4JJXA

Dodecameric structure of spermidine n-acetyltransferase speg from vibrio cholerae o1 biovar eltor
Total Genus 46
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
46
sequence length
172
structure length
172
Chain Sequence
AMNSQLTLRALERGDLRFIHNLNNNRNIMSYWFEEPYESFDELEELYNKHIHDNAERRFVVEDAQKNLIGLVELIEINYIHRSAEFQIIIAPEHQGKGFARTLINRALDYSFTILNLHKIYLHVAVENPKAVHLYEECGFVEEGHLVEEFFINGRYQDVKRMYILQSKYLNR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Spermidine n1-acetyltransferase
publication title A Novel Polyamine Allosteric Site of SpeG from Vibrio cholerae Is Revealed by Its Dodecameric Structure.
pubmed doi rcsb
source organism Vibrio cholerae o1 biovar el tor
molecule tags Transferase
total genus 46
structure length 172
sequence length 172
chains with identical sequence B, C
ec nomenclature ec 2.3.1.57: Diamine N-acetyltransferase.
pdb deposition date 2013-03-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13302 Acetyltransf_3 Acetyltransferase (GNAT) domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.630.30 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Aminopeptidase 4jjxA00
1Z4RA 2ATRA 1L0CA 1ON0A 4UWIA 2PQ8A 3LD2A 5F46A 2P6EA 2B58A 3C26A 3D8PA 5F49A 1KUVA 3DSBA 5C82A 1MJ9A 2REFA 2JEVA 4FD7A 1Y9KA 1LRZA 1IIDA 1GHEA 3RYOA 4HNXB 5H84A 4AVCA 4HNYB 4NSQA 2AE6A 3D3SA 2Q0YA 2H5MA 4IF5A 3OWCA 1Q2YA 2Q4YA 3R9FA 1TIQA 1YVKA 1Z4EA 4KUBA 4CAXA 4RS2A 2FL4A 1N71A 2ZW5A 3TFYA 2PR8A 1J4JA 3SXNA 3FYNA 1PU9A 1PUAA 1UFHA 3CXSA 4H6ZA 1XMTA 5EC4A 2Q44A 2VXKA 4QC6A 3T90A 4B5PB 2B4DB 2QMLA 2Q04A 3DR8A 3TO9A 4RI1A 1QSMA 3GYAA 4R3KA 4PSXA 4EVYA 4ZBGA 1IYKA 2FT0A 1XEBA 3DDDA 1S7LA 1RO5A 3EY5A 3NE7A 4XNHC 2ZPAA 4CAVA 4MBUA 1B6BA 1Y9WA 4XPKA 5JQ4A 2B4BA 2BEIA 3I9SA 4QB9A 3K9UA 1YREA 4KOSA 1B87A 3W91A 1MJBA 4I49A 1QSNA 2VQYA 4CRZB 2B3VA 1I12A 4YGOA 1Y7RA 2OU2A 2NMTA 2VBQA 1IB1E 4XNHB 3ZZIA 2B3UA 1CM0A 2D4PA 1NSLA 4UWJA 1QSTA 4YRHA 1P0HA 3WR7A 4K30A 4ORFA 5IX3A 3EXNA 1IYLA 5CNPA 3MGDA 4AG7A 4PSWA 3F0AA 1BOBA 1QSOA 4YFJA 4U9YA 4U9ZA 4NEXA 2VZYA 1Q2DA 2EVNA 2IL4A 2B5GA 1KZFA 2BL1A 2FIAA 1NE9A 3TO7A 1CJWA 2FE7A 2CNMA 2VI7A 4B5OA 1I21A 5E96A 1S7FA 4R9MA 2D4OA 1S5KA 1M44A 2X7BA 4E2AA 3R9GA 3PZJA 1WWZA 1P4NA 2G3TA 3B8GA 5GCNA 1Z9UA 5KTCA 4CRYB 3BLNA 2DXQA 2JDDA 4X5KA 4KOXA 2FXFA 2C27A 4KVXA 3GY9A 4AVAA 2O28A 2OB0A 3FB3A 1XE4A 4MHDA 4KOTA 1S7KA 2FIWA 2J8NA 2P6FA 3E0KA 2FCKA 4F6AA 1NMTA 4BMHA 4KLWA 2HQYA 4M3SA 5J8FA 2Z11A 5H86A 4F0YA 2ARHA 1M1DA 2RC4A 4PK2A 5J8CA 3IWGA 2FSRA 1XIXA 1YK3A 2AJ6A 1M4IA 2EUIA 1IICA 4QUSA 1V0CA 4KLVA 2F5IA 5F48A 5KTAA 3CXQA 4FD5A 3F5BA 3SXOA 2QIRA 2BSWA 4UA3A 3TT2A 1Q2CA 4XPDC 4KORA 4MJ8A 1KUYA 4PK3A 5EBVA 3VWDA 1M4GA 2J8RA 4UBRA 4Y49C 4JJXA 4II9A 2Z10A 1R57A 2JDCA 2ZXVA 5HH1A 4AB7A 4PV6A 3TTHA 3S6FA 4L89A 2P0WA 3R1KA 5IV0A 1OZPA 2WPXA 2K5TA 3D2PA 4KOVA 1YVOA 4NF1A 3ZJ0A 2QECA 3P2FA 4KZTA 4KVOE 2OZGA 3EC4A 3JUWA 2GANA 4Y49B 4CAWA 3IGRA 2GE3A 1U6MA 2CY2A 4JD6A 3FBUA 4FD6A 1SQHA 4M85A 2ZW6A 4L8AA 4E8OA 4AG9A 5HMNA 2CNSA 3G8WA 4QVTA 2J8MA 4NCZA 3CXPA 1K4JA 3G3SA 3D2MA 4ONUA 2R7HA 5IB0A 2JLMA 2Y0MA 4HKFA 2VZZA 4KOYA 5ISVA 4HNWB 3PGPA 4JXRA 2A4NA 3TE4A 2ZW7A 3DR6A 4B5PA 3BJ8A 2B4DA 3QAHA 3W6XA 1S7NA 2OZUA 3FIXA 3TCVA 3S6HA 2R1IA 4CS0B 3W6SA 4R57A 3T9YA 1S60A 3FXTA 2B5GB 1VKCA 3F8KA 4R3LA 4LUAA 1YLEA 1FY7A 1MJAA 5F47A 1M4DA 2G0BA 2I79A 1KUXA 4GS4A 3N7ZA 2Q4VA 3TOBA 5C88A 4J3GA 4H89A 1MK4A 2PDOA 3EFAA 3H4QA 2OH1A 4MI4A 3JVNA 2HUZA 4DNCA 2BUEA 4MY3A 4E0AA 2G3AA 2R98A 2REEA 2Z0ZA 4QBJA 2CNTA 3S6KA 1WK4A 2OZHA 3SHPA 3GKRA 3S6GA 3BJ7A 2HV2A 3VWEA 1XF8A 3FNCA 2PR1A 2R8VA 2Q7BA 3UY5A 3PP9A 5DWNA 5JPHA 1S3ZA 4FD4A 3TOAA 3QB8A 1BO4A 3DNSA 5KTDA 4KUAA 2WPWA 4JXQA 4IUSA 3V8IA 3R96A 3TO6A 1VHSA 2PC1A 1YGHA 4OLLA 5I0CA 1YR0A 4NXYA 3KKWA 3R95A 4XPLA 2FS5A 1RXTA 4OAEA 4AVBA 3P2HA 2PSWA 4KOUA 3LODA 3EO4A 2ZW4A 4XPDB 5DWMA 4KOWA 2VEZA 4OADA 2I00A 3FRMA 5FVJA 4H6UA 4JLYA 2KCWA 1QSRA 3I3GA 4MY0A 2P6GA 4LX9A 4R87A 1YX0A 2PRBA 4JWPA 4KVME 2GIVA 4U5YA 1I1DA 3R9EA
chains in the Genus database with same CATH superfamily
2GREA 1Z4RA 2ATRA 4MFPA 1L0CA 1ON0A 3IWEA 3CT9A 4MFQA 1VHEA 2PJ3A 4X3RA 4UWIA 2WSAA 4PXCA 1OBRA 3RZAA 4NJQA 2PQ8A 3KL9A 4M6HA 3LD2A 2DPSA 3FJUA 5F46A 2CXAA 2P6EA 2B58A 3NH5A 3C26A 3D8PA 3QAYA 5F49A 1KUVA 4UFWA 2V77A 4MHPA 4KSAA 3DSBA 5AG5A 5LYDA 1MJ9A 5C82A 2REFA 4LQGA 4ZY0A 2JEVA 4P44A 4FD7A 2EK9A 2C6CA 1Y9KA 4ZY2A 4RN7A 1LRZA 1IIDA 1GHEA 2VL1A 3RYOA 4HNXB 5H84A 1Z8TA 4HNYB 3KI9A 4AVCA 4NSQA 2AFXA 2AE6A 3D3SA 2PJAA 1F57A 3GIUA 3SI2A 2O53A 2Q0YA 2H5MA 4IF5A 3OWCA 2JEWA 1Q2YA 2Q4YA 3R9FA 4IAVA 1ZLHA 4FAIA 1TIQA 1YVKA 4B11A 1Z4EA 3PFEA 4KUBA 4CAXA 4RS2A 5AG7A 2FL4A 3I1UA 1AUGA 3IU1A 2Q51A 3B3TA 1N71A 3HUVA 4MMOA 2ZW5A 2Z3NA 4A31A 3TFYA 2PR8A 2PJ6A 1J4JA 3SXNA 3FYNA 3D66A 1PU9A 1PUAA 4MXUA 1UFHA 5AG6A 3CXSA 1XFOA 3FVLA 2PJ4A 3MRUA 2ZEGA 2C6GA 1LAPA 2J9AA 4H6ZA 1XMTA 1X10A 5EC4A 4MHYA 2Q44A 2VXKA 4QC6A 3FH4A 3K2KA 4X2TA 3T90A 4B5PB 2B4DB 3D7GA 1LANA 2QMLA 2G9DA 2Q04A 3DR8A 3TO9A 4UFXA 4OC5A 4RI1A 1HDQA 1QSMA 2ZENA 3GYAA 4R3KA 4PSXA 4EVYA 3FF3A 3FMCA 4ZBGA 4CGLA 1XBUA 5LRGA 1IYKA 2WUUA 1EE3P 2OOTA 2FT0A 2PJ1A 4EWTA 1XEBA 3DDDA 4F8ZA 1S7LA 4NGQA 3V7ZA 2ZELA 3BI1A 1RO5A 3EY5A 1CPXA 3LWUA 3PFOA 4UEEA 5JM6A 3B3VA 3NE7A 2PVVA 4UFVA 4XNHC 2ZPAA 4CAVA 1KWMA 4UIAA 2XEGA 2Z3OA 2AFOA 4MBUA 3PEIA 1B6BA 1Y9WA 3IO1A 4OIWA 4XPKA 4C68A 4RUHA 5JQ4A 4TWEA 2B4BA 2BEIA 3I9SA 4C7IA 4QB9A 2YGWA 3K9UA 4UCNA 2JBKA 1YREA 4CYQA 4KOSA 1B87A 4YWYA 3W91A 1MJBA 1PYTB 2I3CA 1YSJA 4I49A 4M6GA 1IU8A 1QSNA 2C6PA 4YU9A 2VQYA 2ABZA 4CRZB 3RNZA 4HPSA 2B3VA 4IK2A 1I12A 4YGOA 1Y7RA 4KS9A 2OU2A 4JZ0A 2Q7SA 2NMTA 2VBQA 1IB1E 3N5FA 4XNHB 3ZZIA 2B3UA 1CM0A 2D4PA 1NSLA 1IOIA 1DTDA 2OR4A 3NE8A 4R7MA 2DF5A 4UWJA 4P45A 1QSTA 1TKFA 4NJRA 2PJ9A 4MFZA 4MFKA 1P0HA 4YRHA 2GLFA 4A95A 1F2PA 1LOKA 4MCSA 4MRIA 3WR7A 5ELYA 4K30A 3KASA 4ORFA 2RFHA 5IX3A 1JWQA 2ANPA 1Z8WA 2YNCA 4BBHA 4R6TA 4WJBA 3EXNA 3IFEA 1IYLA 5CNPA 3MGDA 4AG7A 4PSWA 2Z3MA 2Z3KA 3F0AA 4ZX9A 1BOBA 4NGSA 1QSOA 4YFJA 4U9YA 2F8HA 4U9ZA 6CPAA 4NEXA 2VZYA 1Q2DA 1VIXA 2QYVA 2EVNA 2V8VA 2IL4A 4UEZA 4CAFA 2B5GA 3TC8A 1KZFA 2BL1A 2FIAA 4CYOA 1NSAA 1NE9A 3B3SA 3PBEA 3TO7A 3S9NA 1CJWA 1LFWA 2FE7A 2CNMA 2VI7A 3D7HA 4B5OA 1Z5RA 4W9YA 1I21A 2IMOA 3B3CA 1S7FA 4R9MA 5E96A 4ZGYB 4C7HA 2YNCC 2DPTA 2Z3LA 3PB9X 2D4OA 3H8FA 5AGEA 1S5KA 2AFMA 1M44A 3S9LA 4JYWA 2X7BA 2PJ2A 4E2AA 1R43A 3R9GA 3PZJA 4C2XA 1TF9A 1P4NA 1WWZA 2G3TA 2AFWA 2PE3A 4A38A 3B8GA 1ELLP 2XEIA 2PJCA 5GCNA 4BD9A 1Z9UA 5KTCA 4CRYB 5LRJA 3BLNA 2DXQA 2JDDA 3SI1A 3CDXA 3H8EA 4A30A 1CPSA 4F9UA 4X5KA 3HLPA 1GYTA 3GUXA 4KOXA 3SJFA 4C2YA 2FXFA 3SJEA 1UWYA 4CPAA 1RTQA 4NGRA 3RBUA 2C27A 4MCPA 2CF4A 4KVXA 3GY9A 4AVAA 2O28A 3BI0A 1CP6A 2OB0A 1TXRA 3FB3A 4OC3A 4ONWA 1XE4A 4MHDA 4KOTA 1S7KA 1LCPA 2FIWA 3IJ3A 1QQ9A 1ARLA 4Q36A 2HB6A 3KQXA 2J8NA 2P6FA 4A39A 3E0KA 2FCKA 4F6AA 1YQEA 4OC1A 4K3NA 1Z2LA 1HEEA 2V8GA 4O23A 1NMTA 4BMHA 4UCPA 5HVFA 4P4DA 4KLWA 1BAVA 2HQYA 2QJ8A 2CTBA 3D67A 4M3SA 5G20A 4F9VA 3FX6A 3D7FA 3QNVA 5LRKA 5J8FA 2Z11A 3IIBA 3PB6X 5G21A 3T8WA 5H86A 2EBJA 3JTKA 1M4LA 4F0YA 5K8NA 2ARHA 2ZOFA 5EMIA 1M1DA 2RC4A 4PK2A 3PBBA 5J8CA 2RB7A 2O4HA 4H2KA 3MN8A 2ZEDA 3IWGA 2FSRA 1XIXA 3VATA 1YK3A 2AJ6A 1M4IA 2EUIA 2GFQA 4B10A 3VH9A 1IICA 4QUSA 1LAMA 1V0CA 4ZX8A 5LYFA 2C1CA 4KLVA 2F5IA 5F48A 3WC5A 3CXQA 4FD5A 5KTAA 4F0XA 3WT4A 3F5BA 5HXDA 4UIBA 2ZEHA 2IQ6A 4UCMA 3VARA 1YMEA 3KQZA 3S9MA 3D4UA 4LQ6A 3KHZA 3SXOA 1Y0RA 2QIRA 4A33A 3V38A 2BSWA 3PB8X 4UA3A 3TT2A 1Q2CA 4X8IA 4XPDC 3BXMA 4KORA 5K8PA 1YLOA 2AFUA 1CX8A 1CP7A 2WYRA 1TKJA 4MJ8A 5D29A 1KUYA 4PK3A 5EBVA 2HC9A 3VWDA 1M4GA 2J8RA 4UBRA 4Y49C 4JJXA 4II9A 4UEFA 2Z10A 1R57A 2JDCA 4ZYQA 2ZXVA 5HH1A 4MFLA 4AB7A 1Y7EA 3B35A 1F2OA 4PV6A 3CZXA 3S6FA 3TTHA 4L89A 5CBMA 2P0WA 3R1KA 5IV0A 1OZPA 2AFZA 2WPXA 2K5TA 5G22A 2PJ5A 5DS0A 3D2PA 4KOVA 1YVOA 4NF1A 3ZJ0A 4FBEA 4WWVA 2QECA 2DEAA 2AFSA 1R3NA 1TF8A 3BHXA 3P2FA 4NGTA 4KZTA 4NGPA 4IHMA 2ZEMA 1PCAA 4KVOE 3CPXA 3GLJA 2OZGA 3WABA 3EC4A 3JUWA 2GANA 1HDUA 4Y49B 4CAWA 2CTCA 3IGRA 1YW4A 2GE3A 1XMBA 3NFZA 1U6MA 3RO0A 1VHOA 2CY2A 1Y0YA 4JD6A 1AMPA 3A9LA 3FBUA 3KHXA 5D8NA 2ODFA 3SJGA 1CBXA 5JH9A 4FD6A 4MCRA 3KR5A 4OC4A 4Q7AA 5K8MA 4B6ZA 1ELMP 3TX8A 2XEFA 1SQHA 4M85A 2ZW6A 4L8AA 4E8OA 4AG9A 5HMNA 2CNSA 3G8WA 4QVTA 2J8MA 4KSIA 4NCZA 3B7IA 4R8FA 2POKA 4PXDA 3CXPA 1K4JA 3G3SA 3D2MA 4ONUA 1IGBA 2IJZA 4PXEA 5JGFA 3K9TA 2R7HA 4Q38A 2PJ0A 3DGVA 5IB0A 2JLMA 4CGPA 2Y0MA 4HKFA 2VZZA 4KOYA 5BWAB 2PVWA 5ISVA 4HNWB 3PGPA 4JXRA 2NYQA 2A4NA 3CPAA 3PB7X 3B2YA 3TE4A 2ZW7A 3DR6A 1H8LA 2JBJA 4P6YA 3BJ8A 4B5PA 4B12A 2B4DA 3QAHA 5I4MA 2PCUA 3W6XA 8CPAA 1S7NA 2OZUA 2XEJA 3NH8A 4EMEA 1BPNA 3FIXA 3TCVA 3S6HA 2R1IA 2GLJA 4CAEA 2Q4ZA 3W6SA 4CS0B 4M6IA 4R57A 3IC1A 3T9YA 5IB9A 1YW6A 4Z65A 1S60A 3FXTA 3WC7A 7CPAA 4A32A 1IOFA 3NH4A 4G1PA 2B5GB 1VKCA 4FUUA 2FVGA 2PJ7A 2WZNA 4OC2A 2Q43A 4MHZA 4A37A 2PJBA 5A27A 3F8KA 4OIDA 4R3LA 4A2ZA 1QMUA 1ZLIA 4LUAA 1YLEA 1FY7A 4OC0A 1MJAA 4OP4A 5F47A 1M4DA 1X12A 4MFJA 3D68A 4B14A 4CYNA 4ZI6A 2G0BA 2I79A 1XOVA 3H8GA 1KUXA 4GS4A 3N7ZA 1XRYA 1A2ZA 4MHNA 3IWWA 3FEEA 4EFDA 1IY7A 2Q4VA 4A94A 3DLJA 4KSFA 4NGMA 3TOBA 5C88A 4J3GA 4H89A 1CG2A 1MK4A 3NA6A 3RAMA 4P4FA 1Q7LA 4DYOA 2PDOA 3EFAA 4MCQA 3ISZA 3KZWA 2PRQA 4OKOA 4P4JA 2CIJA 3H4QA 5A28A 2OH1A 4NGNA 1ARMA 3JVNA 4MI4A 1FT7A 1Z8LA 1BLLE 5HVHA 2YNDA 2HUZA 4DNCA 2BUEA 4MY3A 4E0AA 2G3AA 2R98A 2REEA 2Z0ZA 1TKHA 2CNTA 4QBJA 3S6KA 1WK4A 2OZHA 3SHPA 2ZOGA 4GM5A 4CYPA 1ZG8A 3GKRA 5AG4A 3S6GA 2V8HA 3BJ7A 3L2NA 2HV2A 4R76A 3PRTA 4TNUA 3VWEA 4DJLA 4ZY1A 1XF8A 3FNCA 2PR1A 2R8VA 3IU2A 5CPAA 3PP9A 4PQAA 2Q7BA 3UY5A 5DWNA 5JPHA 1S3ZA 4FD4A 1JQGA 2V8DA 3TOAA 3SJXA 3QB8A 1BO4A 5J1QA 2BCOA 1VGYA 2EO8A 3DNSA 4KUAA 2WPWA 2F7VA 5KTDA 4JXQA 4IUSA 2ZEPA 3V8IA 4CGMA 3ISXA 3R96A 3TO6A 1VHSA 2PC1A 2BO9A 1ZG9A 4PPZA 3LACA 2EWBA 1YGHA 3GB0A 3KR4A 3PB4X 4OLLA 4P10A 5I0CA 1YR0A 4NXYA 3LMSA 2PIZA 3KKWA 4CGNA 3R95A 4CGOA 4XPLA 2FS5A 3H5ZA 1RXTA 4OMEA 5G1ZA 3WC6A 2ZEFA 2EK8A 1Z8XA 1AYEA 2QVPA 4OAEA 4AVBA 4C2ZA 1BPMA 3P2HA 4P4BA 2NSMA 4PXBA 3IEHA 4UF4A 3SI0A 2PSWA 4KOUA 4DUKA 3LODA 2ZEEA 3EO4A 4FWUA 4NFRA 1XJOA 3D7DA 5LYIA 2ZW4A 4BINA 5K8OA 4XPDB 2BOAA 3KGQA 1ZO0A 4KOWA 5DWMA 2Z3PA 2VEZA 4GXHA 3FECA 2GU2A 4OADA 1DE4C 1FNOA 2I00A 3FRMA 5FVJA 3FEDA 4H6UA 4JLYA 2KCWA 1ZG7A 1QSRA 2YNEA 3I3GA 5THWA 4MY0A 2P6GA 4LX9A 2PJ8A 4R87A 1YX0A 4P4IA 4B13A 5HVGA 2PRBA 2PIYA 4JWPA 4KVME 5F09A 2GIVA 3JRUA 4U5YA 3B3WA 1I1DA 4P4EA 3R9EA 5LYLA 4AXVA 2ZEOA
chains in the Genus database with same CATH topology
1Z4RA 2ATRA 4MFPA 1L0CA 1ON0A 3IWEA 4MFQA 4UWIA 2WSAA 2PQ8A 3LD2A 2DPSA 5F46A 2CXAA 2P6EA 2B58A 3C26A 3D8PA 5F49A 1KUVA 4UFWA 4KSAA 3DSBA 5AG5A 5C82A 1MJ9A 2REFA 2JEVA 4FD7A 1Y9KA 1LRZA 1IIDA 1GHEA 3RYOA 4HNXB 5H84A 4AVCA 4HNYB 4NSQA 2AE6A 3D3SA 2Q0YA 2H5MA 4IF5A 3OWCA 1Q2YA 2Q4YA 3R9FA 1TIQA 1YVKA 4B11A 1Z4EA 4KUBA 4CAXA 4RS2A 5AG7A 2FL4A 3IU1A 1N71A 2ZW5A 2Z3NA 4A31A 3TFYA 2PR8A 1J4JA 3SXNA 3FYNA 1PU9A 1PUAA 1UFHA 5AG6A 3CXSA 4H6ZA 1XMTA 5EC4A 2Q44A 2VXKA 4QC6A 3T90A 4B5PB 2B4DB 2QMLA 2Q04A 3DR8A 3TO9A 4UFXA 4RI1A 1QSMA 3GYAA 4R3KA 4PSXA 4EVYA 4ZBGA 4CGLA 1IYKA 2WUUA 2FT0A 1XEBA 3DDDA 1S7LA 1RO5A 3EY5A 3NE7A 4UFVA 4XNHC 2ZPAA 4CAVA 2Z3OA 4MBUA 4C68A 1B6BA 1Y9WA 4XPKA 5JQ4A 2B4BA 2BEIA 3I9SA 4C7IA 4QB9A 2YGWA 3K9UA 4UCNA 4CYQA 1YREA 4KOSA 1B87A 3W91A 1MJBA 4I49A 1QSNA 2VQYA 4CRZB 2B3VA 1I12A 4YGOA 1Y7RA 4KS9A 2OU2A 2NMTA 2VBQA 1IB1E 4XNHB 3ZZIA 2B3UA 1CM0A 2D4PA 1NSLA 4UWJA 1QSTA 4MFZA 4MFKA 1P0HA 4YRHA 4A95A 3WR7A 4K30A 4ORFA 5IX3A 2YNCA 4BBHA 3EXNA 1IYLA 5CNPA 3MGDA 4AG7A 4PSWA 2Z3MA 2Z3KA 3F0AA 1BOBA 1QSOA 4YFJA 4U9YA 4U9ZA 4NEXA 2VZYA 1Q2DA 2EVNA 4CAFA 2IL4A 2B5GA 1KZFA 2BL1A 2FIAA 4CYOA 1NE9A 3TO7A 1CJWA 2FE7A 2CNMA 2VI7A 4B5OA 1I21A 5E96A 1S7FA 4R9MA 4ZGYB 4C7HA 2YNCC 2DPTA 2Z3LA 2D4OA 5AGEA 1S5KA 1M44A 2X7BA 4E2AA 3R9GA 3PZJA 4C2XA 1WWZA 1P4NA 2G3TA 3B8GA 5GCNA 1Z9UA 5KTCA 4CRYB 3BLNA 2DXQA 2JDDA 4A30A 4X5KA 4KOXA 4C2YA 2FXFA 2C27A 4KVXA 3GY9A 4AVAA 2O28A 2OB0A 3FB3A 1XE4A 4MHDA 4KOTA 1S7KA 4Q36A 2FIWA 2J8NA 2P6FA 3E0KA 2FCKA 4F6AA 1NMTA 4BMHA 4UCPA 4KLWA 2HQYA 4M3SA 5G20A 5J8FA 2Z11A 5G21A 5H86A 3JTKA 4F0YA 2ARHA 1M1DA 2RC4A 4PK2A 5J8CA 3IWGA 2FSRA 1XIXA 1YK3A 2AJ6A 1M4IA 2EUIA 4B10A 1IICA 4QUSA 1V0CA 4KLVA 2F5IA 5F48A 5KTAA 3CXQA 4FD5A 4F0XA 3F5BA 4UCMA 3SXOA 2QIRA 4A33A 2BSWA 4UA3A 3TT2A 1Q2CA 4XPDC 4KORA 4MJ8A 1KUYA 4PK3A 5EBVA 3VWDA 1M4GA 2J8RA 4UBRA 4Y49C 4JJXA 4II9A 2Z10A 1R57A 2JDCA 2ZXVA 5HH1A 4MFLA 4AB7A 4PV6A 3TTHA 3S6FA 4L89A 2P0WA 3R1KA 5IV0A 1OZPA 2WPXA 2K5TA 5G22A 3D2PA 4KOVA 1YVOA 4NF1A 3ZJ0A 2QECA 3P2FA 4KZTA 4KVOE 2OZGA 3EC4A 3JUWA 2GANA 4Y49B 4CAWA 3IGRA 2GE3A 1U6MA 2CY2A 4JD6A 3A9LA 3FBUA 4FD6A 1SQHA 4M85A 2ZW6A 4L8AA 4E8OA 4AG9A 5HMNA 2CNSA 3G8WA 4QVTA 2J8MA 4NCZA 3CXPA 1K4JA 3G3SA 3D2MA 4ONUA 2R7HA 4Q38A 5IB0A 2JLMA 4CGPA 2Y0MA 4HKFA 2VZZA 4KOYA 5BWAB 5ISVA 4HNWB 3PGPA 4JXRA 2A4NA 3TE4A 2ZW7A 3DR6A 4B5PA 3BJ8A 4B12A 2B4DA 3QAHA 3W6XA 1S7NA 2OZUA 3FIXA 3TCVA 3S6HA 2R1IA 4CAEA 4CS0B 3W6SA 4R57A 3T9YA 1S60A 3FXTA 4A32A 2B5GB 1VKCA 5A27A 3F8KA 4R3LA 4A2ZA 4LUAA 1YLEA 1FY7A 1MJAA 5F47A 1M4DA 4MFJA 4B14A 4CYNA 2G0BA 2I79A 1KUXA 4GS4A 3N7ZA 2Q4VA 4KSFA 3TOBA 5C88A 4J3GA 4H89A 1MK4A 2PDOA 3EFAA 3H4QA 5A28A 2OH1A 4MI4A 3JVNA 2YNDA 2HUZA 4DNCA 2BUEA 4MY3A 4E0AA 2G3AA 2R98A 2REEA 2Z0ZA 4QBJA 2CNTA 3S6KA 1WK4A 2OZHA 3SHPA 4CYPA 5AG4A 3GKRA 3S6GA 3BJ7A 2HV2A 3VWEA 1XF8A 3FNCA 2PR1A 2R8VA 3IU2A 2Q7BA 3PP9A 3UY5A 5DWNA 5JPHA 1S3ZA 4FD4A 3TOAA 3QB8A 1BO4A 3DNSA 5KTDA 4KUAA 2WPWA 4JXQA 4IUSA 3V8IA 4CGMA 3R96A 3TO6A 1VHSA 2PC1A 1YGHA 4OLLA 5I0CA 1YR0A 4NXYA 3KKWA 4CGNA 3R95A 4CGOA 4XPLA 2FS5A 3H5ZA 1RXTA 5G1ZA 4OAEA 4AVBA 4C2ZA 3P2HA 2PSWA 4KOUA 3LODA 3EO4A 2ZW4A 4XPDB 5DWMA 1ZO0A 4KOWA 2Z3PA 2VEZA 4OADA 2I00A 3FRMA 5FVJA 4H6UA 4JLYA 2KCWA 1QSRA 2YNEA 3I3GA 4MY0A 2P6GA 4LX9A 4R87A 1YX0A 4B13A 2PRBA 4JWPA 4KVME 2GIVA 4U5YA 1I1DA 3R9EA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1Z4R A;  2ATR A;  1L0C A;  1ON0 A;  4UWI A;  2PQ8 A;  3LD2 A;  5F46 A;  2P6E A;  2B58 A;  3C26 A;  3D8P A;  5F49 A;  1KUV A;  3DSB A;  5C82 A;  1MJ9 A;  2REF A;  2JEV A;  4FD7 A;  1Y9K A;  1LRZ A;  1IID A;  1GHE A;  3RYO A;  4HNX B;  5H84 A;  4AVC A;  4HNY B;  4NSQ A;  2AE6 A;  3D3S A;  2Q0Y A;  2H5M A;  4IF5 A;  3OWC A;  1Q2Y A;  2Q4Y A;  3R9F A;  1TIQ A;  1YVK A;  1Z4E A;  4KUB A;  4CAX A;  4RS2 A;  2FL4 A;  1N71 A;  2ZW5 A;  3TFY A;  2PR8 A;  1J4J A;  3SXN A;  3FYN A;  1PU9 A;  1PUA A;  1UFH A;  3CXS A;  4H6Z A;  1XMT A;  5EC4 A;  2Q44 A;  2VXK A;  4QC6 A;  3T90 A;  4B5P B;  2B4D B;  2QML A;  2Q04 A;  3DR8 A;  3TO9 A;  4RI1 A;  1QSM A;  3GYA A;  4R3K A;  4PSX A;  4EVY A;  4ZBG A;  1IYK A;  2FT0 A;  1XEB A;  3DDD A;  1S7L A;  1RO5 A;  3EY5 A;  3NE7 A;  4XNH C;  2ZPA A;  4CAV A;  4MBU A;  1B6B A;  1Y9W A;  4XPK A;  5JQ4 A;  2B4B A;  2BEI A;  3I9S A;  4QB9 A;  3K9U A;  1YRE A;  4KOS A;  1B87 A;  3W91 A;  1MJB A;  4I49 A;  1QSN A;  2VQY A;  4CRZ B;  2B3V A;  1I12 A;  4YGO A;  1Y7R A;  2OU2 A;  2NMT A;  2VBQ A;  1IB1 E;  4XNH B;  3ZZI A;  2B3U A;  1CM0 A;  2D4P A;  1NSL A;  4UWJ A;  1QST A;  4YRH A;  1P0H A;  3WR7 A;  4K30 A;  4ORF A;  5IX3 A;  3EXN A;  1IYL A;  5CNP A;  3MGD A;  4AG7 A;  4PSW A;  3F0A A;  1BOB A;  1QSO A;  4YFJ A;  4U9Y A;  4U9Z A;  4NEX A;  2VZY A;  1Q2D A;  2EVN A;  2IL4 A;  2B5G A;  1KZF A;  2BL1 A;  2FIA A;  1NE9 A;  3TO7 A;  1CJW A;  2FE7 A;  2CNM A;  2VI7 A;  4B5O A;  1I21 A;  5E96 A;  1S7F A;  4R9M A;  2D4O A;  1S5K A;  1M44 A;  2X7B A;  4E2A A;  3R9G A;  3PZJ A;  1WWZ A;  1P4N A;  2G3T A;  3B8G A;  5GCN A;  1Z9U A;  5KTC A;  4CRY B;  3BLN A;  2DXQ A;  2JDD A;  4X5K A;  4KOX A;  2FXF A;  2C27 A;  4KVX A;  3GY9 A;  4AVA A;  2O28 A;  2OB0 A;  3FB3 A;  1XE4 A;  4MHD A;  4KOT A;  1S7K A;  2FIW A;  2J8N A;  2P6F A;  3E0K A;  2FCK A;  4F6A A;  1NMT A;  4BMH A;  4KLW A;  2HQY A;  4M3S A;  5J8F A;  2Z11 A;  5H86 A;  4F0Y A;  2ARH A;  1M1D A;  2RC4 A;  4PK2 A;  5J8C A;  3IWG A;  2FSR A;  1XIX A;  1YK3 A;  2AJ6 A;  1M4I A;  2EUI A;  1IIC A;  4QUS A;  1V0C A;  4KLV A;  2F5I A;  5F48 A;  5KTA A;  3CXQ A;  4FD5 A;  3F5B A;  3SXO A;  2QIR A;  2BSW A;  4UA3 A;  3TT2 A;  1Q2C A;  4XPD C;  4KOR A;  4MJ8 A;  1KUY A;  4PK3 A;  5EBV A;  3VWD A;  1M4G A;  2J8R A;  4UBR A;  4Y49 C;  4JJX A;  4II9 A;  2Z10 A;  1R57 A;  2JDC A;  2ZXV A;  5HH1 A;  4AB7 A;  4PV6 A;  3TTH A;  3S6F A;  4L89 A;  2P0W A;  3R1K A;  5IV0 A;  1OZP A;  2WPX A;  2K5T A;  3D2P A;  4KOV A;  1YVO A;  4NF1 A;  3ZJ0 A;  2QEC A;  3P2F A;  4KZT A;  4KVO E;  2OZG A;  3EC4 A;  3JUW A;  2GAN A;  4Y49 B;  4CAW A;  3IGR A;  2GE3 A;  1U6M A;  2CY2 A;  4JD6 A;  3FBU A;  4FD6 A;  1SQH A;  4M85 A;  2ZW6 A;  4L8A A;  4E8O A;  4AG9 A;  5HMN A;  2CNS A;  3G8W A;  4QVT A;  2J8M A;  4NCZ A;  3CXP A;  1K4J A;  3G3S A;  3D2M A;  4ONU A;  2R7H A;  5IB0 A;  2JLM A;  2Y0M A;  4HKF A;  2VZZ A;  4KOY A;  5ISV A;  4HNW B;  3PGP A;  4JXR A;  2A4N A;  3TE4 A;  2ZW7 A;  3DR6 A;  4B5P A;  3BJ8 A;  2B4D A;  3QAH A;  3W6X A;  1S7N A;  2OZU A;  3FIX A;  3TCV A;  3S6H A;  2R1I A;  4CS0 B;  3W6S A;  4R57 A;  3T9Y A;  1S60 A;  3FXT A;  2B5G B;  1VKC A;  3F8K A;  4R3L A;  4LUA A;  1YLE A;  1FY7 A;  1MJA A;  5F47 A;  1M4D A;  2G0B A;  2I79 A;  1KUX A;  4GS4 A;  3N7Z A;  2Q4V A;  3TOB A;  5C88 A;  4J3G A;  4H89 A;  1MK4 A;  2PDO A;  3EFA A;  3H4Q A;  2OH1 A;  4MI4 A;  3JVN A;  2HUZ A;  4DNC A;  2BUE A;  4MY3 A;  4E0A A;  2G3A A;  2R98 A;  2REE A;  2Z0Z A;  4QBJ A;  2CNT A;  3S6K A;  1WK4 A;  2OZH A;  3SHP A;  3GKR A;  3S6G A;  3BJ7 A;  2HV2 A;  3VWE A;  1XF8 A;  3FNC A;  2PR1 A;  2R8V A;  2Q7B A;  3UY5 A;  3PP9 A;  5DWN A;  5JPH A;  1S3Z A;  4FD4 A;  3TOA A;  3QB8 A;  1BO4 A;  3DNS A;  5KTD A;  4KUA A;  2WPW A;  4JXQ A;  4IUS A;  3V8I A;  3R96 A;  3TO6 A;  1VHS A;  2PC1 A;  1YGH A;  4OLL A;  5I0C A;  1YR0 A;  4NXY A;  3KKW A;  3R95 A;  4XPL A;  2FS5 A;  1RXT A;  4OAE A;  4AVB A;  3P2H A;  2PSW A;  4KOU A;  3LOD A;  3EO4 A;  2ZW4 A;  4XPD B;  5DWM A;  4KOW A;  2VEZ A;  4OAD A;  2I00 A;  3FRM A;  5FVJ A;  4H6U A;  4JLY A;  2KCW A;  1QSR A;  3I3G A;  4MY0 A;  2P6G A;  4LX9 A;  4R87 A;  1YX0 A;  2PRB A;  4JWP A;  4KVM E;  2GIV A;  4U5Y A;  1I1D A;  3R9E A; 
#chains in the Genus database with same CATH topology
 2GRE A;  1Z4R A;  2ATR A;  4MFP A;  1L0C A;  1ON0 A;  3IWE A;  3CT9 A;  4MFQ A;  1VHE A;  2PJ3 A;  4X3R A;  4UWI A;  2WSA A;  4PXC A;  1OBR A;  3RZA A;  4NJQ A;  2PQ8 A;  3KL9 A;  4M6H A;  3LD2 A;  2DPS A;  3FJU A;  5F46 A;  2CXA A;  2P6E A;  2B58 A;  3NH5 A;  3C26 A;  3D8P A;  3QAY A;  5F49 A;  1KUV A;  4UFW A;  2V77 A;  4MHP A;  4KSA A;  3DSB A;  5AG5 A;  5LYD A;  1MJ9 A;  5C82 A;  2REF A;  4LQG A;  4ZY0 A;  2JEV A;  4P44 A;  4FD7 A;  2EK9 A;  2C6C A;  1Y9K A;  4ZY2 A;  4RN7 A;  1LRZ A;  1IID A;  1GHE A;  2VL1 A;  3RYO A;  4HNX B;  5H84 A;  1Z8T A;  4HNY B;  3KI9 A;  4AVC A;  4NSQ A;  2AFX A;  2AE6 A;  3D3S A;  2PJA A;  1F57 A;  3GIU A;  3SI2 A;  2O53 A;  2Q0Y A;  2H5M A;  4IF5 A;  3OWC A;  2JEW A;  1Q2Y A;  2Q4Y A;  3R9F A;  4IAV A;  1ZLH A;  4FAI A;  1TIQ A;  1YVK A;  4B11 A;  1Z4E A;  3PFE A;  4KUB A;  4CAX A;  4RS2 A;  5AG7 A;  2FL4 A;  3I1U A;  1AUG A;  3IU1 A;  2Q51 A;  3B3T A;  1N71 A;  3HUV A;  4MMO A;  2ZW5 A;  2Z3N A;  4A31 A;  3TFY A;  2PR8 A;  2PJ6 A;  1J4J A;  3SXN A;  3FYN A;  3D66 A;  1PU9 A;  1PUA A;  4MXU A;  1UFH A;  5AG6 A;  3CXS A;  1XFO A;  3FVL A;  2PJ4 A;  3MRU A;  2ZEG A;  2C6G A;  1LAP A;  2J9A A;  4H6Z A;  1XMT A;  1X10 A;  5EC4 A;  4MHY A;  2Q44 A;  2VXK A;  4QC6 A;  3FH4 A;  3K2K A;  4X2T A;  3T90 A;  4B5P B;  2B4D B;  3D7G A;  1LAN A;  2QML A;  2G9D A;  2Q04 A;  3DR8 A;  3TO9 A;  4UFX A;  4OC5 A;  4RI1 A;  1HDQ A;  1QSM A;  2ZEN A;  3GYA A;  4R3K A;  4PSX A;  4EVY A;  3FF3 A;  3FMC A;  4ZBG A;  4CGL A;  1XBU A;  5LRG A;  1IYK A;  2WUU A;  1EE3 P;  2OOT A;  2FT0 A;  2PJ1 A;  4EWT A;  1XEB A;  3DDD A;  4F8Z A;  1S7L A;  4NGQ A;  3V7Z A;  2ZEL A;  3BI1 A;  1RO5 A;  3EY5 A;  1CPX A;  3LWU A;  3PFO A;  4UEE A;  5JM6 A;  3B3V A;  3NE7 A;  2PVV A;  4UFV A;  4XNH C;  2ZPA A;  4CAV A;  1KWM A;  4UIA A;  2XEG A;  2Z3O A;  2AFO A;  4MBU A;  3PEI A;  1B6B A;  1Y9W A;  3IO1 A;  4OIW A;  4XPK A;  4C68 A;  4RUH A;  5JQ4 A;  4TWE A;  2B4B A;  2BEI A;  3I9S A;  4C7I A;  4QB9 A;  2YGW A;  3K9U A;  4UCN A;  2JBK A;  1YRE A;  4CYQ A;  4KOS A;  1B87 A;  4YWY A;  3W91 A;  1MJB A;  1PYT B;  2I3C A;  1YSJ A;  4I49 A;  4M6G A;  1IU8 A;  1QSN A;  2C6P A;  4YU9 A;  2VQY A;  2ABZ A;  4CRZ B;  3RNZ A;  4HPS A;  2B3V A;  4IK2 A;  1I12 A;  4YGO A;  1Y7R A;  4KS9 A;  2OU2 A;  4JZ0 A;  2Q7S A;  2NMT A;  2VBQ A;  1IB1 E;  3N5F A;  4XNH B;  3ZZI A;  2B3U A;  1CM0 A;  2D4P A;  1NSL A;  1IOI A;  1DTD A;  2OR4 A;  3NE8 A;  4R7M A;  2DF5 A;  4UWJ A;  4P45 A;  1QST A;  1TKF A;  4NJR A;  2PJ9 A;  4MFZ A;  4MFK A;  1P0H A;  4YRH A;  2GLF A;  4A95 A;  1F2P A;  1LOK A;  4MCS A;  4MRI A;  3WR7 A;  5ELY A;  4K30 A;  3KAS A;  4ORF A;  2RFH A;  5IX3 A;  1JWQ A;  2ANP A;  1Z8W A;  2YNC A;  4BBH A;  4R6T A;  4WJB A;  3EXN A;  3IFE A;  1IYL A;  5CNP A;  3MGD A;  4AG7 A;  4PSW A;  2Z3M A;  2Z3K A;  3F0A A;  4ZX9 A;  1BOB A;  4NGS A;  1QSO A;  4YFJ A;  4U9Y A;  2F8H A;  4U9Z A;  6CPA A;  4NEX A;  2VZY A;  1Q2D A;  1VIX A;  2QYV A;  2EVN A;  2V8V A;  2IL4 A;  4UEZ A;  4CAF A;  2B5G A;  3TC8 A;  1KZF A;  2BL1 A;  2FIA A;  4CYO A;  1NSA A;  1NE9 A;  3B3S A;  3PBE A;  3TO7 A;  3S9N A;  1CJW A;  1LFW A;  2FE7 A;  2CNM A;  2VI7 A;  3D7H A;  4B5O A;  1Z5R A;  4W9Y A;  1I21 A;  2IMO A;  3B3C A;  1S7F A;  4R9M A;  5E96 A;  4ZGY B;  4C7H A;  2YNC C;  2DPT A;  2Z3L A;  3PB9 X;  2D4O A;  3H8F A;  5AGE A;  1S5K A;  2AFM A;  1M44 A;  3S9L A;  4JYW A;  2X7B A;  2PJ2 A;  4E2A A;  1R43 A;  3R9G A;  3PZJ A;  4C2X A;  1TF9 A;  1P4N A;  1WWZ A;  2G3T A;  2AFW A;  2PE3 A;  4A38 A;  3B8G A;  1ELL P;  2XEI A;  2PJC A;  5GCN A;  4BD9 A;  1Z9U A;  5KTC A;  4CRY B;  5LRJ A;  3BLN A;  2DXQ A;  2JDD A;  3SI1 A;  3CDX A;  3H8E A;  4A30 A;  1CPS A;  4F9U A;  4X5K A;  3HLP A;  1GYT A;  3GUX A;  4KOX A;  3SJF A;  4C2Y A;  2FXF A;  3SJE A;  1UWY A;  4CPA A;  1RTQ A;  4NGR A;  3RBU A;  2C27 A;  4MCP A;  2CF4 A;  4KVX A;  3GY9 A;  4AVA A;  2O28 A;  3BI0 A;  1CP6 A;  2OB0 A;  1TXR A;  3FB3 A;  4OC3 A;  4ONW A;  1XE4 A;  4MHD A;  4KOT A;  1S7K A;  1LCP A;  2FIW A;  3IJ3 A;  1QQ9 A;  1ARL A;  4Q36 A;  2HB6 A;  3KQX A;  2J8N A;  2P6F A;  4A39 A;  3E0K A;  2FCK A;  4F6A A;  1YQE A;  4OC1 A;  4K3N A;  1Z2L A;  1HEE A;  2V8G A;  4O23 A;  1NMT A;  4BMH A;  4UCP A;  5HVF A;  4P4D A;  4KLW A;  1BAV A;  2HQY A;  2QJ8 A;  2CTB A;  3D67 A;  4M3S A;  5G20 A;  4F9V A;  3FX6 A;  3D7F A;  3QNV A;  5LRK A;  5J8F A;  2Z11 A;  3IIB A;  3PB6 X;  5G21 A;  3T8W A;  5H86 A;  2EBJ A;  3JTK A;  1M4L A;  4F0Y A;  5K8N A;  2ARH A;  2ZOF A;  5EMI A;  1M1D A;  2RC4 A;  4PK2 A;  3PBB A;  5J8C A;  2RB7 A;  2O4H A;  4H2K A;  3MN8 A;  2ZED A;  3IWG A;  2FSR A;  1XIX A;  3VAT A;  1YK3 A;  2AJ6 A;  1M4I A;  2EUI A;  2GFQ A;  4B10 A;  3VH9 A;  1IIC A;  4QUS A;  1LAM A;  1V0C A;  4ZX8 A;  5LYF A;  2C1C A;  4KLV A;  2F5I A;  5F48 A;  3WC5 A;  3CXQ A;  4FD5 A;  5KTA A;  4F0X A;  3WT4 A;  3F5B A;  5HXD A;  4UIB A;  2ZEH A;  2IQ6 A;  4UCM A;  3VAR A;  1YME A;  3KQZ A;  3S9M A;  3D4U A;  4LQ6 A;  3KHZ A;  3SXO A;  1Y0R A;  2QIR A;  4A33 A;  3V38 A;  2BSW A;  3PB8 X;  4UA3 A;  3TT2 A;  1Q2C A;  4X8I A;  4XPD C;  3BXM A;  4KOR A;  5K8P A;  1YLO A;  2AFU A;  1CX8 A;  1CP7 A;  2WYR A;  1TKJ A;  4MJ8 A;  5D29 A;  1KUY A;  4PK3 A;  5EBV A;  2HC9 A;  3VWD A;  1M4G A;  2J8R A;  4UBR A;  4Y49 C;  4JJX A;  4II9 A;  4UEF A;  2Z10 A;  1R57 A;  2JDC A;  4ZYQ A;  2ZXV A;  5HH1 A;  4MFL A;  4AB7 A;  1Y7E A;  3B35 A;  1F2O A;  4PV6 A;  3CZX A;  3S6F A;  3TTH A;  4L89 A;  5CBM A;  2P0W A;  3R1K A;  5IV0 A;  1OZP A;  2AFZ A;  2WPX A;  2K5T A;  5G22 A;  2PJ5 A;  5DS0 A;  3D2P A;  4KOV A;  1YVO A;  4NF1 A;  3ZJ0 A;  4FBE A;  4WWV A;  2QEC A;  2DEA A;  2AFS A;  1R3N A;  1TF8 A;  3BHX A;  3P2F A;  4NGT A;  4KZT A;  4NGP A;  4IHM A;  2ZEM A;  1PCA A;  4KVO E;  3CPX A;  3GLJ A;  2OZG A;  3WAB A;  3EC4 A;  3JUW A;  2GAN A;  1HDU A;  4Y49 B;  4CAW A;  2CTC A;  3IGR A;  1YW4 A;  2GE3 A;  1XMB A;  3NFZ A;  1U6M A;  3RO0 A;  1VHO A;  2CY2 A;  1Y0Y A;  4JD6 A;  1AMP A;  3A9L A;  3FBU A;  3KHX A;  5D8N A;  2ODF A;  3SJG A;  1CBX A;  5JH9 A;  4FD6 A;  4MCR A;  3KR5 A;  4OC4 A;  4Q7A A;  5K8M A;  4B6Z A;  1ELM P;  3TX8 A;  2XEF A;  1SQH A;  4M85 A;  2ZW6 A;  4L8A A;  4E8O A;  4AG9 A;  5HMN A;  2CNS A;  3G8W A;  4QVT A;  2J8M A;  4KSI A;  4NCZ A;  3B7I A;  4R8F A;  2POK A;  4PXD A;  3CXP A;  1K4J A;  3G3S A;  3D2M A;  4ONU A;  1IGB A;  2IJZ A;  4PXE A;  5JGF A;  3K9T A;  2R7H A;  4Q38 A;  2PJ0 A;  3DGV A;  5IB0 A;  2JLM A;  4CGP A;  2Y0M A;  4HKF A;  2VZZ A;  4KOY A;  5BWA B;  2PVW A;  5ISV A;  4HNW B;  3PGP A;  4JXR A;  2NYQ A;  2A4N A;  3CPA A;  3PB7 X;  3B2Y A;  3TE4 A;  2ZW7 A;  3DR6 A;  1H8L A;  2JBJ A;  4P6Y A;  3BJ8 A;  4B5P A;  4B12 A;  2B4D A;  3QAH A;  5I4M A;  2PCU A;  3W6X A;  8CPA A;  1S7N A;  2OZU A;  2XEJ A;  3NH8 A;  4EME A;  1BPN A;  3FIX A;  3TCV A;  3S6H A;  2R1I A;  2GLJ A;  4CAE A;  2Q4Z A;  3W6S A;  4CS0 B;  4M6I A;  4R57 A;  3IC1 A;  3T9Y A;  5IB9 A;  1YW6 A;  4Z65 A;  1S60 A;  3FXT A;  3WC7 A;  7CPA A;  4A32 A;  1IOF A;  3NH4 A;  4G1P A;  2B5G B;  1VKC A;  4FUU A;  2FVG A;  2PJ7 A;  2WZN A;  4OC2 A;  2Q43 A;  4MHZ A;  4A37 A;  2PJB A;  5A27 A;  3F8K A;  4OID A;  4R3L A;  4A2Z A;  1QMU A;  1ZLI A;  4LUA A;  1YLE A;  1FY7 A;  4OC0 A;  1MJA A;  4OP4 A;  5F47 A;  1M4D A;  1X12 A;  4MFJ A;  3D68 A;  4B14 A;  4CYN A;  4ZI6 A;  2G0B A;  2I79 A;  1XOV A;  3H8G A;  1KUX A;  4GS4 A;  3N7Z A;  1XRY A;  1A2Z A;  4MHN A;  3IWW A;  3FEE A;  4EFD A;  1IY7 A;  2Q4V A;  4A94 A;  3DLJ A;  4KSF A;  4NGM A;  3TOB A;  5C88 A;  4J3G A;  4H89 A;  1CG2 A;  1MK4 A;  3NA6 A;  3RAM A;  4P4F A;  1Q7L A;  4DYO A;  2PDO A;  3EFA A;  4MCQ A;  3ISZ A;  3KZW A;  2PRQ A;  4OKO A;  4P4J A;  2CIJ A;  3H4Q A;  5A28 A;  2OH1 A;  4NGN A;  1ARM A;  3JVN A;  4MI4 A;  1FT7 A;  1Z8L A;  1BLL E;  5HVH A;  2YND A;  2HUZ A;  4DNC A;  2BUE A;  4MY3 A;  4E0A A;  2G3A A;  2R98 A;  2REE A;  2Z0Z A;  1TKH A;  2CNT A;  4QBJ A;  3S6K A;  1WK4 A;  2OZH A;  3SHP A;  2ZOG A;  4GM5 A;  4CYP A;  1ZG8 A;  3GKR A;  5AG4 A;  3S6G A;  2V8H A;  3BJ7 A;  3L2N A;  2HV2 A;  4R76 A;  3PRT A;  4TNU A;  3VWE A;  4DJL A;  4ZY1 A;  1XF8 A;  3FNC A;  2PR1 A;  2R8V A;  3IU2 A;  5CPA A;  3PP9 A;  4PQA A;  2Q7B A;  3UY5 A;  5DWN A;  5JPH A;  1S3Z A;  4FD4 A;  1JQG A;  2V8D A;  3TOA A;  3SJX A;  3QB8 A;  1BO4 A;  5J1Q A;  2BCO A;  1VGY A;  2EO8 A;  3DNS A;  4KUA A;  2WPW A;  2F7V A;  5KTD A;  4JXQ A;  4IUS A;  2ZEP A;  3V8I A;  4CGM A;  3ISX A;  3R96 A;  3TO6 A;  1VHS A;  2PC1 A;  2BO9 A;  1ZG9 A;  4PPZ A;  3LAC A;  2EWB A;  1YGH A;  3GB0 A;  3KR4 A;  3PB4 X;  4OLL A;  4P10 A;  5I0C A;  1YR0 A;  4NXY A;  3LMS A;  2PIZ A;  3KKW A;  4CGN A;  3R95 A;  4CGO A;  4XPL A;  2FS5 A;  3H5Z A;  1RXT A;  4OME A;  5G1Z A;  3WC6 A;  2ZEF A;  2EK8 A;  1Z8X A;  1AYE A;  2QVP A;  4OAE A;  4AVB A;  4C2Z A;  1BPM A;  3P2H A;  4P4B A;  2NSM A;  4PXB A;  3IEH A;  4UF4 A;  3SI0 A;  2PSW A;  4KOU A;  4DUK A;  3LOD A;  2ZEE A;  3EO4 A;  4FWU A;  4NFR A;  1XJO A;  3D7D A;  5LYI A;  2ZW4 A;  4BIN A;  5K8O A;  4XPD B;  2BOA A;  3KGQ A;  1ZO0 A;  4KOW A;  5DWM A;  2Z3P A;  2VEZ A;  4GXH A;  3FEC A;  2GU2 A;  4OAD A;  1DE4 C;  1FNO A;  2I00 A;  3FRM A;  5FVJ A;  3FED A;  4H6U A;  4JLY A;  2KCW A;  1ZG7 A;  1QSR A;  2YNE A;  3I3G A;  5THW A;  4MY0 A;  2P6G A;  4LX9 A;  2PJ8 A;  4R87 A;  1YX0 A;  4P4I A;  4B13 A;  5HVG A;  2PRB A;  2PIY A;  4JWP A;  4KVM E;  5F09 A;  2GIV A;  3JRU A;  4U5Y A;  3B3W A;  1I1D A;  4P4E A;  3R9E A;  5LYL A;  4AXV A;  2ZEO A; 
#chains in the Genus database with same CATH homology
 1Z4R A;  2ATR A;  4MFP A;  1L0C A;  1ON0 A;  3IWE A;  4MFQ A;  4UWI A;  2WSA A;  2PQ8 A;  3LD2 A;  2DPS A;  5F46 A;  2CXA A;  2P6E A;  2B58 A;  3C26 A;  3D8P A;  5F49 A;  1KUV A;  4UFW A;  4KSA A;  3DSB A;  5AG5 A;  5C82 A;  1MJ9 A;  2REF A;  2JEV A;  4FD7 A;  1Y9K A;  1LRZ A;  1IID A;  1GHE A;  3RYO A;  4HNX B;  5H84 A;  4AVC A;  4HNY B;  4NSQ A;  2AE6 A;  3D3S A;  2Q0Y A;  2H5M A;  4IF5 A;  3OWC A;  1Q2Y A;  2Q4Y A;  3R9F A;  1TIQ A;  1YVK A;  4B11 A;  1Z4E A;  4KUB A;  4CAX A;  4RS2 A;  5AG7 A;  2FL4 A;  3IU1 A;  1N71 A;  2ZW5 A;  2Z3N A;  4A31 A;  3TFY A;  2PR8 A;  1J4J A;  3SXN A;  3FYN A;  1PU9 A;  1PUA A;  1UFH A;  5AG6 A;  3CXS A;  4H6Z A;  1XMT A;  5EC4 A;  2Q44 A;  2VXK A;  4QC6 A;  3T90 A;  4B5P B;  2B4D B;  2QML A;  2Q04 A;  3DR8 A;  3TO9 A;  4UFX A;  4RI1 A;  1QSM A;  3GYA A;  4R3K A;  4PSX A;  4EVY A;  4ZBG A;  4CGL A;  1IYK A;  2WUU A;  2FT0 A;  1XEB A;  3DDD A;  1S7L A;  1RO5 A;  3EY5 A;  3NE7 A;  4UFV A;  4XNH C;  2ZPA A;  4CAV A;  2Z3O A;  4MBU A;  4C68 A;  1B6B A;  1Y9W A;  4XPK A;  5JQ4 A;  2B4B A;  2BEI A;  3I9S A;  4C7I A;  4QB9 A;  2YGW A;  3K9U A;  4UCN A;  4CYQ A;  1YRE A;  4KOS A;  1B87 A;  3W91 A;  1MJB A;  4I49 A;  1QSN A;  2VQY A;  4CRZ B;  2B3V A;  1I12 A;  4YGO A;  1Y7R A;  4KS9 A;  2OU2 A;  2NMT A;  2VBQ A;  1IB1 E;  4XNH B;  3ZZI A;  2B3U A;  1CM0 A;  2D4P A;  1NSL A;  4UWJ A;  1QST A;  4MFZ A;  4MFK A;  1P0H A;  4YRH A;  4A95 A;  3WR7 A;  4K30 A;  4ORF A;  5IX3 A;  2YNC A;  4BBH A;  3EXN A;  1IYL A;  5CNP A;  3MGD A;  4AG7 A;  4PSW A;  2Z3M A;  2Z3K A;  3F0A A;  1BOB A;  1QSO A;  4YFJ A;  4U9Y A;  4U9Z A;  4NEX A;  2VZY A;  1Q2D A;  2EVN A;  4CAF A;  2IL4 A;  2B5G A;  1KZF A;  2BL1 A;  2FIA A;  4CYO A;  1NE9 A;  3TO7 A;  1CJW A;  2FE7 A;  2CNM A;  2VI7 A;  4B5O A;  1I21 A;  5E96 A;  1S7F A;  4R9M A;  4ZGY B;  4C7H A;  2YNC C;  2DPT A;  2Z3L A;  2D4O A;  5AGE A;  1S5K A;  1M44 A;  2X7B A;  4E2A A;  3R9G A;  3PZJ A;  4C2X A;  1WWZ A;  1P4N A;  2G3T A;  3B8G A;  5GCN A;  1Z9U A;  5KTC A;  4CRY B;  3BLN A;  2DXQ A;  2JDD A;  4A30 A;  4X5K A;  4KOX A;  4C2Y A;  2FXF A;  2C27 A;  4KVX A;  3GY9 A;  4AVA A;  2O28 A;  2OB0 A;  3FB3 A;  1XE4 A;  4MHD A;  4KOT A;  1S7K A;  4Q36 A;  2FIW A;  2J8N A;  2P6F A;  3E0K A;  2FCK A;  4F6A A;  1NMT A;  4BMH A;  4UCP A;  4KLW A;  2HQY A;  4M3S A;  5G20 A;  5J8F A;  2Z11 A;  5G21 A;  5H86 A;  3JTK A;  4F0Y A;  2ARH A;  1M1D A;  2RC4 A;  4PK2 A;  5J8C A;  3IWG A;  2FSR A;  1XIX A;  1YK3 A;  2AJ6 A;  1M4I A;  2EUI A;  4B10 A;  1IIC A;  4QUS A;  1V0C A;  4KLV A;  2F5I A;  5F48 A;  5KTA A;  3CXQ A;  4FD5 A;  4F0X A;  3F5B A;  4UCM A;  3SXO A;  2QIR A;  4A33 A;  2BSW A;  4UA3 A;  3TT2 A;  1Q2C A;  4XPD C;  4KOR A;  4MJ8 A;  1KUY A;  4PK3 A;  5EBV A;  3VWD A;  1M4G A;  2J8R A;  4UBR A;  4Y49 C;  4JJX A;  4II9 A;  2Z10 A;  1R57 A;  2JDC A;  2ZXV A;  5HH1 A;  4MFL A;  4AB7 A;  4PV6 A;  3TTH A;  3S6F A;  4L89 A;  2P0W A;  3R1K A;  5IV0 A;  1OZP A;  2WPX A;  2K5T A;  5G22 A;  3D2P A;  4KOV A;  1YVO A;  4NF1 A;  3ZJ0 A;  2QEC A;  3P2F A;  4KZT A;  4KVO E;  2OZG A;  3EC4 A;  3JUW A;  2GAN A;  4Y49 B;  4CAW A;  3IGR A;  2GE3 A;  1U6M A;  2CY2 A;  4JD6 A;  3A9L A;  3FBU A;  4FD6 A;  1SQH A;  4M85 A;  2ZW6 A;  4L8A A;  4E8O A;  4AG9 A;  5HMN A;  2CNS A;  3G8W A;  4QVT A;  2J8M A;  4NCZ A;  3CXP A;  1K4J A;  3G3S A;  3D2M A;  4ONU A;  2R7H A;  4Q38 A;  5IB0 A;  2JLM A;  4CGP A;  2Y0M A;  4HKF A;  2VZZ A;  4KOY A;  5BWA B;  5ISV A;  4HNW B;  3PGP A;  4JXR A;  2A4N A;  3TE4 A;  2ZW7 A;  3DR6 A;  4B5P A;  3BJ8 A;  4B12 A;  2B4D A;  3QAH A;  3W6X A;  1S7N A;  2OZU A;  3FIX A;  3TCV A;  3S6H A;  2R1I A;  4CAE A;  4CS0 B;  3W6S A;  4R57 A;  3T9Y A;  1S60 A;  3FXT A;  4A32 A;  2B5G B;  1VKC A;  5A27 A;  3F8K A;  4R3L A;  4A2Z A;  4LUA A;  1YLE A;  1FY7 A;  1MJA A;  5F47 A;  1M4D A;  4MFJ A;  4B14 A;  4CYN A;  2G0B A;  2I79 A;  1KUX A;  4GS4 A;  3N7Z A;  2Q4V A;  4KSF A;  3TOB A;  5C88 A;  4J3G A;  4H89 A;  1MK4 A;  2PDO A;  3EFA A;  3H4Q A;  5A28 A;  2OH1 A;  4MI4 A;  3JVN A;  2YND A;  2HUZ A;  4DNC A;  2BUE A;  4MY3 A;  4E0A A;  2G3A A;  2R98 A;  2REE A;  2Z0Z A;  4QBJ A;  2CNT A;  3S6K A;  1WK4 A;  2OZH A;  3SHP A;  4CYP A;  5AG4 A;  3GKR A;  3S6G A;  3BJ7 A;  2HV2 A;  3VWE A;  1XF8 A;  3FNC A;  2PR1 A;  2R8V A;  3IU2 A;  2Q7B A;  3PP9 A;  3UY5 A;  5DWN A;  5JPH A;  1S3Z A;  4FD4 A;  3TOA A;  3QB8 A;  1BO4 A;  3DNS A;  5KTD A;  4KUA A;  2WPW A;  4JXQ A;  4IUS A;  3V8I A;  4CGM A;  3R96 A;  3TO6 A;  1VHS A;  2PC1 A;  1YGH A;  4OLL A;  5I0C A;  1YR0 A;  4NXY A;  3KKW A;  4CGN A;  3R95 A;  4CGO A;  4XPL A;  2FS5 A;  3H5Z A;  1RXT A;  5G1Z A;  4OAE A;  4AVB A;  4C2Z A;  3P2H A;  2PSW A;  4KOU A;  3LOD A;  3EO4 A;  2ZW4 A;  4XPD B;  5DWM A;  1ZO0 A;  4KOW A;  2Z3P A;  2VEZ A;  4OAD A;  2I00 A;  3FRM A;  5FVJ A;  4H6U A;  4JLY A;  2KCW A;  1QSR A;  2YNE A;  3I3G A;  4MY0 A;  2P6G A;  4LX9 A;  4R87 A;  1YX0 A;  4B13 A;  2PRB A;  4JWP A;  4KVM E;  2GIV A;  4U5Y A;  1I1D A;  3R9E A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...