  5LYI A;  4A30 A;  1LRZ A;  3LWU A;  1Y9K A;  2B3V A;  4IHM A;  5LYL A;  1EE3 P;  2QVP A;  2V8G A;  1Z8X A;  3KQZ A;  4MJ8 A;  4MY3 A;  3R9G A;  3OWC A;  4H2K A;  4EFD A;  2F5I A;  2VQY A;  5AGE A;  4NF1 A;  2PJ4 A;  4BD9 A;  3W6S A;  2PJ2 A;  4CYP A;  3S6H A;  4XPK A;  4X8I A;  4B12 A;  3BJ8 A;  2ZW4 A;  5LRJ A;  4Z65 A;  5HXD A;  2OZG A;  4LQG A;  5H84 A;  2RFH A;  3D2M A;  3FX6 A;  4R76 A;  2CNT A;  2XEI A;  2Y0M A;  2PRB A;  3JVN A;  4R57 A;  4CYQ A;  1R57 A;  3I3G A;  2PVW A;  2VI7 A;  3VWE A;  1B87 A;  2FCK A;  1AUG A;  1YVK A;  2ZEM A;  2FIW A;  1YLE A;  3PB9 X;  4P45 A;  4X5K A;  3TOB A;  4A33 A;  2PCU A;  5AG7 A;  2JEW A;  4UCN A;  2V8V A;  1NSL A;  1YVO A;  2CTC A;  2P0W A;  3HUV A;  4A32 A;  4I49 A;  5AG4 A;  1S5K A;  3TC8 A;  2EUI A;  3SHP A;  1UFH A;  1S7K A;  4PSX A;  3SI2 A;  2VZY A;  3GKR A;  2PJ3 A;  3SJG A;  2FSR A;  3S9L A;  1CX8 A;  5DS0 A;  2FS5 A;  1R43 A;  2ZEN A;  2OH1 A;  3F5B A;  4FD7 A;  2DPT A;  4NGR A;  3CPA A;  4UIA A;  3DLJ A;  3S6K A;  1BLL E;  2ZEG A;  4JXQ A;  4AXV A;  2OZH A;  4IK2 A;  1QQ9 A;  4KLW A;  1QSR A;  3T8W A;  3DR8 A;  4UEE A;  4C2Z A;  2EK9 A;  1P0H A;  3GYA A;  1IU8 A;  5I0C A;  1X12 A;  2R7H A;  4UCP A;  2GU2 A;  2QIR A;  3D3S A;  2PJB A;  2XEF A;  4QC6 A;  3RNZ A;  4GM5 A;  5G20 A;  2BO9 A;  4CAE A;  5D29 A;  3LAC A;  2REF A;  4C7H A;  4KVO E;  3IU1 A;  1BOB A;  4BBH A;  1CM0 A;  1YSJ A;  4FBE A;  4PSW A;  4KOW A;  1HDU A;  3K9U A;  4NEX A;  4BIN A;  5J8C A;  4P4F A;  4F8Z A;  2HUZ A;  4MFL A;  3T9Y A;  4F0Y A;  1A2Z A;  4KOR A;  3R9E A;  1OBR A;  1YW6 A;  4NGT A;  1Y9W A;  2ODF A;  2JBJ A;  1YR0 A;  4OC3 A;  3QNV A;  4M6I A;  3B3V A;  5CPA A;  2DEA A;  3KHX A;  4EWT A;  1QSO A;  1BPN A;  3H8F A;  4R87 A;  2JBK A;  4HNW B;  1TKJ A;  1RTQ A;  2HB6 A;  4MHZ A;  4CGP A;  4CYN A;  5FVJ A;  4II9 A;  1ZLI A;  2O4H A;  4OLL A;  3FEE A;  5IB9 A;  4PK3 A;  2Z3O A;  4M85 A;  3EFA A;  3S9N A;  1BAV A;  1YX0 A;  2ZEP A;  4KOU A;  1RO5 A;  4MFP A;  4NCZ A;  1DE4 C;  2BOA A;  2B4B A;  2AFZ A;  3FEC A;  2B4D B;  4QBJ A;  2R8V A;  2REE A;  3PBE A;  3NH4 A;  2EWB A;  1TKF A;  4A39 A;  2PIY A;  1WK4 A;  3IJ3 A;  4GXH A;  2NSM A;  3KL9 A;  3FVL A;  3RZA A;  1MJ9 A;  1Y7E A;  5EBV A;  3R1K A;  4A38 A;  7CPA A;  4FUU A;  4R7M A;  1F2O A;  3SI0 A;  4MY0 A;  5I4M A;  1QSM A;  4B10 A;  2AFS A;  2Z0Z A;  4JD6 A;  5D8N A;  4K3N A;  1S60 A;  3KZW A;  3TX8 A; 
#chains in the Genus database with same CATH homology
 5IV0 A;  3W91 A;  4Y49 B;  4L8A A;  2P6E A;  3UY5 A;  2Z3N A;  1Z4E A;  3D8P A;  3KKW A;  3BLN A;  4AVB A;  2C27 A;  4KS9 A;  5F49 A;  4KSA A;  1M1D A;  4J3G A;  4C68 A;  3QB8 A;  3N7Z A;  2YNC A;  1QST A;  4UCM A;  1SQH A;  4A95 A;  4AG9 A;  3SXN A;  5C82 A;  5IB0 A;  1XMT A;  5F46 A;  4U5Y A;  1S7N A;  5JPH A;  4KUB A;  2VXK A;  3E0K A;  2RC4 A;  5AG5 A;  4KOT A;  4MFK A;  3SXO A;  2FXF A;  2OU2 A;  2ZPA A;  5CNP A;  3IWG A;  4RI1 A;  4DNC A;  3EC4 A;  3H4Q A;  3QAH A;  1BO4 A;  1M4I A;  1YK3 A;  3S6G A;  3I9S A;  4CGN A;  2ARH A;  4Q38 A;  4AVA A;  3MGD A;  5KTC A;  3H5Z A;  4NXY A;  1IID A;  3FXT A;  2HQY A;  4H6U A;  2PDO A;  4JWP A;  4Q36 A;  4FD4 A;  5F48 A;  1IIC A;  1Z4R A;  2YNC C;  3EY5 A;  4MFQ A;  2G3T A;  3JTK A;  4BMH A;  3TOA A;  2Z10 A;  1J4J A;  5BWA B;  4KUA A;  3G8W A;  2J8N A;  1VKC A;  4ZGY B;  2CNM A;  2IL4 A;  3B8G A;  4HNX B;  2P6G A;  2B58 A;  1YGH A;  2PR1 A;  1KZF A;  4LUA A;  5IX3 A;  5E96 A;  4ORF A;  4CS0 B;  5KTA A;  2Z3M A;  5GCN A;  4OAD A;  3TTH A;  5G22 A;  1P4N A;  3PGP A;  3T90 A;  4HNY B;  1Q2Y A;  4AVC A;  2X7B A;  3DDD A;  4YFJ A;  5J8F A;  2WPX A;  2R1I A;  4ONU A;  2Z3P A;  4E8O A;  4CYO A;  3S6F A;  4NSQ A;  4KOV A;  1NE9 A;  3R95 A;  2BUE A;  2BSW A;  4UA3 A;  5DWN A;  4C2X A;  4KSF A;  4QB9 A;  2VZZ A;  4XNH C;  3CXQ A;  3GY9 A;  4B14 A;  2GIV A;  4IF5 A;  1S3Z A;  2Q4V A;  3F8K A;  1VHS A;  4AG7 A;  4B5P B;  1N71 A;  4Y49 C;  4C2Y A;  4HKF A;  1U6M A;  1IYK A;  1MJA A;  1IB1 E;  2D4O A;  4UFV A;  2PQ8 A;  5G21 A;  2JDC A;  5ISV A;  1QSN A;  4R9M A;  5DWM A;  3DR6 A;  4JXR A;  3CXP A;  4MHD A;  2VBQ A;  3DSB A;  1I21 A;  1S7F A;  4A2Z A;  4F6A A;  2VEZ A;  4R3K A;  2JDD A;  4GS4 A;  4UFW A;  4XPL A;  3R96 A;  3LOD A;  4CAX A;  3EO4 A;  2Q0Y A;  2G3A A;  2WPW A;  2YNE A;  5A27 A;  1Y7R A;  1K4J A;  2K5T A;  2Z3L A;  3WR7 A;  1NMT A;  4E0A A;  5JQ4 A;  2AE6 A;  4UWJ A;  3DNS A;  4KOY A;  2JEV A;  3FBU A;  3TCV A;  1FY7 A;  4YRH A;  5F47 A;  4CGO A;  2Z3K A;  3IWE A;  4F0X A;  1WWZ A;  5AG6 A;  2ZXV A;  4CRY B;  3CXS A;  4OAE A;  4RS2 A;  4AB7 A;  4H6Z A;  2PSW A;  3FYN A;  1Q2C A;  1TIQ A;  1XIX A;  2OB0 A;  1YRE A;  2WUU A;  1I12 A;  3FIX A;  4PV6 A;  2B5G B;  4M3S A;  4UWI A;  4UBR A;  4XPD B;  2ZW6 A;  2GAN A;  2I79 A;  3NE7 A;  1M44 A;  1M4G A;  3ZJ0 A;  2Q44 A;  3IU2 A;  1RXT A;  3A9L A;  2QML A;  3PP9 A;  2CXA A;  4JJX A;  2B4D A;  4A31 A;  3FB3 A;  4B5P A;  3PZJ A;  1Z9U A;  3C26 A;  4CGL A;  4KVM E;  4E2A A;  1S7L A;  4KOS A;  2ATR A;  1PU9 A;  2HV2 A;  1B6B A;  2JLM A;  4PK2 A;  2O28 A;  4C7I A;  2CNS A;  4UFX A;  2WSA A;  4CAF A;  2B3U A;  2D4P A;  3W6X A;  1MK4 A;  2GE3 A;  4K30 A;  1GHE A;  2OZU A;  1KUX A;  3TFY A;  2ZW5 A;  1KUY A;  1V0C A;  2YGW A;  3ZZI A;  2DPS A;  2R98 A;  4JLY A;  1IYL A;  1XF8 A;  2J8R A;  1MJB A;  2A4N A;  4KVX A;  4LX9 A;  3RYO A;  3P2F A;  3TT2 A;  5HMN A;  3F0A A;  5HH1 A;  4CRZ B;  3V8I A;  1CJW A;  3D2P A;  2P6F A;  3LD2 A;  4R3L A;  3G3S A;  2Q04 A;  4B11 A;  1M4D A;  4KOX A;  4MBU A;  1I1D A;  2AJ6 A;  2B5G A;  2FT0 A;  3JUW A;  4B13 A;  5KTD A;  4FD6 A;  3TE4 A;  2ZW7 A;  1PUA A;  4YGO A;  2YND A;  2CY2 A;  3TO9 A;  4ZBG A;  4QVT A;  2I00 A;  3VWD A;  2G0B A;  2BEI A;  2BL1 A;  2FL4 A;  4KZT A;  2FIA A;  2Q4Y A;  4MFJ A;  1KUV A;  4CGM A;  2PC1 A;  4XNH B;  4KLV A;  1Q2D A;  3EXN A;  2Q7B A;  1XE4 A;  5G1Z A;  4B5O A;  3BJ7 A;  3TO7 A;  2Z11 A;  4MFZ A;  4EVY A;  2DXQ A;  2QEC A;  4CAV A;  3FNC A;  4CAW A;  4XPD C;  1ON0 A;  4MI4 A;  5H86 A;  5A28 A;  3IGR A;  4U9Z A;  4H89 A;  2H5M A;  3FRM A;  4L89 A;  4QUS A;  2FE7 A;  2PR8 A;  3P2H A;  2KCW A;  1L0C A;  5C88 A;  5EC4 A;  4FD5 A;  4U9Y A;  3R9F A;  2EVN A;  1XEB A;  1OZP A;  4IUS A;  1ZO0 A;  2J8M A;  2NMT A;  4A30 A;  1LRZ A;  1Y9K A;  2B3V A;  4MY3 A;  4MJ8 A;  3R9G A;  3OWC A;  2F5I A;  2VQY A;  5AGE A;  4NF1 A;  3W6S A;  4CYP A;  3S6H A;  4XPK A;  4B12 A;  3BJ8 A;  2ZW4 A;  2OZG A;  5H84 A;  3D2M A;  2CNT A;  2Y0M A;  2PRB A;  3JVN A;  4R57 A;  4CYQ A;  1R57 A;  3I3G A;  2VI7 A;  3VWE A;  1B87 A;  2FCK A;  1YVK A;  4X5K A;  2FIW A;  1YLE A;  3TOB A;  4A33 A;  5AG7 A;  4UCN A;  1NSL A;  1YVO A;  2P0W A;  4A32 A;  4I49 A;  5AG4 A;  1S5K A;  2EUI A;  3SHP A;  1UFH A;  1S7K A;  4PSX A;  2VZY A;  3GKR A;  2FSR A;  2FS5 A;  3F5B A;  4FD7 A;  2OH1 A;  2DPT A;  3S6K A;  4JXQ A;  2OZH A;  4KLW A;  1QSR A;  3DR8 A;  4C2Z A;  3GYA A;  1P0H A;  5I0C A;  2R7H A;  4UCP A;  2QIR A;  3D3S A;  4QC6 A;  4CAE A;  5G20 A;  2REF A;  4C7H A;  4KVO E;  3IU1 A;  1BOB A;  4BBH A;  1CM0 A;  4PSW A;  4KOW A;  4NEX A;  3K9U A;  5J8C A;  2HUZ A;  4MFL A;  3T9Y A;  4F0Y A;  4KOR A;  3R9E A;  1Y9W A;  1YR0 A;  1QSO A;  4R87 A;  4HNW B;  4CGP A;  4II9 A;  4CYN A;  5FVJ A;  4OLL A;  4PK3 A;  2Z3O A;  4M85 A;  3EFA A;  4MFP A;  1YX0 A;  4KOU A;  1RO5 A;  4NCZ A;  2B4B A;  2B4D B;  4QBJ A;  2R8V A;  2REE A;  1WK4 A;  1MJ9 A;  5EBV A;  3R1K A;  4MY0 A;  1QSM A;  4B10 A;  2Z0Z A;  4JD6 A;  1S60 A;  3TO6 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...