2WPXA

Tandem gnat protein from the clavulanic acid biosynthesis pathway (with accoa)
Total Genus 87
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
87
sequence length
334
structure length
326
Chain Sequence
AGELEFVPLAANDDETVGQWLDLMALAAETGPRAAPPCNVDMVGSLRFAPPATALDDWVVRSGGRVVGALRLALPDGAPTARVDQLLVHPGRRRRGIGRALWAHARELARKHDRTTLTATVVESLPSGPAQDPGPAAFAAAMGAHRSDIPAGTHQWLDLDRHDPLADGVPAVPAGYSLVTWGTITPDEYAVPVSELELRAAQEVRTSYARQFETMRVGRGRRAYHTGAVHDATGALAGYTSVSKTTGNPAYALQGMTVVHREHRGHALGTLLKLANLEYVLRHEPEVRLVETANAEDNHPMIAVNAALGFEPYDRWVFWTAEAGPS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords ORF14
publication title Crystallographic and mass spectrometric analyses of a tandem GNAT protein from the clavulanic acid biosynthesis pathway.
pubmed doi rcsb
source organism Streptomyces clavuligerus
total genus 87
structure length 326
sequence length 334
chains with identical sequence B
ec nomenclature ec 2.3.1.-:
pdb deposition date 2009-08-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00583 Acetyltransf_1 Acetyltransferase (GNAT) family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.630.30 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Aminopeptidase 2wpxA00
2GE3A 2ZW6A 4XPLA 4Y49B 5KTCA 2H5MA 1N71A 5HMNA 4QVTA 1XEBA 4RS2A 2BEIA 5EBVA 1P0HA 2DXQA 4MY0A 2HUZA 3FNCA 4CAVA 3S6FA 2D4OA 1YVKA 4AVAA 2FSRA 3C26A 2OZGA 4UBRA 2G0BA 3S6HA 5IV0A 4FD7A 4XPDC 4L89A 3R9GA 4H6UA 1R57A 2WPXA 3EFAA 1U6MA 3UY5A 5HH1A 3DNSA 4YRHA 3SHPA 2B3UA 2GIVA 2Z0ZA 1M44A 4I49A 1M1DA 2Q4VA 4KOVA 5ISVA 5DWMA 4MI4A 1I12A 3S6KA 1NMTA 1Y9KA 2C27A 4CS0B 4J3GA 2ZPAA 3LD2A 4KVME 5FVJA 5GCNA 2B3VA 1RO5A 4L8AA 3TO9A 2AJ6A 5EC4A 5DWNA 1B6BA 3F5BA 1B87A 4RI1A 4NSQA 4MHDA 2ZW7A 2O28A 4M3SA 4MJ8A 2P6GA 2JDCA 1MJBA 4U9YA 4U9ZA 2J8MA 4QUSA 4HNYB 1J4JA 1M4GA 2B4DB 3D3SA 2D4PA 1IYKA 1KZFA 1WK4A 3EC4A 1S3ZA 3VWEA 4UA3A 2CNMA 3TOAA 5F49A 2FT0A 4HNXB 5IB0A 3PP9A 4OLLA 3QB8A 3JUWA 1ON0A 2FL4A 1QSNA 1XF8A 3D2MA 2B4BA 4AG7A 5IX3A 3CXSA 4CRZB 3TO7A 4JXRA 3PGPA 1VKCA 1QSMA 4KVOE 1S60A 2Y0MA 1IB1E 4QB9A 4OADA 2Q04A 2FS5A 4JXQA 1NE9A 1CM0A 2AE6A 4B5OA 4ONUA 3IWGA 2OU2A 4X5KA 4AG9A 2G3AA 1KUVA 1MK4A 1IYLA 4XNHB 4E0AA 1BOBA 1L0CA 3NE7A 2QECA 2PC1A 4KLVA 2Z11A 4UWJA 2QIRA 5F48A 1QSTA 1NSLA 2NMTA 2R1IA 1Y7RA 4KLWA 4FD5A 2J8RA 4F6AA 3FXTA 3B8GA 2VI7A 1P4NA 3ZZIA 3BLNA 2Q0YA 3FRMA 4MY3A 3KKWA 2OZUA 1S7KA 4JD6A 2I00A 4KZTA 3P2HA 2JLMA 5H84A 2JDDA 2ATRA 5F46A 2PR8A 2OH1A 3CXPA 3W91A 2QMLA 3R95A 2F5IA 1I1DA 4CAWA 3GKRA 2WPWA 4NF1A 4GS4A 5F47A 2I79A 1QSRA 1XE4A 1XMTA 3TCVA 2R8VA 2OB0A 2Q44A 3GYAA 3DSBA 3F8KA 3JVNA 2B5GA 1VHSA 2VXKA 5JPHA 3EY5A 1UFHA 5I0CA 2PDOA 3R9EA 1Y9WA 2CY2A 1S7LA 3EO4A 1YREA 2Q4YA 2GANA 4JLYA 4ZBGA 2FIAA 2VEZA 3R96A 3RYOA 1S7FA 2Z10A 1OZPA 4NCZA 1Q2DA 2B4DA 3R1KA 1YK3A 3DR6A 2OZHA 3E0KA 3FYNA 3TOBA 4DNCA 2PRBA 4NXYA 2P0WA 4FD4A 4KOTA 3CXQA 2PR1A 4KORA 1KUXA 2KCWA 4LX9A 1QSOA 4R3KA 3TT2A 4BMHA 3DDDA 2FE7A 4PSWA 3SXOA 3N7ZA 5C88A 2CNTA 4K30A 2A4NA 2BL1A 1Z9UA 4CAXA 2Q7BA 4PSXA 4II9A 3W6XA 2FCKA 5KTDA 4YGOA 4E8OA 5J8FA 3SXNA 1Z4EA 4QBJA 3T90A 2ZXVA 3K9UA 5JQ4A 1K4JA 5E96A 3TTHA 4E2AA 4B5PB 4Y49C 3I9SA 4KUBA 5J8CA 1V0CA 1KUYA 4EVYA 1BO4A 4HKFA 4R57A 4MBUA 4KOSA 4LUAA 2VZYA 2HV2A 2PSWA 4M85A 2RC4A 4JJXA 1YX0A 4ORFA 1I21A 1WWZA 4F0YA 1YVOA 4R9MA 5H86A 4R3LA 4AB7A 2BSWA 3T9YA 3P2FA 3G3SA 1M4IA 3ZJ0A 2VQYA 3I3GA 2ARHA 4PK2A 4AVCA 4CRYB 4R87A 5CNPA 4XPDB 2R98A 1GHEA 1TIQA 1Z4RA 4UWIA 2G3TA 4KUAA 5KTAA 3D2PA 1YR0A 1YGHA 1MJAA 3H4QA 2P6EA 1YLEA 3OWCA 3WR7A 3FB3A 1IIDA 1PUAA 3QAHA 3IGRA 3TE4A 2BUEA 2K5TA 1Q2CA 2FIWA 3TO6A 3BJ8A 3EXNA 1S7NA 2CNSA 3S6GA 3R9FA 4FD6A 2R7HA 3BJ7A 4H6ZA 2B5GB 2PQ8A 3PZJA 4XPKA 3D8PA 2EUIA 4AVBA 2J8NA 4KVXA 4KOWA 1IICA 1Q2YA 1LRZA 4PK3A 5C82A 2P6FA 2REEA 4IUSA 4PV6A 1S5KA 3FIXA 4YFJA 4KOXA 2FXFA 1MJ9A 3LODA 4IF5A 1SQHA 3G8WA 4QC6A 3GY9A 2EVNA 2VZZA 1XIXA 4KOYA 3W6SA 2VBQA 1PU9A 2REFA 2X7BA 1M4DA 4U5YA 2B58A 3TFYA 3FBUA 4KOUA 4NEXA 2ZW5A 2IL4A 2HQYA 4XNHC 4HNWB 4JWPA 2JEVA 3VWDA 1CJWA 4B5PA 3F0AA 2ZW4A 4H89A 3V8IA 1FY7A 3MGDA 3DR8A 1RXTA 4OAEA
chains in the Genus database with same CATH superfamily
2GE3A 2ZW6A 1YSJA 4XPLA 4Y49B 4UEEA 2H5MA 5KTCA 3N5FA 1N71A 2ZEFA 5HMNA 2C6CA 4QVTA 1XEBA 4RS2A 1DTDA 3RBUA 3KHXA 2BEIA 3D67A 8CPAA 4F0XA 5EBVA 4B6ZA 1P0HA 2DXQA 4ZX8A 4MY0A 4P4BA 2HUZA 3S9NA 3NA6A 4OIDA 3B3WA 3FNCA 5G20A 4CAVA 3S6FA 2D4OA 1YVKA 4AVAA 2ZEGA 3PBEA 2FSRA 2ZOGA 1IU8A 3C26A 4MXUA 2OZGA 4NFRA 4UBRA 2G0BA 5AG5A 2GLFA 2PJCA 3S6HA 5IV0A 3D7HA 4FD7A 5LYIA 2PJ5A 2O53A 2Q51A 4XPDC 4BBHA 4L89A 1ZG9A 4OP4A 2ODFA 2PE3A 4H6UA 4X8IA 3R9GA 5JGFA 1R57A 3BI1A 2WPXA 3EFAA 2QYVA 2F7VA 2YNEA 2Z3PA 1U6MA 3UY5A 2QVPA 4NGTA 3FJUA 4G1PA 3DNSA 5HH1A 2PJ4A 4YRHA 1TF9A 3R9FA 4F9VA 3SHPA 4MHZA 2B3UA 2GIVA 2QJ8A 3BXMA 4KSAA 2Z0ZA 2WUUA 3H5ZA 4ZYQA 4IHMA 1YW4A 1M44A 4I49A 1TKFA 4CGLA 4MCRA 2PJ1A 1M1DA 2Q4VA 3CDXA 2V8HA 4KOVA 2NYQA 7CPAA 5ISVA 4X3RA 4CAFA 1YLOA 4B13A 2DPTA 2YNDA 2Q43A 5DWMA 3H8FA 4MI4A 1I12A 3S6KA 4MFPA 1NMTA 1ZLIA 1Y9KA 2C27A 4CS0B 4J3GA 2ZPAA 3LD2A 4KVME 4PXBA 5FVJA 5GCNA 5LYDA 2B3VA 2XEIA 1RO5A 4L8AA 4OC4A 3L2NA 4UCNA 3TO9A 4M6HA 3SJGA 1HDUA 4ZY2A 2AJ6A 2Z3LA 5EC4A 5DWNA 1B6BA 3F5BA 1B87A 4RI1A 1Z2LA 4NSQA 2VL1A 3K9TA 4MHDA 2ZW7A 4A32A 2O28A 4M3SA 1HEEA 4MJ8A 2ZEHA 2P6GA 1CBXA 3KHZA 2JDCA 1MJBA 4U9YA 4U9ZA 4A30A 1VHEA 2J8MA 3KGQA 4ONWA 4QUSA 4HNYB 1J4JA 3SI0A 1M4GA 2B4DB 3D3SA 2D4PA 1IYKA 4OC0A 3MN8A 4OMEA 1KZFA 5HVHA 1WK4A 3BHXA 3NFZA 4ZY1A 3D4UA 3EC4A 1S3ZA 2CF4A 3PFOA 3VWEA 4UA3A 2CNMA 3TOAA 1HDQA 4TWEA 5F49A 2PIYA 2FT0A 2GLJA 4HNXB 4UCPA 3VATA 5IB0A 1F57A 4A95A 3PP9A 3IU1A 2PVVA 3QB8A 4OLLA 4OC1A 3JUWA 1ON0A 2FL4A 4W9YA 3RO0A 4UF4A 1QSNA 1ZO0A 4OC3A 3V7ZA 1XF8A 1PYTB 2B4BA 3D2MA 5JM6A 4AG7A 1XBUA 3H8EA 5IX3A 1FNOA 3CXSA 4KSIA 3TO7A 3WC5A 4CRZB 1LAMA 4JXRA 3PGPA 1XOVA 1VKCA 1QSMA 1JQGA 4KVOE 1CG2A 1LOKA 1S60A 2Y0MA 4RUHA 1IB1E 4QB9A 2YGWA 4OADA 1R3NA 3D7FA 2Q04A 2FS5A 5AG6A 4JXQA 1NE9A 2PJAA 1VHOA 1CM0A 1CP7A 2AE6A 4X2TA 4B5OA 4ONUA 2J9AA 3IWGA 2OU2A 2ZEMA 4X5KA 4AG9A 2G3AA 3FMCA 2WZNA 1KUVA 1MK4A 5D29A 4C2ZA 4M6GA 4P4JA 2PVWA 2O4HA 3IJ3A 3TX8A 4CYQA 1IYLA 3QNVA 3GLJA 4MRIA 4XNHB 5THWA 5K8MA 3I1UA 4E0AA 1BOBA 3FH4A 4EMEA 5ELYA 1L0CA 1Y7EA 4FAIA 3NE7A 2QECA 4NGRA 3D66A 4PQAA 2PC1A 4KLVA 2Z11A 4UWJA 2QIRA 4OC5A 4IAVA 5F48A 2ZEEA 3SI1A 1PCAA 2RB7A 2Q4ZA 1QSTA 1Z8TA 1Z8LA 1NSLA 2Z3NA 2IQ6A 4A2ZA 1KWMA 2NMTA 2R1IA 4A39A 1Y7RA 2PJ2A 4KLWA 2Z3KA 4FD5A 4CPAA 2J8RA 4F6AA 1Y0YA 3IC1A 5AGEA 3FXTA 3PRTA 4H2KA 4UIAA 3B8GA 4R6TA 4ZY0A 4F8ZA 4P44A 5J1QA 1VIXA 2VI7A 2C1CA 3SJXA 5LRKA 1P4NA 3KI9A 3ZZIA 3BLNA 3B7IA 2Q0YA 3FRMA 2PJ3A 2F8HA 4K3NA 4MY3A 3KKWA 2OZUA 3NH8A 1S7KA 3ISXA 4JD6A 4TNUA 2GREA 2I00A 4UCMA 2BOAA 4Q36A 4F9UA 4Q38A 3NH4A 1LFWA 3T8WA 2JEWA 4DYOA 4KZTA 3P2HA 2JLMA 4CGMA 2PJ6A 5H84A 1F2PA 2JDDA 4OIWA 3LWUA 2ATRA 1Z8XA 5F46A 5K8PA 2PR8A 1CX8A 1LCPA 2OH1A 3CXPA 4WWVA 2QMLA 3W91A 3FEEA 1TF8A 5G1ZA 2CTCA 2IJZA 4LQGA 1ARLA 1TKJA 3R95A 2F5IA 5K8OA 1YQEA 1I1DA 4CAWA 3GKRA 2WPWA 4BINA 3B35A 4NF1A 2ZEPA 4WJBA 4NGPA 4GS4A 2ZEOA 5F47A 2I79A 1QSRA 1XE4A 1XMTA 3TCVA 2R8VA 1OBRA 4JZ0A 2OB0A 2Q44A 3KASA 3GYAA 4MHYA 3DSBA 4FBEA 2PJ7A 2GU2A 3F8KA 3JVNA 2B5GA 1VHSA 2VXKA 2XEFA 5BWAB 5A27A 5JH9A 5JPHA 3QAYA 4EWTA 1TKHA 3EY5A 3FVLA 4MCQA 5F09A 3PB7X 1UFHA 2V8DA 3RNZA 5I0CA 2PDOA 3R9EA 3PBBA 1Y9WA 2DF5A 4PXDA 3NE8A 2CY2A 4CYOA 1S7LA 1Z8WA 3EO4A 4IK2A 1YREA 1IOIA 1QMUA 2Q4YA 4GM5A 2GANA 4MHPA 4JLYA 4ZBGA 4P10A 1IGBA 2FIAA 2VEZA 2PCUA 2NSMA 2V77A 3R96A 3RYOA 1S7FA 1BLLE 2Z10A 1OZPA 4NCZA 1Q2DA 2EWBA 2B4DA 2HB6A 3R1KA 5CBMA 1YK3A 2GFQA 3DR6A 3IU2A 4NGMA 4FUUA 2CXAA 2OZHA 2XEGA 3E0KA 5IB9A 1YMEA 3FYNA 3K2KA 1YW6A 3TOBA 4DNCA 2I3CA 3WT4A 2PRBA 4NXYA 2PIZA 2P0WA 4O23A 2AFSA 4FD4A 4KOTA 2XEJA 3CXQA 5HVFA 2PR1A 4KORA 1JWQA 4CAEA 1KUXA 4UFWA 4ZGYB 1Y0RA 2KCWA 4LX9A 1QSOA 4R3KA 3B3SA 3TT2A 4BMHA 1ZG8A 2OR4A 2DPSA 3B3VA 4UEFA 3DDDA 2FE7A 5K8NA 1CPXA 4PSWA 3SXOA 3N7ZA 1UWYA 4UFVA 2AFUA 5C88A 2CNTA 4K30A 1R43A 1Z5RA 2A4NA 2BL1A 1Z9UA 3IWEA 4CAXA 3IEHA 3CZXA 4PSXA 4MFZA 2HC9A 2Q7BA 4II9A 2YNCA 4A94A 5EMIA 1AYEA 2C6PA 3B3TA 3CPXA 3SJEA 3PB9X 3W6XA 2FCKA 2PJ8A 2YNCC 5KTDA 5LYLA 4YGOA 2Z3MA 3A9LA 4CGPA 2AFMA 4E8OA 2ZENA 5J8FA 5G21A 3TC8A 1LAPA 3SXNA 2V8GA 1Z4EA 4UFXA 4CGNA 1EE3P 4PXEA 2PJBA 2Z3OA 2FVGA 4QBJA 2ZELA 2OOTA 3T90A 2ZXVA 1XRYA 3K9UA 5JQ4A 5DS0A 1K4JA 1ELLP 5E96A 3TTHA 4UIBA 4E2AA 4B5PB 4Y49C 2ANPA 3I9SA 4KUBA 5J8CA 3VARA 1IOFA 3RAMA 4P45A 4C7HA 3GB0A 1V0CA 4CYNA 3JTKA 1KUYA 5D8NA 4EVYA 4B11A 1BO4A 3MRUA 2G9DA 4HKFA 3PB4X 3IFEA 4R57A 4MBUA 2WYRA 4KOSA 4LUAA 2VZYA 4ZI6A 2HV2A 2PSWA 3KR4A 4M85A 2RC4A 4B14A 4JJXA 3B3CA 1YX0A 5HVGA 2ABZA 4ORFA 1I21A 1WWZA 4F0YA 1YVOA 1ELMP 4FWUA 4R9MA 5H86A 4R3LA 2AFZA 4C68A 1QQ9A 3D7DA 4B12A 4AB7A 2BSWA 3T9YA 4R7MA 3KQZA 3P2FA 3G3SA 1Q7LA 1M4IA 2EBJA 4C2YA 3ZJ0A 2VQYA 3SJFA 3I3GA 2ARHA 4PK2A 3GIUA 4AVCA 2DEAA 4NGNA 4C7IA 4CRYB 3FX6A 4EFDA 4R87A 2RFHA 3FEDA 5CNPA 4XPDB 2C6GA 3NH5A 3B2YA 2R98A 4PPZA 1GHEA 1TIQA 1Z4RA 4UWIA 2G3TA 3V38A 3ISZA 1H8LA 4KUAA 5KTAA 3D2PA 4MHNA 4PXCA 1YR0A 1XFOA 1YGHA 4MFJA 1A2ZA 1MJAA 3H4QA 2P6EA 1YLEA 3KZWA 3OWCA 5AG7A 3WR7A 2PJ0A 2BO9A 3KR5A 1ZG7A 3FB3A 4GXHA 4NGSA 4P4FA 2CIJA 1IIDA 1PUAA 1BPMA 3VH9A 3QAHA 2EK9A 3IO1A 4JYWA 3IGRA 1IY7A 3TE4A 2BUEA 4MCSA 2K5TA 1Q2CA 2FIWA 3TO6A 4DUKA 3FECA 3BJ8A 3EXNA 3S9MA 1CP6A 4OC2A 5CPAA 1S7NA 2AFXA 2EK8A 4MFKA 3H8GA 4MFLA 1CPSA 2CNSA 3S6GA 4BD9A 4MMOA 4FD6A 4KSFA 2R7HA 4P4IA 3DGVA 3BJ7A 4H6ZA 2B5GB 1TXRA 3GUXA 4C2XA 2JBKA 5LRGA 2PQ8A 3D68A 3PZJA 4XPKA 1AUGA 2PJ9A 3D8PA 2EUIA 4B10A 1LANA 4AVBA 2J8NA 4P6YA 4KVXA 4KOWA 1IICA 3IIBA 1X12A 1XJOA 2Q7SA 1Q2YA 1LRZA 3KQXA 4YU9A 4PK3A 3CPAA 5C82A 4OKOA 4ZX9A 1RTQA 4A37A 1NSAA 2P6FA 2REEA 1ZLHA 1GYTA 3HLPA 2IMOA 4YWYA 1AMPA 4IUSA 2ZEDA 2AFOA 4LQ6A 4PV6A 1S5KA 3FIXA 5I4MA 4YFJA 3HUVA 4MFQA 5G22A 4A38A 3S9LA 4KOXA 4A33A 2FXFA 2V8VA 4RN7A 1MJ9A 2CTBA 4KS9A 3RZAA 1X10A 4NJQA 3LODA 2AFWA 1SQHA 4IF5A 3WABA 3G8WA 3BI0A 4AXVA 4R76A 4A31A 4QC6A 4UEZA 3PEIA 3WC6A 4M6IA 4P4EA 3LMSA 4Q7AA 3GY9A 1XMBA 2EVNA 2VZZA 1XIXA 4KOYA 3W6SA 4Z65A 3LACA 5AG4A 2JBJA 4DJLA 2BCOA 2EO8A 2VBQA 1PU9A 4MCPA 2REFA 1ARMA 2POKA 4R8FA 2X7BA 1M4LA 1M4DA 5HXDA 3FF3A 3KL9A 3PFEA 3PB8X 6CPAA 4U5YA 2B58A 3TFYA 2PRQA 5LYFA 1FT7A 2WSAA 3FBUA 4KOUA 5LRJA 4NEXA 5A28A 2ZW5A 2IL4A 1VGYA 2HQYA 3WC7A 4HPSA 4XNHC 4CGOA 4HNWB 2ZOFA 4NJRA 3IWWA 4JWPA 3CT9A 1BAVA 3DLJA 4NGQA 3SI2A 2JEVA 4CYPA 1BPNA 3VWDA 4P4DA 1DE4C 3PB6X 1CJWA 3JRUA 4B5PA 3F0AA 2ZW4A 4H89A 3V8IA 1FY7A 3MGDA 3D7GA 3DR8A 1RXTA 4OAEA 1F2OA
chains in the Genus database with same CATH topology
2GE3A 2ZW6A 4XPLA 4Y49B 5KTCA 2H5MA 1N71A 5HMNA 4QVTA 1XEBA 4RS2A 2BEIA 4F0XA 5EBVA 1P0HA 2DXQA 4MY0A 2HUZA 3FNCA 5G20A 4CAVA 3S6FA 2D4OA 1YVKA 4AVAA 2FSRA 3C26A 2OZGA 4UBRA 2G0BA 5AG5A 3S6HA 5IV0A 4FD7A 4XPDC 4BBHA 4L89A 3R9GA 4H6UA 1R57A 2WPXA 3EFAA 2YNEA 2Z3PA 1U6MA 3UY5A 5HH1A 3DNSA 4YRHA 3SHPA 2B3UA 2GIVA 4KSAA 2Z0ZA 2WUUA 3H5ZA 1M44A 4I49A 4CGLA 1M1DA 2Q4VA 4KOVA 5ISVA 4CAFA 4B13A 2DPTA 2YNDA 5DWMA 4MI4A 1I12A 3S6KA 4MFPA 1NMTA 1Y9KA 2C27A 4CS0B 4J3GA 2ZPAA 3LD2A 4KVME 5FVJA 5GCNA 2B3VA 1RO5A 4L8AA 4UCNA 3TO9A 2AJ6A 2Z3LA 5EC4A 5DWNA 1B6BA 3F5BA 1B87A 4RI1A 4NSQA 4MHDA 2ZW7A 4A32A 2O28A 4M3SA 4MJ8A 2P6GA 2JDCA 1MJBA 4U9YA 4U9ZA 4A30A 2J8MA 4QUSA 4HNYB 1J4JA 1M4GA 2B4DB 3D3SA 2D4PA 1IYKA 1KZFA 1WK4A 3EC4A 1S3ZA 3VWEA 4UA3A 2CNMA 3TOAA 5F49A 2FT0A 4HNXB 4UCPA 5IB0A 4A95A 3PP9A 3IU1A 3QB8A 4OLLA 3JUWA 1ON0A 2FL4A 1QSNA 1ZO0A 1XF8A 3D2MA 2B4BA 4AG7A 5IX3A 3CXSA 4CRZB 3TO7A 4JXRA 3PGPA 1VKCA 1QSMA 4KVOE 1S60A 2Y0MA 1IB1E 4QB9A 2YGWA 4OADA 2Q04A 2FS5A 5AG6A 4JXQA 1NE9A 1CM0A 2AE6A 4B5OA 4ONUA 3IWGA 2OU2A 4X5KA 4AG9A 2G3AA 1KUVA 1MK4A 4C2ZA 4CYQA 1IYLA 4XNHB 4E0AA 1BOBA 1L0CA 3NE7A 2QECA 2PC1A 4KLVA 2Z11A 4UWJA 2QIRA 5F48A 1QSTA 1NSLA 2Z3NA 4A2ZA 2NMTA 2R1IA 1Y7RA 4KLWA 2Z3KA 4FD5A 2J8RA 4F6AA 5AGEA 3FXTA 3B8GA 2VI7A 1P4NA 3ZZIA 3BLNA 2Q0YA 3FRMA 4MY3A 3KKWA 2OZUA 1S7KA 4JD6A 4UCMA 2I00A 4Q36A 4Q38A 4KZTA 3P2HA 2JLMA 4CGMA 5H84A 2JDDA 2ATRA 5F46A 2PR8A 2OH1A 3CXPA 3W91A 2QMLA 5G1ZA 3R95A 2F5IA 1I1DA 4CAWA 3GKRA 2WPWA 4NF1A 4GS4A 5F47A 2I79A 1QSRA 1XE4A 1XMTA 3TCVA 2R8VA 2OB0A 2Q44A 3GYAA 3DSBA 3F8KA 3JVNA 2B5GA 1VHSA 2VXKA 5BWAB 5A27A 5JPHA 3EY5A 1UFHA 5I0CA 2PDOA 3R9EA 1Y9WA 2CY2A 4CYOA 1S7LA 3EO4A 1YREA 2Q4YA 2GANA 4JLYA 4ZBGA 2FIAA 2VEZA 3R96A 3RYOA 1S7FA 2Z10A 1OZPA 4NCZA 1Q2DA 2B4DA 3R1KA 1YK3A 3DR6A 3IU2A 2CXAA 2OZHA 3E0KA 3FYNA 3TOBA 4DNCA 2PRBA 4NXYA 2P0WA 4FD4A 4KOTA 3CXQA 2PR1A 4KORA 4CAEA 1KUXA 4UFWA 4ZGYB 2KCWA 4LX9A 1QSOA 4R3KA 3TT2A 4BMHA 2DPSA 3DDDA 2FE7A 4PSWA 3SXOA 3N7ZA 4UFVA 5C88A 2CNTA 4K30A 2A4NA 2BL1A 1Z9UA 3IWEA 4CAXA 2Q7BA 4PSXA 4II9A 4MFZA 2YNCA 3W6XA 2FCKA 2YNCC 5KTDA 4YGOA 2Z3MA 3A9LA 4CGPA 4E8OA 5J8FA 5G21A 3SXNA 4UFXA 1Z4EA 4CGNA 2Z3OA 4QBJA 3T90A 2ZXVA 3K9UA 5JQ4A 1K4JA 5E96A 3TTHA 4E2AA 4B5PB 4Y49C 3I9SA 4KUBA 5J8CA 4C7HA 4CYNA 1V0CA 3JTKA 1KUYA 4EVYA 4B11A 1BO4A 4HKFA 4R57A 4MBUA 4KOSA 4LUAA 2VZYA 2HV2A 2PSWA 4M85A 2RC4A 4B14A 4JJXA 1YX0A 4ORFA 1I21A 1WWZA 4F0YA 1YVOA 4R9MA 5H86A 4R3LA 4C68A 4B12A 4AB7A 2BSWA 3T9YA 3P2FA 3G3SA 1M4IA 4C2YA 3ZJ0A 2VQYA 3I3GA 2ARHA 4PK2A 4AVCA 4C7IA 4CRYB 4R87A 5CNPA 4XPDB 2R98A 1GHEA 1TIQA 1Z4RA 4UWIA 2G3TA 4KUAA 5KTAA 3D2PA 1YR0A 1YGHA 4MFJA 1MJAA 3H4QA 2P6EA 1YLEA 5AG7A 3OWCA 3WR7A 3FB3A 1IIDA 1PUAA 3QAHA 3IGRA 3TE4A 2BUEA 2K5TA 1Q2CA 2FIWA 3TO6A 3BJ8A 3EXNA 1S7NA 4MFKA 4MFLA 2CNSA 3S6GA 3R9FA 4FD6A 4KSFA 2R7HA 3BJ7A 4H6ZA 2B5GB 4C2XA 2PQ8A 3PZJA 4XPKA 3D8PA 2EUIA 4B10A 4AVBA 2J8NA 4KVXA 4KOWA 1IICA 1Q2YA 1LRZA 4PK3A 5C82A 2P6FA 2REEA 4IUSA 4PV6A 1S5KA 3FIXA 4YFJA 4MFQA 5G22A 4KOXA 4A33A 2FXFA 1MJ9A 4KS9A 3LODA 4IF5A 1SQHA 3G8WA 4A31A 4QC6A 3GY9A 2EVNA 2VZZA 1XIXA 4KOYA 3W6SA 5AG4A 2VBQA 1PU9A 2REFA 2X7BA 1M4DA 4U5YA 2B58A 3TFYA 2WSAA 3FBUA 4KOUA 4NEXA 5A28A 2ZW5A 2IL4A 2HQYA 4XNHC 4CGOA 4HNWB 4JWPA 2JEVA 4CYPA 3VWDA 1CJWA 4B5PA 3F0AA 2ZW4A 4H89A 3V8IA 1FY7A 3MGDA 3DR8A 1RXTA 4OAEA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2GE3 A;  2ZW6 A;  4XPL A;  4Y49 B;  5KTC A;  2H5M A;  1N71 A;  5HMN A;  4QVT A;  1XEB A;  4RS2 A;  2BEI A;  5EBV A;  1P0H A;  2DXQ A;  4MY0 A;  2HUZ A;  3FNC A;  4CAV A;  3S6F A;  2D4O A;  1YVK A;  4AVA A;  2FSR A;  3C26 A;  2OZG A;  4UBR A;  2G0B A;  3S6H A;  5IV0 A;  4FD7 A;  4XPD C;  4L89 A;  3R9G A;  4H6U A;  1R57 A;  2WPX A;  3EFA A;  1U6M A;  3UY5 A;  5HH1 A;  3DNS A;  4YRH A;  3SHP A;  2B3U A;  2GIV A;  2Z0Z A;  1M44 A;  4I49 A;  1M1D A;  2Q4V A;  4KOV A;  5ISV A;  5DWM A;  4MI4 A;  1I12 A;  3S6K A;  1NMT A;  1Y9K A;  2C27 A;  4CS0 B;  4J3G A;  2ZPA A;  3LD2 A;  4KVM E;  5FVJ A;  5GCN A;  2B3V A;  1RO5 A;  4L8A A;  3TO9 A;  2AJ6 A;  5EC4 A;  5DWN A;  1B6B A;  3F5B A;  1B87 A;  4RI1 A;  4NSQ A;  4MHD A;  2ZW7 A;  2O28 A;  4M3S A;  4MJ8 A;  2P6G A;  2JDC A;  1MJB A;  4U9Y A;  4U9Z A;  2J8M A;  4QUS A;  4HNY B;  1J4J A;  1M4G A;  2B4D B;  3D3S A;  2D4P A;  1IYK A;  1KZF A;  1WK4 A;  3EC4 A;  1S3Z A;  3VWE A;  4UA3 A;  2CNM A;  3TOA A;  5F49 A;  2FT0 A;  4HNX B;  5IB0 A;  3PP9 A;  4OLL A;  3QB8 A;  3JUW A;  1ON0 A;  2FL4 A;  1QSN A;  1XF8 A;  3D2M A;  2B4B A;  4AG7 A;  5IX3 A;  3CXS A;  4CRZ B;  3TO7 A;  4JXR A;  3PGP A;  1VKC A;  1QSM A;  4KVO E;  1S60 A;  2Y0M A;  1IB1 E;  4QB9 A;  4OAD A;  2Q04 A;  2FS5 A;  4JXQ A;  1NE9 A;  1CM0 A;  2AE6 A;  4B5O A;  4ONU A;  3IWG A;  2OU2 A;  4X5K A;  4AG9 A;  2G3A A;  1KUV A;  1MK4 A;  1IYL A;  4XNH B;  4E0A A;  1BOB A;  1L0C A;  3NE7 A;  2QEC A;  2PC1 A;  4KLV A;  2Z11 A;  4UWJ A;  2QIR A;  5F48 A;  1QST A;  1NSL A;  2NMT A;  2R1I A;  1Y7R A;  4KLW A;  4FD5 A;  2J8R A;  4F6A A;  3FXT A;  3B8G A;  2VI7 A;  1P4N A;  3ZZI A;  3BLN A;  2Q0Y A;  3FRM A;  4MY3 A;  3KKW A;  2OZU A;  1S7K A;  4JD6 A;  2I00 A;  4KZT A;  3P2H A;  2JLM A;  5H84 A;  2JDD A;  2ATR A;  5F46 A;  2PR8 A;  2OH1 A;  3CXP A;  3W91 A;  2QML A;  3R95 A;  2F5I A;  1I1D A;  4CAW A;  3GKR A;  2WPW A;  4NF1 A;  4GS4 A;  5F47 A;  2I79 A;  1QSR A;  1XE4 A;  1XMT A;  3TCV A;  2R8V A;  2OB0 A;  2Q44 A;  3GYA A;  3DSB A;  3F8K A;  3JVN A;  2B5G A;  1VHS A;  2VXK A;  5JPH A;  3EY5 A;  1UFH A;  5I0C A;  2PDO A;  3R9E A;  1Y9W A;  2CY2 A;  1S7L A;  3EO4 A;  1YRE A;  2Q4Y A;  2GAN A;  4JLY A;  4ZBG A;  2FIA A;  2VEZ A;  3R96 A;  3RYO A;  1S7F A;  2Z10 A;  1OZP A;  4NCZ A;  1Q2D A;  2B4D A;  3R1K A;  1YK3 A;  3DR6 A;  2OZH A;  3E0K A;  3FYN A;  3TOB A;  4DNC A;  2PRB A;  4NXY A;  2P0W A;  4FD4 A;  4KOT A;  3CXQ A;  2PR1 A;  4KOR A;  1KUX A;  2KCW A;  4LX9 A;  1QSO A;  4R3K A;  3TT2 A;  4BMH A;  3DDD A;  2FE7 A;  4PSW A;  3SXO A;  3N7Z A;  5C88 A;  2CNT A;  4K30 A;  2A4N A;  2BL1 A;  1Z9U A;  4CAX A;  2Q7B A;  4PSX A;  4II9 A;  3W6X A;  2FCK A;  5KTD A;  4YGO A;  4E8O A;  5J8F A;  3SXN A;  1Z4E A;  4QBJ A;  3T90 A;  2ZXV A;  3K9U A;  5JQ4 A;  1K4J A;  5E96 A;  3TTH A;  4E2A A;  4B5P B;  4Y49 C;  3I9S A;  4KUB A;  5J8C A;  1V0C A;  1KUY A;  4EVY A;  1BO4 A;  4HKF A;  4R57 A;  4MBU A;  4KOS A;  4LUA A;  2VZY A;  2HV2 A;  2PSW A;  4M85 A;  2RC4 A;  4JJX A;  1YX0 A;  4ORF A;  1I21 A;  1WWZ A;  4F0Y A;  1YVO A;  4R9M A;  5H86 A;  4R3L A;  4AB7 A;  2BSW A;  3T9Y A;  3P2F A;  3G3S A;  1M4I A;  3ZJ0 A;  2VQY A;  3I3G A;  2ARH A;  4PK2 A;  4AVC A;  4CRY B;  4R87 A;  5CNP A;  4XPD B;  2R98 A;  1GHE A;  1TIQ A;  1Z4R A;  4UWI A;  2G3T A;  4KUA A;  5KTA A;  3D2P A;  1YR0 A;  1YGH A;  1MJA A;  3H4Q A;  2P6E A;  1YLE A;  3OWC A;  3WR7 A;  3FB3 A;  1IID A;  1PUA A;  3QAH A;  3IGR A;  3TE4 A;  2BUE A;  2K5T A;  1Q2C A;  2FIW A;  3TO6 A;  3BJ8 A;  3EXN A;  1S7N A;  2CNS A;  3S6G A;  3R9F A;  4FD6 A;  2R7H A;  3BJ7 A;  4H6Z A;  2B5G B;  2PQ8 A;  3PZJ A;  4XPK A;  3D8P A;  2EUI A;  4AVB A;  2J8N A;  4KVX A;  4KOW A;  1IIC A;  1Q2Y A;  1LRZ A;  4PK3 A;  5C82 A;  2P6F A;  2REE A;  4IUS A;  4PV6 A;  1S5K A;  3FIX A;  4YFJ A;  4KOX A;  2FXF A;  1MJ9 A;  3LOD A;  4IF5 A;  1SQH A;  3G8W A;  4QC6 A;  3GY9 A;  2EVN A;  2VZZ A;  1XIX A;  4KOY A;  3W6S A;  2VBQ A;  1PU9 A;  2REF A;  2X7B A;  1M4D A;  4U5Y A;  2B58 A;  3TFY A;  3FBU A;  4KOU A;  4NEX A;  2ZW5 A;  2IL4 A;  2HQY A;  4XNH C;  4HNW B;  4JWP A;  2JEV A;  3VWD A;  1CJW A;  4B5P A;  3F0A A;  2ZW4 A;  4H89 A;  3V8I A;  1FY7 A;  3MGD A;  3DR8 A;  1RXT A;  4OAE A; 
#chains in the Genus database with same CATH topology
 2GE3 A;  2ZW6 A;  1YSJ A;  4XPL A;  4Y49 B;  4UEE A;  2H5M A;  5KTC A;  3N5F A;  1N71 A;  2ZEF A;  5HMN A;  2C6C A;  4QVT A;  1XEB A;  4RS2 A;  1DTD A;  3RBU A;  3KHX A;  2BEI A;  3D67 A;  8CPA A;  4F0X A;  5EBV A;  4B6Z A;  1P0H A;  2DXQ A;  4ZX8 A;  4MY0 A;  4P4B A;  2HUZ A;  3S9N A;  3NA6 A;  4OID A;  3B3W A;  3FNC A;  5G20 A;  4CAV A;  3S6F A;  2D4O A;  1YVK A;  4AVA A;  2ZEG A;  3PBE A;  2FSR A;  2ZOG A;  1IU8 A;  3C26 A;  4MXU A;  2OZG A;  4NFR A;  4UBR A;  2G0B A;  5AG5 A;  2GLF A;  2PJC A;  3S6H A;  5IV0 A;  3D7H A;  4FD7 A;  5LYI A;  2PJ5 A;  2O53 A;  2Q51 A;  4XPD C;  4BBH A;  4L89 A;  1ZG9 A;  4OP4 A;  2ODF A;  2PE3 A;  4H6U A;  4X8I A;  3R9G A;  5JGF A;  1R57 A;  3BI1 A;  2WPX A;  3EFA A;  2QYV A;  2F7V A;  2YNE A;  2Z3P A;  1U6M A;  3UY5 A;  2QVP A;  4NGT A;  3FJU A;  4G1P A;  3DNS A;  5HH1 A;  2PJ4 A;  4YRH A;  1TF9 A;  3R9F A;  4F9V A;  3SHP A;  4MHZ A;  2B3U A;  2GIV A;  2QJ8 A;  3BXM A;  4KSA A;  2Z0Z A;  2WUU A;  3H5Z A;  4ZYQ A;  4IHM A;  1YW4 A;  1M44 A;  4I49 A;  1TKF A;  4CGL A;  4MCR A;  2PJ1 A;  1M1D A;  2Q4V A;  3CDX A;  2V8H A;  4KOV A;  2NYQ A;  7CPA A;  5ISV A;  4X3R A;  4CAF A;  1YLO A;  4B13 A;  2DPT A;  2YND A;  2Q43 A;  5DWM A;  3H8F A;  4MI4 A;  1I12 A;  3S6K A;  4MFP A;  1NMT A;  1ZLI A;  1Y9K A;  2C27 A;  4CS0 B;  4J3G A;  2ZPA A;  3LD2 A;  4KVM E;  4PXB A;  5FVJ A;  5GCN A;  5LYD A;  2B3V A;  2XEI A;  1RO5 A;  4L8A A;  4OC4 A;  3L2N A;  4UCN A;  3TO9 A;  4M6H A;  3SJG A;  1HDU A;  4ZY2 A;  2AJ6 A;  2Z3L A;  5EC4 A;  5DWN A;  1B6B A;  3F5B A;  1B87 A;  4RI1 A;  1Z2L A;  4NSQ A;  2VL1 A;  3K9T A;  4MHD A;  2ZW7 A;  4A32 A;  2O28 A;  4M3S A;  1HEE A;  4MJ8 A;  2ZEH A;  2P6G A;  1CBX A;  3KHZ A;  2JDC A;  1MJB A;  4U9Y A;  4U9Z A;  4A30 A;  1VHE A;  2J8M A;  3KGQ A;  4ONW A;  4QUS A;  4HNY B;  1J4J A;  3SI0 A;  1M4G A;  2B4D B;  3D3S A;  2D4P A;  1IYK A;  4OC0 A;  3MN8 A;  4OME A;  1KZF A;  5HVH A;  1WK4 A;  3BHX A;  3NFZ A;  4ZY1 A;  3D4U A;  3EC4 A;  1S3Z A;  2CF4 A;  3PFO A;  3VWE A;  4UA3 A;  2CNM A;  3TOA A;  1HDQ A;  4TWE A;  5F49 A;  2PIY A;  2FT0 A;  2GLJ A;  4HNX B;  4UCP A;  3VAT A;  5IB0 A;  1F57 A;  4A95 A;  3PP9 A;  3IU1 A;  2PVV A;  3QB8 A;  4OLL A;  4OC1 A;  3JUW A;  1ON0 A;  2FL4 A;  4W9Y A;  3RO0 A;  4UF4 A;  1QSN A;  1ZO0 A;  4OC3 A;  3V7Z A;  1XF8 A;  1PYT B;  2B4B A;  3D2M A;  5JM6 A;  4AG7 A;  1XBU A;  3H8E A;  5IX3 A;  1FNO A;  3CXS A;  4KSI A;  3TO7 A;  3WC5 A;  4CRZ B;  1LAM A;  4JXR A;  3PGP A;  1XOV A;  1VKC A;  1QSM A;  1JQG A;  4KVO E;  1CG2 A;  1LOK A;  1S60 A;  2Y0M A;  4RUH A;  1IB1 E;  4QB9 A;  2YGW A;  4OAD A;  1R3N A;  3D7F A;  2Q04 A;  2FS5 A;  5AG6 A;  4JXQ A;  1NE9 A;  2PJA A;  1VHO A;  1CM0 A;  1CP7 A;  2AE6 A;  4X2T A;  4B5O A;  4ONU A;  2J9A A;  3IWG A;  2OU2 A;  2ZEM A;  4X5K A;  4AG9 A;  2G3A A;  3FMC A;  2WZN A;  1KUV A;  1MK4 A;  5D29 A;  4C2Z A;  4M6G A;  4P4J A;  2PVW A;  2O4H A;  3IJ3 A;  3TX8 A;  4CYQ A;  1IYL A;  3QNV A;  3GLJ A;  4MRI A;  4XNH B;  5THW A;  5K8M A;  3I1U A;  4E0A A;  1BOB A;  3FH4 A;  4EME A;  5ELY A;  1L0C A;  1Y7E A;  4FAI A;  3NE7 A;  2QEC A;  4NGR A;  3D66 A;  4PQA A;  2PC1 A;  4KLV A;  2Z11 A;  4UWJ A;  2QIR A;  4OC5 A;  4IAV A;  5F48 A;  2ZEE A;  3SI1 A;  1PCA A;  2RB7 A;  2Q4Z A;  1QST A;  1Z8T A;  1Z8L A;  1NSL A;  2Z3N A;  2IQ6 A;  4A2Z A;  1KWM A;  2NMT A;  2R1I A;  4A39 A;  1Y7R A;  2PJ2 A;  4KLW A;  2Z3K A;  4FD5 A;  4CPA A;  2J8R A;  4F6A A;  1Y0Y A;  3IC1 A;  5AGE A;  3FXT A;  3PRT A;  4H2K A;  4UIA A;  3B8G A;  4R6T A;  4ZY0 A;  4F8Z A;  4P44 A;  5J1Q A;  1VIX A;  2VI7 A;  2C1C A;  3SJX A;  5LRK A;  1P4N A;  3KI9 A;  3ZZI A;  3BLN A;  3B7I A;  2Q0Y A;  3FRM A;  2PJ3 A;  2F8H A;  4K3N A;  4MY3 A;  3KKW A;  2OZU A;  3NH8 A;  1S7K A;  3ISX A;  4JD6 A;  4TNU A;  2GRE A;  2I00 A;  4UCM A;  2BOA A;  4Q36 A;  4F9U A;  4Q38 A;  3NH4 A;  1LFW A;  3T8W A;  2JEW A;  4DYO A;  4KZT A;  3P2H A;  2JLM A;  4CGM A;  2PJ6 A;  5H84 A;  1F2P A;  2JDD A;  4OIW A;  3LWU A;  2ATR A;  1Z8X A;  5F46 A;  5K8P A;  2PR8 A;  1CX8 A;  1LCP A;  2OH1 A;  3CXP A;  4WWV A;  2QML A;  3W91 A;  3FEE A;  1TF8 A;  5G1Z A;  2CTC A;  2IJZ A;  4LQG A;  1ARL A;  1TKJ A;  3R95 A;  2F5I A;  5K8O A;  1YQE A;  1I1D A;  4CAW A;  3GKR A;  2WPW A;  4BIN A;  3B35 A;  4NF1 A;  2ZEP A;  4WJB A;  4NGP A;  4GS4 A;  2ZEO A;  5F47 A;  2I79 A;  1QSR A;  1XE4 A;  1XMT A;  3TCV A;  2R8V A;  1OBR A;  4JZ0 A;  2OB0 A;  2Q44 A;  3KAS A;  3GYA A;  4MHY A;  3DSB A;  4FBE A;  2PJ7 A;  2GU2 A;  3F8K A;  3JVN A;  2B5G A;  1VHS A;  2VXK A;  2XEF A;  5BWA B;  5A27 A;  5JH9 A;  5JPH A;  3QAY A;  4EWT A;  1TKH A;  3EY5 A;  3FVL A;  4MCQ A;  5F09 A;  3PB7 X;  1UFH A;  2V8D A;  3RNZ A;  5I0C A;  2PDO A;  3R9E A;  3PBB A;  1Y9W A;  2DF5 A;  4PXD A;  3NE8 A;  2CY2 A;  4CYO A;  1S7L A;  1Z8W A;  3EO4 A;  4IK2 A;  1YRE A;  1IOI A;  1QMU A;  2Q4Y A;  4GM5 A;  2GAN A;  4MHP A;  4JLY A;  4ZBG A;  4P10 A;  1IGB A;  2FIA A;  2VEZ A;  2PCU A;  2NSM A;  2V77 A;  3R96 A;  3RYO A;  1S7F A;  1BLL E;  2Z10 A;  1OZP A;  4NCZ A;  1Q2D A;  2EWB A;  2B4D A;  2HB6 A;  3R1K A;  5CBM A;  1YK3 A;  2GFQ A;  3DR6 A;  3IU2 A;  4NGM A;  4FUU A;  2CXA A;  2OZH A;  2XEG A;  3E0K A;  5IB9 A;  1YME A;  3FYN A;  3K2K A;  1YW6 A;  3TOB A;  4DNC A;  2I3C A;  3WT4 A;  2PRB A;  4NXY A;  2PIZ A;  2P0W A;  4O23 A;  2AFS A;  4FD4 A;  4KOT A;  2XEJ A;  3CXQ A;  5HVF A;  2PR1 A;  4KOR A;  1JWQ A;  4CAE A;  1KUX A;  4UFW A;  4ZGY B;  1Y0R A;  2KCW A;  4LX9 A;  1QSO A;  4R3K A;  3B3S A;  3TT2 A;  4BMH A;  1ZG8 A;  2OR4 A;  2DPS A;  3B3V A;  4UEF A;  3DDD A;  2FE7 A;  5K8N A;  1CPX A;  4PSW A;  3SXO A;  3N7Z A;  1UWY A;  4UFV A;  2AFU A;  5C88 A;  2CNT A;  4K30 A;  1R43 A;  1Z5R A;  2A4N A;  2BL1 A;  1Z9U A;  3IWE A;  4CAX A;  3IEH A;  3CZX A;  4PSX A;  4MFZ A;  2HC9 A;  2Q7B A;  4II9 A;  2YNC A;  4A94 A;  5EMI A;  1AYE A;  2C6P A;  3B3T A;  3CPX A;  3SJE A;  3PB9 X;  3W6X A;  2FCK A;  2PJ8 A;  2YNC C;  5KTD A;  5LYL A;  4YGO A;  2Z3M A;  3A9L A;  4CGP A;  2AFM A;  4E8O A;  2ZEN A;  5J8F A;  5G21 A;  3TC8 A;  1LAP A;  3SXN A;  2V8G A;  1Z4E A;  4UFX A;  4CGN A;  1EE3 P;  4PXE A;  2PJB A;  2Z3O A;  2FVG A;  4QBJ A;  2ZEL A;  2OOT A;  3T90 A;  2ZXV A;  1XRY A;  3K9U A;  5JQ4 A;  5DS0 A;  1K4J A;  1ELL P;  5E96 A;  3TTH A;  4UIB A;  4E2A A;  4B5P B;  4Y49 C;  2ANP A;  3I9S A;  4KUB A;  5J8C A;  3VAR A;  1IOF A;  3RAM A;  4P45 A;  4C7H A;  3GB0 A;  1V0C A;  4CYN A;  3JTK A;  1KUY A;  5D8N A;  4EVY A;  4B11 A;  1BO4 A;  3MRU A;  2G9D A;  4HKF A;  3PB4 X;  3IFE A;  4R57 A;  4MBU A;  2WYR A;  4KOS A;  4LUA A;  2VZY A;  4ZI6 A;  2HV2 A;  2PSW A;  3KR4 A;  4M85 A;  2RC4 A;  4B14 A;  4JJX A;  3B3C A;  1YX0 A;  5HVG A;  2ABZ A;  4ORF A;  1I21 A;  1WWZ A;  4F0Y A;  1YVO A;  1ELM P;  4FWU A;  4R9M A;  5H86 A;  4R3L A;  2AFZ A;  4C68 A;  1QQ9 A;  3D7D A;  4B12 A;  4AB7 A;  2BSW A;  3T9Y A;  4R7M A;  3KQZ A;  3P2F A;  3G3S A;  1Q7L A;  1M4I A;  2EBJ A;  4C2Y A;  3ZJ0 A;  2VQY A;  3SJF A;  3I3G A;  2ARH A;  4PK2 A;  3GIU A;  4AVC A;  2DEA A;  4NGN A;  4C7I A;  4CRY B;  3FX6 A;  4EFD A;  4R87 A;  2RFH A;  3FED A;  5CNP A;  4XPD B;  2C6G A;  3NH5 A;  3B2Y A;  2R98 A;  4PPZ A;  1GHE A;  1TIQ A;  1Z4R A;  4UWI A;  2G3T A;  3V38 A;  3ISZ A;  1H8L A;  4KUA A;  5KTA A;  3D2P A;  4MHN A;  4PXC A;  1YR0 A;  1XFO A;  1YGH A;  4MFJ A;  1A2Z A;  1MJA A;  3H4Q A;  2P6E A;  1YLE A;  3KZW A;  3OWC A;  5AG7 A;  3WR7 A;  2PJ0 A;  2BO9 A;  3KR5 A;  1ZG7 A;  3FB3 A;  4GXH A;  4NGS A;  4P4F A;  2CIJ A;  1IID A;  1PUA A;  1BPM A;  3VH9 A;  3QAH A;  2EK9 A;  3IO1 A;  4JYW A;  3IGR A;  1IY7 A;  3TE4 A;  2BUE A;  4MCS A;  2K5T A;  1Q2C A;  2FIW A;  3TO6 A;  4DUK A;  3FEC A;  3BJ8 A;  3EXN A;  3S9M A;  1CP6 A;  4OC2 A;  5CPA A;  1S7N A;  2AFX A;  2EK8 A;  4MFK A;  3H8G A;  4MFL A;  1CPS A;  2CNS A;  3S6G A;  4BD9 A;  4MMO A;  4FD6 A;  4KSF A;  2R7H A;  4P4I A;  3DGV A;  3BJ7 A;  4H6Z A;  2B5G B;  1TXR A;  3GUX A;  4C2X A;  2JBK A;  5LRG A;  2PQ8 A;  3D68 A;  3PZJ A;  4XPK A;  1AUG A;  2PJ9 A;  3D8P A;  2EUI A;  4B10 A;  1LAN A;  4AVB A;  2J8N A;  4P6Y A;  4KVX A;  4KOW A;  1IIC A;  3IIB A;  1X12 A;  1XJO A;  2Q7S A;  1Q2Y A;  1LRZ A;  3KQX A;  4YU9 A;  4PK3 A;  3CPA A;  5C82 A;  4OKO A;  4ZX9 A;  1RTQ A;  4A37 A;  1NSA A;  2P6F A;  2REE A;  1ZLH A;  1GYT A;  3HLP A;  2IMO A;  4YWY A;  1AMP A;  4IUS A;  2ZED A;  2AFO A;  4LQ6 A;  4PV6 A;  1S5K A;  3FIX A;  5I4M A;  4YFJ A;  3HUV A;  4MFQ A;  5G22 A;  4A38 A;  3S9L A;  4KOX A;  4A33 A;  2FXF A;  2V8V A;  4RN7 A;  1MJ9 A;  2CTB A;  4KS9 A;  3RZA A;  1X10 A;  4NJQ A;  3LOD A;  2AFW A;  1SQH A;  4IF5 A;  3WAB A;  3G8W A;  3BI0 A;  4AXV A;  4R76 A;  4A31 A;  4QC6 A;  4UEZ A;  3PEI A;  3WC6 A;  4M6I A;  4P4E A;  3LMS A;  4Q7A A;  3GY9 A;  1XMB A;  2EVN A;  2VZZ A;  1XIX A;  4KOY A;  3W6S A;  4Z65 A;  3LAC A;  5AG4 A;  2JBJ A;  4DJL A;  2BCO A;  2EO8 A;  2VBQ A;  1PU9 A;  4MCP A;  2REF A;  1ARM A;  2POK A;  4R8F A;  2X7B A;  1M4L A;  1M4D A;  5HXD A;  3FF3 A;  3KL9 A;  3PFE A;  3PB8 X;  6CPA A;  4U5Y A;  2B58 A;  3TFY A;  2PRQ A;  5LYF A;  1FT7 A;  2WSA A;  3FBU A;  4KOU A;  5LRJ A;  4NEX A;  5A28 A;  2ZW5 A;  2IL4 A;  1VGY A;  2HQY A;  3WC7 A;  4HPS A;  4XNH C;  4CGO A;  4HNW B;  2ZOF A;  4NJR A;  3IWW A;  4JWP A;  3CT9 A;  1BAV A;  3DLJ A;  4NGQ A;  3SI2 A;  2JEV A;  4CYP A;  1BPN A;  3VWD A;  4P4D A;  1DE4 C;  3PB6 X;  1CJW A;  3JRU A;  4B5P A;  3F0A A;  2ZW4 A;  4H89 A;  3V8I A;  1FY7 A;  3MGD A;  3D7G A;  3DR8 A;  1RXT A;  4OAE A;  1F2O A; 
#chains in the Genus database with same CATH homology
 2GE3 A;  2ZW6 A;  4XPL A;  4Y49 B;  5KTC A;  2H5M A;  1N71 A;  5HMN A;  4QVT A;  1XEB A;  4RS2 A;  2BEI A;  4F0X A;  5EBV A;  1P0H A;  2DXQ A;  4MY0 A;  2HUZ A;  3FNC A;  5G20 A;  4CAV A;  3S6F A;  2D4O A;  1YVK A;  4AVA A;  2FSR A;  3C26 A;  2OZG A;  4UBR A;  2G0B A;  5AG5 A;  3S6H A;  5IV0 A;  4FD7 A;  4XPD C;  4BBH A;  4L89 A;  3R9G A;  4H6U A;  1R57 A;  2WPX A;  3EFA A;  2YNE A;  2Z3P A;  1U6M A;  3UY5 A;  5HH1 A;  3DNS A;  4YRH A;  3SHP A;  2B3U A;  2GIV A;  4KSA A;  2Z0Z A;  2WUU A;  3H5Z A;  1M44 A;  4I49 A;  4CGL A;  1M1D A;  2Q4V A;  4KOV A;  5ISV A;  4CAF A;  4B13 A;  2DPT A;  2YND A;  5DWM A;  4MI4 A;  1I12 A;  3S6K A;  4MFP A;  1NMT A;  1Y9K A;  2C27 A;  4CS0 B;  4J3G A;  2ZPA A;  3LD2 A;  4KVM E;  5FVJ A;  5GCN A;  2B3V A;  1RO5 A;  4L8A A;  4UCN A;  3TO9 A;  2AJ6 A;  2Z3L A;  5EC4 A;  5DWN A;  1B6B A;  3F5B A;  1B87 A;  4RI1 A;  4NSQ A;  4MHD A;  2ZW7 A;  4A32 A;  2O28 A;  4M3S A;  4MJ8 A;  2P6G A;  2JDC A;  1MJB A;  4U9Y A;  4U9Z A;  4A30 A;  2J8M A;  4QUS A;  4HNY B;  1J4J A;  1M4G A;  2B4D B;  3D3S A;  2D4P A;  1IYK A;  1KZF A;  1WK4 A;  3EC4 A;  1S3Z A;  3VWE A;  4UA3 A;  2CNM A;  3TOA A;  5F49 A;  2FT0 A;  4HNX B;  4UCP A;  5IB0 A;  4A95 A;  3PP9 A;  3IU1 A;  3QB8 A;  4OLL A;  3JUW A;  1ON0 A;  2FL4 A;  1QSN A;  1ZO0 A;  1XF8 A;  3D2M A;  2B4B A;  4AG7 A;  5IX3 A;  3CXS A;  4CRZ B;  3TO7 A;  4JXR A;  3PGP A;  1VKC A;  1QSM A;  4KVO E;  1S60 A;  2Y0M A;  1IB1 E;  4QB9 A;  2YGW A;  4OAD A;  2Q04 A;  2FS5 A;  5AG6 A;  4JXQ A;  1NE9 A;  1CM0 A;  2AE6 A;  4B5O A;  4ONU A;  3IWG A;  2OU2 A;  4X5K A;  4AG9 A;  2G3A A;  1KUV A;  1MK4 A;  4C2Z A;  4CYQ A;  1IYL A;  4XNH B;  4E0A A;  1BOB A;  1L0C A;  3NE7 A;  2QEC A;  2PC1 A;  4KLV A;  2Z11 A;  4UWJ A;  2QIR A;  5F48 A;  1QST A;  1NSL A;  2Z3N A;  4A2Z A;  2NMT A;  2R1I A;  1Y7R A;  4KLW A;  2Z3K A;  4FD5 A;  2J8R A;  4F6A A;  5AGE A;  3FXT A;  3B8G A;  2VI7 A;  1P4N A;  3ZZI A;  3BLN A;  2Q0Y A;  3FRM A;  4MY3 A;  3KKW A;  2OZU A;  1S7K A;  4JD6 A;  4UCM A;  2I00 A;  4Q36 A;  4Q38 A;  4KZT A;  3P2H A;  2JLM A;  4CGM A;  5H84 A;  2JDD A;  2ATR A;  5F46 A;  2PR8 A;  2OH1 A;  3CXP A;  3W91 A;  2QML A;  5G1Z A;  3R95 A;  2F5I A;  1I1D A;  4CAW A;  3GKR A;  2WPW A;  4NF1 A;  4GS4 A;  5F47 A;  2I79 A;  1QSR A;  1XE4 A;  1XMT A;  3TCV A;  2R8V A;  2OB0 A;  2Q44 A;  3GYA A;  3DSB A;  3F8K A;  3JVN A;  2B5G A;  1VHS A;  2VXK A;  5BWA B;  5A27 A;  5JPH A;  3EY5 A;  1UFH A;  5I0C A;  2PDO A;  3R9E A;  1Y9W A;  2CY2 A;  4CYO A;  1S7L A;  3EO4 A;  1YRE A;  2Q4Y A;  2GAN A;  4JLY A;  4ZBG A;  2FIA A;  2VEZ A;  3R96 A;  3RYO A;  1S7F A;  2Z10 A;  1OZP A;  4NCZ A;  1Q2D A;  2B4D A;  3R1K A;  1YK3 A;  3DR6 A;  3IU2 A;  2CXA A;  2OZH A;  3E0K A;  3FYN A;  3TOB A;  4DNC A;  2PRB A;  4NXY A;  2P0W A;  4FD4 A;  4KOT A;  3CXQ A;  2PR1 A;  4KOR A;  4CAE A;  1KUX A;  4UFW A;  4ZGY B;  2KCW A;  4LX9 A;  1QSO A;  4R3K A;  3TT2 A;  4BMH A;  2DPS A;  3DDD A;  2FE7 A;  4PSW A;  3SXO A;  3N7Z A;  4UFV A;  5C88 A;  2CNT A;  4K30 A;  2A4N A;  2BL1 A;  1Z9U A;  3IWE A;  4CAX A;  2Q7B A;  4PSX A;  4II9 A;  4MFZ A;  2YNC A;  3W6X A;  2FCK A;  2YNC C;  5KTD A;  4YGO A;  2Z3M A;  3A9L A;  4CGP A;  4E8O A;  5J8F A;  5G21 A;  3SXN A;  4UFX A;  1Z4E A;  4CGN A;  2Z3O A;  4QBJ A;  3T90 A;  2ZXV A;  3K9U A;  5JQ4 A;  1K4J A;  5E96 A;  3TTH A;  4E2A A;  4B5P B;  4Y49 C;  3I9S A;  4KUB A;  5J8C A;  4C7H A;  4CYN A;  1V0C A;  3JTK A;  1KUY A;  4EVY A;  4B11 A;  1BO4 A;  4HKF A;  4R57 A;  4MBU A;  4KOS A;  4LUA A;  2VZY A;  2HV2 A;  2PSW A;  4M85 A;  2RC4 A;  4B14 A;  4JJX A;  1YX0 A;  4ORF A;  1I21 A;  1WWZ A;  4F0Y A;  1YVO A;  4R9M A;  5H86 A;  4R3L A;  4C68 A;  4B12 A;  4AB7 A;  2BSW A;  3T9Y A;  3P2F A;  3G3S A;  1M4I A;  4C2Y A;  3ZJ0 A;  2VQY A;  3I3G A;  2ARH A;  4PK2 A;  4AVC A;  4C7I A;  4CRY B;  4R87 A;  5CNP A;  4XPD B;  2R98 A;  1GHE A;  1TIQ A;  1Z4R A;  4UWI A;  2G3T A;  4KUA A;  5KTA A;  3D2P A;  1YR0 A;  1YGH A;  4MFJ A;  1MJA A;  3H4Q A;  2P6E A;  1YLE A;  5AG7 A;  3OWC A;  3WR7 A;  3FB3 A;  1IID A;  1PUA A;  3QAH A;  3IGR A;  3TE4 A;  2BUE A;  2K5T A;  1Q2C A;  2FIW A;  3TO6 A;  3BJ8 A;  3EXN A;  1S7N A;  4MFK A;  4MFL A;  2CNS A;  3S6G A;  3R9F A;  4FD6 A;  4KSF A;  2R7H A;  3BJ7 A;  4H6Z A;  2B5G B;  4C2X A;  2PQ8 A;  3PZJ A;  4XPK A;  3D8P A;  2EUI A;  4B10 A;  4AVB A;  2J8N A;  4KVX A;  4KOW A;  1IIC A;  1Q2Y A;  1LRZ A;  4PK3 A;  5C82 A;  2P6F A;  2REE A;  4IUS A;  4PV6 A;  1S5K A;  3FIX A;  4YFJ A;  4MFQ A;  5G22 A;  4KOX A;  4A33 A;  2FXF A;  1MJ9 A;  4KS9 A;  3LOD A;  4IF5 A;  1SQH A;  3G8W A;  4A31 A;  4QC6 A;  3GY9 A;  2EVN A;  2VZZ A;  1XIX A;  4KOY A;  3W6S A;  5AG4 A;  2VBQ A;  1PU9 A;  2REF A;  2X7B A;  1M4D A;  4U5Y A;  2B58 A;  3TFY A;  2WSA A;  3FBU A;  4KOU A;  4NEX A;  5A28 A;  2ZW5 A;  2IL4 A;  2HQY A;  4XNH C;  4CGO A;  4HNW B;  4JWP A;  2JEV A;  4CYP A;  3VWD A;  1CJW A;  4B5P A;  3F0A A;  2ZW4 A;  4H89 A;  3V8I A;  1FY7 A;  3MGD A;  3DR8 A;  1RXT A;  4OAE A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...