2WPXA

Tandem gnat protein from the clavulanic acid biosynthesis pathway (with accoa)
Total Genus 87
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
87
sequence length
334
structure length
326
Chain Sequence
AGELEFVPLAANDDETVGQWLDLMALAAETGPRAAPPCNVDMVGSLRFAPPATALDDWVVRSGGRVVGALRLALPDGAPTARVDQLLVHPGRRRRGIGRALWAHARELARKHDRTTLTATVVESLPSGPAQDPGPAAFAAAMGAHRSDIPAGTHQWLDLDRHDPLADGVPAVPAGYSLVTWGTITPDEYAVPVSELELRAAQEVRTSYARQFETMRVGRGRRAYHTGAVHDATGALAGYTSVSKTTGNPAYALQGMTVVHREHRGHALGTLLKLANLEYVLRHEPEVRLVETANAEDNHPMIAVNAALGFEPYDRWVFWTAEAGPS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords ORF14
publication title Crystallographic and mass spectrometric analyses of a tandem GNAT protein from the clavulanic acid biosynthesis pathway.
pubmed doi rcsb
source organism Streptomyces clavuligerus
molecule tags Transferase
total genus 87
structure length 326
sequence length 334
chains with identical sequence B
ec nomenclature ec 2.3.1.-:
pdb deposition date 2009-08-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00583 Acetyltransf_1 Acetyltransferase (GNAT) family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.630.30 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Aminopeptidase 2wpxA00
2OZGA 1I21A 2B3VA 4AVAA 3BJ7A 4KLVA 4JLYA 4NF1A 5F48A 5C88A 1BO4A 5IB0A 3K9UA 2ZXVA 2G3TA 4MY0A 4M85A 1XMTA 3LD2A 5DWMA 3EY5A 3G8WA 3FBUA 1ON0A 2Z10A 2R8VA 2Q04A 4QBJA 3DR6A 2FCKA 4I49A 1MK4A 1I1DA 3OWCA 2VXKA 4ORFA 3SXOA 1CJWA 3QAHA 4XPKA 2I00A 3S6HA 3IWGA 3R1KA 1Z4RA 4XPDC 3T9YA 4LUAA 5KTAA 4FD7A 2PRBA 1QSRA 4UWIA 2JDCA 2B58A 4EVYA 4KUAA 3FNCA 4KLWA 3JUWA 2ATRA 4CAVA 5KTCA 4B5OA 3TTHA 2REFA 2VQYA 2Z11A 3VWEA 3DDDA 1S5KA 2H5MA 3W6XA 2G3AA 3I9SA 4BMHA 1R57A 1Q2DA 4X5KA 1S7NA 4NSQA 1Q2CA 1IYKA 1M44A 2AE6A 4R87A 4XPLA 5J8CA 3JVNA 1S60A 4H89A 1Z4EA 4NEXA 4CAXA 2A4NA 2R7HA 4L8AA 3S6GA 1N71A 1Y9KA 4LX9A 2VBQA 4UBRA 2F5IA 1TIQA 3P2FA 3I3GA 3FXTA 1KUVA 2WPXA 2VZZA 2P0WA 2GE3A 3ZZIA 4IF5A 1M4GA 4AG7A 5JQ4A 4CS0B 4MI4A 1NSLA 3ZJ0A 1XF8A 2PSWA 3TOAA 4KOYA 4E8OA 2JDDA 3D2MA 3EXNA 2QMLA 1S7LA 4QUSA 3F0AA 4H6ZA 3D3SA 4XNHB 1S3ZA 4KOTA 3PGPA 5HH1A 3R9FA 3S6FA 2I79A 3FIXA 1KUXA 1KZFA 1YVOA 2R1IA 2G0BA 1IICA 4JJXA 1M4IA 3BLNA 2CNMA 1M1DA 1XEBA 2D4OA 5FVJA 3VWDA 3D8PA 4E0AA 5IV0A 4MHDA 5F49A 3CXPA 2JLMA 4HNWB 3V8IA 4MBUA 1YREA 1Q2YA 3EO4A 1WK4A 2WPWA 1V0CA 1WWZA 1B87A 2OZUA 2VEZA 3TO9A 1P4NA 1Y9WA 5IX3A 4JWPA 2VI7A 4FD4A 1MJAA 4RS2A 4RI1A 4M3SA 2RC4A 2D4PA 4AVBA 3LODA 1S7FA 1QSNA 4R57A 3RYOA 2BSWA 2B3UA 3WR7A 3W6SA 3N7ZA 2FXFA 1IB1E 2ZW7A 3F8KA 2GANA 4KVOE 2CNSA 4QC6A 2J8NA 5F47A 2PR1A 2VZYA 4PK2A 3P2HA 1YX0A 1OZPA 3TCVA 1BOBA 1Y7RA 2CNTA 3GKRA 4L89A 3E0KA 2HUZA 4ZBGA 3EFAA 4U9ZA 1VKCA 4PSWA 4OAEA 3KKWA 4U9YA 2JEVA 4H6UA 3S6KA 2X7BA 4CRYB 2J8RA 2O28A 4MJ8A 2PDOA 1QSOA 1K4JA 5E96A 2R98A 1KUYA 4DNCA 4YGOA 3TO6A 2EVNA 1NMTA 1SQHA 1Z9UA 2KCWA 5HMNA 2EUIA 3CXSA 1QSTA 4PSXA 4Y49B 3W91A 4IUSA 2OU2A 1QSMA 1RO5A 1I12A 1IIDA 1S7KA 2FS5A 3BJ8A 2FL4A 3G3SA 2B4DA 2ZW5A 4KORA 2Q44A 3UY5A 4B5PA 4XNHC 4KVME 1NE9A 5J8FA 1VHSA 4KOSA 2ZW4A 4R3KA 2Q0YA 2BL1A 2B4DB 3T90A 4KUBA 1XE4A 4B5PB 4OADA 4PV6A 2Z0ZA 1YR0A 4FD6A 5C82A 4MY3A 4R9MA 1U6MA 3H4QA 4U5YA 2BUEA 4FD5A 4JXQA 3GYAA 5EBVA 4HNYB 2REEA 2FE7A 5EC4A 4GS4A 2BEIA 1LRZA 3DSBA 3FB3A 4OLLA 3FRMA 1P0HA 3D2PA 2B4BA 3TT2A 1YVKA 3CXQA 2K5TA 2ZPAA 4NXYA 2ZW6A 1YK3A 1XIXA 3PZJA 1CM0A 2FT0A 4KOWA 4YRHA 4KOVA 2HQYA 4CAWA 3FYNA 2B5GA 4CRZB 4KOXA 2PC1A 5H84A 4NCZA 2P6EA 2Q4YA 5KTDA 1L0CA 5GCNA 3R96A 4XPDB 1UFHA 2P6GA 2GIVA 3TE4A 2B5GB 1PU9A 1YLEA 4E2AA 4UWJA 3NE7A 2OZHA 1GHEA 3MGDA 2ARHA 1MJBA 4YFJA 2Q7BA 3SHPA 3SXNA 2PQ8A 4R3LA 3GY9A 4QVTA 5F46A 3C26A 2J8MA 2AJ6A 5H86A 3PP9A 4JXRA 5I0CA 4Y49C 3TOBA 5JPHA 5DWNA 1YGHA 2HV2A 4AG9A 4KZTA 3TFYA 4QB9A 2IL4A 3DNSA 3F5BA 1MJ9A 2CY2A 4KOUA 3EC4A 2P6FA 3R9GA 1FY7A 2OB0A 4J3GA 1IYLA 1J4JA 2Y0MA 1M4DA 2OH1A 4F0YA 1PUAA 2Q4VA 4UA3A 1RXTA 5ISVA 3IGRA 4II9A 3TO7A 3R9EA 4AVCA 3R95A 4K30A 4HNXB 4JD6A 2DXQA 2FSRA 2QIRA 4F6AA 2C27A 3B8GA 2FIWA 4ONUA 4KVXA 5CNPA 4PK3A 4AB7A 2PR8A 4HKFA 3QB8A 2NMTA 2QECA 1B6BA 3DR8A 2FIAA
chains in the Genus database with same CATH superfamily
4DUKA 2OZGA 2EBJA 1I21A 2B3VA 3I1UA 3D7HA 3NH8A 3BJ7A 4AVAA 3PB4X 4KLVA 4JLYA 2Z3OA 4NF1A 5F48A 5C88A 1BO4A 5IB0A 1AMPA 1NSAA 2I3CA 3K9UA 2ZOFA 4A95A 1PCAA 2ZEDA 3B3TA 2ZXVA 2G3TA 1F2OA 2WSAA 4MY0A 4OC0A 4M85A 4FUUA 3QNVA 4P6YA 3B7IA 1XMTA 3LD2A 5DWMA 1LAPA 1Y0RA 3EY5A 2C6CA 1XRYA 3G8WA 3FBUA 4F9UA 4UEFA 1ON0A 1RTQA 2IJZA 2Z10A 4AXVA 2PJ0A 4F0XA 2R8VA 2Q04A 4QBJA 3DR6A 3IU2A 2FCKA 4I49A 1MK4A 1I1DA 1JWQA 2VXKA 3OWCA 5HXDA 4ORFA 4MFZA 1CJWA 4OMEA 3SXOA 3QAHA 1F57A 4XPKA 2I00A 3S6HA 5AGEA 3IWGA 2Z3PA 4P4FA 3R1KA 1Z4RA 8CPAA 3B3VA 4XPDC 4LUAA 3T9YA 5KTAA 3KR4A 4FD7A 2PIZA 2PRBA 4OC2A 4UEEA 1QSRA 3GLJA 4UWIA 4R7MA 2HB6A 2C6PA 2JDCA 2B58A 4EVYA 4RN7A 4KUAA 3FNCA 1CPSA 4KLWA 3LWUA 5K8PA 4MFJA 3JUWA 2ATRA 4CAVA 3K2KA 5KTCA 4B5OA 5EMIA 2GREA 2REFA 5G21A 2ABZA 2ODFA 2VQYA 2Z11A 4O23A 3TTHA 5JGFA 4YWYA 1CP7A 5G20A 1VHEA 1IOIA 3KGQA 3VWEA 2YNCC 4Q36A 3LMSA 3DDDA 1S5KA 4MFPA 4PQAA 2H5MA 3W6XA 5LYLA 2G3AA 1OBRA 3I9SA 1R57A 4BMHA 5F09A 3JRUA 1R43A 1BPNA 4P10A 4EWTA 1Q2DA 1X12A 4X5KA 1S7NA 4DYOA 6CPAA 4NSQA 1Q2CA 1TXRA 1IYKA 1M44A 2AE6A 3PBBA 4R87A 4XPLA 5J8CA 4A94A 3JVNA 4P4JA 1S60A 4H89A 4CYPA 1Z4EA 3D66A 2CTBA 4NEXA 2IMOA 4FBEA 4HPSA 3VATA 2A4NA 4CAXA 2R7HA 4L8AA 4MFQA 1N71A 3S6GA 1Y9KA 4LX9A 2VBQA 4UBRA 4B12A 2F5IA 1TKJA 1TIQA 3MRUA 2V8VA 3BI1A 3P2FA 4UFVA 2O4HA 3I3GA 3FXTA 1BLLE 1Z8LA 2GLFA 2EWBA 4P45A 1KUVA 2WPXA 2VZZA 2P0WA 5J1QA 2DF5A 2GE3A 3ZZIA 3K9TA 4IF5A 1M4GA 3MN8A 3B3WA 3FX6A 4R6TA 4CYQA 4ZYQA 4AG7A 3SJFA 5JQ4A 4IHMA 5D8NA 4MCQA 3DGVA 4MI4A 2EK8A 1NSLA 1XF8A 2AFSA 3ZJ0A 2PSWA 3TOAA 4KOYA 4A38A 4BBHA 4Z65A 4E8OA 2JDDA 4MXUA 3PEIA 3D2MA 1A2ZA 3EXNA 2ZEEA 3PRTA 1YW4A 3KHZA 4UFWA 2QMLA 4EFDA 1S7LA 2XEIA 4QUSA 3F0AA 3CDXA 2GU2A 4H6ZA 4CS0B 3D3SA 1TKHA 4XNHB 4ZY1A 3KR5A 1S3ZA 4MHYA 4F9VA 4KSFA 4KOTA 3PGPA 3H5ZA 5HH1A 3R9FA 3S6FA 2I79A 3FIXA 4GXHA 3ISZA 1KUXA 3IO1A 1KZFA 4MRIA 1YVOA 4A37A 2R1IA 2G0BA 1IICA 4GM5A 4JJXA 2ZELA 5HVGA 1M4IA 4CAFA 2V77A 1LOKA 1YMEA 3BLNA 2CNMA 1M1DA 1XEBA 1VHOA 2D4OA 4WJBA 3D8PA 4WWVA 5FVJA 5THWA 4MHDA 5F49A 5IV0A 3CXPA 5G1ZA 1Z8WA 4A30A 2PJ6A 2JBJA 2JLMA 4HNWB 3V8IA 4MBUA 1YREA 1Q2YA 3EO4A 5CPAA 1WK4A 4KS9A 2WPWA 3IWEA 1V0CA 1WWZA 5AG4A 1B87A 2OZUA 2WZNA 1QMUA 2G9DA 2DPTA 1BPMA 2VEZA 3BXMA 3TO9A 4CPAA 1P4NA 2C6GA 4G1PA 1Y9WA 4CAEA 3VARA 4OP4A 2ZEOA 2BCOA 4JWPA 5IX3A 2VI7A 4MFLA 4FD4A 1ELMP 1ARLA 1MJAA 4RI1A 4RS2A 4M3SA 2RC4A 1X10A 4BINA 2D4PA 4AVBA 3LODA 1S7FA 3D7FA 5A27A 3TC8A 1ZLIA 4ONWA 1QSNA 2F7VA 2Z3LA 4R57A 3RYOA 2GLJA 2BSWA 1HDQA 3TX8A 4W9YA 2B3UA 2AFMA 3WR7A 2BOAA 5A28A 3W6SA 4B14A 3N7ZA 2EK9A 2FXFA 3WC7A 3NE8A 5LYIA 3PFOA 1IB1E 2CXAA 2PVVA 1Z8XA 2QYVA 2ZW7A 3F8KA 4PXBA 1YLOA 2GANA 3WT4A 4KVOE 2CNSA 4QC6A 2PJ7A 5ELYA 2J8NA 3B3SA 4KSIA 5F47A 2PR1A 3B2YA 2VZYA 4PK2A 3P2HA 1R3NA 1YX0A 4MCSA 1OZPA 4P4IA 3TCVA 1BOBA 1Y7RA 2CNTA 2NSMA 3GKRA 4L89A 3E0KA 4A31A 4UIAA 3PFEA 3SI0A 2AFUA 2HUZA 3FEDA 4ZBGA 2PJ2A 4CGMA 3HUVA 4X8IA 4C68A 3EFAA 4U9ZA 1VKCA 4IAVA 4OC1A 4OAEA 3KKWA 4PSWA 3S9MA 4U9YA 3GB0A 2JEVA 4H6UA 1IGBA 2ANPA 2XEJA 4TWEA 3S6KA 2X7BA 3VH9A 4CRYB 3FJUA 2J8RA 2O28A 2JEWA 4MJ8A 2PDOA 2Z3KA 4OKOA 1K4JA 1QSOA 5E96A 1DTDA 2R98A 3KHXA 5LYDA 3IEHA 5AG5A 4DJLA 1KUYA 4DNCA 4YGOA 3CPAA 3TO6A 2EVNA 2IQ6A 2DEAA 2YNDA 3CT9A 1NMTA 4NGRA 4CGOA 4F8ZA 2CIJA 1TKFA 3D4UA 5LRGA 1YSJA 1SQHA 4BD9A 2PJ4A 1Z9UA 1Z2LA 2KCWA 5HMNA 2EUIA 2PJ3A 3CXSA 1QSTA 4MCRA 4MHZA 3PB7X 3RZAA 3A9LA 3V38A 4C2XA 5K8MA 4PSXA 5CBMA 5JH9A 3IC1A 4Y49B 3W91A 2V8HA 3D67A 2OU2A 4IUSA 1QSMA 1RO5A 1I12A 1IIDA 3FVLA 4LQ6A 3SJGA 1LFWA 2V8DA 4ZI6A 1HDUA 1S7KA 2FS5A 3BJ8A 3IFEA 3VWDA 4ZX8A 2FL4A 4OIDA 3G3SA 4OIWA 2B4DA 3CPXA 3ISXA 4H2KA 2ZW5A 4KORA 2Q44A 2AFWA 3UY5A 3IU1A 2RFHA 4M6HA 4B5PA 1TF8A 4XNHC 1ZG9A 4FAIA 4NGNA 4C7HA 4KVME 1NE9A 5J8FA 2Q43A 1CP6A 1VHSA 4RUHA 4KOSA 2PJAA 4UFXA 2ZW4A 4UCPA 4R3KA 3GUXA 2GFQA 2Q0YA 1GYTA 2JBKA 2BL1A 2B4DB 3T90A 3H8GA 4KUBA 1XE4A 4P4BA 4B5PB 2BO9A 4OADA 1KWMA 4PV6A 2Z0ZA 4CGLA 4A2ZA 1YR0A 1Z5RA 4FD6A 4R8FA 2Q4ZA 5K8OA 5C82A 1Z8TA 4MY3A 3KQXA 4B6ZA 3SI1A 3KASA 3FECA 4R9MA 2WYRA 2PJ8A 4Q38A 3QAYA 1U6MA 2ZEPA 1IY7A 2EO8A 4MFKA 3H4QA 4U5YA 1ELLP 2BUEA 1CG2A 4FD5A 1CX8A 1XJOA 4JXQA 1CPXA 3SJEA 5LYFA 3JTKA 3GYAA 5EBVA 3FH4A 4HNYB 3KZWA 4JYWA 4NGQA 2Q7SA 4OC5A 4IK2A 2PJ5A 5DS0A 3T8WA 2REEA 2FE7A 3N5FA 5HVFA 5EC4A 1Y0YA 2QVPA 4GS4A 1Q7LA 1ZLHA 2BEIA 2J9AA 3FEEA 2ZEHA 4CGPA 1EE3P 2ZENA 2PVWA 4MHPA 1LRZA 4A32A 3D7DA 1YW6A 3DSBA 3FB3A 1TF9A 3FRMA 4OLLA 4A39A 1P0HA 3D2PA 2B4BA 3KL9A 2Q51A 3TT2A 1YVKA 1HEEA 3PBEA 2AFZA 1LAMA 3CXQA 2K5TA 2ZPAA 4NGTA 4NXYA 2ZW6A 4K3NA 1YK3A 2OOTA 1XOVA 1XIXA 3CZXA 2Z3MA 3KI9A 1PYTB 1FNOA 4NJQA 3PZJA 1Y7EA 1CM0A 4UCNA 2FT0A 2PJ1A 4KOWA 1ZO0A 4YRHA 5G22A 4KOVA 2HQYA 3BHXA 4CAWA 1XBUA 2B5GA 3FYNA 5I4MA 5LRKA 3L2NA 3RNZA 4CRZB 1YQEA 4Q7AA 3PB9X 4KOXA 2PC1A 5H84A 4NCZA 2P6EA 2PJBA 2XEGA 2ZEGA 3NH5A 4NGSA 5HVHA 4P44A 1FT7A 5JM6A 2Q4YA 2VL1A 1L0CA 5GCNA 5KTDA 3R96A 4XPDB 5AG6A 1XFOA 4OC4A 4KSAA 3B35A 1UFHA 2P6GA 2GIVA 3TE4A 2B5GB 3NFZA 2YNCA 4LQGA 4B13A 3V7ZA 1IU8A 4C2YA 1PU9A 1YLEA 2POKA 2WUUA 3FF3A 4M6IA 4NJRA 4UWJA 5AG7A 4E2AA 1M4LA 3S9LA 3NE7A 2OZHA 1GHEA 3MGDA 4R76A 2ARHA 5BWAB 4MMOA 1CBXA 1ARMA 4NGPA 3RAMA 1MJBA 4YFJA 4B11A 2FVGA 2Q7BA 3GIUA 3SHPA 3WC5A 3SXNA 2O53A 2PQ8A 2YGWA 3NH4A 4R3LA 4M6GA 4P4EA 4YU9A 2NYQA 3GY9A 4QVTA 4ZX9A 4NFRA 5F46A 3C26A 2J8MA 2AJ6A 3PB8X 2PCUA 5H86A 2PJ9A 4B10A 3PP9A 4OC3A 4JXRA 2YNEA 5I0CA 3SJXA 3H8FA 4CYOA 1H8LA 4Y49C 4ZY2A 3TOBA 5JPHA 2DPSA 4MCPA 4PPZA 5DWNA 4ZGYB 1VIXA 3S9NA 4UIBA 3DLJA 1VGYA 1YGHA 2HV2A 3D68A 5D29A 4TNUA 4AG9A 4KZTA 3WABA 2Z3NA 4E0AA 3TFYA 3LACA 4QB9A 2IL4A 3DNSA 4C7IA 3F5BA 1MJ9A 5K8NA 2CY2A 2F8HA 3SI2A 1AYEA 3IIBA 2RB7A 4KOUA 3EC4A 2P6FA 3R9GA 4PXEA 3B3CA 3RO0A 1FY7A 2OB0A 4J3GA 1F2PA 1IYLA 1XMBA 2QJ8A 2AFXA 4CYNA 2XEFA 1J4JA 2Y0MA 1M4DA 2OH1A 2CTCA 1AUGA 1BAVA 4F0YA 1PUAA 2Q4VA 1ZG8A 4UEZA 2AFOA 3WC6A 2ZEFA 3FMCA 4NGMA 4EMEA 3H8EA 3KQZA 4UA3A 1RXTA 1DE4C 5ISVA 2ZEMA 4X3RA 3IGRA 2ZOGA 3IJ3A 2OR4A 2HC9A 4ZY0A 4II9A 1LANA 3BI0A 3TO7A 3R9EA 4A33A 4AVCA 3R95A 4K30A 2PE3A 4HNXB 2DXQA 3D7GA 2FSRA 2V8GA 4JD6A 2QIRA 3PB6X 4F6AA 2C27A 3B8GA 1ZG7A 2FIWA 2PRQA 1JQGA 4ONUA 4PXDA 4KVXA 3RBUA 4PXCA 5CNPA 2PIYA 4MHNA 4C2ZA 4PK3A 4UCMA 1IOFA 4FWUA 4AB7A 2PR8A 4HKFA 3IWWA 5LRJA 3NA6A 3QB8A 2NMTA 3HLPA 1UWYA 4UF4A 4X2TA 4CGNA 7CPAA 1LCPA 2QECA 4P4DA 5IB9A 1B6BA 4JZ0A 2PJCA 3DR8A 2CF4A 2C1CA 1QQ9A 2FIAA
chains in the Genus database with same CATH topology
2OZGA 1I21A 2B3VA 4AVAA 3BJ7A 4KLVA 4JLYA 2Z3OA 4NF1A 5F48A 5C88A 1BO4A 5IB0A 4A95A 3K9UA 2ZXVA 2G3TA 4MY0A 2WSAA 4M85A 1XMTA 3LD2A 5DWMA 3EY5A 3G8WA 3FBUA 1ON0A 2Z10A 4F0XA 2R8VA 2Q04A 4QBJA 3DR6A 3IU2A 2FCKA 4I49A 1MK4A 1I1DA 3OWCA 2VXKA 4ORFA 4MFZA 1CJWA 3SXOA 3QAHA 4XPKA 2I00A 3S6HA 5AGEA 3IWGA 2Z3PA 3R1KA 1Z4RA 4XPDC 3T9YA 4LUAA 5KTAA 4FD7A 2PRBA 1QSRA 4UWIA 2JDCA 2B58A 4EVYA 4KUAA 3FNCA 4KLWA 4MFJA 3JUWA 2ATRA 4CAVA 5KTCA 4B5OA 3TTHA 2REFA 5G21A 2VQYA 2Z11A 5G20A 3VWEA 2YNCC 4Q36A 3DDDA 1S5KA 4MFPA 2H5MA 3W6XA 2G3AA 3I9SA 4BMHA 1R57A 1Q2DA 4X5KA 1S7NA 4NSQA 1Q2CA 1IYKA 1M44A 2AE6A 4R87A 4XPLA 5J8CA 3JVNA 1S60A 4H89A 4CYPA 1Z4EA 4NEXA 4CAXA 2A4NA 2R7HA 4L8AA 4MFQA 1N71A 3S6GA 1Y9KA 4LX9A 2VBQA 4UBRA 4B12A 2F5IA 1TIQA 3P2FA 4UFVA 3I3GA 3FXTA 1KUVA 2WPXA 2VZZA 2P0WA 2GE3A 3ZZIA 4IF5A 1M4GA 4CYQA 4AG7A 5JQ4A 4CS0B 4MI4A 1NSLA 3ZJ0A 1XF8A 2PSWA 3TOAA 4KOYA 4BBHA 4E8OA 2JDDA 3D2MA 3EXNA 4UFWA 2QMLA 1S7LA 4QUSA 3F0AA 4H6ZA 3D3SA 4XNHB 1S3ZA 4KSFA 4KOTA 3PGPA 3H5ZA 5HH1A 3R9FA 3S6FA 2I79A 3FIXA 1KUXA 1KZFA 1YVOA 2R1IA 2G0BA 1IICA 4JJXA 1M4IA 4CAFA 3BLNA 2CNMA 1M1DA 1XEBA 2D4OA 5FVJA 3VWDA 3D8PA 4E0AA 5IV0A 4MHDA 5F49A 3CXPA 5G1ZA 4A30A 2JLMA 4HNWB 3V8IA 4MBUA 1YREA 1Q2YA 3EO4A 1WK4A 4KS9A 2WPWA 3IWEA 1V0CA 1WWZA 5AG4A 1B87A 2OZUA 2DPTA 2VEZA 3TO9A 1P4NA 1Y9WA 4CAEA 5IX3A 4JWPA 2VI7A 4MFLA 4FD4A 1MJAA 4RS2A 4RI1A 4M3SA 2RC4A 2D4PA 4AVBA 3LODA 1S7FA 5A27A 1QSNA 4R57A 2Z3LA 3RYOA 2BSWA 2B3UA 3WR7A 5A28A 3W6SA 4B14A 3N7ZA 2FXFA 1IB1E 2CXAA 2ZW7A 3F8KA 2GANA 4KVOE 2CNSA 4QC6A 2J8NA 5F47A 2PR1A 2VZYA 4PK2A 3P2HA 1YX0A 1OZPA 3TCVA 1BOBA 1Y7RA 2CNTA 3GKRA 4L89A 3E0KA 4A31A 2HUZA 4ZBGA 4CGMA 4C68A 3EFAA 4U9ZA 1VKCA 4PSWA 4OAEA 3KKWA 4U9YA 2JEVA 4H6UA 3S6KA 2X7BA 4CRYB 2J8RA 2O28A 4MJ8A 2PDOA 2Z3KA 1QSOA 1K4JA 5E96A 2R98A 5AG5A 1KUYA 4DNCA 4YGOA 3TO6A 2EVNA 2YNDA 4CGOA 1NMTA 1SQHA 1Z9UA 2KCWA 5HMNA 2EUIA 3CXSA 1QSTA 3A9LA 4C2XA 4PSXA 4Y49B 3W91A 4IUSA 2OU2A 1QSMA 1RO5A 1I12A 1IIDA 1S7KA 2FS5A 3BJ8A 2FL4A 3G3SA 2B4DA 2ZW5A 4KORA 2Q44A 3UY5A 3IU1A 4B5PA 4XNHC 4C7HA 4KVME 1NE9A 5J8FA 1VHSA 4KOSA 4UFXA 2ZW4A 4UCPA 4R3KA 2Q0YA 2BL1A 2B4DB 3T90A 4KUBA 1XE4A 4B5PB 4OADA 4CGLA 4PV6A 2Z0ZA 4A2ZA 1YR0A 4FD6A 5C82A 4MY3A 4R9MA 4Q38A 1U6MA 4MFKA 3H4QA 4U5YA 2BUEA 4FD5A 4JXQA 3JTKA 3GYAA 5EBVA 4HNYB 2REEA 2FE7A 5EC4A 4GS4A 2BEIA 4CGPA 1LRZA 4A32A 3DSBA 3FB3A 4OLLA 3FRMA 1P0HA 3D2PA 2B4BA 3TT2A 1YVKA 3CXQA 2K5TA 2ZPAA 4NXYA 2ZW6A 1YK3A 1XIXA 2Z3MA 3PZJA 1CM0A 4UCNA 2FT0A 4KOWA 1ZO0A 4YRHA 5G22A 4KOVA 2HQYA 4CAWA 3FYNA 2B5GA 4CRZB 4KOXA 2PC1A 5H84A 4NCZA 2P6EA 2Q4YA 5KTDA 1L0CA 5GCNA 3R96A 4XPDB 5AG6A 4KSAA 1UFHA 2P6GA 2GIVA 3TE4A 2B5GB 2YNCA 4B13A 4C2YA 1PU9A 1YLEA 2WUUA 5AG7A 4E2AA 4UWJA 3NE7A 2OZHA 1GHEA 3MGDA 2ARHA 5BWAB 1MJBA 4YFJA 4B11A 2Q7BA 3SHPA 3SXNA 2PQ8A 2YGWA 4R3LA 3GY9A 4QVTA 5F46A 3C26A 2J8MA 2AJ6A 5H86A 4B10A 3PP9A 4JXRA 2YNEA 5I0CA 4CYOA 4Y49C 3TOBA 5JPHA 2DPSA 4ZGYB 5DWNA 1YGHA 2HV2A 4AG9A 4KZTA 2Z3NA 3TFYA 4QB9A 2IL4A 3DNSA 4C7IA 3F5BA 1MJ9A 2CY2A 4KOUA 3EC4A 2P6FA 3R9GA 1FY7A 2OB0A 4J3GA 1IYLA 4CYNA 1J4JA 2Y0MA 1M4DA 2OH1A 4F0YA 1PUAA 2Q4VA 4UA3A 1RXTA 5ISVA 3IGRA 4II9A 3TO7A 3R9EA 4A33A 4AVCA 3R95A 4K30A 4HNXB 4JD6A 2DXQA 2FSRA 2QIRA 4F6AA 2C27A 3B8GA 2FIWA 4ONUA 4KVXA 5CNPA 4C2ZA 4PK3A 4UCMA 4AB7A 2PR8A 4HKFA 3QB8A 4CGNA 2NMTA 2QECA 1B6BA 3DR8A 2FIAA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2OZG A;  1I21 A;  2B3V A;  4AVA A;  3BJ7 A;  4KLV A;  4JLY A;  4NF1 A;  5F48 A;  5C88 A;  1BO4 A;  5IB0 A;  3K9U A;  2ZXV A;  2G3T A;  4MY0 A;  4M85 A;  1XMT A;  3LD2 A;  5DWM A;  3EY5 A;  3G8W A;  3FBU A;  1ON0 A;  2Z10 A;  2R8V A;  2Q04 A;  4QBJ A;  3DR6 A;  2FCK A;  4I49 A;  1MK4 A;  1I1D A;  3OWC A;  2VXK A;  4ORF A;  3SXO A;  1CJW A;  3QAH A;  4XPK A;  2I00 A;  3S6H A;  3IWG A;  3R1K A;  1Z4R A;  4XPD C;  3T9Y A;  4LUA A;  5KTA A;  4FD7 A;  2PRB A;  1QSR A;  4UWI A;  2JDC A;  2B58 A;  4EVY A;  4KUA A;  3FNC A;  4KLW A;  3JUW A;  2ATR A;  4CAV A;  5KTC A;  4B5O A;  3TTH A;  2REF A;  2VQY A;  2Z11 A;  3VWE A;  3DDD A;  1S5K A;  2H5M A;  3W6X A;  2G3A A;  3I9S A;  4BMH A;  1R57 A;  1Q2D A;  4X5K A;  1S7N A;  4NSQ A;  1Q2C A;  1IYK A;  1M44 A;  2AE6 A;  4R87 A;  4XPL A;  5J8C A;  3JVN A;  1S60 A;  4H89 A;  1Z4E A;  4NEX A;  4CAX A;  2A4N A;  2R7H A;  4L8A A;  3S6G A;  1N71 A;  1Y9K A;  4LX9 A;  2VBQ A;  4UBR A;  2F5I A;  1TIQ A;  3P2F A;  3I3G A;  3FXT A;  1KUV A;  2WPX A;  2VZZ A;  2P0W A;  2GE3 A;  3ZZI A;  4IF5 A;  1M4G A;  4AG7 A;  5JQ4 A;  4CS0 B;  4MI4 A;  1NSL A;  3ZJ0 A;  1XF8 A;  2PSW A;  3TOA A;  4KOY A;  4E8O A;  2JDD A;  3D2M A;  3EXN A;  2QML A;  1S7L A;  4QUS A;  3F0A A;  4H6Z A;  3D3S A;  4XNH B;  1S3Z A;  4KOT A;  3PGP A;  5HH1 A;  3R9F A;  3S6F A;  2I79 A;  3FIX A;  1KUX A;  1KZF A;  1YVO A;  2R1I A;  2G0B A;  1IIC A;  4JJX A;  1M4I A;  3BLN A;  2CNM A;  1M1D A;  1XEB A;  2D4O A;  5FVJ A;  3VWD A;  3D8P A;  4E0A A;  5IV0 A;  4MHD A;  5F49 A;  3CXP A;  2JLM A;  4HNW B;  3V8I A;  4MBU A;  1YRE A;  1Q2Y A;  3EO4 A;  1WK4 A;  2WPW A;  1V0C A;  1WWZ A;  1B87 A;  2OZU A;  2VEZ A;  3TO9 A;  1P4N A;  1Y9W A;  5IX3 A;  4JWP A;  2VI7 A;  4FD4 A;  1MJA A;  4RS2 A;  4RI1 A;  4M3S A;  2RC4 A;  2D4P A;  4AVB A;  3LOD A;  1S7F A;  1QSN A;  4R57 A;  3RYO A;  2BSW A;  2B3U A;  3WR7 A;  3W6S A;  3N7Z A;  2FXF A;  1IB1 E;  2ZW7 A;  3F8K A;  2GAN A;  4KVO E;  2CNS A;  4QC6 A;  2J8N A;  5F47 A;  2PR1 A;  2VZY A;  4PK2 A;  3P2H A;  1YX0 A;  1OZP A;  3TCV A;  1BOB A;  1Y7R A;  2CNT A;  3GKR A;  4L89 A;  3E0K A;  2HUZ A;  4ZBG A;  3EFA A;  4U9Z A;  1VKC A;  4PSW A;  4OAE A;  3KKW A;  4U9Y A;  2JEV A;  4H6U A;  3S6K A;  2X7B A;  4CRY B;  2J8R A;  2O28 A;  4MJ8 A;  2PDO A;  1QSO A;  1K4J A;  5E96 A;  2R98 A;  1KUY A;  4DNC A;  4YGO A;  3TO6 A;  2EVN A;  1NMT A;  1SQH A;  1Z9U A;  2KCW A;  5HMN A;  2EUI A;  3CXS A;  1QST A;  4PSX A;  4Y49 B;  3W91 A;  4IUS A;  2OU2 A;  1QSM A;  1RO5 A;  1I12 A;  1IID A;  1S7K A;  2FS5 A;  3BJ8 A;  2FL4 A;  3G3S A;  2B4D A;  2ZW5 A;  4KOR A;  2Q44 A;  3UY5 A;  4B5P A;  4XNH C;  4KVM E;  1NE9 A;  5J8F A;  1VHS A;  4KOS A;  2ZW4 A;  4R3K A;  2Q0Y A;  2BL1 A;  2B4D B;  3T90 A;  4KUB A;  1XE4 A;  4B5P B;  4OAD A;  4PV6 A;  2Z0Z A;  1YR0 A;  4FD6 A;  5C82 A;  4MY3 A;  4R9M A;  1U6M A;  3H4Q A;  4U5Y A;  2BUE A;  4FD5 A;  4JXQ A;  3GYA A;  5EBV A;  4HNY B;  2REE A;  2FE7 A;  5EC4 A;  4GS4 A;  2BEI A;  1LRZ A;  3DSB A;  3FB3 A;  4OLL A;  3FRM A;  1P0H A;  3D2P A;  2B4B A;  3TT2 A;  1YVK A;  3CXQ A;  2K5T A;  2ZPA A;  4NXY A;  2ZW6 A;  1YK3 A;  1XIX A;  3PZJ A;  1CM0 A;  2FT0 A;  4KOW A;  4YRH A;  4KOV A;  2HQY A;  4CAW A;  3FYN A;  2B5G A;  4CRZ B;  4KOX A;  2PC1 A;  5H84 A;  4NCZ A;  2P6E A;  2Q4Y A;  5KTD A;  1L0C A;  5GCN A;  3R96 A;  4XPD B;  1UFH A;  2P6G A;  2GIV A;  3TE4 A;  2B5G B;  1PU9 A;  1YLE A;  4E2A A;  4UWJ A;  3NE7 A;  2OZH A;  1GHE A;  3MGD A;  2ARH A;  1MJB A;  4YFJ A;  2Q7B A;  3SHP A;  3SXN A;  2PQ8 A;  4R3L A;  3GY9 A;  4QVT A;  5F46 A;  3C26 A;  2J8M A;  2AJ6 A;  5H86 A;  3PP9 A;  4JXR A;  5I0C A;  4Y49 C;  3TOB A;  5JPH A;  5DWN A;  1YGH A;  2HV2 A;  4AG9 A;  4KZT A;  3TFY A;  4QB9 A;  2IL4 A;  3DNS A;  3F5B A;  1MJ9 A;  2CY2 A;  4KOU A;  3EC4 A;  2P6F A;  3R9G A;  1FY7 A;  2OB0 A;  4J3G A;  1IYL A;  1J4J A;  2Y0M A;  1M4D A;  2OH1 A;  4F0Y A;  1PUA A;  2Q4V A;  4UA3 A;  1RXT A;  5ISV A;  3IGR A;  4II9 A;  3TO7 A;  3R9E A;  4AVC A;  3R95 A;  4K30 A;  4HNX B;  4JD6 A;  2DXQ A;  2FSR A;  2QIR A;  4F6A A;  2C27 A;  3B8G A;  2FIW A;  4ONU A;  4KVX A;  5CNP A;  4PK3 A;  4AB7 A;  2PR8 A;  4HKF A;  3QB8 A;  2NMT A;  2QEC A;  1B6B A;  3DR8 A;  2FIA A; 
#chains in the Genus database with same CATH topology
 4DUK A;  2OZG A;  2EBJ A;  1I21 A;  2B3V A;  3I1U A;  3D7H A;  3NH8 A;  3BJ7 A;  4AVA A;  3PB4 X;  4KLV A;  4JLY A;  2Z3O A;  4NF1 A;  5F48 A;  5C88 A;  1BO4 A;  5IB0 A;  1AMP A;  1NSA A;  2I3C A;  3K9U A;  2ZOF A;  4A95 A;  1PCA A;  2ZED A;  3B3T A;  2ZXV A;  2G3T A;  1F2O A;  2WSA A;  4MY0 A;  4OC0 A;  4M85 A;  4FUU A;  3QNV A;  4P6Y A;  3B7I A;  1XMT A;  3LD2 A;  5DWM A;  1LAP A;  1Y0R A;  3EY5 A;  2C6C A;  1XRY A;  3G8W A;  3FBU A;  4F9U A;  4UEF A;  1ON0 A;  1RTQ A;  2IJZ A;  2Z10 A;  4AXV A;  2PJ0 A;  4F0X A;  2R8V A;  2Q04 A;  4QBJ A;  3DR6 A;  3IU2 A;  2FCK A;  4I49 A;  1MK4 A;  1I1D A;  1JWQ A;  2VXK A;  3OWC A;  5HXD A;  4ORF A;  4MFZ A;  1CJW A;  4OME A;  3SXO A;  3QAH A;  1F57 A;  4XPK A;  2I00 A;  3S6H A;  5AGE A;  3IWG A;  2Z3P A;  4P4F A;  3R1K A;  1Z4R A;  8CPA A;  3B3V A;  4XPD C;  4LUA A;  3T9Y A;  5KTA A;  3KR4 A;  4FD7 A;  2PIZ A;  2PRB A;  4OC2 A;  4UEE A;  1QSR A;  3GLJ A;  4UWI A;  4R7M A;  2HB6 A;  2C6P A;  2JDC A;  2B58 A;  4EVY A;  4RN7 A;  4KUA A;  3FNC A;  1CPS A;  4KLW A;  3LWU A;  5K8P A;  4MFJ A;  3JUW A;  2ATR A;  4CAV A;  3K2K A;  5KTC A;  4B5O A;  5EMI A;  2GRE A;  2REF A;  5G21 A;  2ABZ A;  2ODF A;  2VQY A;  2Z11 A;  4O23 A;  3TTH A;  5JGF A;  4YWY A;  1CP7 A;  5G20 A;  1VHE A;  1IOI A;  3KGQ A;  3VWE A;  2YNC C;  4Q36 A;  3LMS A;  3DDD A;  1S5K A;  4MFP A;  4PQA A;  2H5M A;  3W6X A;  5LYL A;  2G3A A;  1OBR A;  3I9S A;  1R57 A;  4BMH A;  5F09 A;  3JRU A;  1R43 A;  1BPN A;  4P10 A;  4EWT A;  1Q2D A;  1X12 A;  4X5K A;  1S7N A;  4DYO A;  6CPA A;  4NSQ A;  1Q2C A;  1TXR A;  1IYK A;  1M44 A;  2AE6 A;  3PBB A;  4R87 A;  4XPL A;  5J8C A;  4A94 A;  3JVN A;  4P4J A;  1S60 A;  4H89 A;  4CYP A;  1Z4E A;  3D66 A;  2CTB A;  4NEX A;  2IMO A;  4FBE A;  4HPS A;  3VAT A;  2A4N A;  4CAX A;  2R7H A;  4L8A A;  4MFQ A;  1N71 A;  3S6G A;  1Y9K A;  4LX9 A;  2VBQ A;  4UBR A;  4B12 A;  2F5I A;  1TKJ A;  1TIQ A;  3MRU A;  2V8V A;  3BI1 A;  3P2F A;  4UFV A;  2O4H A;  3I3G A;  3FXT A;  1BLL E;  1Z8L A;  2GLF A;  2EWB A;  4P45 A;  1KUV A;  2WPX A;  2VZZ A;  2P0W A;  5J1Q A;  2DF5 A;  2GE3 A;  3ZZI A;  3K9T A;  4IF5 A;  1M4G A;  3MN8 A;  3B3W A;  3FX6 A;  4R6T A;  4CYQ A;  4ZYQ A;  4AG7 A;  3SJF A;  5JQ4 A;  4IHM A;  5D8N A;  4MCQ A;  3DGV A;  4MI4 A;  2EK8 A;  1NSL A;  1XF8 A;  2AFS A;  3ZJ0 A;  2PSW A;  3TOA A;  4KOY A;  4A38 A;  4BBH A;  4Z65 A;  4E8O A;  2JDD A;  4MXU A;  3PEI A;  3D2M A;  1A2Z A;  3EXN A;  2ZEE A;  3PRT A;  1YW4 A;  3KHZ A;  4UFW A;  2QML A;  4EFD A;  1S7L A;  2XEI A;  4QUS A;  3F0A A;  3CDX A;  2GU2 A;  4H6Z A;  4CS0 B;  3D3S A;  1TKH A;  4XNH B;  4ZY1 A;  3KR5 A;  1S3Z A;  4MHY A;  4F9V A;  4KSF A;  4KOT A;  3PGP A;  3H5Z A;  5HH1 A;  3R9F A;  3S6F A;  2I79 A;  3FIX A;  4GXH A;  3ISZ A;  1KUX A;  3IO1 A;  1KZF A;  4MRI A;  1YVO A;  4A37 A;  2R1I A;  2G0B A;  1IIC A;  4GM5 A;  4JJX A;  2ZEL A;  5HVG A;  1M4I A;  4CAF A;  2V77 A;  1LOK A;  1YME A;  3BLN A;  2CNM A;  1M1D A;  1XEB A;  1VHO A;  2D4O A;  4WJB A;  3D8P A;  4WWV A;  5FVJ A;  5THW A;  4MHD A;  5F49 A;  5IV0 A;  3CXP A;  5G1Z A;  1Z8W A;  4A30 A;  2PJ6 A;  2JBJ A;  2JLM A;  4HNW B;  3V8I A;  4MBU A;  1YRE A;  1Q2Y A;  3EO4 A;  5CPA A;  1WK4 A;  4KS9 A;  2WPW A;  3IWE A;  1V0C A;  1WWZ A;  5AG4 A;  1B87 A;  2OZU A;  2WZN A;  1QMU A;  2G9D A;  2DPT A;  1BPM A;  2VEZ A;  3BXM A;  3TO9 A;  4CPA A;  1P4N A;  2C6G A;  4G1P A;  1Y9W A;  4CAE A;  3VAR A;  4OP4 A;  2ZEO A;  2BCO A;  4JWP A;  5IX3 A;  2VI7 A;  4MFL A;  4FD4 A;  1ELM P;  1ARL A;  1MJA A;  4RI1 A;  4RS2 A;  4M3S A;  2RC4 A;  1X10 A;  4BIN A;  2D4P A;  4AVB A;  3LOD A;  1S7F A;  3D7F A;  5A27 A;  3TC8 A;  1ZLI A;  4ONW A;  1QSN A;  2F7V A;  2Z3L A;  4R57 A;  3RYO A;  2GLJ A;  2BSW A;  1HDQ A;  3TX8 A;  4W9Y A;  2B3U A;  2AFM A;  3WR7 A;  2BOA A;  5A28 A;  3W6S A;  4B14 A;  3N7Z A;  2EK9 A;  2FXF A;  3WC7 A;  3NE8 A;  5LYI A;  3PFO A;  1IB1 E;  2CXA A;  2PVV A;  1Z8X A;  2QYV A;  2ZW7 A;  3F8K A;  4PXB A;  1YLO A;  2GAN A;  3WT4 A;  4KVO E;  2CNS A;  4QC6 A;  2PJ7 A;  5ELY A;  2J8N A;  3B3S A;  4KSI A;  5F47 A;  2PR1 A;  3B2Y A;  2VZY A;  4PK2 A;  3P2H A;  1R3N A;  1YX0 A;  4MCS A;  1OZP A;  4P4I A;  3TCV A;  1BOB A;  1Y7R A;  2CNT A;  2NSM A;  3GKR A;  4L89 A;  3E0K A;  4A31 A;  4UIA A;  3PFE A;  3SI0 A;  2AFU A;  2HUZ A;  3FED A;  4ZBG A;  2PJ2 A;  4CGM A;  3HUV A;  4X8I A;  4C68 A;  3EFA A;  4U9Z A;  1VKC A;  4IAV A;  4OC1 A;  4OAE A;  3KKW A;  4PSW A;  3S9M A;  4U9Y A;  3GB0 A;  2JEV A;  4H6U A;  1IGB A;  2ANP A;  2XEJ A;  4TWE A;  3S6K A;  2X7B A;  3VH9 A;  4CRY B;  3FJU A;  2J8R A;  2O28 A;  2JEW A;  4MJ8 A;  2PDO A;  2Z3K A;  4OKO A;  1K4J A;  1QSO A;  5E96 A;  1DTD A;  2R98 A;  3KHX A;  5LYD A;  3IEH A;  5AG5 A;  4DJL A;  1KUY A;  4DNC A;  4YGO A;  3CPA A;  3TO6 A;  2EVN A;  2IQ6 A;  2DEA A;  2YND A;  3CT9 A;  1NMT A;  4NGR A;  4CGO A;  4F8Z A;  2CIJ A;  1TKF A;  3D4U A;  5LRG A;  1YSJ A;  1SQH A;  4BD9 A;  2PJ4 A;  1Z9U A;  1Z2L A;  2KCW A;  5HMN A;  2EUI A;  2PJ3 A;  3CXS A;  1QST A;  4MCR A;  4MHZ A;  3PB7 X;  3RZA A;  3A9L A;  3V38 A;  4C2X A;  5K8M A;  4PSX A;  5CBM A;  5JH9 A;  3IC1 A;  4Y49 B;  3W91 A;  2V8H A;  3D67 A;  2OU2 A;  4IUS A;  1QSM A;  1RO5 A;  1I12 A;  1IID A;  3FVL A;  4LQ6 A;  3SJG A;  1LFW A;  2V8D A;  4ZI6 A;  1HDU A;  1S7K A;  2FS5 A;  3BJ8 A;  3IFE A;  3VWD A;  4ZX8 A;  2FL4 A;  4OID A;  3G3S A;  4OIW A;  2B4D A;  3CPX A;  3ISX A;  4H2K A;  2ZW5 A;  4KOR A;  2Q44 A;  2AFW A;  3UY5 A;  3IU1 A;  2RFH A;  4M6H A;  4B5P A;  1TF8 A;  4XNH C;  1ZG9 A;  4FAI A;  4NGN A;  4C7H A;  4KVM E;  1NE9 A;  5J8F A;  2Q43 A;  1CP6 A;  1VHS A;  4RUH A;  4KOS A;  2PJA A;  4UFX A;  2ZW4 A;  4UCP A;  4R3K A;  3GUX A;  2GFQ A;  2Q0Y A;  1GYT A;  2JBK A;  2BL1 A;  2B4D B;  3T90 A;  3H8G A;  4KUB A;  1XE4 A;  4P4B A;  4B5P B;  2BO9 A;  4OAD A;  1KWM A;  4PV6 A;  2Z0Z A;  4CGL A;  4A2Z A;  1YR0 A;  1Z5R A;  4FD6 A;  4R8F A;  2Q4Z A;  5K8O A;  5C82 A;  1Z8T A;  4MY3 A;  3KQX A;  4B6Z A;  3SI1 A;  3KAS A;  3FEC A;  4R9M A;  2WYR A;  2PJ8 A;  4Q38 A;  3QAY A;  1U6M A;  2ZEP A;  1IY7 A;  2EO8 A;  4MFK A;  3H4Q A;  4U5Y A;  1ELL P;  2BUE A;  1CG2 A;  4FD5 A;  1CX8 A;  1XJO A;  4JXQ A;  1CPX A;  3SJE A;  5LYF A;  3JTK A;  3GYA A;  5EBV A;  3FH4 A;  4HNY B;  3KZW A;  4JYW A;  4NGQ A;  2Q7S A;  4OC5 A;  4IK2 A;  2PJ5 A;  5DS0 A;  3T8W A;  2REE A;  2FE7 A;  3N5F A;  5HVF A;  5EC4 A;  1Y0Y A;  2QVP A;  4GS4 A;  1Q7L A;  1ZLH A;  2BEI A;  2J9A A;  3FEE A;  2ZEH A;  4CGP A;  1EE3 P;  2ZEN A;  2PVW A;  4MHP A;  1LRZ A;  4A32 A;  3D7D A;  1YW6 A;  3DSB A;  3FB3 A;  1TF9 A;  3FRM A;  4OLL A;  4A39 A;  1P0H A;  3D2P A;  2B4B A;  3KL9 A;  2Q51 A;  3TT2 A;  1YVK A;  1HEE A;  3PBE A;  2AFZ A;  1LAM A;  3CXQ A;  2K5T A;  2ZPA A;  4NGT A;  4NXY A;  2ZW6 A;  4K3N A;  1YK3 A;  2OOT A;  1XOV A;  1XIX A;  3CZX A;  2Z3M A;  3KI9 A;  1PYT B;  1FNO A;  4NJQ A;  3PZJ A;  1Y7E A;  1CM0 A;  4UCN A;  2FT0 A;  2PJ1 A;  4KOW A;  1ZO0 A;  4YRH A;  5G22 A;  4KOV A;  2HQY A;  3BHX A;  4CAW A;  1XBU A;  2B5G A;  3FYN A;  5I4M A;  5LRK A;  3L2N A;  3RNZ A;  4CRZ B;  1YQE A;  4Q7A A;  3PB9 X;  4KOX A;  2PC1 A;  5H84 A;  4NCZ A;  2P6E A;  2PJB A;  2XEG A;  2ZEG A;  3NH5 A;  4NGS A;  5HVH A;  4P44 A;  1FT7 A;  5JM6 A;  2Q4Y A;  2VL1 A;  1L0C A;  5GCN A;  5KTD A;  3R96 A;  4XPD B;  5AG6 A;  1XFO A;  4OC4 A;  4KSA A;  3B35 A;  1UFH A;  2P6G A;  2GIV A;  3TE4 A;  2B5G B;  3NFZ A;  2YNC A;  4LQG A;  4B13 A;  3V7Z A;  1IU8 A;  4C2Y A;  1PU9 A;  1YLE A;  2POK A;  2WUU A;  3FF3 A;  4M6I A;  4NJR A;  4UWJ A;  5AG7 A;  4E2A A;  1M4L A;  3S9L A;  3NE7 A;  2OZH A;  1GHE A;  3MGD A;  4R76 A;  2ARH A;  5BWA B;  4MMO A;  1CBX A;  1ARM A;  4NGP A;  3RAM A;  1MJB A;  4YFJ A;  4B11 A;  2FVG A;  2Q7B A;  3GIU A;  3SHP A;  3WC5 A;  3SXN A;  2O53 A;  2PQ8 A;  2YGW A;  3NH4 A;  4R3L A;  4M6G A;  4P4E A;  4YU9 A;  2NYQ A;  3GY9 A;  4QVT A;  4ZX9 A;  4NFR A;  5F46 A;  3C26 A;  2J8M A;  2AJ6 A;  3PB8 X;  2PCU A;  5H86 A;  2PJ9 A;  4B10 A;  3PP9 A;  4OC3 A;  4JXR A;  2YNE A;  5I0C A;  3SJX A;  3H8F A;  4CYO A;  1H8L A;  4Y49 C;  4ZY2 A;  3TOB A;  5JPH A;  2DPS A;  4MCP A;  4PPZ A;  5DWN A;  4ZGY B;  1VIX A;  3S9N A;  4UIB A;  3DLJ A;  1VGY A;  1YGH A;  2HV2 A;  3D68 A;  5D29 A;  4TNU A;  4AG9 A;  4KZT A;  3WAB A;  2Z3N A;  4E0A A;  3TFY A;  3LAC A;  4QB9 A;  2IL4 A;  3DNS A;  4C7I A;  3F5B A;  1MJ9 A;  5K8N A;  2CY2 A;  2F8H A;  3SI2 A;  1AYE A;  3IIB A;  2RB7 A;  4KOU A;  3EC4 A;  2P6F A;  3R9G A;  4PXE A;  3B3C A;  3RO0 A;  1FY7 A;  2OB0 A;  4J3G A;  1F2P A;  1IYL A;  1XMB A;  2QJ8 A;  2AFX A;  4CYN A;  2XEF A;  1J4J A;  2Y0M A;  1M4D A;  2OH1 A;  2CTC A;  1AUG A;  1BAV A;  4F0Y A;  1PUA A;  2Q4V A;  1ZG8 A;  4UEZ A;  2AFO A;  3WC6 A;  2ZEF A;  3FMC A;  4NGM A;  4EME A;  3H8E A;  3KQZ A;  4UA3 A;  1RXT A;  1DE4 C;  5ISV A;  2ZEM A;  4X3R A;  3IGR A;  2ZOG A;  3IJ3 A;  2OR4 A;  2HC9 A;  4ZY0 A;  4II9 A;  1LAN A;  3BI0 A;  3TO7 A;  3R9E A;  4A33 A;  4AVC A;  3R95 A;  4K30 A;  2PE3 A;  4HNX B;  2DXQ A;  3D7G A;  2FSR A;  2V8G A;  4JD6 A;  2QIR A;  3PB6 X;  4F6A A;  2C27 A;  3B8G A;  1ZG7 A;  2FIW A;  2PRQ A;  1JQG A;  4ONU A;  4PXD A;  4KVX A;  3RBU A;  4PXC A;  5CNP A;  2PIY A;  4MHN A;  4C2Z A;  4PK3 A;  4UCM A;  1IOF A;  4FWU A;  4AB7 A;  2PR8 A;  4HKF A;  3IWW A;  5LRJ A;  3NA6 A;  3QB8 A;  2NMT A;  3HLP A;  1UWY A;  4UF4 A;  4X2T A;  4CGN A;  7CPA A;  1LCP A;  2QEC A;  4P4D A;  5IB9 A;  1B6B A;  4JZ0 A;  2PJC A;  3DR8 A;  2CF4 A;  2C1C A;  1QQ9 A;  2FIA A; 
#chains in the Genus database with same CATH homology
 2OZG A;  1I21 A;  2B3V A;  4AVA A;  3BJ7 A;  4KLV A;  4JLY A;  2Z3O A;  4NF1 A;  5F48 A;  5C88 A;  1BO4 A;  5IB0 A;  4A95 A;  3K9U A;  2ZXV A;  2G3T A;  4MY0 A;  2WSA A;  4M85 A;  1XMT A;  3LD2 A;  5DWM A;  3EY5 A;  3G8W A;  3FBU A;  1ON0 A;  2Z10 A;  4F0X A;  2R8V A;  2Q04 A;  4QBJ A;  3DR6 A;  3IU2 A;  2FCK A;  4I49 A;  1MK4 A;  1I1D A;  3OWC A;  2VXK A;  4ORF A;  4MFZ A;  1CJW A;  3SXO A;  3QAH A;  4XPK A;  2I00 A;  3S6H A;  5AGE A;  3IWG A;  2Z3P A;  3R1K A;  1Z4R A;  4XPD C;  3T9Y A;  4LUA A;  5KTA A;  4FD7 A;  2PRB A;  1QSR A;  4UWI A;  2JDC A;  2B58 A;  4EVY A;  4KUA A;  3FNC A;  4KLW A;  4MFJ A;  3JUW A;  2ATR A;  4CAV A;  5KTC A;  4B5O A;  3TTH A;  2REF A;  5G21 A;  2VQY A;  2Z11 A;  5G20 A;  3VWE A;  2YNC C;  4Q36 A;  3DDD A;  1S5K A;  4MFP A;  2H5M A;  3W6X A;  2G3A A;  3I9S A;  4BMH A;  1R57 A;  1Q2D A;  4X5K A;  1S7N A;  4NSQ A;  1Q2C A;  1IYK A;  1M44 A;  2AE6 A;  4R87 A;  4XPL A;  5J8C A;  3JVN A;  1S60 A;  4H89 A;  4CYP A;  1Z4E A;  4NEX A;  4CAX A;  2A4N A;  2R7H A;  4L8A A;  4MFQ A;  1N71 A;  3S6G A;  1Y9K A;  4LX9 A;  2VBQ A;  4UBR A;  4B12 A;  2F5I A;  1TIQ A;  3P2F A;  4UFV A;  3I3G A;  3FXT A;  1KUV A;  2WPX A;  2VZZ A;  2P0W A;  2GE3 A;  3ZZI A;  4IF5 A;  1M4G A;  4CYQ A;  4AG7 A;  5JQ4 A;  4CS0 B;  4MI4 A;  1NSL A;  3ZJ0 A;  1XF8 A;  2PSW A;  3TOA A;  4KOY A;  4BBH A;  4E8O A;  2JDD A;  3D2M A;  3EXN A;  4UFW A;  2QML A;  1S7L A;  4QUS A;  3F0A A;  4H6Z A;  3D3S A;  4XNH B;  1S3Z A;  4KSF A;  4KOT A;  3PGP A;  3H5Z A;  5HH1 A;  3R9F A;  3S6F A;  2I79 A;  3FIX A;  1KUX A;  1KZF A;  1YVO A;  2R1I A;  2G0B A;  1IIC A;  4JJX A;  1M4I A;  4CAF A;  3BLN A;  2CNM A;  1M1D A;  1XEB A;  2D4O A;  5FVJ A;  3VWD A;  3D8P A;  4E0A A;  5IV0 A;  4MHD A;  5F49 A;  3CXP A;  5G1Z A;  4A30 A;  2JLM A;  4HNW B;  3V8I A;  4MBU A;  1YRE A;  1Q2Y A;  3EO4 A;  1WK4 A;  4KS9 A;  2WPW A;  3IWE A;  1V0C A;  1WWZ A;  5AG4 A;  1B87 A;  2OZU A;  2DPT A;  2VEZ A;  3TO9 A;  1P4N A;  1Y9W A;  4CAE A;  5IX3 A;  4JWP A;  2VI7 A;  4MFL A;  4FD4 A;  1MJA A;  4RS2 A;  4RI1 A;  4M3S A;  2RC4 A;  2D4P A;  4AVB A;  3LOD A;  1S7F A;  5A27 A;  1QSN A;  4R57 A;  2Z3L A;  3RYO A;  2BSW A;  2B3U A;  3WR7 A;  5A28 A;  3W6S A;  4B14 A;  3N7Z A;  2FXF A;  1IB1 E;  2CXA A;  2ZW7 A;  3F8K A;  2GAN A;  4KVO E;  2CNS A;  4QC6 A;  2J8N A;  5F47 A;  2PR1 A;  2VZY A;  4PK2 A;  3P2H A;  1YX0 A;  1OZP A;  3TCV A;  1BOB A;  1Y7R A;  2CNT A;  3GKR A;  4L89 A;  3E0K A;  4A31 A;  2HUZ A;  4ZBG A;  4CGM A;  4C68 A;  3EFA A;  4U9Z A;  1VKC A;  4PSW A;  4OAE A;  3KKW A;  4U9Y A;  2JEV A;  4H6U A;  3S6K A;  2X7B A;  4CRY B;  2J8R A;  2O28 A;  4MJ8 A;  2PDO A;  2Z3K A;  1QSO A;  1K4J A;  5E96 A;  2R98 A;  5AG5 A;  1KUY A;  4DNC A;  4YGO A;  3TO6 A;  2EVN A;  2YND A;  4CGO A;  1NMT A;  1SQH A;  1Z9U A;  2KCW A;  5HMN A;  2EUI A;  3CXS A;  1QST A;  3A9L A;  4C2X A;  4PSX A;  4Y49 B;  3W91 A;  4IUS A;  2OU2 A;  1QSM A;  1RO5 A;  1I12 A;  1IID A;  1S7K A;  2FS5 A;  3BJ8 A;  2FL4 A;  3G3S A;  2B4D A;  2ZW5 A;  4KOR A;  2Q44 A;  3UY5 A;  3IU1 A;  4B5P A;  4XNH C;  4C7H A;  4KVM E;  1NE9 A;  5J8F A;  1VHS A;  4KOS A;  4UFX A;  2ZW4 A;  4UCP A;  4R3K A;  2Q0Y A;  2BL1 A;  2B4D B;  3T90 A;  4KUB A;  1XE4 A;  4B5P B;  4OAD A;  4CGL A;  4PV6 A;  2Z0Z A;  4A2Z A;  1YR0 A;  4FD6 A;  5C82 A;  4MY3 A;  4R9M A;  4Q38 A;  1U6M A;  4MFK A;  3H4Q A;  4U5Y A;  2BUE A;  4FD5 A;  4JXQ A;  3JTK A;  3GYA A;  5EBV A;  4HNY B;  2REE A;  2FE7 A;  5EC4 A;  4GS4 A;  2BEI A;  4CGP A;  1LRZ A;  4A32 A;  3DSB A;  3FB3 A;  4OLL A;  3FRM A;  1P0H A;  3D2P A;  2B4B A;  3TT2 A;  1YVK A;  3CXQ A;  2K5T A;  2ZPA A;  4NXY A;  2ZW6 A;  1YK3 A;  1XIX A;  2Z3M A;  3PZJ A;  1CM0 A;  4UCN A;  2FT0 A;  4KOW A;  1ZO0 A;  4YRH A;  5G22 A;  4KOV A;  2HQY A;  4CAW A;  3FYN A;  2B5G A;  4CRZ B;  4KOX A;  2PC1 A;  5H84 A;  4NCZ A;  2P6E A;  2Q4Y A;  5KTD A;  1L0C A;  5GCN A;  3R96 A;  4XPD B;  5AG6 A;  4KSA A;  1UFH A;  2P6G A;  2GIV A;  3TE4 A;  2B5G B;  2YNC A;  4B13 A;  4C2Y A;  1PU9 A;  1YLE A;  2WUU A;  5AG7 A;  4E2A A;  4UWJ A;  3NE7 A;  2OZH A;  1GHE A;  3MGD A;  2ARH A;  5BWA B;  1MJB A;  4YFJ A;  4B11 A;  2Q7B A;  3SHP A;  3SXN A;  2PQ8 A;  2YGW A;  4R3L A;  3GY9 A;  4QVT A;  5F46 A;  3C26 A;  2J8M A;  2AJ6 A;  5H86 A;  4B10 A;  3PP9 A;  4JXR A;  2YNE A;  5I0C A;  4CYO A;  4Y49 C;  3TOB A;  5JPH A;  2DPS A;  4ZGY B;  5DWN A;  1YGH A;  2HV2 A;  4AG9 A;  4KZT A;  2Z3N A;  3TFY A;  4QB9 A;  2IL4 A;  3DNS A;  4C7I A;  3F5B A;  1MJ9 A;  2CY2 A;  4KOU A;  3EC4 A;  2P6F A;  3R9G A;  1FY7 A;  2OB0 A;  4J3G A;  1IYL A;  4CYN A;  1J4J A;  2Y0M A;  1M4D A;  2OH1 A;  4F0Y A;  1PUA A;  2Q4V A;  4UA3 A;  1RXT A;  5ISV A;  3IGR A;  4II9 A;  3TO7 A;  3R9E A;  4A33 A;  4AVC A;  3R95 A;  4K30 A;  4HNX B;  4JD6 A;  2DXQ A;  2FSR A;  2QIR A;  4F6A A;  2C27 A;  3B8G A;  2FIW A;  4ONU A;  4KVX A;  5CNP A;  4C2Z A;  4PK3 A;  4UCM A;  4AB7 A;  2PR8 A;  4HKF A;  3QB8 A;  4CGN A;  2NMT A;  2QEC A;  1B6B A;  3DR8 A;  2FIA A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...