4JJXA

Dodecameric structure of spermidine n-acetyltransferase speg from vibrio cholerae o1 biovar eltor
Total Genus 46
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
46
sequence length
172
structure length
172
Chain Sequence
AMNSQLTLRALERGDLRFIHNLNNNRNIMSYWFEEPYESFDELEELYNKHIHDNAERRFVVEDAQKNLIGLVELIEINYIHRSAEFQIIIAPEHQGKGFARTLINRALDYSFTILNLHKIYLHVAVENPKAVHLYEECGFVEEGHLVEEFFINGRYQDVKRMYILQSKYLNR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Spermidine n1-acetyltransferase
publication title A Novel Polyamine Allosteric Site of SpeG from Vibrio cholerae Is Revealed by Its Dodecameric Structure.
pubmed doi rcsb
source organism Vibrio cholerae o1 biovar el tor
molecule tags Transferase
total genus 46
structure length 172
sequence length 172
chains with identical sequence B, C
ec nomenclature ec 2.3.1.57: Diamine N-acetyltransferase.
pdb deposition date 2013-03-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13302 Acetyltransf_3 Acetyltransferase (GNAT) domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.630.30 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Aminopeptidase 4jjxA00
4JXRA 2CNTA 2PR1A 1YK3A 4KOWA 4M3SA 4DNCA 2EUIA 1Q2CA 5F48A 5KTCA 4QUSA 2G0BA 5F49A 1S7FA 3VWDA 1WWZA 4Y49C 1NSLA 5DWMA 4KOUA 3R9FA 3KKWA 1B87A 2I79A 2HUZA 3TOBA 2VXKA 5JPHA 4R3LA 4QVTA 3I9SA 2ZW6A 4H89A 1MJAA 5IX3A 5J8CA 3CXQA 3DR8A 2PR8A 3TO9A 4F6AA 1IICA 3GYAA 2P0WA 1PU9A 1RXTA 2CNSA 1B6BA 4MY3A 1K4JA 3D2MA 4NXYA 2REFA 2C27A 3SXNA 1J4JA 1FY7A 3EC4A 2EVNA 2WPXA 2OB0A 4IUSA 1YREA 2P6GA 3B8GA 3K9UA 4PV6A 3S6HA 4GS4A 2QECA 4B5PA 4II9A 3EFAA 4AG7A 2REEA 2B3VA 2B3UA 2VZYA 2Q7BA 1LRZA 2BUEA 2P6EA 4MY0A 3IGRA 4CRZB 3G3SA 2X7BA 3R9EA 1V0CA 2A4NA 3PGPA 5F47A 1P4NA 4FD7A 5FVJA 3W6SA 2OZGA 4ONUA 5IB0A 2CY2A 1Z4EA 2OZUA 5EC4A 2ZXVA 3R9GA 4KLVA 1YVKA 4AB7A 1OZPA 2B4DA 5H84A 4KOYA 1L0CA 4LUAA 4XNHC 4J3GA 3ZZIA 3TT2A 1M4IA 4XPLA 4B5PB 2HV2A 4YFJA 1YVOA 4KOVA 2CNMA 4ZBGA 4AVCA 2DXQA 2ZPAA 4L89A 4B5OA 5ISVA 3SXOA 3S6GA 1IYKA 1YLEA 3MGDA 2I00A 3TTHA 4MHDA 2FT0A 2R8VA 1QSTA 3T90A 3GY9A 5GCNA 2B4DB 1U6MA 5KTAA 3NE7A 2Q4YA 1Y9KA 3FIXA 1M4DA 5F46A 2B58A 2PQ8A 4KUAA 4FD6A 4YGOA 2FCKA 1Q2DA 2O28A 1P0HA 2B5GA 1MK4A 4Y49B 1YR0A 4E8OA 2Q44A 1YGHA 3VWEA 3S6FA 4L8AA 4JLYA 4NCZA 4XPKA 1VHSA 2JDCA 4MBUA 4FD5A 2JLMA 1XIXA 5C82A 3D2PA 4NF1A 1I1DA 4K30A 1VKCA 2J8NA 4PSXA 2KCWA 4KOSA 4QC6A 1XF8A 3V8IA 1S7NA 1MJBA 1Q2YA 1QSMA 3SHPA 4U9ZA 3S6KA 1SQHA 3F8KA 5DWNA 2HQYA 1N71A 2D4PA 2K5TA 2B5GB 4BMHA 4AVBA 3D8PA 4X5KA 2GANA 1KUYA 3JUWA 2PDOA 3FYNA 2VEZA 1QSOA 4RI1A 4H6UA 4PSWA 4R87A 4HNYB 3TOAA 4NEXA 3DR6A 3ZJ0A 4EVYA 3D3SA 4I49A 4QB9A 1YX0A 5JQ4A 3F0AA 4XPDC 1I21A 3TO7A 1Z9UA 3FXTA 4PK2A 4KVOE 2PC1A 2R7HA 1UFHA 3BJ8A 3R1KA 2Y0MA 2Z11A 2GE3A 3RYOA 2BL1A 3P2HA 1M4GA 1TIQA 4U9YA 5HMNA 5EBVA 2BSWA 4XNHB 2ZW5A 3DNSA 1S60A 3QAHA 2JEVA 1BOBA 2P6FA 4JD6A 1KZFA 1PUAA 3R95A 3TCVA 5J8FA 3EXNA 3JVNA 2B4BA 2FL4A 4M85A 4UA3A 3LODA 3FBUA 3R96A 3QB8A 1KUVA 3BLNA 2OH1A 2G3TA 4R9MA 4H6ZA 2BEIA 2Z0ZA 4E2AA 4RS2A 1S5KA 1NE9A 1ON0A 4KLWA 2PRBA 2FE7A 2J8RA 4QBJA 2Q04A 1M1DA 3LD2A 4LX9A 3FRMA 2G3AA 4AVAA 3CXSA 2J8MA 2VZZA 4F0YA 4R57A 4HNXB 4UBRA 4CS0B 4CAWA 3UY5A 1S7KA 2OZHA 4HNWB 3PP9A 4ORFA 2FXFA 3PZJA 1CM0A 2FIAA 4R3KA 3FNCA 2D4OA 5H86A 2OU2A 2Q0YA 1S3ZA 2FSRA 2Q4VA 2F5IA 2AE6A 4KUBA 4MI4A 5HH1A 4NSQA 2ARHA 1Y7RA 4KOTA 4AG9A 3DDDA 1M44A 2FIWA 2H5MA 2IL4A 1R57A 5E96A 4KORA 2VQYA 2QIRA 4JXQA 3EO4A 2PSWA 2ZW7A 3TFYA 1MJ9A 1QSRA 4OADA 1IB1E 2R1IA 2ATRA 4KVXA 5IV0A 3P2FA 4UWJA 5I0CA 1XMTA 4CAXA 3E0KA 4UWIA 4CAVA 1QSNA 1Z4RA 2R98A 1KUXA 1GHEA 2ZW4A 1RO5A 1XEBA 2GIVA 2JDDA 3EY5A 3T9YA 2Z10A 4PK3A 3WR7A 1Y9WA 3G8WA 4JJXA 3CXPA 1NMTA 2FS5A 3W6XA 3BJ7A 3FB3A 3N7ZA 4XPDB 3F5BA 4IF5A 4OAEA 4JWPA 3I3GA 4MJ8A 1IIDA 1BO4A 2VI7A 2NMTA 4YRHA 4HKFA 2WPWA 4U5YA 4CRYB 4KZTA 1WK4A 2AJ6A 4OLLA 3DSBA 2VBQA 1CJWA 3C26A 4FD4A 3H4QA 3TE4A 1IYLA 3GKRA 4E0AA 2RC4A 5KTDA 3TO6A 4KOXA 3IWGA 5C88A 1I12A 4KVME 1XE4A 3OWCA 2QMLA 3W91A 1S7LA 5CNPA
chains in the Genus database with same CATH superfamily
4JXRA 5HVFA 2CNTA 2PR1A 2Q43A 4CGMA 4C68A 1YK3A 4KOWA 8CPAA 1CBXA 2POKA 4M3SA 4O23A 4DNCA 4P4FA 2EUIA 1Q2CA 5F48A 2XEGA 3FMCA 2ANPA 5KTCA 4MCSA 3IIBA 4QUSA 2G0BA 3D7GA 4JYWA 2PIZA 5F49A 1S7FA 2PVWA 2PJCA 1XBUA 3VWDA 4ZX8A 1WWZA 4B10A 4MHYA 2XEFA 4Y49C 1NSLA 3PEIA 4MFPA 3HUVA 4NGSA 2ZEOA 4P4IA 4R76A 5DWMA 1YW4A 4KOUA 3K2KA 4NGQA 3R9FA 3RBUA 3KKWA 1Z2LA 1B87A 4UFXA 2I79A 2HUZA 2PJ2A 3TOBA 2VXKA 5JPHA 4R3LA 4UEEA 4QVTA 1DTDA 4P44A 3I9SA 1NSAA 4C2ZA 2ZW6A 3D67A 4H89A 1MJAA 4W9YA 5IX3A 5J8CA 3CXQA 2J9AA 4FAIA 3DR8A 2PR8A 2DEAA 2PVVA 1IU8A 4MFKA 1QQ9A 3K9TA 3TO9A 1Z5RA 4WJBA 4F6AA 1IICA 3GYAA 2P0WA 3GUXA 6CPAA 3MRUA 4R8FA 4M6IA 4IHMA 3B3WA 1PU9A 4NGNA 1LCPA 1RXTA 4NFRA 2CNSA 1B6BA 4IK2A 3D7DA 3D66A 4MY3A 2ZEHA 3B3VA 1K4JA 3D2MA 5K8OA 3ISZA 4NXYA 1TKHA 2REFA 2BCOA 3N5FA 2CF4A 2C27A 3PB9X 3WABA 4A37A 1IOFA 3SXNA 4CAEA 5K8MA 1F2PA 1J4JA 1FY7A 1Z8TA 2JBJA 4WWVA 3EC4A 5EMIA 3PFOA 3IWEA 4X2TA 3BHXA 4B11A 2PE3A 1X12A 2EVNA 2WPXA 2OB0A 4CYNA 4IUSA 1YREA 2P6GA 4MCRA 4A31A 3B8GA 4R6TA 3K9UA 4PV6A 2EK9A 1FT7A 1CP7A 2JBKA 3SJXA 3S6HA 4GS4A 2PJ5A 2QECA 4MFLA 2NSMA 4B5PA 3CPXA 1ARMA 3D4UA 3EFAA 1HDUA 2REEA 4UF4A 4YWYA 3V38A 4AG7A 1H8LA 2BOAA 2B3VA 2B3UA 3IEHA 2VZYA 2Q7BA 4ZYQA 1LRZA 2BUEA 2DPTA 2P6EA 4MY0A 3IGRA 4CRZB 3G3SA 4M6GA 2X7BA 3R9EA 1V0CA 2A4NA 2HB6A 2CTBA 3PGPA 5F47A 4C7HA 1P4NA 2AFXA 4FD7A 4ZX9A 1ELMP 4MHPA 5FVJA 2ZOGA 4UFWA 4OC5A 3W6SA 4NJQA 2OZGA 4ONUA 1TXRA 5IB0A 3DGVA 1XOVA 2CY2A 1Q7LA 4UIAA 1Z4EA 2YNDA 4ZY0A 4NGPA 3FEEA 4BD9A 2AFOA 2OZUA 5EC4A 5LYIA 2ZXVA 4MRIA 4DYOA 4ZI6A 5IB9A 4P10A 3R9GA 2XEJA 3KQZA 2WUUA 3SJGA 5JM6A 1AUGA 4KLVA 1YVKA 4AB7A 4OC3A 4TWEA 1OZPA 2B4DA 2PJ0A 4CYPA 5H84A 4KS9A 4KOYA 1L0CA 3KQXA 4LUAA 4J3GA 4XNHC 3ZZIA 4OC0A 4CGLA 4GM5A 5HVGA 3TT2A 1M4IA 2PJ8A 2V77A 4XPLA 2HV2A 4B5PB 2QVPA 1YVOA 4KOVA 4RUHA 4YFJA 2CNMA 1R3NA 1ELLP 3RO0A 2YNCC 3FH4A 4ZBGA 3TX8A 4AVCA 2DXQA 2WYRA 4UIBA 4PQAA 2ZPAA 4GXHA 4L89A 7CPAA 3PBBA 4NGMA 2ZEEA 4B5OA 4NJRA 2IJZA 3SXOA 5ISVA 3KASA 1BPMA 1IYKA 3DLJA 1YLEA 2Q7SA 2I00A 3MGDA 3S6GA 3TTHA 5F09A 4MHDA 4JZ0A 2FT0A 2R8VA 1QSTA 2V8VA 2XEIA 3GB0A 2ODFA 3FX6A 2ZOFA 3T90A 4KSAA 2AFMA 4P45A 3GY9A 1X10A 5GCNA 4B6ZA 4EFDA 1TKFA 2B4DB 4KSIA 4YU9A 1U6MA 3S9NA 1DE4C 1Y7EA 3KHXA 4PXDA 4UEZA 2Z3LA 5KTAA 2Z3PA 5G21A 4MCPA 3NE7A 2Q4YA 3IU2A 1Y9KA 3FIXA 1M4DA 1ARLA 5F46A 2B58A 4LQGA 2PQ8A 2F8HA 4ONWA 3PBEA 1XJOA 1LFWA 3B35A 3RNZA 1CP6A 2EWBA 4KUAA 3SI1A 3CDXA 3VATA 4CGOA 2GFQA 4FD6A 3WC7A 4YGOA 2DF5A 2FCKA 1Q2DA 1IOIA 1R43A 2O28A 3FVLA 1P0HA 2PJ4A 1QMUA 4CGNA 2HC9A 2Z3NA 2B5GA 4TNUA 1MK4A 4Y49B 1YR0A 1BAVA 1Z8LA 2Q44A 4E8OA 1YGHA 3VWEA 2CTCA 4R7MA 4MHNA 1ZLHA 3S6FA 4L8AA 5LRJA 4JLYA 4NCZA 2F7VA 4NGTA 4UCMA 4XPKA 1VHSA 5AG4A 2JDCA 4MBUA 3VARA 4BINA 4FD5A 2ZEPA 2JLMA 5K8NA 3IO1A 3SI0A 1XIXA 5C82A 3D2PA 2EK8A 4NF1A 1VGYA 4Q7AA 1I1DA 4K30A 4A39A 1VKCA 2RFHA 4DUKA 2ZELA 2J8NA 4PSXA 2KCWA 4KOSA 4QC6A 1XF8A 3V8IA 1S7NA 1MJBA 5HXDA 1Q2YA 1QSMA 4G1PA 3SHPA 4U9ZA 3S6KA 1SQHA 2PJ3A 5BWAB 3F8KA 5DWNA 2PJAA 2HQYA 1N71A 2D4PA 2K5TA 2B5GB 4BMHA 3D68A 4AVBA 1IY7A 3D8PA 4PXEA 4X5KA 2GANA 3IFEA 1KUYA 3JUWA 3PB8X 4MHZA 2PDOA 3SI2A 1AYEA 2GLJA 4MCQA 3FYNA 2VEZA 1QSOA 3FF3A 4RI1A 3IJ3A 4H6UA 4PSWA 2Z3MA 4R87A 4HNYB 4B14A 3QNVA 2ZENA 3TOAA 1ZO0A 4NEXA 3LWUA 3DR6A 3ZJ0A 4OIDA 2OR4A 3KR4A 4EVYA 2AFSA 1AMPA 3D3SA 3NH5A 1LAPA 4I49A 4MXUA 4QB9A 3IC1A 2YNCA 5JGFA 1YX0A 5I4MA 3B3CA 1VHOA 5JQ4A 3F0AA 4XPDC 1I21A 1KWMA 4M6HA 4OMEA 3TO7A 2ABZA 3JTKA 1Z9UA 3KR5A 3LACA 2GLFA 3FXTA 3KGQA 4PK2A 4KVOE 4PXBA 3TC8A 4ZY2A 2PC1A 2R7HA 3GIUA 4P4BA 5D29A 4AXVA 1UFHA 2WSAA 3BJ8A 3R1KA 4OP4A 1BPNA 2Y0MA 1CPXA 2Z11A 5LRGA 1XMBA 1YMEA 2GE3A 1TF8A 5D8NA 3RYOA 5LYLA 2NYQA 2BL1A 1PYTB 3P2HA 2PRQA 1M4GA 1TIQA 4U9YA 5A28A 5EBVA 5HMNA 1IGBA 2BSWA 3BXMA 2ZEFA 4XNHB 2ZW5A 3DNSA 4P6YA 2QJ8A 1S60A 2JEVA 1Z8WA 3QAHA 4OKOA 1BOBA 5THWA 4CAFA 4FBEA 2IMOA 2P6FA 4JD6A 1KZFA 2Q51A 3KL9A 1PUAA 3H8FA 5LYDA 3R95A 3TCVA 3EXNA 4F0XA 3KI9A 5J8FA 3JVNA 2B4BA 1F57A 2FL4A 4M85A 4UA3A 3I1UA 3LODA 3B2YA 4UCNA 2AFUA 3FBUA 3R96A 3H5ZA 4C2YA 5A27A 5ELYA 3QB8A 5AG7A 5AG5A 1KUVA 1TKJA 2Z3KA 3BLNA 2PJ6A 2OH1A 1TF9A 2G3TA 4R9MA 2PCUA 4H6ZA 4BBHA 4KSFA 3CT9A 2C6PA 2BEIA 1YW6A 2Z0ZA 4E2AA 4RS2A 1S5KA 3V7ZA 1NE9A 1ON0A 3NFZA 3MN8A 4KLWA 2PRBA 1A2ZA 2FE7A 2J8RA 4QBJA 2JEWA 4B12A 1GYTA 2Q04A 4CPAA 3H8GA 1M1DA 3LD2A 4LX9A 3KZWA 3FRMA 2G3AA 4AVAA 1YLOA 3CXSA 4FWUA 3B3TA 2PJ7A 2OOTA 1XRYA 4NGRA 1BLLE 4A30A 3PB4X 4MFZA 2J8MA 2VZZA 4F0YA 5HVHA 1CG2A 4R57A 2PJ9A 4HNXB 4UBRA 4CS0B 4CAWA 1ZLIA 3UY5A 1S7KA 1HEEA 2OZHA 3RZAA 1XFOA 2WZNA 4HNWB 1M4LA 3PP9A 4ORFA 2FXFA 3PZJA 1CM0A 2FIAA 1CPSA 3NH4A 2EBJA 4R3KA 3FNCA 1PCAA 2C6CA 2IQ6A 3NE8A 2D4OA 3GLJA 2OU2A 4P4DA 5H86A 1S3ZA 2FSRA 2Q0YA 2CXAA 2Q4VA 2F5IA 2AE6A 4B13A 3IU1A 4KUBA 1JWQA 4A38A 2V8HA 4HPSA 4MI4A 5HH1A 5JH9A 4NSQA 2ARHA 3JRUA 1Y7RA 2YNEA 4ZY1A 4KOTA 4AG9A 5LYFA 2GREA 4FUUA 4OC2A 4F8ZA 3DDDA 1JQGA 1M44A 2FIWA 2H5MA 2IL4A 1LANA 1R57A 3CZXA 5E96A 3B3SA 3IWWA 4OIWA 4KORA 2Q4ZA 2QIRA 2VQYA 4JXQA 1OBRA 3EO4A 4LQ6A 4IAVA 4Z65A 2PSWA 3PFEA 3L2NA 1FNOA 2ZW7A 3TFYA 2ZEGA 1MJ9A 1QSRA 4OADA 4Q38A 1CX8A 1IB1E 3LMSA 2I3CA 2R1IA 2ATRA 4KVXA 2QYVA 5IV0A 2ZEDA 1ZG9A 4K3NA 4P4JA 3P2FA 4UWJA 5I0CA 1XMTA 4EWTA 2VL1A 3WT4A 4A2ZA 1F2OA 5G1ZA 4CAXA 3E0KA 4UWIA 4F9UA 4Q36A 4DJLA 3RAMA 3T8WA 5CBMA 3ISXA 4CAVA 1QSNA 2BO9A 4OC4A 2O4HA 1Z4RA 2R98A 2CIJA 4A95A 4A32A 3SJFA 1KUXA 1LOKA 1Z8XA 1GHEA 3KHZA 2ZW4A 1RO5A 1LAMA 1XEBA 2GIVA 2JDDA 3EY5A 3T9YA 2Z10A 4PXCA 5AG6A 4C7IA 5G20A 4PK3A 3HLPA 3WR7A 2AFZA 4P4EA 1Y9WA 3G8WA 4CYQA 4JJXA 2Z3OA 3CXPA 5K8PA 4RN7A 4II9A 1NMTA 2FS5A 3CPAA 3BJ7A 3FB3A 2AFWA 3N7ZA 4UFVA 3W6XA 4XPDB 4ZGYB 3F5BA 4IF5A 4H2KA 4OAEA 4JWPA 3I3GA 4F9VA 4MJ8A 5AGEA 1IIDA 1VIXA 1VHEA 1BO4A 1Y0RA 2G9DA 2VI7A 4UCPA 2NMTA 2PIYA 2PJBA 3S9MA 2YGWA 4X3RA 3PRTA 4YRHA 4HKFA 1RTQA 2DPSA 2WPWA 4X8IA 4U5YA 4CRYB 4KZTA 3D7HA 5LRKA 3D7FA 2O53A 3SJEA 1Y0YA 1WK4A 1EE3P 2AJ6A 3H8EA 3PB6X 4OLLA 2C1CA 3DSBA 4OC1A 4A33A 4C2XA 2VBQA 1CJWA 1ZG7A 3C26A 3FECA 3H4QA 4FD4A 1ZG8A 4MFQA 3VH9A 3TE4A 3QAYA 1UWYA 3NH8A 4A94A 4UEFA 1IYLA 2FVGA 4MFJA 4MMOA 2RB7A 2V8GA 3GKRA 4PPZA 5DS0A 4E0AA 2PJ1A 3B7IA 2RC4A 3WC6A 1YQEA 3TO6A 2EO8A 4CYOA 5KTDA 4KOXA 3IWGA 5G22A 4CGPA 5CPAA 4EMEA 2ZEMA 5C88A 2V8DA 1I12A 1HDQA 1XE4A 3A9LA 3NA6A 4KVME 2GU2A 3WC5A 5J1QA 3OWCA 3FEDA 2C6GA 2QMLA 3BI1A 1YSJA 3FJUA 3PB7X 3W91A 1S7LA 3S9LA 5CNPA 3BI0A
chains in the Genus database with same CATH topology
4JXRA 2CNTA 2PR1A 4CGMA 4C68A 1YK3A 4KOWA 4M3SA 4DNCA 2EUIA 1Q2CA 5F48A 5KTCA 4QUSA 2G0BA 5F49A 1S7FA 3VWDA 1WWZA 4B10A 4Y49C 1NSLA 4MFPA 5DWMA 4KOUA 3R9FA 3KKWA 1B87A 4UFXA 2I79A 2HUZA 3TOBA 2VXKA 5JPHA 4R3LA 4QVTA 3I9SA 4C2ZA 2ZW6A 4H89A 1MJAA 5IX3A 5J8CA 3CXQA 3DR8A 2PR8A 4MFKA 3TO9A 4F6AA 1IICA 3GYAA 2P0WA 1PU9A 1RXTA 2CNSA 1B6BA 4MY3A 1K4JA 3D2MA 4NXYA 2REFA 4CAEA 2C27A 3SXNA 1J4JA 1FY7A 3EC4A 3IWEA 4B11A 2EVNA 2WPXA 2OB0A 4CYNA 4IUSA 1YREA 2P6GA 4A31A 3B8GA 3K9UA 4PV6A 3S6HA 4GS4A 2QECA 4MFLA 4B5PA 4II9A 3EFAA 4AG7A 2REEA 2B3VA 2B3UA 2VZYA 2Q7BA 1LRZA 2BUEA 2DPTA 2P6EA 4MY0A 3IGRA 4CRZB 3G3SA 2X7BA 3R9EA 1V0CA 2A4NA 3PGPA 5F47A 4C7HA 1P4NA 4FD7A 5FVJA 4UFWA 3W6SA 2OZGA 4ONUA 5IB0A 2CY2A 1Z4EA 2YNDA 2OZUA 5EC4A 2ZXVA 3R9GA 2WUUA 4KLVA 1YVKA 4AB7A 1OZPA 2B4DA 4CYPA 5H84A 4KS9A 4KOYA 1L0CA 4LUAA 4XNHC 4J3GA 3ZZIA 4CGLA 3TT2A 1M4IA 4XPLA 4B5PB 2HV2A 4YFJA 1YVOA 4KOVA 2CNMA 2YNCC 4ZBGA 4AVCA 2DXQA 2ZPAA 4L89A 4B5OA 5ISVA 3SXOA 3S6GA 1IYKA 1YLEA 3MGDA 2I00A 3TTHA 4MHDA 2FT0A 2R8VA 1QSTA 3T90A 4KSAA 3GY9A 5GCNA 2B4DB 1U6MA 2Z3LA 5KTAA 2Z3PA 5G21A 3NE7A 2Q4YA 3IU2A 1Y9KA 3FIXA 1M4DA 5F46A 2B58A 2PQ8A 4KUAA 4CGOA 4FD6A 4YGOA 2FCKA 1Q2DA 2O28A 1P0HA 4CGNA 2Z3NA 2B5GA 1MK4A 4Y49B 1YR0A 4E8OA 2Q44A 1YGHA 3VWEA 3S6FA 4L8AA 4JLYA 4NCZA 4UCMA 4XPKA 1VHSA 5AG4A 2JDCA 4MBUA 4FD5A 2JLMA 1XIXA 5C82A 3D2PA 4NF1A 1I1DA 4K30A 1VKCA 2J8NA 4PSXA 2KCWA 4KOSA 4QC6A 1XF8A 3V8IA 1S7NA 1MJBA 1Q2YA 1QSMA 3SHPA 4U9ZA 3S6KA 1SQHA 5BWAB 3F8KA 5DWNA 2HQYA 1N71A 2D4PA 2K5TA 2B5GB 4BMHA 4AVBA 3D8PA 4X5KA 2GANA 1KUYA 3JUWA 2PDOA 3FYNA 2VEZA 1QSOA 4RI1A 4H6UA 4PSWA 2Z3MA 4R87A 4HNYB 4B14A 3TOAA 1ZO0A 4NEXA 3DR6A 3ZJ0A 4EVYA 3D3SA 4I49A 4QB9A 2YNCA 1YX0A 5JQ4A 3F0AA 4XPDC 1I21A 3TO7A 3JTKA 1Z9UA 3FXTA 4PK2A 4KVOE 2PC1A 2R7HA 1UFHA 2WSAA 3BJ8A 3R1KA 2Y0MA 2Z11A 2GE3A 3RYOA 2BL1A 3P2HA 1M4GA 1TIQA 4U9YA 5A28A 5EBVA 5HMNA 2BSWA 4XNHB 2ZW5A 3DNSA 1S60A 3QAHA 2JEVA 4CAFA 1BOBA 2P6FA 4JD6A 1KZFA 1PUAA 4F0XA 3R95A 3TCVA 5J8FA 3EXNA 3JVNA 2B4BA 2FL4A 4M85A 4UA3A 3LODA 4UCNA 3FBUA 3R96A 3H5ZA 4C2YA 5A27A 3QB8A 5AG7A 5AG5A 1KUVA 2Z3KA 3BLNA 2OH1A 2G3TA 4R9MA 4H6ZA 4BBHA 4KSFA 2BEIA 2Z0ZA 4E2AA 4RS2A 1S5KA 1NE9A 1ON0A 4KLWA 2PRBA 2FE7A 2J8RA 4QBJA 4B12A 2Q04A 1M1DA 3LD2A 4LX9A 3FRMA 2G3AA 4AVAA 3CXSA 4A30A 4MFZA 2J8MA 2VZZA 4F0YA 4R57A 4HNXB 4UBRA 4CS0B 4CAWA 3UY5A 1S7KA 2OZHA 4HNWB 3PP9A 4ORFA 3PZJA 2FXFA 1CM0A 2FIAA 4R3KA 3FNCA 2D4OA 5H86A 2OU2A 2Q0YA 1S3ZA 2FSRA 2CXAA 2Q4VA 2F5IA 2AE6A 4B13A 3IU1A 4KUBA 4MI4A 5HH1A 4NSQA 2ARHA 1Y7RA 2YNEA 4KOTA 4AG9A 3DDDA 1M44A 2FIWA 2H5MA 2IL4A 1R57A 5E96A 4KORA 2VQYA 2QIRA 4JXQA 3EO4A 2PSWA 2ZW7A 3TFYA 1MJ9A 1QSRA 4OADA 4Q38A 1IB1E 2R1IA 2ATRA 4KVXA 5IV0A 3P2FA 4UWJA 5I0CA 1XMTA 4A2ZA 5G1ZA 4CAXA 3E0KA 4UWIA 4Q36A 4CAVA 1QSNA 1Z4RA 2R98A 4A95A 4A32A 1KUXA 1GHEA 2ZW4A 1RO5A 1XEBA 2GIVA 2JDDA 3EY5A 3T9YA 2Z10A 5AG6A 4C7IA 5G20A 4PK3A 3WR7A 1Y9WA 3G8WA 4CYQA 4JJXA 2Z3OA 3CXPA 1NMTA 2FS5A 3W6XA 3BJ7A 3FB3A 3N7ZA 4UFVA 4XPDB 4ZGYB 3F5BA 4IF5A 4OAEA 4JWPA 3I3GA 4MJ8A 5AGEA 1IIDA 1BO4A 2VI7A 4UCPA 2NMTA 2YGWA 4YRHA 4HKFA 2DPSA 2WPWA 4U5YA 4CRYB 4KZTA 1WK4A 2AJ6A 4OLLA 4A33A 3DSBA 4C2XA 2VBQA 1CJWA 3C26A 4FD4A 4MFQA 3H4QA 3TE4A 1IYLA 4MFJA 3GKRA 4E0AA 2RC4A 5KTDA 3TO6A 4CYOA 4KOXA 3IWGA 5G22A 4CGPA 5C88A 1I12A 4KVME 1XE4A 3A9LA 3OWCA 2QMLA 3W91A 1S7LA 5CNPA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4JXR A;  2CNT A;  2PR1 A;  1YK3 A;  4KOW A;  4M3S A;  4DNC A;  2EUI A;  1Q2C A;  5F48 A;  5KTC A;  4QUS A;  2G0B A;  5F49 A;  1S7F A;  3VWD A;  1WWZ A;  4Y49 C;  1NSL A;  5DWM A;  4KOU A;  3R9F A;  3KKW A;  1B87 A;  2I79 A;  2HUZ A;  3TOB A;  2VXK A;  5JPH A;  4R3L A;  4QVT A;  3I9S A;  2ZW6 A;  4H89 A;  1MJA A;  5IX3 A;  5J8C A;  3CXQ A;  3DR8 A;  2PR8 A;  3TO9 A;  4F6A A;  1IIC A;  3GYA A;  2P0W A;  1PU9 A;  1RXT A;  2CNS A;  1B6B A;  4MY3 A;  1K4J A;  3D2M A;  4NXY A;  2REF A;  2C27 A;  3SXN A;  1J4J A;  1FY7 A;  3EC4 A;  2EVN A;  2WPX A;  2OB0 A;  4IUS A;  1YRE A;  2P6G A;  3B8G A;  3K9U A;  4PV6 A;  3S6H A;  4GS4 A;  2QEC A;  4B5P A;  4II9 A;  3EFA A;  4AG7 A;  2REE A;  2B3V A;  2B3U A;  2VZY A;  2Q7B A;  1LRZ A;  2BUE A;  2P6E A;  4MY0 A;  3IGR A;  4CRZ B;  3G3S A;  2X7B A;  3R9E A;  1V0C A;  2A4N A;  3PGP A;  5F47 A;  1P4N A;  4FD7 A;  5FVJ A;  3W6S A;  2OZG A;  4ONU A;  5IB0 A;  2CY2 A;  1Z4E A;  2OZU A;  5EC4 A;  2ZXV A;  3R9G A;  4KLV A;  1YVK A;  4AB7 A;  1OZP A;  2B4D A;  5H84 A;  4KOY A;  1L0C A;  4LUA A;  4XNH C;  4J3G A;  3ZZI A;  3TT2 A;  1M4I A;  4XPL A;  4B5P B;  2HV2 A;  4YFJ A;  1YVO A;  4KOV A;  2CNM A;  4ZBG A;  4AVC A;  2DXQ A;  2ZPA A;  4L89 A;  4B5O A;  5ISV A;  3SXO A;  3S6G A;  1IYK A;  1YLE A;  3MGD A;  2I00 A;  3TTH A;  4MHD A;  2FT0 A;  2R8V A;  1QST A;  3T90 A;  3GY9 A;  5GCN A;  2B4D B;  1U6M A;  5KTA A;  3NE7 A;  2Q4Y A;  1Y9K A;  3FIX A;  1M4D A;  5F46 A;  2B58 A;  2PQ8 A;  4KUA A;  4FD6 A;  4YGO A;  2FCK A;  1Q2D A;  2O28 A;  1P0H A;  2B5G A;  1MK4 A;  4Y49 B;  1YR0 A;  4E8O A;  2Q44 A;  1YGH A;  3VWE A;  3S6F A;  4L8A A;  4JLY A;  4NCZ A;  4XPK A;  1VHS A;  2JDC A;  4MBU A;  4FD5 A;  2JLM A;  1XIX A;  5C82 A;  3D2P A;  4NF1 A;  1I1D A;  4K30 A;  1VKC A;  2J8N A;  4PSX A;  2KCW A;  4KOS A;  4QC6 A;  1XF8 A;  3V8I A;  1S7N A;  1MJB A;  1Q2Y A;  1QSM A;  3SHP A;  4U9Z A;  3S6K A;  1SQH A;  3F8K A;  5DWN A;  2HQY A;  1N71 A;  2D4P A;  2K5T A;  2B5G B;  4BMH A;  4AVB A;  3D8P A;  4X5K A;  2GAN A;  1KUY A;  3JUW A;  2PDO A;  3FYN A;  2VEZ A;  1QSO A;  4RI1 A;  4H6U A;  4PSW A;  4R87 A;  4HNY B;  3TOA A;  4NEX A;  3DR6 A;  3ZJ0 A;  4EVY A;  3D3S A;  4I49 A;  4QB9 A;  1YX0 A;  5JQ4 A;  3F0A A;  4XPD C;  1I21 A;  3TO7 A;  1Z9U A;  3FXT A;  4PK2 A;  4KVO E;  2PC1 A;  2R7H A;  1UFH A;  3BJ8 A;  3R1K A;  2Y0M A;  2Z11 A;  2GE3 A;  3RYO A;  2BL1 A;  3P2H A;  1M4G A;  1TIQ A;  4U9Y A;  5HMN A;  5EBV A;  2BSW A;  4XNH B;  2ZW5 A;  3DNS A;  1S60 A;  3QAH A;  2JEV A;  1BOB A;  2P6F A;  4JD6 A;  1KZF A;  1PUA A;  3R95 A;  3TCV A;  5J8F A;  3EXN A;  3JVN A;  2B4B A;  2FL4 A;  4M85 A;  4UA3 A;  3LOD A;  3FBU A;  3R96 A;  3QB8 A;  1KUV A;  3BLN A;  2OH1 A;  2G3T A;  4R9M A;  4H6Z A;  2BEI A;  2Z0Z A;  4E2A A;  4RS2 A;  1S5K A;  1NE9 A;  1ON0 A;  4KLW A;  2PRB A;  2FE7 A;  2J8R A;  4QBJ A;  2Q04 A;  1M1D A;  3LD2 A;  4LX9 A;  3FRM A;  2G3A A;  4AVA A;  3CXS A;  2J8M A;  2VZZ A;  4F0Y A;  4R57 A;  4HNX B;  4UBR A;  4CS0 B;  4CAW A;  3UY5 A;  1S7K A;  2OZH A;  4HNW B;  3PP9 A;  4ORF A;  2FXF A;  3PZJ A;  1CM0 A;  2FIA A;  4R3K A;  3FNC A;  2D4O A;  5H86 A;  2OU2 A;  2Q0Y A;  1S3Z A;  2FSR A;  2Q4V A;  2F5I A;  2AE6 A;  4KUB A;  4MI4 A;  5HH1 A;  4NSQ A;  2ARH A;  1Y7R A;  4KOT A;  4AG9 A;  3DDD A;  1M44 A;  2FIW A;  2H5M A;  2IL4 A;  1R57 A;  5E96 A;  4KOR A;  2VQY A;  2QIR A;  4JXQ A;  3EO4 A;  2PSW A;  2ZW7 A;  3TFY A;  1MJ9 A;  1QSR A;  4OAD A;  1IB1 E;  2R1I A;  2ATR A;  4KVX A;  5IV0 A;  3P2F A;  4UWJ A;  5I0C A;  1XMT A;  4CAX A;  3E0K A;  4UWI A;  4CAV A;  1QSN A;  1Z4R A;  2R98 A;  1KUX A;  1GHE A;  2ZW4 A;  1RO5 A;  1XEB A;  2GIV A;  2JDD A;  3EY5 A;  3T9Y A;  2Z10 A;  4PK3 A;  3WR7 A;  1Y9W A;  3G8W A;  4JJX A;  3CXP A;  1NMT A;  2FS5 A;  3W6X A;  3BJ7 A;  3FB3 A;  3N7Z A;  4XPD B;  3F5B A;  4IF5 A;  4OAE A;  4JWP A;  3I3G A;  4MJ8 A;  1IID A;  1BO4 A;  2VI7 A;  2NMT A;  4YRH A;  4HKF A;  2WPW A;  4U5Y A;  4CRY B;  4KZT A;  1WK4 A;  2AJ6 A;  4OLL A;  3DSB A;  2VBQ A;  1CJW A;  3C26 A;  4FD4 A;  3H4Q A;  3TE4 A;  1IYL A;  3GKR A;  4E0A A;  2RC4 A;  5KTD A;  3TO6 A;  4KOX A;  3IWG A;  5C88 A;  1I12 A;  4KVM E;  1XE4 A;  3OWC A;  2QML A;  3W91 A;  1S7L A;  5CNP A; 
#chains in the Genus database with same CATH topology
 4JXR A;  5HVF A;  2CNT A;  2PR1 A;  2Q43 A;  4CGM A;  4C68 A;  1YK3 A;  4KOW A;  8CPA A;  1CBX A;  2POK A;  4M3S A;  4O23 A;  4DNC A;  4P4F A;  2EUI A;  1Q2C A;  5F48 A;  2XEG A;  3FMC A;  2ANP A;  5KTC A;  4MCS A;  3IIB A;  4QUS A;  2G0B A;  3D7G A;  4JYW A;  2PIZ A;  5F49 A;  1S7F A;  2PVW A;  2PJC A;  1XBU A;  3VWD A;  4ZX8 A;  1WWZ A;  4B10 A;  4MHY A;  2XEF A;  4Y49 C;  1NSL A;  3PEI A;  4MFP A;  3HUV A;  4NGS A;  2ZEO A;  4P4I A;  4R76 A;  5DWM A;  1YW4 A;  4KOU A;  3K2K A;  4NGQ A;  3R9F A;  3RBU A;  3KKW A;  1Z2L A;  1B87 A;  4UFX A;  2I79 A;  2HUZ A;  2PJ2 A;  3TOB A;  2VXK A;  5JPH A;  4R3L A;  4UEE A;  4QVT A;  1DTD A;  4P44 A;  3I9S A;  1NSA A;  4C2Z A;  2ZW6 A;  3D67 A;  4H89 A;  1MJA A;  4W9Y A;  5IX3 A;  5J8C A;  3CXQ A;  2J9A A;  4FAI A;  3DR8 A;  2PR8 A;  2DEA A;  2PVV A;  1IU8 A;  4MFK A;  1QQ9 A;  3K9T A;  3TO9 A;  1Z5R A;  4WJB A;  4F6A A;  1IIC A;  3GYA A;  2P0W A;  3GUX A;  6CPA A;  3MRU A;  4R8F A;  4M6I A;  4IHM A;  3B3W A;  1PU9 A;  4NGN A;  1LCP A;  1RXT A;  4NFR A;  2CNS A;  1B6B A;  4IK2 A;  3D7D A;  3D66 A;  4MY3 A;  2ZEH A;  3B3V A;  1K4J A;  3D2M A;  5K8O A;  3ISZ A;  4NXY A;  1TKH A;  2REF A;  2BCO A;  3N5F A;  2CF4 A;  2C27 A;  3PB9 X;  3WAB A;  4A37 A;  1IOF A;  3SXN A;  4CAE A;  5K8M A;  1F2P A;  1J4J A;  1FY7 A;  1Z8T A;  2JBJ A;  4WWV A;  3EC4 A;  5EMI A;  3PFO A;  3IWE A;  4X2T A;  3BHX A;  4B11 A;  2PE3 A;  1X12 A;  2EVN A;  2WPX A;  2OB0 A;  4CYN A;  4IUS A;  1YRE A;  2P6G A;  4MCR A;  4A31 A;  3B8G A;  4R6T A;  3K9U A;  4PV6 A;  2EK9 A;  1FT7 A;  1CP7 A;  2JBK A;  3SJX A;  3S6H A;  4GS4 A;  2PJ5 A;  2QEC A;  4MFL A;  2NSM A;  4B5P A;  3CPX A;  1ARM A;  3D4U A;  3EFA A;  1HDU A;  2REE A;  4UF4 A;  4YWY A;  3V38 A;  4AG7 A;  1H8L A;  2BOA A;  2B3V A;  2B3U A;  3IEH A;  2VZY A;  2Q7B A;  4ZYQ A;  1LRZ A;  2BUE A;  2DPT A;  2P6E A;  4MY0 A;  3IGR A;  4CRZ B;  3G3S A;  4M6G A;  2X7B A;  3R9E A;  1V0C A;  2A4N A;  2HB6 A;  2CTB A;  3PGP A;  5F47 A;  4C7H A;  1P4N A;  2AFX A;  4FD7 A;  4ZX9 A;  1ELM P;  4MHP A;  5FVJ A;  2ZOG A;  4UFW A;  4OC5 A;  3W6S A;  4NJQ A;  2OZG A;  4ONU A;  1TXR A;  5IB0 A;  3DGV A;  1XOV A;  2CY2 A;  1Q7L A;  4UIA A;  1Z4E A;  2YND A;  4ZY0 A;  4NGP A;  3FEE A;  4BD9 A;  2AFO A;  2OZU A;  5EC4 A;  5LYI A;  2ZXV A;  4MRI A;  4DYO A;  4ZI6 A;  5IB9 A;  4P10 A;  3R9G A;  2XEJ A;  3KQZ A;  2WUU A;  3SJG A;  5JM6 A;  1AUG A;  4KLV A;  1YVK A;  4AB7 A;  4OC3 A;  4TWE A;  1OZP A;  2B4D A;  2PJ0 A;  4CYP A;  5H84 A;  4KS9 A;  4KOY A;  1L0C A;  3KQX A;  4LUA A;  4J3G A;  4XNH C;  3ZZI A;  4OC0 A;  4CGL A;  4GM5 A;  5HVG A;  3TT2 A;  1M4I A;  2PJ8 A;  2V77 A;  4XPL A;  2HV2 A;  4B5P B;  2QVP A;  1YVO A;  4KOV A;  4RUH A;  4YFJ A;  2CNM A;  1R3N A;  1ELL P;  3RO0 A;  2YNC C;  3FH4 A;  4ZBG A;  3TX8 A;  4AVC A;  2DXQ A;  2WYR A;  4UIB A;  4PQA A;  2ZPA A;  4GXH A;  4L89 A;  7CPA A;  3PBB A;  4NGM A;  2ZEE A;  4B5O A;  4NJR A;  2IJZ A;  3SXO A;  5ISV A;  3KAS A;  1BPM A;  1IYK A;  3DLJ A;  1YLE A;  2Q7S A;  2I00 A;  3MGD A;  3S6G A;  3TTH A;  5F09 A;  4MHD A;  4JZ0 A;  2FT0 A;  2R8V A;  1QST A;  2V8V A;  2XEI A;  3GB0 A;  2ODF A;  3FX6 A;  2ZOF A;  3T90 A;  4KSA A;  2AFM A;  4P45 A;  3GY9 A;  1X10 A;  5GCN A;  4B6Z A;  4EFD A;  1TKF A;  2B4D B;  4KSI A;  4YU9 A;  1U6M A;  3S9N A;  1DE4 C;  1Y7E A;  3KHX A;  4PXD A;  4UEZ A;  2Z3L A;  5KTA A;  2Z3P A;  5G21 A;  4MCP A;  3NE7 A;  2Q4Y A;  3IU2 A;  1Y9K A;  3FIX A;  1M4D A;  1ARL A;  5F46 A;  2B58 A;  4LQG A;  2PQ8 A;  2F8H A;  4ONW A;  3PBE A;  1XJO A;  1LFW A;  3B35 A;  3RNZ A;  1CP6 A;  2EWB A;  4KUA A;  3SI1 A;  3CDX A;  3VAT A;  4CGO A;  2GFQ A;  4FD6 A;  3WC7 A;  4YGO A;  2DF5 A;  2FCK A;  1Q2D A;  1IOI A;  1R43 A;  2O28 A;  3FVL A;  1P0H A;  2PJ4 A;  1QMU A;  4CGN A;  2HC9 A;  2Z3N A;  2B5G A;  4TNU A;  1MK4 A;  4Y49 B;  1YR0 A;  1BAV A;  1Z8L A;  2Q44 A;  4E8O A;  1YGH A;  3VWE A;  2CTC A;  4R7M A;  4MHN A;  1ZLH A;  3S6F A;  4L8A A;  5LRJ A;  4JLY A;  4NCZ A;  2F7V A;  4NGT A;  4UCM A;  4XPK A;  1VHS A;  5AG4 A;  2JDC A;  4MBU A;  3VAR A;  4BIN A;  4FD5 A;  2ZEP A;  2JLM A;  5K8N A;  3IO1 A;  3SI0 A;  1XIX A;  5C82 A;  3D2P A;  2EK8 A;  4NF1 A;  1VGY A;  4Q7A A;  1I1D A;  4K30 A;  4A39 A;  1VKC A;  2RFH A;  4DUK A;  2ZEL A;  2J8N A;  4PSX A;  2KCW A;  4KOS A;  4QC6 A;  1XF8 A;  3V8I A;  1S7N A;  1MJB A;  5HXD A;  1Q2Y A;  1QSM A;  4G1P A;  3SHP A;  4U9Z A;  3S6K A;  1SQH A;  2PJ3 A;  5BWA B;  3F8K A;  5DWN A;  2PJA A;  2HQY A;  1N71 A;  2D4P A;  2K5T A;  2B5G B;  4BMH A;  3D68 A;  4AVB A;  1IY7 A;  3D8P A;  4PXE A;  4X5K A;  2GAN A;  3IFE A;  1KUY A;  3JUW A;  3PB8 X;  4MHZ A;  2PDO A;  3SI2 A;  1AYE A;  2GLJ A;  4MCQ A;  3FYN A;  2VEZ A;  1QSO A;  3FF3 A;  4RI1 A;  3IJ3 A;  4H6U A;  4PSW A;  2Z3M A;  4R87 A;  4HNY B;  4B14 A;  3QNV A;  2ZEN A;  3TOA A;  1ZO0 A;  4NEX A;  3LWU A;  3DR6 A;  3ZJ0 A;  4OID A;  2OR4 A;  3KR4 A;  4EVY A;  2AFS A;  1AMP A;  3D3S A;  3NH5 A;  1LAP A;  4I49 A;  4MXU A;  4QB9 A;  3IC1 A;  2YNC A;  5JGF A;  1YX0 A;  5I4M A;  3B3C A;  1VHO A;  5JQ4 A;  3F0A A;  4XPD C;  1I21 A;  1KWM A;  4M6H A;  4OME A;  3TO7 A;  2ABZ A;  3JTK A;  1Z9U A;  3KR5 A;  3LAC A;  2GLF A;  3FXT A;  3KGQ A;  4PK2 A;  4KVO E;  4PXB A;  3TC8 A;  4ZY2 A;  2PC1 A;  2R7H A;  3GIU A;  4P4B A;  5D29 A;  4AXV A;  1UFH A;  2WSA A;  3BJ8 A;  3R1K A;  4OP4 A;  1BPN A;  2Y0M A;  1CPX A;  2Z11 A;  5LRG A;  1XMB A;  1YME A;  2GE3 A;  1TF8 A;  5D8N A;  3RYO A;  5LYL A;  2NYQ A;  2BL1 A;  1PYT B;  3P2H A;  2PRQ A;  1M4G A;  1TIQ A;  4U9Y A;  5A28 A;  5EBV A;  5HMN A;  1IGB A;  2BSW A;  3BXM A;  2ZEF A;  4XNH B;  2ZW5 A;  3DNS A;  4P6Y A;  2QJ8 A;  1S60 A;  2JEV A;  1Z8W A;  3QAH A;  4OKO A;  1BOB A;  5THW A;  4CAF A;  4FBE A;  2IMO A;  2P6F A;  4JD6 A;  1KZF A;  2Q51 A;  3KL9 A;  1PUA A;  3H8F A;  5LYD A;  3R95 A;  3TCV A;  3EXN A;  4F0X A;  3KI9 A;  5J8F A;  3JVN A;  2B4B A;  1F57 A;  2FL4 A;  4M85 A;  4UA3 A;  3I1U A;  3LOD A;  3B2Y A;  4UCN A;  2AFU A;  3FBU A;  3R96 A;  3H5Z A;  4C2Y A;  5A27 A;  5ELY A;  3QB8 A;  5AG7 A;  5AG5 A;  1KUV A;  1TKJ A;  2Z3K A;  3BLN A;  2PJ6 A;  2OH1 A;  1TF9 A;  2G3T A;  4R9M A;  2PCU A;  4H6Z A;  4BBH A;  4KSF A;  3CT9 A;  2C6P A;  2BEI A;  1YW6 A;  2Z0Z A;  4E2A A;  4RS2 A;  1S5K A;  3V7Z A;  1NE9 A;  1ON0 A;  3NFZ A;  3MN8 A;  4KLW A;  2PRB A;  1A2Z A;  2FE7 A;  2J8R A;  4QBJ A;  2JEW A;  4B12 A;  1GYT A;  2Q04 A;  4CPA A;  3H8G A;  1M1D A;  3LD2 A;  4LX9 A;  3KZW A;  3FRM A;  2G3A A;  4AVA A;  1YLO A;  3CXS A;  4FWU A;  3B3T A;  2PJ7 A;  2OOT A;  1XRY A;  4NGR A;  1BLL E;  4A30 A;  3PB4 X;  4MFZ A;  2J8M A;  2VZZ A;  4F0Y A;  5HVH A;  1CG2 A;  4R57 A;  2PJ9 A;  4HNX B;  4UBR A;  4CS0 B;  4CAW A;  1ZLI A;  3UY5 A;  1S7K A;  1HEE A;  2OZH A;  3RZA A;  1XFO A;  2WZN A;  4HNW B;  1M4L A;  3PP9 A;  4ORF A;  2FXF A;  3PZJ A;  1CM0 A;  2FIA A;  1CPS A;  3NH4 A;  2EBJ A;  4R3K A;  3FNC A;  1PCA A;  2C6C A;  2IQ6 A;  3NE8 A;  2D4O A;  3GLJ A;  2OU2 A;  4P4D A;  5H86 A;  1S3Z A;  2FSR A;  2Q0Y A;  2CXA A;  2Q4V A;  2F5I A;  2AE6 A;  4B13 A;  3IU1 A;  4KUB A;  1JWQ A;  4A38 A;  2V8H A;  4HPS A;  4MI4 A;  5HH1 A;  5JH9 A;  4NSQ A;  2ARH A;  3JRU A;  1Y7R A;  2YNE A;  4ZY1 A;  4KOT A;  4AG9 A;  5LYF A;  2GRE A;  4FUU A;  4OC2 A;  4F8Z A;  3DDD A;  1JQG A;  1M44 A;  2FIW A;  2H5M A;  2IL4 A;  1LAN A;  1R57 A;  3CZX A;  5E96 A;  3B3S A;  3IWW A;  4OIW A;  4KOR A;  2Q4Z A;  2QIR A;  2VQY A;  4JXQ A;  1OBR A;  3EO4 A;  4LQ6 A;  4IAV A;  4Z65 A;  2PSW A;  3PFE A;  3L2N A;  1FNO A;  2ZW7 A;  3TFY A;  2ZEG A;  1MJ9 A;  1QSR A;  4OAD A;  4Q38 A;  1CX8 A;  1IB1 E;  3LMS A;  2I3C A;  2R1I A;  2ATR A;  4KVX A;  2QYV A;  5IV0 A;  2ZED A;  1ZG9 A;  4K3N A;  4P4J A;  3P2F A;  4UWJ A;  5I0C A;  1XMT A;  4EWT A;  2VL1 A;  3WT4 A;  4A2Z A;  1F2O A;  5G1Z A;  4CAX A;  3E0K A;  4UWI A;  4F9U A;  4Q36 A;  4DJL A;  3RAM A;  3T8W A;  5CBM A;  3ISX A;  4CAV A;  1QSN A;  2BO9 A;  4OC4 A;  2O4H A;  1Z4R A;  2R98 A;  2CIJ A;  4A95 A;  4A32 A;  3SJF A;  1KUX A;  1LOK A;  1Z8X A;  1GHE A;  3KHZ A;  2ZW4 A;  1RO5 A;  1LAM A;  1XEB A;  2GIV A;  2JDD A;  3EY5 A;  3T9Y A;  2Z10 A;  4PXC A;  5AG6 A;  4C7I A;  5G20 A;  4PK3 A;  3HLP A;  3WR7 A;  2AFZ A;  4P4E A;  1Y9W A;  3G8W A;  4CYQ A;  4JJX A;  2Z3O A;  3CXP A;  5K8P A;  4RN7 A;  4II9 A;  1NMT A;  2FS5 A;  3CPA A;  3BJ7 A;  3FB3 A;  2AFW A;  3N7Z A;  4UFV A;  3W6X A;  4XPD B;  4ZGY B;  3F5B A;  4IF5 A;  4H2K A;  4OAE A;  4JWP A;  3I3G A;  4F9V A;  4MJ8 A;  5AGE A;  1IID A;  1VIX A;  1VHE A;  1BO4 A;  1Y0R A;  2G9D A;  2VI7 A;  4UCP A;  2NMT A;  2PIY A;  2PJB A;  3S9M A;  2YGW A;  4X3R A;  3PRT A;  4YRH A;  4HKF A;  1RTQ A;  2DPS A;  2WPW A;  4X8I A;  4U5Y A;  4CRY B;  4KZT A;  3D7H A;  5LRK A;  3D7F A;  2O53 A;  3SJE A;  1Y0Y A;  1WK4 A;  1EE3 P;  2AJ6 A;  3H8E A;  3PB6 X;  4OLL A;  2C1C A;  3DSB A;  4OC1 A;  4A33 A;  4C2X A;  2VBQ A;  1CJW A;  1ZG7 A;  3C26 A;  3FEC A;  3H4Q A;  4FD4 A;  1ZG8 A;  4MFQ A;  3VH9 A;  3TE4 A;  3QAY A;  1UWY A;  3NH8 A;  4A94 A;  4UEF A;  1IYL A;  2FVG A;  4MFJ A;  4MMO A;  2RB7 A;  2V8G A;  3GKR A;  4PPZ A;  5DS0 A;  4E0A A;  2PJ1 A;  3B7I A;  2RC4 A;  3WC6 A;  1YQE A;  3TO6 A;  2EO8 A;  4CYO A;  5KTD A;  4KOX A;  3IWG A;  5G22 A;  4CGP A;  5CPA A;  4EME A;  2ZEM A;  5C88 A;  2V8D A;  1I12 A;  1HDQ A;  1XE4 A;  3A9L A;  3NA6 A;  4KVM E;  2GU2 A;  3WC5 A;  5J1Q A;  3OWC A;  3FED A;  2C6G A;  2QML A;  3BI1 A;  1YSJ A;  3FJU A;  3PB7 X;  3W91 A;  1S7L A;  3S9L A;  5CNP A;  3BI0 A; 
#chains in the Genus database with same CATH homology
 4JXR A;  2CNT A;  2PR1 A;  4CGM A;  4C68 A;  1YK3 A;  4KOW A;  4M3S A;  4DNC A;  2EUI A;  1Q2C A;  5F48 A;  5KTC A;  4QUS A;  2G0B A;  5F49 A;  1S7F A;  3VWD A;  1WWZ A;  4B10 A;  4Y49 C;  1NSL A;  4MFP A;  5DWM A;  4KOU A;  3R9F A;  3KKW A;  1B87 A;  4UFX A;  2I79 A;  2HUZ A;  3TOB A;  2VXK A;  5JPH A;  4R3L A;  4QVT A;  3I9S A;  4C2Z A;  2ZW6 A;  4H89 A;  1MJA A;  5IX3 A;  5J8C A;  3CXQ A;  3DR8 A;  2PR8 A;  4MFK A;  3TO9 A;  4F6A A;  1IIC A;  3GYA A;  2P0W A;  1PU9 A;  1RXT A;  2CNS A;  1B6B A;  4MY3 A;  1K4J A;  3D2M A;  4NXY A;  2REF A;  4CAE A;  2C27 A;  3SXN A;  1J4J A;  1FY7 A;  3EC4 A;  3IWE A;  4B11 A;  2EVN A;  2WPX A;  2OB0 A;  4CYN A;  4IUS A;  1YRE A;  2P6G A;  4A31 A;  3B8G A;  3K9U A;  4PV6 A;  3S6H A;  4GS4 A;  2QEC A;  4MFL A;  4B5P A;  4II9 A;  3EFA A;  4AG7 A;  2REE A;  2B3V A;  2B3U A;  2VZY A;  2Q7B A;  1LRZ A;  2BUE A;  2DPT A;  2P6E A;  4MY0 A;  3IGR A;  4CRZ B;  3G3S A;  2X7B A;  3R9E A;  1V0C A;  2A4N A;  3PGP A;  5F47 A;  4C7H A;  1P4N A;  4FD7 A;  5FVJ A;  4UFW A;  3W6S A;  2OZG A;  4ONU A;  5IB0 A;  2CY2 A;  1Z4E A;  2YND A;  2OZU A;  5EC4 A;  2ZXV A;  3R9G A;  2WUU A;  4KLV A;  1YVK A;  4AB7 A;  1OZP A;  2B4D A;  4CYP A;  5H84 A;  4KS9 A;  4KOY A;  1L0C A;  4LUA A;  4XNH C;  4J3G A;  3ZZI A;  4CGL A;  3TT2 A;  1M4I A;  4XPL A;  4B5P B;  2HV2 A;  4YFJ A;  1YVO A;  4KOV A;  2CNM A;  2YNC C;  4ZBG A;  4AVC A;  2DXQ A;  2ZPA A;  4L89 A;  4B5O A;  5ISV A;  3SXO A;  3S6G A;  1IYK A;  1YLE A;  3MGD A;  2I00 A;  3TTH A;  4MHD A;  2FT0 A;  2R8V A;  1QST A;  3T90 A;  4KSA A;  3GY9 A;  5GCN A;  2B4D B;  1U6M A;  2Z3L A;  5KTA A;  2Z3P A;  5G21 A;  3NE7 A;  2Q4Y A;  3IU2 A;  1Y9K A;  3FIX A;  1M4D A;  5F46 A;  2B58 A;  2PQ8 A;  4KUA A;  4CGO A;  4FD6 A;  4YGO A;  2FCK A;  1Q2D A;  2O28 A;  1P0H A;  4CGN A;  2Z3N A;  2B5G A;  1MK4 A;  4Y49 B;  1YR0 A;  4E8O A;  2Q44 A;  1YGH A;  3VWE A;  3S6F A;  4L8A A;  4JLY A;  4NCZ A;  4UCM A;  4XPK A;  1VHS A;  5AG4 A;  2JDC A;  4MBU A;  4FD5 A;  2JLM A;  1XIX A;  5C82 A;  3D2P A;  4NF1 A;  1I1D A;  4K30 A;  1VKC A;  2J8N A;  4PSX A;  2KCW A;  4KOS A;  4QC6 A;  1XF8 A;  3V8I A;  1S7N A;  1MJB A;  1Q2Y A;  1QSM A;  3SHP A;  4U9Z A;  3S6K A;  1SQH A;  5BWA B;  3F8K A;  5DWN A;  2HQY A;  1N71 A;  2D4P A;  2K5T A;  2B5G B;  4BMH A;  4AVB A;  3D8P A;  4X5K A;  2GAN A;  1KUY A;  3JUW A;  2PDO A;  3FYN A;  2VEZ A;  1QSO A;  4RI1 A;  4H6U A;  4PSW A;  2Z3M A;  4R87 A;  4HNY B;  4B14 A;  3TOA A;  1ZO0 A;  4NEX A;  3DR6 A;  3ZJ0 A;  4EVY A;  3D3S A;  4I49 A;  4QB9 A;  2YNC A;  1YX0 A;  5JQ4 A;  3F0A A;  4XPD C;  1I21 A;  3TO7 A;  3JTK A;  1Z9U A;  3FXT A;  4PK2 A;  4KVO E;  2PC1 A;  2R7H A;  1UFH A;  2WSA A;  3BJ8 A;  3R1K A;  2Y0M A;  2Z11 A;  2GE3 A;  3RYO A;  2BL1 A;  3P2H A;  1M4G A;  1TIQ A;  4U9Y A;  5A28 A;  5EBV A;  5HMN A;  2BSW A;  4XNH B;  2ZW5 A;  3DNS A;  1S60 A;  3QAH A;  2JEV A;  4CAF A;  1BOB A;  2P6F A;  4JD6 A;  1KZF A;  1PUA A;  4F0X A;  3R95 A;  3TCV A;  5J8F A;  3EXN A;  3JVN A;  2B4B A;  2FL4 A;  4M85 A;  4UA3 A;  3LOD A;  4UCN A;  3FBU A;  3R96 A;  3H5Z A;  4C2Y A;  5A27 A;  3QB8 A;  5AG7 A;  5AG5 A;  1KUV A;  2Z3K A;  3BLN A;  2OH1 A;  2G3T A;  4R9M A;  4H6Z A;  4BBH A;  4KSF A;  2BEI A;  2Z0Z A;  4E2A A;  4RS2 A;  1S5K A;  1NE9 A;  1ON0 A;  4KLW A;  2PRB A;  2FE7 A;  2J8R A;  4QBJ A;  4B12 A;  2Q04 A;  1M1D A;  3LD2 A;  4LX9 A;  3FRM A;  2G3A A;  4AVA A;  3CXS A;  4A30 A;  4MFZ A;  2J8M A;  2VZZ A;  4F0Y A;  4R57 A;  4HNX B;  4UBR A;  4CS0 B;  4CAW A;  3UY5 A;  1S7K A;  2OZH A;  4HNW B;  3PP9 A;  4ORF A;  3PZJ A;  2FXF A;  1CM0 A;  2FIA A;  4R3K A;  3FNC A;  2D4O A;  5H86 A;  2OU2 A;  2Q0Y A;  1S3Z A;  2FSR A;  2CXA A;  2Q4V A;  2F5I A;  2AE6 A;  4B13 A;  3IU1 A;  4KUB A;  4MI4 A;  5HH1 A;  4NSQ A;  2ARH A;  1Y7R A;  2YNE A;  4KOT A;  4AG9 A;  3DDD A;  1M44 A;  2FIW A;  2H5M A;  2IL4 A;  1R57 A;  5E96 A;  4KOR A;  2VQY A;  2QIR A;  4JXQ A;  3EO4 A;  2PSW A;  2ZW7 A;  3TFY A;  1MJ9 A;  1QSR A;  4OAD A;  4Q38 A;  1IB1 E;  2R1I A;  2ATR A;  4KVX A;  5IV0 A;  3P2F A;  4UWJ A;  5I0C A;  1XMT A;  4A2Z A;  5G1Z A;  4CAX A;  3E0K A;  4UWI A;  4Q36 A;  4CAV A;  1QSN A;  1Z4R A;  2R98 A;  4A95 A;  4A32 A;  1KUX A;  1GHE A;  2ZW4 A;  1RO5 A;  1XEB A;  2GIV A;  2JDD A;  3EY5 A;  3T9Y A;  2Z10 A;  5AG6 A;  4C7I A;  5G20 A;  4PK3 A;  3WR7 A;  1Y9W A;  3G8W A;  4CYQ A;  4JJX A;  2Z3O A;  3CXP A;  1NMT A;  2FS5 A;  3W6X A;  3BJ7 A;  3FB3 A;  3N7Z A;  4UFV A;  4XPD B;  4ZGY B;  3F5B A;  4IF5 A;  4OAE A;  4JWP A;  3I3G A;  4MJ8 A;  5AGE A;  1IID A;  1BO4 A;  2VI7 A;  4UCP A;  2NMT A;  2YGW A;  4YRH A;  4HKF A;  2DPS A;  2WPW A;  4U5Y A;  4CRY B;  4KZT A;  1WK4 A;  2AJ6 A;  4OLL A;  4A33 A;  3DSB A;  4C2X A;  2VBQ A;  1CJW A;  3C26 A;  4FD4 A;  4MFQ A;  3H4Q A;  3TE4 A;  1IYL A;  4MFJ A;  3GKR A;  4E0A A;  2RC4 A;  5KTD A;  3TO6 A;  4CYO A;  4KOX A;  3IWG A;  5G22 A;  4CGP A;  5C88 A;  1I12 A;  4KVM E;  1XE4 A;  3A9L A;  3OWC A;  2QML A;  3W91 A;  1S7L A;  5CNP A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...