2ZEGA

Crystal structure of the human glutaminyl cyclase mutant e201l at 2.08 angstrom resolution
Total Genus 107
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
107
sequence length
329
structure length
323
Chain Sequence
ASAWPEEKNYHQPAILNSSALRQIAEGTSISEMWQNDLQPLLIERYPGSPGSYAARQHIMQRIQRLQADWVLEIDTFLSQTPYGYRSFSNIISTLNPTAKRHLVLACHYDSKYFSHWNNRVFVGATDSAVPCAMMLELARALDKKLLSLKPDLSLQLIFFDGLEAFLHWSPQDSLYGSRHLAAKMASTPHPPGARGTSQLHGMDLLVLLDLIGAPNPTFPNFFPNSARWFERLQAIEHELHELGLLKDHSLEGRYFQNYSYGGVIQDDHIPFLRRGVPVLHLIPSPFPEVWHTMDDNEENLDESTIDNLNKILQVFVLEYLHL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords Glutaminyl-peptide cyclotransferase
publication title A conserved hydrogen-bond network in the catalytic centre of animal glutaminyl cyclases is critical for catalysis.
pubmed doi rcsb
source organism Homo sapiens
total genus 107
structure length 323
sequence length 329
chains with identical sequence B
ec nomenclature ec 2.3.2.5: Glutaminyl-peptide cyclotransferase.
pdb deposition date 2007-12-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF04389 Peptidase_M28 Peptidase family M28
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.630.10 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Zn peptidases 2zegA00
3D7DA 3RBUA 4UF4A 4G1PA 2RFHA 3FH4A 2OOTA 4F9VA 3B3VA 1TXRA 3TX8A 3I1UA 1PCAA 3PBEA 3TC8A 1Y7EA 1TF8A 3H8EA 4WJBA 3WC7A 2BCOA 3FVLA 1ZLIA 4PXBA 2XEGA 2PJ1A 4UEEA 1BPNA 1TKJA 3KHXA 1CP6A 3ISXA 2GLJA 3KZWA 1XMBA 2QJ8A 2PE3A 2PJAA 4OIWA 1IY7A 1CPXA 1BPMA 3PEIA 4A38A 4MRIA 1R3NA 4GM5A 4ZX8A 1FT7A 4EWTA 2V77A 1PYTB 4EFDA 3BI1A 4TWEA 1M4LA 3SI1A 3WC5A 3SJEA 2PJBA 4UIBA 1Z5RA 4F9UA 4PXEA 2EK9A 3LMSA 3IFEA 5J1QA 4H2KA 2WZNA 2ZEMA 2IJZA 4TNUA 5D8NA 2F7VA 4OC0A 2ZEHA 2F8HA 2XEIA 3MRUA 5LRJA 4MHPA 1XFOA 1DE4C 2Q51A 4MMOA 5JGFA 1ZG7A 1TKHA 2CIJA 1TF9A 1HDQA 4NGRA 4P4DA 4X3RA 3IEHA 3PRTA 3NH5A 3WC6A 2O53A 4X2TA 1LOKA 3D67A 3PB7X 3FEEA 2PVVA 3VATA 2VL1A 7CPAA 1LCPA 4FUUA 4DYOA 4YU9A 2ZENA 3N5FA 4R76A 5HVHA 5K8NA 4IK2A 1LANA 3ISZA 2PCUA 4OIDA 4WWVA 2NSMA 4OC4A 3DLJA 4PXDA 1NSAA 4OMEA 3RAMA 2PJ8A 5ELYA 1YMEA 2PJ6A 2BO9A 1VIXA 2PRQA 5DS0A 4UEZA 2XEJA 4Z65A 3WT4A 2JBKA 1XBUA 4OC1A 2NYQA 1BLLE 4MCSA 2PJ5A 3CPAA 2Q43A 3NH8A 4MCRA 1VHEA 3PFEA 3GB0A 2V8HA 2PVWA 4ONWA 3SJXA 4IHMA 3B7IA 5JM6A 3SJGA 1CX8A 2PIZA 4MHZA 1H8LA 1VGYA 3HUVA 3B3SA 4CPAA 4O23A 3KQZA 3B3WA 1JQGA 2Q4ZA 5LYFA 2PJCA 3S9NA 3VARA 4P4JA 2ANPA 2GREA 4OKOA 2I3CA 5LRKA 4ZY0A 2XEFA 1HEEA 2PIYA 3K9TA 3LWUA 4UEFA 3PB8X 3KR4A 5IB9A 2V8GA 3KI9A 3D66A 1UWYA 3FMCA 4NFRA 2CTCA 3SI2A 1Y0RA 1ZLHA 2ABZA 2C6PA 3FF3A 1YSJA 5HVGA 3IIBA 3L2NA 4PPZA 3NH4A 2WYRA 4OP4A 1LAPA 4NGPA 5F09A 2AFMA 3B2YA 1RTQA 1R43A 2AFUA 2ZOGA 4P45A 4R7MA 4UIAA 3H8FA 4A37A 4DJLA 4A94A 1HDUA 3H8GA 4NGQA 2PJ7A 4ZY2A 1GYTA 2C6GA 3SI0A 3DGVA 4P4FA 5K8PA 1Z8LA 4P44A 4P4IA 2FVGA 1FNOA 3KQXA 4ZX9A 2ZEOA 1XRYA 1Y0YA 5I4MA 4OC2A 4PQAA 3B3TA 4MXUA 5HXDA 2HC9A 4R6TA 4MCQA 2IMOA 5THWA 3V7ZA 4B6ZA 3NA6A 4NGSA 1OBRA 5CBMA 1TKFA 1YW6A 2ZEDA 3FECA 4MCPA 1ELLP 1Q7LA 1EE3P 4EMEA 3PB9X 4JZ0A 2PJ4A 4MHNA 3CPXA 1F2OA 2PJ3A 2V8VA 2ZEPA 3IJ3A 2CF4A 3KGQA 4BD9A 4YWYA 5HVFA 1CG2A 4K3NA 3S9LA 3D7HA 2OR4A 2ZEGA 2BOAA 2EWBA 3B3CA 3B35A 5JH9A 2C6CA 2AFXA 1IGBA 2O4HA 1LAMA 3FX6A 1F2PA 1KWMA 3BXMA 5LYLA 5K8MA 1YW4A 4X8IA 4NJRA 3PBBA 4NGNA 3IWWA 4FAIA 4OC5A 2ZEFA 4OC3A 3JRUA 2GLFA 3IC1A 1DTDA 3KHZA 8CPAA 2IQ6A 2V8DA 3PB4X 3KASA 1CBXA 1ARMA 4F8ZA 2AFSA 1QQ9A 4A39A 4ZY1A 4KSIA 1Z2LA 4AXVA 3VH9A 1YLOA 3D7GA 4P4EA 1LFWA 5D29A 4IAVA 1AMPA 3RZAA 4DUKA 3PFOA 4NJQA 2JEWA 3KR5A 1CP7A 5CPAA 4P6YA 4P10A 3FJUA 5LYIA 2CTBA 3PB6X 2ZELA 3CT9A 3HLPA 2QYVA 4NGMA 4FWUA 1ZG9A 1XJOA 2AFOA 4Q7AA 2DEAA 3D4UA 1ZG8A 3GLJA 3QNVA 2J9AA 3T8WA 4P4BA 1AYEA 2C1CA 2PJ9A 4NGTA 2POKA 3IO1A 3KL9A 4ZI6A 2PJ0A 4LQGA 2AFWA 1BAVA 3FEDA 3S9MA 3CDXA 1ARLA 3V38A 3WABA 5K8OA 2JBJA 4R8FA 1QMUA 1F57A 2ZEEA 3MN8A 2RB7A 3SJFA 6CPAA 2ZOFA 2AFZA 2G9DA 4MHYA 2EK8A 3D68A 2PJ2A 3NFZA 4W9YA 3BI0A 4ZYQA 2HB6A 5LRGA 1CPSA 4PXCA 5LYDA 3GUXA 3BHXA 1VHOA 3K2KA 1ELMP 2GU2A 4FBEA 4JYWA 2QVPA 4RUHA 3D7FA
chains in the Genus database with same CATH superfamily
1Y7RA 1NSLA 3D7DA 4C2ZA 3RBUA 4CGLA 5A27A 4UF4A 1Z8WA 4G1PA 2RFHA 3FH4A 3MGDA 2OOTA 4F9VA 4U9YA 2R1IA 2FCKA 1S7FA 3W6SA 1IYKA 3IGRA 4KLWA 4MFKA 3R9FA 4UFWA 3B3VA 1TXRA 1Z4RA 3T90A 3TX8A 3I1UA 4NEXA 1PCAA 3H4QA 3PBEA 4FD6A 4RN7A 3R9GA 1Y7EA 3TC8A 1Q2YA 1TF8A 3H8EA 4WJBA 3WC7A 5IB0A 2BCOA 3CZXA 3FVLA 3OWCA 1ZLIA 1WK4A 4A33A 4PXBA 2Q0YA 2VZZA 4CYOA 1X12A 1BO4A 2XEGA 2PJ1A 3LODA 1IICA 5IV0A 5HH1A 3RYOA 4UEEA 4KVOE 1BPNA 1TKJA 3KHXA 4E8OA 5JPHA 4JXRA 1CP6A 2BL1A 3ISXA 1U6MA 4JWPA 4CRYB 2GLJA 3KZWA 1XMBA 2QJ8A 4A32A 2PE3A 4XPDC 2AE6A 2Z3OA 2PDOA 1YLEA 3C26A 4JD6A 2PJAA 1YR0A 1IY7A 4OIWA 1CPXA 4OADA 4M6GA 4ZGYB 1BPMA 3PEIA 4A38A 2QECA 2IL4A 4MRIA 5H86A 1R3NA 1Z8XA 2KCWA 1S3ZA 4GM5A 4KOSA 4KVXA 1I12A 1FT7A 5EBVA 4ZX8A 2YNCA 4B12A 1Z4EA 4EWTA 3P2HA 2V77A 3D2PA 1PYTB 2B5GA 4EFDA 2Z3MA 3BI1A 2B58A 4C2YA 4TWEA 5AG6A 1IYLA 4UCMA 1M4LA 2YGWA 2OH1A 4XPDB 3SI1A 1I1DA 3WC5A 2Z3KA 3SJEA 2PJBA 4B5PB 1Z9UA 4UIBA 5C88A 1Z5RA 1QSOA 4F9UA 3PZJA 4PXEA 2EK9A 3K9UA 3SHPA 3LMSA 3N7ZA 2X7BA 4A95A 3IFEA 5JQ4A 3TE4A 4KOWA 2Q04A 2EBJA 5J1QA 3KKWA 4H2KA 2Z3NA 2WZNA 4R57A 3TTHA 1CM0A 4YFJA 2ZEMA 1BOBA 2IJZA 4H6ZA 4TNUA 5D8NA 4CAVA 2F7VA 4Q36A 2G3AA 2NMTA 4OC0A 1GHEA 2ZEHA 2F8HA 5I0CA 1CJWA 1IU8A 1MJBA 2PR1A 2XEIA 3MRUA 1KUVA 5LRJA 4MHPA 1XFOA 2GANA 3S6GA 1DE4C 2Q51A 4MMOA 1YQEA 4KORA 2DF5A 2ZW5A 5JGFA 4HPSA 1Q2CA 1ZG7A 1TKHA 2CIJA 3BJ8A 1TF9A 2WUUA 1FY7A 1HDQA 2ATRA 4NGRA 4P4DA 4X3RA 3IEHA 2ARHA 4B5OA 4UA3A 3PRTA 3NH5A 4JXQA 3WC6A 2O53A 4X2TA 1LOKA 3D67A 4KSAA 2I79A 3PB7X 2FIWA 3FEEA 4X5KA 1M4IA 1P0HA 2OU2A 2PVVA 4PV6A 3VATA 2VL1A 7CPAA 1LCPA 1N71A 4KLVA 4KVME 4KZTA 3RNZA 4FUUA 3D8PA 3GIUA 4DYOA 3FNCA 4YU9A 2ZENA 1J4JA 3I9SA 1YREA 2FXFA 4MFZA 3N5FA 3TFYA 4R76A 3IWEA 3EXNA 4CGOA 3CXSA 5HVHA 5G20A 1MJAA 5K8NA 4IK2A 2ZPAA 3CXQA 1LANA 2G3TA 4XNHC 3B8GA 3PB6X 5C82A 3ISZA 2G0BA 1XMTA 2DPSA 2PCUA 4OIDA 2B4BA 4WWVA 2NSMA 4B11A 4UWJA 3RO0A 4CYNA 4OC4A 3DLJA 4PXDA 3DR8A 3TO6A 1NSAA 2H5MA 4OMEA 4EVYA 4QUSA 2WPXA 3RAMA 2P6EA 2PJ8A 4NCZA 4CGNA 5ELYA 4F0XA 1KZFA 1K4JA 1OZPA 1VHSA 1YMEA 1VIXA 2BO9A 2PJ6A 3LACA 2PRQA 4KS9A 5DS0A 4UEZA 4XNHB 2PQ8A 3VWDA 4PK2A 4PK3A 2XEJA 3F0AA 5KTDA 3R96A 1XIXA 4Z65A 3GY9A 3WT4A 4MHDA 3QB8A 2JBKA 1YGHA 3TT2A 1XBUA 4OC1A 2NYQA 1BLLE 4IF5A 4II9A 2R98A 4MCSA 4KUBA 2PJ5A 2Q7SA 2VQYA 1IOFA 3FRMA 4HNXB 3CPAA 3H5ZA 2Z3PA 1TIQA 2Q43A 3NH8A 1AUGA 4MCRA 1VHEA 1QSRA 3GB0A 2V8HA 3JUWA 3PFEA 2PVWA 4ONWA 3SJXA 3FYNA 4IHMA 4CAWA 3B7IA 4NSQA 5JM6A 1Z8TA 3CXPA 3LD2A 3SJGA 1CX8A 2PIZA 4MHZA 2ZXVA 2FT0A 2JLMA 4FD7A 4PSWA 1H8LA 1VGYA 4CGMA 2Q7BA 4ONUA 3HUVA 3TO7A 3B3SA 2Q44A 4M3SA 4AVAA 4CPAA 4O23A 3DSBA 3KQZA 3B3WA 1JQGA 4RS2A 1SQHA 2Q4ZA 4C7IA 5LYFA 3P2FA 2PJCA 3S9NA 3VARA 4P4JA 4FD4A 2ANPA 3SXNA 2GREA 3R1KA 4OKOA 5A28A 5F46A 2I3CA 1PU9A 4C2XA 5LRKA 4ZY0A 4UFXA 4I49A 2XEFA 1HEEA 2PIYA 4MFPA 1YK3A 3K9TA 3LWUA 1S7KA 4UEFA 2YNCC 3PB8X 3EY5A 3KR4A 2CY2A 4IUSA 5IB9A 2V8GA 3JVNA 3FB3A 3KI9A 2Z11A 4BMHA 3D66A 1UWYA 3FMCA 1MK4A 4NFRA 2VBQA 2CTCA 5DWMA 5G1ZA 3SI2A 5CNPA 1Y0RA 1ZLHA 2ABZA 2C6PA 3FF3A 3SXOA 1YSJA 3R9EA 3IIBA 5HVGA 3L2NA 4PPZA 3V8IA 3NH4A 2WYRA 4H89A 4OP4A 4A2ZA 1LAPA 3E0KA 4NGPA 5AGEA 3A9LA 4UFVA 4XPLA 2AFMA 2QMLA 5F09A 1B87A 2B4DA 2B5GB 3B2YA 2D4PA 1RTQA 2HQYA 2ODFA 2HV2A 3FXTA 2JEVA 2Q4YA 3GYAA 2FIAA 1R43A 2AFUA 2ZOGA 1XE4A 4P45A 4R7MA 4UCPA 4UWIA 4DNCA 4UIAA 3H8FA 3IU2A 4A37A 4DJLA 3I3GA 1HDUA 3H8GA 4UCNA 2P0WA 4A94A 2VZYA 1WWZA 4U9ZA 1YVKA 4C68A 2OZUA 4NGQA 4ORFA 3BJ7A 2PJ7A 4ZY2A 4CYQA 1GYTA 1VKCA 1Y9WA 2C6GA 5G21A 3SI0A 3DGVA 4P4FA 5K8PA 1PUAA 2Z10A 1Z8LA 3NE8A 1M1DA 5BWAB 4HNWB 4MFLA 4BINA 4P44A 4P4IA 5G22A 2FVGA 1FNOA 5KTAA 3DR6A 3KQXA 4ZX9A 2ZEOA 5AG5A 2I00A 4L89A 4OLLA 1IB1E 1XRYA 1Y0YA 2BSWA 4HNYB 4CGPA 5I4MA 4U5YA 4ZBGA 2REFA 4OC2A 3S6HA 1IOIA 4PQAA 2YNEA 4BBHA 3B3TA 2Z3LA 4KOUA 4MXUA 2PC1A 4K30A 5HXDA 2HC9A 4R6TA 4MCQA 2IMOA 2RC4A 5THWA 3V7ZA 4B6ZA 3NA6A 4NGSA 1OBRA 4H6UA 3WR7A 5CBMA 1TKFA 1YW6A 2ZEDA 3TOAA 3IWGA 4E0AA 3FECA 5AG7A 4MCPA 1ELLP 4KOVA 1Q7LA 1EE3P 4CRZB 3W91A 3ZJ0A 4MFJA 4AG9A 4EMEA 5HMNA 4KOXA 2J8NA 2J8MA 4QC6A 1QSNA 3PB9X 4JZ0A 2GFQA 2PJ4A 3NE7A 2CNTA 5KTCA 4MHNA 1NMTA 1B6BA 3CPXA 1F2OA 4QVTA 1R57A 2JDCA 2PJ3A 2V8VA 2REEA 2ZEPA 1XEBA 3IJ3A 5F47A 3FIXA 3F5BA 2CF4A 3KGQA 3TO9A 4BD9A 3R95A 4YWYA 5HVFA 1CG2A 2DPTA 4K3NA 1S7NA 2VEZA 3S9LA 4M6IA 2BUEA 3D7HA 2OR4A 2ZEGA 4AB7A 4CS0B 1JWQA 2AJ6A 2D4OA 2DXQA 2BOAA 2EWBA 3B3CA 4A30A 3B35A 5JH9A 2C6CA 2F5IA 1RO5A 2AFXA 2O4HA 1IGBA 4M85A 1M4GA 1LAMA 1QSMA 3FX6A 1F2PA 1KWMA 3BXMA 3FBUA 4RI1A 5H84A 5LYLA 5K8MA 1YW4A 4X8IA 4NJRA 2R7HA 4OAEA 3D3SA 3PBBA 2J8RA 4NGNA 4CAXA 4C7HA 4YGOA 4UBRA 3IWWA 4FAIA 4YRHA 4OC5A 5AG4A 2ZEFA 4B10A 1NE9A 2ZW6A 5FVJA 4OC3A 3EO4A 3JRUA 2GLFA 4B5PA 3BLNA 3QAYA 4NF1A 3IC1A 1DTDA 3DNSA 3KHZA 8CPAA 4R3KA 2IQ6A 1MJ9A 2V8DA 3PB4X 3KASA 1I21A 1CBXA 1ARMA 4PSXA 2AFSA 1QQ9A 4XPKA 5EC4A 4A39A 4F8ZA 2Z0ZA 4QBJA 4KOTA 4ZY1A 4KSIA 4CAFA 1YVOA 1Z2LA 4LUAA 4LX9A 1XOVA 4AXVA 1UFHA 3VH9A 1YLOA 3D7GA 2K5TA 5J8CA 2VXKA 2YNDA 4M6HA 1LFWA 4P4EA 5D29A 4L8AA 4IAVA 4CAEA 5J8FA 1AMPA 3D2MA 3RZAA 4DUKA 3PFOA 4MY0A 4NJQA 2PR8A 2JEWA 2P6FA 3KR5A 2CNMA 1CP7A 2OB0A 2A4NA 4P6YA 1Y9KA 2WPWA 4P10A 2EO8A 5CPAA 1ON0A 2Y0MA 3IU1A 2P6GA 3FJUA 5LYIA 1KUXA 4GXHA 3EC4A 3S6KA 1M44A 2CTBA 1YX0A 3G8WA 2ZELA 1Q2DA 2JDDA 3CT9A 3HLPA 2WSAA 3JTKA 2QYVA 4Y49C 4NGMA 1XF8A 1IIDA 4FWUA 1ZG9A 1XJOA 2AFOA 4Q7AA 2DEAA 2OZHA 3D4UA 2O28A 1ZG8A 3GLJA 3QNVA 2PSWA 4FD5A 2EUIA 2J9AA 3T8WA 1A2ZA 3DDDA 4P4BA 4F6AA 2CXAA 1AYEA 2C1CA 4NXYA 2PJ9A 4NGTA 1M4DA 2POKA 3IO1A 4A31A 4Y49B 3EFAA 3KL9A 2ZW4A 2FS5A 4MFQA 5IX3A 4ZI6A 2OZGA 2PJ0A 4KOYA 4LQGA 3S6FA 2AFWA 3QAHA 2R8VA 1BAVA 3FEDA 4GS4A 2C27A 3CDXA 1ARLA 3S9MA 4Q38A 3TOBA 4KSFA 4B13A 2ZW7A 3V38A 2GE3A 3T9YA 2PRBA 3WABA 1S5KA 2B4DB 3GKRA 5K8OA 2JBJA 4R8FA 4AVBA 4AVCA 1QMUA 1F57A 2BEIA 2ZEEA 4MY3A 3MN8A 2RB7A 4QB9A 3W6XA 1KUYA 3SJFA 1LRZA 1RXTA 6CPAA 4J3GA 5DWNA 5E96A 5EMIA 2ZOFA 4HKFA 3ZZIA 1L0CA 2AFZA 2FSRA 2G9DA 1X10A 4MHYA 2EK8A 3D68A 2QIRA 4LQ6A 4R9MA 2PJ2A 3NFZA 4W9YA 3UY5A 3BI0A 4ZYQA 2HB6A 1S60A 2VI7A 3PP9A 5LRGA 4JJXA 1CPSA 4PXCA 4R87A 3F8KA 5LYDA 3GUXA 3BHXA 2B3VA 3G3SA 4R3LA 5ISVA 1S7LA 2CNSA 2EVNA 1VHOA 5F48A 3TCVA 3K2KA 1ELMP 4MJ8A 4E2AA 3PGPA 3VWEA 4JLYA 1P4NA 4KUAA 5F49A 4AG7A 4B14A 2B3UA 2GU2A 4MBUA 4FBEA 2GIVA 2FL4A 1V0CA 2FE7A 4JYWA 2QVPA 4MI4A 5GCNA 4RUHA 2Q4VA 4F0YA 2HUZA 3D7FA 1ZO0A 4CYPA 1QSTA
chains in the Genus database with same CATH topology
3D7DA 3RBUA 4UF4A 4G1PA 2RFHA 3FH4A 2OOTA 4F9VA 3B3VA 1TXRA 3TX8A 3I1UA 1PCAA 3PBEA 3TC8A 1Y7EA 1TF8A 3H8EA 4WJBA 3WC7A 2BCOA 3FVLA 1ZLIA 4PXBA 2XEGA 2PJ1A 4UEEA 1BPNA 1TKJA 3KHXA 1CP6A 3ISXA 2GLJA 3KZWA 1XMBA 2QJ8A 2PE3A 2PJAA 4OIWA 1IY7A 1CPXA 1BPMA 3PEIA 4A38A 4MRIA 1R3NA 4GM5A 4ZX8A 1FT7A 4EWTA 2V77A 1PYTB 4EFDA 3BI1A 4TWEA 1M4LA 3SI1A 3WC5A 3SJEA 2PJBA 4UIBA 1Z5RA 4F9UA 4PXEA 2EK9A 3LMSA 3IFEA 5J1QA 4H2KA 2WZNA 2ZEMA 2IJZA 4TNUA 5D8NA 2F7VA 4OC0A 2ZEHA 2F8HA 2XEIA 3MRUA 5LRJA 4MHPA 1XFOA 1DE4C 2Q51A 4MMOA 5JGFA 1ZG7A 1TKHA 2CIJA 1TF9A 1HDQA 4NGRA 4P4DA 4X3RA 3IEHA 3PRTA 3NH5A 3WC6A 2O53A 4X2TA 1LOKA 3D67A 3PB7X 3FEEA 2PVVA 3VATA 2VL1A 7CPAA 1LCPA 4FUUA 4DYOA 4YU9A 2ZENA 3N5FA 4R76A 5HVHA 5K8NA 4IK2A 1LANA 3ISZA 2PCUA 4OIDA 4WWVA 2NSMA 4OC4A 3DLJA 4PXDA 1NSAA 4OMEA 3RAMA 2PJ8A 5ELYA 1YMEA 2PJ6A 2BO9A 1VIXA 2PRQA 5DS0A 4UEZA 2XEJA 4Z65A 3WT4A 2JBKA 1XBUA 4OC1A 2NYQA 1BLLE 4MCSA 2PJ5A 3CPAA 2Q43A 3NH8A 4MCRA 1VHEA 3PFEA 3GB0A 2V8HA 2PVWA 4ONWA 3SJXA 4IHMA 3B7IA 5JM6A 3SJGA 1CX8A 2PIZA 4MHZA 1H8LA 1VGYA 3HUVA 3B3SA 4CPAA 4O23A 3KQZA 3B3WA 1JQGA 2Q4ZA 5LYFA 2PJCA 3S9NA 3VARA 4P4JA 2ANPA 2GREA 4OKOA 2I3CA 5LRKA 4ZY0A 2XEFA 1HEEA 2PIYA 3K9TA 3LWUA 4UEFA 3PB8X 3KR4A 5IB9A 2V8GA 3KI9A 3D66A 1UWYA 3FMCA 4NFRA 2CTCA 3SI2A 1Y0RA 1ZLHA 2ABZA 2C6PA 3FF3A 1YSJA 5HVGA 3IIBA 3L2NA 4PPZA 3NH4A 2WYRA 4OP4A 1LAPA 4NGPA 5F09A 2AFMA 3B2YA 1RTQA 1R43A 2AFUA 2ZOGA 4P45A 4R7MA 4UIAA 3H8FA 4A37A 4DJLA 4A94A 1HDUA 3H8GA 4NGQA 2PJ7A 4ZY2A 1GYTA 2C6GA 3SI0A 3DGVA 4P4FA 5K8PA 1Z8LA 4P44A 4P4IA 2FVGA 1FNOA 3KQXA 4ZX9A 2ZEOA 1XRYA 1Y0YA 5I4MA 4OC2A 4PQAA 3B3TA 4MXUA 5HXDA 2HC9A 4R6TA 4MCQA 2IMOA 5THWA 3V7ZA 4B6ZA 3NA6A 4NGSA 1OBRA 5CBMA 1TKFA 1YW6A 2ZEDA 3FECA 4MCPA 1ELLP 1Q7LA 1EE3P 4EMEA 3PB9X 4JZ0A 2PJ4A 4MHNA 3CPXA 1F2OA 2PJ3A 2V8VA 2ZEPA 3IJ3A 2CF4A 3KGQA 4BD9A 4YWYA 5HVFA 1CG2A 4K3NA 3S9LA 3D7HA 2OR4A 2ZEGA 2BOAA 2EWBA 3B3CA 3B35A 5JH9A 2C6CA 2AFXA 1IGBA 2O4HA 1LAMA 3FX6A 1F2PA 1KWMA 3BXMA 5LYLA 5K8MA 1YW4A 4X8IA 4NJRA 3PBBA 4NGNA 3IWWA 4FAIA 4OC5A 2ZEFA 4OC3A 3JRUA 2GLFA 3IC1A 1DTDA 3KHZA 8CPAA 2IQ6A 2V8DA 3PB4X 3KASA 1CBXA 1ARMA 4F8ZA 2AFSA 1QQ9A 4A39A 4ZY1A 4KSIA 1Z2LA 4AXVA 3VH9A 1YLOA 3D7GA 4P4EA 1LFWA 5D29A 4IAVA 1AMPA 3RZAA 4DUKA 3PFOA 4NJQA 2JEWA 3KR5A 1CP7A 5CPAA 4P6YA 4P10A 3FJUA 5LYIA 2CTBA 3PB6X 2ZELA 3CT9A 3HLPA 2QYVA 4NGMA 4FWUA 1ZG9A 1XJOA 2AFOA 4Q7AA 2DEAA 3D4UA 1ZG8A 3GLJA 3QNVA 2J9AA 3T8WA 4P4BA 1AYEA 2C1CA 2PJ9A 4NGTA 2POKA 3IO1A 3KL9A 4ZI6A 2PJ0A 4LQGA 2AFWA 1BAVA 3FEDA 3S9MA 3CDXA 1ARLA 3V38A 3WABA 5K8OA 2JBJA 4R8FA 1QMUA 1F57A 2ZEEA 3MN8A 2RB7A 3SJFA 6CPAA 2ZOFA 2AFZA 2G9DA 4MHYA 2EK8A 3D68A 2PJ2A 3NFZA 4W9YA 3BI0A 4ZYQA 2HB6A 5LRGA 1CPSA 4PXCA 5LYDA 3GUXA 3BHXA 1VHOA 3K2KA 1ELMP 2GU2A 4FBEA 4JYWA 2QVPA 4RUHA 3D7FA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3D7D A;  3RBU A;  4UF4 A;  4G1P A;  2RFH A;  3FH4 A;  2OOT A;  4F9V A;  3B3V A;  1TXR A;  3TX8 A;  3I1U A;  1PCA A;  3PBE A;  3TC8 A;  1Y7E A;  1TF8 A;  3H8E A;  4WJB A;  3WC7 A;  2BCO A;  3FVL A;  1ZLI A;  4PXB A;  2XEG A;  2PJ1 A;  4UEE A;  1BPN A;  1TKJ A;  3KHX A;  1CP6 A;  3ISX A;  2GLJ A;  3KZW A;  1XMB A;  2QJ8 A;  2PE3 A;  2PJA A;  4OIW A;  1IY7 A;  1CPX A;  1BPM A;  3PEI A;  4A38 A;  4MRI A;  1R3N A;  4GM5 A;  4ZX8 A;  1FT7 A;  4EWT A;  2V77 A;  1PYT B;  4EFD A;  3BI1 A;  4TWE A;  1M4L A;  3SI1 A;  3WC5 A;  3SJE A;  2PJB A;  4UIB A;  1Z5R A;  4F9U A;  4PXE A;  2EK9 A;  3LMS A;  3IFE A;  5J1Q A;  4H2K A;  2WZN A;  2ZEM A;  2IJZ A;  4TNU A;  5D8N A;  2F7V A;  4OC0 A;  2ZEH A;  2F8H A;  2XEI A;  3MRU A;  5LRJ A;  4MHP A;  1XFO A;  1DE4 C;  2Q51 A;  4MMO A;  5JGF A;  1ZG7 A;  1TKH A;  2CIJ A;  1TF9 A;  1HDQ A;  4NGR A;  4P4D A;  4X3R A;  3IEH A;  3PRT A;  3NH5 A;  3WC6 A;  2O53 A;  4X2T A;  1LOK A;  3D67 A;  3PB7 X;  3FEE A;  2PVV A;  3VAT A;  2VL1 A;  7CPA A;  1LCP A;  4FUU A;  4DYO A;  4YU9 A;  2ZEN A;  3N5F A;  4R76 A;  5HVH A;  5K8N A;  4IK2 A;  1LAN A;  3ISZ A;  2PCU A;  4OID A;  4WWV A;  2NSM A;  4OC4 A;  3DLJ A;  4PXD A;  1NSA A;  4OME A;  3RAM A;  2PJ8 A;  5ELY A;  1YME A;  2PJ6 A;  2BO9 A;  1VIX A;  2PRQ A;  5DS0 A;  4UEZ A;  2XEJ A;  4Z65 A;  3WT4 A;  2JBK A;  1XBU A;  4OC1 A;  2NYQ A;  1BLL E;  4MCS A;  2PJ5 A;  3CPA A;  2Q43 A;  3NH8 A;  4MCR A;  1VHE A;  3PFE A;  3GB0 A;  2V8H A;  2PVW A;  4ONW A;  3SJX A;  4IHM A;  3B7I A;  5JM6 A;  3SJG A;  1CX8 A;  2PIZ A;  4MHZ A;  1H8L A;  1VGY A;  3HUV A;  3B3S A;  4CPA A;  4O23 A;  3KQZ A;  3B3W A;  1JQG A;  2Q4Z A;  5LYF A;  2PJC A;  3S9N A;  3VAR A;  4P4J A;  2ANP A;  2GRE A;  4OKO A;  2I3C A;  5LRK A;  4ZY0 A;  2XEF A;  1HEE A;  2PIY A;  3K9T A;  3LWU A;  4UEF A;  3PB8 X;  3KR4 A;  5IB9 A;  2V8G A;  3KI9 A;  3D66 A;  1UWY A;  3FMC A;  4NFR A;  2CTC A;  3SI2 A;  1Y0R A;  1ZLH A;  2ABZ A;  2C6P A;  3FF3 A;  1YSJ A;  5HVG A;  3IIB A;  3L2N A;  4PPZ A;  3NH4 A;  2WYR A;  4OP4 A;  1LAP A;  4NGP A;  5F09 A;  2AFM A;  3B2Y A;  1RTQ A;  1R43 A;  2AFU A;  2ZOG A;  4P45 A;  4R7M A;  4UIA A;  3H8F A;  4A37 A;  4DJL A;  4A94 A;  1HDU A;  3H8G A;  4NGQ A;  2PJ7 A;  4ZY2 A;  1GYT A;  2C6G A;  3SI0 A;  3DGV A;  4P4F A;  5K8P A;  1Z8L A;  4P44 A;  4P4I A;  2FVG A;  1FNO A;  3KQX A;  4ZX9 A;  2ZEO A;  1XRY A;  1Y0Y A;  5I4M A;  4OC2 A;  4PQA A;  3B3T A;  4MXU A;  5HXD A;  2HC9 A;  4R6T A;  4MCQ A;  2IMO A;  5THW A;  3V7Z A;  4B6Z A;  3NA6 A;  4NGS A;  1OBR A;  5CBM A;  1TKF A;  1YW6 A;  2ZED A;  3FEC A;  4MCP A;  1ELL P;  1Q7L A;  1EE3 P;  4EME A;  3PB9 X;  4JZ0 A;  2PJ4 A;  4MHN A;  3CPX A;  1F2O A;  2PJ3 A;  2V8V A;  2ZEP A;  3IJ3 A;  2CF4 A;  3KGQ A;  4BD9 A;  4YWY A;  5HVF A;  1CG2 A;  4K3N A;  3S9L A;  3D7H A;  2OR4 A;  2ZEG A;  2BOA A;  2EWB A;  3B3C A;  3B35 A;  5JH9 A;  2C6C A;  2AFX A;  1IGB A;  2O4H A;  1LAM A;  3FX6 A;  1F2P A;  1KWM A;  3BXM A;  5LYL A;  5K8M A;  1YW4 A;  4X8I A;  4NJR A;  3PBB A;  4NGN A;  3IWW A;  4FAI A;  4OC5 A;  2ZEF A;  4OC3 A;  3JRU A;  2GLF A;  3IC1 A;  1DTD A;  3KHZ A;  8CPA A;  2IQ6 A;  2V8D A;  3PB4 X;  3KAS A;  1CBX A;  1ARM A;  4F8Z A;  2AFS A;  1QQ9 A;  4A39 A;  4ZY1 A;  4KSI A;  1Z2L A;  4AXV A;  3VH9 A;  1YLO A;  3D7G A;  4P4E A;  1LFW A;  5D29 A;  4IAV A;  1AMP A;  3RZA A;  4DUK A;  3PFO A;  4NJQ A;  2JEW A;  3KR5 A;  1CP7 A;  5CPA A;  4P6Y A;  4P10 A;  3FJU A;  5LYI A;  2CTB A;  3PB6 X;  2ZEL A;  3CT9 A;  3HLP A;  2QYV A;  4NGM A;  4FWU A;  1ZG9 A;  1XJO A;  2AFO A;  4Q7A A;  2DEA A;  3D4U A;  1ZG8 A;  3GLJ A;  3QNV A;  2J9A A;  3T8W A;  4P4B A;  1AYE A;  2C1C A;  2PJ9 A;  4NGT A;  2POK A;  3IO1 A;  3KL9 A;  4ZI6 A;  2PJ0 A;  4LQG A;  2AFW A;  1BAV A;  3FED A;  3S9M A;  3CDX A;  1ARL A;  3V38 A;  3WAB A;  5K8O A;  2JBJ A;  4R8F A;  1QMU A;  1F57 A;  2ZEE A;  3MN8 A;  2RB7 A;  3SJF A;  6CPA A;  2ZOF A;  2AFZ A;  2G9D A;  4MHY A;  2EK8 A;  3D68 A;  2PJ2 A;  3NFZ A;  4W9Y A;  3BI0 A;  4ZYQ A;  2HB6 A;  5LRG A;  1CPS A;  4PXC A;  5LYD A;  3GUX A;  3BHX A;  1VHO A;  3K2K A;  1ELM P;  2GU2 A;  4FBE A;  4JYW A;  2QVP A;  4RUH A;  3D7F A; 
#chains in the Genus database with same CATH topology
 1Y7R A;  1NSL A;  3D7D A;  4C2Z A;  3RBU A;  4CGL A;  5A27 A;  4UF4 A;  1Z8W A;  4G1P A;  2RFH A;  3FH4 A;  3MGD A;  2OOT A;  4F9V A;  4U9Y A;  2R1I A;  2FCK A;  1S7F A;  3W6S A;  1IYK A;  3IGR A;  4KLW A;  4MFK A;  3R9F A;  4UFW A;  3B3V A;  1TXR A;  1Z4R A;  3T90 A;  3TX8 A;  3I1U A;  4NEX A;  1PCA A;  3H4Q A;  3PBE A;  4FD6 A;  4RN7 A;  3R9G A;  1Y7E A;  3TC8 A;  1Q2Y A;  1TF8 A;  3H8E A;  4WJB A;  3WC7 A;  5IB0 A;  2BCO A;  3CZX A;  3FVL A;  3OWC A;  1ZLI A;  1WK4 A;  4A33 A;  4PXB A;  2Q0Y A;  2VZZ A;  4CYO A;  1X12 A;  1BO4 A;  2XEG A;  2PJ1 A;  3LOD A;  1IIC A;  5IV0 A;  5HH1 A;  3RYO A;  4UEE A;  4KVO E;  1BPN A;  1TKJ A;  3KHX A;  4E8O A;  5JPH A;  4JXR A;  1CP6 A;  2BL1 A;  3ISX A;  1U6M A;  4JWP A;  4CRY B;  2GLJ A;  3KZW A;  1XMB A;  2QJ8 A;  4A32 A;  2PE3 A;  4XPD C;  2AE6 A;  2Z3O A;  2PDO A;  1YLE A;  3C26 A;  4JD6 A;  2PJA A;  1YR0 A;  1IY7 A;  4OIW A;  1CPX A;  4OAD A;  4M6G A;  4ZGY B;  1BPM A;  3PEI A;  4A38 A;  2QEC A;  2IL4 A;  4MRI A;  5H86 A;  1R3N A;  1Z8X A;  2KCW A;  1S3Z A;  4GM5 A;  4KOS A;  4KVX A;  1I12 A;  1FT7 A;  5EBV A;  4ZX8 A;  2YNC A;  4B12 A;  1Z4E A;  4EWT A;  3P2H A;  2V77 A;  3D2P A;  1PYT B;  2B5G A;  4EFD A;  2Z3M A;  3BI1 A;  2B58 A;  4C2Y A;  4TWE A;  5AG6 A;  1IYL A;  4UCM A;  1M4L A;  2YGW A;  2OH1 A;  4XPD B;  3SI1 A;  1I1D A;  3WC5 A;  2Z3K A;  3SJE A;  2PJB A;  4B5P B;  1Z9U A;  4UIB A;  5C88 A;  1Z5R A;  1QSO A;  4F9U A;  3PZJ A;  4PXE A;  2EK9 A;  3K9U A;  3SHP A;  3LMS A;  3N7Z A;  2X7B A;  4A95 A;  3IFE A;  5JQ4 A;  3TE4 A;  4KOW A;  2Q04 A;  2EBJ A;  5J1Q A;  3KKW A;  4H2K A;  2Z3N A;  2WZN A;  4R57 A;  3TTH A;  1CM0 A;  4YFJ A;  2ZEM A;  1BOB A;  2IJZ A;  4H6Z A;  4TNU A;  5D8N A;  4CAV A;  2F7V A;  4Q36 A;  2G3A A;  2NMT A;  4OC0 A;  1GHE A;  2ZEH A;  2F8H A;  5I0C A;  1CJW A;  1IU8 A;  1MJB A;  2PR1 A;  2XEI A;  3MRU A;  1KUV A;  5LRJ A;  4MHP A;  1XFO A;  2GAN A;  3S6G A;  1DE4 C;  2Q51 A;  4MMO A;  1YQE A;  4KOR A;  2DF5 A;  2ZW5 A;  5JGF A;  4HPS A;  1Q2C A;  1ZG7 A;  1TKH A;  2CIJ A;  3BJ8 A;  1TF9 A;  2WUU A;  1FY7 A;  1HDQ A;  2ATR A;  4NGR A;  4P4D A;  4X3R A;  3IEH A;  2ARH A;  4B5O A;  4UA3 A;  3PRT A;  3NH5 A;  4JXQ A;  3WC6 A;  2O53 A;  4X2T A;  1LOK A;  3D67 A;  4KSA A;  2I79 A;  3PB7 X;  2FIW A;  3FEE A;  4X5K A;  1M4I A;  1P0H A;  2OU2 A;  2PVV A;  4PV6 A;  3VAT A;  2VL1 A;  7CPA A;  1LCP A;  1N71 A;  4KLV A;  4KVM E;  4KZT A;  3RNZ A;  4FUU A;  3D8P A;  3GIU A;  4DYO A;  3FNC A;  4YU9 A;  2ZEN A;  1J4J A;  3I9S A;  1YRE A;  2FXF A;  4MFZ A;  3N5F A;  3TFY A;  4R76 A;  3IWE A;  3EXN A;  4CGO A;  3CXS A;  5HVH A;  5G20 A;  1MJA A;  5K8N A;  4IK2 A;  2ZPA A;  3CXQ A;  1LAN A;  2G3T A;  4XNH C;  3B8G A;  3PB6 X;  5C82 A;  3ISZ A;  2G0B A;  1XMT A;  2DPS A;  2PCU A;  4OID A;  2B4B A;  4WWV A;  2NSM A;  4B11 A;  4UWJ A;  3RO0 A;  4CYN A;  4OC4 A;  3DLJ A;  4PXD A;  3DR8 A;  3TO6 A;  1NSA A;  2H5M A;  4OME A;  4EVY A;  4QUS A;  2WPX A;  3RAM A;  2P6E A;  2PJ8 A;  4NCZ A;  4CGN A;  5ELY A;  4F0X A;  1KZF A;  1K4J A;  1OZP A;  1VHS A;  1YME A;  1VIX A;  2BO9 A;  2PJ6 A;  3LAC A;  2PRQ A;  4KS9 A;  5DS0 A;  4UEZ A;  4XNH B;  2PQ8 A;  3VWD A;  4PK2 A;  4PK3 A;  2XEJ A;  3F0A A;  5KTD A;  3R96 A;  1XIX A;  4Z65 A;  3GY9 A;  3WT4 A;  4MHD A;  3QB8 A;  2JBK A;  1YGH A;  3TT2 A;  1XBU A;  4OC1 A;  2NYQ A;  1BLL E;  4IF5 A;  4II9 A;  2R98 A;  4MCS A;  4KUB A;  2PJ5 A;  2Q7S A;  2VQY A;  1IOF A;  3FRM A;  4HNX B;  3CPA A;  3H5Z A;  2Z3P A;  1TIQ A;  2Q43 A;  3NH8 A;  1AUG A;  4MCR A;  1VHE A;  1QSR A;  3GB0 A;  2V8H A;  3JUW A;  3PFE A;  2PVW A;  4ONW A;  3SJX A;  3FYN A;  4IHM A;  4CAW A;  3B7I A;  4NSQ A;  5JM6 A;  1Z8T A;  3CXP A;  3LD2 A;  3SJG A;  1CX8 A;  2PIZ A;  4MHZ A;  2ZXV A;  2FT0 A;  2JLM A;  4FD7 A;  4PSW A;  1H8L A;  1VGY A;  4CGM A;  2Q7B A;  4ONU A;  3HUV A;  3TO7 A;  3B3S A;  2Q44 A;  4M3S A;  4AVA A;  4CPA A;  4O23 A;  3DSB A;  3KQZ A;  3B3W A;  1JQG A;  4RS2 A;  1SQH A;  2Q4Z A;  4C7I A;  5LYF A;  3P2F A;  2PJC A;  3S9N A;  3VAR A;  4P4J A;  4FD4 A;  2ANP A;  3SXN A;  2GRE A;  3R1K A;  4OKO A;  5A28 A;  5F46 A;  2I3C A;  1PU9 A;  4C2X A;  5LRK A;  4ZY0 A;  4UFX A;  4I49 A;  2XEF A;  1HEE A;  2PIY A;  4MFP A;  1YK3 A;  3K9T A;  3LWU A;  1S7K A;  4UEF A;  2YNC C;  3PB8 X;  3EY5 A;  3KR4 A;  2CY2 A;  4IUS A;  5IB9 A;  2V8G A;  3JVN A;  3FB3 A;  3KI9 A;  2Z11 A;  4BMH A;  3D66 A;  1UWY A;  3FMC A;  1MK4 A;  4NFR A;  2VBQ A;  2CTC A;  5DWM A;  5G1Z A;  3SI2 A;  5CNP A;  1Y0R A;  1ZLH A;  2ABZ A;  2C6P A;  3FF3 A;  3SXO A;  1YSJ A;  3R9E A;  3IIB A;  5HVG A;  3L2N A;  4PPZ A;  3V8I A;  3NH4 A;  2WYR A;  4H89 A;  4OP4 A;  4A2Z A;  1LAP A;  3E0K A;  4NGP A;  5AGE A;  3A9L A;  4UFV A;  4XPL A;  2AFM A;  2QML A;  5F09 A;  1B87 A;  2B4D A;  2B5G B;  3B2Y A;  2D4P A;  1RTQ A;  2HQY A;  2ODF A;  2HV2 A;  3FXT A;  2JEV A;  2Q4Y A;  3GYA A;  2FIA A;  1R43 A;  2AFU A;  2ZOG A;  1XE4 A;  4P45 A;  4R7M A;  4UCP A;  4UWI A;  4DNC A;  4UIA A;  3H8F A;  3IU2 A;  4A37 A;  4DJL A;  3I3G A;  1HDU A;  3H8G A;  4UCN A;  2P0W A;  4A94 A;  2VZY A;  1WWZ A;  4U9Z A;  1YVK A;  4C68 A;  2OZU A;  4NGQ A;  4ORF A;  3BJ7 A;  2PJ7 A;  4ZY2 A;  4CYQ A;  1GYT A;  1VKC A;  1Y9W A;  2C6G A;  5G21 A;  3SI0 A;  3DGV A;  4P4F A;  5K8P A;  1PUA A;  2Z10 A;  1Z8L A;  3NE8 A;  1M1D A;  5BWA B;  4HNW B;  4MFL A;  4BIN A;  4P44 A;  4P4I A;  5G22 A;  2FVG A;  1FNO A;  5KTA A;  3DR6 A;  3KQX A;  4ZX9 A;  2ZEO A;  5AG5 A;  2I00 A;  4L89 A;  4OLL A;  1IB1 E;  1XRY A;  1Y0Y A;  2BSW A;  4HNY B;  4CGP A;  5I4M A;  4U5Y A;  4ZBG A;  2REF A;  4OC2 A;  3S6H A;  1IOI A;  4PQA A;  2YNE A;  4BBH A;  3B3T A;  2Z3L A;  4KOU A;  4MXU A;  2PC1 A;  4K30 A;  5HXD A;  2HC9 A;  4R6T A;  4MCQ A;  2IMO A;  2RC4 A;  5THW A;  3V7Z A;  4B6Z A;  3NA6 A;  4NGS A;  1OBR A;  4H6U A;  3WR7 A;  5CBM A;  1TKF A;  1YW6 A;  2ZED A;  3TOA A;  3IWG A;  4E0A A;  3FEC A;  5AG7 A;  4MCP A;  1ELL P;  4KOV A;  1Q7L A;  1EE3 P;  4CRZ B;  3W91 A;  3ZJ0 A;  4MFJ A;  4AG9 A;  4EME A;  5HMN A;  4KOX A;  2J8N A;  2J8M A;  4QC6 A;  1QSN A;  3PB9 X;  4JZ0 A;  2GFQ A;  2PJ4 A;  3NE7 A;  2CNT A;  5KTC A;  4MHN A;  1NMT A;  1B6B A;  3CPX A;  1F2O A;  4QVT A;  1R57 A;  2JDC A;  2PJ3 A;  2V8V A;  2REE A;  2ZEP A;  1XEB A;  3IJ3 A;  5F47 A;  3FIX A;  3F5B A;  2CF4 A;  3KGQ A;  3TO9 A;  4BD9 A;  3R95 A;  4YWY A;  5HVF A;  1CG2 A;  2DPT A;  4K3N A;  1S7N A;  2VEZ A;  3S9L A;  4M6I A;  2BUE A;  3D7H A;  2OR4 A;  2ZEG A;  4AB7 A;  4CS0 B;  1JWQ A;  2AJ6 A;  2D4O A;  2DXQ A;  2BOA A;  2EWB A;  3B3C A;  4A30 A;  3B35 A;  5JH9 A;  2C6C A;  2F5I A;  1RO5 A;  2AFX A;  2O4H A;  1IGB A;  4M85 A;  1M4G A;  1LAM A;  1QSM A;  3FX6 A;  1F2P A;  1KWM A;  3BXM A;  3FBU A;  4RI1 A;  5H84 A;  5LYL A;  5K8M A;  1YW4 A;  4X8I A;  4NJR A;  2R7H A;  4OAE A;  3D3S A;  3PBB A;  2J8R A;  4NGN A;  4CAX A;  4C7H A;  4YGO A;  4UBR A;  3IWW A;  4FAI A;  4YRH A;  4OC5 A;  5AG4 A;  2ZEF A;  4B10 A;  1NE9 A;  2ZW6 A;  5FVJ A;  4OC3 A;  3EO4 A;  3JRU A;  2GLF A;  4B5P A;  3BLN A;  3QAY A;  4NF1 A;  3IC1 A;  1DTD A;  3DNS A;  3KHZ A;  8CPA A;  4R3K A;  2IQ6 A;  1MJ9 A;  2V8D A;  3PB4 X;  3KAS A;  1I21 A;  1CBX A;  1ARM A;  4PSX A;  2AFS A;  1QQ9 A;  4XPK A;  5EC4 A;  4A39 A;  4F8Z A;  2Z0Z A;  4QBJ A;  4KOT A;  4ZY1 A;  4KSI A;  4CAF A;  1YVO A;  1Z2L A;  4LUA A;  4LX9 A;  1XOV A;  4AXV A;  1UFH A;  3VH9 A;  1YLO A;  3D7G A;  2K5T A;  5J8C A;  2VXK A;  2YND A;  4M6H A;  1LFW A;  4P4E A;  5D29 A;  4L8A A;  4IAV A;  4CAE A;  5J8F A;  1AMP A;  3D2M A;  3RZA A;  4DUK A;  3PFO A;  4MY0 A;  4NJQ A;  2PR8 A;  2JEW A;  2P6F A;  3KR5 A;  2CNM A;  1CP7 A;  2OB0 A;  2A4N A;  4P6Y A;  1Y9K A;  2WPW A;  4P10 A;  2EO8 A;  5CPA A;  1ON0 A;  2Y0M A;  3IU1 A;  2P6G A;  3FJU A;  5LYI A;  1KUX A;  4GXH A;  3EC4 A;  3S6K A;  1M44 A;  2CTB A;  1YX0 A;  3G8W A;  2ZEL A;  1Q2D A;  2JDD A;  3CT9 A;  3HLP A;  2WSA A;  3JTK A;  2QYV A;  4Y49 C;  4NGM A;  1XF8 A;  1IID A;  4FWU A;  1ZG9 A;  1XJO A;  2AFO A;  4Q7A A;  2DEA A;  2OZH A;  3D4U A;  2O28 A;  1ZG8 A;  3GLJ A;  3QNV A;  2PSW A;  4FD5 A;  2EUI A;  2J9A A;  3T8W A;  1A2Z A;  3DDD A;  4P4B A;  4F6A A;  2CXA A;  1AYE A;  2C1C A;  4NXY A;  2PJ9 A;  4NGT A;  1M4D A;  2POK A;  3IO1 A;  4A31 A;  4Y49 B;  3EFA A;  3KL9 A;  2ZW4 A;  2FS5 A;  4MFQ A;  5IX3 A;  4ZI6 A;  2OZG A;  2PJ0 A;  4KOY A;  4LQG A;  3S6F A;  2AFW A;  3QAH A;  2R8V A;  1BAV A;  3FED A;  4GS4 A;  2C27 A;  3CDX A;  1ARL A;  3S9M A;  4Q38 A;  3TOB A;  4KSF A;  4B13 A;  2ZW7 A;  3V38 A;  2GE3 A;  3T9Y A;  2PRB A;  3WAB A;  1S5K A;  2B4D B;  3GKR A;  5K8O A;  2JBJ A;  4R8F A;  4AVB A;  4AVC A;  1QMU A;  1F57 A;  2BEI A;  2ZEE A;  4MY3 A;  3MN8 A;  2RB7 A;  4QB9 A;  3W6X A;  1KUY A;  3SJF A;  1LRZ A;  1RXT A;  6CPA A;  4J3G A;  5DWN A;  5E96 A;  5EMI A;  2ZOF A;  4HKF A;  3ZZI A;  1L0C A;  2AFZ A;  2FSR A;  2G9D A;  1X10 A;  4MHY A;  2EK8 A;  3D68 A;  2QIR A;  4LQ6 A;  4R9M A;  2PJ2 A;  3NFZ A;  4W9Y A;  3UY5 A;  3BI0 A;  4ZYQ A;  2HB6 A;  1S60 A;  2VI7 A;  3PP9 A;  5LRG A;  4JJX A;  1CPS A;  4PXC A;  4R87 A;  3F8K A;  5LYD A;  3GUX A;  3BHX A;  2B3V A;  3G3S A;  4R3L A;  5ISV A;  1S7L A;  2CNS A;  2EVN A;  1VHO A;  5F48 A;  3TCV A;  3K2K A;  1ELM P;  4MJ8 A;  4E2A A;  3PGP A;  3VWE A;  4JLY A;  1P4N A;  4KUA A;  5F49 A;  4AG7 A;  4B14 A;  2B3U A;  2GU2 A;  4MBU A;  4FBE A;  2GIV A;  2FL4 A;  1V0C A;  2FE7 A;  4JYW A;  2QVP A;  4MI4 A;  5GCN A;  4RUH A;  2Q4V A;  4F0Y A;  2HUZ A;  3D7F A;  1ZO0 A;  4CYP A;  1QST A; 
#chains in the Genus database with same CATH homology
 3D7D A;  3RBU A;  4UF4 A;  4G1P A;  2RFH A;  3FH4 A;  2OOT A;  4F9V A;  3B3V A;  1TXR A;  3TX8 A;  3I1U A;  1PCA A;  3PBE A;  3TC8 A;  1Y7E A;  1TF8 A;  3H8E A;  4WJB A;  3WC7 A;  2BCO A;  3FVL A;  1ZLI A;  4PXB A;  2XEG A;  2PJ1 A;  4UEE A;  1BPN A;  1TKJ A;  3KHX A;  1CP6 A;  3ISX A;  2GLJ A;  3KZW A;  1XMB A;  2QJ8 A;  2PE3 A;  2PJA A;  4OIW A;  1IY7 A;  1CPX A;  1BPM A;  3PEI A;  4A38 A;  4MRI A;  1R3N A;  4GM5 A;  4ZX8 A;  1FT7 A;  4EWT A;  2V77 A;  1PYT B;  4EFD A;  3BI1 A;  4TWE A;  1M4L A;  3SI1 A;  3WC5 A;  3SJE A;  2PJB A;  4UIB A;  1Z5R A;  4F9U A;  4PXE A;  2EK9 A;  3LMS A;  3IFE A;  5J1Q A;  4H2K A;  2WZN A;  2ZEM A;  2IJZ A;  4TNU A;  5D8N A;  2F7V A;  4OC0 A;  2ZEH A;  2F8H A;  2XEI A;  3MRU A;  5LRJ A;  4MHP A;  1XFO A;  1DE4 C;  2Q51 A;  4MMO A;  5JGF A;  1ZG7 A;  1TKH A;  2CIJ A;  1TF9 A;  1HDQ A;  4NGR A;  4P4D A;  4X3R A;  3IEH A;  3PRT A;  3NH5 A;  3WC6 A;  2O53 A;  4X2T A;  1LOK A;  3D67 A;  3PB7 X;  3FEE A;  2PVV A;  3VAT A;  2VL1 A;  7CPA A;  1LCP A;  4FUU A;  4DYO A;  4YU9 A;  2ZEN A;  3N5F A;  4R76 A;  5HVH A;  5K8N A;  4IK2 A;  1LAN A;  3ISZ A;  2PCU A;  4OID A;  4WWV A;  2NSM A;  4OC4 A;  3DLJ A;  4PXD A;  1NSA A;  4OME A;  3RAM A;  2PJ8 A;  5ELY A;  1YME A;  2PJ6 A;  2BO9 A;  1VIX A;  2PRQ A;  5DS0 A;  4UEZ A;  2XEJ A;  4Z65 A;  3WT4 A;  2JBK A;  1XBU A;  4OC1 A;  2NYQ A;  1BLL E;  4MCS A;  2PJ5 A;  3CPA A;  2Q43 A;  3NH8 A;  4MCR A;  1VHE A;  3PFE A;  3GB0 A;  2V8H A;  2PVW A;  4ONW A;  3SJX A;  4IHM A;  3B7I A;  5JM6 A;  3SJG A;  1CX8 A;  2PIZ A;  4MHZ A;  1H8L A;  1VGY A;  3HUV A;  3B3S A;  4CPA A;  4O23 A;  3KQZ A;  3B3W A;  1JQG A;  2Q4Z A;  5LYF A;  2PJC A;  3S9N A;  3VAR A;  4P4J A;  2ANP A;  2GRE A;  4OKO A;  2I3C A;  5LRK A;  4ZY0 A;  2XEF A;  1HEE A;  2PIY A;  3K9T A;  3LWU A;  4UEF A;  3PB8 X;  3KR4 A;  5IB9 A;  2V8G A;  3KI9 A;  3D66 A;  1UWY A;  3FMC A;  4NFR A;  2CTC A;  3SI2 A;  1Y0R A;  1ZLH A;  2ABZ A;  2C6P A;  3FF3 A;  1YSJ A;  5HVG A;  3IIB A;  3L2N A;  4PPZ A;  3NH4 A;  2WYR A;  4OP4 A;  1LAP A;  4NGP A;  5F09 A;  2AFM A;  3B2Y A;  1RTQ A;  1R43 A;  2AFU A;  2ZOG A;  4P45 A;  4R7M A;  4UIA A;  3H8F A;  4A37 A;  4DJL A;  4A94 A;  1HDU A;  3H8G A;  4NGQ A;  2PJ7 A;  4ZY2 A;  1GYT A;  2C6G A;  3SI0 A;  3DGV A;  4P4F A;  5K8P A;  1Z8L A;  4P44 A;  4P4I A;  2FVG A;  1FNO A;  3KQX A;  4ZX9 A;  2ZEO A;  1XRY A;  1Y0Y A;  5I4M A;  4OC2 A;  4PQA A;  3B3T A;  4MXU A;  5HXD A;  2HC9 A;  4R6T A;  4MCQ A;  2IMO A;  5THW A;  3V7Z A;  4B6Z A;  3NA6 A;  4NGS A;  1OBR A;  5CBM A;  1TKF A;  1YW6 A;  2ZED A;  3FEC A;  4MCP A;  1ELL P;  1Q7L A;  1EE3 P;  4EME A;  3PB9 X;  4JZ0 A;  2PJ4 A;  4MHN A;  3CPX A;  1F2O A;  2PJ3 A;  2V8V A;  2ZEP A;  3IJ3 A;  2CF4 A;  3KGQ A;  4BD9 A;  4YWY A;  5HVF A;  1CG2 A;  4K3N A;  3S9L A;  3D7H A;  2OR4 A;  2ZEG A;  2BOA A;  2EWB A;  3B3C A;  3B35 A;  5JH9 A;  2C6C A;  2AFX A;  1IGB A;  2O4H A;  1LAM A;  3FX6 A;  1F2P A;  1KWM A;  3BXM A;  5LYL A;  5K8M A;  1YW4 A;  4X8I A;  4NJR A;  3PBB A;  4NGN A;  3IWW A;  4FAI A;  4OC5 A;  2ZEF A;  4OC3 A;  3JRU A;  2GLF A;  3IC1 A;  1DTD A;  3KHZ A;  8CPA A;  2IQ6 A;  2V8D A;  3PB4 X;  3KAS A;  1CBX A;  1ARM A;  4F8Z A;  2AFS A;  1QQ9 A;  4A39 A;  4ZY1 A;  4KSI A;  1Z2L A;  4AXV A;  3VH9 A;  1YLO A;  3D7G A;  4P4E A;  1LFW A;  5D29 A;  4IAV A;  1AMP A;  3RZA A;  4DUK A;  3PFO A;  4NJQ A;  2JEW A;  3KR5 A;  1CP7 A;  5CPA A;  4P6Y A;  4P10 A;  3FJU A;  5LYI A;  2CTB A;  3PB6 X;  2ZEL A;  3CT9 A;  3HLP A;  2QYV A;  4NGM A;  4FWU A;  1ZG9 A;  1XJO A;  2AFO A;  4Q7A A;  2DEA A;  3D4U A;  1ZG8 A;  3GLJ A;  3QNV A;  2J9A A;  3T8W A;  4P4B A;  1AYE A;  2C1C A;  2PJ9 A;  4NGT A;  2POK A;  3IO1 A;  3KL9 A;  4ZI6 A;  2PJ0 A;  4LQG A;  2AFW A;  1BAV A;  3FED A;  3S9M A;  3CDX A;  1ARL A;  3V38 A;  3WAB A;  5K8O A;  2JBJ A;  4R8F A;  1QMU A;  1F57 A;  2ZEE A;  3MN8 A;  2RB7 A;  3SJF A;  6CPA A;  2ZOF A;  2AFZ A;  2G9D A;  4MHY A;  2EK8 A;  3D68 A;  2PJ2 A;  3NFZ A;  4W9Y A;  3BI0 A;  4ZYQ A;  2HB6 A;  5LRG A;  1CPS A;  4PXC A;  5LYD A;  3GUX A;  3BHX A;  1VHO A;  3K2K A;  1ELM P;  2GU2 A;  4FBE A;  4JYW A;  2QVP A;  4RUH A;  3D7F A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...