4JJXA

Dodecameric structure of spermidine n-acetyltransferase speg from vibrio cholerae o1 biovar eltor
Total Genus 46
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
46
sequence length
172
structure length
172
Chain Sequence
AMNSQLTLRALERGDLRFIHNLNNNRNIMSYWFEEPYESFDELEELYNKHIHDNAERRFVVEDAQKNLIGLVELIEINYIHRSAEFQIIIAPEHQGKGFARTLINRALDYSFTILNLHKIYLHVAVENPKAVHLYEECGFVEEGHLVEEFFINGRYQDVKRMYILQSKYLNR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords Spermidine n1-acetyltransferase
publication title A Novel Polyamine Allosteric Site of SpeG from Vibrio cholerae Is Revealed by Its Dodecameric Structure.
pubmed doi rcsb
source organism Vibrio cholerae o1 biovar el tor
total genus 46
structure length 172
sequence length 172
chains with identical sequence B, C
ec nomenclature ec 2.3.1.57: Diamine N-acetyltransferase.
pdb deposition date 2013-03-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13302 Acetyltransf_3 Acetyltransferase (GNAT) domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.630.30 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Aminopeptidase 4jjxA00
4XNHC 1YK3A 4QUSA 4CRYB 4R3LA 4KVOE 4I49A 4MI4A 3TOAA 2R98A 1N71A 4KOXA 5KTCA 5EBVA 4KLWA 5JQ4A 2B4DA 3DDDA 3S6GA 1NMTA 4KLVA 3CXPA 3EY5A 2PQ8A 5EC4A 1CJWA 3D8PA 3DSBA 1KUYA 3EO4A 1XMTA 4FD5A 1L0CA 1YR0A 2I00A 1RXTA 4CAXA 2R1IA 2G3AA 2B5GA 3SXNA 4KOWA 4XPDC 3SXOA 2HV2A 3DNSA 3R9GA 1OZPA 1PU9A 3KKWA 4II9A 2KCWA 2ZPAA 3CXSA 3EXNA 3G8WA 2QIRA 3TO6A 2ZXVA 2OZUA 4Y49B 3R9FA 4UA3A 1Q2YA 4J3GA 3JUWA 1IYKA 3TE4A 4ONUA 2FT0A 3TCVA 1WK4A 4LUAA 1MK4A 1VHSA 1S7LA 2Q4YA 3FBUA 1BO4A 3NE7A 3TO9A 1J4JA 1QSMA 5GCNA 3VWDA 3QAHA 4B5PB 3BJ8A 2GE3A 5HH1A 4QC6A 2RC4A 2P6EA 2VXKA 3TOBA 3W91A 4EVYA 4JXRA 3TTHA 3RYOA 4JWPA 3FXTA 1LRZA 1M4DA 2WPWA 2GANA 3D2PA 1YVOA 4KVXA 2HQYA 5CNPA 5F48A 1IB1E 4KOUA 1IICA 4YFJA 3SHPA 2QMLA 2O28A 4UBRA 4H6UA 3R1KA 2Q04A 4QB9A 2FIWA 2FXFA 4ZBGA 1S60A 4NSQA 4NEXA 1P0HA 2AE6A 2EUIA 3B8GA 4NXYA 1Y9KA 5KTAA 1YLEA 3GYAA 4H6ZA 3LD2A 4KVME 4U9YA 4YGOA 4RI1A 4QBJA 4JD6A 3VWEA 4H89A 1PUAA 2G3TA 2CNMA 4XPLA 4OAEA 2ATRA 2Z0ZA 4CRZB 3ZJ0A 4IUSA 4CAVA 3W6SA 4Y49C 1V0CA 3R95A 3S6HA 4HKFA 4K30A 2Z11A 4CS0B 4AVCA 4PSWA 3FNCA 4KOVA 1UFHA 3I3GA 4KORA 5IV0A 1B6BA 2BUEA 1VKCA 1XE4A 1M44A 3FB3A 3T9YA 4R87A 1RO5A 1NSLA 4YRHA 2Q0YA 4JXQA 1GHEA 3E0KA 2I79A 4AG7A 2B58A 3PZJA 1WWZA 2B5GB 1B87A 2AJ6A 2FE7A 2J8NA 2VBQA 1KUXA 2OZHA 4MHDA 5I0CA 1R57A 3K9UA 1YGHA 4KOTA 2GIVA 2ZW6A 1KUVA 3FYNA 2G0BA 2REEA 4LX9A 3MGDA 2PR8A 2VEZA 5H84A 1M4GA 3JVNA 1Y9WA 2B3UA 3FRMA 3LODA 2C27A 1MJAA 3ZZIA 3GKRA 4OLLA 3H4QA 2P6FA 3N7ZA 4B5PA 2IL4A 1YX0A 3D3SA 3I9SA 2K5TA 3TT2A 2D4PA 2ZW4A 4AVBA 1Z4EA 5F46A 3IWGA 4XPKA 2VI7A 3BLNA 2BSWA 2P6GA 2VZZA 3S6FA 4ORFA 1QSRA 4HNYB 4E2AA 2EVNA 1YVKA 3IGRA 3QB8A 1ON0A 2CNSA 4GS4A 3S6KA 4NCZA 1M1DA 2J8RA 1I1DA 4NF1A 5F49A 3R96A 4FD6A 2R8VA 2B3VA 1P4NA 5F47A 3P2FA 2PR1A 2FIAA 5JPHA 4IF5A 4E8OA 1MJBA 4HNXB 5C82A 4FD4A 2WPXA 1CM0A 3F8KA 4AG9A 2PRBA 3GY9A 5J8CA 2ZW7A 3C26A 4AB7A 5KTDA 3CXQA 2Q7BA 1S3ZA 1Y7RA 2HUZA 5H86A 5DWMA 4R57A 3PGPA 4L89A 1QSNA 2ARHA 2B4DB 3TO7A 4AVAA 2FSRA 3P2HA 1MJ9A 2JEVA 2PDOA 2J8MA 1IYLA 1YREA 2OB0A 5C88A 2CNTA 3F0AA 2R7HA 3OWCA 2VZYA 4M3SA 4PK2A 2FL4A 3T90A 2QECA 1S5KA 2H5MA 1Z9UA 2OZGA 5ISVA 2DXQA 1IIDA 4QVTA 2Y0MA 2JDDA 2JDCA 4OADA 5HMNA 2X7BA 4XNHB 4E0AA 4KUBA 1S7KA 2PSWA 4B5OA 4F6AA 1I21A 2NMTA 4MY3A 4MJ8A 5E96A 2REFA 4X5KA 1S7NA 1SQHA 4JLYA 3TFYA 4R9MA 2A4NA 1K4JA 4U5YA 2FS5A 1Q2CA 1S7FA 2BEIA 3R9EA 1XF8A 4DNCA 2FCKA 4XPDB 1FY7A 4CAWA 2JLMA 3UY5A 1TIQA 4KZTA 4MY0A 1U6MA 3F5BA 4JJXA 4BMHA 3WR7A 5IX3A 5J8FA 2OU2A 4PK3A 1XIXA 1QSOA 3PP9A 4HNWB 1KZFA 2CY2A 3DR8A 5DWNA 2Q4VA 2VQYA 2B4BA 1I12A 2OH1A 4KOSA 1Z4RA 5FVJA 4L8AA 4UWIA 4U9ZA 3G3SA 3D2MA 1QSTA 2Z10A 3FIXA 4KUAA 1NE9A 2F5IA 2P0WA 2PC1A 4FD7A 4PSXA 3EFAA 4PV6A 5IB0A 4M85A 1XEBA 2BL1A 1M4IA 3DR6A 3W6XA 2Q44A 1BOBA 2D4OA 4KOYA 4UWJA 3V8IA 3EC4A 4R3KA 3BJ7A 4MBUA 1Q2DA 4RS2A 4F0YA 2ZW5A
chains in the Genus database with same CATH superfamily
1XFOA 2OR4A 4ZX8A 4UCNA 3CZXA 1YK3A 3MN8A 4QUSA 4MCSA 4XNHC 4CRYB 4NGPA 4CGPA 4R3LA 2F7VA 4KVOE 4MFKA 1Z2LA 4I49A 4MI4A 1HDUA 2R98A 3TOAA 2BO9A 1N71A 4TNUA 1ELMP 5D8NA 4KOXA 4F9VA 5KTCA 3KI9A 5EBVA 4KLWA 5AG6A 2QJ8A 5JQ4A 4ZY1A 2B4DA 3DDDA 3S6GA 1NMTA 3FF3A 4KLVA 1ARMA 3CXPA 4CPAA 3EY5A 2PQ8A 5EC4A 1YLOA 2GLJA 2WZNA 2I3CA 5LRGA 1CJWA 5LRKA 3D8PA 2DEAA 3DSBA 5D29A 1KUYA 1FT7A 3EO4A 1XMTA 4FD5A 4CYQA 1L0CA 1YR0A 3CPXA 4OKOA 4X2TA 2I00A 1NSAA 1RXTA 4KSAA 4OP4A 4CAXA 2R1IA 2EK8A 4CYPA 2ABZA 2DPSA 2G3AA 2ZOGA 2B5GA 2PJAA 3SXNA 5LYFA 4KOWA 1DTDA 4XPDC 3SXOA 2HV2A 3DNSA 3R9GA 1YW6A 4IAVA 5LYLA 1OZPA 1Z8LA 1PU9A 3KKWA 4II9A 1XMBA 3PB9X 3TX8A 2KCWA 2ZPAA 4A31A 4CYOA 3CXSA 3EXNA 2PJ3A 3G8WA 5HVHA 3BXMA 2QIRA 3TO6A 2ZXVA 3B3TA 2OZUA 4Y49B 3R9FA 4UA3A 1JQGA 5G22A 1Q2YA 4R8FA 3I1UA 1CP7A 4J3GA 3JUWA 1IYKA 1TF8A 2IJZA 3TE4A 4ONUA 1Y0RA 4AXVA 2FT0A 1PCAA 4M6IA 3DGVA 3S9NA 2Q43A 3LACA 3TCVA 3VH9A 1YSJA 2JEWA 2PJ6A 3PB4X 1WK4A 3LMSA 3T8WA 1BPNA 4A95A 3HUVA 4LUAA 2FVGA 2XEFA 3BI1A 2PJ0A 1MK4A 1VHSA 4ONWA 4KSIA 5LYDA 1S7LA 2Q4YA 3NE8A 4BD9A 3FBUA 1BO4A 1KWMA 3NE7A 3NFZA 4W9YA 5G20A 4EWTA 5JM6A 2ZEPA 3H8EA 3TO9A 3D68A 1J4JA 1QSMA 5GCNA 4UIBA 3VWDA 3A9LA 4RUHA 2BCOA 1GYTA 4KS9A 1XRYA 3WC6A 3K2KA 3QAHA 4DJLA 4MFPA 3KR5A 3BJ8A 5G1ZA 4B5PB 5HVFA 4UEFA 2GE3A 5HH1A 4QC6A 4WWVA 4NGMA 4P4IA 2RC4A 4BBHA 2P6EA 2VXKA 4P6YA 3TOBA 4C2YA 2ZEOA 3W91A 4EVYA 4JXRA 3TTHA 3RYOA 3S9MA 4CAFA 2VL1A 4JWPA 3B2YA 1LRZA 1M4DA 2C6PA 3FEEA 3FXTA 4P4EA 4CGLA 2WPWA 2GANA 3D2PA 1YVOA 1AYEA 4KVXA 2HQYA 2JBJA 1VGYA 2PJ7A 4P44A 5CNPA 5F48A 2YNDA 1IB1E 4KOUA 1IICA 3NH5A 4YFJA 2AFXA 3SHPA 1F57A 1CBXA 2PJ2A 2QMLA 3B3WA 3PBBA 2ZELA 2O28A 4P4JA 3GB0A 4UBRA 1Z8WA 4LQ6A 2PJ5A 4H6UA 3R1KA 3D7DA 3CPAA 2Q04A 4QB9A 4UIAA 2EBJA 2FIWA 1YW4A 2FXFA 4UF4A 5I4MA 3SJXA 4ZBGA 4FUUA 1S60A 2AFZA 2GREA 2Z3LA 4NEXA 4NSQA 4Q7AA 4NGTA 4ZY0A 2PJ8A 1YQEA 4MFLA 3KHXA 1P0HA 2AE6A 2CTCA 2AFUA 2EUIA 3D7GA 4MCPA 4A39A 1AUGA 3B8GA 4NXYA 3SJGA 2CXAA 4RN7A 1Y9KA 4B13A 5KTAA 5K8PA 1YLEA 1ZG7A 3V7ZA 3GYAA 5I0CA 4H6ZA 3PFEA 3NA6A 4PPZA 4C7HA 1IU8A 3PBEA 5K8NA 3LD2A 4KVME 1JWQA 4U9YA 2YNEA 4YGOA 4RI1A 4QBJA 4JD6A 3RBUA 3VWEA 2PIYA 1DE4C 1PUAA 4H89A 2G3TA 2CNMA 2ZEEA 4XPLA 4OAEA 2ATRA 2Z0ZA 4CRZB 2NYQA 4BINA 5AGEA 1QMUA 3ZJ0A 4IUSA 1UWYA 5A27A 4CAVA 3W6SA 2V77A 4Y49C 1V0CA 3R95A 2PE3A 3B7IA 3S6HA 4HKFA 2PJ4A 2Z11A 3PEIA 4K30A 4CS0B 1XJOA 4AVCA 4PSWA 1ZG9A 3FNCA 4C7IA 2YNCA 4KOVA 4OIWA 4P4FA 5G21A 1CPXA 4JZ0A 1UFHA 3I3GA 4GXHA 4CGMA 4MHYA 4OC0A 2GLFA 2ZEFA 4KORA 2RFHA 5IV0A 1B6BA 5K8MA 3NH8A 3FECA 2BUEA 2WSAA 3B3SA 3FMCA 1VKCA 3RAMA 7CPAA 5JGFA 4C68A 1XE4A 1M44A 4Q36A 2J9AA 3FB3A 3T9YA 4R87A 4NGRA 1RO5A 1NSLA 2AFOA 4GM5A 4YRHA 1TKFA 2Q0YA 3L2NA 4JXQA 1Y7EA 1GHEA 3KQXA 3WC7A 5J1QA 3E0KA 2I79A 3B3VA 3PRTA 4AG7A 3KASA 2B58A 3PZJA 4NGQA 4KSFA 1WWZA 2B5GB 1B87A 2AJ6A 2FE7A 2J8NA 2VBQA 1KUXA 2OZHA 3HLPA 4MHDA 1IOIA 4A38A 5CBMA 1R57A 3K9UA 1LANA 4MRIA 1YGHA 2Z3NA 4KOTA 4M6GA 2PVWA 3BHXA 5AG5A 4B10A 3IWWA 4ZX9A 3FEDA 4UFVA 2GIVA 2ZW6A 3PB7X 3SI2A 1KUVA 2PJCA 4OC5A 3ISXA 4CYNA 3FYNA 4EFDA 2HB6A 2PVVA 2G0BA 2REEA 1Z8XA 4TWEA 4R6TA 2EO8A 4LX9A 4OC3A 3H8GA 3MGDA 2PR8A 2VEZA 5H84A 1M4GA 2HC9A 1Y0YA 2BOAA 3JVNA 5THWA 1Y9WA 1TKHA 2B3UA 2CTBA 3FRMA 3GIUA 3PB6X 2EWBA 2PCUA 3NH4A 6CPAA 3LODA 4ZGYB 2C27A 2V8GA 4MFZA 4EMEA 1MJAA 3ZZIA 4PXDA 5CPAA 3GKRA 4OLLA 4MCRA 3H4QA 1LFWA 2P6FA 2WUUA 2CF4A 1AMPA 4NFRA 4WJBA 3N7ZA 2Z3MA 4B5PA 2IL4A 3S9LA 1YX0A 2EK9A 3IC1A 2Z3PA 3D3SA 3I9SA 1VIXA 2K5TA 3KR4A 3TT2A 2D4PA 2ZW4A 3LWUA 1VHEA 4PXCA 2ANPA 2V8HA 2XEGA 4M6HA 4UCPA 1Z4EA 3SJFA 4A33A 3IWGA 4AVBA 4XPKA 2VI7A 5F46A 3BLNA 2BSWA 2P6GA 2VZZA 5ELYA 1X10A 2IMOA 3S6FA 4ORFA 1LOKA 3VATA 1QSRA 4HNYB 4E2AA 2GFQA 2EVNA 3CT9A 4B14A 1YVKA 3SJEA 4P4DA 3IGRA 3QB8A 5IB9A 4OC4A 1ON0A 2CNSA 4GS4A 3S6KA 4NCZA 3SI0A 4Z65A 1M1DA 2Z3KA 3N5FA 4JYWA 2J8RA 1I1DA 4NF1A 4O23A 4YU9A 5F49A 5A28A 3R96A 2V8VA 4FD6A 2R8VA 2B3VA 3FH4A 1ZLHA 1Z5RA 2ZOFA 1P4NA 1CPSA 3IWEA 4UFXA 1RTQA 1ZO0A 3P2FA 5F47A 3RZAA 1F2OA 2O53A 4IK2A 2PR1A 4NJQA 2FIAA 1Z8TA 5EMIA 3GUXA 5JPHA 2Q51A 2O4HA 4IF5A 4E8OA 3B3CA 3CDXA 3D4UA 5BWAB 1MJBA 1F2PA 1LAPA 2AFSA 2Q7SA 4HNXB 5C82A 4UEEA 4FD4A 3JTKA 2WPXA 3K9TA 4A94A 3D7HA 4F0XA 3IU2A 1CM0A 3F8KA 4AG9A 1IOFA 2PRBA 1CX8A 3ISZA 4MMOA 3V38A 3GY9A 5J8CA 2YGWA 2ZW7A 4PXBA 3C26A 4AB7A 4A2ZA 5KTDA 3MRUA 3CXQA 2Q7BA 3PB8X 4MHNA 4P4BA 1BLLE 1S3ZA 4MHPA 2OOTA 2PJ1A 4B12A 4CAEA 1Y7RA 2HUZA 4A37A 5H86A 5DWMA 4ZY2A 4P45A 4R57A 3PGPA 4UFWA 4L89A 1HEEA 1XOVA 1QSNA 4NGNA 2ARHA 2B4DB 5HXDA 3TC8A 3TO7A 4AVAA 2FSRA 3P2HA 1EE3P 4OIDA 5DS0A 3D7FA 1MJ9A 2JEVA 2PDOA 4IHMA 2J8MA 1IYLA 1YREA 5HVGA 2OB0A 1CP6A 4UCMA 5C88A 4MXUA 2CNTA 4YWYA 3F0AA 2R7HA 1R3NA 2AFMA 2VZYA 3OWCA 4M3SA 4F0YA 3SI1A 4PK2A 5K8OA 2FL4A 4MFJA 4A30A 1LCPA 4NGSA 1CG2A 3T90A 1PYTB 2QECA 1S5KA 2F8HA 2H5MA 4HPSA 1Z9UA 2OZGA 2ZEHA 4X3RA 2Z3OA 1LAMA 4F9UA 5ISVA 2DXQA 1HDQA 1IIDA 4R76A 5AG7A 3WT4A 2JBKA 4QVTA 2Y0MA 3IEHA 2C6GA 2JDDA 2PJ9A 2JDCA 3FVLA 4DUKA 3QAYA 4OADA 5HMNA 3RO0A 1YMEA 2X7BA 3WABA 4XNHB 4E0AA 4KUBA 1S7KA 2PSWA 3JRUA 2G9DA 4B5OA 1OBRA 1R43A 2PIZA 1IGBA 2QVPA 1I21A 4F6AA 3D67A 3H8FA 2NMTA 4B6ZA 4MY3A 3BI0A 1ELLP 1BPMA 3IO1A 4MJ8A 5E96A 4NJRA 2REFA 4X5KA 1S7NA 1SQHA 4JLYA 3TFYA 4OC2A 3IU1A 3KGQA 1A2ZA 4R9MA 4B11A 4C2XA 2A4NA 3QNVA 4DYOA 1K4JA 4FWUA 4U5YA 2FS5A 4FBEA 1Q2CA 1S7FA 1X12A 5JH9A 4F8ZA 2V8DA 3D66A 4R7MA 2BEIA 3R9EA 1XF8A 4DNCA 2AFWA 4FAIA 1ZLIA 2FCKA 3VARA 4XPDB 1FY7A 3PFOA 4CAWA 2JLMA 3UY5A 1TIQA 4CGNA 5F09A 1BAVA 4ZYQA 2ODFA 3FX6A 4KZTA 4X8IA 4MY0A 1U6MA 3F5BA 4JJXA 2WYRA 4Q38A 4BMHA 3WR7A 5LYIA 5IX3A 5J8FA 2OU2A 2XEJA 4PK3A 4MHZA 2XEIA 4OC1A 1XIXA 1QSOA 4CGOA 4PQAA 3PP9A 4HNWB 2Q4ZA 1KZFA 2CY2A 3DR8A 5DWNA 2Q4VA 2QYVA 2VQYA 4PXEA 5LRJA 5AG4A 2B4BA 2ZEGA 1I12A 1TF9A 2C1CA 2OH1A 4KOSA 1Z4RA 2POKA 3H5ZA 5FVJA 2IQ6A 4L8AA 4UWIA 4U9ZA 2PRQA 2YNCC 2PJBA 1ARLA 1FNOA 3G3SA 3KQZA 2ZEDA 1IY7A 3IFEA 4UEZA 3D2MA 1QSTA 3KHZA 4A32A 4ZI6A 1ZG8A 2Z10A 1XBUA 2ZENA 3FIXA 4KUAA 1NE9A 2F5IA 2P0WA 2PC1A 4FD7A 2C6CA 4H2KA 3EFAA 4PSXA 4PV6A 5IB0A 4M85A 2RB7A 1M4LA 1XEBA 4LQGA 2BL1A 4P10A 2DF5A 1QQ9A 3KL9A 3KZWA 1M4IA 3DR6A 4MCQA 3W6XA 2GU2A 2ZEMA 2Q44A 3IIBA 1H8LA 1TXRA 4C2ZA 3B35A 1BOBA 2D4OA 4KOYA 1Q7LA 4UWJA 2CIJA 3DLJA 3V8IA 3FJUA 3EC4A 4K3NA 4R3KA 3RNZA 3WC5A 2NSMA 3BJ7A 4MBUA 1VHOA 4OMEA 3GLJA 1Q2DA 4RS2A 4G1PA 3IJ3A 1TKJA 4MFQA 8CPAA 2DPTA 2ZW5A
chains in the Genus database with same CATH topology
4UCNA 4XNHC 1YK3A 4QUSA 4CRYB 4CGPA 4R3LA 4KVOE 4MFKA 4I49A 4MI4A 3TOAA 2R98A 1N71A 4KOXA 5KTCA 5EBVA 4KLWA 5AG6A 5JQ4A 2B4DA 3DDDA 3S6GA 1NMTA 4KLVA 3CXPA 3EY5A 2PQ8A 5EC4A 1CJWA 3D8PA 3DSBA 1KUYA 4CYQA 3EO4A 1XMTA 4FD5A 1L0CA 1YR0A 2I00A 1RXTA 4KSAA 4CAXA 4CYPA 2R1IA 2DPSA 2G3AA 2B5GA 3SXNA 4KOWA 4XPDC 3SXOA 2HV2A 3DNSA 3R9GA 1OZPA 1PU9A 3KKWA 4II9A 2KCWA 2ZPAA 4A31A 4CYOA 3CXSA 3EXNA 3G8WA 2QIRA 3TO6A 2ZXVA 2OZUA 4Y49B 3R9FA 4UA3A 5G22A 1Q2YA 4J3GA 3JUWA 1IYKA 3TE4A 4ONUA 2FT0A 3TCVA 1WK4A 4A95A 4LUAA 1MK4A 1VHSA 1S7LA 2Q4YA 3FBUA 1BO4A 3NE7A 5G20A 3TO9A 1J4JA 1QSMA 5GCNA 3VWDA 3A9LA 4KS9A 3QAHA 4MFPA 5G1ZA 3BJ8A 4B5PB 2GE3A 5HH1A 4QC6A 2RC4A 4BBHA 2P6EA 2VXKA 3TOBA 4C2YA 3W91A 4EVYA 4JXRA 3TTHA 3RYOA 4CAFA 4CGLA 4JWPA 3FXTA 1LRZA 1M4DA 2WPWA 2GANA 3D2PA 1YVOA 4KVXA 2HQYA 5CNPA 5F48A 2YNDA 1IB1E 4KOUA 1IICA 4YFJA 3SHPA 2QMLA 2O28A 4UBRA 4H6UA 3R1KA 2Q04A 4QB9A 2FIWA 2FXFA 4ZBGA 1S60A 2Z3LA 4NEXA 4NSQA 4MFLA 1P0HA 2AE6A 2EUIA 3B8GA 4NXYA 2CXAA 1Y9KA 4B13A 5KTAA 1YLEA 3GYAA 4H6ZA 4C7HA 3LD2A 4KVME 4U9YA 2YNEA 4YGOA 4RI1A 4QBJA 4JD6A 3VWEA 4H89A 1PUAA 2G3TA 2CNMA 4XPLA 4OAEA 2ATRA 2Z0ZA 4CRZB 5AGEA 3ZJ0A 4IUSA 5A27A 4CAVA 3W6SA 4Y49C 1V0CA 3R95A 3S6HA 4HKFA 4K30A 2Z11A 4CS0B 4AVCA 4PSWA 3FNCA 4C7IA 2YNCA 4KOVA 5G21A 1UFHA 3I3GA 4CGMA 4KORA 5IV0A 1B6BA 2BUEA 2WSAA 1VKCA 4C68A 1XE4A 1M44A 4Q36A 3FB3A 3T9YA 4R87A 1RO5A 1NSLA 4YRHA 2Q0YA 4JXQA 1GHEA 3E0KA 2I79A 4AG7A 2B58A 3PZJA 4KSFA 1WWZA 2B5GB 1B87A 2AJ6A 2FE7A 2J8NA 2VBQA 1KUXA 2OZHA 4MHDA 5I0CA 1R57A 3K9UA 1YGHA 2Z3NA 4KOTA 5AG5A 4B10A 4UFVA 2GIVA 2ZW6A 1KUVA 4CYNA 3FYNA 2G0BA 2REEA 4LX9A 3MGDA 2PR8A 2VEZA 5H84A 1M4GA 3JVNA 1Y9WA 2B3UA 3FRMA 3LODA 2C27A 4MFZA 1MJAA 3ZZIA 3GKRA 4OLLA 3H4QA 2P6FA 2WUUA 3N7ZA 2Z3MA 4B5PA 2IL4A 1YX0A 2Z3PA 3D3SA 3I9SA 2K5TA 3TT2A 2D4PA 2ZW4A 4UCPA 4ZGYB 4AVBA 4A33A 1Z4EA 5F46A 3IWGA 4XPKA 2VI7A 3BLNA 2BSWA 2P6GA 2VZZA 3S6FA 4ORFA 1QSRA 4HNYB 4E2AA 2EVNA 4B14A 1YVKA 3IGRA 3QB8A 1ON0A 2CNSA 4GS4A 3S6KA 4NCZA 1M1DA 2Z3KA 2J8RA 1I1DA 4NF1A 5F49A 5A28A 3R96A 4FD6A 2R8VA 2B3VA 1P4NA 3IWEA 4UFXA 1ZO0A 3P2FA 5F47A 2PR1A 2FIAA 5JPHA 4IF5A 4E8OA 5BWAB 1MJBA 4HNXB 5C82A 4FD4A 3JTKA 2WPXA 4F0XA 3IU2A 1CM0A 3F8KA 4AG9A 2PRBA 3GY9A 5J8CA 2YGWA 2ZW7A 3C26A 4AB7A 4A2ZA 5KTDA 3CXQA 2Q7BA 4B12A 1S3ZA 4CAEA 1Y7RA 2HUZA 5H86A 5DWMA 4R57A 3PGPA 4UFWA 4L89A 1QSNA 2ARHA 2B4DB 3TO7A 4AVAA 2FSRA 3P2HA 1MJ9A 2JEVA 2PDOA 2J8MA 1IYLA 1YREA 2OB0A 5C88A 4UCMA 2CNTA 3F0AA 2R7HA 3OWCA 2VZYA 4M3SA 4F0YA 4PK2A 2FL4A 4MFJA 4A30A 3T90A 2QECA 1S5KA 2H5MA 1Z9UA 2OZGA 2Z3OA 5ISVA 2DXQA 1IIDA 5AG7A 4QVTA 2Y0MA 2JDDA 2JDCA 4OADA 5HMNA 2X7BA 4XNHB 4E0AA 4KUBA 1S7KA 2PSWA 4B5OA 4F6AA 1I21A 2NMTA 4MY3A 4MJ8A 5E96A 2REFA 4X5KA 1S7NA 1SQHA 4JLYA 3TFYA 3IU1A 4R9MA 4B11A 4C2XA 2A4NA 1K4JA 4U5YA 2FS5A 1Q2CA 1S7FA 2BEIA 3R9EA 1XF8A 4DNCA 2FCKA 4XPDB 1FY7A 4CAWA 2JLMA 3UY5A 1TIQA 4CGNA 4KZTA 4MY0A 1U6MA 3F5BA 4JJXA 4Q38A 4BMHA 3WR7A 5IX3A 5J8FA 2OU2A 4PK3A 1XIXA 1QSOA 4CGOA 3PP9A 4HNWB 1KZFA 2CY2A 3DR8A 5DWNA 2Q4VA 2VQYA 5AG4A 2B4BA 1I12A 2OH1A 4KOSA 1Z4RA 3H5ZA 5FVJA 4L8AA 4UWIA 4U9ZA 2YNCC 3G3SA 3D2MA 1QSTA 4A32A 2Z10A 3FIXA 4KUAA 1NE9A 2F5IA 2P0WA 2PC1A 4FD7A 4PSXA 3EFAA 4PV6A 5IB0A 4M85A 1XEBA 2BL1A 1M4IA 3DR6A 3W6XA 2Q44A 4C2ZA 1BOBA 2D4OA 4KOYA 4UWJA 3V8IA 3EC4A 4R3KA 3BJ7A 4MBUA 1Q2DA 4RS2A 4MFQA 2DPTA 2ZW5A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4XNH C;  1YK3 A;  4QUS A;  4CRY B;  4R3L A;  4KVO E;  4I49 A;  4MI4 A;  3TOA A;  2R98 A;  1N71 A;  4KOX A;  5KTC A;  5EBV A;  4KLW A;  5JQ4 A;  2B4D A;  3DDD A;  3S6G A;  1NMT A;  4KLV A;  3CXP A;  3EY5 A;  2PQ8 A;  5EC4 A;  1CJW A;  3D8P A;  3DSB A;  1KUY A;  3EO4 A;  1XMT A;  4FD5 A;  1L0C A;  1YR0 A;  2I00 A;  1RXT A;  4CAX A;  2R1I A;  2G3A A;  2B5G A;  3SXN A;  4KOW A;  4XPD C;  3SXO A;  2HV2 A;  3DNS A;  3R9G A;  1OZP A;  1PU9 A;  3KKW A;  4II9 A;  2KCW A;  2ZPA A;  3CXS A;  3EXN A;  3G8W A;  2QIR A;  3TO6 A;  2ZXV A;  2OZU A;  4Y49 B;  3R9F A;  4UA3 A;  1Q2Y A;  4J3G A;  3JUW A;  1IYK A;  3TE4 A;  4ONU A;  2FT0 A;  3TCV A;  1WK4 A;  4LUA A;  1MK4 A;  1VHS A;  1S7L A;  2Q4Y A;  3FBU A;  1BO4 A;  3NE7 A;  3TO9 A;  1J4J A;  1QSM A;  5GCN A;  3VWD A;  3QAH A;  4B5P B;  3BJ8 A;  2GE3 A;  5HH1 A;  4QC6 A;  2RC4 A;  2P6E A;  2VXK A;  3TOB A;  3W91 A;  4EVY A;  4JXR A;  3TTH A;  3RYO A;  4JWP A;  3FXT A;  1LRZ A;  1M4D A;  2WPW A;  2GAN A;  3D2P A;  1YVO A;  4KVX A;  2HQY A;  5CNP A;  5F48 A;  1IB1 E;  4KOU A;  1IIC A;  4YFJ A;  3SHP A;  2QML A;  2O28 A;  4UBR A;  4H6U A;  3R1K A;  2Q04 A;  4QB9 A;  2FIW A;  2FXF A;  4ZBG A;  1S60 A;  4NSQ A;  4NEX A;  1P0H A;  2AE6 A;  2EUI A;  3B8G A;  4NXY A;  1Y9K A;  5KTA A;  1YLE A;  3GYA A;  4H6Z A;  3LD2 A;  4KVM E;  4U9Y A;  4YGO A;  4RI1 A;  4QBJ A;  4JD6 A;  3VWE A;  4H89 A;  1PUA A;  2G3T A;  2CNM A;  4XPL A;  4OAE A;  2ATR A;  2Z0Z A;  4CRZ B;  3ZJ0 A;  4IUS A;  4CAV A;  3W6S A;  4Y49 C;  1V0C A;  3R95 A;  3S6H A;  4HKF A;  4K30 A;  2Z11 A;  4CS0 B;  4AVC A;  4PSW A;  3FNC A;  4KOV A;  1UFH A;  3I3G A;  4KOR A;  5IV0 A;  1B6B A;  2BUE A;  1VKC A;  1XE4 A;  1M44 A;  3FB3 A;  3T9Y A;  4R87 A;  1RO5 A;  1NSL A;  4YRH A;  2Q0Y A;  4JXQ A;  1GHE A;  3E0K A;  2I79 A;  4AG7 A;  2B58 A;  3PZJ A;  1WWZ A;  2B5G B;  1B87 A;  2AJ6 A;  2FE7 A;  2J8N A;  2VBQ A;  1KUX A;  2OZH A;  4MHD A;  5I0C A;  1R57 A;  3K9U A;  1YGH A;  4KOT A;  2GIV A;  2ZW6 A;  1KUV A;  3FYN A;  2G0B A;  2REE A;  4LX9 A;  3MGD A;  2PR8 A;  2VEZ A;  5H84 A;  1M4G A;  3JVN A;  1Y9W A;  2B3U A;  3FRM A;  3LOD A;  2C27 A;  1MJA A;  3ZZI A;  3GKR A;  4OLL A;  3H4Q A;  2P6F A;  3N7Z A;  4B5P A;  2IL4 A;  1YX0 A;  3D3S A;  3I9S A;  2K5T A;  3TT2 A;  2D4P A;  2ZW4 A;  4AVB A;  1Z4E A;  5F46 A;  3IWG A;  4XPK A;  2VI7 A;  3BLN A;  2BSW A;  2P6G A;  2VZZ A;  3S6F A;  4ORF A;  1QSR A;  4HNY B;  4E2A A;  2EVN A;  1YVK A;  3IGR A;  3QB8 A;  1ON0 A;  2CNS A;  4GS4 A;  3S6K A;  4NCZ A;  1M1D A;  2J8R A;  1I1D A;  4NF1 A;  5F49 A;  3R96 A;  4FD6 A;  2R8V A;  2B3V A;  1P4N A;  5F47 A;  3P2F A;  2PR1 A;  2FIA A;  5JPH A;  4IF5 A;  4E8O A;  1MJB A;  4HNX B;  5C82 A;  4FD4 A;  2WPX A;  1CM0 A;  3F8K A;  4AG9 A;  2PRB A;  3GY9 A;  5J8C A;  2ZW7 A;  3C26 A;  4AB7 A;  5KTD A;  3CXQ A;  2Q7B A;  1S3Z A;  1Y7R A;  2HUZ A;  5H86 A;  5DWM A;  4R57 A;  3PGP A;  4L89 A;  1QSN A;  2ARH A;  2B4D B;  3TO7 A;  4AVA A;  2FSR A;  3P2H A;  1MJ9 A;  2JEV A;  2PDO A;  2J8M A;  1IYL A;  1YRE A;  2OB0 A;  5C88 A;  2CNT A;  3F0A A;  2R7H A;  3OWC A;  2VZY A;  4M3S A;  4PK2 A;  2FL4 A;  3T90 A;  2QEC A;  1S5K A;  2H5M A;  1Z9U A;  2OZG A;  5ISV A;  2DXQ A;  1IID A;  4QVT A;  2Y0M A;  2JDD A;  2JDC A;  4OAD A;  5HMN A;  2X7B A;  4XNH B;  4E0A A;  4KUB A;  1S7K A;  2PSW A;  4B5O A;  4F6A A;  1I21 A;  2NMT A;  4MY3 A;  4MJ8 A;  5E96 A;  2REF A;  4X5K A;  1S7N A;  1SQH A;  4JLY A;  3TFY A;  4R9M A;  2A4N A;  1K4J A;  4U5Y A;  2FS5 A;  1Q2C A;  1S7F A;  2BEI A;  3R9E A;  1XF8 A;  4DNC A;  2FCK A;  4XPD B;  1FY7 A;  4CAW A;  2JLM A;  3UY5 A;  1TIQ A;  4KZT A;  4MY0 A;  1U6M A;  3F5B A;  4JJX A;  4BMH A;  3WR7 A;  5IX3 A;  5J8F A;  2OU2 A;  4PK3 A;  1XIX A;  1QSO A;  3PP9 A;  4HNW B;  1KZF A;  2CY2 A;  3DR8 A;  5DWN A;  2Q4V A;  2VQY A;  2B4B A;  1I12 A;  2OH1 A;  4KOS A;  1Z4R A;  5FVJ A;  4L8A A;  4UWI A;  4U9Z A;  3G3S A;  3D2M A;  1QST A;  2Z10 A;  3FIX A;  4KUA A;  1NE9 A;  2F5I A;  2P0W A;  2PC1 A;  4FD7 A;  4PSX A;  3EFA A;  4PV6 A;  5IB0 A;  4M85 A;  1XEB A;  2BL1 A;  1M4I A;  3DR6 A;  3W6X A;  2Q44 A;  1BOB A;  2D4O A;  4KOY A;  4UWJ A;  3V8I A;  3EC4 A;  4R3K A;  3BJ7 A;  4MBU A;  1Q2D A;  4RS2 A;  4F0Y A;  2ZW5 A; 
#chains in the Genus database with same CATH topology
 1XFO A;  2OR4 A;  4ZX8 A;  4UCN A;  3CZX A;  1YK3 A;  3MN8 A;  4QUS A;  4MCS A;  4XNH C;  4CRY B;  4NGP A;  4CGP A;  4R3L A;  2F7V A;  4KVO E;  4MFK A;  1Z2L A;  4I49 A;  4MI4 A;  1HDU A;  2R98 A;  3TOA A;  2BO9 A;  1N71 A;  4TNU A;  1ELM P;  5D8N A;  4KOX A;  4F9V A;  5KTC A;  3KI9 A;  5EBV A;  4KLW A;  5AG6 A;  2QJ8 A;  5JQ4 A;  4ZY1 A;  2B4D A;  3DDD A;  3S6G A;  1NMT A;  3FF3 A;  4KLV A;  1ARM A;  3CXP A;  4CPA A;  3EY5 A;  2PQ8 A;  5EC4 A;  1YLO A;  2GLJ A;  2WZN A;  2I3C A;  5LRG A;  1CJW A;  5LRK A;  3D8P A;  2DEA A;  3DSB A;  5D29 A;  1KUY A;  1FT7 A;  3EO4 A;  1XMT A;  4FD5 A;  4CYQ A;  1L0C A;  1YR0 A;  3CPX A;  4OKO A;  4X2T A;  2I00 A;  1NSA A;  1RXT A;  4KSA A;  4OP4 A;  4CAX A;  2R1I A;  2EK8 A;  4CYP A;  2ABZ A;  2DPS A;  2G3A A;  2ZOG A;  2B5G A;  2PJA A;  3SXN A;  5LYF A;  4KOW A;  1DTD A;  4XPD C;  3SXO A;  2HV2 A;  3DNS A;  3R9G A;  1YW6 A;  4IAV A;  5LYL A;  1OZP A;  1Z8L A;  1PU9 A;  3KKW A;  4II9 A;  1XMB A;  3PB9 X;  3TX8 A;  2KCW A;  2ZPA A;  4A31 A;  4CYO A;  3CXS A;  3EXN A;  2PJ3 A;  3G8W A;  5HVH A;  3BXM A;  2QIR A;  3TO6 A;  2ZXV A;  3B3T A;  2OZU A;  4Y49 B;  3R9F A;  4UA3 A;  1JQG A;  5G22 A;  1Q2Y A;  4R8F A;  3I1U A;  1CP7 A;  4J3G A;  3JUW A;  1IYK A;  1TF8 A;  2IJZ A;  3TE4 A;  4ONU A;  1Y0R A;  4AXV A;  2FT0 A;  1PCA A;  4M6I A;  3DGV A;  3S9N A;  2Q43 A;  3LAC A;  3TCV A;  3VH9 A;  1YSJ A;  2JEW A;  2PJ6 A;  3PB4 X;  1WK4 A;  3LMS A;  3T8W A;  1BPN A;  4A95 A;  3HUV A;  4LUA A;  2FVG A;  2XEF A;  3BI1 A;  2PJ0 A;  1MK4 A;  1VHS A;  4ONW A;  4KSI A;  5LYD A;  1S7L A;  2Q4Y A;  3NE8 A;  4BD9 A;  3FBU A;  1BO4 A;  1KWM A;  3NE7 A;  3NFZ A;  4W9Y A;  5G20 A;  4EWT A;  5JM6 A;  2ZEP A;  3H8E A;  3TO9 A;  3D68 A;  1J4J A;  1QSM A;  5GCN A;  4UIB A;  3VWD A;  3A9L A;  4RUH A;  2BCO A;  1GYT A;  4KS9 A;  1XRY A;  3WC6 A;  3K2K A;  3QAH A;  4DJL A;  4MFP A;  3KR5 A;  3BJ8 A;  5G1Z A;  4B5P B;  5HVF A;  4UEF A;  2GE3 A;  5HH1 A;  4QC6 A;  4WWV A;  4NGM A;  4P4I A;  2RC4 A;  4BBH A;  2P6E A;  2VXK A;  4P6Y A;  3TOB A;  4C2Y A;  2ZEO A;  3W91 A;  4EVY A;  4JXR A;  3TTH A;  3RYO A;  3S9M A;  4CAF A;  2VL1 A;  4JWP A;  3B2Y A;  1LRZ A;  1M4D A;  2C6P A;  3FEE A;  3FXT A;  4P4E A;  4CGL A;  2WPW A;  2GAN A;  3D2P A;  1YVO A;  1AYE A;  4KVX A;  2HQY A;  2JBJ A;  1VGY A;  2PJ7 A;  4P44 A;  5CNP A;  5F48 A;  2YND A;  1IB1 E;  4KOU A;  1IIC A;  3NH5 A;  4YFJ A;  2AFX A;  3SHP A;  1F57 A;  1CBX A;  2PJ2 A;  2QML A;  3B3W A;  3PBB A;  2ZEL A;  2O28 A;  4P4J A;  3GB0 A;  4UBR A;  1Z8W A;  4LQ6 A;  2PJ5 A;  4H6U A;  3R1K A;  3D7D A;  3CPA A;  2Q04 A;  4QB9 A;  4UIA A;  2EBJ A;  2FIW A;  1YW4 A;  2FXF A;  4UF4 A;  5I4M A;  3SJX A;  4ZBG A;  4FUU A;  1S60 A;  2AFZ A;  2GRE A;  2Z3L A;  4NEX A;  4NSQ A;  4Q7A A;  4NGT A;  4ZY0 A;  2PJ8 A;  1YQE A;  4MFL A;  3KHX A;  1P0H A;  2AE6 A;  2CTC A;  2AFU A;  2EUI A;  3D7G A;  4MCP A;  4A39 A;  1AUG A;  3B8G A;  4NXY A;  3SJG A;  2CXA A;  4RN7 A;  1Y9K A;  4B13 A;  5KTA A;  5K8P A;  1YLE A;  1ZG7 A;  3V7Z A;  3GYA A;  5I0C A;  4H6Z A;  3PFE A;  3NA6 A;  4PPZ A;  4C7H A;  1IU8 A;  3PBE A;  5K8N A;  3LD2 A;  4KVM E;  1JWQ A;  4U9Y A;  2YNE A;  4YGO A;  4RI1 A;  4QBJ A;  4JD6 A;  3RBU A;  3VWE A;  2PIY A;  1DE4 C;  1PUA A;  4H89 A;  2G3T A;  2CNM A;  2ZEE A;  4XPL A;  4OAE A;  2ATR A;  2Z0Z A;  4CRZ B;  2NYQ A;  4BIN A;  5AGE A;  1QMU A;  3ZJ0 A;  4IUS A;  1UWY A;  5A27 A;  4CAV A;  3W6S A;  2V77 A;  4Y49 C;  1V0C A;  3R95 A;  2PE3 A;  3B7I A;  3S6H A;  4HKF A;  2PJ4 A;  2Z11 A;  3PEI A;  4K30 A;  4CS0 B;  1XJO A;  4AVC A;  4PSW A;  1ZG9 A;  3FNC A;  4C7I A;  2YNC A;  4KOV A;  4OIW A;  4P4F A;  5G21 A;  1CPX A;  4JZ0 A;  1UFH A;  3I3G A;  4GXH A;  4CGM A;  4MHY A;  4OC0 A;  2GLF A;  2ZEF A;  4KOR A;  2RFH A;  5IV0 A;  1B6B A;  5K8M A;  3NH8 A;  3FEC A;  2BUE A;  2WSA A;  3B3S A;  3FMC A;  1VKC A;  3RAM A;  7CPA A;  5JGF A;  4C68 A;  1XE4 A;  1M44 A;  4Q36 A;  2J9A A;  3FB3 A;  3T9Y A;  4R87 A;  4NGR A;  1RO5 A;  1NSL A;  2AFO A;  4GM5 A;  4YRH A;  1TKF A;  2Q0Y A;  3L2N A;  4JXQ A;  1Y7E A;  1GHE A;  3KQX A;  3WC7 A;  5J1Q A;  3E0K A;  2I79 A;  3B3V A;  3PRT A;  4AG7 A;  3KAS A;  2B58 A;  3PZJ A;  4NGQ A;  4KSF A;  1WWZ A;  2B5G B;  1B87 A;  2AJ6 A;  2FE7 A;  2J8N A;  2VBQ A;  1KUX A;  2OZH A;  3HLP A;  4MHD A;  1IOI A;  4A38 A;  5CBM A;  1R57 A;  3K9U A;  1LAN A;  4MRI A;  1YGH A;  2Z3N A;  4KOT A;  4M6G A;  2PVW A;  3BHX A;  5AG5 A;  4B10 A;  3IWW A;  4ZX9 A;  3FED A;  4UFV A;  2GIV A;  2ZW6 A;  3PB7 X;  3SI2 A;  1KUV A;  2PJC A;  4OC5 A;  3ISX A;  4CYN A;  3FYN A;  4EFD A;  2HB6 A;  2PVV A;  2G0B A;  2REE A;  1Z8X A;  4TWE A;  4R6T A;  2EO8 A;  4LX9 A;  4OC3 A;  3H8G A;  3MGD A;  2PR8 A;  2VEZ A;  5H84 A;  1M4G A;  2HC9 A;  1Y0Y A;  2BOA A;  3JVN A;  5THW A;  1Y9W A;  1TKH A;  2B3U A;  2CTB A;  3FRM A;  3GIU A;  3PB6 X;  2EWB A;  2PCU A;  3NH4 A;  6CPA A;  3LOD A;  4ZGY B;  2C27 A;  2V8G A;  4MFZ A;  4EME A;  1MJA A;  3ZZI A;  4PXD A;  5CPA A;  3GKR A;  4OLL A;  4MCR A;  3H4Q A;  1LFW A;  2P6F A;  2WUU A;  2CF4 A;  1AMP A;  4NFR A;  4WJB A;  3N7Z A;  2Z3M A;  4B5P A;  2IL4 A;  3S9L A;  1YX0 A;  2EK9 A;  3IC1 A;  2Z3P A;  3D3S A;  3I9S A;  1VIX A;  2K5T A;  3KR4 A;  3TT2 A;  2D4P A;  2ZW4 A;  3LWU A;  1VHE A;  4PXC A;  2ANP A;  2V8H A;  2XEG A;  4M6H A;  4UCP A;  1Z4E A;  3SJF A;  4A33 A;  3IWG A;  4AVB A;  4XPK A;  2VI7 A;  5F46 A;  3BLN A;  2BSW A;  2P6G A;  2VZZ A;  5ELY A;  1X10 A;  2IMO A;  3S6F A;  4ORF A;  1LOK A;  3VAT A;  1QSR A;  4HNY B;  4E2A A;  2GFQ A;  2EVN A;  3CT9 A;  4B14 A;  1YVK A;  3SJE A;  4P4D A;  3IGR A;  3QB8 A;  5IB9 A;  4OC4 A;  1ON0 A;  2CNS A;  4GS4 A;  3S6K A;  4NCZ A;  3SI0 A;  4Z65 A;  1M1D A;  2Z3K A;  3N5F A;  4JYW A;  2J8R A;  1I1D A;  4NF1 A;  4O23 A;  4YU9 A;  5F49 A;  5A28 A;  3R96 A;  2V8V A;  4FD6 A;  2R8V A;  2B3V A;  3FH4 A;  1ZLH A;  1Z5R A;  2ZOF A;  1P4N A;  1CPS A;  3IWE A;  4UFX A;  1RTQ A;  1ZO0 A;  3P2F A;  5F47 A;  3RZA A;  1F2O A;  2O53 A;  4IK2 A;  2PR1 A;  4NJQ A;  2FIA A;  1Z8T A;  5EMI A;  3GUX A;  5JPH A;  2Q51 A;  2O4H A;  4IF5 A;  4E8O A;  3B3C A;  3CDX A;  3D4U A;  5BWA B;  1MJB A;  1F2P A;  1LAP A;  2AFS A;  2Q7S A;  4HNX B;  5C82 A;  4UEE A;  4FD4 A;  3JTK A;  2WPX A;  3K9T A;  4A94 A;  3D7H A;  4F0X A;  3IU2 A;  1CM0 A;  3F8K A;  4AG9 A;  1IOF A;  2PRB A;  1CX8 A;  3ISZ A;  4MMO A;  3V38 A;  3GY9 A;  5J8C A;  2YGW A;  2ZW7 A;  4PXB A;  3C26 A;  4AB7 A;  4A2Z A;  5KTD A;  3MRU A;  3CXQ A;  2Q7B A;  3PB8 X;  4MHN A;  4P4B A;  1BLL E;  1S3Z A;  4MHP A;  2OOT A;  2PJ1 A;  4B12 A;  4CAE A;  1Y7R A;  2HUZ A;  4A37 A;  5H86 A;  5DWM A;  4ZY2 A;  4P45 A;  4R57 A;  3PGP A;  4UFW A;  4L89 A;  1HEE A;  1XOV A;  1QSN A;  4NGN A;  2ARH A;  2B4D B;  5HXD A;  3TC8 A;  3TO7 A;  4AVA A;  2FSR A;  3P2H A;  1EE3 P;  4OID A;  5DS0 A;  3D7F A;  1MJ9 A;  2JEV A;  2PDO A;  4IHM A;  2J8M A;  1IYL A;  1YRE A;  5HVG A;  2OB0 A;  1CP6 A;  4UCM A;  5C88 A;  4MXU A;  2CNT A;  4YWY A;  3F0A A;  2R7H A;  1R3N A;  2AFM A;  2VZY A;  3OWC A;  4M3S A;  4F0Y A;  3SI1 A;  4PK2 A;  5K8O A;  2FL4 A;  4MFJ A;  4A30 A;  1LCP A;  4NGS A;  1CG2 A;  3T90 A;  1PYT B;  2QEC A;  1S5K A;  2F8H A;  2H5M A;  4HPS A;  1Z9U A;  2OZG A;  2ZEH A;  4X3R A;  2Z3O A;  1LAM A;  4F9U A;  5ISV A;  2DXQ A;  1HDQ A;  1IID A;  4R76 A;  5AG7 A;  3WT4 A;  2JBK A;  4QVT A;  2Y0M A;  3IEH A;  2C6G A;  2JDD A;  2PJ9 A;  2JDC A;  3FVL A;  4DUK A;  3QAY A;  4OAD A;  5HMN A;  3RO0 A;  1YME A;  2X7B A;  3WAB A;  4XNH B;  4E0A A;  4KUB A;  1S7K A;  2PSW A;  3JRU A;  2G9D A;  4B5O A;  1OBR A;  1R43 A;  2PIZ A;  1IGB A;  2QVP A;  1I21 A;  4F6A A;  3D67 A;  3H8F A;  2NMT A;  4B6Z A;  4MY3 A;  3BI0 A;  1ELL P;  1BPM A;  3IO1 A;  4MJ8 A;  5E96 A;  4NJR A;  2REF A;  4X5K A;  1S7N A;  1SQH A;  4JLY A;  3TFY A;  4OC2 A;  3IU1 A;  3KGQ A;  1A2Z A;  4R9M A;  4B11 A;  4C2X A;  2A4N A;  3QNV A;  4DYO A;  1K4J A;  4FWU A;  4U5Y A;  2FS5 A;  4FBE A;  1Q2C A;  1S7F A;  1X12 A;  5JH9 A;  4F8Z A;  2V8D A;  3D66 A;  4R7M A;  2BEI A;  3R9E A;  1XF8 A;  4DNC A;  2AFW A;  4FAI A;  1ZLI A;  2FCK A;  3VAR A;  4XPD B;  1FY7 A;  3PFO A;  4CAW A;  2JLM A;  3UY5 A;  1TIQ A;  4CGN A;  5F09 A;  1BAV A;  4ZYQ A;  2ODF A;  3FX6 A;  4KZT A;  4X8I A;  4MY0 A;  1U6M A;  3F5B A;  4JJX A;  2WYR A;  4Q38 A;  4BMH A;  3WR7 A;  5LYI A;  5IX3 A;  5J8F A;  2OU2 A;  2XEJ A;  4PK3 A;  4MHZ A;  2XEI A;  4OC1 A;  1XIX A;  1QSO A;  4CGO A;  4PQA A;  3PP9 A;  4HNW B;  2Q4Z A;  1KZF A;  2CY2 A;  3DR8 A;  5DWN A;  2Q4V A;  2QYV A;  2VQY A;  4PXE A;  5LRJ A;  5AG4 A;  2B4B A;  2ZEG A;  1I12 A;  1TF9 A;  2C1C A;  2OH1 A;  4KOS A;  1Z4R A;  2POK A;  3H5Z A;  5FVJ A;  2IQ6 A;  4L8A A;  4UWI A;  4U9Z A;  2PRQ A;  2YNC C;  2PJB A;  1ARL A;  1FNO A;  3G3S A;  3KQZ A;  2ZED A;  1IY7 A;  3IFE A;  4UEZ A;  3D2M A;  1QST A;  3KHZ A;  4A32 A;  4ZI6 A;  1ZG8 A;  2Z10 A;  1XBU A;  2ZEN A;  3FIX A;  4KUA A;  1NE9 A;  2F5I A;  2P0W A;  2PC1 A;  4FD7 A;  2C6C A;  4H2K A;  3EFA A;  4PSX A;  4PV6 A;  5IB0 A;  4M85 A;  2RB7 A;  1M4L A;  1XEB A;  4LQG A;  2BL1 A;  4P10 A;  2DF5 A;  1QQ9 A;  3KL9 A;  3KZW A;  1M4I A;  3DR6 A;  4MCQ A;  3W6X A;  2GU2 A;  2ZEM A;  2Q44 A;  3IIB A;  1H8L A;  1TXR A;  4C2Z A;  3B35 A;  1BOB A;  2D4O A;  4KOY A;  1Q7L A;  4UWJ A;  2CIJ A;  3DLJ A;  3V8I A;  3FJU A;  3EC4 A;  4K3N A;  4R3K A;  3RNZ A;  3WC5 A;  2NSM A;  3BJ7 A;  4MBU A;  1VHO A;  4OME A;  3GLJ A;  1Q2D A;  4RS2 A;  4G1P A;  3IJ3 A;  1TKJ A;  4MFQ A;  8CPA A;  2DPT A;  2ZW5 A; 
#chains in the Genus database with same CATH homology
 4UCN A;  4XNH C;  1YK3 A;  4QUS A;  4CRY B;  4CGP A;  4R3L A;  4KVO E;  4MFK A;  4I49 A;  4MI4 A;  3TOA A;  2R98 A;  1N71 A;  4KOX A;  5KTC A;  5EBV A;  4KLW A;  5AG6 A;  5JQ4 A;  2B4D A;  3DDD A;  3S6G A;  1NMT A;  4KLV A;  3CXP A;  3EY5 A;  2PQ8 A;  5EC4 A;  1CJW A;  3D8P A;  3DSB A;  1KUY A;  4CYQ A;  3EO4 A;  1XMT A;  4FD5 A;  1L0C A;  1YR0 A;  2I00 A;  1RXT A;  4KSA A;  4CAX A;  4CYP A;  2R1I A;  2DPS A;  2G3A A;  2B5G A;  3SXN A;  4KOW A;  4XPD C;  3SXO A;  2HV2 A;  3DNS A;  3R9G A;  1OZP A;  1PU9 A;  3KKW A;  4II9 A;  2KCW A;  2ZPA A;  4A31 A;  4CYO A;  3CXS A;  3EXN A;  3G8W A;  2QIR A;  3TO6 A;  2ZXV A;  2OZU A;  4Y49 B;  3R9F A;  4UA3 A;  5G22 A;  1Q2Y A;  4J3G A;  3JUW A;  1IYK A;  3TE4 A;  4ONU A;  2FT0 A;  3TCV A;  1WK4 A;  4A95 A;  4LUA A;  1MK4 A;  1VHS A;  1S7L A;  2Q4Y A;  3FBU A;  1BO4 A;  3NE7 A;  5G20 A;  3TO9 A;  1J4J A;  1QSM A;  5GCN A;  3VWD A;  3A9L A;  4KS9 A;  3QAH A;  4MFP A;  5G1Z A;  3BJ8 A;  4B5P B;  2GE3 A;  5HH1 A;  4QC6 A;  2RC4 A;  4BBH A;  2P6E A;  2VXK A;  3TOB A;  4C2Y A;  3W91 A;  4EVY A;  4JXR A;  3TTH A;  3RYO A;  4CAF A;  4CGL A;  4JWP A;  3FXT A;  1LRZ A;  1M4D A;  2WPW A;  2GAN A;  3D2P A;  1YVO A;  4KVX A;  2HQY A;  5CNP A;  5F48 A;  2YND A;  1IB1 E;  4KOU A;  1IIC A;  4YFJ A;  3SHP A;  2QML A;  2O28 A;  4UBR A;  4H6U A;  3R1K A;  2Q04 A;  4QB9 A;  2FIW A;  2FXF A;  4ZBG A;  1S60 A;  2Z3L A;  4NEX A;  4NSQ A;  4MFL A;  1P0H A;  2AE6 A;  2EUI A;  3B8G A;  4NXY A;  2CXA A;  1Y9K A;  4B13 A;  5KTA A;  1YLE A;  3GYA A;  4H6Z A;  4C7H A;  3LD2 A;  4KVM E;  4U9Y A;  2YNE A;  4YGO A;  4RI1 A;  4QBJ A;  4JD6 A;  3VWE A;  4H89 A;  1PUA A;  2G3T A;  2CNM A;  4XPL A;  4OAE A;  2ATR A;  2Z0Z A;  4CRZ B;  5AGE A;  3ZJ0 A;  4IUS A;  5A27 A;  4CAV A;  3W6S A;  4Y49 C;  1V0C A;  3R95 A;  3S6H A;  4HKF A;  4K30 A;  2Z11 A;  4CS0 B;  4AVC A;  4PSW A;  3FNC A;  4C7I A;  2YNC A;  4KOV A;  5G21 A;  1UFH A;  3I3G A;  4CGM A;  4KOR A;  5IV0 A;  1B6B A;  2BUE A;  2WSA A;  1VKC A;  4C68 A;  1XE4 A;  1M44 A;  4Q36 A;  3FB3 A;  3T9Y A;  4R87 A;  1RO5 A;  1NSL A;  4YRH A;  2Q0Y A;  4JXQ A;  1GHE A;  3E0K A;  2I79 A;  4AG7 A;  2B58 A;  3PZJ A;  4KSF A;  1WWZ A;  2B5G B;  1B87 A;  2AJ6 A;  2FE7 A;  2J8N A;  2VBQ A;  1KUX A;  2OZH A;  4MHD A;  5I0C A;  1R57 A;  3K9U A;  1YGH A;  2Z3N A;  4KOT A;  5AG5 A;  4B10 A;  4UFV A;  2GIV A;  2ZW6 A;  1KUV A;  4CYN A;  3FYN A;  2G0B A;  2REE A;  4LX9 A;  3MGD A;  2PR8 A;  2VEZ A;  5H84 A;  1M4G A;  3JVN A;  1Y9W A;  2B3U A;  3FRM A;  3LOD A;  2C27 A;  4MFZ A;  1MJA A;  3ZZI A;  3GKR A;  4OLL A;  3H4Q A;  2P6F A;  2WUU A;  3N7Z A;  2Z3M A;  4B5P A;  2IL4 A;  1YX0 A;  2Z3P A;  3D3S A;  3I9S A;  2K5T A;  3TT2 A;  2D4P A;  2ZW4 A;  4UCP A;  4ZGY B;  4AVB A;  4A33 A;  1Z4E A;  5F46 A;  3IWG A;  4XPK A;  2VI7 A;  3BLN A;  2BSW A;  2P6G A;  2VZZ A;  3S6F A;  4ORF A;  1QSR A;  4HNY B;  4E2A A;  2EVN A;  4B14 A;  1YVK A;  3IGR A;  3QB8 A;  1ON0 A;  2CNS A;  4GS4 A;  3S6K A;  4NCZ A;  1M1D A;  2Z3K A;  2J8R A;  1I1D A;  4NF1 A;  5F49 A;  5A28 A;  3R96 A;  4FD6 A;  2R8V A;  2B3V A;  1P4N A;  3IWE A;  4UFX A;  1ZO0 A;  3P2F A;  5F47 A;  2PR1 A;  2FIA A;  5JPH A;  4IF5 A;  4E8O A;  5BWA B;  1MJB A;  4HNX B;  5C82 A;  4FD4 A;  3JTK A;  2WPX A;  4F0X A;  3IU2 A;  1CM0 A;  3F8K A;  4AG9 A;  2PRB A;  3GY9 A;  5J8C A;  2YGW A;  2ZW7 A;  3C26 A;  4AB7 A;  4A2Z A;  5KTD A;  3CXQ A;  2Q7B A;  4B12 A;  1S3Z A;  4CAE A;  1Y7R A;  2HUZ A;  5H86 A;  5DWM A;  4R57 A;  3PGP A;  4UFW A;  4L89 A;  1QSN A;  2ARH A;  2B4D B;  3TO7 A;  4AVA A;  2FSR A;  3P2H A;  1MJ9 A;  2JEV A;  2PDO A;  2J8M A;  1IYL A;  1YRE A;  2OB0 A;  5C88 A;  4UCM A;  2CNT A;  3F0A A;  2R7H A;  3OWC A;  2VZY A;  4M3S A;  4F0Y A;  4PK2 A;  2FL4 A;  4MFJ A;  4A30 A;  3T90 A;  2QEC A;  1S5K A;  2H5M A;  1Z9U A;  2OZG A;  2Z3O A;  5ISV A;  2DXQ A;  1IID A;  5AG7 A;  4QVT A;  2Y0M A;  2JDD A;  2JDC A;  4OAD A;  5HMN A;  2X7B A;  4XNH B;  4E0A A;  4KUB A;  1S7K A;  2PSW A;  4B5O A;  4F6A A;  1I21 A;  2NMT A;  4MY3 A;  4MJ8 A;  5E96 A;  2REF A;  4X5K A;  1S7N A;  1SQH A;  4JLY A;  3TFY A;  3IU1 A;  4R9M A;  4B11 A;  4C2X A;  2A4N A;  1K4J A;  4U5Y A;  2FS5 A;  1Q2C A;  1S7F A;  2BEI A;  3R9E A;  1XF8 A;  4DNC A;  2FCK A;  4XPD B;  1FY7 A;  4CAW A;  2JLM A;  3UY5 A;  1TIQ A;  4CGN A;  4KZT A;  4MY0 A;  1U6M A;  3F5B A;  4JJX A;  4Q38 A;  4BMH A;  3WR7 A;  5IX3 A;  5J8F A;  2OU2 A;  4PK3 A;  1XIX A;  1QSO A;  4CGO A;  3PP9 A;  4HNW B;  1KZF A;  2CY2 A;  3DR8 A;  5DWN A;  2Q4V A;  2VQY A;  5AG4 A;  2B4B A;  1I12 A;  2OH1 A;  4KOS A;  1Z4R A;  3H5Z A;  5FVJ A;  4L8A A;  4UWI A;  4U9Z A;  2YNC C;  3G3S A;  3D2M A;  1QST A;  4A32 A;  2Z10 A;  3FIX A;  4KUA A;  1NE9 A;  2F5I A;  2P0W A;  2PC1 A;  4FD7 A;  4PSX A;  3EFA A;  4PV6 A;  5IB0 A;  4M85 A;  1XEB A;  2BL1 A;  1M4I A;  3DR6 A;  3W6X A;  2Q44 A;  4C2Z A;  1BOB A;  2D4O A;  4KOY A;  4UWJ A;  3V8I A;  3EC4 A;  4R3K A;  3BJ7 A;  4MBU A;  1Q2D A;  4RS2 A;  4MFQ A;  2DPT A;  2ZW5 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...