4JJXA

Dodecameric structure of spermidine n-acetyltransferase speg from vibrio cholerae o1 biovar eltor
Total Genus 46
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
46
sequence length
172
structure length
172
Chain Sequence
b'AMNSQLTLRALERGDLRFIHNLNNNRNIMSYWFEEPYESFDELEELYNKHIHDNAERRFVVEDAQKNLIGLVELIEINYIHRSAEFQIIIAPEHQGKGFARTLINRALDYSFTILNLHKIYLHVAVENPKAVHLYEECGFVEEGHLVEEFFINGRYQDVKRMYILQSKYLNR'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Spermidine n1-acetyltransferase
publication title A Novel Polyamine Allosteric Site of SpeG from Vibrio cholerae Is Revealed by Its Dodecameric Structure.
pubmed doi rcsb
source organism Vibrio cholerae o1 biovar el tor
molecule tags Transferase
total genus 46
structure length 172
sequence length 172
chains with identical sequence B, C
ec nomenclature ec 2.3.1.57: Diamine N-acetyltransferase.
pdb deposition date 2013-03-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13302 Acetyltransf_3 Acetyltransferase (GNAT) domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.630.30 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Aminopeptidase 4jjxA00
5C82A 2G0BA 5F47A 4MJ8A 2BL1A 3W91A 4J3GA 2OH1A 4FD5A 1MJ9A 4KOWA 2VBQA 3D8PA 1QSMA 4KZTA 4CRYB 2P6EA 1Y7RA 1M4IA 1YVOA 1S7FA 1YREA 2DXQA 1J4JA 3EFAA 1Q2CA 3JVNA 4L89A 1M4GA 1BO4A 4II9A 2AJ6A 5F46A 3T90A 3K9UA 3W6XA 4PK3A 3H4QA 2GANA 1YR0A 2WPXA 5DWNA 2ZW4A 4U9YA 3SXNA 4KOTA 1Z9UA 2HV2A 4JXRA 2Z11A 3DDDA 1Q2DA 2Q44A 2Q4YA 4ORFA 4FD6A 3S6GA 1IICA 2Z10A 4JD6A 3R95A 3CXPA 1Y9WA 4NXYA 2VI7A 4CRZB 4PV6A 4HKFA 5KTDA 4F6AA 2Z0ZA 1K4JA 4JWPA 2CNSA 1P0HA 3P2FA 4IF5A 1XF8A 2JLMA 2OZGA 3FBUA 2FL4A 4I49A 1BOBA 1MJBA 2GE3A 5F49A 3IWGA 5J8CA 1MJAA 4CAXA 2J8NA 5GCNA 4XPDB 5CNPA 4U5YA 5IX3A 2P6GA 5IV0A 3R96A 1PU9A 4NF1A 4Y49C 4JXQA 3TO7A 1KZFA 4XPKA 4B5PA 4KOVA 3TE4A 3WR7A 1LRZA 1S7LA 2PR8A 4E0AA 1S7NA 2ZW5A 2OB0A 4R87A 1L0CA 3DR8A 4MHDA 3R9GA 4OAEA 4QUSA 3D2PA 1CM0A 2D4OA 5KTCA 2FXFA 4PSXA 4B5PB 4GS4A 2FT0A 4H6ZA 3TO9A 4QC6A 2H5MA 2B3VA 3IGRA 4YGOA 3G3SA 1YLEA 1Y9KA 2J8MA 2PDOA 2Q4VA 3R9EA 2BEIA 1RXTA 4EVYA 3FYNA 4MY0A 3DSBA 3MGDA 3JUWA 3GY9A 2RC4A 1YVKA 2ZXVA 1B6BA 4DNCA 4MBUA 1KUXA 4XNHB 2G3AA 4YRHA 4E2AA 3RYOA 2VXKA 3DNSA 2B4BA 4FD4A 2KCWA 2FE7A 1XIXA 4HNWB 5HH1A 2GIVA 2B4DA 5HMNA 1S60A 2BUEA 2QECA 3TOAA 4LUAA 2ZPAA 1WWZA 3S6KA 3VWDA 2PQ8A 2B4DB 4UWIA 3BJ8A 2QMLA 2REFA 4BMHA 4U9ZA 3I3GA 3CXSA 1UFHA 1QSTA 1NMTA 4IUSA 2ATRA 2JDDA 4AVBA 4PSWA 3ZZIA 1YGHA 2HUZA 3LD2A 2WPWA 1YX0A 4QB9A 5EBVA 2NMTA 2C27A 1FY7A 1SQHA 2OZUA 3NE7A 3SXOA 3KKWA 3BJ7A 4Y49B 4ONUA 3V8IA 4NEXA 5JPHA 4KVME 4KUAA 1KUYA 2EUIA 2REEA 4CS0B 2FIAA 1P4NA 4KOYA 2VEZA 4R3KA 4HNXB 3W6SA 3UY5A 2IL4A 4OLLA 4KLWA 3G8WA 1IB1E 2R7HA 1GHEA 2O28A 1OZPA 1VKCA 1I12A 3BLNA 4KVOE 5DWMA 1CJWA 4HNYB 2HQYA 4R9MA 4XPLA 4CAWA 3EY5A 3PZJA 2J8RA 2I00A 1XEBA 1RO5A 2P0WA 4QVTA 3PGPA 3F0AA 1TIQA 1VHSA 1QSNA 1YK3A 2I79A 4L8AA 1S7KA 4K30A 4NSQA 2B5GA 3QAHA 2PSWA 1IYLA 3EC4A 4KLVA 3DR6A 1PUAA 2PRBA 2AE6A 4FD7A 4RS2A 4B5OA 2B5GB 3EO4A 1XMTA 3R9FA 4MY3A 3LODA 4H89A 3B8GA 2F5IA 5J8FA 4NCZA 2CNMA 4X5KA 2JDCA 3I9SA 3TOBA 4OADA 1B87A 3FB3A 3FRMA 1WK4A 1N71A 1Z4EA 3D3SA 4AG7A 2VQYA 1M4DA 2R8VA 3GYAA 3TFYA 4R3LA 3F5BA 4AVAA 4KORA 1I21A 2PC1A 3PP9A 1M44A 4PK2A 2ZW6A 4YFJA 4KOSA 2B58A 3C26A 3S6HA 1Q2YA 1S3ZA 2B3UA 4UWJA 3OWCA 5E96A 3N7ZA 1S5KA 1V0CA 4KOXA 3GKRA 5I0CA 1ON0A 5C88A 2CY2A 2ZW7A 5IB0A 4JJXA 4M3SA 2FIWA 5H86A 2P6FA 4KUBA 4XNHC 2ARHA 3D2MA 4H6UA 2K5TA 2FS5A 2Q0YA 2QIRA 4ZBGA 3CXQA 1QSOA 4AG9A 2G3TA 4M85A 4R57A 3EXNA 1I1DA 1U6MA 4MI4A 2OU2A 5EC4A 2PR1A 2Y0MA 3FXTA 3FIXA 1IIDA 3TCVA 5KTAA 3VWEA 4F0YA 3R1KA 3SHPA 1MK4A 3ZJ0A 2JEVA 4UBRA 1XE4A 3FNCA 2A4NA 4JLYA 3F8KA 1M1DA 2Q04A 4KVXA 3T9YA 5F48A 3S6FA 3E0KA 2R98A 2FSRA 2VZZA 4RI1A 1NSLA 4KOUA 5H84A 4QBJA 5ISVA 2OZHA 4AB7A 2FCKA 3TTHA 4XPDC 2VZYA 1NE9A 1R57A 3TO6A 1KUVA 3QB8A 4UA3A 2CNTA 2D4PA 2Q7BA 3TT2A 2EVNA 1Z4RA 4AVCA 2BSWA 2R1IA 4E8OA 5FVJA 5JQ4A 4LX9A 3P2HA 2X7BA 1QSRA 1IYKA 4CAVA
chains in the Genus database with same CATH superfamily
1FT7A 5C82A 4NGQA 4F0XA 2G0BA 5F47A 1R3NA 4MJ8A 2BL1A 5I4MA 2DPSA 2O4HA 3KZWA 4J3GA 3W91A 4A38A 2WSAA 3SI0A 2XEJA 2OH1A 1DTDA 2QJ8A 4FD5A 3B7IA 4R6TA 1LFWA 1MJ9A 4KOWA 2VBQA 2I3CA 3D8PA 2PVVA 1ZLIA 2NSMA 1QSMA 2F7VA 4KZTA 4CRYB 2P6EA 2CTCA 1Y7RA 4A31A 4C7IA 2PJAA 2WYRA 1OBRA 1M4IA 5LYFA 1X12A 1YVOA 1S7FA 1ELLP 1YREA 2DXQA 2V8GA 4PQAA 4A39A 1J4JA 2F8HA 3EFAA 3ISZA 3D68A 1Q2CA 3JVNA 1IY7A 4L89A 1M4GA 1BO4A 3A9LA 3NH5A 4ZGYB 4II9A 2Z3MA 3SI2A 2AJ6A 5F46A 4W9YA 3T90A 3QNVA 3K9UA 2JEWA 4PPZA 3W6XA 2HB6A 2VL1A 7CPAA 2AFUA 4BD9A 4PK3A 3H4QA 1H8LA 2GANA 4PXCA 3BXMA 2JBKA 4LQGA 3H5ZA 1YR0A 2WPXA 4FWUA 2ZW4A 5DWNA 3WC6A 4U9YA 3SXNA 4KOTA 1PYTB 1Z9UA 2ZEMA 3WABA 2HV2A 4JXRA 2Z11A 1CBXA 4R76A 3DDDA 4UIAA 4UEFA 2Z3LA 3PBEA 4MMOA 3JTKA 2PE3A 1Q2DA 2Q44A 2Q4YA 3RO0A 4DJLA 4ORFA 3CPAA 1YQEA 5LRJA 1CPXA 1Y0YA 1TKJA 4FD6A 4P4BA 3S6GA 2POKA 1IICA 2Z10A 4JD6A 4ZX8A 3FECA 3R95A 4ZI6A 1F2PA 2ZEHA 3CXPA 4TWEA 1Y9WA 4NXYA 2VI7A 4PXBA 4CRZB 4PV6A 3PB7X 4HKFA 5KTDA 4F6AA 2Z0ZA 1K4JA 4JWPA 2CNSA 1P0HA 3P2FA 3D7GA 3SJGA 3SI1A 4IF5A 1XF8A 1GYTA 2JLMA 3IWEA 3RAMA 2AFZA 2OZGA 2ZEEA 2FL4A 3FBUA 4I49A 2BO9A 1BOBA 4UIBA 3VH9A 1A2ZA 1MJBA 2GE3A 5F49A 3IWGA 4UFXA 4YU9A 4NJRA 5J8CA 4MFJA 1MJAA 3HUVA 4ZX9A 5HVFA 4P45A 4CAXA 2J8NA 5GCNA 4XPDB 5CNPA 4CYOA 3IC1A 4MHPA 4U5YA 5IX3A 2P6GA 4NGMA 3T8WA 4NGNA 5IV0A 3NA6A 4UCMA 3R96A 4MCSA 5A28A 5D8NA 1PU9A 4NF1A 4Y49C 3PFOA 4JXQA 5JM6A 3TO7A 1Z8WA 3PB9X 1KZFA 4XPKA 4B5PA 4KOVA 3TE4A 2C1CA 3WR7A 1LRZA 4DUKA 4BBHA 1S7LA 1VGYA 2PR8A 4E0AA 5HVGA 1S7NA 2XEGA 4NFRA 2ZW5A 2OB0A 4R87A 5ELYA 3RNZA 3CDXA 1L0CA 3DR8A 4MHDA 3R9GA 3MRUA 4OC2A 1NSAA 4OAEA 4X3RA 4QUSA 5LYLA 3D2PA 1CM0A 5K8OA 5G22A 2D4OA 2YGWA 3LWUA 5KTCA 2FXFA 4PSXA 4B5PB 4GS4A 4M6HA 1IOIA 2FT0A 4H6ZA 3KQZA 3TO9A 5JGFA 3B3WA 4QC6A 2G9DA 5JH9A 2H5MA 2B3VA 1EE3P 3IGRA 4H2KA 4P10A 4YGOA 2Z3NA 1Z8XA 3B2YA 3G3SA 1YLEA 1Y9KA 2J8MA 4M6GA 5K8NA 5HXDA 2PDOA 4CGPA 5A27A 2Q4VA 3VATA 2CTBA 2IQ6A 4C2ZA 1XOVA 3R9EA 2BEIA 3S9MA 1RXTA 3QAYA 3IIBA 4EVYA 3PBBA 3D7HA 3FYNA 2PCUA 3IFEA 4MY0A 2ABZA 2AFXA 3DSBA 4IAVA 1QQ9A 2V77A 3FH4A 4MFPA 4C7HA 3MGDA 1IOFA 3JUWA 3GY9A 2RC4A 3SJFA 1YVKA 4NGRA 5AG7A 4B6ZA 2ZXVA 2XEIA 4Q7AA 1B6BA 1IGBA 2PJ8A 4DNCA 4MBUA 1KUXA 5AG5A 4XNHB 2G3AA 4YRHA 1Z8LA 4LQ6A 1YMEA 3I1UA 2ZEFA 1HDUA 4X2TA 5DS0A 3RYOA 4E2AA 2VXKA 3DNSA 2B4BA 4FD4A 3KGQA 4OC4A 3KI9A 5AG6A 2KCWA 2FE7A 4C2XA 1XIXA 1YW6A 4HNWB 5HH1A 2BCOA 2PIZA 3BI1A 4IHMA 1TKFA 2GIVA 1HDQA 3S9NA 2B4DA 3TC8A 1CPSA 4NGPA 1Y0RA 4P4DA 2PIYA 2RB7A 4MFQA 5HMNA 2Q4ZA 1S60A 2Z3PA 4P4JA 3B3CA 3IU2A 4OC1A 1KWMA 1BPNA 2BUEA 3K2KA 1VHOA 2QECA 4O23A 3TX8A 4FAIA 4C2YA 3TOAA 4LUAA 2ZPAA 1WWZA 4WJBA 3S6KA 3VWDA 4R8FA 3D4UA 1Z8TA 2PQ8A 2B4DB 4UWIA 3BJ8A 2QMLA 2REFA 5K8PA 4BMHA 4U9ZA 3I3GA 4CGLA 3CXSA 1UFHA 4CPAA 1QSTA 4RUHA 1NMTA 2DPTA 4IUSA 2ATRA 2JDDA 2YNCA 2PJ7A 2EWBA 3WT4A 4AVBA 4B12A 3DLJA 4FUUA 4PSWA 4UFWA 3ZZIA 1YGHA 1PCAA 2ZEOA 2HUZA 3LD2A 2PJ9A 1CX8A 4A95A 2WUUA 1AYEA 5EMIA 2QVPA 5CBMA 2WPWA 1YX0A 4QB9A 4MFLA 5EBVA 2NMTA 2C27A 4GXHA 3V38A 4EFDA 3KHZA 2C6GA 5F09A 4B13A 3H8EA 1FY7A 1SQHA 2OZUA 5IB9A 3NE7A 3SXOA 3KKWA 4G1PA 4P44A 4TNUA 4F8ZA 4F9VA 3VARA 3CPXA 3BJ7A 5CPAA 3D7DA 4Y49B 4KS9A 4KSFA 4ONUA 2ZENA 4NEXA 4PXEA 1AUGA 3V8IA 5JPHA 4KVME 4KUAA 4ZY1A 3H8GA 5D29A 2PJ4A 4ZY0A 1KUYA 2EUIA 2REEA 3KHXA 1Q7LA 3KL9A 3LMSA 2YNDA 3B3SA 1RTQA 1Z5RA 2FIAA 1P4NA 4KOYA 2VEZA 4CS0B 4CYQA 1VIXA 3CZXA 4OKOA 4R3KA 4HNXB 3W6SA 3UY5A 2IL4A 4OLLA 4NJQA 4OC3A 4KLWA 3G8WA 1TKHA 1IB1E 2R7HA 1GHEA 5HVHA 2O28A 5LRKA 1OZPA 4UFVA 2EO8A 2YNEA 1VKCA 2PJ5A 1I12A 3BLNA 4KVOE 5LYIA 5DWMA 1CJWA 4HNYB 2Z3KA 4CAFA 4UCPA 2HQYA 4NGTA 3B3VA 4R9MA 4C68A 4XPLA 2HC9A 4CAWA 3EY5A 3NH4A 2J8RA 3D7FA 3PZJA 2GFQA 1DE4C 1BLLE 1XEBA 1BPMA 2I00A 3B35A 1RO5A 3IU1A 5G1ZA 2P0WA 4QVTA 3PGPA 3F0AA 4A33A 5G21A 2JBJA 5THWA 1TIQA 2V8DA 2ZELA 1VHSA 1QSNA 2GLJA 1M4LA 2QYVA 2OOTA 2DF5A 1YK3A 3DGVA 1LANA 2I79A 2RFHA 4MCQA 4L8AA 1ZO0A 3PB6X 1S7KA 3PFEA 4K3NA 5AGEA 5LYDA 4UEEA 1QMUA 4K30A 4NSQA 4OIWA 4A94A 2B5GA 3SJEA 1AMPA 1LOKA 3NH8A 1XFOA 3QAHA 2PSWA 4M6IA 1IYLA 3KR5A 3V7ZA 3EC4A 4KLVA 5LRGA 1TF9A 3GB0A 2AFOA 3DR6A 5BWAB 2IMOA 2ZEGA 1PUAA 2GLFA 2IJZA 2PRBA 3FX6A 2AE6A 4P4IA 3MN8A 3RBUA 1UWYA 1BAVA 3D67A 4OC5A 4FD7A 4MHZA 2ZOGA 1ZG9A 4RS2A 2FVGA 4B5OA 2B5GB 3EO4A 4UEZA 4JYWA 2PVWA 4Q36A 1LAMA 1VHEA 1XMTA 3R9FA 3PB4X 4MY3A 4YWYA 2Z3OA 3LODA 4H89A 3B3TA 3B8GA 4MFZA 1XMBA 2F5IA 4A37A 5J8FA 4NCZA 2CNMA 3IWWA 4X5KA 2JDCA 4A2ZA 1CP7A 2O53A 3I9SA 3TOBA 1LCPA 4OADA 2GU2A 1B87A 2Q43A 3FB3A 2EK9A 3FRMA 3K9TA 1WK4A 2EBJA 1N71A 1XRYA 1Z4EA 3D3SA 4GM5A 4AG7A 2PJ3A 2VQYA 1M4DA 2R8VA 3GYAA 4FBEA 3TFYA 4Z65A 1ELMP 2CIJA 4R3LA 3F5BA 3S9LA 4AVAA 2AFWA 1Z2LA 4KORA 1I21A 2PC1A 2PJ0A 3PP9A 1M44A 4PK2A 2ZW6A 4YFJA 4KOSA 2XEFA 2B58A 2OR4A 3C26A 3S6HA 1Q2YA 1S3ZA 4OC0A 2B3UA 4UWJA 3OWCA 5E96A 3N7ZA 1S5KA 1V0CA 4B11A 3PRTA 4KOXA 4MCRA 1ARMA 2CF4A 4HPSA 2ZEPA 3GKRA 5I0CA 1ON0A 5C88A 2CY2A 3FEDA 2ZW7A 2PJ2A 2PJ6A 4JJXA 5IB0A 1ZG7A 4M3SA 2FIWA 3HLPA 5H86A 1Y7EA 2P6FA 4KUBA 3PB8X 4XNHC 3RZAA 2V8HA 2ARHA 3D2MA 4IK2A 4H6UA 2C6CA 2K5TA 2FS5A 3FEEA 2Q0YA 4NGSA 4OP4A 2QIRA 4UF4A 4ZBGA 3CXQA 2EK8A 1QSOA 1TXRA 3FJUA 2C6PA 4MRIA 2AFMA 3NFZA 4AG9A 3PEIA 3SJXA 5J1QA 2G3TA 4M85A 4R57A 3EXNA 1I1DA 1FNOA 1U6MA 4MI4A 4CGMA 2OU2A 2V8VA 3KQXA 4KSIA 1TF8A 3GLJA 3BHXA 5EC4A 5G20A 2PR1A 2Y0MA 1YW4A 1ZLHA 3FXTA 3LACA 4BINA 3FIXA 4CAEA 1IIDA 1XJOA 2PRQA 3TCVA 5KTAA 4P4FA 3VWEA 4F0YA 3IEHA 3KASA 1JWQA 2PJCA 4B14A 3R1KA 1XBUA 3GIUA 3SHPA 1MK4A 3L2NA 3ZJ0A 2JEVA 4MHYA 4UBRA 1IU8A 1XE4A 3FF3A 3IO1A 4EMEA 4AXVA 1CG2A 1ZG8A 2A4NA 3FNCA 3KR4A 4JLYA 2ANPA 5K8MA 4OIDA 3F8KA 4RN7A 3ISXA 4CGNA 1M1DA 2PJBA 2ODFA 2Q04A 3FMCA 1JQGA 4EWTA 3CT9A 1X10A 5AG4A 2PJ1A 4P6YA 2WZNA 2Q7SA 4A30A 4KVXA 4P4EA 3T9YA 5F48A 2ZOFA 2GREA 3S6FA 2BOAA 2ZEDA 2YNCC 3E0KA 4CGOA 2NYQA 2R98A 2FSRA 1F2OA 2VZZA 4F9UA 1LAPA 4ZYQA 4RI1A 1NSLA 1R43A 4KOUA 4CYPA 4JZ0A 4MCPA 5H84A 4MFKA 3GUXA 4QBJA 5ISVA 2Q51A 2OZHA 4AB7A 3H8FA 2FCKA 3TTHA 4XPDC 4WWVA 2VZYA 2AFSA 4B10A 4R7MA 4UCNA 1NE9A 4A32A 4CYNA 1HEEA 1YSJA 3FVLA 4ONWA 4OMEA 4Q38A 1ARLA 1R57A 4MHNA 2DEAA 3D66A 3TO6A 4DYOA 1CP6A 1KUVA 3QB8A 4PXDA 2CNTA 2D4PA 4UA3A 4X8IA 2Q7BA 2CXAA 3WC5A 4KSAA 3TT2A 3WC7A 8CPAA 2EVNA 6CPAA 3BI0A 1Z4RA 4AVCA 3NE8A 2BSWA 2R1IA 3JRUA 4E8OA 5FVJA 3N5FA 1YLOA 2J9AA 5JQ4A 4LX9A 3P2HA 1F57A 2X7BA 1QSRA 1IYKA 4MXUA 4ZY2A 4CAVA 3IJ3A
chains in the Genus database with same CATH topology
5C82A 4F0XA 2G0BA 5F47A 4MJ8A 2BL1A 2DPSA 3W91A 4J3GA 2WSAA 2OH1A 4FD5A 1MJ9A 4KOWA 2VBQA 3D8PA 1QSMA 4KZTA 4CRYB 2P6EA 1Y7RA 4A31A 4C7IA 1M4IA 1YVOA 1S7FA 1YREA 2DXQA 1J4JA 3EFAA 1Q2CA 3JVNA 4L89A 1M4GA 1BO4A 3A9LA 4ZGYB 4II9A 2Z3MA 2AJ6A 5F46A 3T90A 3K9UA 3W6XA 4PK3A 3H4QA 2GANA 3H5ZA 1YR0A 2WPXA 5DWNA 2ZW4A 4U9YA 3SXNA 4KOTA 1Z9UA 2HV2A 4JXRA 2Z11A 3DDDA 2Z3LA 3JTKA 1Q2DA 2Q44A 2Q4YA 4ORFA 4FD6A 3S6GA 1IICA 2Z10A 4JD6A 3R95A 3CXPA 1Y9WA 4NXYA 2VI7A 4CRZB 4PV6A 4HKFA 5KTDA 4F6AA 2Z0ZA 1K4JA 4JWPA 2CNSA 1P0HA 3P2FA 4IF5A 1XF8A 2JLMA 3IWEA 2OZGA 3FBUA 2FL4A 4I49A 1BOBA 1MJBA 2GE3A 5F49A 3IWGA 4UFXA 5J8CA 4MFJA 1MJAA 4CAXA 2J8NA 5GCNA 4XPDB 5CNPA 4CYOA 4U5YA 5IX3A 2P6GA 5IV0A 4UCMA 3R96A 5A28A 1PU9A 4NF1A 4Y49C 4JXQA 3TO7A 1KZFA 4XPKA 4B5PA 4KOVA 3TE4A 3WR7A 1LRZA 4BBHA 1S7LA 2PR8A 4E0AA 1S7NA 2ZW5A 2OB0A 4R87A 1L0CA 3DR8A 4MHDA 3R9GA 4OAEA 4QUSA 3D2PA 1CM0A 5G22A 2D4OA 2YGWA 5KTCA 2FXFA 4PSXA 4B5PB 4GS4A 2FT0A 4H6ZA 3TO9A 4QC6A 2H5MA 2B3VA 3IGRA 4YGOA 2Z3NA 3G3SA 1YLEA 1Y9KA 2J8MA 2PDOA 4CGPA 5A27A 2Q4VA 4C2ZA 3R9EA 2BEIA 1RXTA 4EVYA 3FYNA 4MY0A 3DSBA 4MFPA 4C7HA 3MGDA 3JUWA 3GY9A 2RC4A 1YVKA 5AG7A 2ZXVA 1B6BA 4DNCA 4MBUA 1KUXA 5AG5A 4XNHB 2G3AA 4YRHA 4E2AA 3RYOA 2VXKA 3DNSA 2B4BA 4FD4A 5AG6A 2KCWA 2FE7A 4C2XA 1XIXA 4HNWB 5HH1A 2GIVA 2B4DA 4MFQA 5HMNA 1S60A 2Z3PA 3IU2A 2BUEA 2QECA 4C2YA 3TOAA 4LUAA 2ZPAA 1WWZA 3S6KA 3VWDA 2PQ8A 2B4DB 4UWIA 3BJ8A 2QMLA 2REFA 4BMHA 4U9ZA 3I3GA 4CGLA 3CXSA 1UFHA 1QSTA 1NMTA 2DPTA 4IUSA 2ATRA 2JDDA 2YNCA 4AVBA 4B12A 4PSWA 3ZZIA 4UFWA 1YGHA 2HUZA 3LD2A 4A95A 2WUUA 2WPWA 1YX0A 4QB9A 4MFLA 5EBVA 2NMTA 2C27A 4B13A 1FY7A 1SQHA 2OZUA 3NE7A 3SXOA 3KKWA 3BJ7A 4Y49B 4KS9A 4KSFA 4ONUA 3V8IA 4NEXA 5JPHA 4KVME 4KUAA 1KUYA 2EUIA 2REEA 2YNDA 4CS0B 4CYQA 2FIAA 1P4NA 4KOYA 2VEZA 4R3KA 4HNXB 3W6SA 3UY5A 2IL4A 4OLLA 4KLWA 3G8WA 1IB1E 2R7HA 1GHEA 2O28A 1OZPA 4UFVA 2YNEA 1VKCA 1I12A 3BLNA 4KVOE 5DWMA 1CJWA 4HNYB 2Z3KA 4CAFA 4UCPA 2HQYA 4R9MA 4C68A 4XPLA 4CAWA 3EY5A 3PZJA 2J8RA 2I00A 1XEBA 1RO5A 3IU1A 5G1ZA 2P0WA 4QVTA 3PGPA 3F0AA 4A33A 5G21A 1TIQA 1VHSA 1QSNA 1YK3A 2I79A 4L8AA 1ZO0A 5AGEA 1S7KA 4K30A 4NSQA 2B5GA 3QAHA 2PSWA 1IYLA 3EC4A 4KLVA 3DR6A 1PUAA 2PRBA 2AE6A 4FD7A 4RS2A 4B5OA 2B5GB 3EO4A 4Q36A 1XMTA 3R9FA 4MY3A 2Z3OA 3LODA 4H89A 3B8GA 4MFZA 2F5IA 5J8FA 4NCZA 2CNMA 4X5KA 2JDCA 4A2ZA 3I9SA 3TOBA 4OADA 1B87A 3FB3A 3FRMA 1WK4A 1N71A 1Z4EA 3D3SA 4AG7A 2VQYA 1M4DA 2R8VA 3GYAA 3TFYA 4R3LA 3F5BA 4AVAA 4KORA 1I21A 2PC1A 3PP9A 1M44A 4PK2A 2ZW6A 4YFJA 4KOSA 2B58A 3C26A 3S6HA 1Q2YA 1S3ZA 2B3UA 4UWJA 3OWCA 5E96A 3N7ZA 1S5KA 1V0CA 4B11A 4KOXA 3GKRA 5I0CA 1ON0A 5C88A 2CY2A 2ZW7A 5IB0A 4JJXA 4M3SA 2FIWA 5H86A 2P6FA 4KUBA 4XNHC 2ARHA 3D2MA 4H6UA 2K5TA 2FS5A 2Q0YA 2QIRA 4ZBGA 3CXQA 1QSOA 4AG9A 2G3TA 4M85A 4R57A 3EXNA 1I1DA 1U6MA 4MI4A 4CGMA 2OU2A 5EC4A 5G20A 2PR1A 2Y0MA 3FXTA 3FIXA 4CAEA 1IIDA 3TCVA 5KTAA 3VWEA 4F0YA 4B14A 3R1KA 3SHPA 1MK4A 3ZJ0A 2JEVA 4UBRA 1XE4A 3FNCA 2A4NA 4JLYA 3F8KA 4CGNA 1M1DA 2Q04A 5AG4A 4A30A 4KVXA 3T9YA 5F48A 3S6FA 2YNCC 3E0KA 4CGOA 2R98A 2FSRA 2VZZA 4RI1A 1NSLA 4KOUA 4CYPA 5H84A 4MFKA 4QBJA 5ISVA 2OZHA 4AB7A 2FCKA 3TTHA 4XPDC 2VZYA 4B10A 4UCNA 1NE9A 4A32A 4CYNA 4Q38A 1R57A 3TO6A 1KUVA 3QB8A 4UA3A 2CNTA 2D4PA 2Q7BA 2CXAA 4KSAA 3TT2A 2EVNA 1Z4RA 4AVCA 2BSWA 2R1IA 4E8OA 5FVJA 5JQ4A 4LX9A 3P2HA 2X7BA 1QSRA 1IYKA 5BWAB 4CAVA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5C82 A;  2G0B A;  5F47 A;  4MJ8 A;  2BL1 A;  3W91 A;  4J3G A;  2OH1 A;  4FD5 A;  1MJ9 A;  4KOW A;  2VBQ A;  3D8P A;  1QSM A;  4KZT A;  4CRY B;  2P6E A;  1Y7R A;  1M4I A;  1YVO A;  1S7F A;  1YRE A;  2DXQ A;  1J4J A;  3EFA A;  1Q2C A;  3JVN A;  4L89 A;  1M4G A;  1BO4 A;  4II9 A;  2AJ6 A;  5F46 A;  3T90 A;  3K9U A;  3W6X A;  4PK3 A;  3H4Q A;  2GAN A;  1YR0 A;  2WPX A;  5DWN A;  2ZW4 A;  4U9Y A;  3SXN A;  4KOT A;  1Z9U A;  2HV2 A;  4JXR A;  2Z11 A;  3DDD A;  1Q2D A;  2Q44 A;  2Q4Y A;  4ORF A;  4FD6 A;  3S6G A;  1IIC A;  2Z10 A;  4JD6 A;  3R95 A;  3CXP A;  1Y9W A;  4NXY A;  2VI7 A;  4CRZ B;  4PV6 A;  4HKF A;  5KTD A;  4F6A A;  2Z0Z A;  1K4J A;  4JWP A;  2CNS A;  1P0H A;  3P2F A;  4IF5 A;  1XF8 A;  2JLM A;  2OZG A;  3FBU A;  2FL4 A;  4I49 A;  1BOB A;  1MJB A;  2GE3 A;  5F49 A;  3IWG A;  5J8C A;  1MJA A;  4CAX A;  2J8N A;  5GCN A;  4XPD B;  5CNP A;  4U5Y A;  5IX3 A;  2P6G A;  5IV0 A;  3R96 A;  1PU9 A;  4NF1 A;  4Y49 C;  4JXQ A;  3TO7 A;  1KZF A;  4XPK A;  4B5P A;  4KOV A;  3TE4 A;  3WR7 A;  1LRZ A;  1S7L A;  2PR8 A;  4E0A A;  1S7N A;  2ZW5 A;  2OB0 A;  4R87 A;  1L0C A;  3DR8 A;  4MHD A;  3R9G A;  4OAE A;  4QUS A;  3D2P A;  1CM0 A;  2D4O A;  5KTC A;  2FXF A;  4PSX A;  4B5P B;  4GS4 A;  2FT0 A;  4H6Z A;  3TO9 A;  4QC6 A;  2H5M A;  2B3V A;  3IGR A;  4YGO A;  3G3S A;  1YLE A;  1Y9K A;  2J8M A;  2PDO A;  2Q4V A;  3R9E A;  2BEI A;  1RXT A;  4EVY A;  3FYN A;  4MY0 A;  3DSB A;  3MGD A;  3JUW A;  3GY9 A;  2RC4 A;  1YVK A;  2ZXV A;  1B6B A;  4DNC A;  4MBU A;  1KUX A;  4XNH B;  2G3A A;  4YRH A;  4E2A A;  3RYO A;  2VXK A;  3DNS A;  2B4B A;  4FD4 A;  2KCW A;  2FE7 A;  1XIX A;  4HNW B;  5HH1 A;  2GIV A;  2B4D A;  5HMN A;  1S60 A;  2BUE A;  2QEC A;  3TOA A;  4LUA A;  2ZPA A;  1WWZ A;  3S6K A;  3VWD A;  2PQ8 A;  2B4D B;  4UWI A;  3BJ8 A;  2QML A;  2REF A;  4BMH A;  4U9Z A;  3I3G A;  3CXS A;  1UFH A;  1QST A;  1NMT A;  4IUS A;  2ATR A;  2JDD A;  4AVB A;  4PSW A;  3ZZI A;  1YGH A;  2HUZ A;  3LD2 A;  2WPW A;  1YX0 A;  4QB9 A;  5EBV A;  2NMT A;  2C27 A;  1FY7 A;  1SQH A;  2OZU A;  3NE7 A;  3SXO A;  3KKW A;  3BJ7 A;  4Y49 B;  4ONU A;  3V8I A;  4NEX A;  5JPH A;  4KVM E;  4KUA A;  1KUY A;  2EUI A;  2REE A;  4CS0 B;  2FIA A;  1P4N A;  4KOY A;  2VEZ A;  4R3K A;  4HNX B;  3W6S A;  3UY5 A;  2IL4 A;  4OLL A;  4KLW A;  3G8W A;  1IB1 E;  2R7H A;  1GHE A;  2O28 A;  1OZP A;  1VKC A;  1I12 A;  3BLN A;  4KVO E;  5DWM A;  1CJW A;  4HNY B;  2HQY A;  4R9M A;  4XPL A;  4CAW A;  3EY5 A;  3PZJ A;  2J8R A;  2I00 A;  1XEB A;  1RO5 A;  2P0W A;  4QVT A;  3PGP A;  3F0A A;  1TIQ A;  1VHS A;  1QSN A;  1YK3 A;  2I79 A;  4L8A A;  1S7K A;  4K30 A;  4NSQ A;  2B5G A;  3QAH A;  2PSW A;  1IYL A;  3EC4 A;  4KLV A;  3DR6 A;  1PUA A;  2PRB A;  2AE6 A;  4FD7 A;  4RS2 A;  4B5O A;  2B5G B;  3EO4 A;  1XMT A;  3R9F A;  4MY3 A;  3LOD A;  4H89 A;  3B8G A;  2F5I A;  5J8F A;  4NCZ A;  2CNM A;  4X5K A;  2JDC A;  3I9S A;  3TOB A;  4OAD A;  1B87 A;  3FB3 A;  3FRM A;  1WK4 A;  1N71 A;  1Z4E A;  3D3S A;  4AG7 A;  2VQY A;  1M4D A;  2R8V A;  3GYA A;  3TFY A;  4R3L A;  3F5B A;  4AVA A;  4KOR A;  1I21 A;  2PC1 A;  3PP9 A;  1M44 A;  4PK2 A;  2ZW6 A;  4YFJ A;  4KOS A;  2B58 A;  3C26 A;  3S6H A;  1Q2Y A;  1S3Z A;  2B3U A;  4UWJ A;  3OWC A;  5E96 A;  3N7Z A;  1S5K A;  1V0C A;  4KOX A;  3GKR A;  5I0C A;  1ON0 A;  5C88 A;  2CY2 A;  2ZW7 A;  5IB0 A;  4JJX A;  4M3S A;  2FIW A;  5H86 A;  2P6F A;  4KUB A;  4XNH C;  2ARH A;  3D2M A;  4H6U A;  2K5T A;  2FS5 A;  2Q0Y A;  2QIR A;  4ZBG A;  3CXQ A;  1QSO A;  4AG9 A;  2G3T A;  4M85 A;  4R57 A;  3EXN A;  1I1D A;  1U6M A;  4MI4 A;  2OU2 A;  5EC4 A;  2PR1 A;  2Y0M A;  3FXT A;  3FIX A;  1IID A;  3TCV A;  5KTA A;  3VWE A;  4F0Y A;  3R1K A;  3SHP A;  1MK4 A;  3ZJ0 A;  2JEV A;  4UBR A;  1XE4 A;  3FNC A;  2A4N A;  4JLY A;  3F8K A;  1M1D A;  2Q04 A;  4KVX A;  3T9Y A;  5F48 A;  3S6F A;  3E0K A;  2R98 A;  2FSR A;  2VZZ A;  4RI1 A;  1NSL A;  4KOU A;  5H84 A;  4QBJ A;  5ISV A;  2OZH A;  4AB7 A;  2FCK A;  3TTH A;  4XPD C;  2VZY A;  1NE9 A;  1R57 A;  3TO6 A;  1KUV A;  3QB8 A;  4UA3 A;  2CNT A;  2D4P A;  2Q7B A;  3TT2 A;  2EVN A;  1Z4R A;  4AVC A;  2BSW A;  2R1I A;  4E8O A;  5FVJ A;  5JQ4 A;  4LX9 A;  3P2H A;  2X7B A;  1QSR A;  1IYK A;  4CAV A; 
#chains in the Genus database with same CATH topology
 1FT7 A;  5C82 A;  4NGQ A;  4F0X A;  2G0B A;  5F47 A;  1R3N A;  4MJ8 A;  2BL1 A;  5I4M A;  2DPS A;  2O4H A;  3KZW A;  4J3G A;  3W91 A;  4A38 A;  2WSA A;  3SI0 A;  2XEJ A;  2OH1 A;  1DTD A;  2QJ8 A;  4FD5 A;  3B7I A;  4R6T A;  1LFW A;  1MJ9 A;  4KOW A;  2VBQ A;  2I3C A;  3D8P A;  2PVV A;  1ZLI A;  2NSM A;  1QSM A;  2F7V A;  4KZT A;  4CRY B;  2P6E A;  2CTC A;  1Y7R A;  4A31 A;  4C7I A;  2PJA A;  2WYR A;  1OBR A;  1M4I A;  5LYF A;  1X12 A;  1YVO A;  1S7F A;  1ELL P;  1YRE A;  2DXQ A;  2V8G A;  4PQA A;  4A39 A;  1J4J A;  2F8H A;  3EFA A;  3ISZ A;  3D68 A;  1Q2C A;  3JVN A;  1IY7 A;  4L89 A;  1M4G A;  1BO4 A;  3A9L A;  3NH5 A;  4ZGY B;  4II9 A;  2Z3M A;  3SI2 A;  2AJ6 A;  5F46 A;  4W9Y A;  3T90 A;  3QNV A;  3K9U A;  2JEW A;  4PPZ A;  3W6X A;  2HB6 A;  2VL1 A;  7CPA A;  2AFU A;  4BD9 A;  4PK3 A;  3H4Q A;  1H8L A;  2GAN A;  4PXC A;  3BXM A;  2JBK A;  4LQG A;  3H5Z A;  1YR0 A;  2WPX A;  4FWU A;  2ZW4 A;  5DWN A;  3WC6 A;  4U9Y A;  3SXN A;  4KOT A;  1PYT B;  1Z9U A;  2ZEM A;  3WAB A;  2HV2 A;  4JXR A;  2Z11 A;  1CBX A;  4R76 A;  3DDD A;  4UIA A;  4UEF A;  2Z3L A;  3PBE A;  4MMO A;  3JTK A;  2PE3 A;  1Q2D A;  2Q44 A;  2Q4Y A;  3RO0 A;  4DJL A;  4ORF A;  3CPA A;  1YQE A;  5LRJ A;  1CPX A;  1Y0Y A;  1TKJ A;  4FD6 A;  4P4B A;  3S6G A;  2POK A;  1IIC A;  2Z10 A;  4JD6 A;  4ZX8 A;  3FEC A;  3R95 A;  4ZI6 A;  1F2P A;  2ZEH A;  3CXP A;  4TWE A;  1Y9W A;  4NXY A;  2VI7 A;  4PXB A;  4CRZ B;  4PV6 A;  3PB7 X;  4HKF A;  5KTD A;  4F6A A;  2Z0Z A;  1K4J A;  4JWP A;  2CNS A;  1P0H A;  3P2F A;  3D7G A;  3SJG A;  3SI1 A;  4IF5 A;  1XF8 A;  1GYT A;  2JLM A;  3IWE A;  3RAM A;  2AFZ A;  2OZG A;  2ZEE A;  2FL4 A;  3FBU A;  4I49 A;  2BO9 A;  1BOB A;  4UIB A;  3VH9 A;  1A2Z A;  1MJB A;  2GE3 A;  5F49 A;  3IWG A;  4UFX A;  4YU9 A;  4NJR A;  5J8C A;  4MFJ A;  1MJA A;  3HUV A;  4ZX9 A;  5HVF A;  4P45 A;  4CAX A;  2J8N A;  5GCN A;  4XPD B;  5CNP A;  4CYO A;  3IC1 A;  4MHP A;  4U5Y A;  5IX3 A;  2P6G A;  4NGM A;  3T8W A;  4NGN A;  5IV0 A;  3NA6 A;  4UCM A;  3R96 A;  4MCS A;  5A28 A;  5D8N A;  1PU9 A;  4NF1 A;  4Y49 C;  3PFO A;  4JXQ A;  5JM6 A;  3TO7 A;  1Z8W A;  3PB9 X;  1KZF A;  4XPK A;  4B5P A;  4KOV A;  3TE4 A;  2C1C A;  3WR7 A;  1LRZ A;  4DUK A;  4BBH A;  1S7L A;  1VGY A;  2PR8 A;  4E0A A;  5HVG A;  1S7N A;  2XEG A;  4NFR A;  2ZW5 A;  2OB0 A;  4R87 A;  5ELY A;  3RNZ A;  3CDX A;  1L0C A;  3DR8 A;  4MHD A;  3R9G A;  3MRU A;  4OC2 A;  1NSA A;  4OAE A;  4X3R A;  4QUS A;  5LYL A;  3D2P A;  1CM0 A;  5K8O A;  5G22 A;  2D4O A;  2YGW A;  3LWU A;  5KTC A;  2FXF A;  4PSX A;  4B5P B;  4GS4 A;  4M6H A;  1IOI A;  2FT0 A;  4H6Z A;  3KQZ A;  3TO9 A;  5JGF A;  3B3W A;  4QC6 A;  2G9D A;  5JH9 A;  2H5M A;  2B3V A;  1EE3 P;  3IGR A;  4H2K A;  4P10 A;  4YGO A;  2Z3N A;  1Z8X A;  3B2Y A;  3G3S A;  1YLE A;  1Y9K A;  2J8M A;  4M6G A;  5K8N A;  5HXD A;  2PDO A;  4CGP A;  5A27 A;  2Q4V A;  3VAT A;  2CTB A;  2IQ6 A;  4C2Z A;  1XOV A;  3R9E A;  2BEI A;  3S9M A;  1RXT A;  3QAY A;  3IIB A;  4EVY A;  3PBB A;  3D7H A;  3FYN A;  2PCU A;  3IFE A;  4MY0 A;  2ABZ A;  2AFX A;  3DSB A;  4IAV A;  1QQ9 A;  2V77 A;  3FH4 A;  4MFP A;  4C7H A;  3MGD A;  1IOF A;  3JUW A;  3GY9 A;  2RC4 A;  3SJF A;  1YVK A;  4NGR A;  5AG7 A;  4B6Z A;  2ZXV A;  2XEI A;  4Q7A A;  1B6B A;  1IGB A;  2PJ8 A;  4DNC A;  4MBU A;  1KUX A;  5AG5 A;  4XNH B;  2G3A A;  4YRH A;  1Z8L A;  4LQ6 A;  1YME A;  3I1U A;  2ZEF A;  1HDU A;  4X2T A;  5DS0 A;  3RYO A;  4E2A A;  2VXK A;  3DNS A;  2B4B A;  4FD4 A;  3KGQ A;  4OC4 A;  3KI9 A;  5AG6 A;  2KCW A;  2FE7 A;  4C2X A;  1XIX A;  1YW6 A;  4HNW B;  5HH1 A;  2BCO A;  2PIZ A;  3BI1 A;  4IHM A;  1TKF A;  2GIV A;  1HDQ A;  3S9N A;  2B4D A;  3TC8 A;  1CPS A;  4NGP A;  1Y0R A;  4P4D A;  2PIY A;  2RB7 A;  4MFQ A;  5HMN A;  2Q4Z A;  1S60 A;  2Z3P A;  4P4J A;  3B3C A;  3IU2 A;  4OC1 A;  1KWM A;  1BPN A;  2BUE A;  3K2K A;  1VHO A;  2QEC A;  4O23 A;  3TX8 A;  4FAI A;  4C2Y A;  3TOA A;  4LUA A;  2ZPA A;  1WWZ A;  4WJB A;  3S6K A;  3VWD A;  4R8F A;  3D4U A;  1Z8T A;  2PQ8 A;  2B4D B;  4UWI A;  3BJ8 A;  2QML A;  2REF A;  5K8P A;  4BMH A;  4U9Z A;  3I3G A;  4CGL A;  3CXS A;  1UFH A;  4CPA A;  1QST A;  4RUH A;  1NMT A;  2DPT A;  4IUS A;  2ATR A;  2JDD A;  2YNC A;  2PJ7 A;  2EWB A;  3WT4 A;  4AVB A;  4B12 A;  3DLJ A;  4FUU A;  4PSW A;  4UFW A;  3ZZI A;  1YGH A;  1PCA A;  2ZEO A;  2HUZ A;  3LD2 A;  2PJ9 A;  1CX8 A;  4A95 A;  2WUU A;  1AYE A;  5EMI A;  2QVP A;  5CBM A;  2WPW A;  1YX0 A;  4QB9 A;  4MFL A;  5EBV A;  2NMT A;  2C27 A;  4GXH A;  3V38 A;  4EFD A;  3KHZ A;  2C6G A;  5F09 A;  4B13 A;  3H8E A;  1FY7 A;  1SQH A;  2OZU A;  5IB9 A;  3NE7 A;  3SXO A;  3KKW A;  4G1P A;  4P44 A;  4TNU A;  4F8Z A;  4F9V A;  3VAR A;  3CPX A;  3BJ7 A;  5CPA A;  3D7D A;  4Y49 B;  4KS9 A;  4KSF A;  4ONU A;  2ZEN A;  4NEX A;  4PXE A;  1AUG A;  3V8I A;  5JPH A;  4KVM E;  4KUA A;  4ZY1 A;  3H8G A;  5D29 A;  2PJ4 A;  4ZY0 A;  1KUY A;  2EUI A;  2REE A;  3KHX A;  1Q7L A;  3KL9 A;  3LMS A;  2YND A;  3B3S A;  1RTQ A;  1Z5R A;  2FIA A;  1P4N A;  4KOY A;  2VEZ A;  4CS0 B;  4CYQ A;  1VIX A;  3CZX A;  4OKO A;  4R3K A;  4HNX B;  3W6S A;  3UY5 A;  2IL4 A;  4OLL A;  4NJQ A;  4OC3 A;  4KLW A;  3G8W A;  1TKH A;  1IB1 E;  2R7H A;  1GHE A;  5HVH A;  2O28 A;  5LRK A;  1OZP A;  4UFV A;  2EO8 A;  2YNE A;  1VKC A;  2PJ5 A;  1I12 A;  3BLN A;  4KVO E;  5LYI A;  5DWM A;  1CJW A;  4HNY B;  2Z3K A;  4CAF A;  4UCP A;  2HQY A;  4NGT A;  3B3V A;  4R9M A;  4C68 A;  4XPL A;  2HC9 A;  4CAW A;  3EY5 A;  3NH4 A;  2J8R A;  3D7F A;  3PZJ A;  2GFQ A;  1DE4 C;  1BLL E;  1XEB A;  1BPM A;  2I00 A;  3B35 A;  1RO5 A;  3IU1 A;  5G1Z A;  2P0W A;  4QVT A;  3PGP A;  3F0A A;  4A33 A;  5G21 A;  2JBJ A;  5THW A;  1TIQ A;  2V8D A;  2ZEL A;  1VHS A;  1QSN A;  2GLJ A;  1M4L A;  2QYV A;  2OOT A;  2DF5 A;  1YK3 A;  3DGV A;  1LAN A;  2I79 A;  2RFH A;  4MCQ A;  4L8A A;  1ZO0 A;  3PB6 X;  1S7K A;  3PFE A;  4K3N A;  5AGE A;  5LYD A;  4UEE A;  1QMU A;  4K30 A;  4NSQ A;  4OIW A;  4A94 A;  2B5G A;  3SJE A;  1AMP A;  1LOK A;  3NH8 A;  1XFO A;  3QAH A;  2PSW A;  4M6I A;  1IYL A;  3KR5 A;  3V7Z A;  3EC4 A;  4KLV A;  5LRG A;  1TF9 A;  3GB0 A;  2AFO A;  3DR6 A;  5BWA B;  2IMO A;  2ZEG A;  1PUA A;  2GLF A;  2IJZ A;  2PRB A;  3FX6 A;  2AE6 A;  4P4I A;  3MN8 A;  3RBU A;  1UWY A;  1BAV A;  3D67 A;  4OC5 A;  4FD7 A;  4MHZ A;  2ZOG A;  1ZG9 A;  4RS2 A;  2FVG A;  4B5O A;  2B5G B;  3EO4 A;  4UEZ A;  4JYW A;  2PVW A;  4Q36 A;  1LAM A;  1VHE A;  1XMT A;  3R9F A;  3PB4 X;  4MY3 A;  4YWY A;  2Z3O A;  3LOD A;  4H89 A;  3B3T A;  3B8G A;  4MFZ A;  1XMB A;  2F5I A;  4A37 A;  5J8F A;  4NCZ A;  2CNM A;  3IWW A;  4X5K A;  2JDC A;  4A2Z A;  1CP7 A;  2O53 A;  3I9S A;  3TOB A;  1LCP A;  4OAD A;  2GU2 A;  1B87 A;  2Q43 A;  3FB3 A;  2EK9 A;  3FRM A;  3K9T A;  1WK4 A;  2EBJ A;  1N71 A;  1XRY A;  1Z4E A;  3D3S A;  4GM5 A;  4AG7 A;  2PJ3 A;  2VQY A;  1M4D A;  2R8V A;  3GYA A;  4FBE A;  3TFY A;  4Z65 A;  1ELM P;  2CIJ A;  4R3L A;  3F5B A;  3S9L A;  4AVA A;  2AFW A;  1Z2L A;  4KOR A;  1I21 A;  2PC1 A;  2PJ0 A;  3PP9 A;  1M44 A;  4PK2 A;  2ZW6 A;  4YFJ A;  4KOS A;  2XEF A;  2B58 A;  2OR4 A;  3C26 A;  3S6H A;  1Q2Y A;  1S3Z A;  4OC0 A;  2B3U A;  4UWJ A;  3OWC A;  5E96 A;  3N7Z A;  1S5K A;  1V0C A;  4B11 A;  3PRT A;  4KOX A;  4MCR A;  1ARM A;  2CF4 A;  4HPS A;  2ZEP A;  3GKR A;  5I0C A;  1ON0 A;  5C88 A;  2CY2 A;  3FED A;  2ZW7 A;  2PJ2 A;  2PJ6 A;  4JJX A;  5IB0 A;  1ZG7 A;  4M3S A;  2FIW A;  3HLP A;  5H86 A;  1Y7E A;  2P6F A;  4KUB A;  3PB8 X;  4XNH C;  3RZA A;  2V8H A;  2ARH A;  3D2M A;  4IK2 A;  4H6U A;  2C6C A;  2K5T A;  2FS5 A;  3FEE A;  2Q0Y A;  4NGS A;  4OP4 A;  2QIR A;  4UF4 A;  4ZBG A;  3CXQ A;  2EK8 A;  1QSO A;  1TXR A;  3FJU A;  2C6P A;  4MRI A;  2AFM A;  3NFZ A;  4AG9 A;  3PEI A;  3SJX A;  5J1Q A;  2G3T A;  4M85 A;  4R57 A;  3EXN A;  1I1D A;  1FNO A;  1U6M A;  4MI4 A;  4CGM A;  2OU2 A;  2V8V A;  3KQX A;  4KSI A;  1TF8 A;  3GLJ A;  3BHX A;  5EC4 A;  5G20 A;  2PR1 A;  2Y0M A;  1YW4 A;  1ZLH A;  3FXT A;  3LAC A;  4BIN A;  3FIX A;  4CAE A;  1IID A;  1XJO A;  2PRQ A;  3TCV A;  5KTA A;  4P4F A;  3VWE A;  4F0Y A;  3IEH A;  3KAS A;  1JWQ A;  2PJC A;  4B14 A;  3R1K A;  1XBU A;  3GIU A;  3SHP A;  1MK4 A;  3L2N A;  3ZJ0 A;  2JEV A;  4MHY A;  4UBR A;  1IU8 A;  1XE4 A;  3FF3 A;  3IO1 A;  4EME A;  4AXV A;  1CG2 A;  1ZG8 A;  2A4N A;  3FNC A;  3KR4 A;  4JLY A;  2ANP A;  5K8M A;  4OID A;  3F8K A;  4RN7 A;  3ISX A;  4CGN A;  1M1D A;  2PJB A;  2ODF A;  2Q04 A;  3FMC A;  1JQG A;  4EWT A;  3CT9 A;  1X10 A;  5AG4 A;  2PJ1 A;  4P6Y A;  2WZN A;  2Q7S A;  4A30 A;  4KVX A;  4P4E A;  3T9Y A;  5F48 A;  2ZOF A;  2GRE A;  3S6F A;  2BOA A;  2ZED A;  2YNC C;  3E0K A;  4CGO A;  2NYQ A;  2R98 A;  2FSR A;  1F2O A;  2VZZ A;  4F9U A;  1LAP A;  4ZYQ A;  4RI1 A;  1NSL A;  1R43 A;  4KOU A;  4CYP A;  4JZ0 A;  4MCP A;  5H84 A;  4MFK A;  3GUX A;  4QBJ A;  5ISV A;  2Q51 A;  2OZH A;  4AB7 A;  3H8F A;  2FCK A;  3TTH A;  4XPD C;  4WWV A;  2VZY A;  2AFS A;  4B10 A;  4R7M A;  4UCN A;  1NE9 A;  4A32 A;  4CYN A;  1HEE A;  1YSJ A;  3FVL A;  4ONW A;  4OME A;  4Q38 A;  1ARL A;  1R57 A;  4MHN A;  2DEA A;  3D66 A;  3TO6 A;  4DYO A;  1CP6 A;  1KUV A;  3QB8 A;  4PXD A;  2CNT A;  2D4P A;  4UA3 A;  4X8I A;  2Q7B A;  2CXA A;  3WC5 A;  4KSA A;  3TT2 A;  3WC7 A;  8CPA A;  2EVN A;  6CPA A;  3BI0 A;  1Z4R A;  4AVC A;  3NE8 A;  2BSW A;  2R1I A;  3JRU A;  4E8O A;  5FVJ A;  3N5F A;  1YLO A;  2J9A A;  5JQ4 A;  4LX9 A;  3P2H A;  1F57 A;  2X7B A;  1QSR A;  1IYK A;  4MXU A;  4ZY2 A;  4CAV A;  3IJ3 A; 
#chains in the Genus database with same CATH homology
 5C82 A;  4F0X A;  2G0B A;  5F47 A;  4MJ8 A;  2BL1 A;  2DPS A;  3W91 A;  4J3G A;  2WSA A;  2OH1 A;  4FD5 A;  1MJ9 A;  4KOW A;  2VBQ A;  3D8P A;  1QSM A;  4KZT A;  4CRY B;  2P6E A;  1Y7R A;  4A31 A;  4C7I A;  1M4I A;  1YVO A;  1S7F A;  1YRE A;  2DXQ A;  1J4J A;  3EFA A;  1Q2C A;  3JVN A;  4L89 A;  1M4G A;  1BO4 A;  3A9L A;  4ZGY B;  4II9 A;  2Z3M A;  2AJ6 A;  5F46 A;  3T90 A;  3K9U A;  3W6X A;  4PK3 A;  3H4Q A;  2GAN A;  3H5Z A;  1YR0 A;  2WPX A;  5DWN A;  2ZW4 A;  4U9Y A;  3SXN A;  4KOT A;  1Z9U A;  2HV2 A;  4JXR A;  2Z11 A;  3DDD A;  2Z3L A;  3JTK A;  1Q2D A;  2Q44 A;  2Q4Y A;  4ORF A;  4FD6 A;  3S6G A;  1IIC A;  2Z10 A;  4JD6 A;  3R95 A;  3CXP A;  1Y9W A;  4NXY A;  2VI7 A;  4CRZ B;  4PV6 A;  4HKF A;  5KTD A;  4F6A A;  2Z0Z A;  1K4J A;  4JWP A;  2CNS A;  1P0H A;  3P2F A;  4IF5 A;  1XF8 A;  2JLM A;  3IWE A;  2OZG A;  3FBU A;  2FL4 A;  4I49 A;  1BOB A;  1MJB A;  2GE3 A;  5F49 A;  3IWG A;  4UFX A;  5J8C A;  4MFJ A;  1MJA A;  4CAX A;  2J8N A;  5GCN A;  4XPD B;  5CNP A;  4CYO A;  4U5Y A;  5IX3 A;  2P6G A;  5IV0 A;  4UCM A;  3R96 A;  5A28 A;  1PU9 A;  4NF1 A;  4Y49 C;  4JXQ A;  3TO7 A;  1KZF A;  4XPK A;  4B5P A;  4KOV A;  3TE4 A;  3WR7 A;  1LRZ A;  4BBH A;  1S7L A;  2PR8 A;  4E0A A;  1S7N A;  2ZW5 A;  2OB0 A;  4R87 A;  1L0C A;  3DR8 A;  4MHD A;  3R9G A;  4OAE A;  4QUS A;  3D2P A;  1CM0 A;  5G22 A;  2D4O A;  2YGW A;  5KTC A;  2FXF A;  4PSX A;  4B5P B;  4GS4 A;  2FT0 A;  4H6Z A;  3TO9 A;  4QC6 A;  2H5M A;  2B3V A;  3IGR A;  4YGO A;  2Z3N A;  3G3S A;  1YLE A;  1Y9K A;  2J8M A;  2PDO A;  4CGP A;  5A27 A;  2Q4V A;  4C2Z A;  3R9E A;  2BEI A;  1RXT A;  4EVY A;  3FYN A;  4MY0 A;  3DSB A;  4MFP A;  4C7H A;  3MGD A;  3JUW A;  3GY9 A;  2RC4 A;  1YVK A;  5AG7 A;  2ZXV A;  1B6B A;  4DNC A;  4MBU A;  1KUX A;  5AG5 A;  4XNH B;  2G3A A;  4YRH A;  4E2A A;  3RYO A;  2VXK A;  3DNS A;  2B4B A;  4FD4 A;  5AG6 A;  2KCW A;  2FE7 A;  4C2X A;  1XIX A;  4HNW B;  5HH1 A;  2GIV A;  2B4D A;  4MFQ A;  5HMN A;  1S60 A;  2Z3P A;  3IU2 A;  2BUE A;  2QEC A;  4C2Y A;  3TOA A;  4LUA A;  2ZPA A;  1WWZ A;  3S6K A;  3VWD A;  2PQ8 A;  2B4D B;  4UWI A;  3BJ8 A;  2QML A;  2REF A;  4BMH A;  4U9Z A;  3I3G A;  4CGL A;  3CXS A;  1UFH A;  1QST A;  1NMT A;  2DPT A;  4IUS A;  2ATR A;  2JDD A;  2YNC A;  4AVB A;  4B12 A;  4PSW A;  3ZZI A;  4UFW A;  1YGH A;  2HUZ A;  3LD2 A;  4A95 A;  2WUU A;  2WPW A;  1YX0 A;  4QB9 A;  4MFL A;  5EBV A;  2NMT A;  2C27 A;  4B13 A;  1FY7 A;  1SQH A;  2OZU A;  3NE7 A;  3SXO A;  3KKW A;  3BJ7 A;  4Y49 B;  4KS9 A;  4KSF A;  4ONU A;  3V8I A;  4NEX A;  5JPH A;  4KVM E;  4KUA A;  1KUY A;  2EUI A;  2REE A;  2YND A;  4CS0 B;  4CYQ A;  2FIA A;  1P4N A;  4KOY A;  2VEZ A;  4R3K A;  4HNX B;  3W6S A;  3UY5 A;  2IL4 A;  4OLL A;  4KLW A;  3G8W A;  1IB1 E;  2R7H A;  1GHE A;  2O28 A;  1OZP A;  4UFV A;  2YNE A;  1VKC A;  1I12 A;  3BLN A;  4KVO E;  5DWM A;  1CJW A;  4HNY B;  2Z3K A;  4CAF A;  4UCP A;  2HQY A;  4R9M A;  4C68 A;  4XPL A;  4CAW A;  3EY5 A;  3PZJ A;  2J8R A;  2I00 A;  1XEB A;  1RO5 A;  3IU1 A;  5G1Z A;  2P0W A;  4QVT A;  3PGP A;  3F0A A;  4A33 A;  5G21 A;  1TIQ A;  1VHS A;  1QSN A;  1YK3 A;  2I79 A;  4L8A A;  1ZO0 A;  5AGE A;  1S7K A;  4K30 A;  4NSQ A;  2B5G A;  3QAH A;  2PSW A;  1IYL A;  3EC4 A;  4KLV A;  3DR6 A;  1PUA A;  2PRB A;  2AE6 A;  4FD7 A;  4RS2 A;  4B5O A;  2B5G B;  3EO4 A;  4Q36 A;  1XMT A;  3R9F A;  4MY3 A;  2Z3O A;  3LOD A;  4H89 A;  3B8G A;  4MFZ A;  2F5I A;  5J8F A;  4NCZ A;  2CNM A;  4X5K A;  2JDC A;  4A2Z A;  3I9S A;  3TOB A;  4OAD A;  1B87 A;  3FB3 A;  3FRM A;  1WK4 A;  1N71 A;  1Z4E A;  3D3S A;  4AG7 A;  2VQY A;  1M4D A;  2R8V A;  3GYA A;  3TFY A;  4R3L A;  3F5B A;  4AVA A;  4KOR A;  1I21 A;  2PC1 A;  3PP9 A;  1M44 A;  4PK2 A;  2ZW6 A;  4YFJ A;  4KOS A;  2B58 A;  3C26 A;  3S6H A;  1Q2Y A;  1S3Z A;  2B3U A;  4UWJ A;  3OWC A;  5E96 A;  3N7Z A;  1S5K A;  1V0C A;  4B11 A;  4KOX A;  3GKR A;  5I0C A;  1ON0 A;  5C88 A;  2CY2 A;  2ZW7 A;  5IB0 A;  4JJX A;  4M3S A;  2FIW A;  5H86 A;  2P6F A;  4KUB A;  4XNH C;  2ARH A;  3D2M A;  4H6U A;  2K5T A;  2FS5 A;  2Q0Y A;  2QIR A;  4ZBG A;  3CXQ A;  1QSO A;  4AG9 A;  2G3T A;  4M85 A;  4R57 A;  3EXN A;  1I1D A;  1U6M A;  4MI4 A;  4CGM A;  2OU2 A;  5EC4 A;  5G20 A;  2PR1 A;  2Y0M A;  3FXT A;  3FIX A;  4CAE A;  1IID A;  3TCV A;  5KTA A;  3VWE A;  4F0Y A;  4B14 A;  3R1K A;  3SHP A;  1MK4 A;  3ZJ0 A;  2JEV A;  4UBR A;  1XE4 A;  3FNC A;  2A4N A;  4JLY A;  3F8K A;  4CGN A;  1M1D A;  2Q04 A;  5AG4 A;  4A30 A;  4KVX A;  3T9Y A;  5F48 A;  3S6F A;  2YNC C;  3E0K A;  4CGO A;  2R98 A;  2FSR A;  2VZZ A;  4RI1 A;  1NSL A;  4KOU A;  4CYP A;  5H84 A;  4MFK A;  4QBJ A;  5ISV A;  2OZH A;  4AB7 A;  2FCK A;  3TTH A;  4XPD C;  2VZY A;  4B10 A;  4UCN A;  1NE9 A;  4A32 A;  4CYN A;  4Q38 A;  1R57 A;  3TO6 A;  1KUV A;  3QB8 A;  4UA3 A;  2CNT A;  2D4P A;  2Q7B A;  2CXA A;  4KSA A;  3TT2 A;  2EVN A;  1Z4R A;  4AVC A;  2BSW A;  2R1I A;  4E8O A;  5FVJ A;  5JQ4 A;  4LX9 A;  3P2H A;  2X7B A;  1QSR A;  1IYK A;  5BWA B;  4CAV A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...