2WPXA

Tandem gnat protein from the clavulanic acid biosynthesis pathway (with accoa)
Total Genus 87
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
87
sequence length
334
structure length
326
Chain Sequence
AGELEFVPLAANDDETVGQWLDLMALAAETGPRAAPPCNVDMVGSLRFAPPATALDDWVVRSGGRVVGALRLALPDGAPTARVDQLLVHPGRRRRGIGRALWAHARELARKHDRTTLTATVVESLPSGPAQDPGPAAFAAAMGAHRSDIPAGTHQWLDLDRHDPLADGVPAVPAGYSLVTWGTITPDEYAVPVSELELRAAQEVRTSYARQFETMRVGRGRRAYHTGAVHDATGALAGYTSVSKTTGNPAYALQGMTVVHREHRGHALGTLLKLANLEYVLRHEPEVRLVETANAEDNHPMIAVNAALGFEPYDRWVFWTAEAGPS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystallographic and mass spectrometric analyses of a tandem GNAT protein from the clavulanic acid biosynthesis pathway.
pubmed doi rcsb
source organism Streptomyces clavuligerus
molecule tags Transferase
molecule keywords ORF14
total genus 87
structure length 326
sequence length 334
chains with identical sequence B
ec nomenclature ec 2.3.1.-:
pdb deposition date 2009-08-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00583 Acetyltransf_1 Acetyltransferase (GNAT) family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.630.30 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Aminopeptidase 2wpxA00
2PQ8A 1YX0A 3DSBA 3TOAA 4NSQA 3C26A 2VEZA 4KLWA 5IV0A 2Q04A 2GANA 2ZPAA 2PDOA 4HNWB 1PU9A 3K9UA 1Y9WA 2AE6A 4U9ZA 3IWGA 4UWJA 4F0YA 3DR6A 2P6EA 4KLVA 5DWNA 3G3SA 2OB0A 4JD6A 4XPDC 1S7FA 2Q4VA 4KOTA 1NE9A 3EFAA 1I12A 2X7BA 1S5KA 3VWDA 2P6FA 3S6GA 3S6FA 1Q2CA 1NMTA 4CS0B 4AVCA 3P2FA 1KUYA 4MHDA 3E0KA 4HNYB 5HH1A 1V0CA 5HMNA 2GIVA 4GS4A 2D4OA 1J4JA 2BUEA 3FNCA 3CXQA 4OADA 3IGRA 2OZUA 5ISVA 4AG9A 1CJWA 4IUSA 4MI4A 3R96A 2VBQA 2OH1A 1S60A 1IICA 2EUIA 2PR8A 3FYNA 2EVNA 1Q2YA 1SQHA 2F5IA 3F0AA 3DDDA 5DWMA 2BEIA 2FXFA 2B58A 4F6AA 1IYKA 3GY9A 3BJ8A 4JJXA 4JLYA 5F46A 2O28A 1U6MA 4NXYA 4KUBA 3FXTA 3TE4A 4QC6A 2D4PA 4PSXA 1M4GA 1KUVA 1M4IA 1XF8A 2BSWA 3F8KA 5EC4A 3TO7A 1GHEA 4AVBA 1XMTA 2I79A 3I9SA 4R9MA 3W6SA 4FD4A 3GYAA 2ATRA 3PZJA 1VKCA 4J3GA 5F49A 2FS5A 2ZW5A 4PSWA 3TOBA 5CNPA 4L8AA 3TO9A 2C27A 4RS2A 4YRHA 1XE4A 4AVAA 2A4NA 4L89A 4B5OA 1YR0A 4JWPA 2BL1A 4UWIA 4FD6A 4CAVA 4NF1A 1YLEA 1PUAA 5KTDA 2P0WA 5H84A 2REFA 2ZXVA 2KCWA 1P4NA 2K5TA 2FIAA 4ZBGA 1QSMA 4KZTA 2G3AA 3S6HA 3R9GA 5KTAA 1Z4RA 1IIDA 1P0HA 3SXNA 3S6KA 4EVYA 1KUXA 2GE3A 1CM0A 4QUSA 3QB8A 2PC1A 1RXTA 3JUWA 3SHPA 4QBJA 5C88A 2B3VA 2FE7A 4PK3A 1XIXA 2P6GA 3QAHA 2VI7A 2R8VA 1KZFA 1S7NA 3G8WA 2QECA 4OLLA 1M1DA 4KOYA 1I1DA 2REEA 4CRZB 3EC4A 3BJ7A 1YVKA 4ONUA 3TO6A 1S7KA 4UBRA 2Z11A 3KKWA 4Y49C 4HKFA 4R87A 2R7HA 2HUZA 4XPKA 4KUAA 1Y7RA 4Y49B 1S7LA 1UFHA 3UY5A 1Z4EA 5H86A 4XNHB 4JXQA 1ON0A 3D2PA 3TTHA 2J8MA 4AB7A 2R98A 3ZZIA 3NE7A 2CY2A 2ZW6A 3MGDA 1TIQA 1OZPA 2J8RA 3JVNA 3N7ZA 1QSTA 1YVOA 3B8GA 2PSWA 5F48A 5GCNA 4E8OA 4M85A 3DNSA 4KOUA 4RI1A 3LODA 4KOVA 3FRMA 4YGOA 2FIWA 3CXSA 2VZYA 5JPHA 1XEBA 5FVJA 5IB0A 1IB1E 5KTCA 3P2HA 2PR1A 1YK3A 4YFJA 3LD2A 2OZHA 2H5MA 2B4BA 4JXRA 3BLNA 4XPLA 4KVXA 2Q4YA 4E2AA 3F5BA 2B5GA 2B5GB 5I0CA 4NCZA 2DXQA 5E96A 1WWZA 4UA3A 4MY3A 3TT2A 4KOSA 1MJBA 2Z10A 4H6ZA 4KVME 4B5PB 4U5YA 3R9EA 2CNMA 3EXNA 5J8FA 3T9YA 2IL4A 4KOWA 4BMHA 5C82A 2OU2A 3EO4A 4R3LA 4LUAA 3T90A 2I00A 2WPXA 2G3TA 4K30A 3SXOA 2B4DA 4CRYB 1M44A 5EBVA 4CAWA 3FBUA 2FT0A 4MBUA 2J8NA 4DNCA 2WPWA 2CNTA 3R1KA 3VWEA 4E0AA 2Q44A 2Q0YA 2Z0ZA 3FIXA 2Q7BA 3GKRA 1RO5A 1B6BA 1BOBA 2G0BA 3FB3A 3PGPA 2PRBA 3R95A 4AG7A 3D3SA 3D8PA 3W91A 3RYOA 5F47A 2Y0MA 3W6XA 1FY7A 1S3ZA 3CXPA 3V8IA 4CAXA 2NMTA 1LRZA 1N71A 4IF5A 4I49A 3R9FA 2B4DB 3TFYA 2FSRA 4B5PA 3WR7A 4OAEA 2HQYA 4LX9A 4PK2A 4R3KA 1NSLA 4U9YA 1MK4A 3PP9A 1M4DA 4II9A 2VQYA 1YREA 1Y9KA 2B3UA 4MY0A 1QSRA 4H89A 2VZZA 4KVOE 2RC4A 5JQ4A 4H6UA 4KOXA 2JDCA 2JDDA 4QB9A 4FD7A 5J8CA 2FCKA 3D2MA 2OZGA 3OWCA 1Q2DA 4XNHC 2AJ6A 1MJ9A 2JLMA 4MJ8A 2ZW7A 1IYLA 4KORA 1VHSA 4X5KA 2VXKA 2CNSA 1YGHA 4R57A 1R57A 4HNXB 2HV2A 1QSOA 3DR8A 1QSNA 4FD5A 1K4JA 4M3SA 1B87A 2R1IA 3ZJ0A 3EY5A 4PV6A 4NEXA 3H4QA 5IX3A 3TCVA 4XPDB 1Z9UA 1MJAA 1WK4A 4QVTA 3I3GA 2QIRA 2ZW4A 2QMLA 4ORFA 2FL4A 1BO4A 2JEVA 1L0CA 1I21A 2ARHA
chains in the Genus database with same CATH superfamily
2QVPA 2PQ8A 4A31A 4MMOA 1BAVA 2ZOFA 3MN8A 1YX0A 1VHEA 3DSBA 2PJ1A 2AFMA 3KZWA 4P4FA 3PBEA 3TOAA 4R7MA 3PB8X 4NSQA 3C26A 4X8IA 5C88A 2VEZA 4KLWA 5IV0A 2Q04A 2ZELA 2GANA 2V8DA 2ZPAA 4MRIA 2I3CA 3KR4A 1CPSA 2PDOA 4PXBA 4Q7AA 5CBMA 4HNWB 1PU9A 2J9AA 1Y9WA 3K9UA 4MCRA 1LFWA 2AE6A 4U9ZA 3CT9A 3IWGA 4UWJA 4F0YA 3DR6A 8CPAA 2P6EA 4KLVA 5DWNA 4R76A 3PB6X 3G3SA 2OB0A 1AUGA 4JD6A 1XBUA 2DPTA 4XPDC 3RAMA 1S7FA 2Q4VA 5G1ZA 3D67A 2AFUA 2PJ3A 4KOTA 2AFZA 1NE9A 5AG5A 2DF5A 1M4LA 3EFAA 1PYTB 1I12A 3QAYA 1Q7LA 2X7BA 1S5KA 3VWDA 2P6FA 3FJUA 3S6GA 3S6FA 3KQZA 4CGOA 1Q2CA 1NMTA 2ZEOA 1LCPA 2V77A 4CS0B 4KS9A 3FEDA 2Q51A 4AVCA 2PIYA 3P2FA 4ZY1A 1KUYA 4MHDA 3E0KA 4HNYB 1Z8WA 5HH1A 1V0CA 4RN7A 1XMBA 5HMNA 2QJ8A 3FVLA 2GIVA 4KSAA 2PVWA 5JM6A 1ARLA 4GS4A 2D4OA 2AFWA 1J4JA 2BUEA 3FNCA 2Z3PA 3BXMA 4P6YA 1HDQA 3CXQA 4OADA 3IGRA 3PB9X 4UEFA 3ISXA 4OMEA 2OZUA 5ISVA 4AG9A 1CJWA 4C68A 4MHPA 3GB0A 5ELYA 3S9LA 3KL9A 1QQ9A 3B3TA 4IUSA 3TC8A 2OR4A 4MFJA 4MI4A 3GUXA 3R96A 4MFLA 2VBQA 2OH1A 2ABZA 1S60A 4ZYQA 1IICA 4FWUA 5AGEA 2EUIA 2PR8A 3H5ZA 2ZEPA 3VH9A 2G9DA 1F2PA 2EVNA 1XRYA 2Q7SA 3FYNA 3K2KA 1Q2YA 1TF8A 2IQ6A 4P4EA 4MFZA 1SQHA 2F5IA 5D29A 1IY7A 2BCOA 2CTBA 3DDDA 3F0AA 2V8VA 5DWMA 2BEIA 5LRKA 2FXFA 2YNCA 2B58A 4F6AA 3IIBA 4H2KA 5THWA 4BBHA 2Q4ZA 1IYKA 3GY9A 1TKJA 3BJ8A 4JJXA 3CPXA 4JLYA 4TWEA 5F46A 3KR5A 1ZG8A 2O28A 1U6MA 4NXYA 1Z8XA 3CZXA 3LACA 4KUBA 3WABA 3FXTA 3VARA 3TE4A 4QC6A 2D4PA 4PSXA 1M4GA 1KUVA 1M4IA 3KHZA 1XF8A 4CGPA 2BSWA 3F8KA 5EC4A 3B3CA 4KSIA 1HEEA 3TO7A 4ZX8A 3T8WA 1GHEA 2PIZA 2PJ9A 4PXCA 1CBXA 4FAIA 4AVBA 1XJOA 1XMTA 4B14A 5K8NA 2I79A 3I9SA 4R9MA 3W6SA 4FD4A 3GYAA 3MRUA 3VATA 2ATRA 3PZJA 3NFZA 1VKCA 4R8FA 4J3GA 5F49A 3LWUA 2FS5A 4OC4A 2C6PA 2ZW5A 3V38A 3D7GA 4PSWA 4R6TA 3TOBA 5CNPA 4GM5A 4L8AA 4PXDA 3TO9A 5HXDA 2C27A 1LAPA 1YMEA 2XEIA 3KGQA 4OIDA 4RS2A 4YRHA 1RTQA 3I1UA 1XE4A 3GIUA 3IU1A 2EK8A 4A95A 1DE4C 2WUUA 4Q36A 3NA6A 1JWQA 4AVAA 4NGTA 5G22A 2A4NA 4L89A 4B5OA 4MCSA 1YR0A 4P44A 4JWPA 2BL1A 3IU2A 4UWIA 4M6IA 4FD6A 4CAVA 4NF1A 4X3RA 1NSAA 1YLEA 4UFWA 2Z3LA 1LANA 1PUAA 4PPZA 1IOFA 3D66A 5KTDA 2P0WA 5H84A 2REFA 2ZXVA 3QNVA 4P45A 2KCWA 1P4NA 2K5TA 2Z3OA 3RBUA 3SI1A 5J1QA 2PJ4A 1TKFA 2FIAA 4ZBGA 2V8GA 1QSMA 4KZTA 2G3AA 1Y7EA 2PVVA 3KHXA 3S6HA 4CYOA 4UF4A 3R9GA 3V7ZA 3PEIA 3B35A 5KTAA 4LQGA 1Z4RA 1ZG7A 4W9YA 1IIDA 1P0HA 3D7DA 3H8FA 4JZ0A 3SXNA 4MHYA 3S6KA 3WT4A 4EVYA 1KUXA 2GE3A 4OC3A 3RZAA 2GREA 1CM0A 4NGPA 4QUSA 3B3WA 3QB8A 2DEAA 2PC1A 1RXTA 3JUWA 4A33A 3SJFA 3SHPA 4QBJA 3B2YA 2B3VA 2FE7A 4OP4A 1XIXA 2P6GA 3QAHA 2EBJA 4PK3A 4P4IA 5AG6A 2VI7A 2R8VA 3S9NA 1KZFA 1S7NA 3G8WA 4C2XA 3L2NA 4ONWA 4F0XA 2QECA 1AYEA 4OLLA 1M1DA 4KOYA 2POKA 3DGVA 2PCUA 1I1DA 1HDUA 2EK9A 3FF3A 2REEA 3CDXA 4C2YA 4CRZB 4MFPA 3EC4A 3BJ7A 2DPSA 2HC9A 1GYTA 1A2ZA 3SJEA 5F09A 3DLJA 1YVKA 4ONUA 3TO6A 1S7KA 3N5FA 4UBRA 5BWAB 2Z3NA 2Z11A 3KKWA 4Y49C 4HKFA 3H8EA 4R87A 4PQAA 3PBBA 3FH4A 2R7HA 2HUZA 4XPKA 4A94A 5JH9A 2CF4A 3NH5A 4KUAA 1F2OA 2WSAA 1Y7RA 4Y49B 1ZLHA 4LQ6A 2BOAA 4KSFA 2ZEDA 1S7LA 4A30A 4X2TA 4MFQA 1UFHA 1FT7A 4O23A 5A28A 5LYFA 3UY5A 3TX8A 4UIBA 1Z4EA 2RFHA 4GXHA 1CPXA 2IJZA 4A38A 2ZEHA 1LAMA 5A27A 5H86A 4NGSA 4XNHB 4JXQA 4M6GA 4BINA 1CX8A 2GLJA 1ON0A 3WC5A 1R3NA 3IFEA 1BPMA 3IEHA 3D2PA 3TTHA 2J8MA 1JQGA 2JEWA 4AB7A 4CAEA 2R98A 3ZZIA 2AFSA 3NE7A 4UCPA 2CY2A 5D8NA 2PJAA 1Z2LA 3D4UA 2ZW6A 3SI0A 5HVFA 3MGDA 1TIQA 1OZPA 2J8RA 4YWYA 3HUVA 1H8LA 3JVNA 1F57A 2ZEEA 3N7ZA 1QSTA 1CP7A 1YVOA 4F8ZA 2XEFA 4WWVA 3B8GA 2PSWA 4MCPA 5F48A 3FEEA 5GCNA 4E8OA 3FMCA 4MXUA 4CAFA 4BD9A 3ISZA 4M6HA 4M85A 4UCMA 3DNSA 4KOUA 2Z3KA 4RI1A 3LODA 4KOVA 3FRMA 4YGOA 4ZY0A 2FIWA 2YNCC 3CXSA 3NH4A 3FECA 2VZYA 5JPHA 1VHOA 5K8MA 1XEBA 5FVJA 1EE3P 2PJ6A 5IB0A 3D7HA 4CYPA 1IB1E 2GU2A 3P2HA 5KTCA 2PR1A 1YK3A 2PE3A 4YFJA 4Z65A 1IOIA 3LD2A 4B11A 2ZEGA 2OZHA 2H5MA 2B4BA 4JXRA 3BLNA 4A32A 2IMOA 1PCAA 1X10A 5LRGA 5LRJA 7CPAA 4XPLA 3B3VA 1X12A 4KVXA 1Y0YA 2RB7A 3BHXA 2Q4YA 3SJXA 4A39A 4E2AA 3JTKA 6CPAA 1CP6A 4IK2A 3F5BA 2B5GA 2B5GB 4NJQA 4UFVA 5I0CA 2HB6A 1OBRA 4NCZA 2DXQA 4OC1A 1YW6A 5E96A 1ELLP 1WWZA 4PXEA 3NE8A 3HLPA 4JYWA 4UA3A 5HVHA 4MY3A 3BI1A 2AFXA 3TT2A 4KOSA 1MJBA 2XEJA 2Z10A 2JBKA 4TNUA 4ZGYB 4H6ZA 4P4JA 2PJBA 2Q43A 4KVME 4B5PB 1BPNA 3IJ3A 2JBJA 4EWTA 4U5YA 2C6CA 2CNMA 3EXNA 2EO8A 3JRUA 3R9EA 3T9YA 5J8FA 2O4HA 5CPAA 2IL4A 4KOWA 4BMHA 3IO1A 5C82A 1Z8TA 2OU2A 3EO4A 4R3LA 4CGMA 4LUAA 3T90A 1Y0RA 2I00A 2WPXA 2G3TA 4K30A 2BO9A 1CG2A 4OC5A 3SXOA 3K9TA 2WZNA 4UFXA 1XFOA 2ZEMA 4MHZA 2B4DA 4UEEA 1BLLE 2WYRA 4CRYB 2XEGA 1M44A 1KWMA 5EBVA 3RO0A 4CAWA 1Z5RA 3FBUA 2FT0A 4NGNA 4MBUA 2J8NA 4DNCA 2WPWA 2CNTA 4B13A 4ZI6A 4DJLA 3R1KA 3VWEA 1Z8LA 3RNZA 2VL1A 3SI2A 4CGNA 4E0AA 4NGQA 4UIAA 2Q44A 4RUHA 2Q0YA 4A37A 5EMIA 2CXAA 2Z0ZA 2ZEFA 3FIXA 3WC6A 2Q7BA 5JGFA 3D68A 3GKRA 1IU8A 5IB9A 1RO5A 3B7IA 2PJ7A 1B6BA 2AFOA 4YU9A 5HVGA 1BOBA 2G0BA 3FB3A 2F8HA 3CPAA 1ELMP 2GFQA 3IC1A 5I4MA 3PGPA 2PRBA 3R95A 4AG7A 3D3SA 3D8PA 4ZX9A 3RYOA 2ODFA 5F47A 4FUUA 2Y0MA 3W91A 3W6XA 1ZO0A 1FY7A 3GLJA 4EFDA 1S3ZA 3CXPA 3V8IA 4P4BA 2PJ5A 4CAXA 2NMTA 4MFKA 4WJBA 1LRZA 3LMSA 1N71A 1VGYA 4IF5A 1YLOA 4UEZA 4B6ZA 4I49A 4OC2A 5LYLA 3R9FA 5AG4A 2B4DB 4IAVA 2FSRA 4B5PA 3WR7A 4DUKA 3TFYA 4OAEA 2HQYA 3BI0A 4LX9A 4PK2A 4R3KA 2CIJA 1NSLA 2YGWA 1TXRA 2ZOGA 4MCQA 5G21A 4U9YA 1MK4A 3PP9A 1YQEA 5G20A 1DTDA 1M4DA 3NH8A 4P10A 3S9MA 4B12A 4II9A 4OKOA 2NSMA 2VQYA 2PJCA 1YREA 2GLFA 1AMPA 1Y9KA 2B3UA 2ANPA 1QSRA 2FVGA 2NYQA 2VZZA 4H89A 4KVOE 2RC4A 4MY0A 5LYIA 4A2ZA 5JQ4A 3PB4X 2F7VA 4H6UA 4G1PA 2C1CA 2YNDA 4KOXA 2OOTA 4CPAA 5AG7A 2JDCA 2JDDA 4QB9A 1FNOA 4FD7A 5J8CA 4IHMA 3KI9A 3PFEA 2FCKA 2PJ8A 2OZGA 3D2MA 3OWCA 4NFRA 1ZLIA 2PRQA 2Z3MA 1Q2DA 4HPSA 4NJRA 4XNHC 3WC7A 3PB7X 4C7IA 1QMUA 4DYOA 2AJ6A 1MJ9A 4C7HA 2CTCA 2JLMA 3IWWA 4MJ8A 1YW4A 2ZW7A 1IYLA 3PFOA 4CYQA 2PJ2A 4KORA 1VHSA 4X5KA 1IGBA 4C2ZA 2VXKA 2CNSA 1LOKA 1TKHA 1YGHA 4R57A 2V8HA 4F9VA 1R57A 2EWBA 4HNXB 5LYDA 2HV2A 1QSOA 4FBEA 3D7FA 1YSJA 3DR8A 1UWYA 1QSNA 1ZG9A 3IWEA 4FD5A 4MHNA 1K4JA 1VIXA 1XOVA 4M3SA 1B87A 2R1IA 4NGRA 4ZY2A 3ZJ0A 4F9UA 1ARMA 2ZENA 5DS0A 3H8GA 3EY5A 4PV6A 4NEXA 4EMEA 3H4QA 5IX3A 2YNEA 3TCVA 4XPDB 1Z9UA 1MJAA 4CGLA 4B10A 1WK4A 3KQXA 4OIWA 4NGMA 4P4DA 4QVTA 4OC0A 4UCNA 3I3GA 3KASA 2O53A 2PJ0A 2QIRA 2ZW4A 2QMLA 3PRTA 4ORFA 2QYVA 5K8OA 4K3NA 1R43A 2FL4A 1BO4A 2C6GA 2JEVA 3A9LA 3FX6A 1TF9A 3SJGA 4AXVA 5K8PA 1L0CA 4Q38A 1I21A 2ARHA 4CYNA 3B3SA
chains in the Genus database with same CATH topology
2PQ8A 4A31A 1YX0A 3DSBA 3TOAA 4NSQA 3C26A 2VEZA 4KLWA 5IV0A 2Q04A 2GANA 2ZPAA 2PDOA 4HNWB 1PU9A 3K9UA 1Y9WA 2AE6A 4U9ZA 3IWGA 4UWJA 4F0YA 3DR6A 2P6EA 4KLVA 5DWNA 3G3SA 2OB0A 4JD6A 2DPTA 4XPDC 1S7FA 2Q4VA 5G1ZA 4KOTA 5AG5A 1NE9A 3EFAA 1I12A 2X7BA 1S5KA 3VWDA 2P6FA 3S6GA 3S6FA 4CGOA 1Q2CA 1NMTA 4CS0B 4KS9A 4AVCA 3P2FA 1KUYA 4MHDA 3E0KA 4HNYB 5HH1A 1V0CA 5HMNA 2GIVA 4KSAA 4GS4A 2D4OA 1J4JA 2BUEA 3FNCA 2Z3PA 3CXQA 4OADA 3IGRA 2OZUA 5ISVA 4AG9A 1CJWA 4C68A 4IUSA 4MFJA 4MI4A 3R96A 4MFLA 2VBQA 2OH1A 1S60A 1IICA 5AGEA 2EUIA 2PR8A 3H5ZA 3FYNA 2EVNA 1Q2YA 4MFZA 1SQHA 2F5IA 3F0AA 3DDDA 5DWMA 2BEIA 2FXFA 2YNCA 2B58A 4F6AA 4BBHA 1IYKA 3GY9A 3BJ8A 4JJXA 4JLYA 5F46A 2O28A 1U6MA 4NXYA 4KUBA 3FXTA 3TE4A 4QC6A 2D4PA 4PSXA 1M4GA 1KUVA 1M4IA 4CGPA 1XF8A 2BSWA 3F8KA 5EC4A 3TO7A 1GHEA 4AVBA 1XMTA 4B14A 2I79A 3I9SA 4R9MA 3W6SA 4FD4A 3GYAA 2ATRA 3PZJA 1VKCA 4J3GA 5F49A 2FS5A 2ZW5A 4PSWA 3TOBA 5CNPA 4L8AA 3TO9A 2C27A 4RS2A 4YRHA 3IU1A 1XE4A 4A95A 2WUUA 4Q36A 4AVAA 5G22A 2A4NA 4L89A 4B5OA 1YR0A 4JWPA 2BL1A 3IU2A 4UWIA 4FD6A 4CAVA 4NF1A 1YLEA 4UFWA 2Z3LA 1PUAA 5KTDA 2P0WA 5H84A 2REFA 2ZXVA 2KCWA 1P4NA 2K5TA 2Z3OA 2FIAA 4ZBGA 1QSMA 4KZTA 2G3AA 3S6HA 4CYOA 3R9GA 5KTAA 1Z4RA 1IIDA 1P0HA 3SXNA 3S6KA 4EVYA 1KUXA 2GE3A 1CM0A 4QUSA 3QB8A 2PC1A 1RXTA 3JUWA 4A33A 3SHPA 4QBJA 5C88A 2B3VA 2FE7A 4PK3A 1XIXA 2P6GA 3QAHA 5AG6A 2VI7A 2R8VA 1KZFA 1S7NA 3G8WA 4C2XA 4F0XA 2QECA 4OLLA 1M1DA 4KOYA 1I1DA 2REEA 4C2YA 4CRZB 4MFPA 3EC4A 3BJ7A 2DPSA 1YVKA 4ONUA 3TO6A 1S7KA 4UBRA 5BWAB 2Z3NA 2Z11A 3KKWA 4Y49C 4HKFA 4R87A 2R7HA 2HUZA 4XPKA 4KUAA 2WSAA 1Y7RA 4Y49B 4KSFA 1S7LA 4A30A 4MFQA 1UFHA 5A28A 3UY5A 1Z4EA 5A27A 5H86A 4XNHB 4JXQA 1ON0A 3D2PA 3TTHA 2J8MA 4AB7A 4CAEA 2R98A 3ZZIA 3NE7A 4UCPA 2CY2A 2ZW6A 3MGDA 1TIQA 1OZPA 2J8RA 3JVNA 3N7ZA 1QSTA 1YVOA 3B8GA 2PSWA 5F48A 5GCNA 4E8OA 4CAFA 4M85A 4UCMA 3DNSA 4KOUA 2Z3KA 4RI1A 3LODA 4KOVA 3FRMA 4YGOA 2FIWA 2YNCC 3CXSA 2VZYA 5JPHA 1XEBA 5FVJA 5IB0A 4CYPA 1IB1E 5KTCA 3P2HA 2PR1A 1YK3A 4YFJA 3LD2A 4B11A 2OZHA 2H5MA 2B4BA 4JXRA 3BLNA 4A32A 4XPLA 4KVXA 2Q4YA 4E2AA 3JTKA 3F5BA 2B5GA 2B5GB 5I0CA 4UFVA 4NCZA 2DXQA 5E96A 1WWZA 4UA3A 4MY3A 3TT2A 4KOSA 1MJBA 2Z10A 4ZGYB 4H6ZA 4KVME 4B5PB 4U5YA 3R9EA 2CNMA 3EXNA 5J8FA 3T9YA 4KOWA 2IL4A 4BMHA 5C82A 2OU2A 3EO4A 4R3LA 4CGMA 4LUAA 3T90A 2I00A 2WPXA 2G3TA 4K30A 3SXOA 4UFXA 2B4DA 4CRYB 1M44A 5EBVA 4CAWA 3FBUA 2FT0A 4MBUA 2J8NA 4DNCA 2WPWA 2CNTA 4B13A 3R1KA 3VWEA 4CGNA 4E0AA 2Q44A 2Q0YA 2CXAA 2Z0ZA 3FIXA 2Q7BA 3GKRA 1RO5A 1B6BA 1BOBA 2G0BA 3FB3A 3PGPA 2PRBA 3R95A 4AG7A 3D3SA 3D8PA 3W91A 3RYOA 5F47A 2Y0MA 3W6XA 1ZO0A 1FY7A 1S3ZA 3CXPA 3V8IA 4CAXA 2NMTA 4MFKA 1LRZA 1N71A 4IF5A 4I49A 3R9FA 5AG4A 2B4DB 3TFYA 2FSRA 4B5PA 3WR7A 4OAEA 2HQYA 4LX9A 4PK2A 4R3KA 1NSLA 2YGWA 5G21A 4U9YA 1MK4A 3PP9A 5G20A 1M4DA 4B12A 4II9A 2VQYA 1YREA 1Y9KA 2B3UA 4MY0A 1QSRA 4H89A 2VZZA 4KVOE 2RC4A 5JQ4A 4A2ZA 4H6UA 2YNDA 4KOXA 5AG7A 2JDCA 2JDDA 4QB9A 4FD7A 5J8CA 2FCKA 3D2MA 2OZGA 3OWCA 2Z3MA 1Q2DA 4XNHC 4C7IA 2AJ6A 1MJ9A 4C7HA 2JLMA 4MJ8A 2ZW7A 1IYLA 4CYQA 4KORA 1VHSA 4X5KA 4C2ZA 2VXKA 2CNSA 1YGHA 4R57A 1R57A 4HNXB 2HV2A 1QSOA 3DR8A 1QSNA 3IWEA 4FD5A 1K4JA 4M3SA 1B87A 2R1IA 3ZJ0A 3EY5A 4PV6A 4NEXA 3H4QA 5IX3A 2YNEA 3TCVA 4XPDB 1Z9UA 1MJAA 4CGLA 4B10A 1WK4A 4QVTA 4UCNA 3I3GA 2QIRA 2ZW4A 2QMLA 4ORFA 2FL4A 1BO4A 2JEVA 3A9LA 1L0CA 4Q38A 1I21A 2ARHA 4CYNA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2PQ8 A;  1YX0 A;  3DSB A;  3TOA A;  4NSQ A;  3C26 A;  2VEZ A;  4KLW A;  5IV0 A;  2Q04 A;  2GAN A;  2ZPA A;  2PDO A;  4HNW B;  1PU9 A;  3K9U A;  1Y9W A;  2AE6 A;  4U9Z A;  3IWG A;  4UWJ A;  4F0Y A;  3DR6 A;  2P6E A;  4KLV A;  5DWN A;  3G3S A;  2OB0 A;  4JD6 A;  4XPD C;  1S7F A;  2Q4V A;  4KOT A;  1NE9 A;  3EFA A;  1I12 A;  2X7B A;  1S5K A;  3VWD A;  2P6F A;  3S6G A;  3S6F A;  1Q2C A;  1NMT A;  4CS0 B;  4AVC A;  3P2F A;  1KUY A;  4MHD A;  3E0K A;  4HNY B;  5HH1 A;  1V0C A;  5HMN A;  2GIV A;  4GS4 A;  2D4O A;  1J4J A;  2BUE A;  3FNC A;  3CXQ A;  4OAD A;  3IGR A;  2OZU A;  5ISV A;  4AG9 A;  1CJW A;  4IUS A;  4MI4 A;  3R96 A;  2VBQ A;  2OH1 A;  1S60 A;  1IIC A;  2EUI A;  2PR8 A;  3FYN A;  2EVN A;  1Q2Y A;  1SQH A;  2F5I A;  3F0A A;  3DDD A;  5DWM A;  2BEI A;  2FXF A;  2B58 A;  4F6A A;  1IYK A;  3GY9 A;  3BJ8 A;  4JJX A;  4JLY A;  5F46 A;  2O28 A;  1U6M A;  4NXY A;  4KUB A;  3FXT A;  3TE4 A;  4QC6 A;  2D4P A;  4PSX A;  1M4G A;  1KUV A;  1M4I A;  1XF8 A;  2BSW A;  3F8K A;  5EC4 A;  3TO7 A;  1GHE A;  4AVB A;  1XMT A;  2I79 A;  3I9S A;  4R9M A;  3W6S A;  4FD4 A;  3GYA A;  2ATR A;  3PZJ A;  1VKC A;  4J3G A;  5F49 A;  2FS5 A;  2ZW5 A;  4PSW A;  3TOB A;  5CNP A;  4L8A A;  3TO9 A;  2C27 A;  4RS2 A;  4YRH A;  1XE4 A;  4AVA A;  2A4N A;  4L89 A;  4B5O A;  1YR0 A;  4JWP A;  2BL1 A;  4UWI A;  4FD6 A;  4CAV A;  4NF1 A;  1YLE A;  1PUA A;  5KTD A;  2P0W A;  5H84 A;  2REF A;  2ZXV A;  2KCW A;  1P4N A;  2K5T A;  2FIA A;  4ZBG A;  1QSM A;  4KZT A;  2G3A A;  3S6H A;  3R9G A;  5KTA A;  1Z4R A;  1IID A;  1P0H A;  3SXN A;  3S6K A;  4EVY A;  1KUX A;  2GE3 A;  1CM0 A;  4QUS A;  3QB8 A;  2PC1 A;  1RXT A;  3JUW A;  3SHP A;  4QBJ A;  5C88 A;  2B3V A;  2FE7 A;  4PK3 A;  1XIX A;  2P6G A;  3QAH A;  2VI7 A;  2R8V A;  1KZF A;  1S7N A;  3G8W A;  2QEC A;  4OLL A;  1M1D A;  4KOY A;  1I1D A;  2REE A;  4CRZ B;  3EC4 A;  3BJ7 A;  1YVK A;  4ONU A;  3TO6 A;  1S7K A;  4UBR A;  2Z11 A;  3KKW A;  4Y49 C;  4HKF A;  4R87 A;  2R7H A;  2HUZ A;  4XPK A;  4KUA A;  1Y7R A;  4Y49 B;  1S7L A;  1UFH A;  3UY5 A;  1Z4E A;  5H86 A;  4XNH B;  4JXQ A;  1ON0 A;  3D2P A;  3TTH A;  2J8M A;  4AB7 A;  2R98 A;  3ZZI A;  3NE7 A;  2CY2 A;  2ZW6 A;  3MGD A;  1TIQ A;  1OZP A;  2J8R A;  3JVN A;  3N7Z A;  1QST A;  1YVO A;  3B8G A;  2PSW A;  5F48 A;  5GCN A;  4E8O A;  4M85 A;  3DNS A;  4KOU A;  4RI1 A;  3LOD A;  4KOV A;  3FRM A;  4YGO A;  2FIW A;  3CXS A;  2VZY A;  5JPH A;  1XEB A;  5FVJ A;  5IB0 A;  1IB1 E;  5KTC A;  3P2H A;  2PR1 A;  1YK3 A;  4YFJ A;  3LD2 A;  2OZH A;  2H5M A;  2B4B A;  4JXR A;  3BLN A;  4XPL A;  4KVX A;  2Q4Y A;  4E2A A;  3F5B A;  2B5G A;  2B5G B;  5I0C A;  4NCZ A;  2DXQ A;  5E96 A;  1WWZ A;  4UA3 A;  4MY3 A;  3TT2 A;  4KOS A;  1MJB A;  2Z10 A;  4H6Z A;  4KVM E;  4B5P B;  4U5Y A;  3R9E A;  2CNM A;  3EXN A;  5J8F A;  3T9Y A;  2IL4 A;  4KOW A;  4BMH A;  5C82 A;  2OU2 A;  3EO4 A;  4R3L A;  4LUA A;  3T90 A;  2I00 A;  2WPX A;  2G3T A;  4K30 A;  3SXO A;  2B4D A;  4CRY B;  1M44 A;  5EBV A;  4CAW A;  3FBU A;  2FT0 A;  4MBU A;  2J8N A;  4DNC A;  2WPW A;  2CNT A;  3R1K A;  3VWE A;  4E0A A;  2Q44 A;  2Q0Y A;  2Z0Z A;  3FIX A;  2Q7B A;  3GKR A;  1RO5 A;  1B6B A;  1BOB A;  2G0B A;  3FB3 A;  3PGP A;  2PRB A;  3R95 A;  4AG7 A;  3D3S A;  3D8P A;  3W91 A;  3RYO A;  5F47 A;  2Y0M A;  3W6X A;  1FY7 A;  1S3Z A;  3CXP A;  3V8I A;  4CAX A;  2NMT A;  1LRZ A;  1N71 A;  4IF5 A;  4I49 A;  3R9F A;  2B4D B;  3TFY A;  2FSR A;  4B5P A;  3WR7 A;  4OAE A;  2HQY A;  4LX9 A;  4PK2 A;  4R3K A;  1NSL A;  4U9Y A;  1MK4 A;  3PP9 A;  1M4D A;  4II9 A;  2VQY A;  1YRE A;  1Y9K A;  2B3U A;  4MY0 A;  1QSR A;  4H89 A;  2VZZ A;  4KVO E;  2RC4 A;  5JQ4 A;  4H6U A;  4KOX A;  2JDC A;  2JDD A;  4QB9 A;  4FD7 A;  5J8C A;  2FCK A;  3D2M A;  2OZG A;  3OWC A;  1Q2D A;  4XNH C;  2AJ6 A;  1MJ9 A;  2JLM A;  4MJ8 A;  2ZW7 A;  1IYL A;  4KOR A;  1VHS A;  4X5K A;  2VXK A;  2CNS A;  1YGH A;  4R57 A;  1R57 A;  4HNX B;  2HV2 A;  1QSO A;  3DR8 A;  1QSN A;  4FD5 A;  1K4J A;  4M3S A;  1B87 A;  2R1I A;  3ZJ0 A;  3EY5 A;  4PV6 A;  4NEX A;  3H4Q A;  5IX3 A;  3TCV A;  4XPD B;  1Z9U A;  1MJA A;  1WK4 A;  4QVT A;  3I3G A;  2QIR A;  2ZW4 A;  2QML A;  4ORF A;  2FL4 A;  1BO4 A;  2JEV A;  1L0C A;  1I21 A;  2ARH A; 
#chains in the Genus database with same CATH topology
 2QVP A;  2PQ8 A;  4A31 A;  4MMO A;  1BAV A;  2ZOF A;  3MN8 A;  1YX0 A;  1VHE A;  3DSB A;  2PJ1 A;  2AFM A;  3KZW A;  4P4F A;  3PBE A;  3TOA A;  4R7M A;  3PB8 X;  4NSQ A;  3C26 A;  4X8I A;  5C88 A;  2VEZ A;  4KLW A;  5IV0 A;  2Q04 A;  2ZEL A;  2GAN A;  2V8D A;  2ZPA A;  4MRI A;  2I3C A;  3KR4 A;  1CPS A;  2PDO A;  4PXB A;  4Q7A A;  5CBM A;  4HNW B;  1PU9 A;  2J9A A;  1Y9W A;  3K9U A;  4MCR A;  1LFW A;  2AE6 A;  4U9Z A;  3CT9 A;  3IWG A;  4UWJ A;  4F0Y A;  3DR6 A;  8CPA A;  2P6E A;  4KLV A;  5DWN A;  4R76 A;  3PB6 X;  3G3S A;  2OB0 A;  1AUG A;  4JD6 A;  1XBU A;  2DPT A;  4XPD C;  3RAM A;  1S7F A;  2Q4V A;  5G1Z A;  3D67 A;  2AFU A;  2PJ3 A;  4KOT A;  2AFZ A;  1NE9 A;  5AG5 A;  2DF5 A;  1M4L A;  3EFA A;  1PYT B;  1I12 A;  3QAY A;  1Q7L A;  2X7B A;  1S5K A;  3VWD A;  2P6F A;  3FJU A;  3S6G A;  3S6F A;  3KQZ A;  4CGO A;  1Q2C A;  1NMT A;  2ZEO A;  1LCP A;  2V77 A;  4CS0 B;  4KS9 A;  3FED A;  2Q51 A;  4AVC A;  2PIY A;  3P2F A;  4ZY1 A;  1KUY A;  4MHD A;  3E0K A;  4HNY B;  1Z8W A;  5HH1 A;  1V0C A;  4RN7 A;  1XMB A;  5HMN A;  2QJ8 A;  3FVL A;  2GIV A;  4KSA A;  2PVW A;  5JM6 A;  1ARL A;  4GS4 A;  2D4O A;  2AFW A;  1J4J A;  2BUE A;  3FNC A;  2Z3P A;  3BXM A;  4P6Y A;  1HDQ A;  3CXQ A;  4OAD A;  3IGR A;  3PB9 X;  4UEF A;  3ISX A;  4OME A;  2OZU A;  5ISV A;  4AG9 A;  1CJW A;  4C68 A;  4MHP A;  3GB0 A;  5ELY A;  3S9L A;  3KL9 A;  1QQ9 A;  3B3T A;  4IUS A;  3TC8 A;  2OR4 A;  4MFJ A;  4MI4 A;  3GUX A;  3R96 A;  4MFL A;  2VBQ A;  2OH1 A;  2ABZ A;  1S60 A;  4ZYQ A;  1IIC A;  4FWU A;  5AGE A;  2EUI A;  2PR8 A;  3H5Z A;  2ZEP A;  3VH9 A;  2G9D A;  1F2P A;  2EVN A;  1XRY A;  2Q7S A;  3FYN A;  3K2K A;  1Q2Y A;  1TF8 A;  2IQ6 A;  4P4E A;  4MFZ A;  1SQH A;  2F5I A;  5D29 A;  1IY7 A;  2BCO A;  2CTB A;  3DDD A;  3F0A A;  2V8V A;  5DWM A;  2BEI A;  5LRK A;  2FXF A;  2YNC A;  2B58 A;  4F6A A;  3IIB A;  4H2K A;  5THW A;  4BBH A;  2Q4Z A;  1IYK A;  3GY9 A;  1TKJ A;  3BJ8 A;  4JJX A;  3CPX A;  4JLY A;  4TWE A;  5F46 A;  3KR5 A;  1ZG8 A;  2O28 A;  1U6M A;  4NXY A;  1Z8X A;  3CZX A;  3LAC A;  4KUB A;  3WAB A;  3FXT A;  3VAR A;  3TE4 A;  4QC6 A;  2D4P A;  4PSX A;  1M4G A;  1KUV A;  1M4I A;  3KHZ A;  1XF8 A;  4CGP A;  2BSW A;  3F8K A;  5EC4 A;  3B3C A;  4KSI A;  1HEE A;  3TO7 A;  4ZX8 A;  3T8W A;  1GHE A;  2PIZ A;  2PJ9 A;  4PXC A;  1CBX A;  4FAI A;  4AVB A;  1XJO A;  1XMT A;  4B14 A;  5K8N A;  2I79 A;  3I9S A;  4R9M A;  3W6S A;  4FD4 A;  3GYA A;  3MRU A;  3VAT A;  2ATR A;  3PZJ A;  3NFZ A;  1VKC A;  4R8F A;  4J3G A;  5F49 A;  3LWU A;  2FS5 A;  4OC4 A;  2C6P A;  2ZW5 A;  3V38 A;  3D7G A;  4PSW A;  4R6T A;  3TOB A;  5CNP A;  4GM5 A;  4L8A A;  4PXD A;  3TO9 A;  5HXD A;  2C27 A;  1LAP A;  1YME A;  2XEI A;  3KGQ A;  4OID A;  4RS2 A;  4YRH A;  1RTQ A;  3I1U A;  1XE4 A;  3GIU A;  3IU1 A;  2EK8 A;  4A95 A;  1DE4 C;  2WUU A;  4Q36 A;  3NA6 A;  1JWQ A;  4AVA A;  4NGT A;  5G22 A;  2A4N A;  4L89 A;  4B5O A;  4MCS A;  1YR0 A;  4P44 A;  4JWP A;  2BL1 A;  3IU2 A;  4UWI A;  4M6I A;  4FD6 A;  4CAV A;  4NF1 A;  4X3R A;  1NSA A;  1YLE A;  4UFW A;  2Z3L A;  1LAN A;  1PUA A;  4PPZ A;  1IOF A;  3D66 A;  5KTD A;  2P0W A;  5H84 A;  2REF A;  2ZXV A;  3QNV A;  4P45 A;  2KCW A;  1P4N A;  2K5T A;  2Z3O A;  3RBU A;  3SI1 A;  5J1Q A;  2PJ4 A;  1TKF A;  2FIA A;  4ZBG A;  2V8G A;  1QSM A;  4KZT A;  2G3A A;  1Y7E A;  2PVV A;  3KHX A;  3S6H A;  4CYO A;  4UF4 A;  3R9G A;  3V7Z A;  3PEI A;  3B35 A;  5KTA A;  4LQG A;  1Z4R A;  1ZG7 A;  4W9Y A;  1IID A;  1P0H A;  3D7D A;  3H8F A;  4JZ0 A;  3SXN A;  4MHY A;  3S6K A;  3WT4 A;  4EVY A;  1KUX A;  2GE3 A;  4OC3 A;  3RZA A;  2GRE A;  1CM0 A;  4NGP A;  4QUS A;  3B3W A;  3QB8 A;  2DEA A;  2PC1 A;  1RXT A;  3JUW A;  4A33 A;  3SJF A;  3SHP A;  4QBJ A;  3B2Y A;  2B3V A;  2FE7 A;  4OP4 A;  1XIX A;  2P6G A;  3QAH A;  2EBJ A;  4PK3 A;  4P4I A;  5AG6 A;  2VI7 A;  2R8V A;  3S9N A;  1KZF A;  1S7N A;  3G8W A;  4C2X A;  3L2N A;  4ONW A;  4F0X A;  2QEC A;  1AYE A;  4OLL A;  1M1D A;  4KOY A;  2POK A;  3DGV A;  2PCU A;  1I1D A;  1HDU A;  2EK9 A;  3FF3 A;  2REE A;  3CDX A;  4C2Y A;  4CRZ B;  4MFP A;  3EC4 A;  3BJ7 A;  2DPS A;  2HC9 A;  1GYT A;  1A2Z A;  3SJE A;  5F09 A;  3DLJ A;  1YVK A;  4ONU A;  3TO6 A;  1S7K A;  3N5F A;  4UBR A;  5BWA B;  2Z3N A;  2Z11 A;  3KKW A;  4Y49 C;  4HKF A;  3H8E A;  4R87 A;  4PQA A;  3PBB A;  3FH4 A;  2R7H A;  2HUZ A;  4XPK A;  4A94 A;  5JH9 A;  2CF4 A;  3NH5 A;  4KUA A;  1F2O A;  2WSA A;  1Y7R A;  4Y49 B;  1ZLH A;  4LQ6 A;  2BOA A;  4KSF A;  2ZED A;  1S7L A;  4A30 A;  4X2T A;  4MFQ A;  1UFH A;  1FT7 A;  4O23 A;  5A28 A;  5LYF A;  3UY5 A;  3TX8 A;  4UIB A;  1Z4E A;  2RFH A;  4GXH A;  1CPX A;  2IJZ A;  4A38 A;  2ZEH A;  1LAM A;  5A27 A;  5H86 A;  4NGS A;  4XNH B;  4JXQ A;  4M6G A;  4BIN A;  1CX8 A;  2GLJ A;  1ON0 A;  3WC5 A;  1R3N A;  3IFE A;  1BPM A;  3IEH A;  3D2P A;  3TTH A;  2J8M A;  1JQG A;  2JEW A;  4AB7 A;  4CAE A;  2R98 A;  3ZZI A;  2AFS A;  3NE7 A;  4UCP A;  2CY2 A;  5D8N A;  2PJA A;  1Z2L A;  3D4U A;  2ZW6 A;  3SI0 A;  5HVF A;  3MGD A;  1TIQ A;  1OZP A;  2J8R A;  4YWY A;  3HUV A;  1H8L A;  3JVN A;  1F57 A;  2ZEE A;  3N7Z A;  1QST A;  1CP7 A;  1YVO A;  4F8Z A;  2XEF A;  4WWV A;  3B8G A;  2PSW A;  4MCP A;  5F48 A;  3FEE A;  5GCN A;  4E8O A;  3FMC A;  4MXU A;  4CAF A;  4BD9 A;  3ISZ A;  4M6H A;  4M85 A;  4UCM A;  3DNS A;  4KOU A;  2Z3K A;  4RI1 A;  3LOD A;  4KOV A;  3FRM A;  4YGO A;  4ZY0 A;  2FIW A;  2YNC C;  3CXS A;  3NH4 A;  3FEC A;  2VZY A;  5JPH A;  1VHO A;  5K8M A;  1XEB A;  5FVJ A;  1EE3 P;  2PJ6 A;  5IB0 A;  3D7H A;  4CYP A;  1IB1 E;  2GU2 A;  3P2H A;  5KTC A;  2PR1 A;  1YK3 A;  2PE3 A;  4YFJ A;  4Z65 A;  1IOI A;  3LD2 A;  4B11 A;  2ZEG A;  2OZH A;  2H5M A;  2B4B A;  4JXR A;  3BLN A;  4A32 A;  2IMO A;  1PCA A;  1X10 A;  5LRG A;  5LRJ A;  7CPA A;  4XPL A;  3B3V A;  1X12 A;  4KVX A;  1Y0Y A;  2RB7 A;  3BHX A;  2Q4Y A;  3SJX A;  4A39 A;  4E2A A;  3JTK A;  6CPA A;  1CP6 A;  4IK2 A;  3F5B A;  2B5G A;  2B5G B;  4NJQ A;  4UFV A;  5I0C A;  2HB6 A;  1OBR A;  4NCZ A;  2DXQ A;  4OC1 A;  1YW6 A;  5E96 A;  1ELL P;  1WWZ A;  4PXE A;  3NE8 A;  3HLP A;  4JYW A;  4UA3 A;  5HVH A;  4MY3 A;  3BI1 A;  2AFX A;  3TT2 A;  4KOS A;  1MJB A;  2XEJ A;  2Z10 A;  2JBK A;  4TNU A;  4ZGY B;  4H6Z A;  4P4J A;  2PJB A;  2Q43 A;  4KVM E;  4B5P B;  1BPN A;  3IJ3 A;  2JBJ A;  4EWT A;  4U5Y A;  2C6C A;  2CNM A;  3EXN A;  2EO8 A;  3JRU A;  3R9E A;  3T9Y A;  5J8F A;  2O4H A;  5CPA A;  2IL4 A;  4KOW A;  4BMH A;  3IO1 A;  5C82 A;  1Z8T A;  2OU2 A;  3EO4 A;  4R3L A;  4CGM A;  4LUA A;  3T90 A;  1Y0R A;  2I00 A;  2WPX A;  2G3T A;  4K30 A;  2BO9 A;  1CG2 A;  4OC5 A;  3SXO A;  3K9T A;  2WZN A;  4UFX A;  1XFO A;  2ZEM A;  4MHZ A;  2B4D A;  4UEE A;  1BLL E;  2WYR A;  4CRY B;  2XEG A;  1M44 A;  1KWM A;  5EBV A;  3RO0 A;  4CAW A;  1Z5R A;  3FBU A;  2FT0 A;  4NGN A;  4MBU A;  2J8N A;  4DNC A;  2WPW A;  2CNT A;  4B13 A;  4ZI6 A;  4DJL A;  3R1K A;  3VWE A;  1Z8L A;  3RNZ A;  2VL1 A;  3SI2 A;  4CGN A;  4E0A A;  4NGQ A;  4UIA A;  2Q44 A;  4RUH A;  2Q0Y A;  4A37 A;  5EMI A;  2CXA A;  2Z0Z A;  2ZEF A;  3FIX A;  3WC6 A;  2Q7B A;  5JGF A;  3D68 A;  3GKR A;  1IU8 A;  5IB9 A;  1RO5 A;  3B7I A;  2PJ7 A;  1B6B A;  2AFO A;  4YU9 A;  5HVG A;  1BOB A;  2G0B A;  3FB3 A;  2F8H A;  3CPA A;  1ELM P;  2GFQ A;  3IC1 A;  5I4M A;  3PGP A;  2PRB A;  3R95 A;  4AG7 A;  3D3S A;  3D8P A;  4ZX9 A;  3RYO A;  2ODF A;  5F47 A;  4FUU A;  2Y0M A;  3W91 A;  3W6X A;  1ZO0 A;  1FY7 A;  3GLJ A;  4EFD A;  1S3Z A;  3CXP A;  3V8I A;  4P4B A;  2PJ5 A;  4CAX A;  2NMT A;  4MFK A;  4WJB A;  1LRZ A;  3LMS A;  1N71 A;  1VGY A;  4IF5 A;  1YLO A;  4UEZ A;  4B6Z A;  4I49 A;  4OC2 A;  5LYL A;  3R9F A;  5AG4 A;  2B4D B;  4IAV A;  2FSR A;  4B5P A;  3WR7 A;  4DUK A;  3TFY A;  4OAE A;  2HQY A;  3BI0 A;  4LX9 A;  4PK2 A;  4R3K A;  2CIJ A;  1NSL A;  2YGW A;  1TXR A;  2ZOG A;  4MCQ A;  5G21 A;  4U9Y A;  1MK4 A;  3PP9 A;  1YQE A;  5G20 A;  1DTD A;  1M4D A;  3NH8 A;  4P10 A;  3S9M A;  4B12 A;  4II9 A;  4OKO A;  2NSM A;  2VQY A;  2PJC A;  1YRE A;  2GLF A;  1AMP A;  1Y9K A;  2B3U A;  2ANP A;  1QSR A;  2FVG A;  2NYQ A;  2VZZ A;  4H89 A;  4KVO E;  2RC4 A;  4MY0 A;  5LYI A;  4A2Z A;  5JQ4 A;  3PB4 X;  2F7V A;  4H6U A;  4G1P A;  2C1C A;  2YND A;  4KOX A;  2OOT A;  4CPA A;  5AG7 A;  2JDC A;  2JDD A;  4QB9 A;  1FNO A;  4FD7 A;  5J8C A;  4IHM A;  3KI9 A;  3PFE A;  2FCK A;  2PJ8 A;  2OZG A;  3D2M A;  3OWC A;  4NFR A;  1ZLI A;  2PRQ A;  2Z3M A;  1Q2D A;  4HPS A;  4NJR A;  4XNH C;  3WC7 A;  3PB7 X;  4C7I A;  1QMU A;  4DYO A;  2AJ6 A;  1MJ9 A;  4C7H A;  2CTC A;  2JLM A;  3IWW A;  4MJ8 A;  1YW4 A;  2ZW7 A;  1IYL A;  3PFO A;  4CYQ A;  2PJ2 A;  4KOR A;  1VHS A;  4X5K A;  1IGB A;  4C2Z A;  2VXK A;  2CNS A;  1LOK A;  1TKH A;  1YGH A;  4R57 A;  2V8H A;  4F9V A;  1R57 A;  2EWB A;  4HNX B;  5LYD A;  2HV2 A;  1QSO A;  4FBE A;  3D7F A;  1YSJ A;  3DR8 A;  1UWY A;  1QSN A;  1ZG9 A;  3IWE A;  4FD5 A;  4MHN A;  1K4J A;  1VIX A;  1XOV A;  4M3S A;  1B87 A;  2R1I A;  4NGR A;  4ZY2 A;  3ZJ0 A;  4F9U A;  1ARM A;  2ZEN A;  5DS0 A;  3H8G A;  3EY5 A;  4PV6 A;  4NEX A;  4EME A;  3H4Q A;  5IX3 A;  2YNE A;  3TCV A;  4XPD B;  1Z9U A;  1MJA A;  4CGL A;  4B10 A;  1WK4 A;  3KQX A;  4OIW A;  4NGM A;  4P4D A;  4QVT A;  4OC0 A;  4UCN A;  3I3G A;  3KAS A;  2O53 A;  2PJ0 A;  2QIR A;  2ZW4 A;  2QML A;  3PRT A;  4ORF A;  2QYV A;  5K8O A;  4K3N A;  1R43 A;  2FL4 A;  1BO4 A;  2C6G A;  2JEV A;  3A9L A;  3FX6 A;  1TF9 A;  3SJG A;  4AXV A;  5K8P A;  1L0C A;  4Q38 A;  1I21 A;  2ARH A;  4CYN A;  3B3S A; 
#chains in the Genus database with same CATH homology
 2PQ8 A;  4A31 A;  1YX0 A;  3DSB A;  3TOA A;  4NSQ A;  3C26 A;  2VEZ A;  4KLW A;  5IV0 A;  2Q04 A;  2GAN A;  2ZPA A;  2PDO A;  4HNW B;  1PU9 A;  3K9U A;  1Y9W A;  2AE6 A;  4U9Z A;  3IWG A;  4UWJ A;  4F0Y A;  3DR6 A;  2P6E A;  4KLV A;  5DWN A;  3G3S A;  2OB0 A;  4JD6 A;  2DPT A;  4XPD C;  1S7F A;  2Q4V A;  5G1Z A;  4KOT A;  5AG5 A;  1NE9 A;  3EFA A;  1I12 A;  2X7B A;  1S5K A;  3VWD A;  2P6F A;  3S6G A;  3S6F A;  4CGO A;  1Q2C A;  1NMT A;  4CS0 B;  4KS9 A;  4AVC A;  3P2F A;  1KUY A;  4MHD A;  3E0K A;  4HNY B;  5HH1 A;  1V0C A;  5HMN A;  2GIV A;  4KSA A;  4GS4 A;  2D4O A;  1J4J A;  2BUE A;  3FNC A;  2Z3P A;  3CXQ A;  4OAD A;  3IGR A;  2OZU A;  5ISV A;  4AG9 A;  1CJW A;  4C68 A;  4IUS A;  4MFJ A;  4MI4 A;  3R96 A;  4MFL A;  2VBQ A;  2OH1 A;  1S60 A;  1IIC A;  5AGE A;  2EUI A;  2PR8 A;  3H5Z A;  3FYN A;  2EVN A;  1Q2Y A;  4MFZ A;  1SQH A;  2F5I A;  3F0A A;  3DDD A;  5DWM A;  2BEI A;  2FXF A;  2YNC A;  2B58 A;  4F6A A;  4BBH A;  1IYK A;  3GY9 A;  3BJ8 A;  4JJX A;  4JLY A;  5F46 A;  2O28 A;  1U6M A;  4NXY A;  4KUB A;  3FXT A;  3TE4 A;  4QC6 A;  2D4P A;  4PSX A;  1M4G A;  1KUV A;  1M4I A;  4CGP A;  1XF8 A;  2BSW A;  3F8K A;  5EC4 A;  3TO7 A;  1GHE A;  4AVB A;  1XMT A;  4B14 A;  2I79 A;  3I9S A;  4R9M A;  3W6S A;  4FD4 A;  3GYA A;  2ATR A;  3PZJ A;  1VKC A;  4J3G A;  5F49 A;  2FS5 A;  2ZW5 A;  4PSW A;  3TOB A;  5CNP A;  4L8A A;  3TO9 A;  2C27 A;  4RS2 A;  4YRH A;  3IU1 A;  1XE4 A;  4A95 A;  2WUU A;  4Q36 A;  4AVA A;  5G22 A;  2A4N A;  4L89 A;  4B5O A;  1YR0 A;  4JWP A;  2BL1 A;  3IU2 A;  4UWI A;  4FD6 A;  4CAV A;  4NF1 A;  1YLE A;  4UFW A;  2Z3L A;  1PUA A;  5KTD A;  2P0W A;  5H84 A;  2REF A;  2ZXV A;  2KCW A;  1P4N A;  2K5T A;  2Z3O A;  2FIA A;  4ZBG A;  1QSM A;  4KZT A;  2G3A A;  3S6H A;  4CYO A;  3R9G A;  5KTA A;  1Z4R A;  1IID A;  1P0H A;  3SXN A;  3S6K A;  4EVY A;  1KUX A;  2GE3 A;  1CM0 A;  4QUS A;  3QB8 A;  2PC1 A;  1RXT A;  3JUW A;  4A33 A;  3SHP A;  4QBJ A;  5C88 A;  2B3V A;  2FE7 A;  4PK3 A;  1XIX A;  2P6G A;  3QAH A;  5AG6 A;  2VI7 A;  2R8V A;  1KZF A;  1S7N A;  3G8W A;  4C2X A;  4F0X A;  2QEC A;  4OLL A;  1M1D A;  4KOY A;  1I1D A;  2REE A;  4C2Y A;  4CRZ B;  4MFP A;  3EC4 A;  3BJ7 A;  2DPS A;  1YVK A;  4ONU A;  3TO6 A;  1S7K A;  4UBR A;  5BWA B;  2Z3N A;  2Z11 A;  3KKW A;  4Y49 C;  4HKF A;  4R87 A;  2R7H A;  2HUZ A;  4XPK A;  4KUA A;  2WSA A;  1Y7R A;  4Y49 B;  4KSF A;  1S7L A;  4A30 A;  4MFQ A;  1UFH A;  5A28 A;  3UY5 A;  1Z4E A;  5A27 A;  5H86 A;  4XNH B;  4JXQ A;  1ON0 A;  3D2P A;  3TTH A;  2J8M A;  4AB7 A;  4CAE A;  2R98 A;  3ZZI A;  3NE7 A;  4UCP A;  2CY2 A;  2ZW6 A;  3MGD A;  1TIQ A;  1OZP A;  2J8R A;  3JVN A;  3N7Z A;  1QST A;  1YVO A;  3B8G A;  2PSW A;  5F48 A;  5GCN A;  4E8O A;  4CAF A;  4M85 A;  4UCM A;  3DNS A;  4KOU A;  2Z3K A;  4RI1 A;  3LOD A;  4KOV A;  3FRM A;  4YGO A;  2FIW A;  2YNC C;  3CXS A;  2VZY A;  5JPH A;  1XEB A;  5FVJ A;  5IB0 A;  4CYP A;  1IB1 E;  5KTC A;  3P2H A;  2PR1 A;  1YK3 A;  4YFJ A;  3LD2 A;  4B11 A;  2OZH A;  2H5M A;  2B4B A;  4JXR A;  3BLN A;  4A32 A;  4XPL A;  4KVX A;  2Q4Y A;  4E2A A;  3JTK A;  3F5B A;  2B5G A;  2B5G B;  5I0C A;  4UFV A;  4NCZ A;  2DXQ A;  5E96 A;  1WWZ A;  4UA3 A;  4MY3 A;  3TT2 A;  4KOS A;  1MJB A;  2Z10 A;  4ZGY B;  4H6Z A;  4KVM E;  4B5P B;  4U5Y A;  3R9E A;  2CNM A;  3EXN A;  5J8F A;  3T9Y A;  4KOW A;  2IL4 A;  4BMH A;  5C82 A;  2OU2 A;  3EO4 A;  4R3L A;  4CGM A;  4LUA A;  3T90 A;  2I00 A;  2WPX A;  2G3T A;  4K30 A;  3SXO A;  4UFX A;  2B4D A;  4CRY B;  1M44 A;  5EBV A;  4CAW A;  3FBU A;  2FT0 A;  4MBU A;  2J8N A;  4DNC A;  2WPW A;  2CNT A;  4B13 A;  3R1K A;  3VWE A;  4CGN A;  4E0A A;  2Q44 A;  2Q0Y A;  2CXA A;  2Z0Z A;  3FIX A;  2Q7B A;  3GKR A;  1RO5 A;  1B6B A;  1BOB A;  2G0B A;  3FB3 A;  3PGP A;  2PRB A;  3R95 A;  4AG7 A;  3D3S A;  3D8P A;  3W91 A;  3RYO A;  5F47 A;  2Y0M A;  3W6X A;  1ZO0 A;  1FY7 A;  1S3Z A;  3CXP A;  3V8I A;  4CAX A;  2NMT A;  4MFK A;  1LRZ A;  1N71 A;  4IF5 A;  4I49 A;  3R9F A;  5AG4 A;  2B4D B;  3TFY A;  2FSR A;  4B5P A;  3WR7 A;  4OAE A;  2HQY A;  4LX9 A;  4PK2 A;  4R3K A;  1NSL A;  2YGW A;  5G21 A;  4U9Y A;  1MK4 A;  3PP9 A;  5G20 A;  1M4D A;  4B12 A;  4II9 A;  2VQY A;  1YRE A;  1Y9K A;  2B3U A;  4MY0 A;  1QSR A;  4H89 A;  2VZZ A;  4KVO E;  2RC4 A;  5JQ4 A;  4A2Z A;  4H6U A;  2YND A;  4KOX A;  5AG7 A;  2JDC A;  2JDD A;  4QB9 A;  4FD7 A;  5J8C A;  2FCK A;  3D2M A;  2OZG A;  3OWC A;  2Z3M A;  1Q2D A;  4XNH C;  4C7I A;  2AJ6 A;  1MJ9 A;  4C7H A;  2JLM A;  4MJ8 A;  2ZW7 A;  1IYL A;  4CYQ A;  4KOR A;  1VHS A;  4X5K A;  4C2Z A;  2VXK A;  2CNS A;  1YGH A;  4R57 A;  1R57 A;  4HNX B;  2HV2 A;  1QSO A;  3DR8 A;  1QSN A;  3IWE A;  4FD5 A;  1K4J A;  4M3S A;  1B87 A;  2R1I A;  3ZJ0 A;  3EY5 A;  4PV6 A;  4NEX A;  3H4Q A;  5IX3 A;  2YNE A;  3TCV A;  4XPD B;  1Z9U A;  1MJA A;  4CGL A;  4B10 A;  1WK4 A;  4QVT A;  4UCN A;  3I3G A;  2QIR A;  2ZW4 A;  2QML A;  4ORF A;  2FL4 A;  1BO4 A;  2JEV A;  3A9L A;  1L0C A;  4Q38 A;  1I21 A;  2ARH A;  4CYN A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...