3PZJA

Crystal structure of a probable acetyltransferases (gnat family) from chromobacterium violaceum atcc 12472
Total Genus 49
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
49
sequence length
198
structure length
198
Chain Sequence
SPPIAPSTPLLAGWRSAGKAPEAAIRGEAVSLQPLDAPRHGAALFRLFAGDDSHWEHLPYGPFEDEDAFITWLALTVAQSDTALYVVCAKDSDQALGFLGYRQMVQAHGAIEIGHVNFSPALRRTRLATEAVFLLLKTAFELGYRRCEWRCDSRNAASAAAARRFGFQFEGTLRQAMVVKRRNRDTHVFSMLDGEWDA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of a probable acetyltransferases (GNAT family) from Chromobacterium violaceum ATCC 12472
rcsb
source organism Chromobacterium violaceum
molecule tags Transferase
molecule keywords Probable acetyltransferases
total genus 49
structure length 198
sequence length 198
chains with identical sequence B
ec nomenclature ec 2.3.1.-:
pdb deposition date 2010-12-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13302 Acetyltransf_3 Acetyltransferase (GNAT) domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.630.30 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Aminopeptidase 3pzjA00
4YRHA 2BSWA 1QSNA 2PSWA 1FY7A 4L8AA 2G3TA 1LRZA 3R9EA 2P6EA 4Y49B 3B8GA 4QBJA 4YGOA 4ZBGA 4XPKA 5H84A 4OADA 1NMTA 1P4NA 2WPXA 5GCNA 4UWJA 4F6AA 4NSQA 2HQYA 4B5PB 2P0WA 2BEIA 1BO4A 4IUSA 4MI4A 4QUSA 4CRZB 2OZUA 4OAEA 1XE4A 4RI1A 3ZZIA 3EFAA 3LODA 4IF5A 3P2FA 2VEZA 2EVNA 3TO9A 2REEA 2VXKA 3E0KA 1XF8A 3JVNA 3R9GA 5F47A 4OLLA 3D2PA 2HUZA 2QECA 3QB8A 3GY9A 3R96A 1I12A 5JQ4A 1B87A 4NCZA 1WK4A 3I9SA 5KTAA 1CM0A 1B6BA 4KZTA 4PK2A 2FXFA 4U5YA 2OU2A 2ZW5A 4X5KA 4CRYB 1RO5A 5EC4A 5KTCA 3GYAA 5C88A 4XPDC 1S3ZA 1S7NA 2NMTA 1Z4RA 3D8PA 4NF1A 2B4DB 3EC4A 2B5GA 3FNCA 2FIAA 2B58A 2FCKA 5IX3A 2FT0A 4E0AA 1PUAA 3RYOA 2PC1A 1YREA 3T90A 1P0HA 4F0YA 3F8KA 2FS5A 2BL1A 4NXYA 4XPDB 2ZW6A 3S6HA 2F5IA 4KVOE 4QC6A 1YVOA 4CS0B 2R8VA 2HV2A 4HNXB 4KOVA 2D4OA 5DWMA 4KOSA 1R57A 4UA3A 3R9FA 3W6SA 1IYLA 4HKFA 2P6FA 4II9A 2ZPAA 2AE6A 4JXQA 4J3GA 4BMHA 3I3GA 1GHEA 1RXTA 2JLMA 2ATRA 1YLEA 4L89A 1ON0A 2KCWA 4KOUA 1J4JA 1L0CA 2JDCA 2RC4A 4I49A 2ARHA 5E96A 1I1DA 1IIDA 3WR7A 2IL4A 3EY5A 1IYKA 3F0AA 4PSWA 2REFA 2J8NA 3R1KA 4H6UA 4ONUA 5F46A 4UWIA 4R87A 1M4GA 2J8RA 4XPLA 2J8MA 1QSRA 3BJ8A 4PK3A 2FIWA 4PSXA 2O28A 3FRMA 4KOYA 3DR6A 3NE7A 4XNHC 4HNYB 1Y9KA 4MY0A 3DNSA 3VWEA 1YR0A 4YFJA 1M44A 1UFHA 4KUAA 1BOBA 4K30A 3S6GA 1IB1E 4QB9A 5KTDA 2ZXVA 1XIXA 2OZHA 2OZGA 3BLNA 1S7FA 2D4PA 1M4DA 3EO4A 4R3LA 5F49A 2PRBA 5EBVA 1MJAA 3D2MA 3DDDA 1WWZA 1S5KA 4AB7A 2X7BA 2G0BA 2B3UA 3G8WA 4JJXA 1I21A 4AVAA 2Q04A 4KORA 4KVXA 4R57A 4UBRA 4H6ZA 3CXSA 4MBUA 3T9YA 2QIRA 2GE3A 1KUVA 2VQYA 1S7LA 3FIXA 2VI7A 3GKRA 4KLVA 2C27A 5JPHA 2Z10A 1N71A 2EUIA 4GS4A 1Y9WA 4U9YA 4KVME 4AVCA 4E2AA 5HH1A 4E8OA 3F5BA 4KLWA 1YX0A 3JUWA 2Q7BA 2A4NA 4MHDA 3R95A 5F48A 3S6KA 4MY3A 4Y49C 4M85A 2VZZA 2Q44A 4CAWA 1Z4EA 2Q0YA 4EVYA 1XEBA 2GIVA 3LD2A 1S60A 4KOTA 5J8FA 4JXRA 4JWPA 1VHSA 3TCVA 4RS2A 1K4JA 3PP9A 1XMTA 1Q2DA 2VBQA 2FL4A 2ZW4A 4M3SA 3C26A 3VWDA 5IB0A 1S7KA 3V8IA 3QAHA 1QSTA 3D3SA 4AVBA 4JD6A 2ZW7A 3ZJ0A 2FSRA 1QSOA 2QMLA 5J8CA 1KZFA 2CY2A 3CXPA 3EXNA 3TT2A 1Y7RA 4R3KA 1VKCA 4QVTA 1KUXA 1NE9A 5IV0A 2OB0A 3DSBA 3TE4A 4PV6A 1Q2CA 4AG7A 5DWNA 3KKWA 2FE7A 2AJ6A 1V0CA 3TOBA 1TIQA 4CAVA 1NSLA 2Q4VA 2OH1A 3TO7A 2JDDA 2PR8A 2I79A 1PU9A 2Y0MA 1KUYA 2Z11A 4KUBA 3S6FA 3H4QA 4FD7A 2R98A 3IGRA 2B4DA 3SXOA 2GANA 2PR1A 3CXQA 2VZYA 1IICA 2H5MA 5FVJA 3BJ7A 3TO6A 4B5OA 4FD4A 3W6XA 1MJBA 1M4IA 1YGHA 1QSMA 3K9UA 2PDOA 4H89A 2R1IA 4LUAA 4MJ8A 4LX9A 1Z9UA 2WPWA 3FYNA 1MK4A 3FXTA 5CNPA 5H86A 5C82A 4JLYA 3MGDA 2B5GB 2I00A 4AG9A 3TOAA 3SXNA 2B3VA 4R9MA 4U9ZA 4HNWB 4FD5A 5ISVA 2CNTA 2K5TA 2Q4YA 4KOWA 3IWGA 2DXQA 3N7ZA 2Z0ZA 4NEXA 3FB3A 2CNSA 3G3SA 4CAXA 2R7HA 2G3AA 2B4BA 3SHPA 1YK3A 1U6MA 4KOXA 4FD6A 3P2HA 2PQ8A 3PZJA 1YVKA 1Q2YA 3PGPA 2BUEA 4DNCA 1M1DA 5HMNA 4ORFA 5I0CA 3W91A 2P6GA 1CJWA 3UY5A 3OWCA 3DR8A 2CNMA 4B5PA 3FBUA 3TFYA 3TTHA 1MJ9A 1SQHA 4XNHB 2JEVA 1OZPA
chains in the Genus database with same CATH superfamily
4CAEA 4YRHA 4IHMA 4O23A 4CAFA 3D7GA 2BSWA 2Z3PA 4UF4A 1QSNA 2PSWA 4MFJA 1FY7A 4MHNA 4L8AA 4UCPA 2G3TA 1LRZA 3H8GA 3JRUA 5EMIA 3R9EA 2P6EA 3RZAA 1QMUA 4Y49B 1HDQA 3B8GA 4NJRA 4QBJA 4YGOA 4ZBGA 4XPKA 3D66A 3KR4A 2CIJA 2JBJA 4NGPA 2RFHA 3GB0A 1IU8A 5H84A 4OADA 1F2OA 1NMTA 1P4NA 1Z8TA 4MCRA 2WPXA 5GCNA 2BO9A 1CPXA 3H8EA 4UWJA 4LQGA 2C1CA 4F6AA 4NSQA 1VIXA 2JBKA 2HQYA 3ISXA 2NSMA 3RNZA 4B5PB 1DE4C 2P0WA 2BEIA 1BO4A 3FECA 3D7DA 4IUSA 3H8FA 4MI4A 5G21A 4QUSA 4CRZB 5JGFA 4NGTA 1CG2A 2OZUA 4OAEA 4PXEA 1LAPA 2PIYA 2RB7A 1XE4A 4RI1A 4CGNA 3SI1A 3ZZIA 3SI0A 4FWUA 1GYTA 2ZEPA 3PB9X 3EFAA 2PVWA 2WUUA 3LODA 4BD9A 4TWEA 4IF5A 4JYWA 4LQ6A 4WJBA 3P2FA 2VEZA 4WWVA 3LMSA 2EVNA 4P6YA 1CX8A 5LYFA 1R3NA 4MFQA 2REEA 3TO9A 4NJQA 4MFPA 2VXKA 2WSAA 2Z3LA 2ZEEA 5LRGA 5JH9A 1A2ZA 4A33A 2GFQA 2OOTA 3E0KA 1XF8A 4MFLA 4A39A 5IB9A 7CPAA 3JVNA 1XMBA 3R9GA 2POKA 5F47A 1BLLE 4OLLA 2AFXA 3FMCA 4OC3A 3SI2A 3D2PA 2HUZA 2QECA 3QB8A 1YSJA 1CBXA 4F9UA 3GY9A 3PFEA 3NH4A 3R96A 2PJCA 4C2YA 1I12A 3LACA 4F0XA 5JQ4A 5LRKA 1B87A 4NCZA 1WK4A 3I9SA 5KTAA 1CM0A 2ZEHA 1B6BA 4OC1A 4KZTA 2G9DA 3PBEA 3B3SA 2FXFA 4PK2A 1XFOA 4F8ZA 2PVVA 4U5YA 2OU2A 2ZW5A 5AG7A 4X5KA 2C6CA 4Q7AA 4CRYB 2YNCC 1RO5A 4B6ZA 5EC4A 4CYPA 5KTCA 4UFWA 3GYAA 1Z8XA 1LANA 5C88A 1R43A 4XPDC 1S3ZA 8CPAA 1S7NA 2NMTA 3FVLA 1FNOA 1Z4RA 3D8PA 3CPXA 3D7FA 1Z2LA 2GLJA 4A38A 4A94A 2V8GA 1ARMA 1FT7A 3KR5A 1PCAA 2B4DB 2B5GA 3EC4A 3FNCA 4NF1A 2FIAA 2B58A 2FCKA 5IX3A 2FT0A 4CGPA 2YGWA 1PUAA 4E0AA 5LYIA 3RYOA 2PC1A 3TX8A 2PJ0A 2Z3NA 2V8HA 4YU9A 1YREA 3T90A 2CTCA 4EFDA 3MRUA 3QAYA 4NGMA 5G22A 4FAIA 1P0HA 4F0YA 4FBEA 3F8KA 2FS5A 3WT4A 2BL1A 3DGVA 4NXYA 4UEEA 4XPDB 1IOFA 1TKFA 2ZW6A 4ZX8A 2F5IA 3S6HA 4KVOE 4RUHA 3PEIA 3B7IA 4QC6A 1YVOA 2XEFA 3IWEA 4CS0B 2R8VA 2HV2A 4HNXB 4KOVA 3PB4X 4R6TA 3FEEA 4X3RA 2D4OA 5DWMA 4KOSA 1R57A 4MHPA 4OP4A 2QYVA 4UA3A 3R9FA 3W6SA 1LOKA 4C2ZA 1IYLA 4HKFA 2P6FA 3KGQA 4II9A 5K8OA 4P4FA 2ZPAA 4P4BA 3VH9A 3KHXA 3B35A 4KSIA 2AE6A 2PE3A 4J3GA 4JXQA 3B3VA 4R8FA 4BMHA 3I3GA 1GHEA 3RBUA 1YQEA 1XRYA 1RXTA 2WYRA 1X12A 2JLMA 2ATRA 1YLEA 4X8IA 4L89A 4B13A 4NGQA 4TNUA 4A30A 4Q36A 1ON0A 4P4JA 1XOVA 2KCWA 4KOUA 1J4JA 1XJOA 1L0CA 1ZLHA 2JDCA 4OMEA 4P4IA 5AG4A 1ZG7A 3KASA 5G20A 2RC4A 2WZNA 4I49A 2ARHA 5E96A 1BAVA 1LCPA 4OC2A 1I1DA 3VATA 3PBBA 2ZEGA 4PXCA 1BPNA 3HLPA 4OC0A 1IIDA 3WR7A 2IL4A 3BHXA 2YNCA 3EY5A 1IYKA 3F0AA 4PSWA 4A37A 2REFA 4IAVA 2J8NA 3R1KA 4H6UA 4ONUA 5F46A 1HEEA 4UWIA 3A9LA 2IQ6A 1M4GA 4R87A 2BOAA 2J8RA 4FUUA 2J8MA 3K2KA 4XPLA 3JTKA 1QSRA 2PJ4A 3BJ8A 4KS9A 4PK3A 4NFRA 2FIWA 3FX6A 4PSXA 3D68A 5HXDA 2O28A 3FRMA 4KOYA 5J1QA 4R76A 3DR6A 3NE7A 4XNHC 4HNYB 1Y9KA 4MY0A 5LRJA 3SJEA 4OC4A 3DNSA 3VWEA 4CYOA 1YR0A 4YFJA 2NYQA 1M44A 3GIUA 3IIBA 1UFHA 2HC9A 4KUAA 1BOBA 3K9TA 4GXHA 2ANPA 2J9AA 2PJAA 4K30A 3S6GA 1ARLA 4P4DA 1IY7A 1IB1E 4QB9A 5KTDA 2ZXVA 1XIXA 2QJ8A 2OZHA 2PJ2A 2OZGA 3IJ3A 4ONWA 2ZENA 3BLNA 2PIZA 1S7FA 2F7VA 2D4PA 1M4DA 2BCOA 3EO4A 2O53A 2PCUA 3B3WA 4MXUA 2V77A 4R3LA 4UFVA 5F49A 4UCMA 2PJ8A 2ZELA 2PRBA 3IFEA 4ZY0A 5EBVA 1MJAA 3CT9A 3PB6X 2PJBA 3D2MA 4OIWA 5D29A 3DDDA 1WWZA 2V8VA 3CDXA 1S5KA 5CBMA 4AB7A 2X7BA 2G0BA 3RAMA 2YNDA 4M6IA 5F09A 5LYDA 5HVHA 2B3UA 1TXRA 3G8WA 4CYNA 4JJXA 3MN8A 4CPAA 4C2XA 1I21A 3GLJA 4KSAA 4AVAA 2ZEFA 5AG5A 2Q04A 4KORA 4KVXA 4R57A 4UBRA 3FJUA 4H6ZA 1VHOA 1ELMP 3CXSA 3KL9A 4MBUA 2QIRA 3T9YA 2GE3A 4P4EA 3S9LA 3CPAA 1RTQA 3IU1A 4OIDA 1JWQA 4B10A 1KUVA 3DLJA 4IK2A 1XBUA 2VQYA 1S7LA 3FIXA 2VI7A 3GKRA 4KLVA 2C27A 5JPHA 2Z10A 1VHEA 1N71A 2Q51A 4ZX9A 2EUIA 4GS4A 5BWAB 1Y9WA 3PB8X 3TC8A 2AFWA 3I1UA 4U9YA 1Z5RA 1LAMA 2OR4A 4KVME 4AVCA 3KI9A 4E2AA 1Q7LA 1QQ9A 4MMOA 1Y0RA 5HH1A 5CPAA 4E8OA 1Y0YA 2DPTA 3F5BA 5DS0A 4KLWA 5HVFA 3FH4A 3S9NA 1YX0A 3JUWA 2Q7BA 2A4NA 4MHDA 4DJLA 3R95A 5F48A 3S6KA 4MY3A 4Y49C 3B2YA 2VZZA 4M85A 2Q44A 4CAWA 4OC5A 5LYLA 1Z4EA 2Q0YA 3KQXA 1Z8WA 2ZOFA 4MFZA 3FF3A 2Z3MA 3IEHA 4PXDA 4EVYA 3H5ZA 4BINA 1XEBA 2GIVA 2IMOA 1CP6A 3HUVA 3LD2A 1S60A 4KOTA 4UFXA 5K8NA 3SJGA 4M6HA 5J8FA 2EBJA 4JXRA 1NSAA 4JWPA 1VHSA 4OKOA 3TCVA 2PJ7A 4RS2A 3V7ZA 1K4JA 1PYTB 4ZGYB 3PP9A 2F8HA 1XMTA 1Q2DA 5I4MA 2EK8A 4UEFA 2Z3KA 1F2PA 3NH8A 2VBQA 2FL4A 2ZW4A 2PJ9A 2V8DA 2EWBA 4M3SA 2O4HA 4PQAA 2PJ1A 3C26A 3VWDA 4P10A 4B12A 5IB0A 1S7KA 3V8IA 3QAHA 4F9VA 1QSTA 1VGYA 2CXAA 1YW4A 3D3SA 4AVBA 4JD6A 2VL1A 1F57A 2ZW7A 3ZJ0A 2FSRA 1QSOA 2QMLA 4CGOA 5J8CA 1KZFA 3WC6A 4CGMA 4A31A 4ZY1A 3N5FA 2CY2A 1EE3P 4EMEA 3CXPA 3EXNA 3TT2A 1Y7RA 3V38A 4R3KA 1VKCA 3D4UA 4MHZA 4QVTA 1KUXA 4UEZA 4X2TA 2EK9A 3KQZA 1NE9A 4MRIA 5IV0A 2OB0A 3DSBA 3LWUA 3TE4A 3KHZA 4PV6A 1Q2CA 4AG7A 4KSFA 5DWNA 3KKWA 2FE7A 4MCQA 3SJFA 1YW6A 2AJ6A 2PJ5A 1V0CA 1CP7A 3PRTA 3WC7A 3TOBA 1TIQA 1UWYA 3BXMA 4CAVA 3IC1A 1NSLA 2Q4VA 1IGBA 2OH1A 3D7HA 2JDDA 3TO7A 2AFOA 2PR8A 2I79A 1KWMA 1PU9A 4H2KA 2Y0MA 1KUYA 2Z11A 4KUBA 3S6FA 4MCPA 4PXBA 4UIBA 3QNVA 3SJXA 3H4QA 4FD7A 2R98A 4PPZA 3IGRA 3NE8A 4YWYA 2HB6A 2B4DA 3SXOA 4CGLA 2GANA 2PR1A 3CXQA 2VZYA 1IICA 2AFSA 2H5MA 2ABZA 5FVJA 3B3TA 2GLFA 4CYQA 3BJ7A 3FEDA 2C6PA 1TKHA 3TO6A 4B5OA 4FD4A 5AGEA 3W6XA 1MJBA 3WC5A 5K8MA 4MFKA 1ZLIA 4C68A 1Z8LA 4Z65A 1M4IA 4R7MA 1YGHA 3BI0A 1QSMA 1ELLP 1ZG8A 2ODFA 3K9UA 4G1PA 2PDOA 3PB7X 4H89A 4ZYQA 4C7HA 4P44A 2R1IA 2YNEA 3CZXA 3NFZA 3KZWA 4HPSA 1AYEA 3ISZA 2DEAA 3IWWA 4LUAA 1IOIA 1Y7EA 2DPSA 4LX9A 4MJ8A 1Z9UA 2WPWA 3FYNA 1MK4A 3FXTA 5JM6A 2XEIA 5CNPA 5H86A 4UIAA 5C82A 2AFUA 4JLYA 3MGDA 2B5GB 5A28A 2AFZA 1TKJA 4MHYA 4ZY2A 2Q7SA 2QVPA 4JZ0A 5D8NA 2ZOGA 1TF9A 3S9MA 3PFOA 5ELYA 4Q38A 2I00A 4P45A 1M4LA 1LFWA 2ZEOA 4AG9A 1HDUA 5THWA 1OBRA 3TOAA 3SXNA 2B3VA 3T8WA 4NGRA 4R9MA 4U9ZA 1BPMA 4HNWB 1ZG9A 2PJ3A 4FD5A 4B11A 5ISVA 2CNTA 2GU2A 1CPSA 1YMEA 2K5TA 2CF4A 2Q4YA 3NA6A 4KOWA 3IWGA 2DXQA 4K3NA 2JEWA 6CPAA 2Z3OA 3N7ZA 1X10A 2Z0ZA 4BBHA 4C7IA 1H8LA 4NGNA 4NEXA 3FB3A 3VARA 2CNSA 4DYOA 2AFMA 3RO0A 1AMPA 4AXVA 3GUXA 3G3SA 4CAXA 5HVGA 2XEGA 2R7HA 5K8PA 2G3AA 3L2NA 2B4BA 5A27A 2ZEMA 3SHPA 4A95A 1YK3A 1U6MA 2PJ6A 4KOXA 3IO1A 4FD6A 3P2HA 2PQ8A 3PZJA 1YVKA 1DTDA 1Q2YA 4A2ZA 3PGPA 1AUGA 2BUEA 4DNCA 1M1DA 2XEJA 5HMNA 2GREA 2I3CA 3WABA 4ORFA 2Q4ZA 1ZO0A 2Q43A 5I0CA 3W91A 2P6GA 1CJWA 1TF8A 2EO8A 4GM5A 3UY5A 5G1ZA 3D67A 4EWTA 2C6GA 2DF5A 4MCSA 2ZEDA 3OWCA 3DR8A 2IJZA 3IU2A 4ZI6A 4B14A 4UCNA 2CNMA 4DUKA 4M6GA 4W9YA 1YLOA 2FVGA 4B5PA 3FBUA 3TFYA 4A32A 3NH5A 3B3CA 2PRQA 3TTHA 5AG6A 1JQGA 1MJ9A 3BI1A 4RN7A 1SQHA 4NGSA 4XNHB 2CTBA 2JEVA 1OZPA
chains in the Genus database with same CATH topology
4CAEA 4YRHA 4CAFA 2BSWA 2Z3PA 1QSNA 2PSWA 4MFJA 1FY7A 4L8AA 4UCPA 2G3TA 1LRZA 3R9EA 2P6EA 4Y49B 3B8GA 4QBJA 4YGOA 4ZBGA 4XPKA 5H84A 4OADA 1NMTA 1P4NA 2WPXA 5GCNA 4UWJA 4F6AA 4NSQA 2HQYA 4B5PB 2P0WA 2BEIA 1BO4A 4IUSA 4MI4A 5G21A 4QUSA 4CRZB 2OZUA 4OAEA 1XE4A 4RI1A 4CGNA 3ZZIA 3EFAA 2WUUA 3LODA 4IF5A 3P2FA 2VEZA 2EVNA 3TO9A 4MFQA 2REEA 4MFPA 2VXKA 2WSAA 2Z3LA 4A33A 3E0KA 1XF8A 4MFLA 3JVNA 3R9GA 5F47A 4OLLA 3D2PA 2HUZA 2QECA 3QB8A 3GY9A 3R96A 4C2YA 1I12A 4F0XA 5JQ4A 1B87A 4NCZA 1WK4A 3I9SA 5KTAA 1CM0A 1B6BA 4KZTA 4PK2A 2FXFA 4U5YA 2OU2A 2ZW5A 5AG7A 4X5KA 4CRYB 2YNCC 1RO5A 5EC4A 4CYPA 5KTCA 4UFWA 3GYAA 5C88A 4XPDC 1S3ZA 1S7NA 2NMTA 1Z4RA 3D8PA 4NF1A 2B4DB 3EC4A 2B5GA 3FNCA 2FIAA 2B58A 2FCKA 5IX3A 2FT0A 4CGPA 2YGWA 1PUAA 4E0AA 3RYOA 2PC1A 2Z3NA 1YREA 3T90A 5G22A 1P0HA 4F0YA 3F8KA 2FS5A 2BL1A 4NXYA 4XPDB 2ZW6A 3S6HA 2F5IA 4KVOE 4QC6A 1YVOA 3IWEA 4CS0B 2R8VA 2HV2A 4HNXB 4KOVA 2D4OA 5DWMA 4KOSA 1R57A 4UA3A 4C2ZA 3R9FA 3W6SA 1IYLA 4HKFA 2P6FA 4II9A 2ZPAA 2AE6A 4JXQA 4J3GA 4BMHA 3I3GA 1GHEA 1RXTA 2JLMA 2ATRA 1YLEA 4L89A 4B13A 4A30A 4Q36A 1ON0A 2KCWA 4KOUA 1J4JA 1L0CA 2JDCA 5AG4A 5G20A 2RC4A 4I49A 2ARHA 5E96A 1I1DA 1IIDA 3WR7A 2IL4A 2YNCA 3EY5A 1IYKA 3F0AA 4PSWA 2REFA 2J8NA 3R1KA 4H6UA 4ONUA 5F46A 4UWIA 3A9LA 4R87A 1M4GA 2J8RA 4XPLA 2J8MA 3JTKA 1QSRA 4KS9A 3BJ8A 4PK3A 2FIWA 4PSXA 2O28A 3FRMA 4KOYA 3DR6A 3NE7A 4XNHC 4HNYB 1Y9KA 4MY0A 3DNSA 3VWEA 4CYOA 1YR0A 4YFJA 1M44A 1UFHA 4KUAA 1BOBA 4K30A 3S6GA 1IB1E 4QB9A 5KTDA 2ZXVA 1XIXA 2OZHA 2OZGA 3BLNA 1S7FA 2D4PA 1M4DA 3EO4A 4R3LA 4UFVA 5F49A 4UCMA 2PRBA 5EBVA 1MJAA 3D2MA 3DDDA 1WWZA 1S5KA 4AB7A 2X7BA 2G0BA 2YNDA 2B3UA 3G8WA 4CYNA 4JJXA 4C2XA 1I21A 4KSAA 4AVAA 5AG5A 2Q04A 4KORA 4KVXA 4R57A 4UBRA 4H6ZA 3CXSA 4MBUA 3T9YA 2QIRA 2GE3A 3IU1A 4B10A 1KUVA 2VQYA 1S7LA 3FIXA 2VI7A 3GKRA 4KLVA 2C27A 5JPHA 2Z10A 1N71A 5BWAB 2EUIA 4GS4A 1Y9WA 4U9YA 4KVME 4AVCA 4E2AA 5HH1A 4E8OA 3F5BA 2DPTA 4KLWA 1YX0A 3JUWA 2Q7BA 2A4NA 4MHDA 3R95A 5F48A 3S6KA 4MY3A 4Y49C 4M85A 2VZZA 2Q44A 4CAWA 1Z4EA 2Q0YA 4MFZA 2Z3MA 4EVYA 3H5ZA 1XEBA 2GIVA 3LD2A 4UFXA 1S60A 4KOTA 5J8FA 4JXRA 4JWPA 1VHSA 3TCVA 4RS2A 1K4JA 4ZGYB 3PP9A 1XMTA 1Q2DA 2Z3KA 2VBQA 2FL4A 2ZW4A 4M3SA 3C26A 3VWDA 4B12A 5IB0A 1S7KA 3V8IA 3QAHA 1QSTA 2CXAA 3D3SA 4AVBA 4JD6A 2ZW7A 3ZJ0A 2FSRA 1QSOA 2QMLA 4CGOA 5J8CA 1KZFA 4CGMA 4A31A 2CY2A 3CXPA 3EXNA 3TT2A 1Y7RA 4R3KA 1VKCA 4QVTA 1KUXA 1NE9A 5IV0A 2OB0A 3DSBA 3TE4A 4PV6A 1Q2CA 4AG7A 4KSFA 5DWNA 3KKWA 2FE7A 2AJ6A 1V0CA 3TOBA 1TIQA 4CAVA 1NSLA 2Q4VA 2OH1A 3TO7A 2JDDA 2PR8A 2I79A 1PU9A 2Y0MA 1KUYA 2Z11A 4KUBA 3S6FA 3H4QA 4FD7A 2R98A 3IGRA 2B4DA 3SXOA 4CGLA 2GANA 2PR1A 3CXQA 2VZYA 1IICA 2H5MA 5FVJA 4CYQA 3BJ7A 3TO6A 4B5OA 4FD4A 5AGEA 3W6XA 1MJBA 4MFKA 4C68A 1M4IA 1YGHA 1QSMA 3K9UA 2PDOA 4H89A 4C7HA 2R1IA 2YNEA 4LUAA 2DPSA 4LX9A 4MJ8A 1Z9UA 2WPWA 3FYNA 1MK4A 3FXTA 5CNPA 5H86A 5C82A 4JLYA 3MGDA 2B5GB 5A28A 4Q38A 2I00A 4AG9A 3TOAA 3SXNA 2B3VA 4R9MA 4U9ZA 4HNWB 4FD5A 4B11A 5ISVA 2CNTA 2K5TA 2Q4YA 4KOWA 3IWGA 2DXQA 2Z3OA 3N7ZA 2Z0ZA 4BBHA 4C7IA 4NEXA 3FB3A 2CNSA 3G3SA 4CAXA 2R7HA 2G3AA 2B4BA 5A27A 3SHPA 4A95A 1YK3A 1U6MA 4KOXA 4FD6A 3P2HA 2PQ8A 3PZJA 1YVKA 1Q2YA 4A2ZA 3PGPA 2BUEA 4DNCA 1M1DA 5HMNA 4ORFA 1ZO0A 5I0CA 3W91A 2P6GA 1CJWA 3UY5A 5G1ZA 3OWCA 3DR8A 3IU2A 4B14A 4UCNA 2CNMA 4B5PA 3FBUA 3TFYA 4A32A 3TTHA 5AG6A 1MJ9A 1SQHA 4XNHB 2JEVA 1OZPA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4YRH A;  2BSW A;  1QSN A;  2PSW A;  1FY7 A;  4L8A A;  2G3T A;  1LRZ A;  3R9E A;  2P6E A;  4Y49 B;  3B8G A;  4QBJ A;  4YGO A;  4ZBG A;  4XPK A;  5H84 A;  4OAD A;  1NMT A;  1P4N A;  2WPX A;  5GCN A;  4UWJ A;  4F6A A;  4NSQ A;  2HQY A;  4B5P B;  2P0W A;  2BEI A;  1BO4 A;  4IUS A;  4MI4 A;  4QUS A;  4CRZ B;  2OZU A;  4OAE A;  1XE4 A;  4RI1 A;  3ZZI A;  3EFA A;  3LOD A;  4IF5 A;  3P2F A;  2VEZ A;  2EVN A;  3TO9 A;  2REE A;  2VXK A;  3E0K A;  1XF8 A;  3JVN A;  3R9G A;  5F47 A;  4OLL A;  3D2P A;  2HUZ A;  2QEC A;  3QB8 A;  3GY9 A;  3R96 A;  1I12 A;  5JQ4 A;  1B87 A;  4NCZ A;  1WK4 A;  3I9S A;  5KTA A;  1CM0 A;  1B6B A;  4KZT A;  4PK2 A;  2FXF A;  4U5Y A;  2OU2 A;  2ZW5 A;  4X5K A;  4CRY B;  1RO5 A;  5EC4 A;  5KTC A;  3GYA A;  5C88 A;  4XPD C;  1S3Z A;  1S7N A;  2NMT A;  1Z4R A;  3D8P A;  4NF1 A;  2B4D B;  3EC4 A;  2B5G A;  3FNC A;  2FIA A;  2B58 A;  2FCK A;  5IX3 A;  2FT0 A;  4E0A A;  1PUA A;  3RYO A;  2PC1 A;  1YRE A;  3T90 A;  1P0H A;  4F0Y A;  3F8K A;  2FS5 A;  2BL1 A;  4NXY A;  4XPD B;  2ZW6 A;  3S6H A;  2F5I A;  4KVO E;  4QC6 A;  1YVO A;  4CS0 B;  2R8V A;  2HV2 A;  4HNX B;  4KOV A;  2D4O A;  5DWM A;  4KOS A;  1R57 A;  4UA3 A;  3R9F A;  3W6S A;  1IYL A;  4HKF A;  2P6F A;  4II9 A;  2ZPA A;  2AE6 A;  4JXQ A;  4J3G A;  4BMH A;  3I3G A;  1GHE A;  1RXT A;  2JLM A;  2ATR A;  1YLE A;  4L89 A;  1ON0 A;  2KCW A;  4KOU A;  1J4J A;  1L0C A;  2JDC A;  2RC4 A;  4I49 A;  2ARH A;  5E96 A;  1I1D A;  1IID A;  3WR7 A;  2IL4 A;  3EY5 A;  1IYK A;  3F0A A;  4PSW A;  2REF A;  2J8N A;  3R1K A;  4H6U A;  4ONU A;  5F46 A;  4UWI A;  4R87 A;  1M4G A;  2J8R A;  4XPL A;  2J8M A;  1QSR A;  3BJ8 A;  4PK3 A;  2FIW A;  4PSX A;  2O28 A;  3FRM A;  4KOY A;  3DR6 A;  3NE7 A;  4XNH C;  4HNY B;  1Y9K A;  4MY0 A;  3DNS A;  3VWE A;  1YR0 A;  4YFJ A;  1M44 A;  1UFH A;  4KUA A;  1BOB A;  4K30 A;  3S6G A;  1IB1 E;  4QB9 A;  5KTD A;  2ZXV A;  1XIX A;  2OZH A;  2OZG A;  3BLN A;  1S7F A;  2D4P A;  1M4D A;  3EO4 A;  4R3L A;  5F49 A;  2PRB A;  5EBV A;  1MJA A;  3D2M A;  3DDD A;  1WWZ A;  1S5K A;  4AB7 A;  2X7B A;  2G0B A;  2B3U A;  3G8W A;  4JJX A;  1I21 A;  4AVA A;  2Q04 A;  4KOR A;  4KVX A;  4R57 A;  4UBR A;  4H6Z A;  3CXS A;  4MBU A;  3T9Y A;  2QIR A;  2GE3 A;  1KUV A;  2VQY A;  1S7L A;  3FIX A;  2VI7 A;  3GKR A;  4KLV A;  2C27 A;  5JPH A;  2Z10 A;  1N71 A;  2EUI A;  4GS4 A;  1Y9W A;  4U9Y A;  4KVM E;  4AVC A;  4E2A A;  5HH1 A;  4E8O A;  3F5B A;  4KLW A;  1YX0 A;  3JUW A;  2Q7B A;  2A4N A;  4MHD A;  3R95 A;  5F48 A;  3S6K A;  4MY3 A;  4Y49 C;  4M85 A;  2VZZ A;  2Q44 A;  4CAW A;  1Z4E A;  2Q0Y A;  4EVY A;  1XEB A;  2GIV A;  3LD2 A;  1S60 A;  4KOT A;  5J8F A;  4JXR A;  4JWP A;  1VHS A;  3TCV A;  4RS2 A;  1K4J A;  3PP9 A;  1XMT A;  1Q2D A;  2VBQ A;  2FL4 A;  2ZW4 A;  4M3S A;  3C26 A;  3VWD A;  5IB0 A;  1S7K A;  3V8I A;  3QAH A;  1QST A;  3D3S A;  4AVB A;  4JD6 A;  2ZW7 A;  3ZJ0 A;  2FSR A;  1QSO A;  2QML A;  5J8C A;  1KZF A;  2CY2 A;  3CXP A;  3EXN A;  3TT2 A;  1Y7R A;  4R3K A;  1VKC A;  4QVT A;  1KUX A;  1NE9 A;  5IV0 A;  2OB0 A;  3DSB A;  3TE4 A;  4PV6 A;  1Q2C A;  4AG7 A;  5DWN A;  3KKW A;  2FE7 A;  2AJ6 A;  1V0C A;  3TOB A;  1TIQ A;  4CAV A;  1NSL A;  2Q4V A;  2OH1 A;  3TO7 A;  2JDD A;  2PR8 A;  2I79 A;  1PU9 A;  2Y0M A;  1KUY A;  2Z11 A;  4KUB A;  3S6F A;  3H4Q A;  4FD7 A;  2R98 A;  3IGR A;  2B4D A;  3SXO A;  2GAN A;  2PR1 A;  3CXQ A;  2VZY A;  1IIC A;  2H5M A;  5FVJ A;  3BJ7 A;  3TO6 A;  4B5O A;  4FD4 A;  3W6X A;  1MJB A;  1M4I A;  1YGH A;  1QSM A;  3K9U A;  2PDO A;  4H89 A;  2R1I A;  4LUA A;  4MJ8 A;  4LX9 A;  1Z9U A;  2WPW A;  3FYN A;  1MK4 A;  3FXT A;  5CNP A;  5H86 A;  5C82 A;  4JLY A;  3MGD A;  2B5G B;  2I00 A;  4AG9 A;  3TOA A;  3SXN A;  2B3V A;  4R9M A;  4U9Z A;  4HNW B;  4FD5 A;  5ISV A;  2CNT A;  2K5T A;  2Q4Y A;  4KOW A;  3IWG A;  2DXQ A;  3N7Z A;  2Z0Z A;  4NEX A;  3FB3 A;  2CNS A;  3G3S A;  4CAX A;  2R7H A;  2G3A A;  2B4B A;  3SHP A;  1YK3 A;  1U6M A;  4KOX A;  4FD6 A;  3P2H A;  2PQ8 A;  3PZJ A;  1YVK A;  1Q2Y A;  3PGP A;  2BUE A;  4DNC A;  1M1D A;  5HMN A;  4ORF A;  5I0C A;  3W91 A;  2P6G A;  1CJW A;  3UY5 A;  3OWC A;  3DR8 A;  2CNM A;  4B5P A;  3FBU A;  3TFY A;  3TTH A;  1MJ9 A;  1SQH A;  4XNH B;  2JEV A;  1OZP A; 
#chains in the Genus database with same CATH topology
 4CAE A;  4YRH A;  4IHM A;  4O23 A;  4CAF A;  3D7G A;  2BSW A;  2Z3P A;  4UF4 A;  1QSN A;  2PSW A;  4MFJ A;  1FY7 A;  4MHN A;  4L8A A;  4UCP A;  2G3T A;  1LRZ A;  3H8G A;  3JRU A;  5EMI A;  3R9E A;  2P6E A;  3RZA A;  1QMU A;  4Y49 B;  1HDQ A;  3B8G A;  4NJR A;  4QBJ A;  4YGO A;  4ZBG A;  4XPK A;  3D66 A;  3KR4 A;  2CIJ A;  2JBJ A;  4NGP A;  2RFH A;  3GB0 A;  1IU8 A;  5H84 A;  4OAD A;  1F2O A;  1NMT A;  1P4N A;  1Z8T A;  4MCR A;  2WPX A;  5GCN A;  2BO9 A;  1CPX A;  3H8E A;  4UWJ A;  4LQG A;  2C1C A;  4F6A A;  4NSQ A;  1VIX A;  2JBK A;  2HQY A;  3ISX A;  2NSM A;  3RNZ A;  4B5P B;  1DE4 C;  2P0W A;  2BEI A;  1BO4 A;  3FEC A;  3D7D A;  4IUS A;  3H8F A;  4MI4 A;  5G21 A;  4QUS A;  4CRZ B;  5JGF A;  4NGT A;  1CG2 A;  2OZU A;  4OAE A;  4PXE A;  1LAP A;  2PIY A;  2RB7 A;  1XE4 A;  4RI1 A;  4CGN A;  3SI1 A;  3ZZI A;  3SI0 A;  4FWU A;  1GYT A;  2ZEP A;  3PB9 X;  3EFA A;  2PVW A;  2WUU A;  3LOD A;  4BD9 A;  4TWE A;  4IF5 A;  4JYW A;  4LQ6 A;  4WJB A;  3P2F A;  2VEZ A;  4WWV A;  3LMS A;  2EVN A;  4P6Y A;  1CX8 A;  5LYF A;  1R3N A;  4MFQ A;  2REE A;  3TO9 A;  4NJQ A;  4MFP A;  2VXK A;  2WSA A;  2Z3L A;  2ZEE A;  5LRG A;  5JH9 A;  1A2Z A;  4A33 A;  2GFQ A;  2OOT A;  3E0K A;  1XF8 A;  4MFL A;  4A39 A;  5IB9 A;  7CPA A;  3JVN A;  1XMB A;  3R9G A;  2POK A;  5F47 A;  1BLL E;  4OLL A;  2AFX A;  3FMC A;  4OC3 A;  3SI2 A;  3D2P A;  2HUZ A;  2QEC A;  3QB8 A;  1YSJ A;  1CBX A;  4F9U A;  3GY9 A;  3PFE A;  3NH4 A;  3R96 A;  2PJC A;  4C2Y A;  1I12 A;  3LAC A;  4F0X A;  5JQ4 A;  5LRK A;  1B87 A;  4NCZ A;  1WK4 A;  3I9S A;  5KTA A;  1CM0 A;  2ZEH A;  1B6B A;  4OC1 A;  4KZT A;  2G9D A;  3PBE A;  3B3S A;  2FXF A;  4PK2 A;  1XFO A;  4F8Z A;  2PVV A;  4U5Y A;  2OU2 A;  2ZW5 A;  5AG7 A;  4X5K A;  2C6C A;  4Q7A A;  4CRY B;  2YNC C;  1RO5 A;  4B6Z A;  5EC4 A;  4CYP A;  5KTC A;  4UFW A;  3GYA A;  1Z8X A;  1LAN A;  5C88 A;  1R43 A;  4XPD C;  1S3Z A;  8CPA A;  1S7N A;  2NMT A;  3FVL A;  1FNO A;  1Z4R A;  3D8P A;  3CPX A;  3D7F A;  1Z2L A;  2GLJ A;  4A38 A;  4A94 A;  2V8G A;  1ARM A;  1FT7 A;  3KR5 A;  1PCA A;  2B4D B;  2B5G A;  3EC4 A;  3FNC A;  4NF1 A;  2FIA A;  2B58 A;  2FCK A;  5IX3 A;  2FT0 A;  4CGP A;  2YGW A;  1PUA A;  4E0A A;  5LYI A;  3RYO A;  2PC1 A;  3TX8 A;  2PJ0 A;  2Z3N A;  2V8H A;  4YU9 A;  1YRE A;  3T90 A;  2CTC A;  4EFD A;  3MRU A;  3QAY A;  4NGM A;  5G22 A;  4FAI A;  1P0H A;  4F0Y A;  4FBE A;  3F8K A;  2FS5 A;  3WT4 A;  2BL1 A;  3DGV A;  4NXY A;  4UEE A;  4XPD B;  1IOF A;  1TKF A;  2ZW6 A;  4ZX8 A;  2F5I A;  3S6H A;  4KVO E;  4RUH A;  3PEI A;  3B7I A;  4QC6 A;  1YVO A;  2XEF A;  3IWE A;  4CS0 B;  2R8V A;  2HV2 A;  4HNX B;  4KOV A;  3PB4 X;  4R6T A;  3FEE A;  4X3R A;  2D4O A;  5DWM A;  4KOS A;  1R57 A;  4MHP A;  4OP4 A;  2QYV A;  4UA3 A;  3R9F A;  3W6S A;  1LOK A;  4C2Z A;  1IYL A;  4HKF A;  2P6F A;  3KGQ A;  4II9 A;  5K8O A;  4P4F A;  2ZPA A;  4P4B A;  3VH9 A;  3KHX A;  3B35 A;  4KSI A;  2AE6 A;  2PE3 A;  4J3G A;  4JXQ A;  3B3V A;  4R8F A;  4BMH A;  3I3G A;  1GHE A;  3RBU A;  1YQE A;  1XRY A;  1RXT A;  2WYR A;  1X12 A;  2JLM A;  2ATR A;  1YLE A;  4X8I A;  4L89 A;  4B13 A;  4NGQ A;  4TNU A;  4A30 A;  4Q36 A;  1ON0 A;  4P4J A;  1XOV A;  2KCW A;  4KOU A;  1J4J A;  1XJO A;  1L0C A;  1ZLH A;  2JDC A;  4OME A;  4P4I A;  5AG4 A;  1ZG7 A;  3KAS A;  5G20 A;  2RC4 A;  2WZN A;  4I49 A;  2ARH A;  5E96 A;  1BAV A;  1LCP A;  4OC2 A;  1I1D A;  3VAT A;  3PBB A;  2ZEG A;  4PXC A;  1BPN A;  3HLP A;  4OC0 A;  1IID A;  3WR7 A;  2IL4 A;  3BHX A;  2YNC A;  3EY5 A;  1IYK A;  3F0A A;  4PSW A;  4A37 A;  2REF A;  4IAV A;  2J8N A;  3R1K A;  4H6U A;  4ONU A;  5F46 A;  1HEE A;  4UWI A;  3A9L A;  2IQ6 A;  1M4G A;  4R87 A;  2BOA A;  2J8R A;  4FUU A;  2J8M A;  3K2K A;  4XPL A;  3JTK A;  1QSR A;  2PJ4 A;  3BJ8 A;  4KS9 A;  4PK3 A;  4NFR A;  2FIW A;  3FX6 A;  4PSX A;  3D68 A;  5HXD A;  2O28 A;  3FRM A;  4KOY A;  5J1Q A;  4R76 A;  3DR6 A;  3NE7 A;  4XNH C;  4HNY B;  1Y9K A;  4MY0 A;  5LRJ A;  3SJE A;  4OC4 A;  3DNS A;  3VWE A;  4CYO A;  1YR0 A;  4YFJ A;  2NYQ A;  1M44 A;  3GIU A;  3IIB A;  1UFH A;  2HC9 A;  4KUA A;  1BOB A;  3K9T A;  4GXH A;  2ANP A;  2J9A A;  2PJA A;  4K30 A;  3S6G A;  1ARL A;  4P4D A;  1IY7 A;  1IB1 E;  4QB9 A;  5KTD A;  2ZXV A;  1XIX A;  2QJ8 A;  2OZH A;  2PJ2 A;  2OZG A;  3IJ3 A;  4ONW A;  2ZEN A;  3BLN A;  2PIZ A;  1S7F A;  2F7V A;  2D4P A;  1M4D A;  2BCO A;  3EO4 A;  2O53 A;  2PCU A;  3B3W A;  4MXU A;  2V77 A;  4R3L A;  4UFV A;  5F49 A;  4UCM A;  2PJ8 A;  2ZEL A;  2PRB A;  3IFE A;  4ZY0 A;  5EBV A;  1MJA A;  3CT9 A;  3PB6 X;  2PJB A;  3D2M A;  4OIW A;  5D29 A;  3DDD A;  1WWZ A;  2V8V A;  3CDX A;  1S5K A;  5CBM A;  4AB7 A;  2X7B A;  2G0B A;  3RAM A;  2YND A;  4M6I A;  5F09 A;  5LYD A;  5HVH A;  2B3U A;  1TXR A;  3G8W A;  4CYN A;  4JJX A;  3MN8 A;  4CPA A;  4C2X A;  1I21 A;  3GLJ A;  4KSA A;  4AVA A;  2ZEF A;  5AG5 A;  2Q04 A;  4KOR A;  4KVX A;  4R57 A;  4UBR A;  3FJU A;  4H6Z A;  1VHO A;  1ELM P;  3CXS A;  3KL9 A;  4MBU A;  2QIR A;  3T9Y A;  2GE3 A;  4P4E A;  3S9L A;  3CPA A;  1RTQ A;  3IU1 A;  4OID A;  1JWQ A;  4B10 A;  1KUV A;  3DLJ A;  4IK2 A;  1XBU A;  2VQY A;  1S7L A;  3FIX A;  2VI7 A;  3GKR A;  4KLV A;  2C27 A;  5JPH A;  2Z10 A;  1VHE A;  1N71 A;  2Q51 A;  4ZX9 A;  2EUI A;  4GS4 A;  5BWA B;  1Y9W A;  3PB8 X;  3TC8 A;  2AFW A;  3I1U A;  4U9Y A;  1Z5R A;  1LAM A;  2OR4 A;  4KVM E;  4AVC A;  3KI9 A;  4E2A A;  1Q7L A;  1QQ9 A;  4MMO A;  1Y0R A;  5HH1 A;  5CPA A;  4E8O A;  1Y0Y A;  2DPT A;  3F5B A;  5DS0 A;  4KLW A;  5HVF A;  3FH4 A;  3S9N A;  1YX0 A;  3JUW A;  2Q7B A;  2A4N A;  4MHD A;  4DJL A;  3R95 A;  5F48 A;  3S6K A;  4MY3 A;  4Y49 C;  3B2Y A;  2VZZ A;  4M85 A;  2Q44 A;  4CAW A;  4OC5 A;  5LYL A;  1Z4E A;  2Q0Y A;  3KQX A;  1Z8W A;  2ZOF A;  4MFZ A;  3FF3 A;  2Z3M A;  3IEH A;  4PXD A;  4EVY A;  3H5Z A;  4BIN A;  1XEB A;  2GIV A;  2IMO A;  1CP6 A;  3HUV A;  3LD2 A;  1S60 A;  4KOT A;  4UFX A;  5K8N A;  3SJG A;  4M6H A;  5J8F A;  2EBJ A;  4JXR A;  1NSA A;  4JWP A;  1VHS A;  4OKO A;  3TCV A;  2PJ7 A;  4RS2 A;  3V7Z A;  1K4J A;  1PYT B;  4ZGY B;  3PP9 A;  2F8H A;  1XMT A;  1Q2D A;  5I4M A;  2EK8 A;  4UEF A;  2Z3K A;  1F2P A;  3NH8 A;  2VBQ A;  2FL4 A;  2ZW4 A;  2PJ9 A;  2V8D A;  2EWB A;  4M3S A;  2O4H A;  4PQA A;  2PJ1 A;  3C26 A;  3VWD A;  4P10 A;  4B12 A;  5IB0 A;  1S7K A;  3V8I A;  3QAH A;  4F9V A;  1QST A;  1VGY A;  2CXA A;  1YW4 A;  3D3S A;  4AVB A;  4JD6 A;  2VL1 A;  1F57 A;  2ZW7 A;  3ZJ0 A;  2FSR A;  1QSO A;  2QML A;  4CGO A;  5J8C A;  1KZF A;  3WC6 A;  4CGM A;  4A31 A;  4ZY1 A;  3N5F A;  2CY2 A;  1EE3 P;  4EME A;  3CXP A;  3EXN A;  3TT2 A;  1Y7R A;  3V38 A;  4R3K A;  1VKC A;  3D4U A;  4MHZ A;  4QVT A;  1KUX A;  4UEZ A;  4X2T A;  2EK9 A;  3KQZ A;  1NE9 A;  4MRI A;  5IV0 A;  2OB0 A;  3DSB A;  3LWU A;  3TE4 A;  3KHZ A;  4PV6 A;  1Q2C A;  4AG7 A;  4KSF A;  5DWN A;  3KKW A;  2FE7 A;  4MCQ A;  3SJF A;  1YW6 A;  2AJ6 A;  2PJ5 A;  1V0C A;  1CP7 A;  3PRT A;  3WC7 A;  3TOB A;  1TIQ A;  1UWY A;  3BXM A;  4CAV A;  3IC1 A;  1NSL A;  2Q4V A;  1IGB A;  2OH1 A;  3D7H A;  2JDD A;  3TO7 A;  2AFO A;  2PR8 A;  2I79 A;  1KWM A;  1PU9 A;  4H2K A;  2Y0M A;  1KUY A;  2Z11 A;  4KUB A;  3S6F A;  4MCP A;  4PXB A;  4UIB A;  3QNV A;  3SJX A;  3H4Q A;  4FD7 A;  2R98 A;  4PPZ A;  3IGR A;  3NE8 A;  4YWY A;  2HB6 A;  2B4D A;  3SXO A;  4CGL A;  2GAN A;  2PR1 A;  3CXQ A;  2VZY A;  1IIC A;  2AFS A;  2H5M A;  2ABZ A;  5FVJ A;  3B3T A;  2GLF A;  4CYQ A;  3BJ7 A;  3FED A;  2C6P A;  1TKH A;  3TO6 A;  4B5O A;  4FD4 A;  5AGE A;  3W6X A;  1MJB A;  3WC5 A;  5K8M A;  4MFK A;  1ZLI A;  4C68 A;  1Z8L A;  4Z65 A;  1M4I A;  4R7M A;  1YGH A;  3BI0 A;  1QSM A;  1ELL P;  1ZG8 A;  2ODF A;  3K9U A;  4G1P A;  2PDO A;  3PB7 X;  4H89 A;  4ZYQ A;  4C7H A;  4P44 A;  2R1I A;  2YNE A;  3CZX A;  3NFZ A;  3KZW A;  4HPS A;  1AYE A;  3ISZ A;  2DEA A;  3IWW A;  4LUA A;  1IOI A;  1Y7E A;  2DPS A;  4LX9 A;  4MJ8 A;  1Z9U A;  2WPW A;  3FYN A;  1MK4 A;  3FXT A;  5JM6 A;  2XEI A;  5CNP A;  5H86 A;  4UIA A;  5C82 A;  2AFU A;  4JLY A;  3MGD A;  2B5G B;  5A28 A;  2AFZ A;  1TKJ A;  4MHY A;  4ZY2 A;  2Q7S A;  2QVP A;  4JZ0 A;  5D8N A;  2ZOG A;  1TF9 A;  3S9M A;  3PFO A;  5ELY A;  4Q38 A;  2I00 A;  4P45 A;  1M4L A;  1LFW A;  2ZEO A;  4AG9 A;  1HDU A;  5THW A;  1OBR A;  3TOA A;  3SXN A;  2B3V A;  3T8W A;  4NGR A;  4R9M A;  4U9Z A;  1BPM A;  4HNW B;  1ZG9 A;  2PJ3 A;  4FD5 A;  4B11 A;  5ISV A;  2CNT A;  2GU2 A;  1CPS A;  1YME A;  2K5T A;  2CF4 A;  2Q4Y A;  3NA6 A;  4KOW A;  3IWG A;  2DXQ A;  4K3N A;  2JEW A;  6CPA A;  2Z3O A;  3N7Z A;  1X10 A;  2Z0Z A;  4BBH A;  4C7I A;  1H8L A;  4NGN A;  4NEX A;  3FB3 A;  3VAR A;  2CNS A;  4DYO A;  2AFM A;  3RO0 A;  1AMP A;  4AXV A;  3GUX A;  3G3S A;  4CAX A;  5HVG A;  2XEG A;  2R7H A;  5K8P A;  2G3A A;  3L2N A;  2B4B A;  5A27 A;  2ZEM A;  3SHP A;  4A95 A;  1YK3 A;  1U6M A;  2PJ6 A;  4KOX A;  3IO1 A;  4FD6 A;  3P2H A;  2PQ8 A;  3PZJ A;  1YVK A;  1DTD A;  1Q2Y A;  4A2Z A;  3PGP A;  1AUG A;  2BUE A;  4DNC A;  1M1D A;  2XEJ A;  5HMN A;  2GRE A;  2I3C A;  3WAB A;  4ORF A;  2Q4Z A;  1ZO0 A;  2Q43 A;  5I0C A;  3W91 A;  2P6G A;  1CJW A;  1TF8 A;  2EO8 A;  4GM5 A;  3UY5 A;  5G1Z A;  3D67 A;  4EWT A;  2C6G A;  2DF5 A;  4MCS A;  2ZED A;  3OWC A;  3DR8 A;  2IJZ A;  3IU2 A;  4ZI6 A;  4B14 A;  4UCN A;  2CNM A;  4DUK A;  4M6G A;  4W9Y A;  1YLO A;  2FVG A;  4B5P A;  3FBU A;  3TFY A;  4A32 A;  3NH5 A;  3B3C A;  2PRQ A;  3TTH A;  5AG6 A;  1JQG A;  1MJ9 A;  3BI1 A;  4RN7 A;  1SQH A;  4NGS A;  4XNH B;  2CTB A;  2JEV A;  1OZP A; 
#chains in the Genus database with same CATH homology
 4CAE A;  4YRH A;  4CAF A;  2BSW A;  2Z3P A;  1QSN A;  2PSW A;  4MFJ A;  1FY7 A;  4L8A A;  4UCP A;  2G3T A;  1LRZ A;  3R9E A;  2P6E A;  4Y49 B;  3B8G A;  4QBJ A;  4YGO A;  4ZBG A;  4XPK A;  5H84 A;  4OAD A;  1NMT A;  1P4N A;  2WPX A;  5GCN A;  4UWJ A;  4F6A A;  4NSQ A;  2HQY A;  4B5P B;  2P0W A;  2BEI A;  1BO4 A;  4IUS A;  4MI4 A;  5G21 A;  4QUS A;  4CRZ B;  2OZU A;  4OAE A;  1XE4 A;  4RI1 A;  4CGN A;  3ZZI A;  3EFA A;  2WUU A;  3LOD A;  4IF5 A;  3P2F A;  2VEZ A;  2EVN A;  3TO9 A;  4MFQ A;  2REE A;  4MFP A;  2VXK A;  2WSA A;  2Z3L A;  4A33 A;  3E0K A;  1XF8 A;  4MFL A;  3JVN A;  3R9G A;  5F47 A;  4OLL A;  3D2P A;  2HUZ A;  2QEC A;  3QB8 A;  3GY9 A;  3R96 A;  4C2Y A;  1I12 A;  4F0X A;  5JQ4 A;  1B87 A;  4NCZ A;  1WK4 A;  3I9S A;  5KTA A;  1CM0 A;  1B6B A;  4KZT A;  4PK2 A;  2FXF A;  4U5Y A;  2OU2 A;  2ZW5 A;  5AG7 A;  4X5K A;  4CRY B;  2YNC C;  1RO5 A;  5EC4 A;  4CYP A;  5KTC A;  4UFW A;  3GYA A;  5C88 A;  4XPD C;  1S3Z A;  1S7N A;  2NMT A;  1Z4R A;  3D8P A;  4NF1 A;  2B4D B;  3EC4 A;  2B5G A;  3FNC A;  2FIA A;  2B58 A;  2FCK A;  5IX3 A;  2FT0 A;  4CGP A;  2YGW A;  1PUA A;  4E0A A;  3RYO A;  2PC1 A;  2Z3N A;  1YRE A;  3T90 A;  5G22 A;  1P0H A;  4F0Y A;  3F8K A;  2FS5 A;  2BL1 A;  4NXY A;  4XPD B;  2ZW6 A;  3S6H A;  2F5I A;  4KVO E;  4QC6 A;  1YVO A;  3IWE A;  4CS0 B;  2R8V A;  2HV2 A;  4HNX B;  4KOV A;  2D4O A;  5DWM A;  4KOS A;  1R57 A;  4UA3 A;  4C2Z A;  3R9F A;  3W6S A;  1IYL A;  4HKF A;  2P6F A;  4II9 A;  2ZPA A;  2AE6 A;  4JXQ A;  4J3G A;  4BMH A;  3I3G A;  1GHE A;  1RXT A;  2JLM A;  2ATR A;  1YLE A;  4L89 A;  4B13 A;  4A30 A;  4Q36 A;  1ON0 A;  2KCW A;  4KOU A;  1J4J A;  1L0C A;  2JDC A;  5AG4 A;  5G20 A;  2RC4 A;  4I49 A;  2ARH A;  5E96 A;  1I1D A;  1IID A;  3WR7 A;  2IL4 A;  2YNC A;  3EY5 A;  1IYK A;  3F0A A;  4PSW A;  2REF A;  2J8N A;  3R1K A;  4H6U A;  4ONU A;  5F46 A;  4UWI A;  3A9L A;  4R87 A;  1M4G A;  2J8R A;  4XPL A;  2J8M A;  3JTK A;  1QSR A;  4KS9 A;  3BJ8 A;  4PK3 A;  2FIW A;  4PSX A;  2O28 A;  3FRM A;  4KOY A;  3DR6 A;  3NE7 A;  4XNH C;  4HNY B;  1Y9K A;  4MY0 A;  3DNS A;  3VWE A;  4CYO A;  1YR0 A;  4YFJ A;  1M44 A;  1UFH A;  4KUA A;  1BOB A;  4K30 A;  3S6G A;  1IB1 E;  4QB9 A;  5KTD A;  2ZXV A;  1XIX A;  2OZH A;  2OZG A;  3BLN A;  1S7F A;  2D4P A;  1M4D A;  3EO4 A;  4R3L A;  4UFV A;  5F49 A;  4UCM A;  2PRB A;  5EBV A;  1MJA A;  3D2M A;  3DDD A;  1WWZ A;  1S5K A;  4AB7 A;  2X7B A;  2G0B A;  2YND A;  2B3U A;  3G8W A;  4CYN A;  4JJX A;  4C2X A;  1I21 A;  4KSA A;  4AVA A;  5AG5 A;  2Q04 A;  4KOR A;  4KVX A;  4R57 A;  4UBR A;  4H6Z A;  3CXS A;  4MBU A;  3T9Y A;  2QIR A;  2GE3 A;  3IU1 A;  4B10 A;  1KUV A;  2VQY A;  1S7L A;  3FIX A;  2VI7 A;  3GKR A;  4KLV A;  2C27 A;  5JPH A;  2Z10 A;  1N71 A;  5BWA B;  2EUI A;  4GS4 A;  1Y9W A;  4U9Y A;  4KVM E;  4AVC A;  4E2A A;  5HH1 A;  4E8O A;  3F5B A;  2DPT A;  4KLW A;  1YX0 A;  3JUW A;  2Q7B A;  2A4N A;  4MHD A;  3R95 A;  5F48 A;  3S6K A;  4MY3 A;  4Y49 C;  4M85 A;  2VZZ A;  2Q44 A;  4CAW A;  1Z4E A;  2Q0Y A;  4MFZ A;  2Z3M A;  4EVY A;  3H5Z A;  1XEB A;  2GIV A;  3LD2 A;  4UFX A;  1S60 A;  4KOT A;  5J8F A;  4JXR A;  4JWP A;  1VHS A;  3TCV A;  4RS2 A;  1K4J A;  4ZGY B;  3PP9 A;  1XMT A;  1Q2D A;  2Z3K A;  2VBQ A;  2FL4 A;  2ZW4 A;  4M3S A;  3C26 A;  3VWD A;  4B12 A;  5IB0 A;  1S7K A;  3V8I A;  3QAH A;  1QST A;  2CXA A;  3D3S A;  4AVB A;  4JD6 A;  2ZW7 A;  3ZJ0 A;  2FSR A;  1QSO A;  2QML A;  4CGO A;  5J8C A;  1KZF A;  4CGM A;  4A31 A;  2CY2 A;  3CXP A;  3EXN A;  3TT2 A;  1Y7R A;  4R3K A;  1VKC A;  4QVT A;  1KUX A;  1NE9 A;  5IV0 A;  2OB0 A;  3DSB A;  3TE4 A;  4PV6 A;  1Q2C A;  4AG7 A;  4KSF A;  5DWN A;  3KKW A;  2FE7 A;  2AJ6 A;  1V0C A;  3TOB A;  1TIQ A;  4CAV A;  1NSL A;  2Q4V A;  2OH1 A;  3TO7 A;  2JDD A;  2PR8 A;  2I79 A;  1PU9 A;  2Y0M A;  1KUY A;  2Z11 A;  4KUB A;  3S6F A;  3H4Q A;  4FD7 A;  2R98 A;  3IGR A;  2B4D A;  3SXO A;  4CGL A;  2GAN A;  2PR1 A;  3CXQ A;  2VZY A;  1IIC A;  2H5M A;  5FVJ A;  4CYQ A;  3BJ7 A;  3TO6 A;  4B5O A;  4FD4 A;  5AGE A;  3W6X A;  1MJB A;  4MFK A;  4C68 A;  1M4I A;  1YGH A;  1QSM A;  3K9U A;  2PDO A;  4H89 A;  4C7H A;  2R1I A;  2YNE A;  4LUA A;  2DPS A;  4LX9 A;  4MJ8 A;  1Z9U A;  2WPW A;  3FYN A;  1MK4 A;  3FXT A;  5CNP A;  5H86 A;  5C82 A;  4JLY A;  3MGD A;  2B5G B;  5A28 A;  4Q38 A;  2I00 A;  4AG9 A;  3TOA A;  3SXN A;  2B3V A;  4R9M A;  4U9Z A;  4HNW B;  4FD5 A;  4B11 A;  5ISV A;  2CNT A;  2K5T A;  2Q4Y A;  4KOW A;  3IWG A;  2DXQ A;  2Z3O A;  3N7Z A;  2Z0Z A;  4BBH A;  4C7I A;  4NEX A;  3FB3 A;  2CNS A;  3G3S A;  4CAX A;  2R7H A;  2G3A A;  2B4B A;  5A27 A;  3SHP A;  4A95 A;  1YK3 A;  1U6M A;  4KOX A;  4FD6 A;  3P2H A;  2PQ8 A;  3PZJ A;  1YVK A;  1Q2Y A;  4A2Z A;  3PGP A;  2BUE A;  4DNC A;  1M1D A;  5HMN A;  4ORF A;  1ZO0 A;  5I0C A;  3W91 A;  2P6G A;  1CJW A;  3UY5 A;  5G1Z A;  3OWC A;  3DR8 A;  3IU2 A;  4B14 A;  4UCN A;  2CNM A;  4B5P A;  3FBU A;  3TFY A;  4A32 A;  3TTH A;  5AG6 A;  1MJ9 A;  1SQH A;  4XNH B;  2JEV A;  1OZP A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...