3PZJA

Crystal structure of a probable acetyltransferases (gnat family) from chromobacterium violaceum atcc 12472
Total Genus 49
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
49
sequence length
198
structure length
198
Chain Sequence
SPPIAPSTPLLAGWRSAGKAPEAAIRGEAVSLQPLDAPRHGAALFRLFAGDDSHWEHLPYGPFEDEDAFITWLALTVAQSDTALYVVCAKDSDQALGFLGYRQMVQAHGAIEIGHVNFSPALRRTRLATEAVFLLLKTAFELGYRRCEWRCDSRNAASAAAARRFGFQFEGTLRQAMVVKRRNRDTHVFSMLDGEWDA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords Probable acetyltransferases
publication title Crystal structure of a probable acetyltransferases (GNAT family) from Chromobacterium violaceum ATCC 12472
rcsb
source organism Chromobacterium violaceum
total genus 49
structure length 198
sequence length 198
chains with identical sequence B
ec nomenclature ec 2.3.1.-:
pdb deposition date 2010-12-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13302 Acetyltransf_3 Acetyltransferase (GNAT) domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.630.30 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Aminopeptidase 3pzjA00
1WWZA 2QIRA 3CXSA 3BJ8A 1VHSA 1YR0A 2JEVA 4FD5A 3R9GA 1UFHA 4LUAA 5C88A 4H6UA 1YX0A 3TO7A 3V8IA 2BSWA 3QB8A 4NSQA 3R9FA 1OZPA 2H5MA 1V0CA 1NSLA 4R87A 3S6FA 2A4NA 1PUAA 2OH1A 1ON0A 3W6SA 2VZYA 1KUYA 2AE6A 3JUWA 4JD6A 2G0BA 4PV6A 1KZFA 3BLNA 4CAWA 1I12A 2EVNA 4NXYA 4M3SA 2ZPAA 2G3AA 1Q2DA 2KCWA 1S5KA 1BOBA 3W91A 3H4QA 4JXRA 1Y7RA 4R57A 2CY2A 3TCVA 5JQ4A 1IIDA 4H89A 4X5KA 4KOVA 1Z4EA 3ZZIA 2DXQA 3D2PA 4I49A 2BL1A 2QMLA 2I79A 2J8NA 2REEA 1RO5A 4KOUA 3GKRA 1Q2CA 1P4NA 2VBQA 2BEIA 3TTHA 1J4JA 5CNPA 2FS5A 4XNHC 4B5PB 1IICA 4KZTA 3KKWA 3FBUA 1CM0A 2QECA 4LX9A 4PSXA 2K5TA 3EC4A 4H6ZA 2P6EA 2D4PA 2Q4YA 4OAEA 3K9UA 2B3VA 2FT0A 4Y49B 5KTCA 2P0WA 5DWMA 5FVJA 2CNMA 3E0KA 2VQYA 3MGDA 4PK2A 3T90A 4QC6A 1QSMA 2Q7BA 5EC4A 1M1DA 3EY5A 3D3SA 5HH1A 5GCNA 4DNCA 2R7HA 2JDCA 1VKCA 4KOSA 3SHPA 4R9MA 3TO6A 4QVTA 3QAHA 3FNCA 4CAXA 4XPDC 2FXFA 1XMTA 2PQ8A 2VXKA 4JJXA 4L8AA 3RYOA 5F47A 3IGRA 2Z11A 1FY7A 1YGHA 4KOTA 2J8MA 3DNSA 2PC1A 3TOAA 4MBUA 4KUAA 2PSWA 4ZBGA 1Q2YA 4MJ8A 2ZW5A 4QBJA 2GIVA 1CJWA 2FSRA 1I21A 4NF1A 4KVOE 4KOXA 1S60A 2AJ6A 2NMTA 3BJ7A 3N7ZA 5IV0A 4OADA 5IB0A 4HNXB 4AG9A 2J8RA 2ZW7A 2FE7A 1QSRA 4K30A 1Z4RA 3G8WA 2X7BA 2CNSA 3UY5A 4E0AA 2JDDA 5E96A 4JLYA 2PR1A 2B5GB 1YVOA 2OZHA 4F6AA 1TIQA 2I00A 4U9ZA 3VWDA 3D8PA 4XPDB 2R98A 4L89A 3S6GA 3TFYA 2G3TA 2Q44A 5H86A 3P2FA 5KTAA 3F0AA 2C27A 1KUVA 1MK4A 5H84A 1YLEA 4M85A 2ZW6A 3W6XA 3JVNA 4MHDA 1LRZA 3CXQA 2PDOA 4NCZA 4JWPA 3DDDA 2FCKA 5F46A 4KOYA 2F5IA 3R1KA 3I3GA 2VI7A 4KVXA 3ZJ0A 3F8KA 4CAVA 4F0YA 4E2AA 2B58A 4MY0A 4UA3A 2OB0A 2Q04A 4MY3A 2P6GA 1B6BA 1YVKA 3IWGA 4KLWA 5HMNA 3PZJA 3PP9A 4R3KA 4UWIA 4YFJA 1XE4A 4KOWA 2PRBA 3TO9A 5EBVA 4HNYB 4AB7A 4EVYA 2PR8A 2Z0ZA 3GY9A 4RS2A 4CRYB 2Q4VA 1S7LA 3P2HA 4KLVA 5ISVA 4AVAA 3TE4A 4QUSA 3T9YA 4II9A 1S7NA 2OZUA 1Z9UA 3FB3A 4KUBA 3DR8A 1GHEA 1XIXA 2VZZA 4JXQA 3WR7A 2FIAA 2ARHA 4ONUA 4R3LA 2JLMA 1QSOA 1SQHA 3F5BA 1Y9KA 1PU9A 3S6KA 2OU2A 4YGOA 1NMTA 2ATRA 5KTDA 1QSTA 5IX3A 4XNHB 3CXPA 2B5GA 4E8OA 1S3ZA 1I1DA 2B4DB 3OWCA 4RI1A 3R96A 3FXTA 2R1IA 1RXTA 2FL4A 4QB9A 1S7FA 4CRZB 1YK3A 3I9SA 3S6HA 4AG7A 3DR6A 3D2MA 1P0HA 3EFAA 1BO4A 4AVCA 1U6MA 5JPHA 5I0CA 1S7KA 4B5OA 2REFA 5J8CA 4BMHA 4OLLA 1M44A 3SXOA 3FIXA 4U9YA 2BUEA 4YRHA 2O28A 5DWNA 3PGPA 4B5PA 3SXNA 3GYAA 1MJAA 3R95A 4CS0B 3EXNA 5C82A 2ZW4A 3C26A 1NE9A 2P6FA 1QSNA 3LODA 2GE3A 4Y49C 1MJBA 1M4IA 2HQYA 3FRMA 2Y0MA 4NEXA 4XPLA 1IB1E 2FIWA 4FD4A 1WK4A 2ZXVA 2IL4A 4FD6A 5J8FA 1N71A 2Z10A 3LD2A 3G3SA 2VEZA 3DSBA 3NE7A 2WPXA 4IUSA 2HUZA 4PK3A 1Y9WA 4UWJA 1B87A 4XPKA 2RC4A 4FD7A 1MJ9A 3TT2A 2D4OA 2WPWA 1M4GA 2R8VA 4GS4A 1XF8A 2Q0YA 3TOBA 2OZGA 1IYLA 3B8GA 2GANA 4U5YA 2HV2A 2B3UA 2B4DA 4AVBA 4MI4A 1M4DA 2EUIA 4J3GA 2CNTA 4PSWA 4ORFA 4KORA 4UBRA 3EO4A 1KUXA 4HKFA 3VWEA 1K4JA 1YREA 3R9EA 1L0CA 1IYKA 4HNWB 1R57A 5F48A 1XEBA 4IF5A 2B4BA 4KVME 5F49A 3FYNA
chains in the Genus database with same CATH superfamily
3PBBA 1TXRA 2AFUA 1M4LA 2PJ1A 1WWZA 4MHYA 2QIRA 3CXSA 4MHNA 3BJ8A 1LANA 5HXDA 5I4MA 2PJ2A 4CGNA 2J9AA 3GLJA 1VHSA 2PJ8A 1YR0A 3W6XA 1LAMA 2JEVA 5AG6A 4FD5A 1GYTA 2IMOA 1X12A 3R9GA 1UFHA 4LUAA 5C88A 4H6UA 3CPXA 1YX0A 5HVFA 3TO7A 4PXEA 2BSWA 3QB8A 3V8IA 2C1CA 4RN7A 1IOIA 4NSQA 3R9FA 1OZPA 1PCAA 3GIUA 2Z3OA 3CDXA 2H5MA 4A37A 4MXUA 3PB6X 1V0CA 4F9VA 3K2KA 4R6TA 1NSLA 4R87A 3S6FA 3IU1A 4JYWA 1BPMA 4P10A 3SJEA 4HPSA 2A4NA 3A9LA 1DE4C 2PJ7A 1PUAA 2AFMA 2OH1A 3FEEA 4A32A 2ZEFA 3FF3A 4M6HA 4GM5A 1ON0A 1AYEA 3W6SA 5A27A 2VZYA 1KUYA 2AE6A 5DS0A 3JUWA 5HVGA 1BAVA 2G0BA 3FEDA 4JD6A 1KZFA 3BLNA 4PV6A 4CAWA 5K8PA 1I12A 2ANPA 1YSJA 2EVNA 2XEGA 3H8GA 4KSFA 4NXYA 4Q36A 4BD9A 4M3SA 4RUHA 2ZPAA 2BOAA 2G3AA 1Q2DA 2KCWA 1S5KA 3B35A 1BOBA 3W91A 3H4QA 4CGMA 2PIYA 4JXRA 1Y7RA 4B14A 3KR4A 4R57A 1CPXA 3KQXA 4UFWA 3FX6A 4DYOA 4PPZA 2CY2A 1X10A 3SI0A 3TCVA 5JQ4A 4G1PA 1IIDA 4OC5A 4OC1A 4H89A 3PB7X 4X5KA 2PVVA 1QMUA 4KOVA 2XEIA 1Z4EA 2HC9A 3ZZIA 1LAPA 2DXQA 4UEZA 2PVWA 4F8ZA 1IY7A 3IWEA 3PFOA 2BO9A 2ZENA 3D2PA 4CYQA 3IJ3A 4I49A 4Z65A 2Z3NA 2BL1A 2QJ8A 2QMLA 4Q38A 2I79A 2J8NA 4UFVA 1F2PA 3WC6A 2REEA 1RO5A 4ZY2A 2XEJA 2F7VA 1ZG9A 4KOUA 1ARLA 5AG7A 1IU8A 3GKRA 3IIBA 1Q2CA 4MFZA 1P4NA 2ZEMA 4YWYA 2VBQA 1ARMA 2WYRA 3NE8A 1XJOA 1EE3P 2BEIA 3TTHA 4ZYQA 2ZEDA 1J4JA 2WSAA 5CNPA 2FS5A 4XNHC 2YNCA 4P45A 4B5PB 1IICA 4CYOA 4KZTA 5D8NA 3KKWA 2ABZA 3FBUA 3T8WA 1CBXA 1CX8A 4YU9A 3IEHA 1CM0A 3HUVA 4MFKA 1TF9A 2DEAA 2QECA 4LX9A 2K5TA 4IK2A 3NH8A 4NGQA 4KS9A 4PSXA 4OC4A 3EC4A 4H6ZA 2P6EA 4R7MA 4IHMA 4F9UA 3KHXA 2D4PA 2Q4YA 1LOKA 4PXBA 3D7HA 4OAEA 3K9UA 4DJLA 2QYVA 4R76A 2QVPA 2B3VA 2FT0A 3D7GA 5AGEA 4Y49B 1ZG7A 2P0WA 5KTCA 4FBEA 5DWMA 5FVJA 1YQEA 2CNMA 2PJAA 3E0KA 3NH5A 4CPAA 2VQYA 3MGDA 3PB9X 4PK2A 2C6PA 2PJBA 3FMCA 4QC6A 5AG5A 3T90A 4A30A 1QSMA 5LYIA 1JQGA 2Q7BA 3KL9A 5EC4A 4PXCA 1M1DA 4X8IA 2V8VA 3EY5A 4C2ZA 2FVGA 7CPAA 2ZOFA 3D3SA 5HH1A 5GCNA 4DNCA 2R7HA 2JDCA 1VKCA 4K3NA 4KOSA 3SHPA 4MCQA 4R9MA 1XFOA 3RBUA 3TO6A 1Y7EA 2BCOA 4QVTA 4UIAA 3QAHA 4P6YA 4OMEA 5G22A 3FNCA 4CAXA 4XPDC 2FXFA 1XMTA 2EK9A 2PJ4A 2PQ8A 2OR4A 2VXKA 4JJXA 4L8AA 2YNEA 5F47A 3IGRA 3RYOA 1XOVA 4TNUA 4IAVA 4ONWA 2Z11A 1AUGA 1FY7A 1YGHA 4KOTA 2J8MA 4A39A 3B7IA 3DNSA 2PC1A 2AFZA 3TOAA 4MBUA 5LYDA 4KUAA 2PSWA 4P4IA 2ZELA 4ZBGA 1ZO0A 3V38A 1Q2YA 4MJ8A 2ZW5A 4QBJA 5ELYA 2GIVA 1CJWA 5JM6A 4BINA 1Z8LA 2FSRA 3BI0A 4A2ZA 1I21A 4NF1A 4ZGYB 4GXHA 3H8FA 4WJBA 1IGBA 4KVOE 2PJCA 4KOXA 5A28A 1S60A 2AJ6A 2NMTA 3BJ7A 1Z8TA 2YNDA 2PCUA 3FJUA 1HDUA 3N7ZA 5IV0A 1NSAA 4OADA 3S9LA 3NFZA 5IB0A 3CPAA 4HNXB 2ZEGA 1Y0RA 4AG9A 2J8RA 2FE7A 2ZOGA 1QSRA 2ZW7A 4K30A 4M6IA 1Z4RA 1RTQA 4X3RA 3G8WA 2X7BA 3I1UA 1XBUA 4P44A 1FT7A 1A2ZA 2CNSA 3UY5A 2JBJA 1CG2A 2YGWA 4E0AA 2JDDA 5E96A 2ZEHA 4JLYA 5LYLA 2PR1A 3KASA 2B5GB 1YVOA 2OZHA 2PE3A 2PJ9A 1Z5RA 4F6AA 2XEFA 5G20A 5D29A 1TIQA 2I00A 4OC2A 4ZY0A 3VATA 1DTDA 4U9ZA 3VWDA 3D8PA 4XPDB 5K8NA 2R98A 4L89A 3S6GA 3TFYA 3KI9A 4WWVA 5BWAB 2G3TA 4B12A 2F8HA 3BHXA 2Q44A 2HB6A 3JRUA 2Z3MA 3H5ZA 3P2FA 5H86A 5HVHA 5KTAA 3F0AA 2C27A 1KUVA 2I3CA 2JBKA 1MK4A 5H84A 1YLEA 1R43A 2ZW6A 4M85A 5G21A 1TKFA 2GU2A 4W9YA 3SI1A 3JVNA 4MHDA 4CGLA 1LRZA 3CXQA 4JZ0A 4P4JA 5CPAA 3CZXA 2PDOA 4NCZA 3CT9A 4A31A 4JWPA 3DDDA 2V77A 2PJ6A 2FCKA 5LYFA 5F46A 2G9DA 4KOYA 1QQ9A 2F5IA 2RFHA 4OP4A 4B10A 4C7HA 2YNCC 1ELMP 3R1KA 2ZEEA 3I3GA 2VI7A 4KVXA 3ZJ0A 3F8KA 5LRKA 2EBJA 4A38A 2PJ0A 2WUUA 4CAVA 4F0YA 2PIZA 4E2AA 2ZEPA 2B58A 4MY0A 4UA3A 2OB0A 3NH4A 2Q04A 4MHPA 4MY3A 2P6GA 4CAFA 1B6BA 1YVKA 1ELLP 4ZY1A 3IWGA 4KLWA 5HMNA 3PZJA 1Z8WA 2GLJA 2Z3PA 3PP9A 1XE4A 4R3KA 4KOWA 4UWIA 2PRBA 3TO9A 4YFJA 1F2OA 5EBVA 3L2NA 4HNYB 4AB7A 1Z8XA 3D67A 3H8EA 4EVYA 2CIJA 2PR8A 2Z0ZA 3GY9A 4C2YA 3DLJA 1VIXA 3B3WA 3PRTA 4RS2A 2C6GA 4CRYB 4KSAA 3BXMA 2Q7SA 2Q4VA 1S7LA 2C6CA 3P2HA 4KLVA 4UEFA 3SJXA 4AVAA 8CPAA 5ISVA 3SJGA 2O53A 3TE4A 3HLPA 4QUSA 2PRQA 3D68A 4F0XA 3T9YA 4II9A 1S7NA 2OZUA 1Z9UA 4MCRA 4ZI6A 3FB3A 1HEEA 4KUBA 2JEWA 3DR8A 1GHEA 1XIXA 4ZX8A 4P4DA 1H8LA 2VZZA 1TKJA 4JXQA 4BBHA 2EWBA 3WR7A 4NJQA 2FIAA 4NJRA 5K8MA 3B2YA 2OOTA 2ARHA 2CTBA 1R3NA 3B3TA 4KSIA 4ONUA 4OC0A 4UCPA 4EFDA 2VL1A 2PJ3A 4R3LA 1TF8A 2JLMA 1AMPA 2DF5A 1YW6A 1QSOA 1SQHA 3F5BA 1Y9KA 4FWUA 3RAMA 1PU9A 2Q51A 3S6KA 2OU2A 4YGOA 1NMTA 4NGTA 4MMOA 4H2KA 2ATRA 3WT4A 5KTDA 4O23A 3GB0A 1QSTA 5IX3A 4C68A 4EMEA 1YW4A 4XNHB 4R8FA 3PB8X 4UEEA 2V8HA 3CXPA 3QNVA 1Y0YA 2B5GA 2V8GA 4P4FA 3TC8A 4E8OA 3GUXA 3LWUA 4TWEA 1S3ZA 5LRJA 1I1DA 2B4DB 3OWCA 4RI1A 4PXDA 4NGMA 2DPTA 4UF4A 4X2TA 3R96A 3FXTA 2R1IA 4P4BA 4FAIA 4UCMA 1RXTA 2FL4A 4QB9A 1S7FA 4A33A 1IOFA 5K8OA 5CBMA 3MN8A 4CRZB 1YK3A 3I9SA 3D7FA 3LMSA 3S6HA 4AG7A 3D4UA 4NGNA 3DR6A 3TX8A 3S9MA 3D2MA 1P0HA 1BLLE 3EFAA 1BO4A 2AFSA 3IFEA 4AVCA 1BPNA 1OBRA 1U6MA 2RB7A 4C2XA 2NYQA 4PQAA 5JPHA 3ISXA 2V8DA 3KQZA 1TKHA 2PJ5A 2Z3LA 3FVLA 4LQ6A 5I0CA 4LQGA 4MRIA 3PBEA 1S7KA 2WZNA 1F57A 2AFXA 2DPSA 2CXAA 2REFA 3N5FA 4B5OA 5J8CA 4BMHA 4OLLA 4DUKA 1M44A 3SXOA 3V7ZA 3FIXA 2NSMA 4M6GA 4U9YA 4CGOA 2AFOA 4B13A 1KWMA 5JH9A 2BUEA 4YRHA 2O28A 2Z3KA 3RO0A 5DWNA 3KGQA 3PGPA 4B5PA 3S9NA 3SXNA 3GYAA 3KR5A 4CYNA 4MFLA 1MJAA 3R95A 4CS0B 3D7DA 3EXNA 2GREA 4UCNA 1VGYA 2ZW4A 3IO1A 3C26A 1NE9A 2P6FA 3FECA 1YMEA 3ISZA 1QSNA 4MFPA 1LCPA 3DGVA 3LODA 3NA6A 1Q7LA 2GFQA 2GE3A 4Y49C 1Z2LA 2IQ6A 1MJBA 4MFQA 2AFWA 3SJFA 1ZLIA 1M4IA 2HQYA 3FRMA 3PB4X 4OKOA 1VHEA 2Y0MA 4A95A 4CYPA 2Q4ZA 4NEXA 4XPLA 5F09A 4MHZA 3MRUA 1XRYA 1IB1E 4CAEA 2FIWA 3RNZA 4FD4A 1FNOA 1WK4A 2ZXVA 2IL4A 4FD6A 3B3VA 1CPSA 4FUUA 5J8FA 1LFWA 1N71A 3PEIA 2Z10A 3B3CA 3LD2A 4NGPA 3G3SA 2VEZA 3DSBA 3NE7A 3QAYA 1HDQA 5J1QA 2GLFA 2ODFA 2WPXA 4IUSA 1VHOA 4OIWA 4OC3A 4Q7AA 3BI1A 5IB9A 2EO8A 5AG4A 3PFEA 2HUZA 4AXVA 4PK3A 5JGFA 6CPAA 2ZEOA 2Q43A 5G1ZA 3JTKA 3LACA 1Y9WA 4B6ZA 4UWJA 1B87A 4MCSA 4XPKA 4MFJA 5LRGA 4CGPA 1ZG8A 2RC4A 1CP6A 4P4EA 1CP7A 4UFXA 4FD7A 1MJ9A 1YLOA 3TT2A 2D4OA 4MCPA 4UIBA 2WPWA 1M4GA 2R8VA 4B11A 4GS4A 1XF8A 2POKA 2Q0YA 2OZGA 3TOBA 1IYLA 3K9TA 4NGRA 3B8GA 2GANA 3IU2A 4U5YA 2HV2A 2B3UA 5EMIA 2B4DA 1JWQA 4AVBA 2IJZA 2CTCA 4MI4A 3RZAA 1M4DA 3WC5A 4EWTA 2EUIA 4J3GA 1ZLHA 4NFRA 1PYTB 2CNTA 1UWYA 2EK8A 4PSWA 3FH4A 4ORFA 4KORA 3KHZA 4C7IA 4UBRA 3EO4A 3D66A 4NGSA 3KZWA 1KUXA 3IWWA 4HKFA 3IC1A 4ZX9A 3VARA 3VH9A 1K4JA 2O4HA 3VWEA 3WABA 5C82A 1YREA 3R9EA 5THWA 1L0CA 1IYKA 3WC7A 4A94A 4HNWB 1R57A 5F48A 1XEBA 4IF5A 2B4BA 4OIDA 4KVME 3SI2A 2CF4A 3B3SA 5F49A 1XMBA 3FYNA
chains in the Genus database with same CATH topology
1WWZA 2QIRA 3CXSA 3BJ8A 4CGNA 1VHSA 1YR0A 2JEVA 5AG6A 4FD5A 3R9GA 1UFHA 4LUAA 5C88A 4H6UA 1YX0A 3TO7A 3V8IA 2BSWA 3QB8A 4NSQA 3R9FA 1OZPA 2Z3OA 2H5MA 1V0CA 1NSLA 4R87A 3S6FA 3IU1A 2A4NA 3A9LA 1PUAA 2OH1A 4A32A 1ON0A 3W6SA 5A27A 2VZYA 1KUYA 2AE6A 3JUWA 4JD6A 2G0BA 4PV6A 1KZFA 3BLNA 4CAWA 1I12A 2EVNA 4KSFA 4NXYA 4Q36A 4M3SA 2ZPAA 2G3AA 1Q2DA 2KCWA 1S5KA 1BOBA 3W91A 3H4QA 4CGMA 4JXRA 1Y7RA 4B14A 4R57A 4UFWA 2CY2A 3TCVA 5JQ4A 1IIDA 4H89A 4X5KA 4KOVA 1Z4EA 3ZZIA 2DXQA 3IWEA 4CYQA 3D2PA 4I49A 2Z3NA 2BL1A 2QMLA 4Q38A 2I79A 2J8NA 4UFVA 2REEA 1RO5A 4KOUA 5AG7A 3GKRA 1Q2CA 4MFZA 1P4NA 2VBQA 2BEIA 3TTHA 1J4JA 2WSAA 5CNPA 2FS5A 4XNHC 2YNCA 4B5PB 1IICA 4KZTA 3KKWA 3FBUA 1CM0A 4MFKA 4CYOA 2QECA 4LX9A 4PSXA 2K5TA 4KS9A 3EC4A 4H6ZA 2P6EA 2D4PA 2Q4YA 4OAEA 3K9UA 2B3VA 2FT0A 5AGEA 4Y49B 5KTCA 2P0WA 5DWMA 5FVJA 2CNMA 3E0KA 2VQYA 3MGDA 4PK2A 5AG5A 3T90A 4QC6A 4A30A 1QSMA 2Q7BA 5EC4A 1M1DA 4C2ZA 3EY5A 3D3SA 5HH1A 5GCNA 4DNCA 2R7HA 2JDCA 1VKCA 4KOSA 3SHPA 4R9MA 3TO6A 4QVTA 3QAHA 5G22A 3FNCA 4CAXA 4XPDC 2FXFA 1XMTA 2PQ8A 2VXKA 4JJXA 4L8AA 2YNEA 5F47A 3IGRA 3RYOA 2Z11A 1FY7A 1YGHA 4KOTA 2J8MA 3DNSA 2PC1A 3TOAA 4MBUA 4KUAA 2PSWA 4ZBGA 1ZO0A 1Q2YA 4MJ8A 2ZW5A 4QBJA 2GIVA 1CJWA 2FSRA 4A2ZA 1I21A 4NF1A 4ZGYB 4KVOE 4KOXA 5A28A 1S60A 2AJ6A 2NMTA 3BJ7A 2YNDA 3N7ZA 5IV0A 4OADA 5IB0A 4HNXB 4AG9A 2J8RA 2ZW7A 2FE7A 1QSRA 4K30A 1Z4RA 3G8WA 2X7BA 2CNSA 3UY5A 2YGWA 4E0AA 2JDDA 5E96A 4JLYA 2PR1A 2B5GB 1YVOA 2OZHA 4F6AA 5G20A 1TIQA 2I00A 4U9ZA 3VWDA 3D8PA 4XPDB 2R98A 4L89A 3S6GA 3TFYA 5BWAB 2G3TA 4B12A 2Q44A 5H86A 2Z3MA 3H5ZA 3P2FA 5KTAA 3F0AA 2C27A 1KUVA 1MK4A 5H84A 1YLEA 4M85A 2ZW6A 5G21A 3W6XA 3JVNA 4MHDA 4CGLA 1LRZA 3CXQA 2PDOA 4NCZA 4A31A 4JWPA 3DDDA 2FCKA 5F46A 4KOYA 2F5IA 4B10A 4C7HA 2YNCC 3R1KA 3I3GA 2VI7A 4KVXA 3ZJ0A 3F8KA 2WUUA 4CAVA 4F0YA 4E2AA 2B58A 4MY0A 4UA3A 2OB0A 4CAFA 2Q04A 4MY3A 2P6GA 1B6BA 1YVKA 3IWGA 4KLWA 5HMNA 3PZJA 3PP9A 2Z3PA 4R3KA 4UWIA 1XE4A 4YFJA 4KOWA 2PRBA 3TO9A 5EBVA 4HNYB 4AB7A 4EVYA 2PR8A 4C2YA 2Z0ZA 3GY9A 4RS2A 4CRYB 4KSAA 2Q4VA 1S7LA 3P2HA 4KLVA 5ISVA 4AVAA 3TE4A 4QUSA 4F0XA 3T9YA 4II9A 1S7NA 2OZUA 1Z9UA 3FB3A 4KUBA 3DR8A 1GHEA 1XIXA 2VZZA 4JXQA 4BBHA 3WR7A 2FIAA 2ARHA 4ONUA 4UCPA 4R3LA 2JLMA 1QSOA 1SQHA 3F5BA 1Y9KA 1PU9A 3S6KA 2OU2A 4YGOA 1NMTA 2ATRA 5KTDA 1QSTA 5IX3A 4C68A 4XNHB 3CXPA 2B5GA 4E8OA 1S3ZA 1I1DA 2B4DB 3OWCA 4RI1A 2DPTA 3R96A 3FXTA 2R1IA 4UCMA 1RXTA 2FL4A 4QB9A 1S7FA 4A33A 4CRZB 1YK3A 3I9SA 3S6HA 4AG7A 3DR6A 3D2MA 1P0HA 3EFAA 1BO4A 4AVCA 1U6MA 4C2XA 5JPHA 2Z3LA 5I0CA 1S7KA 4B5OA 2DPSA 2REFA 5J8CA 2CXAA 4BMHA 4OLLA 1M44A 3SXOA 4CGOA 3FIXA 4U9YA 4B13A 2BUEA 4YRHA 2O28A 2Z3KA 5DWNA 3PGPA 4B5PA 3SXNA 3GYAA 4CYNA 4MFLA 1MJAA 3R95A 4CS0B 3EXNA 5C82A 4UCNA 2ZW4A 3C26A 1NE9A 2P6FA 1QSNA 4MFPA 3LODA 2GE3A 4Y49C 1MJBA 4MFQA 1M4IA 2HQYA 3FRMA 4A95A 2Y0MA 4CYPA 4NEXA 4XPLA 1IB1E 4CAEA 2FIWA 4FD4A 1WK4A 2ZXVA 2IL4A 4FD6A 5J8FA 1N71A 2Z10A 3LD2A 3G3SA 2VEZA 3DSBA 3NE7A 2WPXA 4IUSA 5AG4A 2HUZA 4PK3A 5G1ZA 3JTKA 1Y9WA 4UWJA 1B87A 4XPKA 4MFJA 4CGPA 2RC4A 4UFXA 4FD7A 1MJ9A 4B11A 3TT2A 2D4OA 2WPWA 1M4GA 2R8VA 4GS4A 1XF8A 2Q0YA 3TOBA 2OZGA 1IYLA 3B8GA 2GANA 3IU2A 4U5YA 2HV2A 2B3UA 2B4DA 4AVBA 4MI4A 1M4DA 2EUIA 4J3GA 2CNTA 4PSWA 4ORFA 4KORA 4C7IA 4UBRA 3EO4A 1KUXA 4HKFA 3VWEA 1K4JA 1YREA 3R9EA 1L0CA 1IYKA 4HNWB 1R57A 5F48A 1XEBA 4IF5A 2B4BA 4KVME 5F49A 3FYNA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1WWZ A;  2QIR A;  3CXS A;  3BJ8 A;  1VHS A;  1YR0 A;  2JEV A;  4FD5 A;  3R9G A;  1UFH A;  4LUA A;  5C88 A;  4H6U A;  1YX0 A;  3TO7 A;  3V8I A;  2BSW A;  3QB8 A;  4NSQ A;  3R9F A;  1OZP A;  2H5M A;  1V0C A;  1NSL A;  4R87 A;  3S6F A;  2A4N A;  1PUA A;  2OH1 A;  1ON0 A;  3W6S A;  2VZY A;  1KUY A;  2AE6 A;  3JUW A;  4JD6 A;  2G0B A;  4PV6 A;  1KZF A;  3BLN A;  4CAW A;  1I12 A;  2EVN A;  4NXY A;  4M3S A;  2ZPA A;  2G3A A;  1Q2D A;  2KCW A;  1S5K A;  1BOB A;  3W91 A;  3H4Q A;  4JXR A;  1Y7R A;  4R57 A;  2CY2 A;  3TCV A;  5JQ4 A;  1IID A;  4H89 A;  4X5K A;  4KOV A;  1Z4E A;  3ZZI A;  2DXQ A;  3D2P A;  4I49 A;  2BL1 A;  2QML A;  2I79 A;  2J8N A;  2REE A;  1RO5 A;  4KOU A;  3GKR A;  1Q2C A;  1P4N A;  2VBQ A;  2BEI A;  3TTH A;  1J4J A;  5CNP A;  2FS5 A;  4XNH C;  4B5P B;  1IIC A;  4KZT A;  3KKW A;  3FBU A;  1CM0 A;  2QEC A;  4LX9 A;  4PSX A;  2K5T A;  3EC4 A;  4H6Z A;  2P6E A;  2D4P A;  2Q4Y A;  4OAE A;  3K9U A;  2B3V A;  2FT0 A;  4Y49 B;  5KTC A;  2P0W A;  5DWM A;  5FVJ A;  2CNM A;  3E0K A;  2VQY A;  3MGD A;  4PK2 A;  3T90 A;  4QC6 A;  1QSM A;  2Q7B A;  5EC4 A;  1M1D A;  3EY5 A;  3D3S A;  5HH1 A;  5GCN A;  4DNC A;  2R7H A;  2JDC A;  1VKC A;  4KOS A;  3SHP A;  4R9M A;  3TO6 A;  4QVT A;  3QAH A;  3FNC A;  4CAX A;  4XPD C;  2FXF A;  1XMT A;  2PQ8 A;  2VXK A;  4JJX A;  4L8A A;  3RYO A;  5F47 A;  3IGR A;  2Z11 A;  1FY7 A;  1YGH A;  4KOT A;  2J8M A;  3DNS A;  2PC1 A;  3TOA A;  4MBU A;  4KUA A;  2PSW A;  4ZBG A;  1Q2Y A;  4MJ8 A;  2ZW5 A;  4QBJ A;  2GIV A;  1CJW A;  2FSR A;  1I21 A;  4NF1 A;  4KVO E;  4KOX A;  1S60 A;  2AJ6 A;  2NMT A;  3BJ7 A;  3N7Z A;  5IV0 A;  4OAD A;  5IB0 A;  4HNX B;  4AG9 A;  2J8R A;  2ZW7 A;  2FE7 A;  1QSR A;  4K30 A;  1Z4R A;  3G8W A;  2X7B A;  2CNS A;  3UY5 A;  4E0A A;  2JDD A;  5E96 A;  4JLY A;  2PR1 A;  2B5G B;  1YVO A;  2OZH A;  4F6A A;  1TIQ A;  2I00 A;  4U9Z A;  3VWD A;  3D8P A;  4XPD B;  2R98 A;  4L89 A;  3S6G A;  3TFY A;  2G3T A;  2Q44 A;  5H86 A;  3P2F A;  5KTA A;  3F0A A;  2C27 A;  1KUV A;  1MK4 A;  5H84 A;  1YLE A;  4M85 A;  2ZW6 A;  3W6X A;  3JVN A;  4MHD A;  1LRZ A;  3CXQ A;  2PDO A;  4NCZ A;  4JWP A;  3DDD A;  2FCK A;  5F46 A;  4KOY A;  2F5I A;  3R1K A;  3I3G A;  2VI7 A;  4KVX A;  3ZJ0 A;  3F8K A;  4CAV A;  4F0Y A;  4E2A A;  2B58 A;  4MY0 A;  4UA3 A;  2OB0 A;  2Q04 A;  4MY3 A;  2P6G A;  1B6B A;  1YVK A;  3IWG A;  4KLW A;  5HMN A;  3PZJ A;  3PP9 A;  4R3K A;  4UWI A;  4YFJ A;  1XE4 A;  4KOW A;  2PRB A;  3TO9 A;  5EBV A;  4HNY B;  4AB7 A;  4EVY A;  2PR8 A;  2Z0Z A;  3GY9 A;  4RS2 A;  4CRY B;  2Q4V A;  1S7L A;  3P2H A;  4KLV A;  5ISV A;  4AVA A;  3TE4 A;  4QUS A;  3T9Y A;  4II9 A;  1S7N A;  2OZU A;  1Z9U A;  3FB3 A;  4KUB A;  3DR8 A;  1GHE A;  1XIX A;  2VZZ A;  4JXQ A;  3WR7 A;  2FIA A;  2ARH A;  4ONU A;  4R3L A;  2JLM A;  1QSO A;  1SQH A;  3F5B A;  1Y9K A;  1PU9 A;  3S6K A;  2OU2 A;  4YGO A;  1NMT A;  2ATR A;  5KTD A;  1QST A;  5IX3 A;  4XNH B;  3CXP A;  2B5G A;  4E8O A;  1S3Z A;  1I1D A;  2B4D B;  3OWC A;  4RI1 A;  3R96 A;  3FXT A;  2R1I A;  1RXT A;  2FL4 A;  4QB9 A;  1S7F A;  4CRZ B;  1YK3 A;  3I9S A;  3S6H A;  4AG7 A;  3DR6 A;  3D2M A;  1P0H A;  3EFA A;  1BO4 A;  4AVC A;  1U6M A;  5JPH A;  5I0C A;  1S7K A;  4B5O A;  2REF A;  5J8C A;  4BMH A;  4OLL A;  1M44 A;  3SXO A;  3FIX A;  4U9Y A;  2BUE A;  4YRH A;  2O28 A;  5DWN A;  3PGP A;  4B5P A;  3SXN A;  3GYA A;  1MJA A;  3R95 A;  4CS0 B;  3EXN A;  5C82 A;  2ZW4 A;  3C26 A;  1NE9 A;  2P6F A;  1QSN A;  3LOD A;  2GE3 A;  4Y49 C;  1MJB A;  1M4I A;  2HQY A;  3FRM A;  2Y0M A;  4NEX A;  4XPL A;  1IB1 E;  2FIW A;  4FD4 A;  1WK4 A;  2ZXV A;  2IL4 A;  4FD6 A;  5J8F A;  1N71 A;  2Z10 A;  3LD2 A;  3G3S A;  2VEZ A;  3DSB A;  3NE7 A;  2WPX A;  4IUS A;  2HUZ A;  4PK3 A;  1Y9W A;  4UWJ A;  1B87 A;  4XPK A;  2RC4 A;  4FD7 A;  1MJ9 A;  3TT2 A;  2D4O A;  2WPW A;  1M4G A;  2R8V A;  4GS4 A;  1XF8 A;  2Q0Y A;  3TOB A;  2OZG A;  1IYL A;  3B8G A;  2GAN A;  4U5Y A;  2HV2 A;  2B3U A;  2B4D A;  4AVB A;  4MI4 A;  1M4D A;  2EUI A;  4J3G A;  2CNT A;  4PSW A;  4ORF A;  4KOR A;  4UBR A;  3EO4 A;  1KUX A;  4HKF A;  3VWE A;  1K4J A;  1YRE A;  3R9E A;  1L0C A;  1IYK A;  4HNW B;  1R57 A;  5F48 A;  1XEB A;  4IF5 A;  2B4B A;  4KVM E;  5F49 A;  3FYN A; 
#chains in the Genus database with same CATH topology
 3PBB A;  1TXR A;  2AFU A;  1M4L A;  2PJ1 A;  1WWZ A;  4MHY A;  2QIR A;  3CXS A;  4MHN A;  3BJ8 A;  1LAN A;  5HXD A;  5I4M A;  2PJ2 A;  4CGN A;  2J9A A;  3GLJ A;  1VHS A;  2PJ8 A;  1YR0 A;  3W6X A;  1LAM A;  2JEV A;  5AG6 A;  4FD5 A;  1GYT A;  2IMO A;  1X12 A;  3R9G A;  1UFH A;  4LUA A;  5C88 A;  4H6U A;  3CPX A;  1YX0 A;  5HVF A;  3TO7 A;  4PXE A;  2BSW A;  3QB8 A;  3V8I A;  2C1C A;  4RN7 A;  1IOI A;  4NSQ A;  3R9F A;  1OZP A;  1PCA A;  3GIU A;  2Z3O A;  3CDX A;  2H5M A;  4A37 A;  4MXU A;  3PB6 X;  1V0C A;  4F9V A;  3K2K A;  4R6T A;  1NSL A;  4R87 A;  3S6F A;  3IU1 A;  4JYW A;  1BPM A;  4P10 A;  3SJE A;  4HPS A;  2A4N A;  3A9L A;  1DE4 C;  2PJ7 A;  1PUA A;  2AFM A;  2OH1 A;  3FEE A;  4A32 A;  2ZEF A;  3FF3 A;  4M6H A;  4GM5 A;  1ON0 A;  1AYE A;  3W6S A;  5A27 A;  2VZY A;  1KUY A;  2AE6 A;  5DS0 A;  3JUW A;  5HVG A;  1BAV A;  2G0B A;  3FED A;  4JD6 A;  1KZF A;  3BLN A;  4PV6 A;  4CAW A;  5K8P A;  1I12 A;  2ANP A;  1YSJ A;  2EVN A;  2XEG A;  3H8G A;  4KSF A;  4NXY A;  4Q36 A;  4BD9 A;  4M3S A;  4RUH A;  2ZPA A;  2BOA A;  2G3A A;  1Q2D A;  2KCW A;  1S5K A;  3B35 A;  1BOB A;  3W91 A;  3H4Q A;  4CGM A;  2PIY A;  4JXR A;  1Y7R A;  4B14 A;  3KR4 A;  4R57 A;  1CPX A;  3KQX A;  4UFW A;  3FX6 A;  4DYO A;  4PPZ A;  2CY2 A;  1X10 A;  3SI0 A;  3TCV A;  5JQ4 A;  4G1P A;  1IID A;  4OC5 A;  4OC1 A;  4H89 A;  3PB7 X;  4X5K A;  2PVV A;  1QMU A;  4KOV A;  2XEI A;  1Z4E A;  2HC9 A;  3ZZI A;  1LAP A;  2DXQ A;  4UEZ A;  2PVW A;  4F8Z A;  1IY7 A;  3IWE A;  3PFO A;  2BO9 A;  2ZEN A;  3D2P A;  4CYQ A;  3IJ3 A;  4I49 A;  4Z65 A;  2Z3N A;  2BL1 A;  2QJ8 A;  2QML A;  4Q38 A;  2I79 A;  2J8N A;  4UFV A;  1F2P A;  3WC6 A;  2REE A;  1RO5 A;  4ZY2 A;  2XEJ A;  2F7V A;  1ZG9 A;  4KOU A;  1ARL A;  5AG7 A;  1IU8 A;  3GKR A;  3IIB A;  1Q2C A;  4MFZ A;  1P4N A;  2ZEM A;  4YWY A;  2VBQ A;  1ARM A;  2WYR A;  3NE8 A;  1XJO A;  1EE3 P;  2BEI A;  3TTH A;  4ZYQ A;  2ZED A;  1J4J A;  2WSA A;  5CNP A;  2FS5 A;  4XNH C;  2YNC A;  4P45 A;  4B5P B;  1IIC A;  4CYO A;  4KZT A;  5D8N A;  3KKW A;  2ABZ A;  3FBU A;  3T8W A;  1CBX A;  1CX8 A;  4YU9 A;  3IEH A;  1CM0 A;  3HUV A;  4MFK A;  1TF9 A;  2DEA A;  2QEC A;  4LX9 A;  2K5T A;  4IK2 A;  3NH8 A;  4NGQ A;  4KS9 A;  4PSX A;  4OC4 A;  3EC4 A;  4H6Z A;  2P6E A;  4R7M A;  4IHM A;  4F9U A;  3KHX A;  2D4P A;  2Q4Y A;  1LOK A;  4PXB A;  3D7H A;  4OAE A;  3K9U A;  4DJL A;  2QYV A;  4R76 A;  2QVP A;  2B3V A;  2FT0 A;  3D7G A;  5AGE A;  4Y49 B;  1ZG7 A;  2P0W A;  5KTC A;  4FBE A;  5DWM A;  5FVJ A;  1YQE A;  2CNM A;  2PJA A;  3E0K A;  3NH5 A;  4CPA A;  2VQY A;  3MGD A;  3PB9 X;  4PK2 A;  2C6P A;  2PJB A;  3FMC A;  4QC6 A;  5AG5 A;  3T90 A;  4A30 A;  1QSM A;  5LYI A;  1JQG A;  2Q7B A;  3KL9 A;  5EC4 A;  4PXC A;  1M1D A;  4X8I A;  2V8V A;  3EY5 A;  4C2Z A;  2FVG A;  7CPA A;  2ZOF A;  3D3S A;  5HH1 A;  5GCN A;  4DNC A;  2R7H A;  2JDC A;  1VKC A;  4K3N A;  4KOS A;  3SHP A;  4MCQ A;  4R9M A;  1XFO A;  3RBU A;  3TO6 A;  1Y7E A;  2BCO A;  4QVT A;  4UIA A;  3QAH A;  4P6Y A;  4OME A;  5G22 A;  3FNC A;  4CAX A;  4XPD C;  2FXF A;  1XMT A;  2EK9 A;  2PJ4 A;  2PQ8 A;  2OR4 A;  2VXK A;  4JJX A;  4L8A A;  2YNE A;  5F47 A;  3IGR A;  3RYO A;  1XOV A;  4TNU A;  4IAV A;  4ONW A;  2Z11 A;  1AUG A;  1FY7 A;  1YGH A;  4KOT A;  2J8M A;  4A39 A;  3B7I A;  3DNS A;  2PC1 A;  2AFZ A;  3TOA A;  4MBU A;  5LYD A;  4KUA A;  2PSW A;  4P4I A;  2ZEL A;  4ZBG A;  1ZO0 A;  3V38 A;  1Q2Y A;  4MJ8 A;  2ZW5 A;  4QBJ A;  5ELY A;  2GIV A;  1CJW A;  5JM6 A;  4BIN A;  1Z8L A;  2FSR A;  3BI0 A;  4A2Z A;  1I21 A;  4NF1 A;  4ZGY B;  4GXH A;  3H8F A;  4WJB A;  1IGB A;  4KVO E;  2PJC A;  4KOX A;  5A28 A;  1S60 A;  2AJ6 A;  2NMT A;  3BJ7 A;  1Z8T A;  2YND A;  2PCU A;  3FJU A;  1HDU A;  3N7Z A;  5IV0 A;  1NSA A;  4OAD A;  3S9L A;  3NFZ A;  5IB0 A;  3CPA A;  4HNX B;  2ZEG A;  1Y0R A;  4AG9 A;  2J8R A;  2FE7 A;  2ZOG A;  1QSR A;  2ZW7 A;  4K30 A;  4M6I A;  1Z4R A;  1RTQ A;  4X3R A;  3G8W A;  2X7B A;  3I1U A;  1XBU A;  4P44 A;  1FT7 A;  1A2Z A;  2CNS A;  3UY5 A;  2JBJ A;  1CG2 A;  2YGW A;  4E0A A;  2JDD A;  5E96 A;  2ZEH A;  4JLY A;  5LYL A;  2PR1 A;  3KAS A;  2B5G B;  1YVO A;  2OZH A;  2PE3 A;  2PJ9 A;  1Z5R A;  4F6A A;  2XEF A;  5G20 A;  5D29 A;  1TIQ A;  2I00 A;  4OC2 A;  4ZY0 A;  3VAT A;  1DTD A;  4U9Z A;  3VWD A;  3D8P A;  4XPD B;  5K8N A;  2R98 A;  4L89 A;  3S6G A;  3TFY A;  3KI9 A;  4WWV A;  5BWA B;  2G3T A;  4B12 A;  2F8H A;  3BHX A;  2Q44 A;  2HB6 A;  3JRU A;  2Z3M A;  3H5Z A;  3P2F A;  5H86 A;  5HVH A;  5KTA A;  3F0A A;  2C27 A;  1KUV A;  2I3C A;  2JBK A;  1MK4 A;  5H84 A;  1YLE A;  1R43 A;  2ZW6 A;  4M85 A;  5G21 A;  1TKF A;  2GU2 A;  4W9Y A;  3SI1 A;  3JVN A;  4MHD A;  4CGL A;  1LRZ A;  3CXQ A;  4JZ0 A;  4P4J A;  5CPA A;  3CZX A;  2PDO A;  4NCZ A;  3CT9 A;  4A31 A;  4JWP A;  3DDD A;  2V77 A;  2PJ6 A;  2FCK A;  5LYF A;  5F46 A;  2G9D A;  4KOY A;  1QQ9 A;  2F5I A;  2RFH A;  4OP4 A;  4B10 A;  4C7H A;  2YNC C;  1ELM P;  3R1K A;  2ZEE A;  3I3G A;  2VI7 A;  4KVX A;  3ZJ0 A;  3F8K A;  5LRK A;  2EBJ A;  4A38 A;  2PJ0 A;  2WUU A;  4CAV A;  4F0Y A;  2PIZ A;  4E2A A;  2ZEP A;  2B58 A;  4MY0 A;  4UA3 A;  2OB0 A;  3NH4 A;  2Q04 A;  4MHP A;  4MY3 A;  2P6G A;  4CAF A;  1B6B A;  1YVK A;  1ELL P;  4ZY1 A;  3IWG A;  4KLW A;  5HMN A;  3PZJ A;  1Z8W A;  2GLJ A;  2Z3P A;  3PP9 A;  1XE4 A;  4R3K A;  4KOW A;  4UWI A;  2PRB A;  3TO9 A;  4YFJ A;  1F2O A;  5EBV A;  3L2N A;  4HNY B;  4AB7 A;  1Z8X A;  3D67 A;  3H8E A;  4EVY A;  2CIJ A;  2PR8 A;  2Z0Z A;  3GY9 A;  4C2Y A;  3DLJ A;  1VIX A;  3B3W A;  3PRT A;  4RS2 A;  2C6G A;  4CRY B;  4KSA A;  3BXM A;  2Q7S A;  2Q4V A;  1S7L A;  2C6C A;  3P2H A;  4KLV A;  4UEF A;  3SJX A;  4AVA A;  8CPA A;  5ISV A;  3SJG A;  2O53 A;  3TE4 A;  3HLP A;  4QUS A;  2PRQ A;  3D68 A;  4F0X A;  3T9Y A;  4II9 A;  1S7N A;  2OZU A;  1Z9U A;  4MCR A;  4ZI6 A;  3FB3 A;  1HEE A;  4KUB A;  2JEW A;  3DR8 A;  1GHE A;  1XIX A;  4ZX8 A;  4P4D A;  1H8L A;  2VZZ A;  1TKJ A;  4JXQ A;  4BBH A;  2EWB A;  3WR7 A;  4NJQ A;  2FIA A;  4NJR A;  5K8M A;  3B2Y A;  2OOT A;  2ARH A;  2CTB A;  1R3N A;  3B3T A;  4KSI A;  4ONU A;  4OC0 A;  4UCP A;  4EFD A;  2VL1 A;  2PJ3 A;  4R3L A;  1TF8 A;  2JLM A;  1AMP A;  2DF5 A;  1YW6 A;  1QSO A;  1SQH A;  3F5B A;  1Y9K A;  4FWU A;  3RAM A;  1PU9 A;  2Q51 A;  3S6K A;  2OU2 A;  4YGO A;  1NMT A;  4NGT A;  4MMO A;  4H2K A;  2ATR A;  3WT4 A;  5KTD A;  4O23 A;  3GB0 A;  1QST A;  5IX3 A;  4C68 A;  4EME A;  1YW4 A;  4XNH B;  4R8F A;  3PB8 X;  4UEE A;  2V8H A;  3CXP A;  3QNV A;  1Y0Y A;  2B5G A;  2V8G A;  4P4F A;  3TC8 A;  4E8O A;  3GUX A;  3LWU A;  4TWE A;  1S3Z A;  5LRJ A;  1I1D A;  2B4D B;  3OWC A;  4RI1 A;  4PXD A;  4NGM A;  2DPT A;  4UF4 A;  4X2T A;  3R96 A;  3FXT A;  2R1I A;  4P4B A;  4FAI A;  4UCM A;  1RXT A;  2FL4 A;  4QB9 A;  1S7F A;  4A33 A;  1IOF A;  5K8O A;  5CBM A;  3MN8 A;  4CRZ B;  1YK3 A;  3I9S A;  3D7F A;  3LMS A;  3S6H A;  4AG7 A;  3D4U A;  4NGN A;  3DR6 A;  3TX8 A;  3S9M A;  3D2M A;  1P0H A;  1BLL E;  3EFA A;  1BO4 A;  2AFS A;  3IFE A;  4AVC A;  1BPN A;  1OBR A;  1U6M A;  2RB7 A;  4C2X A;  2NYQ A;  4PQA A;  5JPH A;  3ISX A;  2V8D A;  3KQZ A;  1TKH A;  2PJ5 A;  2Z3L A;  3FVL A;  4LQ6 A;  5I0C A;  4LQG A;  4MRI A;  3PBE A;  1S7K A;  2WZN A;  1F57 A;  2AFX A;  2DPS A;  2CXA A;  2REF A;  3N5F A;  4B5O A;  5J8C A;  4BMH A;  4OLL A;  4DUK A;  1M44 A;  3SXO A;  3V7Z A;  3FIX A;  2NSM A;  4M6G A;  4U9Y A;  4CGO A;  2AFO A;  4B13 A;  1KWM A;  5JH9 A;  2BUE A;  4YRH A;  2O28 A;  2Z3K A;  3RO0 A;  5DWN A;  3KGQ A;  3PGP A;  4B5P A;  3S9N A;  3SXN A;  3GYA A;  3KR5 A;  4CYN A;  4MFL A;  1MJA A;  3R95 A;  4CS0 B;  3D7D A;  3EXN A;  2GRE A;  4UCN A;  1VGY A;  2ZW4 A;  3IO1 A;  3C26 A;  1NE9 A;  2P6F A;  3FEC A;  1YME A;  3ISZ A;  1QSN A;  4MFP A;  1LCP A;  3DGV A;  3LOD A;  3NA6 A;  1Q7L A;  2GFQ A;  2GE3 A;  4Y49 C;  1Z2L A;  2IQ6 A;  1MJB A;  4MFQ A;  2AFW A;  3SJF A;  1ZLI A;  1M4I A;  2HQY A;  3FRM A;  3PB4 X;  4OKO A;  1VHE A;  2Y0M A;  4A95 A;  4CYP A;  2Q4Z A;  4NEX A;  4XPL A;  5F09 A;  4MHZ A;  3MRU A;  1XRY A;  1IB1 E;  4CAE A;  2FIW A;  3RNZ A;  4FD4 A;  1FNO A;  1WK4 A;  2ZXV A;  2IL4 A;  4FD6 A;  3B3V A;  1CPS A;  4FUU A;  5J8F A;  1LFW A;  1N71 A;  3PEI A;  2Z10 A;  3B3C A;  3LD2 A;  4NGP A;  3G3S A;  2VEZ A;  3DSB A;  3NE7 A;  3QAY A;  1HDQ A;  5J1Q A;  2GLF A;  2ODF A;  2WPX A;  4IUS A;  1VHO A;  4OIW A;  4OC3 A;  4Q7A A;  3BI1 A;  5IB9 A;  2EO8 A;  5AG4 A;  3PFE A;  2HUZ A;  4AXV A;  4PK3 A;  5JGF A;  6CPA A;  2ZEO A;  2Q43 A;  5G1Z A;  3JTK A;  3LAC A;  1Y9W A;  4B6Z A;  4UWJ A;  1B87 A;  4MCS A;  4XPK A;  4MFJ A;  5LRG A;  4CGP A;  1ZG8 A;  2RC4 A;  1CP6 A;  4P4E A;  1CP7 A;  4UFX A;  4FD7 A;  1MJ9 A;  1YLO A;  3TT2 A;  2D4O A;  4MCP A;  4UIB A;  2WPW A;  1M4G A;  2R8V A;  4B11 A;  4GS4 A;  1XF8 A;  2POK A;  2Q0Y A;  2OZG A;  3TOB A;  1IYL A;  3K9T A;  4NGR A;  3B8G A;  2GAN A;  3IU2 A;  4U5Y A;  2HV2 A;  2B3U A;  5EMI A;  2B4D A;  1JWQ A;  4AVB A;  2IJZ A;  2CTC A;  4MI4 A;  3RZA A;  1M4D A;  3WC5 A;  4EWT A;  2EUI A;  4J3G A;  1ZLH A;  4NFR A;  1PYT B;  2CNT A;  1UWY A;  2EK8 A;  4PSW A;  3FH4 A;  4ORF A;  4KOR A;  3KHZ A;  4C7I A;  4UBR A;  3EO4 A;  3D66 A;  4NGS A;  3KZW A;  1KUX A;  3IWW A;  4HKF A;  3IC1 A;  4ZX9 A;  3VAR A;  3VH9 A;  1K4J A;  2O4H A;  3VWE A;  3WAB A;  5C82 A;  1YRE A;  3R9E A;  5THW A;  1L0C A;  1IYK A;  3WC7 A;  4A94 A;  4HNW B;  1R57 A;  5F48 A;  1XEB A;  4IF5 A;  2B4B A;  4OID A;  4KVM E;  3SI2 A;  2CF4 A;  3B3S A;  5F49 A;  1XMB A;  3FYN A; 
#chains in the Genus database with same CATH homology
 1WWZ A;  2QIR A;  3CXS A;  3BJ8 A;  4CGN A;  1VHS A;  1YR0 A;  2JEV A;  5AG6 A;  4FD5 A;  3R9G A;  1UFH A;  4LUA A;  5C88 A;  4H6U A;  1YX0 A;  3TO7 A;  3V8I A;  2BSW A;  3QB8 A;  4NSQ A;  3R9F A;  1OZP A;  2Z3O A;  2H5M A;  1V0C A;  1NSL A;  4R87 A;  3S6F A;  3IU1 A;  2A4N A;  3A9L A;  1PUA A;  2OH1 A;  4A32 A;  1ON0 A;  3W6S A;  5A27 A;  2VZY A;  1KUY A;  2AE6 A;  3JUW A;  4JD6 A;  2G0B A;  4PV6 A;  1KZF A;  3BLN A;  4CAW A;  1I12 A;  2EVN A;  4KSF A;  4NXY A;  4Q36 A;  4M3S A;  2ZPA A;  2G3A A;  1Q2D A;  2KCW A;  1S5K A;  1BOB A;  3W91 A;  3H4Q A;  4CGM A;  4JXR A;  1Y7R A;  4B14 A;  4R57 A;  4UFW A;  2CY2 A;  3TCV A;  5JQ4 A;  1IID A;  4H89 A;  4X5K A;  4KOV A;  1Z4E A;  3ZZI A;  2DXQ A;  3IWE A;  4CYQ A;  3D2P A;  4I49 A;  2Z3N A;  2BL1 A;  2QML A;  4Q38 A;  2I79 A;  2J8N A;  4UFV A;  2REE A;  1RO5 A;  4KOU A;  5AG7 A;  3GKR A;  1Q2C A;  4MFZ A;  1P4N A;  2VBQ A;  2BEI A;  3TTH A;  1J4J A;  2WSA A;  5CNP A;  2FS5 A;  4XNH C;  2YNC A;  4B5P B;  1IIC A;  4KZT A;  3KKW A;  3FBU A;  1CM0 A;  4MFK A;  4CYO A;  2QEC A;  4LX9 A;  4PSX A;  2K5T A;  4KS9 A;  3EC4 A;  4H6Z A;  2P6E A;  2D4P A;  2Q4Y A;  4OAE A;  3K9U A;  2B3V A;  2FT0 A;  5AGE A;  4Y49 B;  5KTC A;  2P0W A;  5DWM A;  5FVJ A;  2CNM A;  3E0K A;  2VQY A;  3MGD A;  4PK2 A;  5AG5 A;  3T90 A;  4QC6 A;  4A30 A;  1QSM A;  2Q7B A;  5EC4 A;  1M1D A;  4C2Z A;  3EY5 A;  3D3S A;  5HH1 A;  5GCN A;  4DNC A;  2R7H A;  2JDC A;  1VKC A;  4KOS A;  3SHP A;  4R9M A;  3TO6 A;  4QVT A;  3QAH A;  5G22 A;  3FNC A;  4CAX A;  4XPD C;  2FXF A;  1XMT A;  2PQ8 A;  2VXK A;  4JJX A;  4L8A A;  2YNE A;  5F47 A;  3IGR A;  3RYO A;  2Z11 A;  1FY7 A;  1YGH A;  4KOT A;  2J8M A;  3DNS A;  2PC1 A;  3TOA A;  4MBU A;  4KUA A;  2PSW A;  4ZBG A;  1ZO0 A;  1Q2Y A;  4MJ8 A;  2ZW5 A;  4QBJ A;  2GIV A;  1CJW A;  2FSR A;  4A2Z A;  1I21 A;  4NF1 A;  4ZGY B;  4KVO E;  4KOX A;  5A28 A;  1S60 A;  2AJ6 A;  2NMT A;  3BJ7 A;  2YND A;  3N7Z A;  5IV0 A;  4OAD A;  5IB0 A;  4HNX B;  4AG9 A;  2J8R A;  2ZW7 A;  2FE7 A;  1QSR A;  4K30 A;  1Z4R A;  3G8W A;  2X7B A;  2CNS A;  3UY5 A;  2YGW A;  4E0A A;  2JDD A;  5E96 A;  4JLY A;  2PR1 A;  2B5G B;  1YVO A;  2OZH A;  4F6A A;  5G20 A;  1TIQ A;  2I00 A;  4U9Z A;  3VWD A;  3D8P A;  4XPD B;  2R98 A;  4L89 A;  3S6G A;  3TFY A;  5BWA B;  2G3T A;  4B12 A;  2Q44 A;  5H86 A;  2Z3M A;  3H5Z A;  3P2F A;  5KTA A;  3F0A A;  2C27 A;  1KUV A;  1MK4 A;  5H84 A;  1YLE A;  4M85 A;  2ZW6 A;  5G21 A;  3W6X A;  3JVN A;  4MHD A;  4CGL A;  1LRZ A;  3CXQ A;  2PDO A;  4NCZ A;  4A31 A;  4JWP A;  3DDD A;  2FCK A;  5F46 A;  4KOY A;  2F5I A;  4B10 A;  4C7H A;  2YNC C;  3R1K A;  3I3G A;  2VI7 A;  4KVX A;  3ZJ0 A;  3F8K A;  2WUU A;  4CAV A;  4F0Y A;  4E2A A;  2B58 A;  4MY0 A;  4UA3 A;  2OB0 A;  4CAF A;  2Q04 A;  4MY3 A;  2P6G A;  1B6B A;  1YVK A;  3IWG A;  4KLW A;  5HMN A;  3PZJ A;  3PP9 A;  2Z3P A;  4R3K A;  4UWI A;  1XE4 A;  4YFJ A;  4KOW A;  2PRB A;  3TO9 A;  5EBV A;  4HNY B;  4AB7 A;  4EVY A;  2PR8 A;  4C2Y A;  2Z0Z A;  3GY9 A;  4RS2 A;  4CRY B;  4KSA A;  2Q4V A;  1S7L A;  3P2H A;  4KLV A;  5ISV A;  4AVA A;  3TE4 A;  4QUS A;  4F0X A;  3T9Y A;  4II9 A;  1S7N A;  2OZU A;  1Z9U A;  3FB3 A;  4KUB A;  3DR8 A;  1GHE A;  1XIX A;  2VZZ A;  4JXQ A;  4BBH A;  3WR7 A;  2FIA A;  2ARH A;  4ONU A;  4UCP A;  4R3L A;  2JLM A;  1QSO A;  1SQH A;  3F5B A;  1Y9K A;  1PU9 A;  3S6K A;  2OU2 A;  4YGO A;  1NMT A;  2ATR A;  5KTD A;  1QST A;  5IX3 A;  4C68 A;  4XNH B;  3CXP A;  2B5G A;  4E8O A;  1S3Z A;  1I1D A;  2B4D B;  3OWC A;  4RI1 A;  2DPT A;  3R96 A;  3FXT A;  2R1I A;  4UCM A;  1RXT A;  2FL4 A;  4QB9 A;  1S7F A;  4A33 A;  4CRZ B;  1YK3 A;  3I9S A;  3S6H A;  4AG7 A;  3DR6 A;  3D2M A;  1P0H A;  3EFA A;  1BO4 A;  4AVC A;  1U6M A;  4C2X A;  5JPH A;  2Z3L A;  5I0C A;  1S7K A;  4B5O A;  2DPS A;  2REF A;  5J8C A;  2CXA A;  4BMH A;  4OLL A;  1M44 A;  3SXO A;  4CGO A;  3FIX A;  4U9Y A;  4B13 A;  2BUE A;  4YRH A;  2O28 A;  2Z3K A;  5DWN A;  3PGP A;  4B5P A;  3SXN A;  3GYA A;  4CYN A;  4MFL A;  1MJA A;  3R95 A;  4CS0 B;  3EXN A;  5C82 A;  4UCN A;  2ZW4 A;  3C26 A;  1NE9 A;  2P6F A;  1QSN A;  4MFP A;  3LOD A;  2GE3 A;  4Y49 C;  1MJB A;  4MFQ A;  1M4I A;  2HQY A;  3FRM A;  4A95 A;  2Y0M A;  4CYP A;  4NEX A;  4XPL A;  1IB1 E;  4CAE A;  2FIW A;  4FD4 A;  1WK4 A;  2ZXV A;  2IL4 A;  4FD6 A;  5J8F A;  1N71 A;  2Z10 A;  3LD2 A;  3G3S A;  2VEZ A;  3DSB A;  3NE7 A;  2WPX A;  4IUS A;  5AG4 A;  2HUZ A;  4PK3 A;  5G1Z A;  3JTK A;  1Y9W A;  4UWJ A;  1B87 A;  4XPK A;  4MFJ A;  4CGP A;  2RC4 A;  4UFX A;  4FD7 A;  1MJ9 A;  4B11 A;  3TT2 A;  2D4O A;  2WPW A;  1M4G A;  2R8V A;  4GS4 A;  1XF8 A;  2Q0Y A;  3TOB A;  2OZG A;  1IYL A;  3B8G A;  2GAN A;  3IU2 A;  4U5Y A;  2HV2 A;  2B3U A;  2B4D A;  4AVB A;  4MI4 A;  1M4D A;  2EUI A;  4J3G A;  2CNT A;  4PSW A;  4ORF A;  4KOR A;  4C7I A;  4UBR A;  3EO4 A;  1KUX A;  4HKF A;  3VWE A;  1K4J A;  1YRE A;  3R9E A;  1L0C A;  1IYK A;  4HNW B;  1R57 A;  5F48 A;  1XEB A;  4IF5 A;  2B4B A;  4KVM E;  5F49 A;  3FYN A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...