4FD5A

Crystal structure of arylalkylamine n-acetyltransferase 2 from aedes aegypti
Total Genus 73
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
73
sequence length
216
structure length
216
Chain Sequence
NNIRFETISSKYYDDVIEHLRQTFFADEPLNKAVNLTRPGQGHPLLEQHSLSTLKDNVSIMAISNDGDIAGVALNGILYGNTDIEKSREKLNEIQDESFKKIFKLLYEQNLKINLFKQFDVDKIFEIRILSVDSRFRGKGLAKKLIEKSEELALDRGFQVMKTDATGAFSQRVVSSLGFITKCEINYTDYLDENGEQIFVVDPPHEKLKIMCKVIN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords arylalkylamine N-Acetyltransferase 2
publication title Evolution of insect arylalkylamine N-acetyltransferases: structural evidence from the yellow fever mosquito, Aedes aegypti.
pubmed doi rcsb
source organism Aedes aegypti
total genus 73
structure length 216
sequence length 216
ec nomenclature ec 2.3.1.87: Aralkylamine N-acetyltransferase.
pdb deposition date 2012-05-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00583 Acetyltransf_1 Acetyltransferase (GNAT) family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.630.30 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Aminopeptidase 4fd5A00
2HUZA 3E0KA 4AVAA 5DWMA 3MGDA 1XMTA 2AE6A 2FL4A 3TOAA 1YR0A 4KZTA 4PK2A 1RXTA 3T9YA 5IV0A 2HV2A 2BL1A 3K9UA 1Q2YA 3FRMA 2WPXA 3R9FA 4NXYA 2Q4YA 2R8VA 4B5PA 3R9GA 5CNPA 1S60A 4H6ZA 1XF8A 1SQHA 4M3SA 4KOTA 3R96A 1R57A 2DXQA 2QMLA 2B3VA 4R87A 4KOYA 4M85A 3PGPA 4L89A 2ATRA 4H89A 3VWEA 2BSWA 4PSWA 1I1DA 4KLVA 1YX0A 3IWGA 1MK4A 2Q04A 4R3LA 4AB7A 3R1KA 3BJ8A 5HMNA 3TOBA 4AG7A 3QAHA 4MI4A 2ZXVA 4R57A 4DNCA 2B4BA 3F0AA 4HKFA 3EO4A 3V8IA 4JXQA 2JLMA 1LRZA 4L8AA 2B4DB 2WPWA 4XNHB 2D4PA 3FYNA 4QB9A 2GE3A 2FCKA 2BEIA 4RS2A 1Q2CA 4FD7A 1Z4EA 5EBVA 5F49A 5JQ4A 5IB0A 1YK3A 1RO5A 2R98A 4NF1A 4QVTA 4U9ZA 2Q4VA 2VXKA 2JDCA 1P0HA 2AJ6A 1KUXA 2Y0MA 3FBUA 2HQYA 2B5GA 4KOXA 5EC4A 2IL4A 1WWZA 3FIXA 4KUAA 4JXRA 1IYKA 4UWJA 1Y9KA 5J8CA 1NMTA 3FXTA 2Q44A 1CJWA 1MJBA 3BLNA 1J4JA 2PC1A 1M4IA 3QB8A 1CM0A 1UFHA 1PUAA 3F5BA 4KORA 1S5KA 3D8PA 1QSTA 2C27A 1L0CA 4XNHC 3GYAA 4YRHA 4U9YA 3JVNA 4F6AA 5E96A 2A4NA 2QIRA 4CAXA 1WK4A 2P0WA 4JJXA 5KTAA 2OB0A 2ZW5A 2QECA 2REFA 2G3TA 1KUVA 2H5MA 1MJ9A 4I49A 1MJAA 3B8GA 4U5YA 3RYOA 2O28A 3TO7A 2ZW7A 3W6SA 1M44A 3C26A 4PSXA 2VEZA 1M1DA 5H84A 1I12A 4YGOA 1YGHA 4XPLA 3GKRA 3TO6A 4YFJA 2OH1A 2VI7A 5F47A 4GS4A 4ONUA 2Z10A 3IGRA 4CAWA 2CNMA 4QUSA 4Y49B 5I0CA 3R95A 2GANA 3G8WA 4JLYA 1N71A 2B4DA 2FS5A 2PR1A 1IIDA 4RI1A 2VZYA 2VQYA 4ZBGA 4ORFA 1Y7RA 4MY0A 4IF5A 3DR8A 5F48A 3DDDA 4KOUA 4KVOE 4UA3A 4JWPA 3TTHA 4B5OA 2PQ8A 2FT0A 2D4OA 2Q0YA 2RC4A 2FXFA 1IB1E 3CXSA 1I21A 4H6UA 1YVKA 1Z4RA 2I00A 2OZUA 4LX9A 4AG9A 2J8MA 3S6HA 4OAEA 2P6EA 1M4DA 3W6XA 4AVCA 4MHDA 3F8KA 2EUIA 1K4JA 4F0YA 4CRYB 2B58A 4Y49C 1P4NA 4UBRA 2R1IA 5IX3A 2PSWA 2ARHA 5KTCA 1ON0A 5C88A 2G0BA 1S3ZA 1TIQA 1IICA 5HH1A 5ISVA 2X7BA 3TFYA 1VKCA 2P6GA 2FSRA 3TO9A 2REEA 3W91A 3D3SA 1GHEA 3CXQA 2P6FA 2CY2A 2VBQA 3SXNA 1PU9A 4BMHA 1B87A 4CRZB 4QC6A 4LUAA 1NSLA 2B3UA 3S6GA 4XPKA 4KOWA 1FY7A 1BOBA 1KUYA 3S6KA 3G3SA 3LD2A 5H86A 4E8OA 4R9MA 2Q7BA 3D2MA 1BO4A 2GIVA 3R9EA 3LODA 3ZJ0A 4E0AA 2G3AA 1S7KA 2EVNA 4K30A 3P2FA 3P2HA 2JEVA 1NE9A 4KUBA 4JD6A 3VWDA 3DSBA 3I9SA 4E2AA 2BUEA 2ZPAA 2J8RA 2PR8A 3SHPA 3PP9A 4KOSA 2PDOA 1U6MA 4CS0B 2OZHA 2I79A 3TCVA 4HNXB 3DR6A 4MBUA 4PK3A 4OLLA 2R7HA 1B6BA 1QSOA 4HNWB 1QSMA 4XPDB 3I3GA 4B5PB 1Z9UA 4PV6A 1QSNA 4NCZA 3DNSA 1XEBA 3N7ZA 5C82A 5KTDA 3EFAA 3S6FA 4KVME 3GY9A 3OWCA 1M4GA 1VHSA 3BJ7A 1S7FA 2PRBA 1YLEA 4KVXA 2JDDA 5JPHA 4MY3A 1OZPA 4KOVA 4MJ8A 4FD4A 2ZW4A 3PZJA 2CNTA 4QBJA 2FIWA 3JUWA 3EXNA 2J8NA 3CXPA 5F46A 3EC4A 1IYLA 3ZZIA 3TT2A 4J3GA 4R3KA 4II9A 1Y9WA 3EY5A 5GCNA 3WR7A 1YREA 2Z0ZA 4X5KA 4AVBA 2NMTA 4XPDC 2OU2A 2FIAA 2VZZA 4OADA 1S7NA 1S7LA 3FNCA 4FD6A 1QSRA 3UY5A 2ZW6A 2FE7A 3NE7A 2Z11A 3SXOA 1KZFA 3FB3A 3TE4A 3KKWA 2B5GB 2K5TA 3H4QA 1XE4A 4NEXA 5FVJA 4HNYB 5J8FA 3T90A 1Q2DA 4KLWA 1XIXA 1YVOA 2CNSA 5DWNA 1V0CA 3D2PA 2F5IA 4CAVA 4NSQA 4FD5A 4EVYA 4IUSA 2KCWA 4UWIA 2OZGA
chains in the Genus database with same CATH superfamily
2IMOA 2HUZA 3E0KA 4AVAA 5DWMA 3SJEA 3MGDA 4B6ZA 4BBHA 3KR5A 2AFUA 2PJAA 1XMTA 2PRQA 4MCQA 2AE6A 5HVHA 3KR4A 2FL4A 2DEAA 2HC9A 3TOAA 1YR0A 3QNVA 4UFWA 2F7VA 4O23A 5LRGA 4KZTA 4MRIA 2V77A 4B11A 4P4JA 4IAVA 4C7HA 4PK2A 1ZG8A 1RXTA 3MN8A 3T9YA 5IV0A 2HV2A 3PRTA 4Z65A 2BL1A 2ZEOA 1FNOA 4W9YA 1YW6A 3K9UA 3KI9A 4P4EA 1Q2YA 2XEFA 3FRMA 4NJRA 2WPXA 3R9FA 3D7HA 4NXYA 4ZYQA 2Q4YA 2R8VA 4B5PA 3R9GA 3WC6A 5CNPA 1S60A 4H6ZA 3RZAA 1XF8A 1SQHA 2C1CA 2YNCC 4M3SA 4KOTA 4A30A 3R96A 4CAEA 1R57A 1BPMA 4NGSA 2JEWA 4EWTA 1R3NA 2DXQA 2QMLA 2B3VA 4R87A 4KOYA 4M85A 4X2TA 3PGPA 4M6GA 4L89A 3FECA 2ATRA 2CIJA 4H89A 4UEEA 1JWQA 3FF3A 3KL9A 4NJQA 3BI1A 2ZEEA 2EWBA 8CPAA 2ZEMA 2ZEHA 3VWEA 3IEHA 1VGYA 5G21A 1IOFA 2BSWA 4PSWA 4R7MA 2Z3LA 1I1DA 3KHXA 4KLVA 1YX0A 4MFZA 3BI0A 1CP7A 3IWGA 5K8MA 1MK4A 2Q04A 4OMEA 4R3LA 4AB7A 3R1KA 2QYVA 3GLJA 4PQAA 5HVGA 3D4UA 3BJ8A 5HMNA 5LYFA 1ELMP 3NFZA 4X8IA 3TOBA 3GUXA 4AG7A 3QAHA 4A94A 2ZELA 4MI4A 4ZY2A 1LAMA 2ZXVA 2EK9A 3D67A 2B4BA 3F0AA 4R57A 4HKFA 3EO4A 3V8IA 4DNCA 4JXQA 3IFEA 2JLMA 3HUVA 3KZWA 1IU8A 1LRZA 2B4DB 2WPWA 4L8AA 2DPSA 2D4PA 4XNHB 2GFQA 1A2ZA 3FYNA 3DGVA 4QB9A 2GE3A 2C6CA 2FCKA 3WC7A 2BEIA 4RS2A 1Q2CA 3FEEA 4FD7A 1Z4EA 1KWMA 5EBVA 2OOTA 4DUKA 5F49A 1AMPA 3BXMA 5JQ4A 1R43A 5IB0A 1YK3A 1RO5A 2C6PA 2R98A 1NSAA 4NF1A 4QVTA 1ZLIA 4U9ZA 4M6HA 2Q4VA 1QMUA 2JDCA 2VXKA 2BOAA 1P0HA 4UEFA 4OKOA 2Q7SA 4DYOA 3PB9X 1LFWA 2AJ6A 2AFOA 2PCUA 1KUXA 2Y0MA 4FAIA 4DJLA 3FBUA 4R6TA 2RB7A 2GLJA 2IJZA 2HQYA 3SJFA 5AG5A 2ANPA 3FX6A 4TWEA 2B5GA 1M4LA 1VHEA 4KOXA 5EC4A 4F0XA 1HDUA 3PB7X 2Q51A 2IL4A 1WWZA 3FIXA 2PJ8A 4KUAA 4JXRA 4MHYA 1CBXA 4UCNA 4NGPA 4IK2A 2AFSA 1IYKA 2I3CA 4UWJA 4R76A 1Q7LA 4G1PA 1Y9KA 5J8CA 1NMTA 1HDQA 3FXTA 1ARMA 3LWUA 4OP4A 2PIYA 2PIZA 2Q44A 1CJWA 7CPAA 4MFLA 1MJBA 3SI2A 3BLNA 1J4JA 2PC1A 2ABZA 4A2ZA 1M4IA 3B3VA 4P10A 2PJ3A 3B3TA 3D7FA 4PXCA 3S9NA 3QB8A 1CM0A 3LMSA 2C6GA 2YNEA 1ZO0A 1UFHA 2RFHA 4CGPA 4CGLA 3IU2A 1PUAA 2VL1A 4MFQA 3F5BA 2GLFA 2Z3OA 1BAVA 1PCAA 1S5KA 2YNDA 3D8PA 4KORA 4CYPA 1QSTA 2C27A 3V38A 5LRKA 3FEDA 1L0CA 3D7GA 3KGQA 4XNHC 3GYAA 2ODFA 3GIUA 4NFRA 1CG2A 4YRHA 4NGMA 4MCSA 4U9YA 2GREA 3JVNA 5DS0A 1ARLA 5E96A 2A4NA 4F6AA 2QIRA 4CAXA 4RUHA 1WK4A 2AFXA 5ELYA 4C2ZA 3VARA 2P0WA 1LCPA 4CGMA 3WC5A 2NSMA 5CPAA 4CAFA 1OBRA 4Q7AA 4JJXA 1Z8WA 2OB0A 2Q43A 2ZW5A 4ZGYB 5KTAA 2QECA 2REFA 2G3TA 1KUVA 2H5MA 1MJ9A 4A33A 2YGWA 3I1UA 3PEIA 4I49A 4F9VA 1MJAA 2WUUA 3B8GA 4U5YA 3RYOA 2O28A 2Z3MA 4AXVA 3TO7A 2ZW7A 5EMIA 3W6SA 2V8GA 4EFDA 1M44A 3SI0A 3C26A 5G20A 4PSXA 1AYEA 2VEZA 1M1DA 2NYQA 5H84A 4B10A 4CYQA 1I12A 4KSIA 1H8LA 2CTCA 4YGOA 3PBBA 4YWYA 1YGHA 4XPLA 4MMOA 3GKRA 2PJ4A 4H2KA 3TO6A 3T8WA 2PJ7A 4OC2A 2Z3PA 1YW4A 4ZY0A 4B13A 4WWVA 2OH1A 4YFJA 2VI7A 5F47A 2QJ8A 4P4DA 2PJ6A 4OC4A 5AGEA 4GS4A 4ONUA 2Z10A 3IGRA 4CAWA 2CNMA 2Z3NA 4QUSA 4Y49B 5BWAB 1YMEA 5I0CA 4YU9A 2PVWA 4CPAA 4RN7A 3R95A 2GANA 1YLOA 3G8WA 3CPAA 3H5ZA 1IY7A 4K3NA 5K8NA 3H8EA 4JLYA 4UIBA 5G22A 3TX8A 1XFOA 1N71A 2B4DA 3ISXA 3WT4A 2FS5A 2HB6A 2PR1A 4WJBA 3B3WA 1IIDA 4RI1A 2AFZA 2VZYA 2VQYA 5AG7A 3B2YA 4ZBGA 4ORFA 3IWEA 1Y7RA 3JRUA 2JBKA 2WSAA 4MY0A 4IF5A 3DR8A 5JH9A 4OIDA 4OC3A 2POKA 3LACA 5F48A 5THWA 4C2XA 3DDDA 3PBEA 3CPXA 4KOUA 4KVOE 4UA3A 1Y0YA 4JWPA 4ZX8A 3SI1A 3TTHA 1RTQA 3B3SA 4B5OA 1PYTB 2PQ8A 2BO9A 2ZEPA 2ZEGA 2FT0A 3BHXA 2V8VA 2D4OA 2Q0YA 2RC4A 2XEJA 2FXFA 1IB1E 3CXSA 1I21A 4B14A 4H6UA 4BD9A 1TF9A 4TNUA 1YVKA 1Z4RA 3RNZA 4MFJA 4A39A 2I00A 2OZUA 4LX9A 4AG9A 2J8MA 1AUGA 3S6HA 4OAEA 2P6EA 1M4DA 1BPNA 4GM5A 3VH9A 3W6XA 4AVCA 3KQZA 4C68A 4EMEA 4MHDA 3F8KA 4P4FA 2EUIA 1K4JA 2PE3A 4F0YA 4CRYB 2B58A 3N5FA 1DTDA 4Y49C 1P4NA 2PJ9A 4MHNA 4A32A 4UBRA 4UIAA 2GU2A 4A37A 2R1IA 5LYDA 5IX3A 2PSWA 2ARHA 1Z8TA 4MXUA 5KTCA 5AG6A 1YSJA 4B12A 1ON0A 5C88A 2G0BA 3PFOA 1S3ZA 1TIQA 2G9DA 3B7IA 1BLLE 2AFWA 1IICA 5HH1A 4OIWA 5ISVA 4OC1A 4LQGA 2X7BA 3TFYA 4CGOA 1VKCA 2P6GA 2FSRA 5LYIA 2REEA 3TO9A 3W91A 3D3SA 1GHEA 3CXQA 2P6FA 4A38A 4A31A 2CY2A 2VBQA 3NH8A 4KS9A 3KHZA 3SXNA 1PU9A 2Q4ZA 4BMHA 2PVVA 1CPXA 1B87A 4CRZB 5A27A 4IHMA 4OC0A 4QC6A 5J1QA 4NGQA 4ZY1A 1GYTA 2PJ0A 5JM6A 5A28A 4LUAA 1CP6A 1TKHA 2B3UA 2PJ2A 3NA6A 2IQ6A 1NSLA 3S6GA 3VATA 2FVGA 3DLJA 3V7ZA 4LQ6A 4PXBA 3RAMA 3RO0A 1F2OA 4NGNA 4XPKA 4KOWA 1FY7A 1BOBA 1KUYA 1LANA 4PXDA 2PJ5A 3S6KA 3H8FA 3G3SA 3LD2A 5H86A 4MFPA 4E8OA 1YQEA 4R9MA 2Q7BA 3D2MA 1BO4A 2DF5A 2GIVA 5K8PA 1FT7A 3R9EA 4ZX9A 1DE4C 1XRYA 2V8DA 3H8GA 3LODA 3FH4A 5LYLA 3S9LA 3ZJ0A 3IWWA 4X3RA 3SJGA 4E0AA 4UCMA 4P45A 5K8OA 2G3AA 1S7KA 2EVNA 3WABA 2V8HA 4K30A 2ZENA 3P2FA 3P2HA 2JEVA 5D29A 4C7IA 3PB4X 4Q36A 4P4BA 1NE9A 2ZEFA 4KUBA 4JD6A 4UFXA 3VWDA 4NGRA 4CYNA 4P4IA 3DSBA 3K9TA 3I9SA 4MCPA 4Q38A 4E2AA 2ZEDA 2BUEA 1Z8LA 3CT9A 4PPZA 2ZPAA 1JQGA 2EO8A 2J8RA 1F2PA 2PR8A 4OC5A 3SHPA 4CGNA 2QVPA 3PP9A 4KOSA 3JTKA 2PDOA 2ZOFA 1U6MA 2XEGA 4JYWA 2OZHA 4UFVA 4CS0B 4KSFA 3GB0A 2I79A 3TCVA 5HVFA 4HNXB 3DR6A 4MBUA 4PK3A 3PB8X 4OLLA 2O4HA 3KQXA 2R7HA 1B6BA 1ZG7A 3PFEA 2WYRA 1VHOA 1QSOA 4UF4A 4UCPA 2DPTA 4HNWB 1QSMA 4XPDB 1F57A 1ZLHA 3I3GA 4B5PB 4BINA 3IU1A 1Z9UA 4KSAA 4PV6A 3D68A 2CTBA 1QSNA 3A9LA 3IC1A 4NCZA 4FWUA 3DNSA 3FJUA 1XEBA 3N7ZA 5C82A 6CPAA 3KASA 5KTDA 3EFAA 3S6FA 2OR4A 5LRJA 4KVME 1XMBA 3GY9A 3OWCA 1M4GA 1VHSA 2PJBA 3BJ7A 3HLPA 3L2NA 5JGFA 1TF8A 4F8ZA 1S7FA 2PRBA 1XOVA 5I4MA 1YLEA 4KVXA 1ZG9A 1Z2LA 2JDDA 1IOIA 3PB6X 5JPHA 4P44A 4MY3A 3CDXA 4R8FA 1OZPA 4KOVA 4MJ8A 3RBUA 4FD4A 2ZW4A 3PZJA 3D66A 4CYOA 1LAPA 1TKFA 2CNTA 4QBJA 1ELLP 3NH4A 5AG4A 5CBMA 2FIWA 1XJOA 2WZNA 3FVLA 3JUWA 4GXHA 4NGTA 3EXNA 5HXDA 2J8NA 2CF4A 5IB9A 4M6IA 3IIBA 3CXPA 5F46A 4C2YA 5F09A 3MRUA 4UEZA 3NH5A 3EC4A 3ISZA 1IYLA 1IGBA 4P6YA 4MCRA 3ZZIA 3TT2A 3IJ3A 4J3GA 4R3KA 1X10A 3TC8A 4II9A 4FUUA 2BCOA 1X12A 1Y9WA 2EK8A 3EY5A 5GCNA 2F8HA 3WR7A 1CX8A 1YREA 4FBEA 1TKJA 1TXRA 4ONWA 1EE3P 2Z0ZA 4X5KA 2YNCA 4A95A 4AVBA 3CZXA 2PJ1A 3IO1A 2JBJA 2ZOGA 2O53A 2NMTA 4XPDC 2OU2A 4JZ0A 4PXEA 1Y7EA 2FIAA 2EBJA 2Z3KA 1HEEA 2VZZA 4OADA 5D8NA 1S7NA 1S7LA 2J9AA 1QQ9A 3FNCA 3B3CA 3SJXA 4FD6A 1QSRA 4MFKA 2ZW6A 3UY5A 2FE7A 3NE7A 2Z11A 1VIXA 1KZFA 3SXOA 1XBUA 3FB3A 3TE4A 3KKWA 2B5GB 1Z8XA 2K5TA 3H4QA 4MHPA 1Y0RA 1XE4A 3K2KA 4NEXA 3D7DA 4ZI6A 4MHZA 3B35A 5FVJA 3QAYA 3NE8A 5G1ZA 4HNYB 5J8FA 2PJCA 3FMCA 3T90A 1Q2DA 4KLWA 3S9MA 1CPSA 1XIXA 1YVOA 2CNSA 5DWNA 2CXAA 1Z5RA 1V0CA 2AFMA 2F5IA 3D2PA 4HPSA 4F9UA 4CAVA 2XEIA 4NSQA 4FD5A 4EVYA 1UWYA 4IUSA 2KCWA 4UWIA 2OZGA 1LOKA
chains in the Genus database with same CATH topology
2HUZA 3E0KA 4AVAA 5DWMA 4BBHA 3MGDA 1XMTA 2AE6A 2FL4A 3TOAA 1YR0A 4UFWA 4KZTA 4B11A 4C7HA 4PK2A 1RXTA 3T9YA 5IV0A 2HV2A 2BL1A 3K9UA 1Q2YA 3FRMA 2WPXA 3R9FA 4NXYA 2Q4YA 2R8VA 4B5PA 3R9GA 5CNPA 1S60A 4H6ZA 1XF8A 1SQHA 2YNCC 4M3SA 4KOTA 4A30A 3R96A 4CAEA 1R57A 2DXQA 2QMLA 2B3VA 4R87A 4KOYA 4M85A 3PGPA 4L89A 2ATRA 4H89A 3VWEA 5G21A 2BSWA 4PSWA 2Z3LA 1I1DA 4KLVA 1YX0A 4MFZA 3IWGA 1MK4A 2Q04A 4R3LA 4AB7A 3R1KA 3BJ8A 5HMNA 3TOBA 4AG7A 3QAHA 4MI4A 2ZXVA 4R57A 4DNCA 2B4BA 3F0AA 4HKFA 3EO4A 3V8IA 4JXQA 2JLMA 1LRZA 2B4DB 2WPWA 4L8AA 2DPSA 2D4PA 4XNHB 3FYNA 4QB9A 2GE3A 2FCKA 2BEIA 4RS2A 1Q2CA 4FD7A 1Z4EA 5EBVA 5F49A 5JQ4A 5IB0A 1YK3A 1RO5A 2R98A 4NF1A 4QVTA 4U9ZA 2Q4VA 2VXKA 2JDCA 1P0HA 2AJ6A 1KUXA 2Y0MA 3FBUA 2HQYA 5AG5A 2B5GA 4KOXA 5EC4A 4F0XA 2IL4A 1WWZA 3FIXA 4KUAA 4JXRA 4UCNA 1IYKA 4UWJA 1Y9KA 5J8CA 1NMTA 3FXTA 2Q44A 1CJWA 4MFLA 1MJBA 3BLNA 1J4JA 2PC1A 4A2ZA 1M4IA 3QB8A 1CM0A 2YNEA 1ZO0A 1UFHA 4CGPA 4CGLA 3IU2A 1PUAA 4MFQA 3F5BA 2Z3OA 2YNDA 1S5KA 3D8PA 4KORA 4CYPA 1QSTA 2C27A 1L0CA 4XNHC 3GYAA 4YRHA 4U9YA 3JVNA 4F6AA 5E96A 2A4NA 2QIRA 4CAXA 1WK4A 4C2ZA 2P0WA 4CGMA 4CAFA 4JJXA 4ZGYB 2OB0A 2ZW5A 5KTAA 2QECA 2REFA 2G3TA 1KUVA 2H5MA 1MJ9A 4A33A 2YGWA 4I49A 1MJAA 2WUUA 3B8GA 4U5YA 3RYOA 2O28A 2Z3MA 3TO7A 2ZW7A 3W6SA 1M44A 3C26A 5G20A 4PSXA 2VEZA 1M1DA 5H84A 4B10A 4CYQA 1I12A 4YGOA 1YGHA 4XPLA 3GKRA 3TO6A 2Z3PA 4B13A 4YFJA 2OH1A 2VI7A 5F47A 5AGEA 4GS4A 4ONUA 2Z10A 3IGRA 4CAWA 2CNMA 2Z3NA 4QUSA 4Y49B 5BWAB 5I0CA 3R95A 2GANA 3H5ZA 3G8WA 4JLYA 5G22A 1N71A 2B4DA 2FS5A 2PR1A 1IIDA 4RI1A 2VZYA 2VQYA 5AG7A 4ZBGA 4ORFA 3IWEA 1Y7RA 2WSAA 4MY0A 4IF5A 3DR8A 5F48A 4C2XA 3DDDA 4KOUA 4KVOE 4UA3A 4JWPA 3TTHA 4B5OA 2PQ8A 2FT0A 2D4OA 2Q0YA 2RC4A 2FXFA 1IB1E 3CXSA 1I21A 4B14A 4H6UA 1YVKA 1Z4RA 4MFJA 2I00A 2OZUA 4LX9A 4AG9A 2J8MA 3S6HA 4OAEA 2P6EA 1M4DA 3W6XA 4AVCA 4C68A 4MHDA 3F8KA 2EUIA 1K4JA 4F0YA 4CRYB 2B58A 4Y49C 1P4NA 4A32A 4UBRA 2R1IA 5IX3A 2PSWA 2ARHA 5KTCA 5AG6A 4B12A 1ON0A 5C88A 2G0BA 1S3ZA 1TIQA 1IICA 5HH1A 5ISVA 2X7BA 3TFYA 4CGOA 1VKCA 2P6GA 2FSRA 3TO9A 2REEA 3W91A 3D3SA 1GHEA 3CXQA 2P6FA 4A31A 2CY2A 2VBQA 3SXNA 4KS9A 1PU9A 4BMHA 1B87A 4CRZB 5A27A 4QC6A 5A28A 4LUAA 1NSLA 2B3UA 3S6GA 4XPKA 4KOWA 1FY7A 1BOBA 1KUYA 3S6KA 3G3SA 3LD2A 5H86A 4MFPA 4E8OA 4R9MA 2Q7BA 3D2MA 1BO4A 2GIVA 3R9EA 3LODA 3ZJ0A 4E0AA 4UCMA 2G3AA 1S7KA 2EVNA 4K30A 3P2FA 3P2HA 2JEVA 4C7IA 4Q36A 1NE9A 4KUBA 4UFXA 4JD6A 3VWDA 4CYNA 3DSBA 3I9SA 4E2AA 4Q38A 2BUEA 2ZPAA 2J8RA 2PR8A 4CGNA 3SHPA 3PP9A 4KOSA 3JTKA 2PDOA 1U6MA 4CS0B 2OZHA 4UFVA 4KSFA 2I79A 3TCVA 4HNXB 3DR6A 4MBUA 4PK3A 4OLLA 2R7HA 1B6BA 1QSOA 4UCPA 2DPTA 4HNWB 1QSMA 4XPDB 3I3GA 4B5PB 3IU1A 1Z9UA 4KSAA 4PV6A 1QSNA 3A9LA 4NCZA 3DNSA 1XEBA 3N7ZA 5C82A 5KTDA 3EFAA 3S6FA 4KVME 3GY9A 3OWCA 1M4GA 1VHSA 3BJ7A 1S7FA 2PRBA 1YLEA 4KVXA 2JDDA 5JPHA 4MY3A 1OZPA 4KOVA 4MJ8A 4FD4A 2ZW4A 3PZJA 4CYOA 2CNTA 4QBJA 5AG4A 2FIWA 3JUWA 3EXNA 2J8NA 3CXPA 5F46A 4C2YA 3EC4A 1IYLA 3ZZIA 3TT2A 4J3GA 4R3KA 4II9A 1Y9WA 3EY5A 5GCNA 3WR7A 1YREA 2Z0ZA 4X5KA 2YNCA 4A95A 4AVBA 2NMTA 4XPDC 2OU2A 2FIAA 2Z3KA 2VZZA 4OADA 1S7NA 1S7LA 3FNCA 4FD6A 1QSRA 4MFKA 2ZW6A 3UY5A 2FE7A 3NE7A 2Z11A 3SXOA 1KZFA 3FB3A 3TE4A 3KKWA 2B5GB 2K5TA 3H4QA 1XE4A 4NEXA 5FVJA 5G1ZA 4HNYB 5J8FA 3T90A 1Q2DA 4KLWA 1XIXA 1YVOA 2CNSA 5DWNA 2CXAA 1V0CA 3D2PA 2F5IA 4CAVA 4NSQA 4FD5A 4EVYA 4IUSA 2KCWA 4UWIA 2OZGA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2HUZ A;  3E0K A;  4AVA A;  5DWM A;  3MGD A;  1XMT A;  2AE6 A;  2FL4 A;  3TOA A;  1YR0 A;  4KZT A;  4PK2 A;  1RXT A;  3T9Y A;  5IV0 A;  2HV2 A;  2BL1 A;  3K9U A;  1Q2Y A;  3FRM A;  2WPX A;  3R9F A;  4NXY A;  2Q4Y A;  2R8V A;  4B5P A;  3R9G A;  5CNP A;  1S60 A;  4H6Z A;  1XF8 A;  1SQH A;  4M3S A;  4KOT A;  3R96 A;  1R57 A;  2DXQ A;  2QML A;  2B3V A;  4R87 A;  4KOY A;  4M85 A;  3PGP A;  4L89 A;  2ATR A;  4H89 A;  3VWE A;  2BSW A;  4PSW A;  1I1D A;  4KLV A;  1YX0 A;  3IWG A;  1MK4 A;  2Q04 A;  4R3L A;  4AB7 A;  3R1K A;  3BJ8 A;  5HMN A;  3TOB A;  4AG7 A;  3QAH A;  4MI4 A;  2ZXV A;  4R57 A;  4DNC A;  2B4B A;  3F0A A;  4HKF A;  3EO4 A;  3V8I A;  4JXQ A;  2JLM A;  1LRZ A;  4L8A A;  2B4D B;  2WPW A;  4XNH B;  2D4P A;  3FYN A;  4QB9 A;  2GE3 A;  2FCK A;  2BEI A;  4RS2 A;  1Q2C A;  4FD7 A;  1Z4E A;  5EBV A;  5F49 A;  5JQ4 A;  5IB0 A;  1YK3 A;  1RO5 A;  2R98 A;  4NF1 A;  4QVT A;  4U9Z A;  2Q4V A;  2VXK A;  2JDC A;  1P0H A;  2AJ6 A;  1KUX A;  2Y0M A;  3FBU A;  2HQY A;  2B5G A;  4KOX A;  5EC4 A;  2IL4 A;  1WWZ A;  3FIX A;  4KUA A;  4JXR A;  1IYK A;  4UWJ A;  1Y9K A;  5J8C A;  1NMT A;  3FXT A;  2Q44 A;  1CJW A;  1MJB A;  3BLN A;  1J4J A;  2PC1 A;  1M4I A;  3QB8 A;  1CM0 A;  1UFH A;  1PUA A;  3F5B A;  4KOR A;  1S5K A;  3D8P A;  1QST A;  2C27 A;  1L0C A;  4XNH C;  3GYA A;  4YRH A;  4U9Y A;  3JVN A;  4F6A A;  5E96 A;  2A4N A;  2QIR A;  4CAX A;  1WK4 A;  2P0W A;  4JJX A;  5KTA A;  2OB0 A;  2ZW5 A;  2QEC A;  2REF A;  2G3T A;  1KUV A;  2H5M A;  1MJ9 A;  4I49 A;  1MJA A;  3B8G A;  4U5Y A;  3RYO A;  2O28 A;  3TO7 A;  2ZW7 A;  3W6S A;  1M44 A;  3C26 A;  4PSX A;  2VEZ A;  1M1D A;  5H84 A;  1I12 A;  4YGO A;  1YGH A;  4XPL A;  3GKR A;  3TO6 A;  4YFJ A;  2OH1 A;  2VI7 A;  5F47 A;  4GS4 A;  4ONU A;  2Z10 A;  3IGR A;  4CAW A;  2CNM A;  4QUS A;  4Y49 B;  5I0C A;  3R95 A;  2GAN A;  3G8W A;  4JLY A;  1N71 A;  2B4D A;  2FS5 A;  2PR1 A;  1IID A;  4RI1 A;  2VZY A;  2VQY A;  4ZBG A;  4ORF A;  1Y7R A;  4MY0 A;  4IF5 A;  3DR8 A;  5F48 A;  3DDD A;  4KOU A;  4KVO E;  4UA3 A;  4JWP A;  3TTH A;  4B5O A;  2PQ8 A;  2FT0 A;  2D4O A;  2Q0Y A;  2RC4 A;  2FXF A;  1IB1 E;  3CXS A;  1I21 A;  4H6U A;  1YVK A;  1Z4R A;  2I00 A;  2OZU A;  4LX9 A;  4AG9 A;  2J8M A;  3S6H A;  4OAE A;  2P6E A;  1M4D A;  3W6X A;  4AVC A;  4MHD A;  3F8K A;  2EUI A;  1K4J A;  4F0Y A;  4CRY B;  2B58 A;  4Y49 C;  1P4N A;  4UBR A;  2R1I A;  5IX3 A;  2PSW A;  2ARH A;  5KTC A;  1ON0 A;  5C88 A;  2G0B A;  1S3Z A;  1TIQ A;  1IIC A;  5HH1 A;  5ISV A;  2X7B A;  3TFY A;  1VKC A;  2P6G A;  2FSR A;  3TO9 A;  2REE A;  3W91 A;  3D3S A;  1GHE A;  3CXQ A;  2P6F A;  2CY2 A;  2VBQ A;  3SXN A;  1PU9 A;  4BMH A;  1B87 A;  4CRZ B;  4QC6 A;  4LUA A;  1NSL A;  2B3U A;  3S6G A;  4XPK A;  4KOW A;  1FY7 A;  1BOB A;  1KUY A;  3S6K A;  3G3S A;  3LD2 A;  5H86 A;  4E8O A;  4R9M A;  2Q7B A;  3D2M A;  1BO4 A;  2GIV A;  3R9E A;  3LOD A;  3ZJ0 A;  4E0A A;  2G3A A;  1S7K A;  2EVN A;  4K30 A;  3P2F A;  3P2H A;  2JEV A;  1NE9 A;  4KUB A;  4JD6 A;  3VWD A;  3DSB A;  3I9S A;  4E2A A;  2BUE A;  2ZPA A;  2J8R A;  2PR8 A;  3SHP A;  3PP9 A;  4KOS A;  2PDO A;  1U6M A;  4CS0 B;  2OZH A;  2I79 A;  3TCV A;  4HNX B;  3DR6 A;  4MBU A;  4PK3 A;  4OLL A;  2R7H A;  1B6B A;  1QSO A;  4HNW B;  1QSM A;  4XPD B;  3I3G A;  4B5P B;  1Z9U A;  4PV6 A;  1QSN A;  4NCZ A;  3DNS A;  1XEB A;  3N7Z A;  5C82 A;  5KTD A;  3EFA A;  3S6F A;  4KVM E;  3GY9 A;  3OWC A;  1M4G A;  1VHS A;  3BJ7 A;  1S7F A;  2PRB A;  1YLE A;  4KVX A;  2JDD A;  5JPH A;  4MY3 A;  1OZP A;  4KOV A;  4MJ8 A;  4FD4 A;  2ZW4 A;  3PZJ A;  2CNT A;  4QBJ A;  2FIW A;  3JUW A;  3EXN A;  2J8N A;  3CXP A;  5F46 A;  3EC4 A;  1IYL A;  3ZZI A;  3TT2 A;  4J3G A;  4R3K A;  4II9 A;  1Y9W A;  3EY5 A;  5GCN A;  3WR7 A;  1YRE A;  2Z0Z A;  4X5K A;  4AVB A;  2NMT A;  4XPD C;  2OU2 A;  2FIA A;  2VZZ A;  4OAD A;  1S7N A;  1S7L A;  3FNC A;  4FD6 A;  1QSR A;  3UY5 A;  2ZW6 A;  2FE7 A;  3NE7 A;  2Z11 A;  3SXO A;  1KZF A;  3FB3 A;  3TE4 A;  3KKW A;  2B5G B;  2K5T A;  3H4Q A;  1XE4 A;  4NEX A;  5FVJ A;  4HNY B;  5J8F A;  3T90 A;  1Q2D A;  4KLW A;  1XIX A;  1YVO A;  2CNS A;  5DWN A;  1V0C A;  3D2P A;  2F5I A;  4CAV A;  4NSQ A;  4FD5 A;  4EVY A;  4IUS A;  2KCW A;  4UWI A;  2OZG A; 
#chains in the Genus database with same CATH topology
 2IMO A;  2HUZ A;  3E0K A;  4AVA A;  5DWM A;  3SJE A;  3MGD A;  4B6Z A;  4BBH A;  3KR5 A;  2AFU A;  2PJA A;  1XMT A;  2PRQ A;  4MCQ A;  2AE6 A;  5HVH A;  3KR4 A;  2FL4 A;  2DEA A;  2HC9 A;  3TOA A;  1YR0 A;  3QNV A;  4UFW A;  2F7V A;  4O23 A;  5LRG A;  4KZT A;  4MRI A;  2V77 A;  4B11 A;  4P4J A;  4IAV A;  4C7H A;  4PK2 A;  1ZG8 A;  1RXT A;  3MN8 A;  3T9Y A;  5IV0 A;  2HV2 A;  3PRT A;  4Z65 A;  2BL1 A;  2ZEO A;  1FNO A;  4W9Y A;  1YW6 A;  3K9U A;  3KI9 A;  4P4E A;  1Q2Y A;  2XEF A;  3FRM A;  4NJR A;  2WPX A;  3R9F A;  3D7H A;  4NXY A;  4ZYQ A;  2Q4Y A;  2R8V A;  4B5P A;  3R9G A;  3WC6 A;  5CNP A;  1S60 A;  4H6Z A;  3RZA A;  1XF8 A;  1SQH A;  2C1C A;  2YNC C;  4M3S A;  4KOT A;  4A30 A;  3R96 A;  4CAE A;  1R57 A;  1BPM A;  4NGS A;  2JEW A;  4EWT A;  1R3N A;  2DXQ A;  2QML A;  2B3V A;  4R87 A;  4KOY A;  4M85 A;  4X2T A;  3PGP A;  4M6G A;  4L89 A;  3FEC A;  2ATR A;  2CIJ A;  4H89 A;  4UEE A;  1JWQ A;  3FF3 A;  3KL9 A;  4NJQ A;  3BI1 A;  2ZEE A;  2EWB A;  8CPA A;  2ZEM A;  2ZEH A;  3VWE A;  3IEH A;  1VGY A;  5G21 A;  1IOF A;  2BSW A;  4PSW A;  4R7M A;  2Z3L A;  1I1D A;  3KHX A;  4KLV A;  1YX0 A;  4MFZ A;  3BI0 A;  1CP7 A;  3IWG A;  5K8M A;  1MK4 A;  2Q04 A;  4OME A;  4R3L A;  4AB7 A;  3R1K A;  2QYV A;  3GLJ A;  4PQA A;  5HVG A;  3D4U A;  3BJ8 A;  5HMN A;  5LYF A;  1ELM P;  3NFZ A;  4X8I A;  3TOB A;  3GUX A;  4AG7 A;  3QAH A;  4A94 A;  2ZEL A;  4MI4 A;  4ZY2 A;  1LAM A;  2ZXV A;  2EK9 A;  3D67 A;  2B4B A;  3F0A A;  4R57 A;  4HKF A;  3EO4 A;  3V8I A;  4DNC A;  4JXQ A;  3IFE A;  2JLM A;  3HUV A;  3KZW A;  1IU8 A;  1LRZ A;  2B4D B;  2WPW A;  4L8A A;  2DPS A;  2D4P A;  4XNH B;  2GFQ A;  1A2Z A;  3FYN A;  3DGV A;  4QB9 A;  2GE3 A;  2C6C A;  2FCK A;  3WC7 A;  2BEI A;  4RS2 A;  1Q2C A;  3FEE A;  4FD7 A;  1Z4E A;  1KWM A;  5EBV A;  2OOT A;  4DUK A;  5F49 A;  1AMP A;  3BXM A;  5JQ4 A;  1R43 A;  5IB0 A;  1YK3 A;  1RO5 A;  2C6P A;  2R98 A;  1NSA A;  4NF1 A;  4QVT A;  1ZLI A;  4U9Z A;  4M6H A;  2Q4V A;  1QMU A;  2JDC A;  2VXK A;  2BOA A;  1P0H A;  4UEF A;  4OKO A;  2Q7S A;  4DYO A;  3PB9 X;  1LFW A;  2AJ6 A;  2AFO A;  2PCU A;  1KUX A;  2Y0M A;  4FAI A;  4DJL A;  3FBU A;  4R6T A;  2RB7 A;  2GLJ A;  2IJZ A;  2HQY A;  3SJF A;  5AG5 A;  2ANP A;  3FX6 A;  4TWE A;  2B5G A;  1M4L A;  1VHE A;  4KOX A;  5EC4 A;  4F0X A;  1HDU A;  3PB7 X;  2Q51 A;  2IL4 A;  1WWZ A;  3FIX A;  2PJ8 A;  4KUA A;  4JXR A;  4MHY A;  1CBX A;  4UCN A;  4NGP A;  4IK2 A;  2AFS A;  1IYK A;  2I3C A;  4UWJ A;  4R76 A;  1Q7L A;  4G1P A;  1Y9K A;  5J8C A;  1NMT A;  1HDQ A;  3FXT A;  1ARM A;  3LWU A;  4OP4 A;  2PIY A;  2PIZ A;  2Q44 A;  1CJW A;  7CPA A;  4MFL A;  1MJB A;  3SI2 A;  3BLN A;  1J4J A;  2PC1 A;  2ABZ A;  4A2Z A;  1M4I A;  3B3V A;  4P10 A;  2PJ3 A;  3B3T A;  3D7F A;  4PXC A;  3S9N A;  3QB8 A;  1CM0 A;  3LMS A;  2C6G A;  2YNE A;  1ZO0 A;  1UFH A;  2RFH A;  4CGP A;  4CGL A;  3IU2 A;  1PUA A;  2VL1 A;  4MFQ A;  3F5B A;  2GLF A;  2Z3O A;  1BAV A;  1PCA A;  1S5K A;  2YND A;  3D8P A;  4KOR A;  4CYP A;  1QST A;  2C27 A;  3V38 A;  5LRK A;  3FED A;  1L0C A;  3D7G A;  3KGQ A;  4XNH C;  3GYA A;  2ODF A;  3GIU A;  4NFR A;  1CG2 A;  4YRH A;  4NGM A;  4MCS A;  4U9Y A;  2GRE A;  3JVN A;  5DS0 A;  1ARL A;  5E96 A;  2A4N A;  4F6A A;  2QIR A;  4CAX A;  4RUH A;  1WK4 A;  2AFX A;  5ELY A;  4C2Z A;  3VAR A;  2P0W A;  1LCP A;  4CGM A;  3WC5 A;  2NSM A;  5CPA A;  4CAF A;  1OBR A;  4Q7A A;  4JJX A;  1Z8W A;  2OB0 A;  2Q43 A;  2ZW5 A;  4ZGY B;  5KTA A;  2QEC A;  2REF A;  2G3T A;  1KUV A;  2H5M A;  1MJ9 A;  4A33 A;  2YGW A;  3I1U A;  3PEI A;  4I49 A;  4F9V A;  1MJA A;  2WUU A;  3B8G A;  4U5Y A;  3RYO A;  2O28 A;  2Z3M A;  4AXV A;  3TO7 A;  2ZW7 A;  5EMI A;  3W6S A;  2V8G A;  4EFD A;  1M44 A;  3SI0 A;  3C26 A;  5G20 A;  4PSX A;  1AYE A;  2VEZ A;  1M1D A;  2NYQ A;  5H84 A;  4B10 A;  4CYQ A;  1I12 A;  4KSI A;  1H8L A;  2CTC A;  4YGO A;  3PBB A;  4YWY A;  1YGH A;  4XPL A;  4MMO A;  3GKR A;  2PJ4 A;  4H2K A;  3TO6 A;  3T8W A;  2PJ7 A;  4OC2 A;  2Z3P A;  1YW4 A;  4ZY0 A;  4B13 A;  4WWV A;  2OH1 A;  4YFJ A;  2VI7 A;  5F47 A;  2QJ8 A;  4P4D A;  2PJ6 A;  4OC4 A;  5AGE A;  4GS4 A;  4ONU A;  2Z10 A;  3IGR A;  4CAW A;  2CNM A;  2Z3N A;  4QUS A;  4Y49 B;  5BWA B;  1YME A;  5I0C A;  4YU9 A;  2PVW A;  4CPA A;  4RN7 A;  3R95 A;  2GAN A;  1YLO A;  3G8W A;  3CPA A;  3H5Z A;  1IY7 A;  4K3N A;  5K8N A;  3H8E A;  4JLY A;  4UIB A;  5G22 A;  3TX8 A;  1XFO A;  1N71 A;  2B4D A;  3ISX A;  3WT4 A;  2FS5 A;  2HB6 A;  2PR1 A;  4WJB A;  3B3W A;  1IID A;  4RI1 A;  2AFZ A;  2VZY A;  2VQY A;  5AG7 A;  3B2Y A;  4ZBG A;  4ORF A;  3IWE A;  1Y7R A;  3JRU A;  2JBK A;  2WSA A;  4MY0 A;  4IF5 A;  3DR8 A;  5JH9 A;  4OID A;  4OC3 A;  2POK A;  3LAC A;  5F48 A;  5THW A;  4C2X A;  3DDD A;  3PBE A;  3CPX A;  4KOU A;  4KVO E;  4UA3 A;  1Y0Y A;  4JWP A;  4ZX8 A;  3SI1 A;  3TTH A;  1RTQ A;  3B3S A;  4B5O A;  1PYT B;  2PQ8 A;  2BO9 A;  2ZEP A;  2ZEG A;  2FT0 A;  3BHX A;  2V8V A;  2D4O A;  2Q0Y A;  2RC4 A;  2XEJ A;  2FXF A;  1IB1 E;  3CXS A;  1I21 A;  4B14 A;  4H6U A;  4BD9 A;  1TF9 A;  4TNU A;  1YVK A;  1Z4R A;  3RNZ A;  4MFJ A;  4A39 A;  2I00 A;  2OZU A;  4LX9 A;  4AG9 A;  2J8M A;  1AUG A;  3S6H A;  4OAE A;  2P6E A;  1M4D A;  1BPN A;  4GM5 A;  3VH9 A;  3W6X A;  4AVC A;  3KQZ A;  4C68 A;  4EME A;  4MHD A;  3F8K A;  4P4F A;  2EUI A;  1K4J A;  2PE3 A;  4F0Y A;  4CRY B;  2B58 A;  3N5F A;  1DTD A;  4Y49 C;  1P4N A;  2PJ9 A;  4MHN A;  4A32 A;  4UBR A;  4UIA A;  2GU2 A;  4A37 A;  2R1I A;  5LYD A;  5IX3 A;  2PSW A;  2ARH A;  1Z8T A;  4MXU A;  5KTC A;  5AG6 A;  1YSJ A;  4B12 A;  1ON0 A;  5C88 A;  2G0B A;  3PFO A;  1S3Z A;  1TIQ A;  2G9D A;  3B7I A;  1BLL E;  2AFW A;  1IIC A;  5HH1 A;  4OIW A;  5ISV A;  4OC1 A;  4LQG A;  2X7B A;  3TFY A;  4CGO A;  1VKC A;  2P6G A;  2FSR A;  5LYI A;  2REE A;  3TO9 A;  3W91 A;  3D3S A;  1GHE A;  3CXQ A;  2P6F A;  4A38 A;  4A31 A;  2CY2 A;  2VBQ A;  3NH8 A;  4KS9 A;  3KHZ A;  3SXN A;  1PU9 A;  2Q4Z A;  4BMH A;  2PVV A;  1CPX A;  1B87 A;  4CRZ B;  5A27 A;  4IHM A;  4OC0 A;  4QC6 A;  5J1Q A;  4NGQ A;  4ZY1 A;  1GYT A;  2PJ0 A;  5JM6 A;  5A28 A;  4LUA A;  1CP6 A;  1TKH A;  2B3U A;  2PJ2 A;  3NA6 A;  2IQ6 A;  1NSL A;  3S6G A;  3VAT A;  2FVG A;  3DLJ A;  3V7Z A;  4LQ6 A;  4PXB A;  3RAM A;  3RO0 A;  1F2O A;  4NGN A;  4XPK A;  4KOW A;  1FY7 A;  1BOB A;  1KUY A;  1LAN A;  4PXD A;  2PJ5 A;  3S6K A;  3H8F A;  3G3S A;  3LD2 A;  5H86 A;  4MFP A;  4E8O A;  1YQE A;  4R9M A;  2Q7B A;  3D2M A;  1BO4 A;  2DF5 A;  2GIV A;  5K8P A;  1FT7 A;  3R9E A;  4ZX9 A;  1DE4 C;  1XRY A;  2V8D A;  3H8G A;  3LOD A;  3FH4 A;  5LYL A;  3S9L A;  3ZJ0 A;  3IWW A;  4X3R A;  3SJG A;  4E0A A;  4UCM A;  4P45 A;  5K8O A;  2G3A A;  1S7K A;  2EVN A;  3WAB A;  2V8H A;  4K30 A;  2ZEN A;  3P2F A;  3P2H A;  2JEV A;  5D29 A;  4C7I A;  3PB4 X;  4Q36 A;  4P4B A;  1NE9 A;  2ZEF A;  4KUB A;  4JD6 A;  4UFX A;  3VWD A;  4NGR A;  4CYN A;  4P4I A;  3DSB A;  3K9T A;  3I9S A;  4MCP A;  4Q38 A;  4E2A A;  2ZED A;  2BUE A;  1Z8L A;  3CT9 A;  4PPZ A;  2ZPA A;  1JQG A;  2EO8 A;  2J8R A;  1F2P A;  2PR8 A;  4OC5 A;  3SHP A;  4CGN A;  2QVP A;  3PP9 A;  4KOS A;  3JTK A;  2PDO A;  2ZOF A;  1U6M A;  2XEG A;  4JYW A;  2OZH A;  4UFV A;  4CS0 B;  4KSF A;  3GB0 A;  2I79 A;  3TCV A;  5HVF A;  4HNX B;  3DR6 A;  4MBU A;  4PK3 A;  3PB8 X;  4OLL A;  2O4H A;  3KQX A;  2R7H A;  1B6B A;  1ZG7 A;  3PFE A;  2WYR A;  1VHO A;  1QSO A;  4UF4 A;  4UCP A;  2DPT A;  4HNW B;  1QSM A;  4XPD B;  1F57 A;  1ZLH A;  3I3G A;  4B5P B;  4BIN A;  3IU1 A;  1Z9U A;  4KSA A;  4PV6 A;  3D68 A;  2CTB A;  1QSN A;  3A9L A;  3IC1 A;  4NCZ A;  4FWU A;  3DNS A;  3FJU A;  1XEB A;  3N7Z A;  5C82 A;  6CPA A;  3KAS A;  5KTD A;  3EFA A;  3S6F A;  2OR4 A;  5LRJ A;  4KVM E;  1XMB A;  3GY9 A;  3OWC A;  1M4G A;  1VHS A;  2PJB A;  3BJ7 A;  3HLP A;  3L2N A;  5JGF A;  1TF8 A;  4F8Z A;  1S7F A;  2PRB A;  1XOV A;  5I4M A;  1YLE A;  4KVX A;  1ZG9 A;  1Z2L A;  2JDD A;  1IOI A;  3PB6 X;  5JPH A;  4P44 A;  4MY3 A;  3CDX A;  4R8F A;  1OZP A;  4KOV A;  4MJ8 A;  3RBU A;  4FD4 A;  2ZW4 A;  3PZJ A;  3D66 A;  4CYO A;  1LAP A;  1TKF A;  2CNT A;  4QBJ A;  1ELL P;  3NH4 A;  5AG4 A;  5CBM A;  2FIW A;  1XJO A;  2WZN A;  3FVL A;  3JUW A;  4GXH A;  4NGT A;  3EXN A;  5HXD A;  2J8N A;  2CF4 A;  5IB9 A;  4M6I A;  3IIB A;  3CXP A;  5F46 A;  4C2Y A;  5F09 A;  3MRU A;  4UEZ A;  3NH5 A;  3EC4 A;  3ISZ A;  1IYL A;  1IGB A;  4P6Y A;  4MCR A;  3ZZI A;  3TT2 A;  3IJ3 A;  4J3G A;  4R3K A;  1X10 A;  3TC8 A;  4II9 A;  4FUU A;  2BCO A;  1X12 A;  1Y9W A;  2EK8 A;  3EY5 A;  5GCN A;  2F8H A;  3WR7 A;  1CX8 A;  1YRE A;  4FBE A;  1TKJ A;  1TXR A;  4ONW A;  1EE3 P;  2Z0Z A;  4X5K A;  2YNC A;  4A95 A;  4AVB A;  3CZX A;  2PJ1 A;  3IO1 A;  2JBJ A;  2ZOG A;  2O53 A;  2NMT A;  4XPD C;  2OU2 A;  4JZ0 A;  4PXE A;  1Y7E A;  2FIA A;  2EBJ A;  2Z3K A;  1HEE A;  2VZZ A;  4OAD A;  5D8N A;  1S7N A;  1S7L A;  2J9A A;  1QQ9 A;  3FNC A;  3B3C A;  3SJX A;  4FD6 A;  1QSR A;  4MFK A;  2ZW6 A;  3UY5 A;  2FE7 A;  3NE7 A;  2Z11 A;  1VIX A;  1KZF A;  3SXO A;  1XBU A;  3FB3 A;  3TE4 A;  3KKW A;  2B5G B;  1Z8X A;  2K5T A;  3H4Q A;  4MHP A;  1Y0R A;  1XE4 A;  3K2K A;  4NEX A;  3D7D A;  4ZI6 A;  4MHZ A;  3B35 A;  5FVJ A;  3QAY A;  3NE8 A;  5G1Z A;  4HNY B;  5J8F A;  2PJC A;  3FMC A;  3T90 A;  1Q2D A;  4KLW A;  3S9M A;  1CPS A;  1XIX A;  1YVO A;  2CNS A;  5DWN A;  2CXA A;  1Z5R A;  1V0C A;  2AFM A;  2F5I A;  3D2P A;  4HPS A;  4F9U A;  4CAV A;  2XEI A;  4NSQ A;  4FD5 A;  4EVY A;  1UWY A;  4IUS A;  2KCW A;  4UWI A;  2OZG A;  1LOK A; 
#chains in the Genus database with same CATH homology
 2HUZ A;  3E0K A;  4AVA A;  5DWM A;  4BBH A;  3MGD A;  1XMT A;  2AE6 A;  2FL4 A;  3TOA A;  1YR0 A;  4UFW A;  4KZT A;  4B11 A;  4C7H A;  4PK2 A;  1RXT A;  3T9Y A;  5IV0 A;  2HV2 A;  2BL1 A;  3K9U A;  1Q2Y A;  3FRM A;  2WPX A;  3R9F A;  4NXY A;  2Q4Y A;  2R8V A;  4B5P A;  3R9G A;  5CNP A;  1S60 A;  4H6Z A;  1XF8 A;  1SQH A;  2YNC C;  4M3S A;  4KOT A;  4A30 A;  3R96 A;  4CAE A;  1R57 A;  2DXQ A;  2QML A;  2B3V A;  4R87 A;  4KOY A;  4M85 A;  3PGP A;  4L89 A;  2ATR A;  4H89 A;  3VWE A;  5G21 A;  2BSW A;  4PSW A;  2Z3L A;  1I1D A;  4KLV A;  1YX0 A;  4MFZ A;  3IWG A;  1MK4 A;  2Q04 A;  4R3L A;  4AB7 A;  3R1K A;  3BJ8 A;  5HMN A;  3TOB A;  4AG7 A;  3QAH A;  4MI4 A;  2ZXV A;  4R57 A;  4DNC A;  2B4B A;  3F0A A;  4HKF A;  3EO4 A;  3V8I A;  4JXQ A;  2JLM A;  1LRZ A;  2B4D B;  2WPW A;  4L8A A;  2DPS A;  2D4P A;  4XNH B;  3FYN A;  4QB9 A;  2GE3 A;  2FCK A;  2BEI A;  4RS2 A;  1Q2C A;  4FD7 A;  1Z4E A;  5EBV A;  5F49 A;  5JQ4 A;  5IB0 A;  1YK3 A;  1RO5 A;  2R98 A;  4NF1 A;  4QVT A;  4U9Z A;  2Q4V A;  2VXK A;  2JDC A;  1P0H A;  2AJ6 A;  1KUX A;  2Y0M A;  3FBU A;  2HQY A;  5AG5 A;  2B5G A;  4KOX A;  5EC4 A;  4F0X A;  2IL4 A;  1WWZ A;  3FIX A;  4KUA A;  4JXR A;  4UCN A;  1IYK A;  4UWJ A;  1Y9K A;  5J8C A;  1NMT A;  3FXT A;  2Q44 A;  1CJW A;  4MFL A;  1MJB A;  3BLN A;  1J4J A;  2PC1 A;  4A2Z A;  1M4I A;  3QB8 A;  1CM0 A;  2YNE A;  1ZO0 A;  1UFH A;  4CGP A;  4CGL A;  3IU2 A;  1PUA A;  4MFQ A;  3F5B A;  2Z3O A;  2YND A;  1S5K A;  3D8P A;  4KOR A;  4CYP A;  1QST A;  2C27 A;  1L0C A;  4XNH C;  3GYA A;  4YRH A;  4U9Y A;  3JVN A;  4F6A A;  5E96 A;  2A4N A;  2QIR A;  4CAX A;  1WK4 A;  4C2Z A;  2P0W A;  4CGM A;  4CAF A;  4JJX A;  4ZGY B;  2OB0 A;  2ZW5 A;  5KTA A;  2QEC A;  2REF A;  2G3T A;  1KUV A;  2H5M A;  1MJ9 A;  4A33 A;  2YGW A;  4I49 A;  1MJA A;  2WUU A;  3B8G A;  4U5Y A;  3RYO A;  2O28 A;  2Z3M A;  3TO7 A;  2ZW7 A;  3W6S A;  1M44 A;  3C26 A;  5G20 A;  4PSX A;  2VEZ A;  1M1D A;  5H84 A;  4B10 A;  4CYQ A;  1I12 A;  4YGO A;  1YGH A;  4XPL A;  3GKR A;  3TO6 A;  2Z3P A;  4B13 A;  4YFJ A;  2OH1 A;  2VI7 A;  5F47 A;  5AGE A;  4GS4 A;  4ONU A;  2Z10 A;  3IGR A;  4CAW A;  2CNM A;  2Z3N A;  4QUS A;  4Y49 B;  5BWA B;  5I0C A;  3R95 A;  2GAN A;  3H5Z A;  3G8W A;  4JLY A;  5G22 A;  1N71 A;  2B4D A;  2FS5 A;  2PR1 A;  1IID A;  4RI1 A;  2VZY A;  2VQY A;  5AG7 A;  4ZBG A;  4ORF A;  3IWE A;  1Y7R A;  2WSA A;  4MY0 A;  4IF5 A;  3DR8 A;  5F48 A;  4C2X A;  3DDD A;  4KOU A;  4KVO E;  4UA3 A;  4JWP A;  3TTH A;  4B5O A;  2PQ8 A;  2FT0 A;  2D4O A;  2Q0Y A;  2RC4 A;  2FXF A;  1IB1 E;  3CXS A;  1I21 A;  4B14 A;  4H6U A;  1YVK A;  1Z4R A;  4MFJ A;  2I00 A;  2OZU A;  4LX9 A;  4AG9 A;  2J8M A;  3S6H A;  4OAE A;  2P6E A;  1M4D A;  3W6X A;  4AVC A;  4C68 A;  4MHD A;  3F8K A;  2EUI A;  1K4J A;  4F0Y A;  4CRY B;  2B58 A;  4Y49 C;  1P4N A;  4A32 A;  4UBR A;  2R1I A;  5IX3 A;  2PSW A;  2ARH A;  5KTC A;  5AG6 A;  4B12 A;  1ON0 A;  5C88 A;  2G0B A;  1S3Z A;  1TIQ A;  1IIC A;  5HH1 A;  5ISV A;  2X7B A;  3TFY A;  4CGO A;  1VKC A;  2P6G A;  2FSR A;  3TO9 A;  2REE A;  3W91 A;  3D3S A;  1GHE A;  3CXQ A;  2P6F A;  4A31 A;  2CY2 A;  2VBQ A;  3SXN A;  4KS9 A;  1PU9 A;  4BMH A;  1B87 A;  4CRZ B;  5A27 A;  4QC6 A;  5A28 A;  4LUA A;  1NSL A;  2B3U A;  3S6G A;  4XPK A;  4KOW A;  1FY7 A;  1BOB A;  1KUY A;  3S6K A;  3G3S A;  3LD2 A;  5H86 A;  4MFP A;  4E8O A;  4R9M A;  2Q7B A;  3D2M A;  1BO4 A;  2GIV A;  3R9E A;  3LOD A;  3ZJ0 A;  4E0A A;  4UCM A;  2G3A A;  1S7K A;  2EVN A;  4K30 A;  3P2F A;  3P2H A;  2JEV A;  4C7I A;  4Q36 A;  1NE9 A;  4KUB A;  4UFX A;  4JD6 A;  3VWD A;  4CYN A;  3DSB A;  3I9S A;  4E2A A;  4Q38 A;  2BUE A;  2ZPA A;  2J8R A;  2PR8 A;  4CGN A;  3SHP A;  3PP9 A;  4KOS A;  3JTK A;  2PDO A;  1U6M A;  4CS0 B;  2OZH A;  4UFV A;  4KSF A;  2I79 A;  3TCV A;  4HNX B;  3DR6 A;  4MBU A;  4PK3 A;  4OLL A;  2R7H A;  1B6B A;  1QSO A;  4UCP A;  2DPT A;  4HNW B;  1QSM A;  4XPD B;  3I3G A;  4B5P B;  3IU1 A;  1Z9U A;  4KSA A;  4PV6 A;  1QSN A;  3A9L A;  4NCZ A;  3DNS A;  1XEB A;  3N7Z A;  5C82 A;  5KTD A;  3EFA A;  3S6F A;  4KVM E;  3GY9 A;  3OWC A;  1M4G A;  1VHS A;  3BJ7 A;  1S7F A;  2PRB A;  1YLE A;  4KVX A;  2JDD A;  5JPH A;  4MY3 A;  1OZP A;  4KOV A;  4MJ8 A;  4FD4 A;  2ZW4 A;  3PZJ A;  4CYO A;  2CNT A;  4QBJ A;  5AG4 A;  2FIW A;  3JUW A;  3EXN A;  2J8N A;  3CXP A;  5F46 A;  4C2Y A;  3EC4 A;  1IYL A;  3ZZI A;  3TT2 A;  4J3G A;  4R3K A;  4II9 A;  1Y9W A;  3EY5 A;  5GCN A;  3WR7 A;  1YRE A;  2Z0Z A;  4X5K A;  2YNC A;  4A95 A;  4AVB A;  2NMT A;  4XPD C;  2OU2 A;  2FIA A;  2Z3K A;  2VZZ A;  4OAD A;  1S7N A;  1S7L A;  3FNC A;  4FD6 A;  1QSR A;  4MFK A;  2ZW6 A;  3UY5 A;  2FE7 A;  3NE7 A;  2Z11 A;  3SXO A;  1KZF A;  3FB3 A;  3TE4 A;  3KKW A;  2B5G B;  2K5T A;  3H4Q A;  1XE4 A;  4NEX A;  5FVJ A;  5G1Z A;  4HNY B;  5J8F A;  3T90 A;  1Q2D A;  4KLW A;  1XIX A;  1YVO A;  2CNS A;  5DWN A;  2CXA A;  1V0C A;  3D2P A;  2F5I A;  4CAV A;  4NSQ A;  4FD5 A;  4EVY A;  4IUS A;  2KCW A;  4UWI A;  2OZG A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...