5CNPA

X-ray crystal structure of spermidine n1-acetyltransferase from vibrio cholerae.
Total Genus 46
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
46
sequence length
174
structure length
170
Chain Sequence
AMNSQLTLRALERGDLRFIHNLNNMSYWFEEPYESFDELEELYNKHIHDNAERRFVVEDAQKNLIGLVELIEINYIHRSAEFQIIIAPEHQGKGFARTLINRALDYSFTILNLHKIYLHVAVENPKAVHLYEECGFVEEGHLVEEFFINGRYQDVKRMYILQSKYLNRSE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Substrate-Induced Allosteric Change in the Quaternary Structure of the Spermidine N-Acetyltransferase SpeG.
pubmed doi rcsb
source organism Vibrio cholerae serotype o1 (strain atcc 39315 / el tor inaba n16961)
molecule tags Transferase
molecule keywords Spermidine N(1)-acetyltransferase
total genus 46
structure length 170
sequence length 174
chains with identical sequence B, C, D, E, F
ec nomenclature ec 2.3.1.57: Diamine N-acetyltransferase.
pdb deposition date 2015-07-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13302 Acetyltransf_3 Acetyltransferase (GNAT) domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.630.30 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Aminopeptidase 5cnpA00
3FXTA 3S6KA 1Q2DA 4F6AA 2NMTA 4MBUA 2P6GA 1M44A 3BJ8A 4M3SA 2PSWA 1VKCA 2O28A 4L8AA 4UWJA 5C88A 1IIDA 3EXNA 2FIAA 3CXSA 2VQYA 2I79A 3TOBA 2D4PA 1IYKA 2A4NA 4JXQA 1MJAA 4QBJA 3FYNA 4B5PB 5IX3A 1L0CA 3R95A 1LRZA 3IWGA 2ZW6A 2G3AA 3FRMA 1QSRA 2FSRA 5I0CA 2Q4VA 1S7FA 2HUZA 4HNYB 4CAXA 5HH1A 4XNHC 2D4OA 4IF5A 2JEVA 2Q0YA 2QMLA 1FY7A 2R1IA 3EC4A 4LX9A 3T90A 3B8GA 4YFJA 5J8FA 4JWPA 2GE3A 4CAWA 2KCWA 2PQ8A 2Z10A 4YGOA 2CNMA 1M4DA 2JDDA 4K30A 2J8MA 4PSWA 1S7KA 1S7NA 4B5OA 3E0KA 3K9UA 1YVKA 1KUVA 3F8KA 4AG7A 3RYOA 1YLEA 3SXNA 1CM0A 4QVTA 4OADA 4HNWB 4KOTA 4DNCA 4KVXA 3GKRA 4JLYA 2ZPAA 1XE4A 1OZPA 5DWNA 1YVOA 4KVME 3V8IA 2B3UA 1Z9UA 4MI4A 4RI1A 2BEIA 1QSOA 3G8WA 2EUIA 5F46A 1J4JA 1NSLA 4PK2A 2REFA 4XPDB 5KTAA 1BOBA 2ZW7A 3TCVA 1S5KA 1YREA 2FE7A 3D2MA 2I00A 3WR7A 3QB8A 4AG9A 4R3KA 2FXFA 1KZFA 3C26A 4KOVA 1K4JA 4LUAA 1XEBA 2Z0ZA 3TO7A 2VZYA 1S60A 5GCNA 2WPWA 1Q2YA 4H6UA 1V0CA 4KLWA 4AVCA 5KTCA 3KKWA 3LD2A 1S3ZA 1P4NA 1R57A 1PUAA 2Q44A 1B87A 1VHSA 4U9YA 2P6FA 5C82A 4AVAA 1CJWA 4Y49B 4NSQA 2VI7A 4M85A 4XPLA 5HMNA 2EVNA 5EC4A 3P2FA 2B4DA 4CAVA 2CNTA 2GIVA 4ONUA 1Y9WA 5JQ4A 3F5BA 2B5GB 1YGHA 4NXYA 3S6HA 3D2PA 2B3VA 2IL4A 4UA3A 2OH1A 1KUYA 3FNCA 4RS2A 4FD5A 4ZBGA 3S6GA 2REEA 4JXRA 1Z4EA 3BLNA 2ZW4A 2OZUA 1Y9KA 2PR8A 4MJ8A 4MHDA 4JD6A 2PRBA 1MJ9A 1SQHA 4FD6A 4CRYB 1U6MA 2Q4YA 1M1DA 3S6FA 2HQYA 1KUXA 3FIXA 3QAHA 1XMTA 2X7BA 2B5GA 3EO4A 3R9EA 2PDOA 2DXQA 4AVBA 2BSWA 4B5PA 2PC1A 4II9A 1ON0A 1YK3A 2CY2A 4PK3A 5FVJA 3N7ZA 2J8NA 2ATRA 5H84A 4I49A 3DSBA 3PP9A 4R3LA 3TE4A 3D3SA 1MJBA 3JVNA 3T9YA 2GANA 4J3GA 1S7LA 4KOSA 2B58A 5H86A 3P2HA 5F47A 4E8OA 3TT2A 1IYLA 4KLVA 1BO4A 2VXKA 2B4DB 4KUAA 4KOXA 1NE9A 4L89A 2ARHA 2R8VA 3TO6A 5ISVA 3PGPA 3PZJA 3DNSA 2R7HA 1XF8A 4KOUA 4JJXA 1B6BA 1I1DA 3LODA 4MY3A 4H89A 3OWCA 1I12A 2QIRA 3BJ7A 2HV2A 2RC4A 2QECA 2Y0MA 3MGDA 3D8PA 3TO9A 4IUSA 4EVYA 4YRHA 4MY0A 1MK4A 2ZXVA 4Y49C 4ORFA 2AE6A 3IGRA 4R9MA 4HNXB 5CNPA 2VZZA 4FD4A 5J8CA 2FT0A 4U5YA 1IB1E 1GHEA 2BL1A 4NF1A 4KZTA 4E0AA 4AB7A 4CRZB 1Q2CA 4QB9A 4R87A 2FIWA 2G3TA 1M4GA 4UBRA 5IV0A 5E96A 2G0BA 4E2AA 3I3GA 1QSNA 3SHPA 4OLLA 3NE7A 2WPXA 3JUWA 4KVOE 5F48A 3G3SA 2AJ6A 5IB0A 1Y7RA 4KOYA 4XPKA 2OB0A 3CXPA 1NMTA 5F49A 4GS4A 3GYAA 3W91A 3UY5A 2P6EA 2C27A 1WWZA 4KUBA 4QC6A 1YX0A 4NCZA 4F0YA 2JDCA 2P0WA 3R9FA 3W6SA 4NEXA 3TFYA 5DWMA 3DR8A 2Z11A 4HKFA 3VWEA 4QUSA 1M4IA 2VEZA 3DDDA 2F5IA 4UWIA 4H6ZA 3VWDA 3R1KA 1YR0A 2FS5A 2CNSA 4PSXA 3ZJ0A 3FB3A 1N71A 3R96A 1Z4RA 2VBQA 1I21A 3CXQA 3W6XA 2H5MA 1IICA 1QSMA 2FL4A 4U9ZA 2K5TA 4R57A 1RXTA 4CS0B 2Q04A 4KOWA 4XNHB 3FBUA 3TOAA 3EFAA 3TTHA 2FCKA 5EBVA 4X5KA 2PR1A 3H4QA 2OU2A 3GY9A 3ZZIA 4XPDC 5KTDA 2J8RA 1PU9A 2JLMA 3I9SA 1RO5A 1TIQA 2OZHA 1QSTA 3SXOA 4BMHA 3F0AA 2ZW5A 2OZGA 4KORA 3DR6A 2R98A 2B4BA 1XIXA 4PV6A 4OAEA 2Q7BA 5JPHA 4FD7A 3EY5A 2BUEA 1UFHA 1WK4A 3R9GA 1P0HA
chains in the Genus database with same CATH superfamily
3FXTA 3S6KA 1Q2DA 2C6PA 3QAYA 1Q7LA 4CGOA 4ZY2A 3CDXA 4MFLA 4P4JA 5LRJA 2NMTA 3RBUA 4F6AA 5J1QA 4MBUA 4UFVA 2P6GA 1Y0YA 3KGQA 1M44A 3BJ8A 4WWVA 4M3SA 3KQXA 2PSWA 1VKCA 2O28A 4YU9A 4L8AA 1Z2LA 4FWUA 3D66A 3K9TA 4UWJA 5C88A 1IIDA 2YNDA 1IOFA 3EXNA 3IO1A 2FIAA 2I3CA 3CXSA 2VQYA 2I79A 5AGEA 3TOBA 1XOVA 2D4PA 1IYKA 2A4NA 2XEIA 1MJAA 2F8HA 3FYNA 4JXQA 3WT4A 4B5PB 4QBJA 3IC1A 5IX3A 4OC1A 3IU2A 3N5FA 1L0CA 3R95A 1LRZA 1HEEA 3FVLA 3IWGA 4YWYA 4P6YA 2ZW6A 2G3AA 3FRMA 1QSRA 2FSRA 2ZEMA 5I0CA 3B3SA 2Q4VA 1IOIA 1S7FA 3VH9A 3FJUA 3RNZA 2EBJA 2HUZA 4HNYB 2PJ9A 4BINA 4CAXA 4CGNA 5HH1A 4XNHC 3MN8A 3IFEA 1QQ9A 4F8ZA 4ONWA 2GFQA 2D4OA 1RTQA 2ZEOA 4NFRA 4IF5A 2JEVA 3VARA 4CAEA 1Z8WA 2Q0YA 3BI0A 3B2YA 2QMLA 1IY7A 1YW4A 1FY7A 4A37A 2R1IA 3EC4A 3LWUA 4OIDA 4F9VA 1CP6A 4LX9A 3T90A 3B8GA 3B35A 4YFJA 4JWPA 5J8FA 2GE3A 5G1ZA 4CAWA 2PJCA 2CTCA 2C1CA 2KCWA 2PQ8A 2Z10A 3BI1A 4NGMA 2Z3KA 4YGOA 1LAPA 2CNMA 4IHMA 1M4DA 1YSJA 2JDDA 4MMOA 4K30A 4BD9A 1IGBA 4ZX8A 3NH8A 2J8MA 2V8VA 1S7KA 1S7NA 4PSWA 4B5OA 3E0KA 3K9UA 4A38A 1ZG7A 3JRUA 1YVKA 4CYPA 1BLLE 1PCAA 4KSIA 1KUVA 2CF4A 4G1PA 3NH5A 3PRTA 4ZX9A 2ZEEA 3F8KA 4AG7A 3RYOA 4MHYA 4A31A 1H8LA 1YLEA 1AUGA 1PYTB 3SXNA 1JWQA 5A27A 1CM0A 1Y0RA 2JEWA 4QVTA 4OADA 4HNWB 4MHNA 4KOTA 4B12A 5LYDA 1A2ZA 3IJ3A 2QYVA 4UCPA 6CPAA 4DNCA 1LCPA 4TWEA 2IQ6A 5DS0A 4KVXA 3GKRA 4JLYA 4FAIA 2ZPAA 1XE4A 1OZPA 5ELYA 5DWNA 2G9DA 1CPXA 2YNEA 2OOTA 1VIXA 1YVOA 4KVME 8CPAA 2ZEFA 2ZEPA 3CPAA 3NE8A 2B3UA 4NGSA 3KL9A 3V8IA 4C68A 2XEJA 3H8EA 4C7IA 4UF4A 1Z9UA 4MI4A 2BEIA 4RI1A 4MHPA 1F2OA 3WC5A 1QSOA 1F57A 2AFUA 3G8WA 1TKFA 2EUIA 4P4FA 4EFDA 5F46A 1AYEA 2PJ7A 1J4JA 2QVPA 1NSLA 1FT7A 2ZOGA 4PK2A 4ZGYB 2REFA 1CPSA 3PB6X 2GLFA 4XPDB 3D7GA 2NYQA 5AG6A 5KTAA 3CZXA 1BOBA 2ZW7A 3TCVA 1S5KA 1YREA 2FE7A 2VL1A 2CIJA 2EO8A 1ZO0A 1CBXA 3B3TA 3B7IA 3D2MA 1LOKA 2BO9A 3JTKA 3PFEA 2I00A 3WR7A 3SI2A 3QB8A 3KR4A 5G21A 4AG9A 3PB4X 5D29A 3H8FA 4R3KA 2FXFA 2Z3MA 1F2PA 1KZFA 2Q51A 3C26A 1ELMP 4KOVA 1K4JA 4LUAA 1X12A 4B6ZA 4A39A 2DEAA 4MFJA 1R3NA 1XEBA 2Z0ZA 3TO7A 3LACA 2VZYA 4M6IA 1GYTA 1S60A 4MCQA 2WPWA 1BPNA 5GCNA 1Q2YA 4H6UA 4P44A 1LFWA 1V0CA 3NH4A 4KLWA 3DLJA 4AVCA 5KTCA 3KKWA 4MCSA 3LD2A 4OC4A 2PJ3A 1S3ZA 4NGPA 1P4NA 2ZOFA 1R57A 7CPAA 1PUAA 2EK9A 3IWEA 2Q44A 1B87A 1VHSA 3KZWA 4U9YA 3TC8A 2P6FA 4X2TA 1QMUA 5C82A 5JGFA 3A9LA 4AVAA 1CJWA 2PJ1A 4CYOA 4Y49B 4NSQA 3PB9X 2VI7A 4M85A 4MCRA 4XPLA 5CPAA 5HMNA 1YQEA 4X3RA 3PBBA 2ZENA 2EVNA 1UWYA 4Q36A 4ZY1A 5EC4A 4MFKA 1DTDA 3P2FA 2B4DA 4UEZA 4CAVA 2XEFA 2CNTA 2GIVA 2YNCA 4ONUA 4P4DA 1Y9WA 5K8PA 5JQ4A 3BHXA 3F5BA 2B5GB 1YGHA 4NXYA 3S6HA 3D2PA 4UFWA 1X10A 2B3VA 4AXVA 4GXHA 2PJ4A 2IL4A 4KSAA 2PJ8A 2WYRA 2OH1A 4UA3A 1Z8TA 4R76A 1VHOA 4NGNA 1KUYA 3FNCA 4MFPA 2PJAA 1TKHA 4RS2A 4FD5A 1ARLA 4ZBGA 2Q43A 2WZNA 3S6GA 4NJRA 4EMEA 2REEA 3ISXA 3KI9A 4JXRA 1Z4EA 3BLNA 3TX8A 4OC0A 2ZW4A 4A95A 4OC5A 4HPSA 1DE4C 2IMOA 1Y9KA 2OZUA 2NSMA 2PR8A 3QNVA 4MJ8A 4MHDA 4JD6A 2PRBA 3FH4A 3PFOA 1MJ9A 1SQHA 2Q4ZA 1NSAA 2WUUA 4FD6A 5JH9A 4CRYB 1U6MA 2Q4YA 3FMCA 1HDQA 1M1DA 4B11A 4F0XA 1TF9A 4OC3A 2HQYA 3S6FA 4CGLA 1KUXA 3FIXA 3QAHA 4NGTA 1XMTA 2X7BA 5LRGA 2B5GA 3EO4A 5JM6A 4K3NA 4B10A 5HVHA 3R9EA 5EMIA 2PDOA 2ZELA 2DXQA 4P4BA 4GM5A 4AVBA 2ZEDA 2BSWA 4B5PA 4RUHA 2PC1A 1BAVA 4II9A 4LQGA 3KR5A 4JYWA 5BWAB 1ON0A 2GU2A 1YK3A 2CY2A 2ABZA 4PK3A 5FVJA 3VATA 3N7ZA 4A30A 2J8NA 2V77A 5HVFA 2ATRA 4UEFA 3FECA 5H84A 4I49A 5G20A 5THWA 4Q38A 4C2ZA 3DSBA 4MCPA 3SJXA 3PP9A 4R3LA 5AG5A 3TE4A 3D3SA 5IB9A 4M6GA 1Y7EA 1MJBA 3JVNA 3T9YA 2GANA 4J3GA 1S7LA 4KOSA 2B58A 5H86A 3P2HA 4R7MA 2RB7A 1ELLP 3D67A 5F47A 4E8OA 2V8GA 5D8NA 3TT2A 4R6TA 1IYLA 1XRYA 4KLVA 1BO4A 2VXKA 4MFZA 1YLOA 3KHXA 3T8WA 2B4DB 4KUAA 2ANPA 3D4UA 3S9NA 4IAVA 5HXDA 3BXMA 4KOXA 1NE9A 4L89A 3V7ZA 3WC7A 4MHZA 2ARHA 4PXDA 2R8VA 3TO6A 2DF5A 5ISVA 4P4EA 4C2XA 3PGPA 3PZJA 1VHEA 3DNSA 2O4HA 2R7HA 1XF8A 4KOUA 4JJXA 1JQGA 1B6BA 3FEEA 1I1DA 2DPTA 1IU8A 3S9MA 3LODA 4MY3A 3I1UA 4H89A 3OWCA 4CAFA 4PPZA 1I12A 2QIRA 2HC9A 3BJ7A 3H8GA 2HV2A 2XEGA 4EWTA 2RC4A 3PBEA 2QECA 2Y0MA 3MGDA 3D8PA 3TO9A 4DJLA 3SI0A 4ZY0A 2PJBA 4IUSA 4EVYA 1FNOA 3D7DA 4YRHA 2AFZA 4IK2A 1MK4A 4MY0A 3LMSA 2ZXVA 4M6HA 4Y49C 4ORFA 2AE6A 3IGRA 1CP7A 1XMBA 2CXAA 2YNCC 2F7VA 4R9MA 1ZLHA 4HNXB 4PQAA 4UEEA 5CNPA 2EWBA 2DPSA 2JBJA 3D7HA 1HDUA 2VZZA 2PE3A 3PEIA 4FD4A 1YW6A 2PJ0A 5J8CA 2FT0A 1CG2A 3KHZA 1IB1E 4U5YA 2OR4A 4UCNA 1GHEA 3KASA 5LYFA 2BL1A 2C6GA 4A33A 4NF1A 4KZTA 4E0AA 4H2KA 4AB7A 4CRZB 1Q2CA 3WC6A 4QB9A 3SJFA 3SJEA 1VGYA 3FX6A 4R87A 2RFHA 3GLJA 4A94A 1KWMA 4C7HA 2O53A 2G3TA 2FIWA 1BPMA 4A32A 1M4GA 4UBRA 4UIBA 5IV0A 5E96A 2G0BA 4CPAA 4FBEA 2AFOA 2V8HA 4E2AA 2GLJA 3I3GA 1QSNA 2GREA 2PJ6A 2BOAA 3L2NA 3SHPA 3K2KA 5CBMA 4OLLA 5A28A 5K8MA 3NE7A 1ZLIA 2PCUA 2WPXA 3JUWA 4KVOE 4UFXA 4WJBA 5F48A 4DYOA 1Z5RA 2AJ6A 3G3SA 1R43A 3FF3A 2EK8A 3V38A 5IB0A 1Y7RA 4KOYA 1XBUA 4XPKA 3WABA 1XJOA 4P10A 1XFOA 2OB0A 3CXPA 1NMTA 1TF8A 3IWWA 4CYQA 2PJ2A 3B3CA 4GS4A 3GYAA 5F49A 3W91A 5LYLA 3UY5A 2P6EA 3MRUA 4ZYQA 1Z8XA 2C27A 1WWZA 4BBHA 4KUBA 1Z8LA 4F9UA 4W9YA 4QC6A 1ZG8A 1YX0A 4JZ0A 4ZI6A 4NCZA 4MRIA 3CPXA 4F0YA 2JDCA 4CGPA 2P0WA 3PB7X 4MXUA 3R9FA 5AG4A 2FVGA 3RZAA 3W6SA 4KS9A 3HUVA 4P4IA 4NEXA 3TFYA 4MFQA 5DWMA 3DR8A 4NGRA 2Z11A 2PIYA 2Z3NA 3B3WA 4HKFA 3VWEA 2Z3PA 4QUSA 3SJGA 1M4IA 4A2ZA 3S9LA 2VEZA 3DDDA 2F5IA 4UIAA 4UWIA 4H6ZA 3VWDA 4NJQA 4DUKA 3R1KA 1YR0A 2FS5A 5HVGA 3B3VA 2PVWA 1LANA 2PJ5A 2Z3OA 4B13A 2YGWA 2CNSA 2QJ8A 3GB0A 4PSXA 3ZJ0A 4PXEA 1YMEA 3FB3A 5AG7A 1N71A 2HB6A 4X8IA 2POKA 3R96A 1Z4RA 2VBQA 1I21A 3CXQA 2C6CA 4OP4A 3D7FA 3W6XA 2AFMA 2H5MA 5K8NA 3RO0A 5G22A 1IICA 2ODFA 1OBRA 1ZG9A 1QSMA 4LQ6A 3GIUA 2FL4A 1TKJA 4U9ZA 1LAMA 5K8OA 2K5TA 4R57A 4KSFA 5LRKA 2WSAA 3NFZA 1RXTA 3D68A 3PB8X 4FUUA 4CS0B 2Q04A 4KOWA 4B14A 2PRQA 4Q7AA 3FEDA 4XNHB 3FBUA 2Q7SA 3TOAA 3EFAA 4OIWA 3DGVA 3TTHA 2FCKA 2V8DA 3IEHA 4X5KA 5EBVA 3SI1A 4O23A 4NGQA 3CT9A 2PR1A 4CYNA 3H4QA 2OU2A 3GY9A 2JBKA 2J9AA 4C2YA 2PVVA 3ZZIA 4XPDC 2ZEGA 5KTDA 2J8RA 1PU9A 3IU1A 3H5ZA 5F09A 2JLMA 3I9SA 1EE3P 2AFWA 4OKOA 1RO5A 1TIQA 2AFXA 2OZHA 4OMEA 4R8FA 2AFSA 2Z3LA 1QSTA 3HLPA 3SXOA 3F0AA 3KQZA 4OC2A 2ZW5A 4BMHA 4Z65A 2OZGA 4KORA 3DR6A 3NA6A 3GUXA 2R98A 4PXCA 4CGMA 2B4BA 4RN7A 4UCMA 1M4LA 1XIXA 5LYIA 3RAMA 3ISZA 4PV6A 1AMPA 2IJZA 4OAEA 1TXRA 2Q7BA 1ARMA 2CTBA 3IIBA 5JPHA 4FD7A 2PIZA 4TNUA 3EY5A 4PXBA 4P45A 5I4MA 2BUEA 1UFHA 1WK4A 2ZEHA 2BCOA 3R9GA 1P0HA 1CX8A
chains in the Genus database with same CATH topology
3FXTA 3S6KA 1Q2DA 4CGOA 4MFLA 4F6AA 2NMTA 4MBUA 4UFVA 2P6GA 1M44A 3BJ8A 4M3SA 2PSWA 1VKCA 2O28A 4L8AA 4UWJA 5C88A 1IIDA 2YNDA 3EXNA 2FIAA 3CXSA 2VQYA 2I79A 5AGEA 3TOBA 2D4PA 1IYKA 2A4NA 4JXQA 1MJAA 4QBJA 3FYNA 4B5PB 5IX3A 3IU2A 1L0CA 3R95A 1LRZA 3IWGA 2ZW6A 2G3AA 3FRMA 1QSRA 2FSRA 5I0CA 2Q4VA 1S7FA 2HUZA 4HNYB 4CAXA 4CGNA 5HH1A 4XNHC 2D4OA 4CAEA 4IF5A 2JEVA 2Q0YA 2QMLA 1FY7A 2R1IA 3EC4A 4LX9A 3T90A 3B8GA 4YFJA 5J8FA 4JWPA 2GE3A 5G1ZA 4CAWA 2KCWA 2PQ8A 2Z10A 2Z3KA 4YGOA 2CNMA 1M4DA 2JDDA 4K30A 2J8MA 4PSWA 1S7KA 1S7NA 4B5OA 3E0KA 3K9UA 1YVKA 4CYPA 1KUVA 3F8KA 4AG7A 3RYOA 4A31A 1YLEA 3SXNA 5A27A 1CM0A 4QVTA 4OADA 4HNWB 4KOTA 4B12A 4UCPA 4DNCA 4KVXA 3GKRA 4JLYA 2ZPAA 1XE4A 1OZPA 5DWNA 2YNEA 1YVOA 4KVME 3V8IA 2B3UA 4C68A 4C7IA 1Z9UA 4MI4A 2BEIA 4RI1A 1QSOA 3G8WA 2EUIA 5F46A 1J4JA 1NSLA 4PK2A 4ZGYB 2REFA 4XPDB 5KTAA 5AG6A 1BOBA 2ZW7A 3TCVA 1S5KA 1YREA 2FE7A 1ZO0A 3JTKA 3D2MA 2I00A 3WR7A 3QB8A 5G21A 4AG9A 4R3KA 2FXFA 2Z3MA 1KZFA 3C26A 4KOVA 1K4JA 4LUAA 4MFJA 1XEBA 2Z0ZA 3TO7A 2VZYA 1S60A 5GCNA 2WPWA 1Q2YA 4H6UA 1V0CA 4KLWA 4AVCA 5KTCA 3KKWA 3LD2A 1S3ZA 1P4NA 1R57A 1PUAA 3IWEA 2Q44A 1B87A 1VHSA 4U9YA 2P6FA 5C82A 3A9LA 4AVAA 1CJWA 4CYOA 4Y49B 4NSQA 2VI7A 4M85A 4XPLA 5HMNA 2EVNA 4Q36A 5EC4A 4MFKA 3P2FA 2B4DA 4CAVA 2CNTA 2GIVA 2YNCA 4ONUA 1Y9WA 5JQ4A 3F5BA 2B5GB 1YGHA 4NXYA 3S6HA 3D2PA 4UFWA 2B3VA 2IL4A 4KSAA 4UA3A 2OH1A 1KUYA 3FNCA 4MFPA 4RS2A 4FD5A 4ZBGA 3S6GA 2REEA 4JXRA 1Z4EA 3BLNA 2ZW4A 4A95A 2OZUA 1Y9KA 2PR8A 4MJ8A 4MHDA 4JD6A 2PRBA 1MJ9A 1SQHA 2WUUA 4FD6A 4CRYB 1U6MA 2Q4YA 1M1DA 4B11A 4F0XA 3S6FA 2HQYA 4CGLA 1KUXA 3FIXA 3QAHA 1XMTA 2X7BA 2B5GA 3EO4A 4B10A 3R9EA 2PDOA 2DXQA 4AVBA 2BSWA 4B5PA 2PC1A 4II9A 5BWAB 1ON0A 1YK3A 2CY2A 4PK3A 5FVJA 3N7ZA 4A30A 2J8NA 2ATRA 5H84A 4I49A 5G20A 4Q38A 4C2ZA 3DSBA 3PP9A 4R3LA 5AG5A 3TE4A 3D3SA 1MJBA 3JVNA 3T9YA 2GANA 4J3GA 1S7LA 4KOSA 2B58A 5H86A 3P2HA 5F47A 4E8OA 3TT2A 1IYLA 4KLVA 1BO4A 2VXKA 4MFZA 2B4DB 4KUAA 4KOXA 1NE9A 4L89A 2ARHA 2R8VA 3TO6A 5ISVA 4C2XA 3PGPA 3PZJA 3DNSA 2R7HA 1XF8A 4KOUA 4JJXA 1B6BA 1I1DA 2DPTA 3LODA 4MY3A 4H89A 3OWCA 4CAFA 1I12A 2QIRA 3BJ7A 2HV2A 2RC4A 2QECA 2Y0MA 3MGDA 3D8PA 3TO9A 4IUSA 4EVYA 4YRHA 4MY0A 1MK4A 2ZXVA 4Y49C 4ORFA 2AE6A 3IGRA 2CXAA 2YNCC 4R9MA 4HNXB 5CNPA 2DPSA 2VZZA 4FD4A 5J8CA 2FT0A 4U5YA 1IB1E 4UCNA 1GHEA 2BL1A 4A33A 4NF1A 4KZTA 4E0AA 4AB7A 4CRZB 1Q2CA 4QB9A 4R87A 2FIWA 2G3TA 4A32A 1M4GA 4UBRA 5IV0A 5E96A 2G0BA 4E2AA 3I3GA 1QSNA 3SHPA 4OLLA 5A28A 3NE7A 2WPXA 3JUWA 4KVOE 4UFXA 5F48A 3G3SA 2AJ6A 5IB0A 1Y7RA 4KOYA 4XPKA 2OB0A 3CXPA 1NMTA 4CYQA 5F49A 4GS4A 3GYAA 3W91A 3UY5A 2P6EA 2C27A 1WWZA 4BBHA 4KUBA 4QC6A 1YX0A 4NCZA 4F0YA 2JDCA 4CGPA 2P0WA 5AG4A 3R9FA 3W6SA 4KS9A 4NEXA 3TFYA 4MFQA 5DWMA 3DR8A 2Z11A 2Z3NA 4HKFA 3VWEA 2Z3PA 4QUSA 4A2ZA 1M4IA 2VEZA 3DDDA 2F5IA 4UWIA 4H6ZA 3VWDA 3R1KA 1YR0A 2FS5A 2Z3OA 4B13A 2YGWA 2CNSA 4PSXA 3ZJ0A 3FB3A 5AG7A 1N71A 3R96A 1Z4RA 2VBQA 1I21A 3CXQA 3W6XA 2H5MA 5G22A 1IICA 1QSMA 2FL4A 4U9ZA 2K5TA 4R57A 4KSFA 2WSAA 1RXTA 4CS0B 2Q04A 4KOWA 4B14A 4XNHB 3FBUA 3TOAA 3EFAA 3TTHA 2FCKA 5EBVA 4X5KA 4CYNA 2PR1A 3H4QA 2OU2A 3GY9A 4C2YA 3ZZIA 4XPDC 5KTDA 2J8RA 1PU9A 3IU1A 3H5ZA 2JLMA 3I9SA 1RO5A 1TIQA 2OZHA 2Z3LA 1QSTA 3SXOA 4BMHA 3F0AA 2ZW5A 2OZGA 4KORA 3DR6A 2R98A 4CGMA 2B4BA 4UCMA 1XIXA 4PV6A 4OAEA 2Q7BA 5JPHA 4FD7A 3EY5A 2BUEA 1UFHA 1WK4A 4C7HA 3R9GA 1P0HA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3FXT A;  3S6K A;  1Q2D A;  4F6A A;  2NMT A;  4MBU A;  2P6G A;  1M44 A;  3BJ8 A;  4M3S A;  2PSW A;  1VKC A;  2O28 A;  4L8A A;  4UWJ A;  5C88 A;  1IID A;  3EXN A;  2FIA A;  3CXS A;  2VQY A;  2I79 A;  3TOB A;  2D4P A;  1IYK A;  2A4N A;  4JXQ A;  1MJA A;  4QBJ A;  3FYN A;  4B5P B;  5IX3 A;  1L0C A;  3R95 A;  1LRZ A;  3IWG A;  2ZW6 A;  2G3A A;  3FRM A;  1QSR A;  2FSR A;  5I0C A;  2Q4V A;  1S7F A;  2HUZ A;  4HNY B;  4CAX A;  5HH1 A;  4XNH C;  2D4O A;  4IF5 A;  2JEV A;  2Q0Y A;  2QML A;  1FY7 A;  2R1I A;  3EC4 A;  4LX9 A;  3T90 A;  3B8G A;  4YFJ A;  5J8F A;  4JWP A;  2GE3 A;  4CAW A;  2KCW A;  2PQ8 A;  2Z10 A;  4YGO A;  2CNM A;  1M4D A;  2JDD A;  4K30 A;  2J8M A;  4PSW A;  1S7K A;  1S7N A;  4B5O A;  3E0K A;  3K9U A;  1YVK A;  1KUV A;  3F8K A;  4AG7 A;  3RYO A;  1YLE A;  3SXN A;  1CM0 A;  4QVT A;  4OAD A;  4HNW B;  4KOT A;  4DNC A;  4KVX A;  3GKR A;  4JLY A;  2ZPA A;  1XE4 A;  1OZP A;  5DWN A;  1YVO A;  4KVM E;  3V8I A;  2B3U A;  1Z9U A;  4MI4 A;  4RI1 A;  2BEI A;  1QSO A;  3G8W A;  2EUI A;  5F46 A;  1J4J A;  1NSL A;  4PK2 A;  2REF A;  4XPD B;  5KTA A;  1BOB A;  2ZW7 A;  3TCV A;  1S5K A;  1YRE A;  2FE7 A;  3D2M A;  2I00 A;  3WR7 A;  3QB8 A;  4AG9 A;  4R3K A;  2FXF A;  1KZF A;  3C26 A;  4KOV A;  1K4J A;  4LUA A;  1XEB A;  2Z0Z A;  3TO7 A;  2VZY A;  1S60 A;  5GCN A;  2WPW A;  1Q2Y A;  4H6U A;  1V0C A;  4KLW A;  4AVC A;  5KTC A;  3KKW A;  3LD2 A;  1S3Z A;  1P4N A;  1R57 A;  1PUA A;  2Q44 A;  1B87 A;  1VHS A;  4U9Y A;  2P6F A;  5C82 A;  4AVA A;  1CJW A;  4Y49 B;  4NSQ A;  2VI7 A;  4M85 A;  4XPL A;  5HMN A;  2EVN A;  5EC4 A;  3P2F A;  2B4D A;  4CAV A;  2CNT A;  2GIV A;  4ONU A;  1Y9W A;  5JQ4 A;  3F5B A;  2B5G B;  1YGH A;  4NXY A;  3S6H A;  3D2P A;  2B3V A;  2IL4 A;  4UA3 A;  2OH1 A;  1KUY A;  3FNC A;  4RS2 A;  4FD5 A;  4ZBG A;  3S6G A;  2REE A;  4JXR A;  1Z4E A;  3BLN A;  2ZW4 A;  2OZU A;  1Y9K A;  2PR8 A;  4MJ8 A;  4MHD A;  4JD6 A;  2PRB A;  1MJ9 A;  1SQH A;  4FD6 A;  4CRY B;  1U6M A;  2Q4Y A;  1M1D A;  3S6F A;  2HQY A;  1KUX A;  3FIX A;  3QAH A;  1XMT A;  2X7B A;  2B5G A;  3EO4 A;  3R9E A;  2PDO A;  2DXQ A;  4AVB A;  2BSW A;  4B5P A;  2PC1 A;  4II9 A;  1ON0 A;  1YK3 A;  2CY2 A;  4PK3 A;  5FVJ A;  3N7Z A;  2J8N A;  2ATR A;  5H84 A;  4I49 A;  3DSB A;  3PP9 A;  4R3L A;  3TE4 A;  3D3S A;  1MJB A;  3JVN A;  3T9Y A;  2GAN A;  4J3G A;  1S7L A;  4KOS A;  2B58 A;  5H86 A;  3P2H A;  5F47 A;  4E8O A;  3TT2 A;  1IYL A;  4KLV A;  1BO4 A;  2VXK A;  2B4D B;  4KUA A;  4KOX A;  1NE9 A;  4L89 A;  2ARH A;  2R8V A;  3TO6 A;  5ISV A;  3PGP A;  3PZJ A;  3DNS A;  2R7H A;  1XF8 A;  4KOU A;  4JJX A;  1B6B A;  1I1D A;  3LOD A;  4MY3 A;  4H89 A;  3OWC A;  1I12 A;  2QIR A;  3BJ7 A;  2HV2 A;  2RC4 A;  2QEC A;  2Y0M A;  3MGD A;  3D8P A;  3TO9 A;  4IUS A;  4EVY A;  4YRH A;  4MY0 A;  1MK4 A;  2ZXV A;  4Y49 C;  4ORF A;  2AE6 A;  3IGR A;  4R9M A;  4HNX B;  5CNP A;  2VZZ A;  4FD4 A;  5J8C A;  2FT0 A;  4U5Y A;  1IB1 E;  1GHE A;  2BL1 A;  4NF1 A;  4KZT A;  4E0A A;  4AB7 A;  4CRZ B;  1Q2C A;  4QB9 A;  4R87 A;  2FIW A;  2G3T A;  1M4G A;  4UBR A;  5IV0 A;  5E96 A;  2G0B A;  4E2A A;  3I3G A;  1QSN A;  3SHP A;  4OLL A;  3NE7 A;  2WPX A;  3JUW A;  4KVO E;  5F48 A;  3G3S A;  2AJ6 A;  5IB0 A;  1Y7R A;  4KOY A;  4XPK A;  2OB0 A;  3CXP A;  1NMT A;  5F49 A;  4GS4 A;  3GYA A;  3W91 A;  3UY5 A;  2P6E A;  2C27 A;  1WWZ A;  4KUB A;  4QC6 A;  1YX0 A;  4NCZ A;  4F0Y A;  2JDC A;  2P0W A;  3R9F A;  3W6S A;  4NEX A;  3TFY A;  5DWM A;  3DR8 A;  2Z11 A;  4HKF A;  3VWE A;  4QUS A;  1M4I A;  2VEZ A;  3DDD A;  2F5I A;  4UWI A;  4H6Z A;  3VWD A;  3R1K A;  1YR0 A;  2FS5 A;  2CNS A;  4PSX A;  3ZJ0 A;  3FB3 A;  1N71 A;  3R96 A;  1Z4R A;  2VBQ A;  1I21 A;  3CXQ A;  3W6X A;  2H5M A;  1IIC A;  1QSM A;  2FL4 A;  4U9Z A;  2K5T A;  4R57 A;  1RXT A;  4CS0 B;  2Q04 A;  4KOW A;  4XNH B;  3FBU A;  3TOA A;  3EFA A;  3TTH A;  2FCK A;  5EBV A;  4X5K A;  2PR1 A;  3H4Q A;  2OU2 A;  3GY9 A;  3ZZI A;  4XPD C;  5KTD A;  2J8R A;  1PU9 A;  2JLM A;  3I9S A;  1RO5 A;  1TIQ A;  2OZH A;  1QST A;  3SXO A;  4BMH A;  3F0A A;  2ZW5 A;  2OZG A;  4KOR A;  3DR6 A;  2R98 A;  2B4B A;  1XIX A;  4PV6 A;  4OAE A;  2Q7B A;  5JPH A;  4FD7 A;  3EY5 A;  2BUE A;  1UFH A;  1WK4 A;  3R9G A;  1P0H A; 
#chains in the Genus database with same CATH topology
 3FXT A;  3S6K A;  1Q2D A;  2C6P A;  3QAY A;  1Q7L A;  4CGO A;  4ZY2 A;  3CDX A;  4MFL A;  4P4J A;  5LRJ A;  2NMT A;  3RBU A;  4F6A A;  5J1Q A;  4MBU A;  4UFV A;  2P6G A;  1Y0Y A;  3KGQ A;  1M44 A;  3BJ8 A;  4WWV A;  4M3S A;  3KQX A;  2PSW A;  1VKC A;  2O28 A;  4YU9 A;  4L8A A;  1Z2L A;  4FWU A;  3D66 A;  3K9T A;  4UWJ A;  5C88 A;  1IID A;  2YND A;  1IOF A;  3EXN A;  3IO1 A;  2FIA A;  2I3C A;  3CXS A;  2VQY A;  2I79 A;  5AGE A;  3TOB A;  1XOV A;  2D4P A;  1IYK A;  2A4N A;  2XEI A;  1MJA A;  2F8H A;  3FYN A;  4JXQ A;  3WT4 A;  4B5P B;  4QBJ A;  3IC1 A;  5IX3 A;  4OC1 A;  3IU2 A;  3N5F A;  1L0C A;  3R95 A;  1LRZ A;  1HEE A;  3FVL A;  3IWG A;  4YWY A;  4P6Y A;  2ZW6 A;  2G3A A;  3FRM A;  1QSR A;  2FSR A;  2ZEM A;  5I0C A;  3B3S A;  2Q4V A;  1IOI A;  1S7F A;  3VH9 A;  3FJU A;  3RNZ A;  2EBJ A;  2HUZ A;  4HNY B;  2PJ9 A;  4BIN A;  4CAX A;  4CGN A;  5HH1 A;  4XNH C;  3MN8 A;  3IFE A;  1QQ9 A;  4F8Z A;  4ONW A;  2GFQ A;  2D4O A;  1RTQ A;  2ZEO A;  4NFR A;  4IF5 A;  2JEV A;  3VAR A;  4CAE A;  1Z8W A;  2Q0Y A;  3BI0 A;  3B2Y A;  2QML A;  1IY7 A;  1YW4 A;  1FY7 A;  4A37 A;  2R1I A;  3EC4 A;  3LWU A;  4OID A;  4F9V A;  1CP6 A;  4LX9 A;  3T90 A;  3B8G A;  3B35 A;  4YFJ A;  4JWP A;  5J8F A;  2GE3 A;  5G1Z A;  4CAW A;  2PJC A;  2CTC A;  2C1C A;  2KCW A;  2PQ8 A;  2Z10 A;  3BI1 A;  4NGM A;  2Z3K A;  4YGO A;  1LAP A;  2CNM A;  4IHM A;  1M4D A;  1YSJ A;  2JDD A;  4MMO A;  4K30 A;  4BD9 A;  1IGB A;  4ZX8 A;  3NH8 A;  2J8M A;  2V8V A;  1S7K A;  1S7N A;  4PSW A;  4B5O A;  3E0K A;  3K9U A;  4A38 A;  1ZG7 A;  3JRU A;  1YVK A;  4CYP A;  1BLL E;  1PCA A;  4KSI A;  1KUV A;  2CF4 A;  4G1P A;  3NH5 A;  3PRT A;  4ZX9 A;  2ZEE A;  3F8K A;  4AG7 A;  3RYO A;  4MHY A;  4A31 A;  1H8L A;  1YLE A;  1AUG A;  1PYT B;  3SXN A;  1JWQ A;  5A27 A;  1CM0 A;  1Y0R A;  2JEW A;  4QVT A;  4OAD A;  4HNW B;  4MHN A;  4KOT A;  4B12 A;  5LYD A;  1A2Z A;  3IJ3 A;  2QYV A;  4UCP A;  6CPA A;  4DNC A;  1LCP A;  4TWE A;  2IQ6 A;  5DS0 A;  4KVX A;  3GKR A;  4JLY A;  4FAI A;  2ZPA A;  1XE4 A;  1OZP A;  5ELY A;  5DWN A;  2G9D A;  1CPX A;  2YNE A;  2OOT A;  1VIX A;  1YVO A;  4KVM E;  8CPA A;  2ZEF A;  2ZEP A;  3CPA A;  3NE8 A;  2B3U A;  4NGS A;  3KL9 A;  3V8I A;  4C68 A;  2XEJ A;  3H8E A;  4C7I A;  4UF4 A;  1Z9U A;  4MI4 A;  2BEI A;  4RI1 A;  4MHP A;  1F2O A;  3WC5 A;  1QSO A;  1F57 A;  2AFU A;  3G8W A;  1TKF A;  2EUI A;  4P4F A;  4EFD A;  5F46 A;  1AYE A;  2PJ7 A;  1J4J A;  2QVP A;  1NSL A;  1FT7 A;  2ZOG A;  4PK2 A;  4ZGY B;  2REF A;  1CPS A;  3PB6 X;  2GLF A;  4XPD B;  3D7G A;  2NYQ A;  5AG6 A;  5KTA A;  3CZX A;  1BOB A;  2ZW7 A;  3TCV A;  1S5K A;  1YRE A;  2FE7 A;  2VL1 A;  2CIJ A;  2EO8 A;  1ZO0 A;  1CBX A;  3B3T A;  3B7I A;  3D2M A;  1LOK A;  2BO9 A;  3JTK A;  3PFE A;  2I00 A;  3WR7 A;  3SI2 A;  3QB8 A;  3KR4 A;  5G21 A;  4AG9 A;  3PB4 X;  5D29 A;  3H8F A;  4R3K A;  2FXF A;  2Z3M A;  1F2P A;  1KZF A;  2Q51 A;  3C26 A;  1ELM P;  4KOV A;  1K4J A;  4LUA A;  1X12 A;  4B6Z A;  4A39 A;  2DEA A;  4MFJ A;  1R3N A;  1XEB A;  2Z0Z A;  3TO7 A;  3LAC A;  2VZY A;  4M6I A;  1GYT A;  1S60 A;  4MCQ A;  2WPW A;  1BPN A;  5GCN A;  1Q2Y A;  4H6U A;  4P44 A;  1LFW A;  1V0C A;  3NH4 A;  4KLW A;  3DLJ A;  4AVC A;  5KTC A;  3KKW A;  4MCS A;  3LD2 A;  4OC4 A;  2PJ3 A;  1S3Z A;  4NGP A;  1P4N A;  2ZOF A;  1R57 A;  7CPA A;  1PUA A;  2EK9 A;  3IWE A;  2Q44 A;  1B87 A;  1VHS A;  3KZW A;  4U9Y A;  3TC8 A;  2P6F A;  4X2T A;  1QMU A;  5C82 A;  5JGF A;  3A9L A;  4AVA A;  1CJW A;  2PJ1 A;  4CYO A;  4Y49 B;  4NSQ A;  3PB9 X;  2VI7 A;  4M85 A;  4MCR A;  4XPL A;  5CPA A;  5HMN A;  1YQE A;  4X3R A;  3PBB A;  2ZEN A;  2EVN A;  1UWY A;  4Q36 A;  4ZY1 A;  5EC4 A;  4MFK A;  1DTD A;  3P2F A;  2B4D A;  4UEZ A;  4CAV A;  2XEF A;  2CNT A;  2GIV A;  2YNC A;  4ONU A;  4P4D A;  1Y9W A;  5K8P A;  5JQ4 A;  3BHX A;  3F5B A;  2B5G B;  1YGH A;  4NXY A;  3S6H A;  3D2P A;  4UFW A;  1X10 A;  2B3V A;  4AXV A;  4GXH A;  2PJ4 A;  2IL4 A;  4KSA A;  2PJ8 A;  2WYR A;  2OH1 A;  4UA3 A;  1Z8T A;  4R76 A;  1VHO A;  4NGN A;  1KUY A;  3FNC A;  4MFP A;  2PJA A;  1TKH A;  4RS2 A;  4FD5 A;  1ARL A;  4ZBG A;  2Q43 A;  2WZN A;  3S6G A;  4NJR A;  4EME A;  2REE A;  3ISX A;  3KI9 A;  4JXR A;  1Z4E A;  3BLN A;  3TX8 A;  4OC0 A;  2ZW4 A;  4A95 A;  4OC5 A;  4HPS A;  1DE4 C;  2IMO A;  1Y9K A;  2OZU A;  2NSM A;  2PR8 A;  3QNV A;  4MJ8 A;  4MHD A;  4JD6 A;  2PRB A;  3FH4 A;  3PFO A;  1MJ9 A;  1SQH A;  2Q4Z A;  1NSA A;  2WUU A;  4FD6 A;  5JH9 A;  4CRY B;  1U6M A;  2Q4Y A;  3FMC A;  1HDQ A;  1M1D A;  4B11 A;  4F0X A;  1TF9 A;  4OC3 A;  2HQY A;  3S6F A;  4CGL A;  1KUX A;  3FIX A;  3QAH A;  4NGT A;  1XMT A;  2X7B A;  5LRG A;  2B5G A;  3EO4 A;  5JM6 A;  4K3N A;  4B10 A;  5HVH A;  3R9E A;  5EMI A;  2PDO A;  2ZEL A;  2DXQ A;  4P4B A;  4GM5 A;  4AVB A;  2ZED A;  2BSW A;  4B5P A;  4RUH A;  2PC1 A;  1BAV A;  4II9 A;  4LQG A;  3KR5 A;  4JYW A;  5BWA B;  1ON0 A;  2GU2 A;  1YK3 A;  2CY2 A;  2ABZ A;  4PK3 A;  5FVJ A;  3VAT A;  3N7Z A;  4A30 A;  2J8N A;  2V77 A;  5HVF A;  2ATR A;  4UEF A;  3FEC A;  5H84 A;  4I49 A;  5G20 A;  5THW A;  4Q38 A;  4C2Z A;  3DSB A;  4MCP A;  3SJX A;  3PP9 A;  4R3L A;  5AG5 A;  3TE4 A;  3D3S A;  5IB9 A;  4M6G A;  1Y7E A;  1MJB A;  3JVN A;  3T9Y A;  2GAN A;  4J3G A;  1S7L A;  4KOS A;  2B58 A;  5H86 A;  3P2H A;  4R7M A;  2RB7 A;  1ELL P;  3D67 A;  5F47 A;  4E8O A;  2V8G A;  5D8N A;  3TT2 A;  4R6T A;  1IYL A;  1XRY A;  4KLV A;  1BO4 A;  2VXK A;  4MFZ A;  1YLO A;  3KHX A;  3T8W A;  2B4D B;  4KUA A;  2ANP A;  3D4U A;  3S9N A;  4IAV A;  5HXD A;  3BXM A;  4KOX A;  1NE9 A;  4L89 A;  3V7Z A;  3WC7 A;  4MHZ A;  2ARH A;  4PXD A;  2R8V A;  3TO6 A;  2DF5 A;  5ISV A;  4P4E A;  4C2X A;  3PGP A;  3PZJ A;  1VHE A;  3DNS A;  2O4H A;  2R7H A;  1XF8 A;  4KOU A;  4JJX A;  1JQG A;  1B6B A;  3FEE A;  1I1D A;  2DPT A;  1IU8 A;  3S9M A;  3LOD A;  4MY3 A;  3I1U A;  4H89 A;  3OWC A;  4CAF A;  4PPZ A;  1I12 A;  2QIR A;  2HC9 A;  3BJ7 A;  3H8G A;  2HV2 A;  2XEG A;  4EWT A;  2RC4 A;  3PBE A;  2QEC A;  2Y0M A;  3MGD A;  3D8P A;  3TO9 A;  4DJL A;  3SI0 A;  4ZY0 A;  2PJB A;  4IUS A;  4EVY A;  1FNO A;  3D7D A;  4YRH A;  2AFZ A;  4IK2 A;  1MK4 A;  4MY0 A;  3LMS A;  2ZXV A;  4M6H A;  4Y49 C;  4ORF A;  2AE6 A;  3IGR A;  1CP7 A;  1XMB A;  2CXA A;  2YNC C;  2F7V A;  4R9M A;  1ZLH A;  4HNX B;  4PQA A;  4UEE A;  5CNP A;  2EWB A;  2DPS A;  2JBJ A;  3D7H A;  1HDU A;  2VZZ A;  2PE3 A;  3PEI A;  4FD4 A;  1YW6 A;  2PJ0 A;  5J8C A;  2FT0 A;  1CG2 A;  3KHZ A;  1IB1 E;  4U5Y A;  2OR4 A;  4UCN A;  1GHE A;  3KAS A;  5LYF A;  2BL1 A;  2C6G A;  4A33 A;  4NF1 A;  4KZT A;  4E0A A;  4H2K A;  4AB7 A;  4CRZ B;  1Q2C A;  3WC6 A;  4QB9 A;  3SJF A;  3SJE A;  1VGY A;  3FX6 A;  4R87 A;  2RFH A;  3GLJ A;  4A94 A;  1KWM A;  4C7H A;  2O53 A;  2G3T A;  2FIW A;  1BPM A;  4A32 A;  1M4G A;  4UBR A;  4UIB A;  5IV0 A;  5E96 A;  2G0B A;  4CPA A;  4FBE A;  2AFO A;  2V8H A;  4E2A A;  2GLJ A;  3I3G A;  1QSN A;  2GRE A;  2PJ6 A;  2BOA A;  3L2N A;  3SHP A;  3K2K A;  5CBM A;  4OLL A;  5A28 A;  5K8M A;  3NE7 A;  1ZLI A;  2PCU A;  2WPX A;  3JUW A;  4KVO E;  4UFX A;  4WJB A;  5F48 A;  4DYO A;  1Z5R A;  2AJ6 A;  3G3S A;  1R43 A;  3FF3 A;  2EK8 A;  3V38 A;  5IB0 A;  1Y7R A;  4KOY A;  1XBU A;  4XPK A;  3WAB A;  1XJO A;  4P10 A;  1XFO A;  2OB0 A;  3CXP A;  1NMT A;  1TF8 A;  3IWW A;  4CYQ A;  2PJ2 A;  3B3C A;  4GS4 A;  3GYA A;  5F49 A;  3W91 A;  5LYL A;  3UY5 A;  2P6E A;  3MRU A;  4ZYQ A;  1Z8X A;  2C27 A;  1WWZ A;  4BBH A;  4KUB A;  1Z8L A;  4F9U A;  4W9Y A;  4QC6 A;  1ZG8 A;  1YX0 A;  4JZ0 A;  4ZI6 A;  4NCZ A;  4MRI A;  3CPX A;  4F0Y A;  2JDC A;  4CGP A;  2P0W A;  3PB7 X;  4MXU A;  3R9F A;  5AG4 A;  2FVG A;  3RZA A;  3W6S A;  4KS9 A;  3HUV A;  4P4I A;  4NEX A;  3TFY A;  4MFQ A;  5DWM A;  3DR8 A;  4NGR A;  2Z11 A;  2PIY A;  2Z3N A;  3B3W A;  4HKF A;  3VWE A;  2Z3P A;  4QUS A;  3SJG A;  1M4I A;  4A2Z A;  3S9L A;  2VEZ A;  3DDD A;  2F5I A;  4UIA A;  4UWI A;  4H6Z A;  3VWD A;  4NJQ A;  4DUK A;  3R1K A;  1YR0 A;  2FS5 A;  5HVG A;  3B3V A;  2PVW A;  1LAN A;  2PJ5 A;  2Z3O A;  4B13 A;  2YGW A;  2CNS A;  2QJ8 A;  3GB0 A;  4PSX A;  3ZJ0 A;  4PXE A;  1YME A;  3FB3 A;  5AG7 A;  1N71 A;  2HB6 A;  4X8I A;  2POK A;  3R96 A;  1Z4R A;  2VBQ A;  1I21 A;  3CXQ A;  2C6C A;  4OP4 A;  3D7F A;  3W6X A;  2AFM A;  2H5M A;  5K8N A;  3RO0 A;  5G22 A;  1IIC A;  2ODF A;  1OBR A;  1ZG9 A;  1QSM A;  4LQ6 A;  3GIU A;  2FL4 A;  1TKJ A;  4U9Z A;  1LAM A;  5K8O A;  2K5T A;  4R57 A;  4KSF A;  5LRK A;  2WSA A;  3NFZ A;  1RXT A;  3D68 A;  3PB8 X;  4FUU A;  4CS0 B;  2Q04 A;  4KOW A;  4B14 A;  2PRQ A;  4Q7A A;  3FED A;  4XNH B;  3FBU A;  2Q7S A;  3TOA A;  3EFA A;  4OIW A;  3DGV A;  3TTH A;  2FCK A;  2V8D A;  3IEH A;  4X5K A;  5EBV A;  3SI1 A;  4O23 A;  4NGQ A;  3CT9 A;  2PR1 A;  4CYN A;  3H4Q A;  2OU2 A;  3GY9 A;  2JBK A;  2J9A A;  4C2Y A;  2PVV A;  3ZZI A;  4XPD C;  2ZEG A;  5KTD A;  2J8R A;  1PU9 A;  3IU1 A;  3H5Z A;  5F09 A;  2JLM A;  3I9S A;  1EE3 P;  2AFW A;  4OKO A;  1RO5 A;  1TIQ A;  2AFX A;  2OZH A;  4OME A;  4R8F A;  2AFS A;  2Z3L A;  1QST A;  3HLP A;  3SXO A;  3F0A A;  3KQZ A;  4OC2 A;  2ZW5 A;  4BMH A;  4Z65 A;  2OZG A;  4KOR A;  3DR6 A;  3NA6 A;  3GUX A;  2R98 A;  4PXC A;  4CGM A;  2B4B A;  4RN7 A;  4UCM A;  1M4L A;  1XIX A;  5LYI A;  3RAM A;  3ISZ A;  4PV6 A;  1AMP A;  2IJZ A;  4OAE A;  1TXR A;  2Q7B A;  1ARM A;  2CTB A;  3IIB A;  5JPH A;  4FD7 A;  2PIZ A;  4TNU A;  3EY5 A;  4PXB A;  4P45 A;  5I4M A;  2BUE A;  1UFH A;  1WK4 A;  2ZEH A;  2BCO A;  3R9G A;  1P0H A;  1CX8 A; 
#chains in the Genus database with same CATH homology
 3FXT A;  3S6K A;  1Q2D A;  4CGO A;  4MFL A;  4F6A A;  2NMT A;  4MBU A;  4UFV A;  2P6G A;  1M44 A;  3BJ8 A;  4M3S A;  2PSW A;  1VKC A;  2O28 A;  4L8A A;  4UWJ A;  5C88 A;  1IID A;  2YND A;  3EXN A;  2FIA A;  3CXS A;  2VQY A;  2I79 A;  5AGE A;  3TOB A;  2D4P A;  1IYK A;  2A4N A;  4JXQ A;  1MJA A;  4QBJ A;  3FYN A;  4B5P B;  5IX3 A;  3IU2 A;  1L0C A;  3R95 A;  1LRZ A;  3IWG A;  2ZW6 A;  2G3A A;  3FRM A;  1QSR A;  2FSR A;  5I0C A;  2Q4V A;  1S7F A;  2HUZ A;  4HNY B;  4CAX A;  4CGN A;  5HH1 A;  4XNH C;  2D4O A;  4CAE A;  4IF5 A;  2JEV A;  2Q0Y A;  2QML A;  1FY7 A;  2R1I A;  3EC4 A;  4LX9 A;  3T90 A;  3B8G A;  4YFJ A;  5J8F A;  4JWP A;  2GE3 A;  5G1Z A;  4CAW A;  2KCW A;  2PQ8 A;  2Z10 A;  2Z3K A;  4YGO A;  2CNM A;  1M4D A;  2JDD A;  4K30 A;  2J8M A;  4PSW A;  1S7K A;  1S7N A;  4B5O A;  3E0K A;  3K9U A;  1YVK A;  4CYP A;  1KUV A;  3F8K A;  4AG7 A;  3RYO A;  4A31 A;  1YLE A;  3SXN A;  5A27 A;  1CM0 A;  4QVT A;  4OAD A;  4HNW B;  4KOT A;  4B12 A;  4UCP A;  4DNC A;  4KVX A;  3GKR A;  4JLY A;  2ZPA A;  1XE4 A;  1OZP A;  5DWN A;  2YNE A;  1YVO A;  4KVM E;  3V8I A;  2B3U A;  4C68 A;  4C7I A;  1Z9U A;  4MI4 A;  2BEI A;  4RI1 A;  1QSO A;  3G8W A;  2EUI A;  5F46 A;  1J4J A;  1NSL A;  4PK2 A;  4ZGY B;  2REF A;  4XPD B;  5KTA A;  5AG6 A;  1BOB A;  2ZW7 A;  3TCV A;  1S5K A;  1YRE A;  2FE7 A;  1ZO0 A;  3JTK A;  3D2M A;  2I00 A;  3WR7 A;  3QB8 A;  5G21 A;  4AG9 A;  4R3K A;  2FXF A;  2Z3M A;  1KZF A;  3C26 A;  4KOV A;  1K4J A;  4LUA A;  4MFJ A;  1XEB A;  2Z0Z A;  3TO7 A;  2VZY A;  1S60 A;  5GCN A;  2WPW A;  1Q2Y A;  4H6U A;  1V0C A;  4KLW A;  4AVC A;  5KTC A;  3KKW A;  3LD2 A;  1S3Z A;  1P4N A;  1R57 A;  1PUA A;  3IWE A;  2Q44 A;  1B87 A;  1VHS A;  4U9Y A;  2P6F A;  5C82 A;  3A9L A;  4AVA A;  1CJW A;  4CYO A;  4Y49 B;  4NSQ A;  2VI7 A;  4M85 A;  4XPL A;  5HMN A;  2EVN A;  4Q36 A;  5EC4 A;  4MFK A;  3P2F A;  2B4D A;  4CAV A;  2CNT A;  2GIV A;  2YNC A;  4ONU A;  1Y9W A;  5JQ4 A;  3F5B A;  2B5G B;  1YGH A;  4NXY A;  3S6H A;  3D2P A;  4UFW A;  2B3V A;  2IL4 A;  4KSA A;  4UA3 A;  2OH1 A;  1KUY A;  3FNC A;  4MFP A;  4RS2 A;  4FD5 A;  4ZBG A;  3S6G A;  2REE A;  4JXR A;  1Z4E A;  3BLN A;  2ZW4 A;  4A95 A;  2OZU A;  1Y9K A;  2PR8 A;  4MJ8 A;  4MHD A;  4JD6 A;  2PRB A;  1MJ9 A;  1SQH A;  2WUU A;  4FD6 A;  4CRY B;  1U6M A;  2Q4Y A;  1M1D A;  4B11 A;  4F0X A;  3S6F A;  2HQY A;  4CGL A;  1KUX A;  3FIX A;  3QAH A;  1XMT A;  2X7B A;  2B5G A;  3EO4 A;  4B10 A;  3R9E A;  2PDO A;  2DXQ A;  4AVB A;  2BSW A;  4B5P A;  2PC1 A;  4II9 A;  5BWA B;  1ON0 A;  1YK3 A;  2CY2 A;  4PK3 A;  5FVJ A;  3N7Z A;  4A30 A;  2J8N A;  2ATR A;  5H84 A;  4I49 A;  5G20 A;  4Q38 A;  4C2Z A;  3DSB A;  3PP9 A;  4R3L A;  5AG5 A;  3TE4 A;  3D3S A;  1MJB A;  3JVN A;  3T9Y A;  2GAN A;  4J3G A;  1S7L A;  4KOS A;  2B58 A;  5H86 A;  3P2H A;  5F47 A;  4E8O A;  3TT2 A;  1IYL A;  4KLV A;  1BO4 A;  2VXK A;  4MFZ A;  2B4D B;  4KUA A;  4KOX A;  1NE9 A;  4L89 A;  2ARH A;  2R8V A;  3TO6 A;  5ISV A;  4C2X A;  3PGP A;  3PZJ A;  3DNS A;  2R7H A;  1XF8 A;  4KOU A;  4JJX A;  1B6B A;  1I1D A;  2DPT A;  3LOD A;  4MY3 A;  4H89 A;  3OWC A;  4CAF A;  1I12 A;  2QIR A;  3BJ7 A;  2HV2 A;  2RC4 A;  2QEC A;  2Y0M A;  3MGD A;  3D8P A;  3TO9 A;  4IUS A;  4EVY A;  4YRH A;  4MY0 A;  1MK4 A;  2ZXV A;  4Y49 C;  4ORF A;  2AE6 A;  3IGR A;  2CXA A;  2YNC C;  4R9M A;  4HNX B;  5CNP A;  2DPS A;  2VZZ A;  4FD4 A;  5J8C A;  2FT0 A;  4U5Y A;  1IB1 E;  4UCN A;  1GHE A;  2BL1 A;  4A33 A;  4NF1 A;  4KZT A;  4E0A A;  4AB7 A;  4CRZ B;  1Q2C A;  4QB9 A;  4R87 A;  2FIW A;  2G3T A;  4A32 A;  1M4G A;  4UBR A;  5IV0 A;  5E96 A;  2G0B A;  4E2A A;  3I3G A;  1QSN A;  3SHP A;  4OLL A;  5A28 A;  3NE7 A;  2WPX A;  3JUW A;  4KVO E;  4UFX A;  5F48 A;  3G3S A;  2AJ6 A;  5IB0 A;  1Y7R A;  4KOY A;  4XPK A;  2OB0 A;  3CXP A;  1NMT A;  4CYQ A;  5F49 A;  4GS4 A;  3GYA A;  3W91 A;  3UY5 A;  2P6E A;  2C27 A;  1WWZ A;  4BBH A;  4KUB A;  4QC6 A;  1YX0 A;  4NCZ A;  4F0Y A;  2JDC A;  4CGP A;  2P0W A;  5AG4 A;  3R9F A;  3W6S A;  4KS9 A;  4NEX A;  3TFY A;  4MFQ A;  5DWM A;  3DR8 A;  2Z11 A;  2Z3N A;  4HKF A;  3VWE A;  2Z3P A;  4QUS A;  4A2Z A;  1M4I A;  2VEZ A;  3DDD A;  2F5I A;  4UWI A;  4H6Z A;  3VWD A;  3R1K A;  1YR0 A;  2FS5 A;  2Z3O A;  4B13 A;  2YGW A;  2CNS A;  4PSX A;  3ZJ0 A;  3FB3 A;  5AG7 A;  1N71 A;  3R96 A;  1Z4R A;  2VBQ A;  1I21 A;  3CXQ A;  3W6X A;  2H5M A;  5G22 A;  1IIC A;  1QSM A;  2FL4 A;  4U9Z A;  2K5T A;  4R57 A;  4KSF A;  2WSA A;  1RXT A;  4CS0 B;  2Q04 A;  4KOW A;  4B14 A;  4XNH B;  3FBU A;  3TOA A;  3EFA A;  3TTH A;  2FCK A;  5EBV A;  4X5K A;  4CYN A;  2PR1 A;  3H4Q A;  2OU2 A;  3GY9 A;  4C2Y A;  3ZZI A;  4XPD C;  5KTD A;  2J8R A;  1PU9 A;  3IU1 A;  3H5Z A;  2JLM A;  3I9S A;  1RO5 A;  1TIQ A;  2OZH A;  2Z3L A;  1QST A;  3SXO A;  4BMH A;  3F0A A;  2ZW5 A;  2OZG A;  4KOR A;  3DR6 A;  2R98 A;  4CGM A;  2B4B A;  4UCM A;  1XIX A;  4PV6 A;  4OAE A;  2Q7B A;  5JPH A;  4FD7 A;  3EY5 A;  2BUE A;  1UFH A;  1WK4 A;  4C7H A;  3R9G A;  1P0H A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...