2ZEGA

Crystal structure of the human glutaminyl cyclase mutant e201l at 2.08 angstrom resolution
Total Genus 107
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
107
sequence length
329
structure length
323
Chain Sequence
b'ASAWPEEKNYHQPAILNSSALRQIAEGTSISEMWQNDLQPLLIERYPGSPGSYAARQHIMQRIQRLQADWVLEIDTFLSQTPYGYRSFSNIISTLNPTAKRHLVLACHYDSKYFSHWNNRVFVGATDSAVPCAMMLELARALDKKLLSLKPDLSLQLIFFDGLEAFLHWSPQDSLYGSRHLAAKMASTPHPPGARGTSQLHGMDLLVLLDLIGAPNPTFPNFFPNSARWFERLQAIEHELHELGLLKDHSLEGRYFQNYSYGGVIQDDHIPFLRRGVPVLHLIPSPFPEVWHTMDDNEENLDESTIDNLNKILQVFVLEYLHL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Glutaminyl-peptide cyclotransferase
publication title A conserved hydrogen-bond network in the catalytic centre of animal glutaminyl cyclases is critical for catalysis.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
total genus 107
structure length 323
sequence length 329
chains with identical sequence B
ec nomenclature ec 2.3.2.5: Glutaminyl-peptide cyclotransferase.
pdb deposition date 2007-12-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF04389 Peptidase_M28 Peptidase family M28
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.630.10 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Zn peptidases 2zegA00
1ZLIA 3FF3A 1F2OA 1YSJA 4MHYA 3IIBA 4P4EA 3IEHA 3L2NA 1VHOA 2NSMA 2V8GA 3RZAA 3BI1A 1TKJA 2C1CA 2FVGA 3KHXA 4R7MA 1DTDA 2HB6A 3PRTA 2PJCA 4MCRA 4NGPA 2PIYA 4IHMA 3TC8A 4OC5A 3IJ3A 3V38A 3VATA 3WABA 4A38A 1VGYA 2ZEHA 4MHPA 3N5FA 3PB7X 4ZX8A 3WC5A 4YWYA 1Z8LA 3T8WA 3KQZA 4UF4A 1QQ9A 3K2KA 4MCQA 3SI0A 4B6ZA 3KZWA 3LMSA 5LRJA 5J1QA 4OKOA 5HXDA 5HVFA 2XEJA 1LANA 1ZG9A 3NFZA 2PVWA 3FMCA 4ONWA 1CP7A 2V8VA 3WT4A 2XEGA 2ZENA 1ELMP 5DS0A 1BPNA 2JBKA 2PCUA 4G1PA 4LQGA 3D7GA 2NYQA 4KSIA 2O53A 3B3WA 3BHXA 3JRUA 2PJ2A 5LRGA 4A37A 4DYOA 5LYFA 4WWVA 5D29A 3DLJA 1R3NA 1LAPA 4NJQA 4OIDA 2POKA 1TF8A 3NH8A 3TX8A 2ZOFA 4OC0A 4X2TA 1FT7A 4P4JA 5K8OA 3D4UA 2AFZA 3HUVA 4O23A 3PB6X 1RTQA 4MRIA 1XJOA 4UEZA 3LWUA 2ZEPA 1XMBA 2PRQA 2CTCA 4PXDA 4DJLA 2I3CA 3DGVA 2CTBA 4NGSA 4PXEA 4GM5A 4ZY0A 1Z5RA 4MCSA 4DUKA 4W9YA 2QJ8A 4Q7AA 4ZY1A 2WYRA 1AMPA 3K9TA 2WZNA 5K8NA 2PJ9A 1VIXA 2XEIA 2CF4A 3IC1A 3IWWA 1TXRA 4NGRA 1YW6A 1LOKA 3HLPA 4RUHA 4UEFA 1ELLP 1ZLHA 4MHZA 3KGQA 3S9MA 4NGMA 3D7FA 2AFWA 4A39A 3B3SA 3I1UA 2PJAA 4PPZA 4PXCA 1HEEA 2BO9A 2PE3A 3H8EA 4PQAA 4OC2A 4UIBA 6CPAA 1CBXA 4P10A 2C6GA 1BPMA 1H8LA 1YMEA 3GLJA 4FUUA 3KL9A 1VHEA 2HC9A 1AYEA 1CP6A 2PJ7A 4IK2A 5THWA 2PJBA 2ZEGA 5HVHA 2QYVA 3SJGA 3H8FA 3BI0A 2PIZA 7CPAA 4BD9A 1DE4C 2VL1A 4OC4A 5ELYA 2PJ1A 2ZEFA 3H8GA 2ANPA 4CPAA 2PJ5A 3PBBA 4P45A 4F8ZA 5JGFA 2ZEOA 5LRKA 4TWEA 2ZEEA 3KHZA 4MMOA 4K3NA 4ZY2A 2Q43A 3D7DA 2C6CA 1PCAA 3SJXA 3KQXA 8CPAA 2F8HA 2PVVA 1Q7LA 3BXMA 2OR4A 1ARMA 2PJ8A 4Z65A 1CG2A 4X3RA 3FEEA 2EWBA 1Y0YA 3FECA 3B3CA 3PB9X 4OP4A 1OBRA 3FEDA 5HVGA 3FX6A 4FBEA 1BAVA 4NGQA 2PJ6A 2AFXA 4A94A 2BOAA 5F09A 4P6YA 4OC1A 3SJEA 2GLFA 3WC6A 2ABZA 4R76A 1JQGA 1LCPA 1CPXA 4EWTA 3NH4A 3PFEA 4F9UA 3D67A 3VH9A 4R6TA 1F57A 4JYWA 3SJFA 4ZYQA 1Z2LA 3PFOA 5K8PA 3MN8A 4UIAA 2GU2A 1FNOA 2F7VA 2JEWA 2PJ0A 3KASA 4P44A 4MHNA 3CDXA 3FJUA 2OOTA 2QVPA 1R43A 3B2YA 2GLJA 4ZI6A 4UEEA 1LFWA 4OC3A 4NGNA 3CPXA 2ZEMA 4F9VA 3S9NA 1BLLE 4TNUA 2ZELA 4IAVA 3B35A 5D8NA 2V8HA 2Q4ZA 3B3VA 4OMEA 4EMEA 3IO1A 1HDQA 4OIWA 2G9DA 3PBEA 3CPAA 1YW4A 1TKFA 3ISXA 1XFOA 2DEAA 2EK8A 3NH5A 5CBMA 2EK9A 2XEFA 1M4LA 4PXBA 1NSAA 3CT9A 3KR5A 2RFHA 3V7ZA 1ZG8A 3WC7A 3GB0A 2IJZA 1GYTA 2AFMA 2V77A 1CPSA 2RB7A 1UWYA 1HDUA 1ARLA 1ZG7A 1PYTB 3IFEA 5LYIA 1F2PA 1TF9A 4ZX9A 3D68A 4NFRA 2BCOA 4P4IA 3NA6A 4P4DA 4EFDA 3S9LA 4MCPA 1KWMA 2Q51A 3RAMA 3SI1A 3FVLA 1YLOA 4R8FA 2IQ6A 2C6PA 3SI2A 2ZEDA 1EE3P 2PJ4A 3D66A 4MXUA 4YU9A 1Y7EA 3RBUA 2CIJA 3PEIA 2V8DA 2GREA 5IB9A 3B7IA 4NJRA 4H2KA 3GUXA 4P4BA 4AXVA 1IGBA 1CX8A 2IMOA 3PB8X 3ISZA 3FH4A 2J9AA 1XBUA 4WJBA 3B3TA 2JBJA 5CPAA 5I4MA 5JH9A 3KR4A 1TKHA 3KI9A 4P4FA 4FWUA 5K8MA 1IY7A 2O4HA 3QNVA 4X8IA 5JM6A 5LYDA 3VARA 2ZOGA 1LAMA 3PB4X 3MRUA 4JZ0A 2AFUA 1Y0RA 1XRYA 5LYLA 4NGTA 3D7HA 4FAIA 2AFOA 2PJ3A 1QMUA 2AFSA
chains in the Genus database with same CATH superfamily
2Z11A 1B6BA 1ZLIA 2EO8A 5AG7A 3FF3A 4ZGYB 1F2OA 2Z3PA 3JUWA 4KSAA 1YSJA 2ZXVA 4MHYA 4B13A 5J8FA 2Z3LA 1X12A 3IIBA 3IEHA 1M1DA 1S7NA 4P4EA 3L2NA 1VHOA 1XOVA 2NSMA 4CRYB 4X5KA 4R3KA 2YNCA 2AE6A 4XPDB 4HNWB 2V8GA 5A28A 1M4IA 3RZAA 3BI1A 1TKJA 2C1CA 2FVGA 3KHXA 4R7MA 4UEZA 1DTDA 4A2ZA 3ZZIA 2GIVA 2HB6A 3PRTA 2PJCA 3PZJA 4MCRA 2PIYA 4NGPA 2HQYA 2PR8A 5I0CA 4IHMA 3QAHA 4MBUA 4RI1A 3TC8A 4AB7A 4E0AA 1QSMA 4OC5A 3IJ3A 2BSWA 3V38A 3VATA 2VXKA 4C2ZA 3FB3A 4KOTA 4KOUA 3WABA 4B12A 4A38A 2FL4A 4BMHA 5EC4A 3W6XA 1VGYA 3GYAA 5AG4A 2ZEHA 3D3SA 3H4QA 4MHPA 2RC4A 3IWGA 3N5FA 4OAEA 3PB7X 1YLEA 4ZX8A 3CXQA 4CAEA 3WC5A 4YWYA 1Z8LA 3T8WA 4A30A 3KQZA 4CYNA 4UF4A 1QQ9A 3K2KA 4MCQA 1IYKA 3IGRA 2Z0ZA 4CAXA 3SI0A 4KUAA 4CRZB 4B6ZA 4HPSA 2BL1A 3KZWA 3LMSA 5LRJA 5J1QA 4KUBA 2VQYA 4OKOA 4XNHB 5HXDA 2A4NA 5HVFA 2XEJA 1LANA 2H5MA 4CYPA 5H84A 5H86A 1ZG9A 3QB8A 1NSLA 4F0YA 3NFZA 4ORFA 4UCPA 2Y0MA 3FIXA 2X7BA 4R9MA 2B3VA 2WPWA 2PVWA 2P6EA 3FMCA 4IF5A 4ONWA 1M4DA 1CP7A 1S7KA 2V8VA 4B5PB 3WT4A 4E2AA 1YREA 2XEGA 2ZENA 4KLVA 1ELMP 4KLWA 5DS0A 1BPNA 4UCMA 5HMNA 1Q2YA 2Z3MA 3D8PA 2JBKA 2PCUA 2BEIA 4B10A 4AG7A 2J8MA 4G1PA 4LQGA 1ON0A 2FXFA 4GXHA 3W91A 3D7GA 2NYQA 4R57A 2REFA 4KSIA 2Q0YA 2B58A 2O53A 2ZW4A 3B3WA 3BHXA 3DNSA 3JRUA 3P2HA 4L8AA 2CNSA 4OLLA 2PJ2A 5LRGA 2REEA 1XE4A 4A37A 2ODFA 4DYOA 5G1ZA 5LYFA 1XF8A 2OZUA 2PRBA 4RN7A 3V8IA 4KS9A 4WWVA 5D29A 4FD6A 3DLJA 1R3NA 2JDCA 1LAPA 2HUZA 4NJQA 3I9SA 4OIDA 2POKA 1TF8A 1SQHA 3NH8A 4NF1A 1YQEA 2YNDA 1MK4A 3TX8A 2ZOFA 1B87A 3FBUA 4OC0A 4CAVA 4AVBA 4X2TA 1FT7A 4KOSA 4P4JA 5F48A 5GCNA 5K8OA 3D4UA 2AFZA 3HUVA 2PDOA 4HNXB 2DPTA 1Q2CA 2DXQA 4Q38A 4O23A 3CXSA 3EXNA 1RTQA 3PB6X 1XJOA 4JD6A 1YGHA 3LWUA 2FSRA 1XMBA 2ZEPA 4I49A 4LX9A 2PRQA 4U5YA 2CTCA 4B5OA 3RYOA 1OZPA 1MJAA 4PXDA 5J8CA 3SHPA 4DJLA 2I3CA 2CNTA 3DGVA 3I3GA 2CTBA 4U9YA 1KUVA 2D4PA 4NGSA 4PXEA 1P0HA 3G8WA 3TO7A 4GM5A 4ZY0A 3IU1A 1Z5RA 4MCSA 3FXTA 4DUKA 1Q2DA 4RS2A 2R98A 3UY5A 4W9YA 4HKFA 2QJ8A 4KZTA 4Q7AA 4ZY1A 1S5KA 2WYRA 1AMPA 5EBVA 3K9TA 2EUIA 2WZNA 2I00A 3BJ7A 5K8NA 2PJ9A 4BINA 1QSOA 2Q04A 1VIXA 1FY7A 4H6UA 4PK2A 2FIAA 2XEIA 3DSBA 4CAWA 2WPXA 3LACA 1IOFA 4J3GA 2CF4A 3IC1A 4KOWA 3IWWA 1S60A 1TIQA 1TXRA 4NGRA 1YW6A 4YFJA 5JPHA 1XMTA 4C2YA 4NCZA 1LOKA 3HLPA 3TTHA 1YVOA 2Q4VA 4RUHA 2B5GA 4E8OA 4UEFA 4UCNA 2HV2A 5ISVA 2GANA 1ELLP 1YVKA 2J8NA 2QIRA 1ZLHA 4MHZA 4XPKA 3KGQA 3S9MA 3TO9A 4NGMA 2JDDA 2AFWA 2Q7SA 3D7FA 4A39A 2DF5A 2R1IA 3B3SA 4CYQA 3I1UA 4MY0A 2PJAA 4PPZA 4BBHA 4PXCA 4ZBGA 1HEEA 2BO9A 3PP9A 2PE3A 3H8EA 5C82A 4PQAA 4CYOA 5G22A 4OC2A 4UIBA 4CGPA 6CPAA 1CBXA 2O28A 2C6GA 3CXPA 4P10A 3C26A 2B4DA 5F46A 1BPMA 1H8LA 3R9EA 1YMEA 4NSQA 3GLJA 3BLNA 4FUUA 4R3LA 2Q44A 1CJWA 4LQ6A 5C88A 3KL9A 1Z9UA 1VHEA 2Z3OA 2HC9A 2FIWA 1AYEA 4QUSA 3TOAA 1CP6A 2PJ7A 3GY9A 4H6ZA 4IK2A 2R8VA 5THWA 4EVYA 4R87A 1NE9A 4FD4A 1IICA 2PJBA 2FE7A 3T90A 2ZEGA 4JJXA 3F0AA 2Z3NA 2QYVA 3MGDA 5HVHA 3SJGA 3H8FA 2Q7BA 3N7ZA 3BI0A 2PIZA 5IV0A 7CPAA 1BO4A 1UFHA 1DE4C 4MFKA 4BD9A 4C68A 4C7IA 1X10A 2KCWA 1MJBA 2VL1A 2WUUA 4OC4A 5ELYA 2PJ1A 2ZEFA 3H8GA 2IL4A 2ANPA 4A31A 1V0CA 1I21A 4CPAA 2PJ5A 3TE4A 3PBBA 3JTKA 4P45A 4F8ZA 5JGFA 2FT0A 2ZEOA 5HH1A 5G21A 5LRKA 4TWEA 2ZEEA 1IU8A 4U9ZA 3KHZA 4MMOA 3EFAA 4K3NA 4CGOA 5F47A 4ZY2A 3QAYA 4Y49C 1LRZA 1XIXA 2Q43A 3D7DA 4F0XA 2C6CA 2C27A 4MHDA 1IIDA 1PCAA 3SJXA 3KQXA 3OWCA 3RO0A 1IYLA 2PSWA 8CPAA 2F8HA 2PVVA 1S7FA 3DDDA 4UBRA 1Q7LA 3BXMA 3PGPA 2OR4A 1ARMA 5DWNA 4DNCA 2PJ8A 4Z65A 4YGOA 1CG2A 1Z8WA 1I12A 4KOYA 4X3RA 3FEEA 5E96A 2EVNA 1Y0YA 2EWBA 2FS5A 2QECA 3FECA 3B3CA 4XPDC 4KVME 1A2ZA 3PB9X 4OP4A 1OBRA 4UA3A 3FEDA 5HVGA 3FX6A 2B3UA 4FBEA 1BAVA 4MFPA 4NGQA 2PJ6A 2AFXA 3CZXA 4A94A 3EY5A 2R7HA 5A27A 2BOAA 2PQ8A 3R1KA 3EO4A 4P6YA 2GE3A 5F09A 4OC1A 3SJEA 1QSTA 2GLFA 3WC6A 3WR7A 1ZO0A 2ABZA 2WSAA 4R76A 1JQGA 1LCPA 1CPXA 3LD2A 3R95A 4EWTA 5KTAA 4CGNA 3D2MA 4K30A 4CAFA 3NH4A 1P4NA 3VWDA 3PFEA 4F9UA 3D67A 4QVTA 2EBJA 2VBQA 3VH9A 4R6TA 1F57A 4JYWA 3SJFA 4ZYQA 3B8GA 3F8KA 5EMIA 1Z2LA 4QB9A 3PFOA 4QBJA 3D2PA 5K8PA 4KOXA 1VHSA 2NMTA 3MN8A 4UIAA 2GU2A 4MFZA 1FNOA 1K4JA 2F7VA 2JEWA 2I79A 1I1DA 2PJ0A 4PSWA 3KASA 3NE8A 5DWMA 1WWZA 1M4GA 4Y49B 4P44A 4MHNA 2QMLA 3TFYA 2G3TA 3CDXA 3FJUA 2OZHA 3FYNA 2OOTA 1Y9WA 1R43A 1S3ZA 2QVPA 3B2YA 2GLJA 4XNHC 4A95A 3DR8A 1J4JA 4ZI6A 4XPLA 4M6IA 1U6MA 4UEEA 5F49A 5KTCA 1LFWA 2P6FA 4CGLA 1N71A 4OC3A 3W6SA 1S7LA 1CM0A 2B5GB 4NGNA 4PK3A 3TCVA 4H89A 3CPXA 2ZEMA 4F9VA 1AUGA 4A32A 5AGEA 3S9NA 2VI7A 1BLLE 2VEZA 4TNUA 4UFWA 2ZELA 5AG5A 4IAVA 4IUSA 3B35A 5D8NA 2V8HA 3R9FA 2P6GA 2Q4ZA 3B3VA 4OMEA 4EMEA 1KZFA 2GFQA 4JLYA 1MJ9A 2ZW7A 2CXAA 3DR6A 3K9UA 3S6FA 4B14A 4QC6A 2G0BA 1HDQA 3IO1A 2P0WA 2OZGA 3TO6A 4OIWA 3ZJ0A 2G9DA 3PBEA 3CPAA 1YW4A 1VKCA 1R57A 2BUEA 1TKFA 3ISXA 1XFOA 2B4DB 2DEAA 2EK8A 4B11A 4NXYA 3NH5A 5CBMA 4NEXA 1BOBA 1JWQA 2EK9A 2XEFA 1M4LA 4KVXA 3S6HA 4PXBA 3TOBA 1NSAA 3CT9A 2AJ6A 1YX0A 1Y7RA 2VZZA 4MFQA 1RO5A 2RFHA 3KR5A 4FD7A 3V7ZA 3EC4A 1ZG8A 4MY3A 3S6GA 1YK3A 3WC7A 3GB0A 2IJZA 2Q4YA 1GYTA 3IU2A 4C2XA 2AFMA 4Q36A 2V77A 1GHEA 2YNEA 1RXTA 2PR1A 3E0KA 2FCKA 5BWAB 4MFJA 1IOIA 4UWIA 4AG9A 1Z4RA 1CPSA 4M3SA 2RB7A 1UWYA 1HDUA 2ZW5A 2VZYA 1L0CA 1ARLA 1KUYA 1PYTB 1ZG7A 3IFEA 5IB0A 5LYIA 3GKRA 3P2FA 1F2PA 1TF9A 4KOVA 4ZX9A 3D68A 4JXQA 1QSNA 4NFRA 4UFXA 4OADA 4AVCA 2BCOA 4P4IA 1XEBA 4UWJA 3NA6A 4P4DA 4EFDA 3JVNA 4MCPA 3S9LA 1KWMA 2Q51A 3RAMA 4ONUA 1KUXA 2K5TA 3BJ8A 2PC1A 2ZW6A 3A9LA 4GS4A 3SI1A 2J8RA 1M44A 3SXOA 4JWPA 3FVLA 1YLOA 3FNCA 3KKWA 4R8FA 2G3AA 5JQ4A 2IQ6A 2C6PA 3SI2A 4MI4A 4HNYB 4F6AA 2YGWA 1Y9KA 2D4OA 2Z3KA 4LUAA 4KORA 4B5PA 2ZEDA 5AG6A 1EE3P 2PJ4A 3D66A 4MXUA 4YU9A 1Y7EA 3FRMA 3VWEA 3RBUA 2CIJA 2YNCC 3PEIA 1PUAA 3TT2A 2V8DA 1PU9A 1Z8TA 2GREA 5G20A 2ATRA 4C7HA 3S6KA 5IB9A 4A33A 3F5BA 1Z8XA 2JLMA 4M85A 2JEVA 3RNZA 3B7IA 2DPSA 4NJRA 2CNMA 2OU2A 4H2KA 3GUXA 4P4BA 4AXVA 4MRIA 3T9YA 1IGBA 4PV6A 1CX8A 3SXNA 4JXRA 2IMOA 5CNPA 3PB8X 3ISZA 3FH4A 3NE7A 2J9AA 4CGMA 1XBUA 4WJBA 4M6GA 4FD5A 3B3TA 2CY2A 2OB0A 4MJ8A 3LODA 2JBJA 5CPAA 2F5IA 5I4MA 5JH9A 2B4BA 3KR4A 4M6HA 1TKHA 3KI9A 3R96A 3H5ZA 4P4FA 4YRHA 4FWUA 1Z4EA 5K8MA 3IWEA 1IY7A 4CS0B 2O4HA 3QNVA 3R9GA 2ARHA 4X8IA 4PSXA 1QSRA 4MFLA 5JM6A 4UFVA 5LYDA 3VARA 1IB1E 2ZPAA 4II9A 2ZOGA 1LAMA 3PB4X 3MRUA 5IX3A 4JZ0A 2AFUA 1Y0RA 5KTDA 3G3SA 1XRYA 5LYLA 4NGTA 3D7HA 1YR0A 3GIUA 4AVAA 5FVJA 1WK4A 2AFOA 2Z10A 4KVOE 4L89A 4FAIA 2PJ3A 1QMUA 2OH1A 4KSFA 2AFSA 1NMTA
chains in the Genus database with same CATH topology
1ZLIA 3FF3A 1F2OA 1YSJA 4MHYA 3IIBA 4P4EA 3IEHA 3L2NA 1VHOA 2NSMA 2V8GA 3RZAA 3BI1A 1TKJA 2C1CA 2FVGA 3KHXA 4R7MA 1DTDA 2HB6A 3PRTA 2PJCA 4MCRA 4NGPA 2PIYA 4IHMA 3TC8A 4OC5A 3IJ3A 3V38A 3VATA 3WABA 4A38A 1VGYA 2ZEHA 4MHPA 3N5FA 3PB7X 4ZX8A 3WC5A 4YWYA 1Z8LA 3T8WA 3KQZA 4UF4A 1QQ9A 3K2KA 4MCQA 3SI0A 4B6ZA 3KZWA 3LMSA 5LRJA 5J1QA 4OKOA 5HXDA 5HVFA 2XEJA 1LANA 1ZG9A 3NFZA 2PVWA 3FMCA 4ONWA 1CP7A 2V8VA 3WT4A 2XEGA 2ZENA 1ELMP 5DS0A 1BPNA 2JBKA 2PCUA 4G1PA 4LQGA 3D7GA 2NYQA 4KSIA 2O53A 3B3WA 3BHXA 3JRUA 2PJ2A 5LRGA 4A37A 4DYOA 5LYFA 4WWVA 5D29A 3DLJA 1R3NA 1LAPA 4NJQA 4OIDA 2POKA 1TF8A 3NH8A 3TX8A 2ZOFA 4OC0A 4X2TA 1FT7A 4P4JA 5K8OA 3D4UA 2AFZA 3HUVA 4O23A 3PB6X 1RTQA 4MRIA 1XJOA 4UEZA 3LWUA 2ZEPA 1XMBA 2PRQA 2CTCA 4PXDA 4DJLA 2I3CA 3DGVA 2CTBA 4NGSA 4PXEA 4GM5A 4ZY0A 1Z5RA 4MCSA 4DUKA 4W9YA 2QJ8A 4Q7AA 4ZY1A 2WYRA 1AMPA 3K9TA 2WZNA 5K8NA 2PJ9A 1VIXA 2XEIA 2CF4A 3IC1A 3IWWA 1TXRA 4NGRA 1YW6A 1LOKA 3HLPA 4RUHA 4UEFA 1ELLP 1ZLHA 4MHZA 3KGQA 3S9MA 4NGMA 3D7FA 2AFWA 4A39A 3B3SA 3I1UA 2PJAA 4PPZA 4PXCA 1HEEA 2BO9A 2PE3A 3H8EA 4PQAA 4OC2A 4UIBA 6CPAA 1CBXA 4P10A 2C6GA 1BPMA 1H8LA 1YMEA 3GLJA 4FUUA 3KL9A 1VHEA 2HC9A 1AYEA 1CP6A 2PJ7A 4IK2A 5THWA 2PJBA 2ZEGA 5HVHA 2QYVA 3SJGA 3H8FA 3BI0A 2PIZA 7CPAA 4BD9A 1DE4C 2VL1A 4OC4A 5ELYA 2PJ1A 2ZEFA 3H8GA 2ANPA 4CPAA 2PJ5A 3PBBA 4P45A 4F8ZA 5JGFA 2ZEOA 5LRKA 4TWEA 2ZEEA 3KHZA 4MMOA 4K3NA 4ZY2A 2Q43A 3D7DA 2C6CA 1PCAA 3SJXA 3KQXA 8CPAA 2F8HA 2PVVA 1Q7LA 3BXMA 2OR4A 1ARMA 2PJ8A 4Z65A 1CG2A 4X3RA 3FEEA 2EWBA 1Y0YA 3FECA 3B3CA 3PB9X 4OP4A 1OBRA 3FEDA 5HVGA 3FX6A 4FBEA 1BAVA 4NGQA 2PJ6A 2AFXA 4A94A 2BOAA 5F09A 4P6YA 4OC1A 3SJEA 2GLFA 3WC6A 2ABZA 4R76A 1JQGA 1LCPA 1CPXA 4EWTA 3NH4A 3PFEA 4F9UA 3D67A 3VH9A 4R6TA 1F57A 4JYWA 3SJFA 4ZYQA 1Z2LA 3PFOA 5K8PA 3MN8A 4UIAA 2GU2A 1FNOA 2F7VA 2JEWA 2PJ0A 3KASA 4P44A 4MHNA 3CDXA 3FJUA 2OOTA 2QVPA 1R43A 3B2YA 2GLJA 4ZI6A 4UEEA 1LFWA 4OC3A 4NGNA 3CPXA 2ZEMA 4F9VA 3S9NA 1BLLE 4TNUA 2ZELA 4IAVA 3B35A 5D8NA 2V8HA 2Q4ZA 3B3VA 4OMEA 4EMEA 3IO1A 1HDQA 4OIWA 2G9DA 3PBEA 3CPAA 1YW4A 1TKFA 3ISXA 1XFOA 2DEAA 2EK8A 3NH5A 5CBMA 2EK9A 2XEFA 1M4LA 4PXBA 1NSAA 3CT9A 3KR5A 2RFHA 3V7ZA 1ZG8A 3WC7A 3GB0A 2IJZA 1GYTA 2AFMA 2V77A 1CPSA 2RB7A 1UWYA 1HDUA 1ARLA 1ZG7A 1PYTB 3IFEA 5LYIA 1F2PA 1TF9A 4ZX9A 3D68A 4NFRA 2BCOA 4P4IA 3NA6A 4P4DA 4EFDA 3S9LA 4MCPA 1KWMA 2Q51A 3RAMA 3SI1A 3FVLA 1YLOA 4R8FA 2IQ6A 2C6PA 3SI2A 2ZEDA 1EE3P 2PJ4A 3D66A 4MXUA 4YU9A 1Y7EA 3RBUA 2CIJA 3PEIA 2V8DA 2GREA 5IB9A 3B7IA 4NJRA 4H2KA 3GUXA 4P4BA 4AXVA 1IGBA 1CX8A 2IMOA 3PB8X 3ISZA 3FH4A 2J9AA 1XBUA 4WJBA 3B3TA 2JBJA 5CPAA 5I4MA 5JH9A 3KR4A 1TKHA 3KI9A 4P4FA 4FWUA 5K8MA 1IY7A 2O4HA 3QNVA 4X8IA 5JM6A 5LYDA 3VARA 2ZOGA 1LAMA 3PB4X 3MRUA 4JZ0A 2AFUA 1Y0RA 1XRYA 5LYLA 4NGTA 3D7HA 4FAIA 2AFOA 2PJ3A 1QMUA 2AFSA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1ZLI A;  3FF3 A;  1F2O A;  1YSJ A;  4MHY A;  3IIB A;  4P4E A;  3IEH A;  3L2N A;  1VHO A;  2NSM A;  2V8G A;  3RZA A;  3BI1 A;  1TKJ A;  2C1C A;  2FVG A;  3KHX A;  4R7M A;  1DTD A;  2HB6 A;  3PRT A;  2PJC A;  4MCR A;  4NGP A;  2PIY A;  4IHM A;  3TC8 A;  4OC5 A;  3IJ3 A;  3V38 A;  3VAT A;  3WAB A;  4A38 A;  1VGY A;  2ZEH A;  4MHP A;  3N5F A;  3PB7 X;  4ZX8 A;  3WC5 A;  4YWY A;  1Z8L A;  3T8W A;  3KQZ A;  4UF4 A;  1QQ9 A;  3K2K A;  4MCQ A;  3SI0 A;  4B6Z A;  3KZW A;  3LMS A;  5LRJ A;  5J1Q A;  4OKO A;  5HXD A;  5HVF A;  2XEJ A;  1LAN A;  1ZG9 A;  3NFZ A;  2PVW A;  3FMC A;  4ONW A;  1CP7 A;  2V8V A;  3WT4 A;  2XEG A;  2ZEN A;  1ELM P;  5DS0 A;  1BPN A;  2JBK A;  2PCU A;  4G1P A;  4LQG A;  3D7G A;  2NYQ A;  4KSI A;  2O53 A;  3B3W A;  3BHX A;  3JRU A;  2PJ2 A;  5LRG A;  4A37 A;  4DYO A;  5LYF A;  4WWV A;  5D29 A;  3DLJ A;  1R3N A;  1LAP A;  4NJQ A;  4OID A;  2POK A;  1TF8 A;  3NH8 A;  3TX8 A;  2ZOF A;  4OC0 A;  4X2T A;  1FT7 A;  4P4J A;  5K8O A;  3D4U A;  2AFZ A;  3HUV A;  4O23 A;  3PB6 X;  1RTQ A;  4MRI A;  1XJO A;  4UEZ A;  3LWU A;  2ZEP A;  1XMB A;  2PRQ A;  2CTC A;  4PXD A;  4DJL A;  2I3C A;  3DGV A;  2CTB A;  4NGS A;  4PXE A;  4GM5 A;  4ZY0 A;  1Z5R A;  4MCS A;  4DUK A;  4W9Y A;  2QJ8 A;  4Q7A A;  4ZY1 A;  2WYR A;  1AMP A;  3K9T A;  2WZN A;  5K8N A;  2PJ9 A;  1VIX A;  2XEI A;  2CF4 A;  3IC1 A;  3IWW A;  1TXR A;  4NGR A;  1YW6 A;  1LOK A;  3HLP A;  4RUH A;  4UEF A;  1ELL P;  1ZLH A;  4MHZ A;  3KGQ A;  3S9M A;  4NGM A;  3D7F A;  2AFW A;  4A39 A;  3B3S A;  3I1U A;  2PJA A;  4PPZ A;  4PXC A;  1HEE A;  2BO9 A;  2PE3 A;  3H8E A;  4PQA A;  4OC2 A;  4UIB A;  6CPA A;  1CBX A;  4P10 A;  2C6G A;  1BPM A;  1H8L A;  1YME A;  3GLJ A;  4FUU A;  3KL9 A;  1VHE A;  2HC9 A;  1AYE A;  1CP6 A;  2PJ7 A;  4IK2 A;  5THW A;  2PJB A;  2ZEG A;  5HVH A;  2QYV A;  3SJG A;  3H8F A;  3BI0 A;  2PIZ A;  7CPA A;  4BD9 A;  1DE4 C;  2VL1 A;  4OC4 A;  5ELY A;  2PJ1 A;  2ZEF A;  3H8G A;  2ANP A;  4CPA A;  2PJ5 A;  3PBB A;  4P45 A;  4F8Z A;  5JGF A;  2ZEO A;  5LRK A;  4TWE A;  2ZEE A;  3KHZ A;  4MMO A;  4K3N A;  4ZY2 A;  2Q43 A;  3D7D A;  2C6C A;  1PCA A;  3SJX A;  3KQX A;  8CPA A;  2F8H A;  2PVV A;  1Q7L A;  3BXM A;  2OR4 A;  1ARM A;  2PJ8 A;  4Z65 A;  1CG2 A;  4X3R A;  3FEE A;  2EWB A;  1Y0Y A;  3FEC A;  3B3C A;  3PB9 X;  4OP4 A;  1OBR A;  3FED A;  5HVG A;  3FX6 A;  4FBE A;  1BAV A;  4NGQ A;  2PJ6 A;  2AFX A;  4A94 A;  2BOA A;  5F09 A;  4P6Y A;  4OC1 A;  3SJE A;  2GLF A;  3WC6 A;  2ABZ A;  4R76 A;  1JQG A;  1LCP A;  1CPX A;  4EWT A;  3NH4 A;  3PFE A;  4F9U A;  3D67 A;  3VH9 A;  4R6T A;  1F57 A;  4JYW A;  3SJF A;  4ZYQ A;  1Z2L A;  3PFO A;  5K8P A;  3MN8 A;  4UIA A;  2GU2 A;  1FNO A;  2F7V A;  2JEW A;  2PJ0 A;  3KAS A;  4P44 A;  4MHN A;  3CDX A;  3FJU A;  2OOT A;  2QVP A;  1R43 A;  3B2Y A;  2GLJ A;  4ZI6 A;  4UEE A;  1LFW A;  4OC3 A;  4NGN A;  3CPX A;  2ZEM A;  4F9V A;  3S9N A;  1BLL E;  4TNU A;  2ZEL A;  4IAV A;  3B35 A;  5D8N A;  2V8H A;  2Q4Z A;  3B3V A;  4OME A;  4EME A;  3IO1 A;  1HDQ A;  4OIW A;  2G9D A;  3PBE A;  3CPA A;  1YW4 A;  1TKF A;  3ISX A;  1XFO A;  2DEA A;  2EK8 A;  3NH5 A;  5CBM A;  2EK9 A;  2XEF A;  1M4L A;  4PXB A;  1NSA A;  3CT9 A;  3KR5 A;  2RFH A;  3V7Z A;  1ZG8 A;  3WC7 A;  3GB0 A;  2IJZ A;  1GYT A;  2AFM A;  2V77 A;  1CPS A;  2RB7 A;  1UWY A;  1HDU A;  1ARL A;  1ZG7 A;  1PYT B;  3IFE A;  5LYI A;  1F2P A;  1TF9 A;  4ZX9 A;  3D68 A;  4NFR A;  2BCO A;  4P4I A;  3NA6 A;  4P4D A;  4EFD A;  3S9L A;  4MCP A;  1KWM A;  2Q51 A;  3RAM A;  3SI1 A;  3FVL A;  1YLO A;  4R8F A;  2IQ6 A;  2C6P A;  3SI2 A;  2ZED A;  1EE3 P;  2PJ4 A;  3D66 A;  4MXU A;  4YU9 A;  1Y7E A;  3RBU A;  2CIJ A;  3PEI A;  2V8D A;  2GRE A;  5IB9 A;  3B7I A;  4NJR A;  4H2K A;  3GUX A;  4P4B A;  4AXV A;  1IGB A;  1CX8 A;  2IMO A;  3PB8 X;  3ISZ A;  3FH4 A;  2J9A A;  1XBU A;  4WJB A;  3B3T A;  2JBJ A;  5CPA A;  5I4M A;  5JH9 A;  3KR4 A;  1TKH A;  3KI9 A;  4P4F A;  4FWU A;  5K8M A;  1IY7 A;  2O4H A;  3QNV A;  4X8I A;  5JM6 A;  5LYD A;  3VAR A;  2ZOG A;  1LAM A;  3PB4 X;  3MRU A;  4JZ0 A;  2AFU A;  1Y0R A;  1XRY A;  5LYL A;  4NGT A;  3D7H A;  4FAI A;  2AFO A;  2PJ3 A;  1QMU A;  2AFS A; 
#chains in the Genus database with same CATH topology
 2Z11 A;  1B6B A;  1ZLI A;  2EO8 A;  5AG7 A;  3FF3 A;  4ZGY B;  1F2O A;  2Z3P A;  3JUW A;  4KSA A;  1YSJ A;  2ZXV A;  4MHY A;  4B13 A;  5J8F A;  2Z3L A;  1X12 A;  3IIB A;  3IEH A;  1M1D A;  1S7N A;  4P4E A;  3L2N A;  1VHO A;  1XOV A;  2NSM A;  4CRY B;  4X5K A;  4R3K A;  2YNC A;  2AE6 A;  4XPD B;  4HNW B;  2V8G A;  5A28 A;  1M4I A;  3RZA A;  3BI1 A;  1TKJ A;  2C1C A;  2FVG A;  3KHX A;  4R7M A;  4UEZ A;  1DTD A;  4A2Z A;  3ZZI A;  2GIV A;  2HB6 A;  3PRT A;  2PJC A;  3PZJ A;  4MCR A;  2PIY A;  4NGP A;  2HQY A;  2PR8 A;  5I0C A;  4IHM A;  3QAH A;  4MBU A;  4RI1 A;  3TC8 A;  4AB7 A;  4E0A A;  1QSM A;  4OC5 A;  3IJ3 A;  2BSW A;  3V38 A;  3VAT A;  2VXK A;  4C2Z A;  3FB3 A;  4KOT A;  4KOU A;  3WAB A;  4B12 A;  4A38 A;  2FL4 A;  4BMH A;  5EC4 A;  3W6X A;  1VGY A;  3GYA A;  5AG4 A;  2ZEH A;  3D3S A;  3H4Q A;  4MHP A;  2RC4 A;  3IWG A;  3N5F A;  4OAE A;  3PB7 X;  1YLE A;  4ZX8 A;  3CXQ A;  4CAE A;  3WC5 A;  4YWY A;  1Z8L A;  3T8W A;  4A30 A;  3KQZ A;  4CYN A;  4UF4 A;  1QQ9 A;  3K2K A;  4MCQ A;  1IYK A;  3IGR A;  2Z0Z A;  4CAX A;  3SI0 A;  4KUA A;  4CRZ B;  4B6Z A;  4HPS A;  2BL1 A;  3KZW A;  3LMS A;  5LRJ A;  5J1Q A;  4KUB A;  2VQY A;  4OKO A;  4XNH B;  5HXD A;  2A4N A;  5HVF A;  2XEJ A;  1LAN A;  2H5M A;  4CYP A;  5H84 A;  5H86 A;  1ZG9 A;  3QB8 A;  1NSL A;  4F0Y A;  3NFZ A;  4ORF A;  4UCP A;  2Y0M A;  3FIX A;  2X7B A;  4R9M A;  2B3V A;  2WPW A;  2PVW A;  2P6E A;  3FMC A;  4IF5 A;  4ONW A;  1M4D A;  1CP7 A;  1S7K A;  2V8V A;  4B5P B;  3WT4 A;  4E2A A;  1YRE A;  2XEG A;  2ZEN A;  4KLV A;  1ELM P;  4KLW A;  5DS0 A;  1BPN A;  4UCM A;  5HMN A;  1Q2Y A;  2Z3M A;  3D8P A;  2JBK A;  2PCU A;  2BEI A;  4B10 A;  4AG7 A;  2J8M A;  4G1P A;  4LQG A;  1ON0 A;  2FXF A;  4GXH A;  3W91 A;  3D7G A;  2NYQ A;  4R57 A;  2REF A;  4KSI A;  2Q0Y A;  2B58 A;  2O53 A;  2ZW4 A;  3B3W A;  3BHX A;  3DNS A;  3JRU A;  3P2H A;  4L8A A;  2CNS A;  4OLL A;  2PJ2 A;  5LRG A;  2REE A;  1XE4 A;  4A37 A;  2ODF A;  4DYO A;  5G1Z A;  5LYF A;  1XF8 A;  2OZU A;  2PRB A;  4RN7 A;  3V8I A;  4KS9 A;  4WWV A;  5D29 A;  4FD6 A;  3DLJ A;  1R3N A;  2JDC A;  1LAP A;  2HUZ A;  4NJQ A;  3I9S A;  4OID A;  2POK A;  1TF8 A;  1SQH A;  3NH8 A;  4NF1 A;  1YQE A;  2YND A;  1MK4 A;  3TX8 A;  2ZOF A;  1B87 A;  3FBU A;  4OC0 A;  4CAV A;  4AVB A;  4X2T A;  1FT7 A;  4KOS A;  4P4J A;  5F48 A;  5GCN A;  5K8O A;  3D4U A;  2AFZ A;  3HUV A;  2PDO A;  4HNX B;  2DPT A;  1Q2C A;  2DXQ A;  4Q38 A;  4O23 A;  3CXS A;  3EXN A;  1RTQ A;  3PB6 X;  1XJO A;  4JD6 A;  1YGH A;  3LWU A;  2FSR A;  1XMB A;  2ZEP A;  4I49 A;  4LX9 A;  2PRQ A;  4U5Y A;  2CTC A;  4B5O A;  3RYO A;  1OZP A;  1MJA A;  4PXD A;  5J8C A;  3SHP A;  4DJL A;  2I3C A;  2CNT A;  3DGV A;  3I3G A;  2CTB A;  4U9Y A;  1KUV A;  2D4P A;  4NGS A;  4PXE A;  1P0H A;  3G8W A;  3TO7 A;  4GM5 A;  4ZY0 A;  3IU1 A;  1Z5R A;  4MCS A;  3FXT A;  4DUK A;  1Q2D A;  4RS2 A;  2R98 A;  3UY5 A;  4W9Y A;  4HKF A;  2QJ8 A;  4KZT A;  4Q7A A;  4ZY1 A;  1S5K A;  2WYR A;  1AMP A;  5EBV A;  3K9T A;  2EUI A;  2WZN A;  2I00 A;  3BJ7 A;  5K8N A;  2PJ9 A;  4BIN A;  1QSO A;  2Q04 A;  1VIX A;  1FY7 A;  4H6U A;  4PK2 A;  2FIA A;  2XEI A;  3DSB A;  4CAW A;  2WPX A;  3LAC A;  1IOF A;  4J3G A;  2CF4 A;  3IC1 A;  4KOW A;  3IWW A;  1S60 A;  1TIQ A;  1TXR A;  4NGR A;  1YW6 A;  4YFJ A;  5JPH A;  1XMT A;  4C2Y A;  4NCZ A;  1LOK A;  3HLP A;  3TTH A;  1YVO A;  2Q4V A;  4RUH A;  2B5G A;  4E8O A;  4UEF A;  4UCN A;  2HV2 A;  5ISV A;  2GAN A;  1ELL P;  1YVK A;  2J8N A;  2QIR A;  1ZLH A;  4MHZ A;  4XPK A;  3KGQ A;  3S9M A;  3TO9 A;  4NGM A;  2JDD A;  2AFW A;  2Q7S A;  3D7F A;  4A39 A;  2DF5 A;  2R1I A;  3B3S A;  4CYQ A;  3I1U A;  4MY0 A;  2PJA A;  4PPZ A;  4BBH A;  4PXC A;  4ZBG A;  1HEE A;  2BO9 A;  3PP9 A;  2PE3 A;  3H8E A;  5C82 A;  4PQA A;  4CYO A;  5G22 A;  4OC2 A;  4UIB A;  4CGP A;  6CPA A;  1CBX A;  2O28 A;  2C6G A;  3CXP A;  4P10 A;  3C26 A;  2B4D A;  5F46 A;  1BPM A;  1H8L A;  3R9E A;  1YME A;  4NSQ A;  3GLJ A;  3BLN A;  4FUU A;  4R3L A;  2Q44 A;  1CJW A;  4LQ6 A;  5C88 A;  3KL9 A;  1Z9U A;  1VHE A;  2Z3O A;  2HC9 A;  2FIW A;  1AYE A;  4QUS A;  3TOA A;  1CP6 A;  2PJ7 A;  3GY9 A;  4H6Z A;  4IK2 A;  2R8V A;  5THW A;  4EVY A;  4R87 A;  1NE9 A;  4FD4 A;  1IIC A;  2PJB A;  2FE7 A;  3T90 A;  2ZEG A;  4JJX A;  3F0A A;  2Z3N A;  2QYV A;  3MGD A;  5HVH A;  3SJG A;  3H8F A;  2Q7B A;  3N7Z A;  3BI0 A;  2PIZ A;  5IV0 A;  7CPA A;  1BO4 A;  1UFH A;  1DE4 C;  4MFK A;  4BD9 A;  4C68 A;  4C7I A;  1X10 A;  2KCW A;  1MJB A;  2VL1 A;  2WUU A;  4OC4 A;  5ELY A;  2PJ1 A;  2ZEF A;  3H8G A;  2IL4 A;  2ANP A;  4A31 A;  1V0C A;  1I21 A;  4CPA A;  2PJ5 A;  3TE4 A;  3PBB A;  3JTK A;  4P45 A;  4F8Z A;  5JGF A;  2FT0 A;  2ZEO A;  5HH1 A;  5G21 A;  5LRK A;  4TWE A;  2ZEE A;  1IU8 A;  4U9Z A;  3KHZ A;  4MMO A;  3EFA A;  4K3N A;  4CGO A;  5F47 A;  4ZY2 A;  3QAY A;  4Y49 C;  1LRZ A;  1XIX A;  2Q43 A;  3D7D A;  4F0X A;  2C6C A;  2C27 A;  4MHD A;  1IID A;  1PCA A;  3SJX A;  3KQX A;  3OWC A;  3RO0 A;  1IYL A;  2PSW A;  8CPA A;  2F8H A;  2PVV A;  1S7F A;  3DDD A;  4UBR A;  1Q7L A;  3BXM A;  3PGP A;  2OR4 A;  1ARM A;  5DWN A;  4DNC A;  2PJ8 A;  4Z65 A;  4YGO A;  1CG2 A;  1Z8W A;  1I12 A;  4KOY A;  4X3R A;  3FEE A;  5E96 A;  2EVN A;  1Y0Y A;  2EWB A;  2FS5 A;  2QEC A;  3FEC A;  3B3C A;  4XPD C;  4KVM E;  1A2Z A;  3PB9 X;  4OP4 A;  1OBR A;  4UA3 A;  3FED A;  5HVG A;  3FX6 A;  2B3U A;  4FBE A;  1BAV A;  4MFP A;  4NGQ A;  2PJ6 A;  2AFX A;  3CZX A;  4A94 A;  3EY5 A;  2R7H A;  5A27 A;  2BOA A;  2PQ8 A;  3R1K A;  3EO4 A;  4P6Y A;  2GE3 A;  5F09 A;  4OC1 A;  3SJE A;  1QST A;  2GLF A;  3WC6 A;  3WR7 A;  1ZO0 A;  2ABZ A;  2WSA A;  4R76 A;  1JQG A;  1LCP A;  1CPX A;  3LD2 A;  3R95 A;  4EWT A;  5KTA A;  4CGN A;  3D2M A;  4K30 A;  4CAF A;  3NH4 A;  1P4N A;  3VWD A;  3PFE A;  4F9U A;  3D67 A;  4QVT A;  2EBJ A;  2VBQ A;  3VH9 A;  4R6T A;  1F57 A;  4JYW A;  3SJF A;  4ZYQ A;  3B8G A;  3F8K A;  5EMI A;  1Z2L A;  4QB9 A;  3PFO A;  4QBJ A;  3D2P A;  5K8P A;  4KOX A;  1VHS A;  2NMT A;  3MN8 A;  4UIA A;  2GU2 A;  4MFZ A;  1FNO A;  1K4J A;  2F7V A;  2JEW A;  2I79 A;  1I1D A;  2PJ0 A;  4PSW A;  3KAS A;  3NE8 A;  5DWM A;  1WWZ A;  1M4G A;  4Y49 B;  4P44 A;  4MHN A;  2QML A;  3TFY A;  2G3T A;  3CDX A;  3FJU A;  2OZH A;  3FYN A;  2OOT A;  1Y9W A;  1R43 A;  1S3Z A;  2QVP A;  3B2Y A;  2GLJ A;  4XNH C;  4A95 A;  3DR8 A;  1J4J A;  4ZI6 A;  4XPL A;  4M6I A;  1U6M A;  4UEE A;  5F49 A;  5KTC A;  1LFW A;  2P6F A;  4CGL A;  1N71 A;  4OC3 A;  3W6S A;  1S7L A;  1CM0 A;  2B5G B;  4NGN A;  4PK3 A;  3TCV A;  4H89 A;  3CPX A;  2ZEM A;  4F9V A;  1AUG A;  4A32 A;  5AGE A;  3S9N A;  2VI7 A;  1BLL E;  2VEZ A;  4TNU A;  4UFW A;  2ZEL A;  5AG5 A;  4IAV A;  4IUS A;  3B35 A;  5D8N A;  2V8H A;  3R9F A;  2P6G A;  2Q4Z A;  3B3V A;  4OME A;  4EME A;  1KZF A;  2GFQ A;  4JLY A;  1MJ9 A;  2ZW7 A;  2CXA A;  3DR6 A;  3K9U A;  3S6F A;  4B14 A;  4QC6 A;  2G0B A;  1HDQ A;  3IO1 A;  2P0W A;  2OZG A;  3TO6 A;  4OIW A;  3ZJ0 A;  2G9D A;  3PBE A;  3CPA A;  1YW4 A;  1VKC A;  1R57 A;  2BUE A;  1TKF A;  3ISX A;  1XFO A;  2B4D B;  2DEA A;  2EK8 A;  4B11 A;  4NXY A;  3NH5 A;  5CBM A;  4NEX A;  1BOB A;  1JWQ A;  2EK9 A;  2XEF A;  1M4L A;  4KVX A;  3S6H A;  4PXB A;  3TOB A;  1NSA A;  3CT9 A;  2AJ6 A;  1YX0 A;  1Y7R A;  2VZZ A;  4MFQ A;  1RO5 A;  2RFH A;  3KR5 A;  4FD7 A;  3V7Z A;  3EC4 A;  1ZG8 A;  4MY3 A;  3S6G A;  1YK3 A;  3WC7 A;  3GB0 A;  2IJZ A;  2Q4Y A;  1GYT A;  3IU2 A;  4C2X A;  2AFM A;  4Q36 A;  2V77 A;  1GHE A;  2YNE A;  1RXT A;  2PR1 A;  3E0K A;  2FCK A;  5BWA B;  4MFJ A;  1IOI A;  4UWI A;  4AG9 A;  1Z4R A;  1CPS A;  4M3S A;  2RB7 A;  1UWY A;  1HDU A;  2ZW5 A;  2VZY A;  1L0C A;  1ARL A;  1KUY A;  1PYT B;  1ZG7 A;  3IFE A;  5IB0 A;  5LYI A;  3GKR A;  3P2F A;  1F2P A;  1TF9 A;  4KOV A;  4ZX9 A;  3D68 A;  4JXQ A;  1QSN A;  4NFR A;  4UFX A;  4OAD A;  4AVC A;  2BCO A;  4P4I A;  1XEB A;  4UWJ A;  3NA6 A;  4P4D A;  4EFD A;  3JVN A;  4MCP A;  3S9L A;  1KWM A;  2Q51 A;  3RAM A;  4ONU A;  1KUX A;  2K5T A;  3BJ8 A;  2PC1 A;  2ZW6 A;  3A9L A;  4GS4 A;  3SI1 A;  2J8R A;  1M44 A;  3SXO A;  4JWP A;  3FVL A;  1YLO A;  3FNC A;  3KKW A;  4R8F A;  2G3A A;  5JQ4 A;  2IQ6 A;  2C6P A;  3SI2 A;  4MI4 A;  4HNY B;  4F6A A;  2YGW A;  1Y9K A;  2D4O A;  2Z3K A;  4LUA A;  4KOR A;  4B5P A;  2ZED A;  5AG6 A;  1EE3 P;  2PJ4 A;  3D66 A;  4MXU A;  4YU9 A;  1Y7E A;  3FRM A;  3VWE A;  3RBU A;  2CIJ A;  2YNC C;  3PEI A;  1PUA A;  3TT2 A;  2V8D A;  1PU9 A;  1Z8T A;  2GRE A;  5G20 A;  2ATR A;  4C7H A;  3S6K A;  5IB9 A;  4A33 A;  3F5B A;  1Z8X A;  2JLM A;  4M85 A;  2JEV A;  3RNZ A;  3B7I A;  2DPS A;  4NJR A;  2CNM A;  2OU2 A;  4H2K A;  3GUX A;  4P4B A;  4AXV A;  4MRI A;  3T9Y A;  1IGB A;  4PV6 A;  1CX8 A;  3SXN A;  4JXR A;  2IMO A;  5CNP A;  3PB8 X;  3ISZ A;  3FH4 A;  3NE7 A;  2J9A A;  4CGM A;  1XBU A;  4WJB A;  4M6G A;  4FD5 A;  3B3T A;  2CY2 A;  2OB0 A;  4MJ8 A;  3LOD A;  2JBJ A;  5CPA A;  2F5I A;  5I4M A;  5JH9 A;  2B4B A;  3KR4 A;  4M6H A;  1TKH A;  3KI9 A;  3R96 A;  3H5Z A;  4P4F A;  4YRH A;  4FWU A;  1Z4E A;  5K8M A;  3IWE A;  1IY7 A;  4CS0 B;  2O4H A;  3QNV A;  3R9G A;  2ARH A;  4X8I A;  4PSX A;  1QSR A;  4MFL A;  5JM6 A;  4UFV A;  5LYD A;  3VAR A;  1IB1 E;  2ZPA A;  4II9 A;  2ZOG A;  1LAM A;  3PB4 X;  3MRU A;  5IX3 A;  4JZ0 A;  2AFU A;  1Y0R A;  5KTD A;  3G3S A;  1XRY A;  5LYL A;  4NGT A;  3D7H A;  1YR0 A;  3GIU A;  4AVA A;  5FVJ A;  1WK4 A;  2AFO A;  2Z10 A;  4KVO E;  4L89 A;  4FAI A;  2PJ3 A;  1QMU A;  2OH1 A;  4KSF A;  2AFS A;  1NMT A; 
#chains in the Genus database with same CATH homology
 1ZLI A;  3FF3 A;  1F2O A;  1YSJ A;  4MHY A;  3IIB A;  4P4E A;  3IEH A;  3L2N A;  1VHO A;  2NSM A;  2V8G A;  3RZA A;  3BI1 A;  1TKJ A;  2C1C A;  2FVG A;  3KHX A;  4R7M A;  1DTD A;  2HB6 A;  3PRT A;  2PJC A;  4MCR A;  4NGP A;  2PIY A;  4IHM A;  3TC8 A;  4OC5 A;  3IJ3 A;  3V38 A;  3VAT A;  3WAB A;  4A38 A;  1VGY A;  2ZEH A;  4MHP A;  3N5F A;  3PB7 X;  4ZX8 A;  3WC5 A;  4YWY A;  1Z8L A;  3T8W A;  3KQZ A;  4UF4 A;  1QQ9 A;  3K2K A;  4MCQ A;  3SI0 A;  4B6Z A;  3KZW A;  3LMS A;  5LRJ A;  5J1Q A;  4OKO A;  5HXD A;  5HVF A;  2XEJ A;  1LAN A;  1ZG9 A;  3NFZ A;  2PVW A;  3FMC A;  4ONW A;  1CP7 A;  2V8V A;  3WT4 A;  2XEG A;  2ZEN A;  1ELM P;  5DS0 A;  1BPN A;  2JBK A;  2PCU A;  4G1P A;  4LQG A;  3D7G A;  2NYQ A;  4KSI A;  2O53 A;  3B3W A;  3BHX A;  3JRU A;  2PJ2 A;  5LRG A;  4A37 A;  4DYO A;  5LYF A;  4WWV A;  5D29 A;  3DLJ A;  1R3N A;  1LAP A;  4NJQ A;  4OID A;  2POK A;  1TF8 A;  3NH8 A;  3TX8 A;  2ZOF A;  4OC0 A;  4X2T A;  1FT7 A;  4P4J A;  5K8O A;  3D4U A;  2AFZ A;  3HUV A;  4O23 A;  3PB6 X;  1RTQ A;  4MRI A;  1XJO A;  4UEZ A;  3LWU A;  2ZEP A;  1XMB A;  2PRQ A;  2CTC A;  4PXD A;  4DJL A;  2I3C A;  3DGV A;  2CTB A;  4NGS A;  4PXE A;  4GM5 A;  4ZY0 A;  1Z5R A;  4MCS A;  4DUK A;  4W9Y A;  2QJ8 A;  4Q7A A;  4ZY1 A;  2WYR A;  1AMP A;  3K9T A;  2WZN A;  5K8N A;  2PJ9 A;  1VIX A;  2XEI A;  2CF4 A;  3IC1 A;  3IWW A;  1TXR A;  4NGR A;  1YW6 A;  1LOK A;  3HLP A;  4RUH A;  4UEF A;  1ELL P;  1ZLH A;  4MHZ A;  3KGQ A;  3S9M A;  4NGM A;  3D7F A;  2AFW A;  4A39 A;  3B3S A;  3I1U A;  2PJA A;  4PPZ A;  4PXC A;  1HEE A;  2BO9 A;  2PE3 A;  3H8E A;  4PQA A;  4OC2 A;  4UIB A;  6CPA A;  1CBX A;  4P10 A;  2C6G A;  1BPM A;  1H8L A;  1YME A;  3GLJ A;  4FUU A;  3KL9 A;  1VHE A;  2HC9 A;  1AYE A;  1CP6 A;  2PJ7 A;  4IK2 A;  5THW A;  2PJB A;  2ZEG A;  5HVH A;  2QYV A;  3SJG A;  3H8F A;  3BI0 A;  2PIZ A;  7CPA A;  4BD9 A;  1DE4 C;  2VL1 A;  4OC4 A;  5ELY A;  2PJ1 A;  2ZEF A;  3H8G A;  2ANP A;  4CPA A;  2PJ5 A;  3PBB A;  4P45 A;  4F8Z A;  5JGF A;  2ZEO A;  5LRK A;  4TWE A;  2ZEE A;  3KHZ A;  4MMO A;  4K3N A;  4ZY2 A;  2Q43 A;  3D7D A;  2C6C A;  1PCA A;  3SJX A;  3KQX A;  8CPA A;  2F8H A;  2PVV A;  1Q7L A;  3BXM A;  2OR4 A;  1ARM A;  2PJ8 A;  4Z65 A;  1CG2 A;  4X3R A;  3FEE A;  2EWB A;  1Y0Y A;  3FEC A;  3B3C A;  3PB9 X;  4OP4 A;  1OBR A;  3FED A;  5HVG A;  3FX6 A;  4FBE A;  1BAV A;  4NGQ A;  2PJ6 A;  2AFX A;  4A94 A;  2BOA A;  5F09 A;  4P6Y A;  4OC1 A;  3SJE A;  2GLF A;  3WC6 A;  2ABZ A;  4R76 A;  1JQG A;  1LCP A;  1CPX A;  4EWT A;  3NH4 A;  3PFE A;  4F9U A;  3D67 A;  3VH9 A;  4R6T A;  1F57 A;  4JYW A;  3SJF A;  4ZYQ A;  1Z2L A;  3PFO A;  5K8P A;  3MN8 A;  4UIA A;  2GU2 A;  1FNO A;  2F7V A;  2JEW A;  2PJ0 A;  3KAS A;  4P44 A;  4MHN A;  3CDX A;  3FJU A;  2OOT A;  2QVP A;  1R43 A;  3B2Y A;  2GLJ A;  4ZI6 A;  4UEE A;  1LFW A;  4OC3 A;  4NGN A;  3CPX A;  2ZEM A;  4F9V A;  3S9N A;  1BLL E;  4TNU A;  2ZEL A;  4IAV A;  3B35 A;  5D8N A;  2V8H A;  2Q4Z A;  3B3V A;  4OME A;  4EME A;  3IO1 A;  1HDQ A;  4OIW A;  2G9D A;  3PBE A;  3CPA A;  1YW4 A;  1TKF A;  3ISX A;  1XFO A;  2DEA A;  2EK8 A;  3NH5 A;  5CBM A;  2EK9 A;  2XEF A;  1M4L A;  4PXB A;  1NSA A;  3CT9 A;  3KR5 A;  2RFH A;  3V7Z A;  1ZG8 A;  3WC7 A;  3GB0 A;  2IJZ A;  1GYT A;  2AFM A;  2V77 A;  1CPS A;  2RB7 A;  1UWY A;  1HDU A;  1ARL A;  1ZG7 A;  1PYT B;  3IFE A;  5LYI A;  1F2P A;  1TF9 A;  4ZX9 A;  3D68 A;  4NFR A;  2BCO A;  4P4I A;  3NA6 A;  4P4D A;  4EFD A;  3S9L A;  4MCP A;  1KWM A;  2Q51 A;  3RAM A;  3SI1 A;  3FVL A;  1YLO A;  4R8F A;  2IQ6 A;  2C6P A;  3SI2 A;  2ZED A;  1EE3 P;  2PJ4 A;  3D66 A;  4MXU A;  4YU9 A;  1Y7E A;  3RBU A;  2CIJ A;  3PEI A;  2V8D A;  2GRE A;  5IB9 A;  3B7I A;  4NJR A;  4H2K A;  3GUX A;  4P4B A;  4AXV A;  1IGB A;  1CX8 A;  2IMO A;  3PB8 X;  3ISZ A;  3FH4 A;  2J9A A;  1XBU A;  4WJB A;  3B3T A;  2JBJ A;  5CPA A;  5I4M A;  5JH9 A;  3KR4 A;  1TKH A;  3KI9 A;  4P4F A;  4FWU A;  5K8M A;  1IY7 A;  2O4H A;  3QNV A;  4X8I A;  5JM6 A;  5LYD A;  3VAR A;  2ZOG A;  1LAM A;  3PB4 X;  3MRU A;  4JZ0 A;  2AFU A;  1Y0R A;  1XRY A;  5LYL A;  4NGT A;  3D7H A;  4FAI A;  2AFO A;  2PJ3 A;  1QMU A;  2AFS A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...