2WPXA

Tandem gnat protein from the clavulanic acid biosynthesis pathway (with accoa)
Total Genus 87
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
87
sequence length
334
structure length
326
Chain Sequence
b'AGELEFVPLAANDDETVGQWLDLMALAAETGPRAAPPCNVDMVGSLRFAPPATALDDWVVRSGGRVVGALRLALPDGAPTARVDQLLVHPGRRRRGIGRALWAHARELARKHDRTTLTATVVESLPSGPAQDPGPAAFAAAMGAHRSDIPAGTHQWLDLDRHDPLADGVPAVPAGYSLVTWGTITPDEYAVPVSELELRAAQEVRTSYARQFETMRVGRGRRAYHTGAVHDATGALAGYTSVSKTTGNPAYALQGMTVVHREHRGHALGTLLKLANLEYVLRHEPEVRLVETANAEDNHPMIAVNAALGFEPYDRWVFWTAEAGPS'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords ORF14
publication title Crystallographic and mass spectrometric analyses of a tandem GNAT protein from the clavulanic acid biosynthesis pathway.
pubmed doi rcsb
source organism Streptomyces clavuligerus
molecule tags Transferase
total genus 87
structure length 326
sequence length 334
chains with identical sequence B
ec nomenclature ec 2.3.1.-:
pdb deposition date 2009-08-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00583 Acetyltransf_1 Acetyltransferase (GNAT) family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.630.30 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Aminopeptidase 2wpxA00
3DR6A 2HV2A 2ZW5A 4RI1A 3C26A 4M85A 2CNMA 3TOBA 4CRYB 4FD6A 2Q7BA 3B8GA 2HQYA 2PSWA 1MJ9A 2QECA 3FBUA 2J8RA 2VZYA 1QSNA 1S3ZA 4UWIA 5IV0A 1BO4A 2KCWA 1U6MA 4U5YA 1MK4A 3JVNA 1RXTA 4NEXA 2JLMA 3KKWA 5C82A 4B5OA 2J8MA 2J8NA 3D8PA 2OZHA 2Z0ZA 3CXQA 4M3SA 1QSMA 2Q4YA 5EBVA 1XEBA 3R1KA 4OAEA 2B4DA 4LUAA 3D2MA 3ZJ0A 4MJ8A 4PV6A 3R9EA 3TO7A 2VZZA 3P2FA 4AVAA 3P2HA 2REFA 2VQYA 3TE4A 4K30A 3FRMA 4B5PA 1KUYA 1VKCA 1Z9UA 4ORFA 5HH1A 1LRZA 4NCZA 2CY2A 2ZPAA 2B58A 3PGPA 1YLEA 4MY0A 4KOYA 1KZFA 5H86A 2P6FA 4UBRA 4KLWA 1N71A 1YK3A 2ZW4A 5F46A 1S60A 2Q44A 1Q2YA 1XE4A 1NE9A 2FT0A 4JWPA 2GANA 1CJWA 3F8KA 4R87A 3GYAA 5HMNA 2D4PA 2VBQA 3VWDA 5DWNA 4OLLA 4NXYA 3JUWA 4NF1A 2IL4A 1P0HA 2PRBA 4R3LA 4CAWA 4JD6A 3EXNA 2GE3A 4ZBGA 2Z11A 4PSWA 1M4DA 3W6XA 3FNCA 1Q2CA 2OH1A 3R96A 4H89A 4JJXA 4R3KA 5KTCA 3GY9A 2FCKA 2P6EA 1S7KA 2JEVA 2P6GA 1M4GA 1MJAA 2PR1A 1V0CA 3S6KA 1RO5A 2R1IA 3EFAA 3E0KA 4KOSA 1Y9WA 2ATRA 2X7BA 5JPHA 2BEIA 4R9MA 1QSTA 2R98A 3R9FA 3TT2A 5JQ4A 4UA3A 4YFJA 2OB0A 4XNHC 3F0AA 3NE7A 5F47A 2EVNA 3W6SA 1S7NA 2B3UA 1S5KA 4KZTA 1QSOA 1YVOA 2AJ6A 2OU2A 2FIWA 3F5BA 1IICA 4AVBA 1YREA 4HNYB 3R95A 1Y9KA 2FS5A 2ZW7A 1R57A 1PUAA 4CRZB 3TCVA 3QB8A 3PZJA 2Y0MA 4BMHA 4KORA 1TIQA 3SXOA 2G0BA 4YGOA 1S7LA 4AVCA 1CM0A 1NSLA 2ZW6A 3TTHA 1I21A 2AE6A 4KOUA 3RYOA 1XMTA 3FB3A 2F5IA 1P4NA 4RS2A 4XNHB 3LODA 1KUVA 4HKFA 4QUSA 4E2AA 4MI4A 2JDCA 3TO9A 2QIRA 3CXPA 4IF5A 5C88A 4KUAA 2FIAA 3CXSA 4FD7A 2NMTA 3EY5A 4EVYA 2Q4VA 4PSXA 5KTDA 2I79A 4QBJA 2PC1A 1M1DA 3GKRA 4AB7A 4X5KA 2B4BA 4H6ZA 4FD4A 3LD2A 4DNCA 4F6AA 5H84A 4CAXA 5J8CA 4IUSA 3ZZIA 1YX0A 1NMTA 4MY3A 1K4JA 2CNTA 3V8IA 4U9YA 2A4NA 1Z4RA 1Y7RA 2CNSA 2ARHA 5F48A 1QSRA 3W91A 5KTAA 3T90A 5GCNA 2OZGA 3IWGA 2GIVA 4E8OA 4PK2A 4LX9A 4CAVA 5ISVA 4U9ZA 2I00A 1S7FA 2H5MA 5EC4A 3SHPA 2B3VA 4NSQA 4AG7A 3I3GA 1IYKA 2K5TA 3DNSA 1WK4A 1VHSA 4J3GA 1Z4EA 4HNWB 1M4IA 3TO6A 4H6UA 3SXNA 4KOVA 3EO4A 1GHEA 4QC6A 3DDDA 4KVXA 4KOXA 3TFYA 3DR8A 2REEA 3G8WA 3BJ7A 2O28A 3FXTA 4L89A 4XPKA 2P0WA 3FIXA 4YRHA 4PK3A 2R8VA 1L0CA 2BL1A 3S6GA 4GS4A 2FE7A 1ON0A 1SQHA 2C27A 2VI7A 4KOWA 3S6HA 2VEZA 4L8AA 3WR7A 1M44A 4Y49B 2RC4A 2FXFA 1XF8A 3PP9A 3D2PA 4XPLA 1FY7A 2BSWA 4R57A 2G3AA 4KUBA 4XPDC 2QMLA 5J8FA 1I12A 4HNXB 5I0CA 3K9UA 1YR0A 2B4DB 2PDOA 3BLNA 3IGRA 2JDDA 3TOAA 1MJBA 3T9YA 1IIDA 1IYLA 1J4JA 1XIXA 4JXRA 5E96A 2B5GA 3BJ8A 1KUXA 2FSRA 4FD5A 5IB0A 2D4OA 3R9GA 2BUEA 4JXQA 4KOTA 3D3SA 4MHDA 4QB9A 2R7HA 1WWZA 4OADA 2DXQA 4B5PB 4E0AA 1UFHA 3G3SA 2WPXA 3MGDA 2B5GB 2OZUA 3VWEA 1YVKA 4KVOE 5CNPA 4KVME 4ONUA 4II9A 2WPWA 3FYNA 3OWCA 2ZXVA 1PU9A 4JLYA 4KLVA 1YGHA 1Q2DA 4QVTA 1IB1E 4AG9A 2G3TA 3I9SA 4CS0B 2PQ8A 2Q0YA 3H4QA 4XPDB 2VXKA 5IX3A 1OZPA 3EC4A 1B87A 2FL4A 3N7ZA 3UY5A 4UWJA 4MBUA 3S6FA 5F49A 4Y49C 1BOBA 1B6BA 2PR8A 3QAHA 4I49A 5DWMA 2Z10A 5FVJA 4F0YA 1I1DA 2HUZA 2Q04A 3DSBA 2EUIA
chains in the Genus database with same CATH superfamily
4UCMA 3DR6A 4F9UA 2CXAA 5LYDA 1TKHA 2C1CA 2HV2A 2Q51A 2ZW5A 3CPAA 4RI1A 1Z8LA 2PJ0A 3B3SA 3PFEA 2PRQA 4CAFA 2XEIA 3C26A 4F9VA 2DPTA 4M85A 4Z65A 4OC3A 1ZG9A 2CNMA 4O23A 3TOBA 4CRYB 2AFWA 4FD6A 3H8FA 3KL9A 2Q7BA 3BXMA 2Z3PA 3B8GA 1LANA 2HQYA 2PSWA 2Z3OA 1LAPA 1MJ9A 4MHYA 2QECA 3FBUA 4PXBA 2J8RA 4A94A 1H8LA 5D8NA 2VZYA 1QSNA 1VIXA 2POKA 2ZEEA 2ZEFA 4UCPA 2GLFA 1S3ZA 3LMSA 4UWIA 5IV0A 5K8PA 1BO4A 2AFOA 2KCWA 1U6MA 4A31A 4U5YA 1MK4A 3JVNA 3RNZA 4X8IA 4P10A 5ELYA 3SI1A 1RXTA 4NEXA 2JLMA 4MRIA 3KKWA 5C82A 4B5OA 4FUUA 2J8MA 2J8NA 3D8PA 4MCQA 2OZHA 2Z0ZA 3CXQA 3NFZA 4ONWA 3GB0A 4M3SA 1TF9A 1LCPA 1QSMA 2Q4YA 1XEBA 4OC0A 5EBVA 5A28A 2ZOGA 3MRUA 2GU2A 3R1KA 4OAEA 2B4DA 4LUAA 3D2MA 4ZY0A 4CYOA 4X3RA 3ZJ0A 2BCOA 2PIYA 3FVLA 2WSAA 4MJ8A 3T8WA 4PV6A 1TXRA 2GFQA 1BPMA 3IEHA 5HVFA 4PXEA 2XEFA 3R9EA 2VZZA 3TO7A 3P2FA 4AVAA 4CGLA 4TNUA 4OC4A 3P2HA 4OIDA 5EMIA 3D4UA 2REFA 3IWEA 2ZEOA 3D68A 4R8FA 2VQYA 3TE4A 4C2XA 2V77A 2BO9A 4K30A 3FRMA 4B5PA 1KUYA 3S9LA 1VKCA 1Z9UA 3PB4X 4ORFA 5HH1A 2YNCC 1CP6A 1LRZA 3QNVA 4NCZA 2CY2A 2CTCA 2ZPAA 2AFXA 2B58A 3PGPA 2HB6A 4CYPA 1A2ZA 2AFZA 4LQ6A 1CG2A 2CTBA 3PFOA 1YLEA 4Q36A 1XMBA 4LQGA 4MY0A 4KOYA 1KZFA 4OC2A 5H86A 2P6FA 4UBRA 1N71A 1YK3A 2ZW4A 4GXHA 1ZLIA 4KLWA 4B14A 1S60A 2Q44A 1Q2YA 2V8DA 8CPAA 5F46A 3FECA 1PYTB 1TKFA 1XE4A 3B7IA 1NE9A 4IK2A 4NGPA 2FT0A 3BHXA 2GANA 1CJWA 3F8KA 4JWPA 4R87A 5AG7A 2JEWA 3GYAA 2PVVA 4JYWA 4A37A 4UCNA 5LYIA 5HMNA 4EFDA 4FAIA 2D4PA 4UFXA 2VBQA 4KSAA 3FEEA 5DWNA 3VWDA 4NGQA 2J9AA 4OLLA 4UFVA 2WUUA 4NXYA 3D66A 3JUWA 2Z3KA 5HVGA 4NF1A 2GREA 2IL4A 4MMOA 3V38A 1P0HA 2PJ6A 1AYEA 2PRBA 4R3LA 4CAWA 3PB6X 4JD6A 1F2OA 3I1UA 3CDXA 3EXNA 4NFRA 2GE3A 4ZBGA 3TX8A 2Z11A 3WABA 4ZI6A 4MXUA 4PSWA 1M4DA 3W6XA 1TKJA 2XEGA 1Q2CA 2OH1A 3B2YA 3FNCA 3KI9A 3R96A 4B10A 5AG5A 5G1ZA 6CPAA 4H89A 4JJXA 4R3KA 4B6ZA 5KTCA 3GY9A 2FCKA 3GUXA 3RZAA 5JH9A 2P6EA 1S7KA 4UEEA 2PJAA 2JEVA 1F2PA 4C2ZA 1XRYA 2P6GA 1M4GA 1MJAA 2ANPA 2PR1A 2ZEHA 1V0CA 3S6KA 5A27A 3WT4A 1YW6A 4R7MA 1JWQA 1PCAA 1RO5A 4KSIA 1YLOA 2R1IA 3EFAA 3NH4A 4K3NA 2Z3NA 3D7FA 3E0KA 4KOSA 4R6TA 1Y9WA 4CGMA 1ARMA 2ATRA 2X7BA 2ODFA 1DTDA 3K9TA 5JPHA 3RO0A 1JQGA 3LACA 2BEIA 2EO8A 4R9MA 1QSTA 2WYRA 3VARA 4UEZA 2R98A 5G20A 4EWTA 1M4LA 3R9FA 2QJ8A 1YMEA 2DF5A 4Q38A 3TT2A 4C7IA 1CPXA 5JQ4A 4UA3A 1Y0RA 1CPSA 4P44A 4YFJA 5JGFA 2PCUA 1HEEA 5JM6A 3SI2A 2OB0A 4XNHC 1CX8A 3DLJA 4OP4A 5AG4A 2GLJA 1XOVA 3F0AA 4P4DA 3NE7A 5F47A 2G9DA 1HDQA 3GLJA 2PJ9A 2Z3LA 3SI0A 4ZY1A 3IWWA 2PVWA 2Q43A 3V7ZA 2EVNA 3W6SA 1S7NA 2B3UA 1CBXA 4C2YA 1F57A 1TF8A 3BI0A 1S5KA 3D7GA 3HLPA 4KZTA 4NJQA 1QSOA 1YVOA 4M6IA 2AJ6A 4YU9A 1R43A 2Z3MA 5THWA 2OU2A 2FIWA 2O53A 1IICA 3F5BA 4AVBA 1EE3P 1YREA 2C6PA 4MFPA 4HNYB 4F8ZA 1VHOA 3IU2A 3KHXA 7CPAA 3R95A 5K8OA 1Y9KA 2ZEDA 1Y7EA 2FS5A 1QQ9A 2ZW7A 1R57A 4OMEA 1PUAA 4YWYA 4CRZB 1OBRA 3TCVA 3QB8A 3PZJA 2VL1A 2Y0MA 1VGYA 4BMHA 4PPZA 3B3WA 4KORA 1TIQA 4NGSA 2V8GA 3IIBA 4P4BA 2G0BA 3SXOA 4YGOA 1S7LA 4AVCA 1CM0A 1NSLA 3PB9X 2ZW6A 3TTHA 4EMEA 1IOIA 1XBUA 3A9LA 5LRKA 1ELMP 1I21A 2AE6A 4P6YA 4CYQA 4KOUA 5HXDA 4UEFA 3RYOA 1XMTA 3FB3A 2F5IA 1P4NA 4RS2A 4XNHB 5AG6A 3LODA 4PQAA 1KUVA 4H2KA 4HKFA 2CIJA 4QUSA 4E2AA 4IHMA 4MI4A 3CT9A 3FMCA 2Q7SA 2JDCA 3TO9A 2QIRA 3FJUA 1IU8A 3CXPA 3D7DA 4IF5A 4CGNA 5C88A 1Z8XA 1YSJA 4KUAA 2FIAA 3CXSA 4FD7A 4UIBA 2NMTA 3EY5A 2ZEMA 4EVYA 2Q4VA 1R3NA 1Y0YA 4M6GA 4PSXA 3NH8A 5KTDA 1X10A 2I79A 4QBJA 2PC1A 1M1DA 3GKRA 2EBJA 4CPAA 2DEAA 4AB7A 4X5KA 2B4BA 4H6ZA 4FD4A 4MFZA 1KWMA 5K8NA 3LD2A 3PEIA 2YNCA 4F0XA 4DNCA 4ZGYB 4F6AA 5H84A 4CAXA 3PB8X 3PBEA 1QMUA 3FH4A 2DPSA 3KASA 5J8CA 4JZ0A 2WZNA 3FX6A 4IUSA 3ZZIA 1YX0A 1NMTA 3B3TA 1K4JA 2CNTA 4MY3A 1UWYA 2PE3A 3V8IA 1FT7A 2QVPA 2QYVA 4U9YA 4HPSA 3B35A 2A4NA 1Z4RA 1Y7RA 2CNSA 2ARHA 5F48A 4NGRA 1VHEA 4ZYQA 1QSRA 1LOKA 4FWUA 3W91A 5KTAA 1IOFA 4B13A 2PIZA 3RBUA 3T90A 4C7HA 2IMOA 3DGVA 5G22A 3WC5A 3FEDA 4P4FA 4BBHA 5GCNA 1FNOA 4MFJA 2OZGA 3IWGA 2GIVA 3NH5A 4P4IA 4ZY2A 4Q7AA 3CZXA 3WC6A 3JRUA 1ARLA 3WC7A 4MCSA 3IO1A 1GYTA 4WJBA 2JBJA 3IFEA 5DS0A 4E8OA 5AGEA 4P45A 4PK2A 2ZEGA 4LX9A 4CAVA 4KSFA 4U9ZA 5ISVA 2I00A 2C6GA 2ZENA 4CAEA 3VH9A 2C6CA 5K8MA 1S7FA 2XEJA 1Z2LA 2H5MA 3FF3A 5EC4A 2OOTA 3SHPA 1NSAA 2B3VA 2YGWA 4MHNA 2ZELA 1CP7A 3I3GA 3KR4A 4NSQA 3KR5A 4AG7A 4B11A 3CPXA 1IYKA 2K5TA 3DNSA 1WK4A 5LYFA 1VHSA 4J3GA 1Z4EA 4HNWB 2IQ6A 2IJZA 3S9MA 1M4IA 1IY7A 4KS9A 3TO6A 4H6UA 4OKOA 3GIUA 3SXNA 4BINA 4DYOA 4P4JA 4IAVA 4KOVA 3EO4A 1GHEA 4UIAA 3K2KA 4QC6A 4R76A 3DDDA 4KVXA 4KOXA 2V8HA 3DR8A 3TFYA 4BD9A 2REEA 3G8WA 2PJ7A 4MHZA 1X12A 2PJ4A 1XJOA 3D7HA 5CPAA 1Q7LA 3BJ7A 1LAMA 3H8EA 4NGNA 2JBKA 3NE8A 4M6HA 4RUHA 2O28A 3FXTA 4L89A 4XPKA 2P0WA 3FIXA 4YRHA 3D67A 3HUVA 3H5ZA 2AFSA 3H8GA 4A95A 4PK3A 2CF4A 2HC9A 1DE4C 2R8VA 3RAMA 4NGMA 1L0CA 2BL1A 2PJ8A 3B3CA 2O4HA 4GM5A 3S6GA 4GS4A 5IB9A 1Z8TA 2FE7A 1ON0A 1SQHA 4PXCA 2C27A 2NYQA 2VI7A 4FBEA 5F09A 4A33A 4MFLA 4KOWA 3MN8A 3S6HA 3LWUA 2RFHA 2BOAA 2EK8A 2VEZA 4L8AA 1M44A 4UFWA 4Y49B 2RC4A 2FXFA 3NA6A 3WR7A 1XF8A 2V8VA 3SJXA 3ISXA 3PP9A 3D2PA 4XPLA 1FY7A 3PB7X 4MFKA 2BSWA 4R57A 2G3AA 4KUBA 4MHPA 4W9YA 1ZO0A 2ABZA 4XPDC 2EK9A 3SJFA 2FVGA 2QMLA 4NGTA 3SJGA 5J8FA 2F8HA 1I12A 2EWBA 1YQEA 4HNXB 5I0CA 5LYLA 3K9UA 4P4EA 3IJ3A 1BLLE 1YR0A 3L2NA 2B4DB 1Z8WA 3KGQA 4ZX8A 4CGOA 2PDOA 3BLNA 3IGRA 4DUKA 2JDDA 5LRGA 4A38A 5I4MA 3TOAA 1MJBA 2PJ5A 4WWVA 3T9YA 2PJ1A 3ISZA 1IIDA 2I3CA 2Q4ZA 1IYLA 3B3VA 2PJBA 1J4JA 1XIXA 4JXRA 5E96A 2B5GA 3BJ8A 1KUXA 3VATA 3KQXA 2FSRA 4FD5A 1HDUA 5IB0A 2D4OA 3R9GA 1BPNA 2BUEA 4JXQA 4KOTA 4MFQA 5G21A 3D3SA 4MHDA 4QB9A 4RN7A 4X2TA 2R7HA 1WWZA 4OADA 3S9NA 2YNDA 2DXQA 4AXVA 4B5PB 1AUGA 3BI1A 4MCPA 2F7VA 3IU1A 4E0AA 5CBMA 3KZWA 1UFHA 3G3SA 3IC1A 2WPXA 3MGDA 2ZEPA 2B5GB 4TWEA 3KHZA 2OZUA 3PBBA 3VWEA 1YVKA 4KVOE 1YW4A 5CNPA 4KVME 2RB7A 4ONUA 1XFOA 4II9A 2NSMA 2WPWA 3FYNA 3OWCA 2ZXVA 3SJEA 3TC8A 4NJRA 4OIWA 1PU9A 1ZG8A 4JLYA 1ELLP 4KLVA 1YGHA 1Q2DA 2PJCA 4QVTA 2YNEA 1AMPA 4MCRA 1IB1E 4AG9A 2G3TA 3I9SA 2PJ2A 4A30A 4CS0B 2PQ8A 2AFMA 2Q0YA 2ZOFA 3H4QA 3JTKA 4XPDB 2VXKA 3KQZA 1RTQA 5IX3A 1ZG7A 1OZPA 4PXDA 3EC4A 1B87A 1LFWA 4UF4A 2FL4A 5J1QA 3N7ZA 1ZLHA 5D29A 2OR4A 4DJLA 3UY5A 4UWJA 2AFUA 4MBUA 3S6FA 4A2ZA 5F49A 1IGBA 4Y49C 4OC1A 4A39A 1B6BA 1BOBA 1Z5RA 2PR8A 3PRTA 4OC5A 4C68A 3QAHA 4I49A 2PJ3A 5DWMA 2Z10A 5FVJA 4F0YA 1I1DA 5HVHA 2HUZA 2Q04A 4CYNA 1BAVA 5BWAB 3DSBA 4CGPA 4A32A 4B12A 4ZX9A 3QAYA 5LRJA 3N5FA 2EUIA 4G1PA
chains in the Genus database with same CATH topology
4UCMA 3DR6A 2CXAA 2HV2A 2ZW5A 4RI1A 4CAFA 3C26A 2DPTA 4M85A 2CNMA 3TOBA 4CRYB 4FD6A 2Q7BA 2Z3PA 3B8GA 2HQYA 2PSWA 2Z3OA 1MJ9A 2QECA 3FBUA 2J8RA 2VZYA 1QSNA 4UCPA 1S3ZA 4UWIA 5IV0A 1BO4A 2KCWA 1U6MA 4A31A 4U5YA 1MK4A 3JVNA 1RXTA 4NEXA 2JLMA 3KKWA 5C82A 4B5OA 2J8MA 2J8NA 3D8PA 2OZHA 2Z0ZA 3CXQA 4M3SA 1QSMA 2Q4YA 5EBVA 1XEBA 5A28A 3R1KA 4OAEA 2B4DA 4LUAA 3D2MA 4CYOA 3ZJ0A 2WSAA 4MJ8A 4PV6A 3R9EA 3TO7A 2VZZA 3P2FA 4AVAA 4CGLA 3P2HA 2REFA 3IWEA 2VQYA 3TE4A 4C2XA 4K30A 3FRMA 4B5PA 1KUYA 1VKCA 1Z9UA 4ORFA 5HH1A 2YNCC 1LRZA 4NCZA 2CY2A 2ZPAA 2B58A 3PGPA 4CYPA 1YLEA 4Q36A 4MY0A 4KOYA 1KZFA 5H86A 2P6FA 4UBRA 1N71A 1YK3A 2ZW4A 4KLWA 4B14A 5F46A 1S60A 2Q44A 1Q2YA 1XE4A 1NE9A 2FT0A 4JWPA 2GANA 1CJWA 3F8KA 4R87A 5AG7A 3GYAA 4UCNA 5HMNA 2D4PA 4UFXA 2VBQA 4KSAA 3VWDA 5DWNA 4OLLA 4UFVA 2WUUA 4NXYA 3JUWA 2Z3KA 4NF1A 2IL4A 1P0HA 2PRBA 4R3LA 4CAWA 4JD6A 3EXNA 2GE3A 4ZBGA 2Z11A 4PSWA 1M4DA 3W6XA 3FNCA 1Q2CA 2OH1A 3R96A 4B10A 5AG5A 5G1ZA 4H89A 4JJXA 4R3KA 5KTCA 3GY9A 2FCKA 2P6EA 1S7KA 2JEVA 4C2ZA 2P6GA 1M4GA 1MJAA 2PR1A 5A27A 1V0CA 3S6KA 1RO5A 2R1IA 3EFAA 2Z3NA 3E0KA 4KOSA 1Y9WA 4CGMA 2ATRA 2X7BA 5JPHA 2BEIA 4R9MA 1QSTA 2R98A 5G20A 3R9FA 4Q38A 3TT2A 4C7IA 5JQ4A 4UA3A 4YFJA 2OB0A 4XNHC 5AG4A 3F0AA 3NE7A 5F47A 2Z3LA 2EVNA 3W6SA 1S7NA 2B3UA 4C2YA 1S5KA 4KZTA 1QSOA 1YVOA 2AJ6A 2Z3MA 2OU2A 2FIWA 3F5BA 1IICA 4AVBA 1YREA 4MFPA 4HNYB 3IU2A 3R95A 1Y9KA 2FS5A 2ZW7A 1R57A 1PUAA 4CRZB 3TCVA 3QB8A 3PZJA 2Y0MA 4BMHA 4KORA 1TIQA 3SXOA 2G0BA 4YGOA 1S7LA 4AVCA 1CM0A 1NSLA 2ZW6A 3TTHA 3A9LA 1I21A 2AE6A 4CYQA 4KOUA 3RYOA 1XMTA 3FB3A 2F5IA 1P4NA 4RS2A 4XNHB 5AG6A 3LODA 1KUVA 4HKFA 4QUSA 4E2AA 4MI4A 2JDCA 3TO9A 2QIRA 3CXPA 4IF5A 4CGNA 5C88A 4KUAA 2FIAA 3CXSA 4FD7A 2NMTA 3EY5A 4EVYA 2Q4VA 4PSXA 5KTDA 2I79A 4QBJA 2PC1A 1M1DA 3GKRA 4AB7A 4X5KA 2B4BA 4H6ZA 4FD4A 4MFZA 3LD2A 2YNCA 4F0XA 4DNCA 4ZGYB 4F6AA 5H84A 4CAXA 2DPSA 5J8CA 4IUSA 3ZZIA 1YX0A 1NMTA 4MY3A 1K4JA 2CNTA 3V8IA 4U9YA 2A4NA 1Z4RA 1Y7RA 2CNSA 2ARHA 5F48A 1QSRA 3W91A 5KTAA 4B13A 3T90A 4C7HA 5G22A 4BBHA 5GCNA 4MFJA 2OZGA 3IWGA 2GIVA 4E8OA 5AGEA 4PK2A 4LX9A 4CAVA 4KSFA 4U9ZA 5ISVA 2I00A 4CAEA 1S7FA 2H5MA 5EC4A 3SHPA 2B3VA 2YGWA 4NSQA 4AG7A 3I3GA 4B11A 1IYKA 2K5TA 3DNSA 1WK4A 1VHSA 4J3GA 1Z4EA 4HNWB 1M4IA 4KS9A 3TO6A 4H6UA 3SXNA 4KOVA 3EO4A 1GHEA 4QC6A 3DDDA 4KVXA 4KOXA 3TFYA 3DR8A 2REEA 3G8WA 3BJ7A 2O28A 3FXTA 4L89A 4XPKA 2P0WA 3FIXA 4YRHA 3H5ZA 4A95A 4PK3A 2R8VA 1L0CA 2BL1A 3S6GA 4GS4A 2FE7A 1ON0A 1SQHA 2C27A 2VI7A 4A33A 4MFLA 4KOWA 3S6HA 2VEZA 4L8AA 4UFWA 3WR7A 1M44A 4Y49B 2RC4A 2FXFA 1XF8A 3PP9A 3D2PA 4XPLA 1FY7A 4MFKA 2BSWA 4R57A 2G3AA 4KUBA 1ZO0A 4XPDC 2QMLA 5J8FA 1I12A 4HNXB 5I0CA 3K9UA 1YR0A 2B4DB 4CGOA 2PDOA 3BLNA 3IGRA 2JDDA 3TOAA 1MJBA 3T9YA 1IIDA 1IYLA 1J4JA 1XIXA 4JXRA 5E96A 2B5GA 3BJ8A 1KUXA 2FSRA 4FD5A 5IB0A 2D4OA 3R9GA 2BUEA 4JXQA 4KOTA 4MFQA 5G21A 3D3SA 4MHDA 4QB9A 2R7HA 1WWZA 4OADA 2YNDA 2DXQA 4B5PB 3IU1A 4E0AA 1UFHA 3G3SA 2WPXA 3MGDA 2B5GB 2OZUA 3VWEA 1YVKA 4KVOE 5CNPA 4KVME 4ONUA 4II9A 2WPWA 3FYNA 3OWCA 2ZXVA 1PU9A 4JLYA 4KLVA 1YGHA 1Q2DA 4QVTA 2YNEA 1IB1E 4AG9A 2G3TA 3I9SA 4A30A 4CS0B 2PQ8A 2Q0YA 3H4QA 3JTKA 4XPDB 2VXKA 5IX3A 1OZPA 3EC4A 1B87A 2FL4A 3N7ZA 3UY5A 4UWJA 4MBUA 3S6FA 4A2ZA 5F49A 4Y49C 1BOBA 1B6BA 2PR8A 4C68A 3QAHA 4I49A 5DWMA 2Z10A 5FVJA 4F0YA 1I1DA 2HUZA 2Q04A 4CYNA 5BWAB 3DSBA 4CGPA 4A32A 4B12A 2EUIA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3DR6 A;  2HV2 A;  2ZW5 A;  4RI1 A;  3C26 A;  4M85 A;  2CNM A;  3TOB A;  4CRY B;  4FD6 A;  2Q7B A;  3B8G A;  2HQY A;  2PSW A;  1MJ9 A;  2QEC A;  3FBU A;  2J8R A;  2VZY A;  1QSN A;  1S3Z A;  4UWI A;  5IV0 A;  1BO4 A;  2KCW A;  1U6M A;  4U5Y A;  1MK4 A;  3JVN A;  1RXT A;  4NEX A;  2JLM A;  3KKW A;  5C82 A;  4B5O A;  2J8M A;  2J8N A;  3D8P A;  2OZH A;  2Z0Z A;  3CXQ A;  4M3S A;  1QSM A;  2Q4Y A;  5EBV A;  1XEB A;  3R1K A;  4OAE A;  2B4D A;  4LUA A;  3D2M A;  3ZJ0 A;  4MJ8 A;  4PV6 A;  3R9E A;  3TO7 A;  2VZZ A;  3P2F A;  4AVA A;  3P2H A;  2REF A;  2VQY A;  3TE4 A;  4K30 A;  3FRM A;  4B5P A;  1KUY A;  1VKC A;  1Z9U A;  4ORF A;  5HH1 A;  1LRZ A;  4NCZ A;  2CY2 A;  2ZPA A;  2B58 A;  3PGP A;  1YLE A;  4MY0 A;  4KOY A;  1KZF A;  5H86 A;  2P6F A;  4UBR A;  4KLW A;  1N71 A;  1YK3 A;  2ZW4 A;  5F46 A;  1S60 A;  2Q44 A;  1Q2Y A;  1XE4 A;  1NE9 A;  2FT0 A;  4JWP A;  2GAN A;  1CJW A;  3F8K A;  4R87 A;  3GYA A;  5HMN A;  2D4P A;  2VBQ A;  3VWD A;  5DWN A;  4OLL A;  4NXY A;  3JUW A;  4NF1 A;  2IL4 A;  1P0H A;  2PRB A;  4R3L A;  4CAW A;  4JD6 A;  3EXN A;  2GE3 A;  4ZBG A;  2Z11 A;  4PSW A;  1M4D A;  3W6X A;  3FNC A;  1Q2C A;  2OH1 A;  3R96 A;  4H89 A;  4JJX A;  4R3K A;  5KTC A;  3GY9 A;  2FCK A;  2P6E A;  1S7K A;  2JEV A;  2P6G A;  1M4G A;  1MJA A;  2PR1 A;  1V0C A;  3S6K A;  1RO5 A;  2R1I A;  3EFA A;  3E0K A;  4KOS A;  1Y9W A;  2ATR A;  2X7B A;  5JPH A;  2BEI A;  4R9M A;  1QST A;  2R98 A;  3R9F A;  3TT2 A;  5JQ4 A;  4UA3 A;  4YFJ A;  2OB0 A;  4XNH C;  3F0A A;  3NE7 A;  5F47 A;  2EVN A;  3W6S A;  1S7N A;  2B3U A;  1S5K A;  4KZT A;  1QSO A;  1YVO A;  2AJ6 A;  2OU2 A;  2FIW A;  3F5B A;  1IIC A;  4AVB A;  1YRE A;  4HNY B;  3R95 A;  1Y9K A;  2FS5 A;  2ZW7 A;  1R57 A;  1PUA A;  4CRZ B;  3TCV A;  3QB8 A;  3PZJ A;  2Y0M A;  4BMH A;  4KOR A;  1TIQ A;  3SXO A;  2G0B A;  4YGO A;  1S7L A;  4AVC A;  1CM0 A;  1NSL A;  2ZW6 A;  3TTH A;  1I21 A;  2AE6 A;  4KOU A;  3RYO A;  1XMT A;  3FB3 A;  2F5I A;  1P4N A;  4RS2 A;  4XNH B;  3LOD A;  1KUV A;  4HKF A;  4QUS A;  4E2A A;  4MI4 A;  2JDC A;  3TO9 A;  2QIR A;  3CXP A;  4IF5 A;  5C88 A;  4KUA A;  2FIA A;  3CXS A;  4FD7 A;  2NMT A;  3EY5 A;  4EVY A;  2Q4V A;  4PSX A;  5KTD A;  2I79 A;  4QBJ A;  2PC1 A;  1M1D A;  3GKR A;  4AB7 A;  4X5K A;  2B4B A;  4H6Z A;  4FD4 A;  3LD2 A;  4DNC A;  4F6A A;  5H84 A;  4CAX A;  5J8C A;  4IUS A;  3ZZI A;  1YX0 A;  1NMT A;  4MY3 A;  1K4J A;  2CNT A;  3V8I A;  4U9Y A;  2A4N A;  1Z4R A;  1Y7R A;  2CNS A;  2ARH A;  5F48 A;  1QSR A;  3W91 A;  5KTA A;  3T90 A;  5GCN A;  2OZG A;  3IWG A;  2GIV A;  4E8O A;  4PK2 A;  4LX9 A;  4CAV A;  5ISV A;  4U9Z A;  2I00 A;  1S7F A;  2H5M A;  5EC4 A;  3SHP A;  2B3V A;  4NSQ A;  4AG7 A;  3I3G A;  1IYK A;  2K5T A;  3DNS A;  1WK4 A;  1VHS A;  4J3G A;  1Z4E A;  4HNW B;  1M4I A;  3TO6 A;  4H6U A;  3SXN A;  4KOV A;  3EO4 A;  1GHE A;  4QC6 A;  3DDD A;  4KVX A;  4KOX A;  3TFY A;  3DR8 A;  2REE A;  3G8W A;  3BJ7 A;  2O28 A;  3FXT A;  4L89 A;  4XPK A;  2P0W A;  3FIX A;  4YRH A;  4PK3 A;  2R8V A;  1L0C A;  2BL1 A;  3S6G A;  4GS4 A;  2FE7 A;  1ON0 A;  1SQH A;  2C27 A;  2VI7 A;  4KOW A;  3S6H A;  2VEZ A;  4L8A A;  3WR7 A;  1M44 A;  4Y49 B;  2RC4 A;  2FXF A;  1XF8 A;  3PP9 A;  3D2P A;  4XPL A;  1FY7 A;  2BSW A;  4R57 A;  2G3A A;  4KUB A;  4XPD C;  2QML A;  5J8F A;  1I12 A;  4HNX B;  5I0C A;  3K9U A;  1YR0 A;  2B4D B;  2PDO A;  3BLN A;  3IGR A;  2JDD A;  3TOA A;  1MJB A;  3T9Y A;  1IID A;  1IYL A;  1J4J A;  1XIX A;  4JXR A;  5E96 A;  2B5G A;  3BJ8 A;  1KUX A;  2FSR A;  4FD5 A;  5IB0 A;  2D4O A;  3R9G A;  2BUE A;  4JXQ A;  4KOT A;  3D3S A;  4MHD A;  4QB9 A;  2R7H A;  1WWZ A;  4OAD A;  2DXQ A;  4B5P B;  4E0A A;  1UFH A;  3G3S A;  2WPX A;  3MGD A;  2B5G B;  2OZU A;  3VWE A;  1YVK A;  4KVO E;  5CNP A;  4KVM E;  4ONU A;  4II9 A;  2WPW A;  3FYN A;  3OWC A;  2ZXV A;  1PU9 A;  4JLY A;  4KLV A;  1YGH A;  1Q2D A;  4QVT A;  1IB1 E;  4AG9 A;  2G3T A;  3I9S A;  4CS0 B;  2PQ8 A;  2Q0Y A;  3H4Q A;  4XPD B;  2VXK A;  5IX3 A;  1OZP A;  3EC4 A;  1B87 A;  2FL4 A;  3N7Z A;  3UY5 A;  4UWJ A;  4MBU A;  3S6F A;  5F49 A;  4Y49 C;  1BOB A;  1B6B A;  2PR8 A;  3QAH A;  4I49 A;  5DWM A;  2Z10 A;  5FVJ A;  4F0Y A;  1I1D A;  2HUZ A;  2Q04 A;  3DSB A;  2EUI A; 
#chains in the Genus database with same CATH topology
 4UCM A;  3DR6 A;  4F9U A;  2CXA A;  5LYD A;  1TKH A;  2C1C A;  2HV2 A;  2Q51 A;  2ZW5 A;  3CPA A;  4RI1 A;  1Z8L A;  2PJ0 A;  3B3S A;  3PFE A;  2PRQ A;  4CAF A;  2XEI A;  3C26 A;  4F9V A;  2DPT A;  4M85 A;  4Z65 A;  4OC3 A;  1ZG9 A;  2CNM A;  4O23 A;  3TOB A;  4CRY B;  2AFW A;  4FD6 A;  3H8F A;  3KL9 A;  2Q7B A;  3BXM A;  2Z3P A;  3B8G A;  1LAN A;  2HQY A;  2PSW A;  2Z3O A;  1LAP A;  1MJ9 A;  4MHY A;  2QEC A;  3FBU A;  4PXB A;  2J8R A;  4A94 A;  1H8L A;  5D8N A;  2VZY A;  1QSN A;  1VIX A;  2POK A;  2ZEE A;  2ZEF A;  4UCP A;  2GLF A;  1S3Z A;  3LMS A;  4UWI A;  5IV0 A;  5K8P A;  1BO4 A;  2AFO A;  2KCW A;  1U6M A;  4A31 A;  4U5Y A;  1MK4 A;  3JVN A;  3RNZ A;  4X8I A;  4P10 A;  5ELY A;  3SI1 A;  1RXT A;  4NEX A;  2JLM A;  4MRI A;  3KKW A;  5C82 A;  4B5O A;  4FUU A;  2J8M A;  2J8N A;  3D8P A;  4MCQ A;  2OZH A;  2Z0Z A;  3CXQ A;  3NFZ A;  4ONW A;  3GB0 A;  4M3S A;  1TF9 A;  1LCP A;  1QSM A;  2Q4Y A;  1XEB A;  4OC0 A;  5EBV A;  5A28 A;  2ZOG A;  3MRU A;  2GU2 A;  3R1K A;  4OAE A;  2B4D A;  4LUA A;  3D2M A;  4ZY0 A;  4CYO A;  4X3R A;  3ZJ0 A;  2BCO A;  2PIY A;  3FVL A;  2WSA A;  4MJ8 A;  3T8W A;  4PV6 A;  1TXR A;  2GFQ A;  1BPM A;  3IEH A;  5HVF A;  4PXE A;  2XEF A;  3R9E A;  2VZZ A;  3TO7 A;  3P2F A;  4AVA A;  4CGL A;  4TNU A;  4OC4 A;  3P2H A;  4OID A;  5EMI A;  3D4U A;  2REF A;  3IWE A;  2ZEO A;  3D68 A;  4R8F A;  2VQY A;  3TE4 A;  4C2X A;  2V77 A;  2BO9 A;  4K30 A;  3FRM A;  4B5P A;  1KUY A;  3S9L A;  1VKC A;  1Z9U A;  3PB4 X;  4ORF A;  5HH1 A;  2YNC C;  1CP6 A;  1LRZ A;  3QNV A;  4NCZ A;  2CY2 A;  2CTC A;  2ZPA A;  2AFX A;  2B58 A;  3PGP A;  2HB6 A;  4CYP A;  1A2Z A;  2AFZ A;  4LQ6 A;  1CG2 A;  2CTB A;  3PFO A;  1YLE A;  4Q36 A;  1XMB A;  4LQG A;  4MY0 A;  4KOY A;  1KZF A;  4OC2 A;  5H86 A;  2P6F A;  4UBR A;  1N71 A;  1YK3 A;  2ZW4 A;  4GXH A;  1ZLI A;  4KLW A;  4B14 A;  1S60 A;  2Q44 A;  1Q2Y A;  2V8D A;  8CPA A;  5F46 A;  3FEC A;  1PYT B;  1TKF A;  1XE4 A;  3B7I A;  1NE9 A;  4IK2 A;  4NGP A;  2FT0 A;  3BHX A;  2GAN A;  1CJW A;  3F8K A;  4JWP A;  4R87 A;  5AG7 A;  2JEW A;  3GYA A;  2PVV A;  4JYW A;  4A37 A;  4UCN A;  5LYI A;  5HMN A;  4EFD A;  4FAI A;  2D4P A;  4UFX A;  2VBQ A;  4KSA A;  3FEE A;  5DWN A;  3VWD A;  4NGQ A;  2J9A A;  4OLL A;  4UFV A;  2WUU A;  4NXY A;  3D66 A;  3JUW A;  2Z3K A;  5HVG A;  4NF1 A;  2GRE A;  2IL4 A;  4MMO A;  3V38 A;  1P0H A;  2PJ6 A;  1AYE A;  2PRB A;  4R3L A;  4CAW A;  3PB6 X;  4JD6 A;  1F2O A;  3I1U A;  3CDX A;  3EXN A;  4NFR A;  2GE3 A;  4ZBG A;  3TX8 A;  2Z11 A;  3WAB A;  4ZI6 A;  4MXU A;  4PSW A;  1M4D A;  3W6X A;  1TKJ A;  2XEG A;  1Q2C A;  2OH1 A;  3B2Y A;  3FNC A;  3KI9 A;  3R96 A;  4B10 A;  5AG5 A;  5G1Z A;  6CPA A;  4H89 A;  4JJX A;  4R3K A;  4B6Z A;  5KTC A;  3GY9 A;  2FCK A;  3GUX A;  3RZA A;  5JH9 A;  2P6E A;  1S7K A;  4UEE A;  2PJA A;  2JEV A;  1F2P A;  4C2Z A;  1XRY A;  2P6G A;  1M4G A;  1MJA A;  2ANP A;  2PR1 A;  2ZEH A;  1V0C A;  3S6K A;  5A27 A;  3WT4 A;  1YW6 A;  4R7M A;  1JWQ A;  1PCA A;  1RO5 A;  4KSI A;  1YLO A;  2R1I A;  3EFA A;  3NH4 A;  4K3N A;  2Z3N A;  3D7F A;  3E0K A;  4KOS A;  4R6T A;  1Y9W A;  4CGM A;  1ARM A;  2ATR A;  2X7B A;  2ODF A;  1DTD A;  3K9T A;  5JPH A;  3RO0 A;  1JQG A;  3LAC A;  2BEI A;  2EO8 A;  4R9M A;  1QST A;  2WYR A;  3VAR A;  4UEZ A;  2R98 A;  5G20 A;  4EWT A;  1M4L A;  3R9F A;  2QJ8 A;  1YME A;  2DF5 A;  4Q38 A;  3TT2 A;  4C7I A;  1CPX A;  5JQ4 A;  4UA3 A;  1Y0R A;  1CPS A;  4P44 A;  4YFJ A;  5JGF A;  2PCU A;  1HEE A;  5JM6 A;  3SI2 A;  2OB0 A;  4XNH C;  1CX8 A;  3DLJ A;  4OP4 A;  5AG4 A;  2GLJ A;  1XOV A;  3F0A A;  4P4D A;  3NE7 A;  5F47 A;  2G9D A;  1HDQ A;  3GLJ A;  2PJ9 A;  2Z3L A;  3SI0 A;  4ZY1 A;  3IWW A;  2PVW A;  2Q43 A;  3V7Z A;  2EVN A;  3W6S A;  1S7N A;  2B3U A;  1CBX A;  4C2Y A;  1F57 A;  1TF8 A;  3BI0 A;  1S5K A;  3D7G A;  3HLP A;  4KZT A;  4NJQ A;  1QSO A;  1YVO A;  4M6I A;  2AJ6 A;  4YU9 A;  1R43 A;  2Z3M A;  5THW A;  2OU2 A;  2FIW A;  2O53 A;  1IIC A;  3F5B A;  4AVB A;  1EE3 P;  1YRE A;  2C6P A;  4MFP A;  4HNY B;  4F8Z A;  1VHO A;  3IU2 A;  3KHX A;  7CPA A;  3R95 A;  5K8O A;  1Y9K A;  2ZED A;  1Y7E A;  2FS5 A;  1QQ9 A;  2ZW7 A;  1R57 A;  4OME A;  1PUA A;  4YWY A;  4CRZ B;  1OBR A;  3TCV A;  3QB8 A;  3PZJ A;  2VL1 A;  2Y0M A;  1VGY A;  4BMH A;  4PPZ A;  3B3W A;  4KOR A;  1TIQ A;  4NGS A;  2V8G A;  3IIB A;  4P4B A;  2G0B A;  3SXO A;  4YGO A;  1S7L A;  4AVC A;  1CM0 A;  1NSL A;  3PB9 X;  2ZW6 A;  3TTH A;  4EME A;  1IOI A;  1XBU A;  3A9L A;  5LRK A;  1ELM P;  1I21 A;  2AE6 A;  4P6Y A;  4CYQ A;  4KOU A;  5HXD A;  4UEF A;  3RYO A;  1XMT A;  3FB3 A;  2F5I A;  1P4N A;  4RS2 A;  4XNH B;  5AG6 A;  3LOD A;  4PQA A;  1KUV A;  4H2K A;  4HKF A;  2CIJ A;  4QUS A;  4E2A A;  4IHM A;  4MI4 A;  3CT9 A;  3FMC A;  2Q7S A;  2JDC A;  3TO9 A;  2QIR A;  3FJU A;  1IU8 A;  3CXP A;  3D7D A;  4IF5 A;  4CGN A;  5C88 A;  1Z8X A;  1YSJ A;  4KUA A;  2FIA A;  3CXS A;  4FD7 A;  4UIB A;  2NMT A;  3EY5 A;  2ZEM A;  4EVY A;  2Q4V A;  1R3N A;  1Y0Y A;  4M6G A;  4PSX A;  3NH8 A;  5KTD A;  1X10 A;  2I79 A;  4QBJ A;  2PC1 A;  1M1D A;  3GKR A;  2EBJ A;  4CPA A;  2DEA A;  4AB7 A;  4X5K A;  2B4B A;  4H6Z A;  4FD4 A;  4MFZ A;  1KWM A;  5K8N A;  3LD2 A;  3PEI A;  2YNC A;  4F0X A;  4DNC A;  4ZGY B;  4F6A A;  5H84 A;  4CAX A;  3PB8 X;  3PBE A;  1QMU A;  3FH4 A;  2DPS A;  3KAS A;  5J8C A;  4JZ0 A;  2WZN A;  3FX6 A;  4IUS A;  3ZZI A;  1YX0 A;  1NMT A;  3B3T A;  1K4J A;  2CNT A;  4MY3 A;  1UWY A;  2PE3 A;  3V8I A;  1FT7 A;  2QVP A;  2QYV A;  4U9Y A;  4HPS A;  3B35 A;  2A4N A;  1Z4R A;  1Y7R A;  2CNS A;  2ARH A;  5F48 A;  4NGR A;  1VHE A;  4ZYQ A;  1QSR A;  1LOK A;  4FWU A;  3W91 A;  5KTA A;  1IOF A;  4B13 A;  2PIZ A;  3RBU A;  3T90 A;  4C7H A;  2IMO A;  3DGV A;  5G22 A;  3WC5 A;  3FED A;  4P4F A;  4BBH A;  5GCN A;  1FNO A;  4MFJ A;  2OZG A;  3IWG A;  2GIV A;  3NH5 A;  4P4I A;  4ZY2 A;  4Q7A A;  3CZX A;  3WC6 A;  3JRU A;  1ARL A;  3WC7 A;  4MCS A;  3IO1 A;  1GYT A;  4WJB A;  2JBJ A;  3IFE A;  5DS0 A;  4E8O A;  5AGE A;  4P45 A;  4PK2 A;  2ZEG A;  4LX9 A;  4CAV A;  4KSF A;  4U9Z A;  5ISV A;  2I00 A;  2C6G A;  2ZEN A;  4CAE A;  3VH9 A;  2C6C A;  5K8M A;  1S7F A;  2XEJ A;  1Z2L A;  2H5M A;  3FF3 A;  5EC4 A;  2OOT A;  3SHP A;  1NSA A;  2B3V A;  2YGW A;  4MHN A;  2ZEL A;  1CP7 A;  3I3G A;  3KR4 A;  4NSQ A;  3KR5 A;  4AG7 A;  4B11 A;  3CPX A;  1IYK A;  2K5T A;  3DNS A;  1WK4 A;  5LYF A;  1VHS A;  4J3G A;  1Z4E A;  4HNW B;  2IQ6 A;  2IJZ A;  3S9M A;  1M4I A;  1IY7 A;  4KS9 A;  3TO6 A;  4H6U A;  4OKO A;  3GIU A;  3SXN A;  4BIN A;  4DYO A;  4P4J A;  4IAV A;  4KOV A;  3EO4 A;  1GHE A;  4UIA A;  3K2K A;  4QC6 A;  4R76 A;  3DDD A;  4KVX A;  4KOX A;  2V8H A;  3DR8 A;  3TFY A;  4BD9 A;  2REE A;  3G8W A;  2PJ7 A;  4MHZ A;  1X12 A;  2PJ4 A;  1XJO A;  3D7H A;  5CPA A;  1Q7L A;  3BJ7 A;  1LAM A;  3H8E A;  4NGN A;  2JBK A;  3NE8 A;  4M6H A;  4RUH A;  2O28 A;  3FXT A;  4L89 A;  4XPK A;  2P0W A;  3FIX A;  4YRH A;  3D67 A;  3HUV A;  3H5Z A;  2AFS A;  3H8G A;  4A95 A;  4PK3 A;  2CF4 A;  2HC9 A;  1DE4 C;  2R8V A;  3RAM A;  4NGM A;  1L0C A;  2BL1 A;  2PJ8 A;  3B3C A;  2O4H A;  4GM5 A;  3S6G A;  4GS4 A;  5IB9 A;  1Z8T A;  2FE7 A;  1ON0 A;  1SQH A;  4PXC A;  2C27 A;  2NYQ A;  2VI7 A;  4FBE A;  5F09 A;  4A33 A;  4MFL A;  4KOW A;  3MN8 A;  3S6H A;  3LWU A;  2RFH A;  2BOA A;  2EK8 A;  2VEZ A;  4L8A A;  1M44 A;  4UFW A;  4Y49 B;  2RC4 A;  2FXF A;  3NA6 A;  3WR7 A;  1XF8 A;  2V8V A;  3SJX A;  3ISX A;  3PP9 A;  3D2P A;  4XPL A;  1FY7 A;  3PB7 X;  4MFK A;  2BSW A;  4R57 A;  2G3A A;  4KUB A;  4MHP A;  4W9Y A;  1ZO0 A;  2ABZ A;  4XPD C;  2EK9 A;  3SJF A;  2FVG A;  2QML A;  4NGT A;  3SJG A;  5J8F A;  2F8H A;  1I12 A;  2EWB A;  1YQE A;  4HNX B;  5I0C A;  5LYL A;  3K9U A;  4P4E A;  3IJ3 A;  1BLL E;  1YR0 A;  3L2N A;  2B4D B;  1Z8W A;  3KGQ A;  4ZX8 A;  4CGO A;  2PDO A;  3BLN A;  3IGR A;  4DUK A;  2JDD A;  5LRG A;  4A38 A;  5I4M A;  3TOA A;  1MJB A;  2PJ5 A;  4WWV A;  3T9Y A;  2PJ1 A;  3ISZ A;  1IID A;  2I3C A;  2Q4Z A;  1IYL A;  3B3V A;  2PJB A;  1J4J A;  1XIX A;  4JXR A;  5E96 A;  2B5G A;  3BJ8 A;  1KUX A;  3VAT A;  3KQX A;  2FSR A;  4FD5 A;  1HDU A;  5IB0 A;  2D4O A;  3R9G A;  1BPN A;  2BUE A;  4JXQ A;  4KOT A;  4MFQ A;  5G21 A;  3D3S A;  4MHD A;  4QB9 A;  4RN7 A;  4X2T A;  2R7H A;  1WWZ A;  4OAD A;  3S9N A;  2YND A;  2DXQ A;  4AXV A;  4B5P B;  1AUG A;  3BI1 A;  4MCP A;  2F7V A;  3IU1 A;  4E0A A;  5CBM A;  3KZW A;  1UFH A;  3G3S A;  3IC1 A;  2WPX A;  3MGD A;  2ZEP A;  2B5G B;  4TWE A;  3KHZ A;  2OZU A;  3PBB A;  3VWE A;  1YVK A;  4KVO E;  1YW4 A;  5CNP A;  4KVM E;  2RB7 A;  4ONU A;  1XFO A;  4II9 A;  2NSM A;  2WPW A;  3FYN A;  3OWC A;  2ZXV A;  3SJE A;  3TC8 A;  4NJR A;  4OIW A;  1PU9 A;  1ZG8 A;  4JLY A;  1ELL P;  4KLV A;  1YGH A;  1Q2D A;  2PJC A;  4QVT A;  2YNE A;  1AMP A;  4MCR A;  1IB1 E;  4AG9 A;  2G3T A;  3I9S A;  2PJ2 A;  4A30 A;  4CS0 B;  2PQ8 A;  2AFM A;  2Q0Y A;  2ZOF A;  3H4Q A;  3JTK A;  4XPD B;  2VXK A;  3KQZ A;  1RTQ A;  5IX3 A;  1ZG7 A;  1OZP A;  4PXD A;  3EC4 A;  1B87 A;  1LFW A;  4UF4 A;  2FL4 A;  5J1Q A;  3N7Z A;  1ZLH A;  5D29 A;  2OR4 A;  4DJL A;  3UY5 A;  4UWJ A;  2AFU A;  4MBU A;  3S6F A;  4A2Z A;  5F49 A;  1IGB A;  4Y49 C;  4OC1 A;  4A39 A;  1B6B A;  1BOB A;  1Z5R A;  2PR8 A;  3PRT A;  4OC5 A;  4C68 A;  3QAH A;  4I49 A;  2PJ3 A;  5DWM A;  2Z10 A;  5FVJ A;  4F0Y A;  1I1D A;  5HVH A;  2HUZ A;  2Q04 A;  4CYN A;  1BAV A;  5BWA B;  3DSB A;  4CGP A;  4A32 A;  4B12 A;  4ZX9 A;  3QAY A;  5LRJ A;  3N5F A;  2EUI A;  4G1P A; 
#chains in the Genus database with same CATH homology
 4UCM A;  3DR6 A;  2CXA A;  2HV2 A;  2ZW5 A;  4RI1 A;  4CAF A;  3C26 A;  2DPT A;  4M85 A;  2CNM A;  3TOB A;  4CRY B;  4FD6 A;  2Q7B A;  2Z3P A;  3B8G A;  2HQY A;  2PSW A;  2Z3O A;  1MJ9 A;  2QEC A;  3FBU A;  2J8R A;  2VZY A;  1QSN A;  4UCP A;  1S3Z A;  4UWI A;  5IV0 A;  1BO4 A;  2KCW A;  1U6M A;  4A31 A;  4U5Y A;  1MK4 A;  3JVN A;  1RXT A;  4NEX A;  2JLM A;  3KKW A;  5C82 A;  4B5O A;  2J8M A;  2J8N A;  3D8P A;  2OZH A;  2Z0Z A;  3CXQ A;  4M3S A;  1QSM A;  2Q4Y A;  5EBV A;  1XEB A;  5A28 A;  3R1K A;  4OAE A;  2B4D A;  4LUA A;  3D2M A;  4CYO A;  3ZJ0 A;  2WSA A;  4MJ8 A;  4PV6 A;  3R9E A;  3TO7 A;  2VZZ A;  3P2F A;  4AVA A;  4CGL A;  3P2H A;  2REF A;  3IWE A;  2VQY A;  3TE4 A;  4C2X A;  4K30 A;  3FRM A;  4B5P A;  1KUY A;  1VKC A;  1Z9U A;  4ORF A;  5HH1 A;  2YNC C;  1LRZ A;  4NCZ A;  2CY2 A;  2ZPA A;  2B58 A;  3PGP A;  4CYP A;  1YLE A;  4Q36 A;  4MY0 A;  4KOY A;  1KZF A;  5H86 A;  2P6F A;  4UBR A;  1N71 A;  1YK3 A;  2ZW4 A;  4KLW A;  4B14 A;  5F46 A;  1S60 A;  2Q44 A;  1Q2Y A;  1XE4 A;  1NE9 A;  2FT0 A;  4JWP A;  2GAN A;  1CJW A;  3F8K A;  4R87 A;  5AG7 A;  3GYA A;  4UCN A;  5HMN A;  2D4P A;  4UFX A;  2VBQ A;  4KSA A;  3VWD A;  5DWN A;  4OLL A;  4UFV A;  2WUU A;  4NXY A;  3JUW A;  2Z3K A;  4NF1 A;  2IL4 A;  1P0H A;  2PRB A;  4R3L A;  4CAW A;  4JD6 A;  3EXN A;  2GE3 A;  4ZBG A;  2Z11 A;  4PSW A;  1M4D A;  3W6X A;  3FNC A;  1Q2C A;  2OH1 A;  3R96 A;  4B10 A;  5AG5 A;  5G1Z A;  4H89 A;  4JJX A;  4R3K A;  5KTC A;  3GY9 A;  2FCK A;  2P6E A;  1S7K A;  2JEV A;  4C2Z A;  2P6G A;  1M4G A;  1MJA A;  2PR1 A;  5A27 A;  1V0C A;  3S6K A;  1RO5 A;  2R1I A;  3EFA A;  2Z3N A;  3E0K A;  4KOS A;  1Y9W A;  4CGM A;  2ATR A;  2X7B A;  5JPH A;  2BEI A;  4R9M A;  1QST A;  2R98 A;  5G20 A;  3R9F A;  4Q38 A;  3TT2 A;  4C7I A;  5JQ4 A;  4UA3 A;  4YFJ A;  2OB0 A;  4XNH C;  5AG4 A;  3F0A A;  3NE7 A;  5F47 A;  2Z3L A;  2EVN A;  3W6S A;  1S7N A;  2B3U A;  4C2Y A;  1S5K A;  4KZT A;  1QSO A;  1YVO A;  2AJ6 A;  2Z3M A;  2OU2 A;  2FIW A;  3F5B A;  1IIC A;  4AVB A;  1YRE A;  4MFP A;  4HNY B;  3IU2 A;  3R95 A;  1Y9K A;  2FS5 A;  2ZW7 A;  1R57 A;  1PUA A;  4CRZ B;  3TCV A;  3QB8 A;  3PZJ A;  2Y0M A;  4BMH A;  4KOR A;  1TIQ A;  3SXO A;  2G0B A;  4YGO A;  1S7L A;  4AVC A;  1CM0 A;  1NSL A;  2ZW6 A;  3TTH A;  3A9L A;  1I21 A;  2AE6 A;  4CYQ A;  4KOU A;  3RYO A;  1XMT A;  3FB3 A;  2F5I A;  1P4N A;  4RS2 A;  4XNH B;  5AG6 A;  3LOD A;  1KUV A;  4HKF A;  4QUS A;  4E2A A;  4MI4 A;  2JDC A;  3TO9 A;  2QIR A;  3CXP A;  4IF5 A;  4CGN A;  5C88 A;  4KUA A;  2FIA A;  3CXS A;  4FD7 A;  2NMT A;  3EY5 A;  4EVY A;  2Q4V A;  4PSX A;  5KTD A;  2I79 A;  4QBJ A;  2PC1 A;  1M1D A;  3GKR A;  4AB7 A;  4X5K A;  2B4B A;  4H6Z A;  4FD4 A;  4MFZ A;  3LD2 A;  2YNC A;  4F0X A;  4DNC A;  4ZGY B;  4F6A A;  5H84 A;  4CAX A;  2DPS A;  5J8C A;  4IUS A;  3ZZI A;  1YX0 A;  1NMT A;  4MY3 A;  1K4J A;  2CNT A;  3V8I A;  4U9Y A;  2A4N A;  1Z4R A;  1Y7R A;  2CNS A;  2ARH A;  5F48 A;  1QSR A;  3W91 A;  5KTA A;  4B13 A;  3T90 A;  4C7H A;  5G22 A;  4BBH A;  5GCN A;  4MFJ A;  2OZG A;  3IWG A;  2GIV A;  4E8O A;  5AGE A;  4PK2 A;  4LX9 A;  4CAV A;  4KSF A;  4U9Z A;  5ISV A;  2I00 A;  4CAE A;  1S7F A;  2H5M A;  5EC4 A;  3SHP A;  2B3V A;  2YGW A;  4NSQ A;  4AG7 A;  3I3G A;  4B11 A;  1IYK A;  2K5T A;  3DNS A;  1WK4 A;  1VHS A;  4J3G A;  1Z4E A;  4HNW B;  1M4I A;  4KS9 A;  3TO6 A;  4H6U A;  3SXN A;  4KOV A;  3EO4 A;  1GHE A;  4QC6 A;  3DDD A;  4KVX A;  4KOX A;  3TFY A;  3DR8 A;  2REE A;  3G8W A;  3BJ7 A;  2O28 A;  3FXT A;  4L89 A;  4XPK A;  2P0W A;  3FIX A;  4YRH A;  3H5Z A;  4A95 A;  4PK3 A;  2R8V A;  1L0C A;  2BL1 A;  3S6G A;  4GS4 A;  2FE7 A;  1ON0 A;  1SQH A;  2C27 A;  2VI7 A;  4A33 A;  4MFL A;  4KOW A;  3S6H A;  2VEZ A;  4L8A A;  4UFW A;  3WR7 A;  1M44 A;  4Y49 B;  2RC4 A;  2FXF A;  1XF8 A;  3PP9 A;  3D2P A;  4XPL A;  1FY7 A;  4MFK A;  2BSW A;  4R57 A;  2G3A A;  4KUB A;  1ZO0 A;  4XPD C;  2QML A;  5J8F A;  1I12 A;  4HNX B;  5I0C A;  3K9U A;  1YR0 A;  2B4D B;  4CGO A;  2PDO A;  3BLN A;  3IGR A;  2JDD A;  3TOA A;  1MJB A;  3T9Y A;  1IID A;  1IYL A;  1J4J A;  1XIX A;  4JXR A;  5E96 A;  2B5G A;  3BJ8 A;  1KUX A;  2FSR A;  4FD5 A;  5IB0 A;  2D4O A;  3R9G A;  2BUE A;  4JXQ A;  4KOT A;  4MFQ A;  5G21 A;  3D3S A;  4MHD A;  4QB9 A;  2R7H A;  1WWZ A;  4OAD A;  2YND A;  2DXQ A;  4B5P B;  3IU1 A;  4E0A A;  1UFH A;  3G3S A;  2WPX A;  3MGD A;  2B5G B;  2OZU A;  3VWE A;  1YVK A;  4KVO E;  5CNP A;  4KVM E;  4ONU A;  4II9 A;  2WPW A;  3FYN A;  3OWC A;  2ZXV A;  1PU9 A;  4JLY A;  4KLV A;  1YGH A;  1Q2D A;  4QVT A;  2YNE A;  1IB1 E;  4AG9 A;  2G3T A;  3I9S A;  4A30 A;  4CS0 B;  2PQ8 A;  2Q0Y A;  3H4Q A;  3JTK A;  4XPD B;  2VXK A;  5IX3 A;  1OZP A;  3EC4 A;  1B87 A;  2FL4 A;  3N7Z A;  3UY5 A;  4UWJ A;  4MBU A;  3S6F A;  4A2Z A;  5F49 A;  4Y49 C;  1BOB A;  1B6B A;  2PR8 A;  4C68 A;  3QAH A;  4I49 A;  5DWM A;  2Z10 A;  5FVJ A;  4F0Y A;  1I1D A;  2HUZ A;  2Q04 A;  4CYN A;  5BWA B;  3DSB A;  4CGP A;  4A32 A;  4B12 A;  2EUI A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...