5CNPA

X-ray crystal structure of spermidine n1-acetyltransferase from vibrio cholerae.
Total Genus 46
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
46
sequence length
174
structure length
170
Chain Sequence
AMNSQLTLRALERGDLRFIHNLNNMSYWFEEPYESFDELEELYNKHIHDNAERRFVVEDAQKNLIGLVELIEINYIHRSAEFQIIIAPEHQGKGFARTLINRALDYSFTILNLHKIYLHVAVENPKAVHLYEECGFVEEGHLVEEFFINGRYQDVKRMYILQSKYLNRSE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords Spermidine N(1)-acetyltransferase
publication title Substrate-Induced Allosteric Change in the Quaternary Structure of the Spermidine N-Acetyltransferase SpeG.
pubmed doi rcsb
source organism Vibrio cholerae serotype o1 (strain atcc 39315 / el tor inaba n16961)
total genus 46
structure length 170
sequence length 174
chains with identical sequence B, C, D, E, F
ec nomenclature ec 2.3.1.57: Diamine N-acetyltransferase.
pdb deposition date 2015-07-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13302 Acetyltransf_3 Acetyltransferase (GNAT) domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.630.30 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Aminopeptidase 5cnpA00
3S6HA 4FD7A 4DNCA 4XNHB 4AVAA 1RO5A 4I49A 2WPWA 1MK4A 1WK4A 4KVOE 5E96A 4CAXA 4JJXA 4L89A 1QSMA 1MJAA 4NF1A 4RI1A 5J8CA 2GE3A 5FVJA 3D3SA 1QSRA 1L0CA 2FE7A 1NE9A 2PR1A 1S7FA 4MBUA 4CAVA 1LRZA 3F5BA 1M1DA 4R3LA 1RXTA 5F47A 2NMTA 1XE4A 5I0CA 3JVNA 4E8OA 1KZFA 4R9MA 2B5GA 4LX9A 4M3SA 4X5KA 4AVCA 2BUEA 2HV2A 1Q2CA 3F8KA 2JLMA 2G3AA 4U9ZA 1I12A 4AG7A 4JXRA 4U5YA 1Z9UA 3FRMA 3SHPA 1IIDA 4JWPA 3CXPA 1B6BA 4KLWA 3DDDA 4UWIA 2B3UA 4MJ8A 2PR8A 2B4BA 5IV0A 5C88A 1GHEA 2EUIA 3GKRA 1ON0A 3TT2A 1MJ9A 4QC6A 3TTHA 3FBUA 1NSLA 4Y49B 2B4DA 3P2HA 2FIWA 1MJBA 2Q4YA 4FD4A 3TCVA 4HNWB 4XPDC 3FB3A 2BEIA 2R7HA 3D2MA 3C26A 3SXNA 2R1IA 5H86A 4RS2A 5DWNA 3PGPA 1R57A 2VZZA 4E2AA 4GS4A 4NCZA 3I3GA 2B3VA 3VWEA 2B4DB 1CM0A 4JXQA 1NMTA 3UY5A 4KVXA 3I9SA 4J3GA 4NEXA 2DXQA 3D2PA 5F46A 1VHSA 4OAEA 2WPXA 4KORA 3T9YA 2FS5A 5J8FA 2ZW4A 4PSWA 4AVBA 1XMTA 4M85A 3ZZIA 2J8RA 3W6XA 2FSRA 1XEBA 3R96A 2FL4A 4HKFA 3F0AA 4KVME 1S5KA 3BLNA 4HNXB 1VKCA 4ZBGA 4JLYA 3R9EA 1IYLA 1IB1E 4ORFA 1M4IA 2JEVA 3TE4A 4QVTA 2VXKA 1S7LA 4R87A 4OADA 5H84A 2FCKA 4KOTA 1YLEA 1IYKA 3H4QA 4AG9A 1TIQA 4K30A 3OWCA 3JUWA 4JD6A 2BL1A 4KOWA 2R8VA 2ZW6A 4B5PA 1S60A 2QIRA 1QSOA 5JQ4A 5KTAA 1I1DA 3D8PA 1QSNA 5IX3A 4ONUA 4KOUA 3PZJA 4KZTA 2J8NA 3BJ8A 2OZHA 2GANA 5IB0A 1KUXA 2A4NA 4KUBA 3IWGA 2JDCA 2CNMA 1YGHA 2EVNA 1KUVA 2O28A 4IF5A 3R9FA 4NSQA 4PSXA 4QB9A 1YREA 4B5PB 3R9GA 2B5GB 1YK3A 2PQ8A 3TO6A 3QB8A 1P0HA 2ZW7A 3EC4A 2P6FA 3PP9A 4H89A 2J8MA 2P0WA 1XIXA 2OZGA 5ISVA 2X7BA 5DWMA 5GCNA 1M4DA 1V0CA 1SQHA 2REEA 4XPDB 1Q2DA 5HMNA 3GYAA 1PUAA 3FYNA 3ZJ0A 3LODA 1J4JA 3EY5A 4CAWA 2Q0YA 1OZPA 4FD5A 2R98A 2PRBA 1BO4A 5F48A 2Y0MA 2QECA 2P6EA 5EBVA 4PK2A 3TOBA 4HNYB 4KOSA 4IUSA 4Y49C 3TFYA 4KOVA 2FT0A 2G3TA 4AB7A 2H5MA 4CRYB 3CXQA 4MY0A 2ARHA 4B5OA 3GY9A 2Z10A 3DR6A 2I00A 2CNTA 3NE7A 4R57A 4XPLA 1YX0A 1Y9WA 4H6UA 1CJWA 1FY7A 2C27A 3K9UA 4F6AA 2BSWA 3N7ZA 4OLLA 3CXSA 1KUYA 1Q2YA 2VBQA 2VEZA 3RYOA 2Q44A 2Q04A 4XNHC 2OB0A 1UFHA 2AJ6A 2D4OA 2PSWA 2AE6A 4QUSA 2FXFA 4XPKA 4R3KA 4EVYA 1M44A 5KTCA 3FNCA 2KCWA 2I79A 1YVKA 2REFA 4QBJA 3R95A 4U9YA 4L8AA 1YVOA 1U6MA 3LD2A 3R1KA 3V8IA 2K5TA 2G0BA 2JDDA 4E0AA 1S7NA 4BMHA 2Q4VA 5CNPA 4CRZB 2IL4A 3EXNA 4UWJA 4UA3A 4CS0B 2HQYA 2ZPAA 2ZW5A 3SXOA 1Z4EA 2ZXVA 2VZYA 2CY2A 3G3SA 4PK3A 5C82A 3G8WA 4KLVA 5HH1A 3EFAA 3QAHA 4MHDA 4MY3A 4PV6A 3T90A 3DNSA 3DSBA 3BJ7A 1S7KA 2FIAA 2ATRA 1S3ZA 4UBRA 3VWDA 2OU2A 2CNSA 2PDOA 2VI7A 2RC4A 4YRHA 1YR0A 3WR7A 5JPHA 4KUAA 4II9A 1B87A 4YGOA 3W6SA 1WWZA 1N71A 3B8GA 4LUAA 1QSTA 4YFJA 2B58A 2OH1A 1P4NA 3DR8A 4H6ZA 4MI4A 3S6GA 2Z0ZA 1XF8A 3W91A 3MGDA 5F49A 4F0YA 1M4GA 3EO4A 4KOYA 4NXYA 1Z4RA 2Q7BA 4FD6A 3E0KA 3S6FA 1Y7RA 4KOXA 5KTDA 3IGRA 3S6KA 1IICA 1K4JA 3FIXA 1Y9KA 2F5IA 3TOAA 2QMLA 3TO9A 3P2FA 2VQYA 2P6GA 2D4PA 3KKWA 3TO7A 2GIVA 1BOBA 2Z11A 1I21A 2OZUA 2HUZA 3FXTA 5EC4A 1PU9A 2PC1A
chains in the Genus database with same CATH superfamily
2Q43A 3S6HA 2PVWA 3B3TA 4FD7A 4NJRA 3FEDA 2C6CA 4MHNA 2V8VA 2ZELA 3MN8A 4XNHB 4DNCA 4AVAA 1RO5A 3KASA 4I49A 2WPWA 1MK4A 1WK4A 1CPXA 2QVPA 5AGEA 4OC2A 2Q51A 2C1CA 4KVOE 3V7ZA 4C68A 4NGRA 3H8EA 5E96A 2YGWA 4CAXA 4Q38A 4JJXA 4L89A 1QSMA 4R8FA 1MJAA 4NF1A 2JBKA 4PXBA 4M6HA 4RI1A 5J8CA 4CYNA 2GE3A 2V8HA 3PEIA 5FVJA 3D3SA 5LRKA 2CTBA 1QSRA 4NGSA 4PXEA 3KR4A 1L0CA 2CXAA 4P4IA 2FE7A 1NE9A 5AG7A 4CGPA 2XEIA 3WC6A 3QNVA 3FH4A 2PR1A 1YMEA 2NYQA 1S7FA 4MBUA 4ZX8A 4KSFA 5HVFA 4TWEA 4A2ZA 4NFRA 1Y0RA 2WUUA 4MXUA 4P4JA 4CAVA 1LRZA 3F5BA 1M1DA 5K8OA 4R3LA 1OBRA 1RXTA 2NMTA 5F47A 3SJEA 3TX8A 1XE4A 5I0CA 6CPAA 2DPTA 4MMOA 3JVNA 4E8OA 4MFZA 5F09A 1KZFA 4R9MA 3NH8A 2B5GA 1VHOA 4LX9A 4M3SA 2AFWA 4X5KA 1PYTB 1Z8TA 4AVCA 4B11A 2BUEA 2HV2A 2JBJA 1Q2CA 3F8KA 2JLMA 1PCAA 2G3AA 3FMCA 4U9ZA 1YSJA 4BD9A 5CPAA 1I12A 2EO8A 3PB7X 4AG7A 4JXRA 4U5YA 1Z9UA 5LYIA 3FRMA 3QAYA 3SHPA 4IAVA 3CZXA 4C7IA 2ZEHA 3KQXA 4NGMA 1IIDA 7CPAA 4JWPA 2IQ6A 3RAMA 2GU2A 5AG6A 4TNUA 5G21A 2EK8A 4FUUA 4RN7A 3D68A 3SI1A 5LRGA 2Z3MA 3CXPA 2NSMA 2PJ8A 1B6BA 4KLWA 3DDDA 1TXRA 2CF4A 4UWIA 2B3UA 2F8HA 4MJ8A 2PR8A 4BBHA 2B4BA 4HPSA 1QMUA 1FT7A 2WZNA 5IV0A 2EBJA 2POKA 5C88A 1GHEA 2EUIA 2Q7SA 3IFEA 3GKRA 4MFKA 1ON0A 3TT2A 1MJ9A 4X2TA 3BHXA 4UFXA 3KZWA 4QC6A 3TTHA 3FBUA 1NSLA 1IOIA 4A39A 4OC5A 4CPAA 3GB0A 4Y49B 4ZY2A 1X10A 2B4DA 4B12A 5CBMA 1HDQA 3P2HA 2FIWA 2IMOA 5HXDA 5K8NA 1MJBA 4FBEA 2ZEOA 2Q4YA 4FD4A 4WWVA 3TCVA 4HNWB 4ZY1A 1Z5RA 5LYDA 3S9LA 4XPDC 1IGBA 4A33A 3IU1A 1A2ZA 3FB3A 1BPNA 2BEIA 2ANPA 2R7HA 3C26A 3D2MA 2R1IA 4PPZA 3SXNA 4DYOA 2PJ5A 5H86A 4RS2A 5DWNA 2PJBA 1VGYA 3PGPA 1ZG7A 1R57A 4Q7AA 2VZZA 4UF4A 4E2AA 3KHXA 2C6GA 4IHMA 4GS4A 2YNCC 4P6YA 4R6TA 3JTKA 4NCZA 4UIBA 3I3GA 2B3VA 3VWEA 4ZYQA 2B4DB 2ABZA 3I1UA 1GYTA 3FX6A 1CM0A 3B35A 1XBUA 4JXQA 1CG2A 1NMTA 3SI2A 4X8IA 3UY5A 4KVXA 1XRYA 3I9SA 4J3GA 5AG5A 4NEXA 2DXQA 3D2PA 2YNDA 4OKOA 4DJLA 4MFQA 1VHSA 5F46A 1AYEA 4OAEA 1H8LA 2WPXA 4KORA 3T9YA 2FS5A 5J8FA 2ZW4A 4PSWA 3NFZA 2VL1A 1Z8XA 4AVBA 1TKFA 1XMTA 4M85A 4X3RA 5G20A 2PE3A 3ZZIA 3PBBA 1CP6A 2AFOA 2J8RA 3W6XA 2FSRA 1XEBA 2AFZA 2PIZA 4UEFA 3R96A 3VH9A 2Z3PA 2FL4A 3WT4A 2BOAA 2DF5A 4HKFA 3F0AA 2CTCA 4KVME 1S5KA 3BLNA 4HNXB 1BLLE 1VKCA 5BWAB 4ZBGA 4JLYA 3R9EA 1IYLA 4KSIA 1IB1E 4ORFA 1BAVA 2ZOGA 1M4IA 1NSAA 2JEVA 3WABA 3TE4A 1XMBA 4MFJA 4QVTA 2VXKA 2JEWA 1S7LA 1UWYA 2ZEEA 4R87A 1CP7A 4OADA 1TF9A 3FEEA 5H84A 4BINA 1F2PA 2FCKA 4NGQA 2HB6A 2ZENA 3D67A 4KOTA 3SJXA 2PJ7A 3SJFA 1YLEA 3KI9A 3NE8A 1IYKA 1ARMA 4P45A 5G1ZA 1M4LA 3H4QA 1YW6A 4AG9A 3IWEA 1TIQA 4K30A 2Z3OA 3OWCA 3JUWA 4JD6A 2BL1A 4KOWA 1Y0YA 3JRUA 1EE3P 1YLOA 2R8VA 2ZW6A 4B5PA 1S60A 2IJZA 2QIRA 3DGVA 1QSOA 5JQ4A 5KTAA 1I1DA 3D8PA 1R3NA 1Z8LA 1QSNA 4PXDA 1TKHA 5IX3A 4ONUA 3H8GA 1YW4A 4KOUA 3PZJA 3BI1A 3MRUA 3PB4X 4KZTA 4UFWA 2J8NA 3BJ8A 1ZG9A 2OZHA 2WSAA 2GANA 5IB0A 1KUXA 4MCRA 2A4NA 3K2KA 4KUBA 3IWGA 4ZX9A 2JDCA 4MFPA 1AMPA 3K9TA 2CNMA 4MCPA 1YGHA 3RO0A 1LCPA 3A9LA 4FWUA 4ONWA 2EVNA 4K3NA 1KUVA 3N5FA 1FNOA 3PFEA 4KS9A 2O28A 3PRTA 4IF5A 4Q36A 4NSQA 4PSXA 3R9FA 4LQGA 1YREA 4QB9A 4B5PB 3R9GA 2QJ8A 1ELLP 1YK3A 2B5GB 4G1PA 4P4DA 2PQ8A 3NA6A 3TO6A 3D7DA 4P4EA 3QB8A 1P0HA 2ZW7A 4GM5A 5HVHA 1LFWA 3EC4A 2OOTA 2P6FA 3WC5A 3PP9A 4H89A 4MFLA 2PJ4A 1XFOA 4EWTA 1ELMP 2O53A 2J8MA 2YNCA 2P0WA 1VHEA 4CYOA 3NH5A 1IY7A 1XIXA 3RBUA 2OZGA 3B2YA 5ISVA 4ZI6A 1JWQA 2X7BA 5DWMA 2V8DA 1M4DA 5GCNA 3KL9A 4GXHA 1V0CA 1SQHA 4LQ6A 3TC8A 1LANA 4MRIA 2REEA 4A32A 4CYPA 5A27A 4XPDB 1Q2DA 1XJOA 4UEEA 5HMNA 1CBXA 3GYAA 2I3CA 1PUAA 4CGLA 4F9UA 8CPAA 3FYNA 5HVGA 3ZJ0A 3VATA 2OR4A 3PB8X 3LODA 5K8PA 1J4JA 3B3VA 4AXVA 3EY5A 3KR5A 3IJ3A 4CAWA 2ZEFA 2Q0YA 1OZPA 4FD5A 2R98A 2PRBA 1BO4A 1ZG8A 1ZLIA 2WYRA 3D66A 5F48A 2Y0MA 5EMIA 3CDXA 2QECA 3L2NA 2P6EA 4PXCA 5EBVA 2AFUA 2ZOFA 3PB6X 2C6PA 3IU2A 4PK2A 4HNYB 2PJ0A 4KOSA 3TOBA 4IUSA 4Y49C 3TFYA 4W9YA 4KOVA 2FT0A 1AUGA 2G3TA 1DE4C 4DUKA 4AB7A 1XOVA 2H5MA 4CRYB 1DTDA 3CXQA 2PJ1A 4MY0A 3LACA 4UEZA 2XEFA 2ARHA 4B5OA 3GY9A 3IEHA 2EWBA 2J9AA 3FF3A 4OC0A 4F0XA 2PJ3A 3IC1A 2Z10A 1KWMA 3DR6A 3IIBA 4JYWA 5LRJA 2F7VA 2I00A 4C2YA 1YQEA 2QYVA 3PBEA 3GIUA 2CNTA 3NE7A 4MHPA 4R57A 4XPLA 1YX0A 5LYFA 2CIJA 4NGNA 1ARLA 1Y9WA 3IO1A 4H6UA 1CJWA 1FY7A 4OIDA 2C27A 3K9UA 4F6AA 1Z8WA 2BSWA 1RTQA 2RB7A 3B3SA 3B3WA 4RUHA 5DS0A 4Z65A 3N7ZA 2V77A 3CXSA 4OLLA 5G22A 3RNZA 2AFSA 4CGMA 1BPMA 1KUYA 1Q2YA 4JZ0A 1CPSA 2VBQA 2VEZA 3B3CA 4P44A 3RYOA 3FECA 2Q44A 2Q04A 4CGNA 1LAPA 4XNHC 2OB0A 1UFHA 2AJ6A 2D4OA 2PJ2A 2PSWA 3ISXA 3S9MA 4C7HA 2AE6A 2PJAA 4O23A 4WJBA 4QUSA 2EK9A 4C2ZA 5A28A 2FXFA 4XPKA 4P4BA 4ZY0A 4R3KA 4ZGYB 4EVYA 5I4MA 3D7GA 4A95A 1M44A 4B6ZA 5KTCA 2GFQA 1Y7EA 3FNCA 4OC1A 3KQZA 2PJ9A 4MCSA 2PCUA 2RFHA 2ZEPA 3KHZA 3LWUA 3VARA 2PRQA 3FVLA 2I79A 2KCWA 1YVKA 2REFA 2Z3NA 4M6GA 4MHZA 4QBJA 3R95A 3PFOA 4U9YA 4A94A 5THWA 4UCMA 4R7MA 4L8AA 3H5ZA 1YVOA 2Z3LA 5D8NA 1U6MA 3LD2A 3R1KA 3V8IA 2K5TA 2G0BA 2JDDA 4EFDA 2GLJA 1ZLHA 2AFXA 1ZO0A 4A37A 4E0AA 2BCOA 1S7NA 4FAIA 4BMHA 3IWWA 2PVVA 2Q4VA 1Z2LA 3SI0A 5CNPA 4CRZB 2IL4A 3EXNA 3LMSA 4UWJA 4UA3A 1Q7LA 5K8MA 1HEEA 2Z3KA 4NJQA 4CS0B 2XEJA 2V8GA 1TKJA 2HQYA 5JH9A 2ZPAA 2BO9A 4R76A 2XEGA 2DEAA 2ZW5A 3SXOA 3WC7A 4OP4A 4OC3A 4CGOA 4F8ZA 1Z4EA 2ZXVA 3B7IA 2AFMA 2VZYA 5JM6A 2CY2A 3G3SA 4PK3A 5C82A 3G8WA 4KLVA 5HH1A 3HLPA 4MHYA 1LOKA 3BXMA 4P4FA 3GLJA 3EFAA 4YWYA 1R43A 3QAHA 4PQAA 1IOFA 2HC9A 4MCQA 4MHDA 4MY3A 4B13A 4PV6A 3T90A 5IB9A 4H2KA 3BI0A 3DNSA 4OMEA 3DSBA 3T8WA 3BJ7A 1S7KA 2FIAA 1QQ9A 2ATRA 1S3ZA 4P10A 5J1QA 3HUVA 1HDUA 4UBRA 3VWDA 2OU2A 2CNSA 2PDOA 2VI7A 1VIXA 2RC4A 4CAFA 4YRHA 1YR0A 3WR7A 1IU8A 4UFVA 2O4HA 2PIYA 3D7HA 4YU9A 1TF8A 4KUAA 5JPHA 4M6IA 4II9A 1B87A 4YGOA 3W6SA 1WWZA 2ODFA 1N71A 3B8GA 2PJ6A 4LUAA 1QSTA 4NGTA 4EMEA 2G9DA 3CPAA 4A38A 4YFJA 3SJGA 1CX8A 2B58A 4F9VA 2OH1A 1P4NA 3DR8A 4H6ZA 4MI4A 1JQGA 5ELYA 2YNEA 3S6GA 4UCPA 3S9NA 2Z0ZA 3V38A 4CYQA 4KSAA 1XF8A 3W91A 3MGDA 5F49A 4CAEA 4F0YA 1M4GA 2ZEMA 2ZEDA 3EO4A 4KOYA 4IK2A 2PJCA 4NXYA 2DPSA 1Z4RA 2Q7BA 4FD6A 3E0KA 3CT9A 3S6FA 1Y7RA 4KOXA 5KTDA 3RZAA 3IGRA 4OIWA 5D29A 3S6KA 3PB9X 4UCNA 1IICA 1K4JA 5LYLA 4A30A 3D7FA 3FIXA 1Y9KA 2GLFA 3DLJA 4OC4A 2F5IA 4NGPA 3TOAA 3NH4A 3FJUA 4A31A 1LAMA 3KGQA 4B14A 5AG4A 2QMLA 3TO9A 1F2OA 3P2FA 2FVGA 2VQYA 2P6GA 2ZEGA 3CPXA 2D4PA 3KKWA 4C2XA 4B10A 4UIAA 3TO7A 3D4UA 2GIVA 1BOBA 2Z11A 1I21A 3GUXA 5JGFA 2OZUA 3ISZA 2GREA 2HUZA 2Q4ZA 1X12A 3FXTA 5EC4A 3H8FA 1PU9A 1F57A 2PC1A
chains in the Genus database with same CATH topology
3S6HA 4FD7A 4DNCA 4XNHB 4AVAA 1RO5A 4I49A 2WPWA 1MK4A 1WK4A 5AGEA 4KVOE 4C68A 5E96A 2YGWA 4CAXA 4Q38A 4JJXA 4L89A 1QSMA 1MJAA 4NF1A 4RI1A 5J8CA 4CYNA 2GE3A 5FVJA 3D3SA 1QSRA 1L0CA 2CXAA 2FE7A 1NE9A 5AG7A 4CGPA 2PR1A 1S7FA 4MBUA 4KSFA 4A2ZA 2WUUA 4CAVA 1LRZA 3F5BA 1M1DA 4R3LA 1RXTA 5F47A 2NMTA 1XE4A 5I0CA 2DPTA 3JVNA 4E8OA 4MFZA 1KZFA 4R9MA 2B5GA 4LX9A 4M3SA 4X5KA 4AVCA 4B11A 2BUEA 2HV2A 1Q2CA 3F8KA 2JLMA 2G3AA 4U9ZA 1I12A 4AG7A 4JXRA 4U5YA 1Z9UA 3FRMA 3SHPA 4C7IA 1IIDA 4JWPA 5AG6A 5G21A 2Z3MA 3CXPA 1B6BA 4KLWA 3DDDA 4UWIA 2B3UA 4MJ8A 2PR8A 4BBHA 2B4BA 5IV0A 5C88A 1GHEA 2EUIA 3GKRA 1ON0A 3TT2A 1MJ9A 4UFXA 4QC6A 3TTHA 3FBUA 1NSLA 4Y49B 4B12A 2B4DA 3P2HA 2FIWA 1MJBA 2Q4YA 4FD4A 3TCVA 4HNWB 4XPDC 4A33A 3IU1A 3FB3A 2BEIA 2R7HA 3D2MA 3C26A 3SXNA 2R1IA 5H86A 4RS2A 5DWNA 3PGPA 1R57A 2VZZA 4E2AA 4GS4A 2YNCC 3JTKA 4NCZA 3I3GA 2B3VA 3VWEA 2B4DB 1CM0A 4JXQA 1NMTA 3UY5A 4KVXA 3I9SA 4J3GA 5AG5A 4NEXA 2DXQA 3D2PA 2YNDA 5F46A 4MFQA 1VHSA 4OAEA 2WPXA 4KORA 3T9YA 2FS5A 5J8FA 2ZW4A 4PSWA 4AVBA 1XMTA 4M85A 5G20A 3ZZIA 2J8RA 3W6XA 2FSRA 1XEBA 3R96A 2Z3PA 2FL4A 4HKFA 3F0AA 4KVME 1S5KA 3BLNA 4HNXB 1VKCA 5BWAB 4ZBGA 4JLYA 3R9EA 1IYLA 1IB1E 4ORFA 1M4IA 2JEVA 3TE4A 4MFJA 4QVTA 2VXKA 1S7LA 4R87A 4OADA 5H84A 2FCKA 4KOTA 1YLEA 1IYKA 5G1ZA 3H4QA 4AG9A 3IWEA 1TIQA 4K30A 2Z3OA 3OWCA 3JUWA 4JD6A 2BL1A 4KOWA 2R8VA 2ZW6A 4B5PA 1S60A 2QIRA 1QSOA 5JQ4A 5KTAA 1I1DA 3D8PA 1QSNA 5IX3A 4ONUA 4KOUA 3PZJA 4KZTA 4UFWA 2J8NA 3BJ8A 2OZHA 2WSAA 2GANA 5IB0A 1KUXA 2A4NA 4KUBA 3IWGA 2JDCA 4MFPA 2CNMA 1YGHA 3A9LA 2EVNA 1KUVA 4KS9A 2O28A 4IF5A 4Q36A 4NSQA 4PSXA 3R9FA 4QB9A 1YREA 4B5PB 3R9GA 2B5GB 1YK3A 2PQ8A 3TO6A 3QB8A 1P0HA 2ZW7A 3EC4A 2P6FA 3PP9A 4H89A 4MFLA 2J8MA 2YNCA 2P0WA 4CYOA 1XIXA 2OZGA 5ISVA 2X7BA 5DWMA 5GCNA 1M4DA 1V0CA 1SQHA 2REEA 4A32A 4CYPA 5A27A 4XPDB 1Q2DA 5HMNA 3GYAA 1PUAA 4CGLA 3FYNA 3ZJ0A 3LODA 1J4JA 3EY5A 4CAWA 2Q0YA 1OZPA 4FD5A 2R98A 2PRBA 1BO4A 5F48A 2Y0MA 2QECA 2P6EA 5EBVA 4PK2A 3IU2A 3TOBA 4HNYB 4KOSA 4IUSA 4Y49C 3TFYA 4KOVA 2FT0A 2G3TA 4AB7A 2H5MA 4CRYB 3CXQA 4MY0A 2ARHA 4B5OA 3GY9A 4F0XA 2Z10A 3DR6A 4C2YA 2I00A 2CNTA 3NE7A 4R57A 4XPLA 1YX0A 1Y9WA 4H6UA 1CJWA 1FY7A 2C27A 3K9UA 4F6AA 2BSWA 3N7ZA 4OLLA 3CXSA 5G22A 4CGMA 1KUYA 1Q2YA 2VBQA 2VEZA 3RYOA 4CGNA 2Q44A 2Q04A 4XNHC 2OB0A 1UFHA 2AJ6A 2D4OA 2PSWA 4C7HA 2AE6A 4QUSA 4C2ZA 5A28A 2FXFA 4XPKA 4R3KA 4ZGYB 4EVYA 4A95A 1M44A 5KTCA 3FNCA 2KCWA 2I79A 1YVKA 2REFA 2Z3NA 4QBJA 3R95A 4U9YA 4UCMA 4L8AA 3H5ZA 1YVOA 2Z3LA 1U6MA 3LD2A 3R1KA 3V8IA 2K5TA 2G0BA 2JDDA 4E0AA 1ZO0A 1S7NA 4BMHA 2Q4VA 5CNPA 4CRZB 2IL4A 3EXNA 4UWJA 4UA3A 2Z3KA 4CS0B 2HQYA 2ZPAA 2ZW5A 3SXOA 4CGOA 1Z4EA 2ZXVA 2VZYA 2CY2A 3G3SA 4PK3A 5C82A 3G8WA 4KLVA 5HH1A 3EFAA 3QAHA 4MHDA 4MY3A 4B13A 4PV6A 3T90A 3DNSA 3DSBA 3BJ7A 1S7KA 2FIAA 2ATRA 1S3ZA 4UBRA 3VWDA 2OU2A 2CNSA 2PDOA 2VI7A 2RC4A 4CAFA 4YRHA 1YR0A 3WR7A 4UFVA 5JPHA 4KUAA 4II9A 1B87A 4YGOA 3W6SA 1WWZA 1N71A 3B8GA 4LUAA 1QSTA 4YFJA 2B58A 2OH1A 1P4NA 3DR8A 4H6ZA 4MI4A 3S6GA 2YNEA 4UCPA 2Z0ZA 4CYQA 4KSAA 1XF8A 3W91A 3MGDA 5F49A 4CAEA 4F0YA 1M4GA 3EO4A 4KOYA 4NXYA 2DPSA 1Z4RA 2Q7BA 4FD6A 3E0KA 3S6FA 1Y7RA 4KOXA 5KTDA 3IGRA 3S6KA 4UCNA 1IICA 1K4JA 4A30A 3FIXA 1Y9KA 2F5IA 3TOAA 4A31A 4B14A 5AG4A 2QMLA 3TO9A 3P2FA 2VQYA 2P6GA 2D4PA 3KKWA 4C2XA 4B10A 3TO7A 2GIVA 1BOBA 2Z11A 1I21A 2OZUA 2HUZA 3FXTA 5EC4A 1PU9A 4MFKA 2PC1A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3S6H A;  4FD7 A;  4DNC A;  4XNH B;  4AVA A;  1RO5 A;  4I49 A;  2WPW A;  1MK4 A;  1WK4 A;  4KVO E;  5E96 A;  4CAX A;  4JJX A;  4L89 A;  1QSM A;  1MJA A;  4NF1 A;  4RI1 A;  5J8C A;  2GE3 A;  5FVJ A;  3D3S A;  1QSR A;  1L0C A;  2FE7 A;  1NE9 A;  2PR1 A;  1S7F A;  4MBU A;  4CAV A;  1LRZ A;  3F5B A;  1M1D A;  4R3L A;  1RXT A;  5F47 A;  2NMT A;  1XE4 A;  5I0C A;  3JVN A;  4E8O A;  1KZF A;  4R9M A;  2B5G A;  4LX9 A;  4M3S A;  4X5K A;  4AVC A;  2BUE A;  2HV2 A;  1Q2C A;  3F8K A;  2JLM A;  2G3A A;  4U9Z A;  1I12 A;  4AG7 A;  4JXR A;  4U5Y A;  1Z9U A;  3FRM A;  3SHP A;  1IID A;  4JWP A;  3CXP A;  1B6B A;  4KLW A;  3DDD A;  4UWI A;  2B3U A;  4MJ8 A;  2PR8 A;  2B4B A;  5IV0 A;  5C88 A;  1GHE A;  2EUI A;  3GKR A;  1ON0 A;  3TT2 A;  1MJ9 A;  4QC6 A;  3TTH A;  3FBU A;  1NSL A;  4Y49 B;  2B4D A;  3P2H A;  2FIW A;  1MJB A;  2Q4Y A;  4FD4 A;  3TCV A;  4HNW B;  4XPD C;  3FB3 A;  2BEI A;  2R7H A;  3D2M A;  3C26 A;  3SXN A;  2R1I A;  5H86 A;  4RS2 A;  5DWN A;  3PGP A;  1R57 A;  2VZZ A;  4E2A A;  4GS4 A;  4NCZ A;  3I3G A;  2B3V A;  3VWE A;  2B4D B;  1CM0 A;  4JXQ A;  1NMT A;  3UY5 A;  4KVX A;  3I9S A;  4J3G A;  4NEX A;  2DXQ A;  3D2P A;  5F46 A;  1VHS A;  4OAE A;  2WPX A;  4KOR A;  3T9Y A;  2FS5 A;  5J8F A;  2ZW4 A;  4PSW A;  4AVB A;  1XMT A;  4M85 A;  3ZZI A;  2J8R A;  3W6X A;  2FSR A;  1XEB A;  3R96 A;  2FL4 A;  4HKF A;  3F0A A;  4KVM E;  1S5K A;  3BLN A;  4HNX B;  1VKC A;  4ZBG A;  4JLY A;  3R9E A;  1IYL A;  1IB1 E;  4ORF A;  1M4I A;  2JEV A;  3TE4 A;  4QVT A;  2VXK A;  1S7L A;  4R87 A;  4OAD A;  5H84 A;  2FCK A;  4KOT A;  1YLE A;  1IYK A;  3H4Q A;  4AG9 A;  1TIQ A;  4K30 A;  3OWC A;  3JUW A;  4JD6 A;  2BL1 A;  4KOW A;  2R8V A;  2ZW6 A;  4B5P A;  1S60 A;  2QIR A;  1QSO A;  5JQ4 A;  5KTA A;  1I1D A;  3D8P A;  1QSN A;  5IX3 A;  4ONU A;  4KOU A;  3PZJ A;  4KZT A;  2J8N A;  3BJ8 A;  2OZH A;  2GAN A;  5IB0 A;  1KUX A;  2A4N A;  4KUB A;  3IWG A;  2JDC A;  2CNM A;  1YGH A;  2EVN A;  1KUV A;  2O28 A;  4IF5 A;  3R9F A;  4NSQ A;  4PSX A;  4QB9 A;  1YRE A;  4B5P B;  3R9G A;  2B5G B;  1YK3 A;  2PQ8 A;  3TO6 A;  3QB8 A;  1P0H A;  2ZW7 A;  3EC4 A;  2P6F A;  3PP9 A;  4H89 A;  2J8M A;  2P0W A;  1XIX A;  2OZG A;  5ISV A;  2X7B A;  5DWM A;  5GCN A;  1M4D A;  1V0C A;  1SQH A;  2REE A;  4XPD B;  1Q2D A;  5HMN A;  3GYA A;  1PUA A;  3FYN A;  3ZJ0 A;  3LOD A;  1J4J A;  3EY5 A;  4CAW A;  2Q0Y A;  1OZP A;  4FD5 A;  2R98 A;  2PRB A;  1BO4 A;  5F48 A;  2Y0M A;  2QEC A;  2P6E A;  5EBV A;  4PK2 A;  3TOB A;  4HNY B;  4KOS A;  4IUS A;  4Y49 C;  3TFY A;  4KOV A;  2FT0 A;  2G3T A;  4AB7 A;  2H5M A;  4CRY B;  3CXQ A;  4MY0 A;  2ARH A;  4B5O A;  3GY9 A;  2Z10 A;  3DR6 A;  2I00 A;  2CNT A;  3NE7 A;  4R57 A;  4XPL A;  1YX0 A;  1Y9W A;  4H6U A;  1CJW A;  1FY7 A;  2C27 A;  3K9U A;  4F6A A;  2BSW A;  3N7Z A;  4OLL A;  3CXS A;  1KUY A;  1Q2Y A;  2VBQ A;  2VEZ A;  3RYO A;  2Q44 A;  2Q04 A;  4XNH C;  2OB0 A;  1UFH A;  2AJ6 A;  2D4O A;  2PSW A;  2AE6 A;  4QUS A;  2FXF A;  4XPK A;  4R3K A;  4EVY A;  1M44 A;  5KTC A;  3FNC A;  2KCW A;  2I79 A;  1YVK A;  2REF A;  4QBJ A;  3R95 A;  4U9Y A;  4L8A A;  1YVO A;  1U6M A;  3LD2 A;  3R1K A;  3V8I A;  2K5T A;  2G0B A;  2JDD A;  4E0A A;  1S7N A;  4BMH A;  2Q4V A;  5CNP A;  4CRZ B;  2IL4 A;  3EXN A;  4UWJ A;  4UA3 A;  4CS0 B;  2HQY A;  2ZPA A;  2ZW5 A;  3SXO A;  1Z4E A;  2ZXV A;  2VZY A;  2CY2 A;  3G3S A;  4PK3 A;  5C82 A;  3G8W A;  4KLV A;  5HH1 A;  3EFA A;  3QAH A;  4MHD A;  4MY3 A;  4PV6 A;  3T90 A;  3DNS A;  3DSB A;  3BJ7 A;  1S7K A;  2FIA A;  2ATR A;  1S3Z A;  4UBR A;  3VWD A;  2OU2 A;  2CNS A;  2PDO A;  2VI7 A;  2RC4 A;  4YRH A;  1YR0 A;  3WR7 A;  5JPH A;  4KUA A;  4II9 A;  1B87 A;  4YGO A;  3W6S A;  1WWZ A;  1N71 A;  3B8G A;  4LUA A;  1QST A;  4YFJ A;  2B58 A;  2OH1 A;  1P4N A;  3DR8 A;  4H6Z A;  4MI4 A;  3S6G A;  2Z0Z A;  1XF8 A;  3W91 A;  3MGD A;  5F49 A;  4F0Y A;  1M4G A;  3EO4 A;  4KOY A;  4NXY A;  1Z4R A;  2Q7B A;  4FD6 A;  3E0K A;  3S6F A;  1Y7R A;  4KOX A;  5KTD A;  3IGR A;  3S6K A;  1IIC A;  1K4J A;  3FIX A;  1Y9K A;  2F5I A;  3TOA A;  2QML A;  3TO9 A;  3P2F A;  2VQY A;  2P6G A;  2D4P A;  3KKW A;  3TO7 A;  2GIV A;  1BOB A;  2Z11 A;  1I21 A;  2OZU A;  2HUZ A;  3FXT A;  5EC4 A;  1PU9 A;  2PC1 A; 
#chains in the Genus database with same CATH topology
 2Q43 A;  3S6H A;  2PVW A;  3B3T A;  4FD7 A;  4NJR A;  3FED A;  2C6C A;  4MHN A;  2V8V A;  2ZEL A;  3MN8 A;  4XNH B;  4DNC A;  4AVA A;  1RO5 A;  3KAS A;  4I49 A;  2WPW A;  1MK4 A;  1WK4 A;  1CPX A;  2QVP A;  5AGE A;  4OC2 A;  2Q51 A;  2C1C A;  4KVO E;  3V7Z A;  4C68 A;  4NGR A;  3H8E A;  5E96 A;  2YGW A;  4CAX A;  4Q38 A;  4JJX A;  4L89 A;  1QSM A;  4R8F A;  1MJA A;  4NF1 A;  2JBK A;  4PXB A;  4M6H A;  4RI1 A;  5J8C A;  4CYN A;  2GE3 A;  2V8H A;  3PEI A;  5FVJ A;  3D3S A;  5LRK A;  2CTB A;  1QSR A;  4NGS A;  4PXE A;  3KR4 A;  1L0C A;  2CXA A;  4P4I A;  2FE7 A;  1NE9 A;  5AG7 A;  4CGP A;  2XEI A;  3WC6 A;  3QNV A;  3FH4 A;  2PR1 A;  1YME A;  2NYQ A;  1S7F A;  4MBU A;  4ZX8 A;  4KSF A;  5HVF A;  4TWE A;  4A2Z A;  4NFR A;  1Y0R A;  2WUU A;  4MXU A;  4P4J A;  4CAV A;  1LRZ A;  3F5B A;  1M1D A;  5K8O A;  4R3L A;  1OBR A;  1RXT A;  2NMT A;  5F47 A;  3SJE A;  3TX8 A;  1XE4 A;  5I0C A;  6CPA A;  2DPT A;  4MMO A;  3JVN A;  4E8O A;  4MFZ A;  5F09 A;  1KZF A;  4R9M A;  3NH8 A;  2B5G A;  1VHO A;  4LX9 A;  4M3S A;  2AFW A;  4X5K A;  1PYT B;  1Z8T A;  4AVC A;  4B11 A;  2BUE A;  2HV2 A;  2JBJ A;  1Q2C A;  3F8K A;  2JLM A;  1PCA A;  2G3A A;  3FMC A;  4U9Z A;  1YSJ A;  4BD9 A;  5CPA A;  1I12 A;  2EO8 A;  3PB7 X;  4AG7 A;  4JXR A;  4U5Y A;  1Z9U A;  5LYI A;  3FRM A;  3QAY A;  3SHP A;  4IAV A;  3CZX A;  4C7I A;  2ZEH A;  3KQX A;  4NGM A;  1IID A;  7CPA A;  4JWP A;  2IQ6 A;  3RAM A;  2GU2 A;  5AG6 A;  4TNU A;  5G21 A;  2EK8 A;  4FUU A;  4RN7 A;  3D68 A;  3SI1 A;  5LRG A;  2Z3M A;  3CXP A;  2NSM A;  2PJ8 A;  1B6B A;  4KLW A;  3DDD A;  1TXR A;  2CF4 A;  4UWI A;  2B3U A;  2F8H A;  4MJ8 A;  2PR8 A;  4BBH A;  2B4B A;  4HPS A;  1QMU A;  1FT7 A;  2WZN A;  5IV0 A;  2EBJ A;  2POK A;  5C88 A;  1GHE A;  2EUI A;  2Q7S A;  3IFE A;  3GKR A;  4MFK A;  1ON0 A;  3TT2 A;  1MJ9 A;  4X2T A;  3BHX A;  4UFX A;  3KZW A;  4QC6 A;  3TTH A;  3FBU A;  1NSL A;  1IOI A;  4A39 A;  4OC5 A;  4CPA A;  3GB0 A;  4Y49 B;  4ZY2 A;  1X10 A;  2B4D A;  4B12 A;  5CBM A;  1HDQ A;  3P2H A;  2FIW A;  2IMO A;  5HXD A;  5K8N A;  1MJB A;  4FBE A;  2ZEO A;  2Q4Y A;  4FD4 A;  4WWV A;  3TCV A;  4HNW B;  4ZY1 A;  1Z5R A;  5LYD A;  3S9L A;  4XPD C;  1IGB A;  4A33 A;  3IU1 A;  1A2Z A;  3FB3 A;  1BPN A;  2BEI A;  2ANP A;  2R7H A;  3C26 A;  3D2M A;  2R1I A;  4PPZ A;  3SXN A;  4DYO A;  2PJ5 A;  5H86 A;  4RS2 A;  5DWN A;  2PJB A;  1VGY A;  3PGP A;  1ZG7 A;  1R57 A;  4Q7A A;  2VZZ A;  4UF4 A;  4E2A A;  3KHX A;  2C6G A;  4IHM A;  4GS4 A;  2YNC C;  4P6Y A;  4R6T A;  3JTK A;  4NCZ A;  4UIB A;  3I3G A;  2B3V A;  3VWE A;  4ZYQ A;  2B4D B;  2ABZ A;  3I1U A;  1GYT A;  3FX6 A;  1CM0 A;  3B35 A;  1XBU A;  4JXQ A;  1CG2 A;  1NMT A;  3SI2 A;  4X8I A;  3UY5 A;  4KVX A;  1XRY A;  3I9S A;  4J3G A;  5AG5 A;  4NEX A;  2DXQ A;  3D2P A;  2YND A;  4OKO A;  4DJL A;  4MFQ A;  1VHS A;  5F46 A;  1AYE A;  4OAE A;  1H8L A;  2WPX A;  4KOR A;  3T9Y A;  2FS5 A;  5J8F A;  2ZW4 A;  4PSW A;  3NFZ A;  2VL1 A;  1Z8X A;  4AVB A;  1TKF A;  1XMT A;  4M85 A;  4X3R A;  5G20 A;  2PE3 A;  3ZZI A;  3PBB A;  1CP6 A;  2AFO A;  2J8R A;  3W6X A;  2FSR A;  1XEB A;  2AFZ A;  2PIZ A;  4UEF A;  3R96 A;  3VH9 A;  2Z3P A;  2FL4 A;  3WT4 A;  2BOA A;  2DF5 A;  4HKF A;  3F0A A;  2CTC A;  4KVM E;  1S5K A;  3BLN A;  4HNX B;  1BLL E;  1VKC A;  5BWA B;  4ZBG A;  4JLY A;  3R9E A;  1IYL A;  4KSI A;  1IB1 E;  4ORF A;  1BAV A;  2ZOG A;  1M4I A;  1NSA A;  2JEV A;  3WAB A;  3TE4 A;  1XMB A;  4MFJ A;  4QVT A;  2VXK A;  2JEW A;  1S7L A;  1UWY A;  2ZEE A;  4R87 A;  1CP7 A;  4OAD A;  1TF9 A;  3FEE A;  5H84 A;  4BIN A;  1F2P A;  2FCK A;  4NGQ A;  2HB6 A;  2ZEN A;  3D67 A;  4KOT A;  3SJX A;  2PJ7 A;  3SJF A;  1YLE A;  3KI9 A;  3NE8 A;  1IYK A;  1ARM A;  4P45 A;  5G1Z A;  1M4L A;  3H4Q A;  1YW6 A;  4AG9 A;  3IWE A;  1TIQ A;  4K30 A;  2Z3O A;  3OWC A;  3JUW A;  4JD6 A;  2BL1 A;  4KOW A;  1Y0Y A;  3JRU A;  1EE3 P;  1YLO A;  2R8V A;  2ZW6 A;  4B5P A;  1S60 A;  2IJZ A;  2QIR A;  3DGV A;  1QSO A;  5JQ4 A;  5KTA A;  1I1D A;  3D8P A;  1R3N A;  1Z8L A;  1QSN A;  4PXD A;  1TKH A;  5IX3 A;  4ONU A;  3H8G A;  1YW4 A;  4KOU A;  3PZJ A;  3BI1 A;  3MRU A;  3PB4 X;  4KZT A;  4UFW A;  2J8N A;  3BJ8 A;  1ZG9 A;  2OZH A;  2WSA A;  2GAN A;  5IB0 A;  1KUX A;  4MCR A;  2A4N A;  3K2K A;  4KUB A;  3IWG A;  4ZX9 A;  2JDC A;  4MFP A;  1AMP A;  3K9T A;  2CNM A;  4MCP A;  1YGH A;  3RO0 A;  1LCP A;  3A9L A;  4FWU A;  4ONW A;  2EVN A;  4K3N A;  1KUV A;  3N5F A;  1FNO A;  3PFE A;  4KS9 A;  2O28 A;  3PRT A;  4IF5 A;  4Q36 A;  4NSQ A;  4PSX A;  3R9F A;  4LQG A;  1YRE A;  4QB9 A;  4B5P B;  3R9G A;  2QJ8 A;  1ELL P;  1YK3 A;  2B5G B;  4G1P A;  4P4D A;  2PQ8 A;  3NA6 A;  3TO6 A;  3D7D A;  4P4E A;  3QB8 A;  1P0H A;  2ZW7 A;  4GM5 A;  5HVH A;  1LFW A;  3EC4 A;  2OOT A;  2P6F A;  3WC5 A;  3PP9 A;  4H89 A;  4MFL A;  2PJ4 A;  1XFO A;  4EWT A;  1ELM P;  2O53 A;  2J8M A;  2YNC A;  2P0W A;  1VHE A;  4CYO A;  3NH5 A;  1IY7 A;  1XIX A;  3RBU A;  2OZG A;  3B2Y A;  5ISV A;  4ZI6 A;  1JWQ A;  2X7B A;  5DWM A;  2V8D A;  1M4D A;  5GCN A;  3KL9 A;  4GXH A;  1V0C A;  1SQH A;  4LQ6 A;  3TC8 A;  1LAN A;  4MRI A;  2REE A;  4A32 A;  4CYP A;  5A27 A;  4XPD B;  1Q2D A;  1XJO A;  4UEE A;  5HMN A;  1CBX A;  3GYA A;  2I3C A;  1PUA A;  4CGL A;  4F9U A;  8CPA A;  3FYN A;  5HVG A;  3ZJ0 A;  3VAT A;  2OR4 A;  3PB8 X;  3LOD A;  5K8P A;  1J4J A;  3B3V A;  4AXV A;  3EY5 A;  3KR5 A;  3IJ3 A;  4CAW A;  2ZEF A;  2Q0Y A;  1OZP A;  4FD5 A;  2R98 A;  2PRB A;  1BO4 A;  1ZG8 A;  1ZLI A;  2WYR A;  3D66 A;  5F48 A;  2Y0M A;  5EMI A;  3CDX A;  2QEC A;  3L2N A;  2P6E A;  4PXC A;  5EBV A;  2AFU A;  2ZOF A;  3PB6 X;  2C6P A;  3IU2 A;  4PK2 A;  4HNY B;  2PJ0 A;  4KOS A;  3TOB A;  4IUS A;  4Y49 C;  3TFY A;  4W9Y A;  4KOV A;  2FT0 A;  1AUG A;  2G3T A;  1DE4 C;  4DUK A;  4AB7 A;  1XOV A;  2H5M A;  4CRY B;  1DTD A;  3CXQ A;  2PJ1 A;  4MY0 A;  3LAC A;  4UEZ A;  2XEF A;  2ARH A;  4B5O A;  3GY9 A;  3IEH A;  2EWB A;  2J9A A;  3FF3 A;  4OC0 A;  4F0X A;  2PJ3 A;  3IC1 A;  2Z10 A;  1KWM A;  3DR6 A;  3IIB A;  4JYW A;  5LRJ A;  2F7V A;  2I00 A;  4C2Y A;  1YQE A;  2QYV A;  3PBE A;  3GIU A;  2CNT A;  3NE7 A;  4MHP A;  4R57 A;  4XPL A;  1YX0 A;  5LYF A;  2CIJ A;  4NGN A;  1ARL A;  1Y9W A;  3IO1 A;  4H6U A;  1CJW A;  1FY7 A;  4OID A;  2C27 A;  3K9U A;  4F6A A;  1Z8W A;  2BSW A;  1RTQ A;  2RB7 A;  3B3S A;  3B3W A;  4RUH A;  5DS0 A;  4Z65 A;  3N7Z A;  2V77 A;  3CXS A;  4OLL A;  5G22 A;  3RNZ A;  2AFS A;  4CGM A;  1BPM A;  1KUY A;  1Q2Y A;  4JZ0 A;  1CPS A;  2VBQ A;  2VEZ A;  3B3C A;  4P44 A;  3RYO A;  3FEC A;  2Q44 A;  2Q04 A;  4CGN A;  1LAP A;  4XNH C;  2OB0 A;  1UFH A;  2AJ6 A;  2D4O A;  2PJ2 A;  2PSW A;  3ISX A;  3S9M A;  4C7H A;  2AE6 A;  2PJA A;  4O23 A;  4WJB A;  4QUS A;  2EK9 A;  4C2Z A;  5A28 A;  2FXF A;  4XPK A;  4P4B A;  4ZY0 A;  4R3K A;  4ZGY B;  4EVY A;  5I4M A;  3D7G A;  4A95 A;  1M44 A;  4B6Z A;  5KTC A;  2GFQ A;  1Y7E A;  3FNC A;  4OC1 A;  3KQZ A;  2PJ9 A;  4MCS A;  2PCU A;  2RFH A;  2ZEP A;  3KHZ A;  3LWU A;  3VAR A;  2PRQ A;  3FVL A;  2I79 A;  2KCW A;  1YVK A;  2REF A;  2Z3N A;  4M6G A;  4MHZ A;  4QBJ A;  3R95 A;  3PFO A;  4U9Y A;  4A94 A;  5THW A;  4UCM A;  4R7M A;  4L8A A;  3H5Z A;  1YVO A;  2Z3L A;  5D8N A;  1U6M A;  3LD2 A;  3R1K A;  3V8I A;  2K5T A;  2G0B A;  2JDD A;  4EFD A;  2GLJ A;  1ZLH A;  2AFX A;  1ZO0 A;  4A37 A;  4E0A A;  2BCO A;  1S7N A;  4FAI A;  4BMH A;  3IWW A;  2PVV A;  2Q4V A;  1Z2L A;  3SI0 A;  5CNP A;  4CRZ B;  2IL4 A;  3EXN A;  3LMS A;  4UWJ A;  4UA3 A;  1Q7L A;  5K8M A;  1HEE A;  2Z3K A;  4NJQ A;  4CS0 B;  2XEJ A;  2V8G A;  1TKJ A;  2HQY A;  5JH9 A;  2ZPA A;  2BO9 A;  4R76 A;  2XEG A;  2DEA A;  2ZW5 A;  3SXO A;  3WC7 A;  4OP4 A;  4OC3 A;  4CGO A;  4F8Z A;  1Z4E A;  2ZXV A;  3B7I A;  2AFM A;  2VZY A;  5JM6 A;  2CY2 A;  3G3S A;  4PK3 A;  5C82 A;  3G8W A;  4KLV A;  5HH1 A;  3HLP A;  4MHY A;  1LOK A;  3BXM A;  4P4F A;  3GLJ A;  3EFA A;  4YWY A;  1R43 A;  3QAH A;  4PQA A;  1IOF A;  2HC9 A;  4MCQ A;  4MHD A;  4MY3 A;  4B13 A;  4PV6 A;  3T90 A;  5IB9 A;  4H2K A;  3BI0 A;  3DNS A;  4OME A;  3DSB A;  3T8W A;  3BJ7 A;  1S7K A;  2FIA A;  1QQ9 A;  2ATR A;  1S3Z A;  4P10 A;  5J1Q A;  3HUV A;  1HDU A;  4UBR A;  3VWD A;  2OU2 A;  2CNS A;  2PDO A;  2VI7 A;  1VIX A;  2RC4 A;  4CAF A;  4YRH A;  1YR0 A;  3WR7 A;  1IU8 A;  4UFV A;  2O4H A;  2PIY A;  3D7H A;  4YU9 A;  1TF8 A;  4KUA A;  5JPH A;  4M6I A;  4II9 A;  1B87 A;  4YGO A;  3W6S A;  1WWZ A;  2ODF A;  1N71 A;  3B8G A;  2PJ6 A;  4LUA A;  1QST A;  4NGT A;  4EME A;  2G9D A;  3CPA A;  4A38 A;  4YFJ A;  3SJG A;  1CX8 A;  2B58 A;  4F9V A;  2OH1 A;  1P4N A;  3DR8 A;  4H6Z A;  4MI4 A;  1JQG A;  5ELY A;  2YNE A;  3S6G A;  4UCP A;  3S9N A;  2Z0Z A;  3V38 A;  4CYQ A;  4KSA A;  1XF8 A;  3W91 A;  3MGD A;  5F49 A;  4CAE A;  4F0Y A;  1M4G A;  2ZEM A;  2ZED A;  3EO4 A;  4KOY A;  4IK2 A;  2PJC A;  4NXY A;  2DPS A;  1Z4R A;  2Q7B A;  4FD6 A;  3E0K A;  3CT9 A;  3S6F A;  1Y7R A;  4KOX A;  5KTD A;  3RZA A;  3IGR A;  4OIW A;  5D29 A;  3S6K A;  3PB9 X;  4UCN A;  1IIC A;  1K4J A;  5LYL A;  4A30 A;  3D7F A;  3FIX A;  1Y9K A;  2GLF A;  3DLJ A;  4OC4 A;  2F5I A;  4NGP A;  3TOA A;  3NH4 A;  3FJU A;  4A31 A;  1LAM A;  3KGQ A;  4B14 A;  5AG4 A;  2QML A;  3TO9 A;  1F2O A;  3P2F A;  2FVG A;  2VQY A;  2P6G A;  2ZEG A;  3CPX A;  2D4P A;  3KKW A;  4C2X A;  4B10 A;  4UIA A;  3TO7 A;  3D4U A;  2GIV A;  1BOB A;  2Z11 A;  1I21 A;  3GUX A;  5JGF A;  2OZU A;  3ISZ A;  2GRE A;  2HUZ A;  2Q4Z A;  1X12 A;  3FXT A;  5EC4 A;  3H8F A;  1PU9 A;  1F57 A;  2PC1 A; 
#chains in the Genus database with same CATH homology
 3S6H A;  4FD7 A;  4DNC A;  4XNH B;  4AVA A;  1RO5 A;  4I49 A;  2WPW A;  1MK4 A;  1WK4 A;  5AGE A;  4KVO E;  4C68 A;  5E96 A;  2YGW A;  4CAX A;  4Q38 A;  4JJX A;  4L89 A;  1QSM A;  1MJA A;  4NF1 A;  4RI1 A;  5J8C A;  4CYN A;  2GE3 A;  5FVJ A;  3D3S A;  1QSR A;  1L0C A;  2CXA A;  2FE7 A;  1NE9 A;  5AG7 A;  4CGP A;  2PR1 A;  1S7F A;  4MBU A;  4KSF A;  4A2Z A;  2WUU A;  4CAV A;  1LRZ A;  3F5B A;  1M1D A;  4R3L A;  1RXT A;  5F47 A;  2NMT A;  1XE4 A;  5I0C A;  2DPT A;  3JVN A;  4E8O A;  4MFZ A;  1KZF A;  4R9M A;  2B5G A;  4LX9 A;  4M3S A;  4X5K A;  4AVC A;  4B11 A;  2BUE A;  2HV2 A;  1Q2C A;  3F8K A;  2JLM A;  2G3A A;  4U9Z A;  1I12 A;  4AG7 A;  4JXR A;  4U5Y A;  1Z9U A;  3FRM A;  3SHP A;  4C7I A;  1IID A;  4JWP A;  5AG6 A;  5G21 A;  2Z3M A;  3CXP A;  1B6B A;  4KLW A;  3DDD A;  4UWI A;  2B3U A;  4MJ8 A;  2PR8 A;  4BBH A;  2B4B A;  5IV0 A;  5C88 A;  1GHE A;  2EUI A;  3GKR A;  1ON0 A;  3TT2 A;  1MJ9 A;  4UFX A;  4QC6 A;  3TTH A;  3FBU A;  1NSL A;  4Y49 B;  4B12 A;  2B4D A;  3P2H A;  2FIW A;  1MJB A;  2Q4Y A;  4FD4 A;  3TCV A;  4HNW B;  4XPD C;  4A33 A;  3IU1 A;  3FB3 A;  2BEI A;  2R7H A;  3D2M A;  3C26 A;  3SXN A;  2R1I A;  5H86 A;  4RS2 A;  5DWN A;  3PGP A;  1R57 A;  2VZZ A;  4E2A A;  4GS4 A;  2YNC C;  3JTK A;  4NCZ A;  3I3G A;  2B3V A;  3VWE A;  2B4D B;  1CM0 A;  4JXQ A;  1NMT A;  3UY5 A;  4KVX A;  3I9S A;  4J3G A;  5AG5 A;  4NEX A;  2DXQ A;  3D2P A;  2YND A;  5F46 A;  4MFQ A;  1VHS A;  4OAE A;  2WPX A;  4KOR A;  3T9Y A;  2FS5 A;  5J8F A;  2ZW4 A;  4PSW A;  4AVB A;  1XMT A;  4M85 A;  5G20 A;  3ZZI A;  2J8R A;  3W6X A;  2FSR A;  1XEB A;  3R96 A;  2Z3P A;  2FL4 A;  4HKF A;  3F0A A;  4KVM E;  1S5K A;  3BLN A;  4HNX B;  1VKC A;  5BWA B;  4ZBG A;  4JLY A;  3R9E A;  1IYL A;  1IB1 E;  4ORF A;  1M4I A;  2JEV A;  3TE4 A;  4MFJ A;  4QVT A;  2VXK A;  1S7L A;  4R87 A;  4OAD A;  5H84 A;  2FCK A;  4KOT A;  1YLE A;  1IYK A;  5G1Z A;  3H4Q A;  4AG9 A;  3IWE A;  1TIQ A;  4K30 A;  2Z3O A;  3OWC A;  3JUW A;  4JD6 A;  2BL1 A;  4KOW A;  2R8V A;  2ZW6 A;  4B5P A;  1S60 A;  2QIR A;  1QSO A;  5JQ4 A;  5KTA A;  1I1D A;  3D8P A;  1QSN A;  5IX3 A;  4ONU A;  4KOU A;  3PZJ A;  4KZT A;  4UFW A;  2J8N A;  3BJ8 A;  2OZH A;  2WSA A;  2GAN A;  5IB0 A;  1KUX A;  2A4N A;  4KUB A;  3IWG A;  2JDC A;  4MFP A;  2CNM A;  1YGH A;  3A9L A;  2EVN A;  1KUV A;  4KS9 A;  2O28 A;  4IF5 A;  4Q36 A;  4NSQ A;  4PSX A;  3R9F A;  4QB9 A;  1YRE A;  4B5P B;  3R9G A;  2B5G B;  1YK3 A;  2PQ8 A;  3TO6 A;  3QB8 A;  1P0H A;  2ZW7 A;  3EC4 A;  2P6F A;  3PP9 A;  4H89 A;  4MFL A;  2J8M A;  2YNC A;  2P0W A;  4CYO A;  1XIX A;  2OZG A;  5ISV A;  2X7B A;  5DWM A;  5GCN A;  1M4D A;  1V0C A;  1SQH A;  2REE A;  4A32 A;  4CYP A;  5A27 A;  4XPD B;  1Q2D A;  5HMN A;  3GYA A;  1PUA A;  4CGL A;  3FYN A;  3ZJ0 A;  3LOD A;  1J4J A;  3EY5 A;  4CAW A;  2Q0Y A;  1OZP A;  4FD5 A;  2R98 A;  2PRB A;  1BO4 A;  5F48 A;  2Y0M A;  2QEC A;  2P6E A;  5EBV A;  4PK2 A;  3IU2 A;  3TOB A;  4HNY B;  4KOS A;  4IUS A;  4Y49 C;  3TFY A;  4KOV A;  2FT0 A;  2G3T A;  4AB7 A;  2H5M A;  4CRY B;  3CXQ A;  4MY0 A;  2ARH A;  4B5O A;  3GY9 A;  4F0X A;  2Z10 A;  3DR6 A;  4C2Y A;  2I00 A;  2CNT A;  3NE7 A;  4R57 A;  4XPL A;  1YX0 A;  1Y9W A;  4H6U A;  1CJW A;  1FY7 A;  2C27 A;  3K9U A;  4F6A A;  2BSW A;  3N7Z A;  4OLL A;  3CXS A;  5G22 A;  4CGM A;  1KUY A;  1Q2Y A;  2VBQ A;  2VEZ A;  3RYO A;  4CGN A;  2Q44 A;  2Q04 A;  4XNH C;  2OB0 A;  1UFH A;  2AJ6 A;  2D4O A;  2PSW A;  4C7H A;  2AE6 A;  4QUS A;  4C2Z A;  5A28 A;  2FXF A;  4XPK A;  4R3K A;  4ZGY B;  4EVY A;  4A95 A;  1M44 A;  5KTC A;  3FNC A;  2KCW A;  2I79 A;  1YVK A;  2REF A;  2Z3N A;  4QBJ A;  3R95 A;  4U9Y A;  4UCM A;  4L8A A;  3H5Z A;  1YVO A;  2Z3L A;  1U6M A;  3LD2 A;  3R1K A;  3V8I A;  2K5T A;  2G0B A;  2JDD A;  4E0A A;  1ZO0 A;  1S7N A;  4BMH A;  2Q4V A;  5CNP A;  4CRZ B;  2IL4 A;  3EXN A;  4UWJ A;  4UA3 A;  2Z3K A;  4CS0 B;  2HQY A;  2ZPA A;  2ZW5 A;  3SXO A;  4CGO A;  1Z4E A;  2ZXV A;  2VZY A;  2CY2 A;  3G3S A;  4PK3 A;  5C82 A;  3G8W A;  4KLV A;  5HH1 A;  3EFA A;  3QAH A;  4MHD A;  4MY3 A;  4B13 A;  4PV6 A;  3T90 A;  3DNS A;  3DSB A;  3BJ7 A;  1S7K A;  2FIA A;  2ATR A;  1S3Z A;  4UBR A;  3VWD A;  2OU2 A;  2CNS A;  2PDO A;  2VI7 A;  2RC4 A;  4CAF A;  4YRH A;  1YR0 A;  3WR7 A;  4UFV A;  5JPH A;  4KUA A;  4II9 A;  1B87 A;  4YGO A;  3W6S A;  1WWZ A;  1N71 A;  3B8G A;  4LUA A;  1QST A;  4YFJ A;  2B58 A;  2OH1 A;  1P4N A;  3DR8 A;  4H6Z A;  4MI4 A;  3S6G A;  2YNE A;  4UCP A;  2Z0Z A;  4CYQ A;  4KSA A;  1XF8 A;  3W91 A;  3MGD A;  5F49 A;  4CAE A;  4F0Y A;  1M4G A;  3EO4 A;  4KOY A;  4NXY A;  2DPS A;  1Z4R A;  2Q7B A;  4FD6 A;  3E0K A;  3S6F A;  1Y7R A;  4KOX A;  5KTD A;  3IGR A;  3S6K A;  4UCN A;  1IIC A;  1K4J A;  4A30 A;  3FIX A;  1Y9K A;  2F5I A;  3TOA A;  4A31 A;  4B14 A;  5AG4 A;  2QML A;  3TO9 A;  3P2F A;  2VQY A;  2P6G A;  2D4P A;  3KKW A;  4C2X A;  4B10 A;  3TO7 A;  2GIV A;  1BOB A;  2Z11 A;  1I21 A;  2OZU A;  2HUZ A;  3FXT A;  5EC4 A;  1PU9 A;  4MFK A;  2PC1 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...