1QQ9A

Streptomyces griseus aminopeptidase complexed with methionine
Total Genus 110
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
110
sequence length
277
structure length
277
Chain Sequence
APDIPLANVKAHLTQLSTIAANNGGNRAHGRPGYKASVDYVKAKLDAAGYTTTLQQFTSGGATGYNLIANWPGGDPNKVLMAGAHLDSVSSGAGINDNGSGSAAVLETALAVSRAGYQPDKHLRFAWWGAEELGLIGSKFYVNNLPSADRSKLAGYLNFDMIGSPNPGYFVYDDDPVIEKTFKNYFAGLNVPTEIETEGDGRSDHAPFKNVGVPVGGLFTGAGYTKSAAQAQKWGGTAGQAFDRCYHSSCDSLSNINDTALDRNSDAAAHAIWTLSS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Interactions of Streptomyces griseus aminopeptidase with a methionine product analogue: a structural study at 1.53 A resolution.
pubmed doi rcsb
molecule tags Hydrolase
molecule keywords AMINOPEPTIDASE
total genus 110
structure length 277
sequence length 277
ec nomenclature ec 3.4.11.24: Aminopeptidase S.
pdb deposition date 1999-06-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF04389 Peptidase_M28 Peptidase family M28
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.630.10 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Zn peptidases 1qq9A00
1IGBA 2PJ1A 3B35A 3KASA 5K8OA 5LYIA 4PXEA 4TNUA 8CPAA 1CPSA 2V8GA 1YLOA 3WT4A 1R3NA 4DUKA 4X3RA 1VHEA 2PJAA 2IJZA 2NSMA 3HUVA 2JBKA 2RB7A 3ISXA 4ZY2A 3S9MA 2QJ8A 2BOAA 4NFRA 2DEAA 5HVHA 2XEIA 1TF8A 3IWWA 3PB7X 2PJ8A 2CIJA 2Q4ZA 4ZY0A 1LANA 4A37A 1OBRA 1Z8LA 1F57A 2O53A 2BCOA 3RAMA 3VARA 4UEFA 3IJ3A 3NFZA 3V7ZA 5D29A 2QYVA 3B3SA 2POKA 1XJOA 3FX6A 5DS0A 1HEEA 1LAMA 4OC2A 2ZENA 4DYOA 3B7IA 3VH9A 5D8NA 3WC6A 3RBUA 4RUHA 2GLJA 7CPAA 4MHZA 3KI9A 4PXCA 3SI1A 1BLLE 5I4MA 4AXVA 5J1QA 3B2YA 2PRQA 1ZG7A 1ZLHA 2ZEEA 4R7MA 1TKHA 4OC5A 3PB6X 2PJ4A 2PJ0A 4P4IA 4FUUA 4Z65A 2EK8A 1CG2A 1HDQA 2AFSA 3T8WA 3KR4A 4F9VA 3B3WA 4O23A 1LFWA 4ZY1A 3K2KA 5LYLA 3BXMA 5LRGA 4W9YA 2QVPA 2CF4A 1AYEA 2C6GA 4NGNA 3KGQA 4LQGA 3NA6A 2XEJA 5HXDA 1XFOA 1LAPA 2ABZA 3NH4A 4OC1A 4R8FA 4MXUA 1ZLIA 3MRUA 1CBXA 3WABA 4A38A 1IY7A 3FVLA 1M4LA 2F8HA 4MMOA 1Q7LA 2J9AA 5JH9A 5LRJA 2NYQA 2ZEMA 1ELLP 1XBUA 2GREA 2ZOGA 4X2TA 2GU2A 4R76A 3D7GA 4P10A 4P44A 3FF3A 4P4JA 1ARMA 1BPNA 3PFEA 2V8DA 3MN8A 4NJQA 1XRYA 2AFZA 3D68A 4MHYA 2CTBA 5ELYA 5THWA 3IEHA 4PXDA 4OMEA 1CP7A 3V38A 3NH8A 3WC5A 3SI2A 1YSJA 4P45A 4EFDA 3CDXA 2PJCA 4OKOA 2IMOA 4H2KA 4UIBA 4NGMA 3FH4A 2AFUA 3D66A 3LMSA 2ZEPA 5K8PA 2HB6A 3QNVA 1LCPA 4OC3A 2PJ3A 2PJ2A 3KHXA 4P4DA 1Z2LA 2BO9A 2ANPA 4KSIA 2AFXA 3D4UA 2PJBA 2V77A 4P4BA 3B3CA 1NSAA 3BI0A 3D7HA 3IO1A 2ZOFA 1DTDA 2PE3A 3BHXA 3N5FA 4UIAA 5F09A 3KL9A 3JRUA 5K8MA 3FMCA 2WZNA 4NJRA 3SJGA 1F2OA 1Y0YA 2CTCA 4IHMA 4JZ0A 3KHZA 4ONWA 4EWTA 1TKFA 1Y0RA 4PQAA 4MHPA 4FAIA 5LRKA 3HLPA 3H8GA 2PIYA 4NGTA 3SI0A 2PJ6A 4IK2A 1CX8A 2V8VA 3PBBA 1UWYA 4P4FA 4X8IA 3SJFA 2ZEHA 5HVFA 1BPMA 4A39A 3KZWA 2JEWA 3LWUA 2HC9A 5K8NA 1YW6A 2GLFA 4OC4A 4WWVA 1ELMP 1Z5RA 4CPAA 1EE3P 4NGQA 1CP6A 3D67A 3D7DA 3B3TA 2WYRA 4MHNA 1VIXA 1GYTA 4YU9A 4F9UA 3S9LA 5HVGA 4PPZA 2XEFA 1ZG8A 2EWBA 3KQXA 2PVVA 4MCRA 4NGPA 4ZX8A 3PBEA 6CPAA 4FBEA 3FECA 2OOTA 2PVWA 4OC0A 4A94A 3SJXA 3B3VA 4OIWA 3RZAA 2Q51A 4K3NA 3IC1A 3L2NA 4UF4A 1PCAA 5LYDA 1TXRA 3WC7A 3S9NA 2ZELA 2PJ7A 1TF9A 1KWMA 1H8LA 3I1UA 2PCUA 4IAVA 1JQGA 3CPXA 2PIZA 4MCQA 3H8FA 5IB9A 4UEEA 1RTQA 1QMUA 2O4HA 4MCSA 1AMPA 2AFOA 4EMEA 5CPAA 2VL1A 1FT7A 2JBJA 1ARLA 2EK9A 2OR4A 3FEDA 3TC8A 2Q43A 1Y7EA 3FEEA 1VHOA 2C6PA 3ISZA 3GUXA 4NGSA 4JYWA 3PRTA 4GM5A 2ZEDA 3NH5A 1VGYA 3KR5A 5JGFA 1FNOA 1F2PA 3BI1A 4TWEA 3TX8A 3PEIA 3D7FA 4BD9A 1TKJA 2ZEOA 5JM6A 3PB9X 3SJEA 1DE4C 2PJ9A 3DLJA 2FVGA 3IIBA 3CPAA 3CT9A 4G1PA 5LYFA 4WJBA 4B6ZA 4F8ZA 2C1CA 3PFOA 1R43A 1ZG9A 4FWUA 4MRIA 3H8EA 1BAVA 5CBMA 4P4EA 2AFMA 4ZX9A 4OIDA 2ZEFA 3GLJA 2IQ6A 2XEGA 2G9DA 4ZI6A 2F7VA 2V8HA 4P6YA 3VATA 2I3CA 4OP4A 2AFWA 2PJ5A 1PYTB 1XMBA 1QQ9A 1LOKA 1YMEA 2RFHA 4NGRA 1CPXA 1YW4A 3GB0A 3FJUA 1HDUA 2C6CA 3DGVA 3KQZA 2ZEGA 3PB8X 3K9TA 4ZYQA 4UEZA 4Q7AA 3IFEA 3PB4X 4R6TA 4DJLA 4PXBA 4MCPA 4YWYA
chains in the Genus database with same CATH superfamily
5G21A 1IGBA 1Z4RA 2PJ1A 3B35A 2GIVA 2F5IA 4KOXA 2Q4YA 4OAEA 4KOVA 3KASA 2ZW7A 5K8OA 2DPSA 3WR7A 2GFQA 3I9SA 5LYIA 2D4OA 2VQYA 4PXEA 3S6KA 3BLNA 4TNUA 4DNCA 1CPSA 2V8GA 5E96A 1BOBA 1YLOA 3WT4A 8CPAA 2AE6A 1R3NA 1FY7A 4CYOA 4DUKA 5CNPA 4X3RA 4B14A 1VHEA 4B5PA 1Y9WA 4A30A 3I3GA 4L8AA 2PJAA 2IJZA 2NSMA 1J4JA 3HUVA 2JBKA 1XOVA 4KVXA 4MI4A 4H6ZA 1QSRA 2FT0A 2IL4A 2RB7A 3ISXA 2G3TA 4KZTA 4ZY2A 3TT2A 3S9MA 2QJ8A 2BOAA 2PRBA 4KOSA 3RO0A 4NFRA 2Z3KA 5C82A 1XE4A 2DEAA 5HVHA 2XEIA 1TF8A 2FSRA 1IICA 3IWWA 3PB7X 3JTKA 2FCKA 3RNZA 3GYAA 5G22A 2YNCC 2G3AA 2Z3OA 2PJ8A 5KTAA 2CIJA 2Q4ZA 4UWIA 4ZY0A 1NMTA 1LANA 4A37A 2FIAA 4YFJA 1OBRA 4MHDA 4F0XA 3BJ7A 1Z8LA 1F57A 2O53A 2BCOA 3RAMA 2WPXA 3VARA 4CYQA 2PQ8A 1B87A 2P6FA 4KUAA 3IWGA 4AVAA 2OZHA 4UEFA 4UCNA 2K5TA 3IJ3A 3NFZA 3V7ZA 2VEZA 5D29A 3G8WA 2QYVA 4L89A 2Z3PA 3B3SA 1M4GA 2POKA 3OWCA 1UFHA 4BINA 1XJOA 2REEA 3FX6A 3R1KA 4JXRA 5DS0A 2FXFA 2C27A 2DF5A 1HEEA 4MY0A 1LAMA 4OC2A 4LX9A 2B4DA 2ZENA 4J3GA 4DYOA 1M4IA 3H4QA 2YNDA 5G20A 1ON0A 3CZXA 3B7IA 3VH9A 5D8NA 4MFLA 2J8RA 1A2ZA 4F6AA 3WC6A 1LRZA 3RBUA 4RUHA 3FYNA 3TCVA 5G1ZA 2GLJA 4UWJA 7CPAA 5JQ4A 4MHZA 3KI9A 4PXCA 4C7IA 3SI1A 1BLLE 5I4MA 4GS4A 3RYOA 4AXVA 4CAWA 5J1QA 3K9UA 2CNMA 2GANA 3B2YA 4CYNA 4PV6A 2PRQA 1ZG7A 1ZLHA 2ZEEA 4ZBGA 4R7MA 4UCMA 1TKHA 3PB6X 4OC5A 2A4NA 4A95A 2PJ4A 2PJ0A 3C26A 4FUUA 4P4IA 4Z65A 1Z8WA 1CG2A 1HDQA 1YX0A 2AFSA 2EK8A 3FNCA 4Q36A 3TOBA 3T8WA 4HNWB 1IYLA 3KR4A 4F9VA 2J8NA 3B3WA 4CAFA 2ARHA 3EO4A 4O23A 1LFWA 4M6IA 4ZY1A 1R57A 3K2KA 4B12A 3BXMA 5LYLA 1WWZA 1N71A 4KLWA 1Q2YA 3D2PA 5LRGA 1MJBA 4HNYB 2J8MA 3LACA 4B10A 4W9YA 2QVPA 2CF4A 4AG9A 4CS0B 1AYEA 4JXQA 2C6GA 2Y0MA 4RN7A 5DWMA 4NGNA 2P0WA 3KGQA 4JD6A 4ORFA 4LQGA 5AGEA 4KORA 2QMLA 3NA6A 3CXSA 2XEJA 5HXDA 1XFOA 1LAPA 2ABZA 2CNSA 3NH4A 4OC1A 4R8FA 3G3SA 1U6MA 1YREA 4MXUA 4C2ZA 1ZLIA 4R3LA 2R8VA 4AG7A 4PSXA 3MRUA 1KUVA 1CBXA 3WABA 4A38A 1IY7A 3FVLA 1M4LA 4AVCA 1S7KA 2F8HA 4XPLA 1S7LA 4E2AA 1YR0A 4MMOA 1Q7LA 4OADA 2J9AA 5JH9A 5LRJA 2NYQA 4QB9A 2ZEMA 2DXQA 1ELLP 1RO5A 1P0HA 1P4NA 1XBUA 2GREA 2ZOGA 5IV0A 4X2TA 2B5GB 1Z8TA 2GU2A 4R76A 3W6XA 3D7GA 4JLYA 4P10A 4P44A 3FF3A 3MGDA 4P4JA 1ARMA 1BPNA 3IWEA 2Z11A 2OZGA 3PFEA 4BBHA 4CYPA 1IOIA 2V8DA 4A31A 3BJ8A 3MN8A 4NCZA 1XRYA 4NJQA 5KTDA 1Q2CA 2AFZA 3D68A 3FXTA 2Z3MA 2ZW5A 4MHYA 3VWEA 2CTBA 5ELYA 5THWA 1SQHA 3IEHA 4XPKA 2PC1A 2JLMA 4PXDA 3IU2A 4JJXA 1VHSA 4OMEA 4QBJA 1CP7A 2HV2A 4B5PB 3V38A 3NH8A 4B13A 5AG4A 4KOUA 3WC5A 1IYKA 4M6GA 3SI2A 2REFA 1YSJA 2BEIA 1V0CA 4P45A 3GIUA 4KSFA 2FL4A 4EFDA 4CAXA 5F49A 2JDCA 2PJCA 3CDXA 4OKOA 2IMOA 4H2KA 4UIBA 4NGMA 4NXYA 3FH4A 2AFUA 3D66A 5AG5A 4I49A 1YLEA 4E8OA 3LMSA 2ZEPA 3D3SA 3E0KA 5K8PA 2HUZA 4X5KA 2HB6A 5F46A 2ZW4A 2ZXVA 3P2FA 1LCPA 3QNVA 4M3SA 4PSWA 2PDOA 4OC3A 2PJ2A 2PJ3A 1I21A 2B4DB 3PP9A 2VZZA 1MJ9A 3KHXA 4P4DA 1Z2LA 2BO9A 2ANPA 4F0YA 4KSIA 3F0AA 2O28A 3TTHA 2AFXA 3EXNA 3D4UA 2B3VA 2CXAA 2PJBA 2V77A 4P4BA 2BUEA 1NSLA 3T9YA 4IUSA 3B3CA 2I79A 3DR8A 1NSAA 3BI0A 3D7HA 3FRMA 3IO1A 3SXOA 3TFYA 2ZOFA 1QSMA 1DTDA 4FD7A 2PE3A 3BHXA 3N5FA 4C2YA 2DPTA 3D8PA 4UIAA 2Q7SA 3H5ZA 5F09A 4C68A 3KL9A 3JRUA 5K8MA 4LQ6A 2NMTA 4MJ8A 1AUGA 2VI7A 3FMCA 2WZNA 4NJRA 3SJGA 4ZGYB 4EVYA 4HPSA 2ODFA 2CY2A 2Z10A 2PR8A 1VKCA 4BMHA 1F2OA 3IGRA 1Y0YA 2CTCA 4IHMA 2Q7BA 4JZ0A 3KHZA 3IU1A 4ONWA 5AG6A 1MJAA 2Z3NA 2BSWA 4UCPA 4EWTA 5HH1A 1TKFA 4KLVA 1Y0RA 4PQAA 3R96A 3V8IA 4MHPA 4C7HA 4FAIA 5LRKA 4II9A 1KZFA 3HLPA 3H8GA 2PIYA 4NGTA 3SI0A 2PJ6A 4IK2A 4CRYB 4CGLA 2QIRA 1CX8A 1YVOA 2Q0YA 4A33A 2V8VA 3PBBA 5F48A 3R9EA 1UWYA 2VZYA 1M1DA 3EC4A 2R98A 2Z0ZA 4P4FA 1CJWA 1PU9A 4R87A 4CGMA 4X8IA 3SJFA 2ZEHA 5HVFA 5C88A 1BPMA 4FD4A 3KZWA 4PK3A 4A39A 2EUIA 2JEWA 2FS5A 3LWUA 5I0CA 4Y49B 2HC9A 3TO7A 5K8NA 2WSAA 1YW6A 1K4JA 4MFJA 2GLFA 4OC4A 4WWVA 1ELMP 2YNCA 2OU2A 1XEBA 1Z5RA 3DDDA 1EE3P 4CPAA 1IU8A 4NGQA 1CP6A 3D67A 2ZW6A 4B5OA 3D7DA 3B3TA 2WYRA 1YVKA 4MHNA 1VIXA 1GYTA 4KSAA 4NF1A 1Z8XA 4YU9A 3R9GA 4F9UA 3S9LA 1X12A 2EVNA 3CXQA 3FB3A 4PPZA 2WUUA 2XEFA 5HVGA 1ZG8A 3KKWA 2JEVA 3S6HA 2EWBA 4KS9A 3KQXA 3A9LA 4UFXA 2PVVA 2KCWA 4MCRA 2Q44A 4NGPA 2G0BA 3DSBA 4ZX8A 2YNEA 3PBEA 5GCNA 6CPAA 4FBEA 3FECA 4KUBA 4AVBA 3TOAA 1OZPA 2OOTA 4R3KA 2PR1A 2PVWA 4OC0A 4A94A 4RS2A 4K30A 4OLLA 3SJXA 1KUXA 5JPHA 2I00A 3B3VA 4M85A 4AB7A 4OIWA 1KUYA 2OH1A 3RZAA 2Q51A 3LODA 4FD6A 4IF5A 4K3NA 2B4BA 3IC1A 3L2NA 2Q04A 3QAHA 2D4PA 2VXKA 4UF4A 3DNSA 3TO6A 1PCAA 3W6SA 5LYDA 3NE7A 5A28A 3EFAA 1TXRA 3WC7A 4MBUA 3S9NA 1ZO0A 2ZELA 3UY5A 4C2XA 2B3UA 3QAYA 2PJ7A 1TF9A 4CAVA 1KWMA 1Q2DA 1YK3A 1H8LA 3I1UA 2PCUA 4H6UA 4IAVA 2EBJA 1JQGA 3VWDA 1B6BA 3CPXA 2PIZA 4H89A 4MCQA 4R9MA 3H8FA 3JVNA 5AG7A 5IB9A 4UEEA 2HQYA 3FBUA 1IB1E 2FE7A 2R1IA 1Z4EA 1RTQA 2CNTA 1QMUA 2O4HA 3F8KA 1GHEA 3PGPA 2ZPAA 2WPWA 4MCSA 1QSTA 1AMPA 2AFOA 4PK2A 1WK4A 4EMEA 2Z3LA 5CPAA 2VL1A 1FT7A 5BWAB 4B11A 2JBJA 5A27A 1Y7RA 2X7BA 4R57A 1CM0A 1ARLA 3T90A 1Y9KA 4LUAA 3SHPA 3QB8A 2EK9A 4YGOA 2OR4A 3FEDA 2ATRA 3TC8A 3NE8A 2Q43A 4NSQA 5DWNA 5EMIA 1Y7EA 3GY9A 3FEEA 1VHOA 3F5BA 4HKFA 2C6PA 5EC4A 1X10A 3ISZA 3GUXA 4NGSA 4JYWA 2JDDA 4MY3A 3PRTA 4GM5A 2ZEDA 3NH5A 4UFVA 5H84A 3R95A 1VGYA 1I12A 3KR5A 1RXTA 3SXNA 4CGPA 4CRZB 5J8CA 1FNOA 4QC6A 1S5KA 5JGFA 2RC4A 5HMNA 4Y49C 2OZUA 3EY5A 1F2PA 4GXHA 2FIWA 4U9ZA 3BI1A 3DR6A 4TWEA 3TX8A 4A2ZA 3PEIA 4MFKA 4RI1A 2P6EA 4U9YA 5J8FA 3D7FA 4BD9A 2B58A 4HNXB 3P2HA 1TKJA 1Z9UA 1S60A 1NE9A 2ZEOA 1S7NA 2VBQA 4QVTA 1YQEA 3PB9X 1QSOA 4DJLA 5JM6A 3TE4A 4NEXA 4M6HA 3R9FA 4UBRA 3SJEA 3W91A 2QECA 4MFZA 1DE4C 4KVME 2PJ9A 3DLJA 3D2MA 2FVGA 3IIBA 3TO9A 2EO8A 1XIXA 1TIQA 3CPAA 4QUSA 4JWPA 3CT9A 1IIDA 4G1PA 5H86A 2YGWA 4XNHB 3LD2A 5LYFA 4XNHC 1S3ZA 4WJBA 5EBVA 4ONUA 4B6ZA 4F8ZA 2C1CA 4XPDC 3PFOA 4A32A 4CAEA 1XF8A 1R43A 1ZG9A 4FWUA 4U5YA 5IX3A 1IOFA 1QSNA 1PUAA 4MRIA 1XMTA 2P6GA 2H5MA 2AJ6A 1M4DA 1BAVA 1L0CA 3H8EA 4KVOE 4MFQA 4P4EA 1MK4A 2AFMA 4ZX9A 4OIDA 4CGOA 4UA3A 5CBMA 2GE3A 2ZEFA 3GLJA 3B8GA 5F47A 3FIXA 2IQ6A 4KOWA 3CXPA 2XEGA 3S6GA 2G9DA 4KOTA 1I1DA 4YRHA 3ZJ0A 2F7VA 4ZI6A 2V8HA 4P6YA 5ISVA 2OB0A 3VATA 2I3CA 4CGNA 2PSWA 4OP4A 2AFWA 2PJ5A 1PYTB 1XMBA 1QQ9A 1LOKA 1YMEA 1BO4A 3N7ZA 4FD5A 2Q4VA 2RFHA 5FVJA 1CPXA 1YW4A 4NGRA 3GB0A 4Q38A 5IB0A 3FJUA 1HDUA 2C6CA 3DGVA 3KQZA 4E0AA 4KOYA 2ZEGA 3PB8X 3K9TA 1M44A 3GKRA 1JWQA 3ZZIA 5KTCA 3JUWA 4ZYQA 2R7HA 4UEZA 3PZJA 4Q7AA 4XPDB 3S6FA 3IFEA 1S7FA 4UFWA 2B5GA 3PB4X 4MFPA 4R6TA 2BL1A 4PXBA 4MCPA 4YWYA 1YGHA
chains in the Genus database with same CATH topology
1IGBA 2PJ1A 3B35A 3KASA 5K8OA 5LYIA 4PXEA 4TNUA 8CPAA 1CPSA 2V8GA 1YLOA 3WT4A 1R3NA 4DUKA 4X3RA 1VHEA 2PJAA 2IJZA 2NSMA 3HUVA 2JBKA 2RB7A 3ISXA 4ZY2A 3S9MA 2QJ8A 2BOAA 4NFRA 2DEAA 5HVHA 2XEIA 1TF8A 3IWWA 3PB7X 2PJ8A 2CIJA 2Q4ZA 4ZY0A 1LANA 4A37A 1OBRA 1Z8LA 1F57A 2O53A 2BCOA 3RAMA 3VARA 4UEFA 3IJ3A 3NFZA 3V7ZA 5D29A 2QYVA 3B3SA 2POKA 1XJOA 3FX6A 5DS0A 1HEEA 1LAMA 4OC2A 2ZENA 4DYOA 3B7IA 3VH9A 5D8NA 3WC6A 3RBUA 4RUHA 2GLJA 7CPAA 4MHZA 3KI9A 4PXCA 3SI1A 1BLLE 5I4MA 4AXVA 5J1QA 3B2YA 2PRQA 1ZG7A 1ZLHA 2ZEEA 4R7MA 1TKHA 4OC5A 3PB6X 2PJ4A 2PJ0A 4P4IA 4FUUA 4Z65A 2EK8A 1CG2A 1HDQA 2AFSA 3T8WA 3KR4A 4F9VA 3B3WA 4O23A 1LFWA 4ZY1A 3K2KA 5LYLA 3BXMA 5LRGA 4W9YA 2QVPA 2CF4A 1AYEA 2C6GA 4NGNA 3KGQA 4LQGA 3NA6A 2XEJA 5HXDA 1XFOA 1LAPA 2ABZA 3NH4A 4OC1A 4R8FA 4MXUA 1ZLIA 3MRUA 1CBXA 3WABA 4A38A 1IY7A 3FVLA 1M4LA 2F8HA 4MMOA 1Q7LA 2J9AA 5JH9A 5LRJA 2NYQA 2ZEMA 1ELLP 1XBUA 2GREA 2ZOGA 4X2TA 2GU2A 4R76A 3D7GA 4P10A 4P44A 3FF3A 4P4JA 1ARMA 1BPNA 3PFEA 2V8DA 3MN8A 4NJQA 1XRYA 2AFZA 3D68A 4MHYA 2CTBA 5ELYA 5THWA 3IEHA 4PXDA 4OMEA 1CP7A 3V38A 3NH8A 3WC5A 3SI2A 1YSJA 4P45A 4EFDA 3CDXA 2PJCA 4OKOA 2IMOA 4H2KA 4UIBA 4NGMA 3FH4A 2AFUA 3D66A 3LMSA 2ZEPA 5K8PA 2HB6A 3QNVA 1LCPA 4OC3A 2PJ3A 2PJ2A 3KHXA 4P4DA 1Z2LA 2BO9A 2ANPA 4KSIA 2AFXA 3D4UA 2PJBA 2V77A 4P4BA 3B3CA 1NSAA 3BI0A 3D7HA 3IO1A 2ZOFA 1DTDA 2PE3A 3BHXA 3N5FA 4UIAA 5F09A 3KL9A 3JRUA 5K8MA 3FMCA 2WZNA 4NJRA 3SJGA 1F2OA 1Y0YA 2CTCA 4IHMA 4JZ0A 3KHZA 4ONWA 4EWTA 1TKFA 1Y0RA 4PQAA 4MHPA 4FAIA 5LRKA 3HLPA 3H8GA 2PIYA 4NGTA 3SI0A 2PJ6A 4IK2A 1CX8A 2V8VA 3PBBA 1UWYA 4P4FA 4X8IA 3SJFA 2ZEHA 5HVFA 1BPMA 4A39A 3KZWA 2JEWA 3LWUA 2HC9A 5K8NA 1YW6A 2GLFA 4OC4A 4WWVA 1ELMP 1Z5RA 4CPAA 1EE3P 4NGQA 1CP6A 3D67A 3D7DA 3B3TA 2WYRA 4MHNA 1VIXA 1GYTA 4YU9A 4F9UA 3S9LA 5HVGA 4PPZA 2XEFA 1ZG8A 2EWBA 3KQXA 2PVVA 4MCRA 4NGPA 4ZX8A 3PBEA 6CPAA 4FBEA 3FECA 2OOTA 2PVWA 4OC0A 4A94A 3SJXA 3B3VA 4OIWA 3RZAA 2Q51A 4K3NA 3IC1A 3L2NA 4UF4A 1PCAA 5LYDA 1TXRA 3WC7A 3S9NA 2ZELA 2PJ7A 1TF9A 1KWMA 1H8LA 3I1UA 2PCUA 4IAVA 1JQGA 3CPXA 2PIZA 4MCQA 3H8FA 5IB9A 4UEEA 1RTQA 1QMUA 2O4HA 4MCSA 1AMPA 2AFOA 4EMEA 5CPAA 2VL1A 1FT7A 2JBJA 1ARLA 2EK9A 2OR4A 3FEDA 3TC8A 2Q43A 1Y7EA 3FEEA 1VHOA 2C6PA 3ISZA 3GUXA 4NGSA 4JYWA 3PRTA 4GM5A 2ZEDA 3NH5A 1VGYA 3KR5A 5JGFA 1FNOA 1F2PA 3BI1A 4TWEA 3TX8A 3PEIA 3D7FA 4BD9A 1TKJA 2ZEOA 5JM6A 3PB9X 3SJEA 1DE4C 2PJ9A 3DLJA 2FVGA 3IIBA 3CPAA 3CT9A 4G1PA 5LYFA 4WJBA 4B6ZA 4F8ZA 2C1CA 3PFOA 1R43A 1ZG9A 4FWUA 4MRIA 3H8EA 1BAVA 5CBMA 4P4EA 2AFMA 4ZX9A 4OIDA 2ZEFA 3GLJA 2IQ6A 2XEGA 2G9DA 4ZI6A 2F7VA 2V8HA 4P6YA 3VATA 2I3CA 4OP4A 2AFWA 2PJ5A 1PYTB 1XMBA 1QQ9A 1LOKA 1YMEA 2RFHA 4NGRA 1CPXA 1YW4A 3GB0A 3FJUA 1HDUA 2C6CA 3DGVA 3KQZA 2ZEGA 3PB8X 3K9TA 4ZYQA 4UEZA 4Q7AA 3IFEA 3PB4X 4R6TA 4DJLA 4PXBA 4MCPA 4YWYA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1IGB A;  2PJ1 A;  3B35 A;  3KAS A;  5K8O A;  5LYI A;  4PXE A;  4TNU A;  8CPA A;  1CPS A;  2V8G A;  1YLO A;  3WT4 A;  1R3N A;  4DUK A;  4X3R A;  1VHE A;  2PJA A;  2IJZ A;  2NSM A;  3HUV A;  2JBK A;  2RB7 A;  3ISX A;  4ZY2 A;  3S9M A;  2QJ8 A;  2BOA A;  4NFR A;  2DEA A;  5HVH A;  2XEI A;  1TF8 A;  3IWW A;  3PB7 X;  2PJ8 A;  2CIJ A;  2Q4Z A;  4ZY0 A;  1LAN A;  4A37 A;  1OBR A;  1Z8L A;  1F57 A;  2O53 A;  2BCO A;  3RAM A;  3VAR A;  4UEF A;  3IJ3 A;  3NFZ A;  3V7Z A;  5D29 A;  2QYV A;  3B3S A;  2POK A;  1XJO A;  3FX6 A;  5DS0 A;  1HEE A;  1LAM A;  4OC2 A;  2ZEN A;  4DYO A;  3B7I A;  3VH9 A;  5D8N A;  3WC6 A;  3RBU A;  4RUH A;  2GLJ A;  7CPA A;  4MHZ A;  3KI9 A;  4PXC A;  3SI1 A;  1BLL E;  5I4M A;  4AXV A;  5J1Q A;  3B2Y A;  2PRQ A;  1ZG7 A;  1ZLH A;  2ZEE A;  4R7M A;  1TKH A;  4OC5 A;  3PB6 X;  2PJ4 A;  2PJ0 A;  4P4I A;  4FUU A;  4Z65 A;  2EK8 A;  1CG2 A;  1HDQ A;  2AFS A;  3T8W A;  3KR4 A;  4F9V A;  3B3W A;  4O23 A;  1LFW A;  4ZY1 A;  3K2K A;  5LYL A;  3BXM A;  5LRG A;  4W9Y A;  2QVP A;  2CF4 A;  1AYE A;  2C6G A;  4NGN A;  3KGQ A;  4LQG A;  3NA6 A;  2XEJ A;  5HXD A;  1XFO A;  1LAP A;  2ABZ A;  3NH4 A;  4OC1 A;  4R8F A;  4MXU A;  1ZLI A;  3MRU A;  1CBX A;  3WAB A;  4A38 A;  1IY7 A;  3FVL A;  1M4L A;  2F8H A;  4MMO A;  1Q7L A;  2J9A A;  5JH9 A;  5LRJ A;  2NYQ A;  2ZEM A;  1ELL P;  1XBU A;  2GRE A;  2ZOG A;  4X2T A;  2GU2 A;  4R76 A;  3D7G A;  4P10 A;  4P44 A;  3FF3 A;  4P4J A;  1ARM A;  1BPN A;  3PFE A;  2V8D A;  3MN8 A;  4NJQ A;  1XRY A;  2AFZ A;  3D68 A;  4MHY A;  2CTB A;  5ELY A;  5THW A;  3IEH A;  4PXD A;  4OME A;  1CP7 A;  3V38 A;  3NH8 A;  3WC5 A;  3SI2 A;  1YSJ A;  4P45 A;  4EFD A;  3CDX A;  2PJC A;  4OKO A;  2IMO A;  4H2K A;  4UIB A;  4NGM A;  3FH4 A;  2AFU A;  3D66 A;  3LMS A;  2ZEP A;  5K8P A;  2HB6 A;  3QNV A;  1LCP A;  4OC3 A;  2PJ3 A;  2PJ2 A;  3KHX A;  4P4D A;  1Z2L A;  2BO9 A;  2ANP A;  4KSI A;  2AFX A;  3D4U A;  2PJB A;  2V77 A;  4P4B A;  3B3C A;  1NSA A;  3BI0 A;  3D7H A;  3IO1 A;  2ZOF A;  1DTD A;  2PE3 A;  3BHX A;  3N5F A;  4UIA A;  5F09 A;  3KL9 A;  3JRU A;  5K8M A;  3FMC A;  2WZN A;  4NJR A;  3SJG A;  1F2O A;  1Y0Y A;  2CTC A;  4IHM A;  4JZ0 A;  3KHZ A;  4ONW A;  4EWT A;  1TKF A;  1Y0R A;  4PQA A;  4MHP A;  4FAI A;  5LRK A;  3HLP A;  3H8G A;  2PIY A;  4NGT A;  3SI0 A;  2PJ6 A;  4IK2 A;  1CX8 A;  2V8V A;  3PBB A;  1UWY A;  4P4F A;  4X8I A;  3SJF A;  2ZEH A;  5HVF A;  1BPM A;  4A39 A;  3KZW A;  2JEW A;  3LWU A;  2HC9 A;  5K8N A;  1YW6 A;  2GLF A;  4OC4 A;  4WWV A;  1ELM P;  1Z5R A;  4CPA A;  1EE3 P;  4NGQ A;  1CP6 A;  3D67 A;  3D7D A;  3B3T A;  2WYR A;  4MHN A;  1VIX A;  1GYT A;  4YU9 A;  4F9U A;  3S9L A;  5HVG A;  4PPZ A;  2XEF A;  1ZG8 A;  2EWB A;  3KQX A;  2PVV A;  4MCR A;  4NGP A;  4ZX8 A;  3PBE A;  6CPA A;  4FBE A;  3FEC A;  2OOT A;  2PVW A;  4OC0 A;  4A94 A;  3SJX A;  3B3V A;  4OIW A;  3RZA A;  2Q51 A;  4K3N A;  3IC1 A;  3L2N A;  4UF4 A;  1PCA A;  5LYD A;  1TXR A;  3WC7 A;  3S9N A;  2ZEL A;  2PJ7 A;  1TF9 A;  1KWM A;  1H8L A;  3I1U A;  2PCU A;  4IAV A;  1JQG A;  3CPX A;  2PIZ A;  4MCQ A;  3H8F A;  5IB9 A;  4UEE A;  1RTQ A;  1QMU A;  2O4H A;  4MCS A;  1AMP A;  2AFO A;  4EME A;  5CPA A;  2VL1 A;  1FT7 A;  2JBJ A;  1ARL A;  2EK9 A;  2OR4 A;  3FED A;  3TC8 A;  2Q43 A;  1Y7E A;  3FEE A;  1VHO A;  2C6P A;  3ISZ A;  3GUX A;  4NGS A;  4JYW A;  3PRT A;  4GM5 A;  2ZED A;  3NH5 A;  1VGY A;  3KR5 A;  5JGF A;  1FNO A;  1F2P A;  3BI1 A;  4TWE A;  3TX8 A;  3PEI A;  3D7F A;  4BD9 A;  1TKJ A;  2ZEO A;  5JM6 A;  3PB9 X;  3SJE A;  1DE4 C;  2PJ9 A;  3DLJ A;  2FVG A;  3IIB A;  3CPA A;  3CT9 A;  4G1P A;  5LYF A;  4WJB A;  4B6Z A;  4F8Z A;  2C1C A;  3PFO A;  1R43 A;  1ZG9 A;  4FWU A;  4MRI A;  3H8E A;  1BAV A;  5CBM A;  4P4E A;  2AFM A;  4ZX9 A;  4OID A;  2ZEF A;  3GLJ A;  2IQ6 A;  2XEG A;  2G9D A;  4ZI6 A;  2F7V A;  2V8H A;  4P6Y A;  3VAT A;  2I3C A;  4OP4 A;  2AFW A;  2PJ5 A;  1PYT B;  1XMB A;  1QQ9 A;  1LOK A;  1YME A;  2RFH A;  4NGR A;  1CPX A;  1YW4 A;  3GB0 A;  3FJU A;  1HDU A;  2C6C A;  3DGV A;  3KQZ A;  2ZEG A;  3PB8 X;  3K9T A;  4ZYQ A;  4UEZ A;  4Q7A A;  3IFE A;  3PB4 X;  4R6T A;  4DJL A;  4PXB A;  4MCP A;  4YWY A; 
#chains in the Genus database with same CATH topology
 5G21 A;  1IGB A;  1Z4R A;  2PJ1 A;  3B35 A;  2GIV A;  2F5I A;  4KOX A;  2Q4Y A;  4OAE A;  4KOV A;  3KAS A;  2ZW7 A;  5K8O A;  2DPS A;  3WR7 A;  2GFQ A;  3I9S A;  5LYI A;  2D4O A;  2VQY A;  4PXE A;  3S6K A;  3BLN A;  4TNU A;  4DNC A;  1CPS A;  2V8G A;  5E96 A;  1BOB A;  1YLO A;  3WT4 A;  8CPA A;  2AE6 A;  1R3N A;  1FY7 A;  4CYO A;  4DUK A;  5CNP A;  4X3R A;  4B14 A;  1VHE A;  4B5P A;  1Y9W A;  4A30 A;  3I3G A;  4L8A A;  2PJA A;  2IJZ A;  2NSM A;  1J4J A;  3HUV A;  2JBK A;  1XOV A;  4KVX A;  4MI4 A;  4H6Z A;  1QSR A;  2FT0 A;  2IL4 A;  2RB7 A;  3ISX A;  2G3T A;  4KZT A;  4ZY2 A;  3TT2 A;  3S9M A;  2QJ8 A;  2BOA A;  2PRB A;  4KOS A;  3RO0 A;  4NFR A;  2Z3K A;  5C82 A;  1XE4 A;  2DEA A;  5HVH A;  2XEI A;  1TF8 A;  2FSR A;  1IIC A;  3IWW A;  3PB7 X;  3JTK A;  2FCK A;  3RNZ A;  3GYA A;  5G22 A;  2YNC C;  2G3A A;  2Z3O A;  2PJ8 A;  5KTA A;  2CIJ A;  2Q4Z A;  4UWI A;  4ZY0 A;  1NMT A;  1LAN A;  4A37 A;  2FIA A;  4YFJ A;  1OBR A;  4MHD A;  4F0X A;  3BJ7 A;  1Z8L A;  1F57 A;  2O53 A;  2BCO A;  3RAM A;  2WPX A;  3VAR A;  4CYQ A;  2PQ8 A;  1B87 A;  2P6F A;  4KUA A;  3IWG A;  4AVA A;  2OZH A;  4UEF A;  4UCN A;  2K5T A;  3IJ3 A;  3NFZ A;  3V7Z A;  2VEZ A;  5D29 A;  3G8W A;  2QYV A;  4L89 A;  2Z3P A;  3B3S A;  1M4G A;  2POK A;  3OWC A;  1UFH A;  4BIN A;  1XJO A;  2REE A;  3FX6 A;  3R1K A;  4JXR A;  5DS0 A;  2FXF A;  2C27 A;  2DF5 A;  1HEE A;  4MY0 A;  1LAM A;  4OC2 A;  4LX9 A;  2B4D A;  2ZEN A;  4J3G A;  4DYO A;  1M4I A;  3H4Q A;  2YND A;  5G20 A;  1ON0 A;  3CZX A;  3B7I A;  3VH9 A;  5D8N A;  4MFL A;  2J8R A;  1A2Z A;  4F6A A;  3WC6 A;  1LRZ A;  3RBU A;  4RUH A;  3FYN A;  3TCV A;  5G1Z A;  2GLJ A;  4UWJ A;  7CPA A;  5JQ4 A;  4MHZ A;  3KI9 A;  4PXC A;  4C7I A;  3SI1 A;  1BLL E;  5I4M A;  4GS4 A;  3RYO A;  4AXV A;  4CAW A;  5J1Q A;  3K9U A;  2CNM A;  2GAN A;  3B2Y A;  4CYN A;  4PV6 A;  2PRQ A;  1ZG7 A;  1ZLH A;  2ZEE A;  4ZBG A;  4R7M A;  4UCM A;  1TKH A;  3PB6 X;  4OC5 A;  2A4N A;  4A95 A;  2PJ4 A;  2PJ0 A;  3C26 A;  4FUU A;  4P4I A;  4Z65 A;  1Z8W A;  1CG2 A;  1HDQ A;  1YX0 A;  2AFS A;  2EK8 A;  3FNC A;  4Q36 A;  3TOB A;  3T8W A;  4HNW B;  1IYL A;  3KR4 A;  4F9V A;  2J8N A;  3B3W A;  4CAF A;  2ARH A;  3EO4 A;  4O23 A;  1LFW A;  4M6I A;  4ZY1 A;  1R57 A;  3K2K A;  4B12 A;  3BXM A;  5LYL A;  1WWZ A;  1N71 A;  4KLW A;  1Q2Y A;  3D2P A;  5LRG A;  1MJB A;  4HNY B;  2J8M A;  3LAC A;  4B10 A;  4W9Y A;  2QVP A;  2CF4 A;  4AG9 A;  4CS0 B;  1AYE A;  4JXQ A;  2C6G A;  2Y0M A;  4RN7 A;  5DWM A;  4NGN A;  2P0W A;  3KGQ A;  4JD6 A;  4ORF A;  4LQG A;  5AGE A;  4KOR A;  2QML A;  3NA6 A;  3CXS A;  2XEJ A;  5HXD A;  1XFO A;  1LAP A;  2ABZ A;  2CNS A;  3NH4 A;  4OC1 A;  4R8F A;  3G3S A;  1U6M A;  1YRE A;  4MXU A;  4C2Z A;  1ZLI A;  4R3L A;  2R8V A;  4AG7 A;  4PSX A;  3MRU A;  1KUV A;  1CBX A;  3WAB A;  4A38 A;  1IY7 A;  3FVL A;  1M4L A;  4AVC A;  1S7K A;  2F8H A;  4XPL A;  1S7L A;  4E2A A;  1YR0 A;  4MMO A;  1Q7L A;  4OAD A;  2J9A A;  5JH9 A;  5LRJ A;  2NYQ A;  4QB9 A;  2ZEM A;  2DXQ A;  1ELL P;  1RO5 A;  1P0H A;  1P4N A;  1XBU A;  2GRE A;  2ZOG A;  5IV0 A;  4X2T A;  2B5G B;  1Z8T A;  2GU2 A;  4R76 A;  3W6X A;  3D7G A;  4JLY A;  4P10 A;  4P44 A;  3FF3 A;  3MGD A;  4P4J A;  1ARM A;  1BPN A;  3IWE A;  2Z11 A;  2OZG A;  3PFE A;  4BBH A;  4CYP A;  1IOI A;  2V8D A;  4A31 A;  3BJ8 A;  3MN8 A;  4NCZ A;  1XRY A;  4NJQ A;  5KTD A;  1Q2C A;  2AFZ A;  3D68 A;  3FXT A;  2Z3M A;  2ZW5 A;  4MHY A;  3VWE A;  2CTB A;  5ELY A;  5THW A;  1SQH A;  3IEH A;  4XPK A;  2PC1 A;  2JLM A;  4PXD A;  3IU2 A;  4JJX A;  1VHS A;  4OME A;  4QBJ A;  1CP7 A;  2HV2 A;  4B5P B;  3V38 A;  3NH8 A;  4B13 A;  5AG4 A;  4KOU A;  3WC5 A;  1IYK A;  4M6G A;  3SI2 A;  2REF A;  1YSJ A;  2BEI A;  1V0C A;  4P45 A;  3GIU A;  4KSF A;  2FL4 A;  4EFD A;  4CAX A;  5F49 A;  2JDC A;  2PJC A;  3CDX A;  4OKO A;  2IMO A;  4H2K A;  4UIB A;  4NGM A;  4NXY A;  3FH4 A;  2AFU A;  3D66 A;  5AG5 A;  4I49 A;  1YLE A;  4E8O A;  3LMS A;  2ZEP A;  3D3S A;  3E0K A;  5K8P A;  2HUZ A;  4X5K A;  2HB6 A;  5F46 A;  2ZW4 A;  2ZXV A;  3P2F A;  1LCP A;  3QNV A;  4M3S A;  4PSW A;  2PDO A;  4OC3 A;  2PJ2 A;  2PJ3 A;  1I21 A;  2B4D B;  3PP9 A;  2VZZ A;  1MJ9 A;  3KHX A;  4P4D A;  1Z2L A;  2BO9 A;  2ANP A;  4F0Y A;  4KSI A;  3F0A A;  2O28 A;  3TTH A;  2AFX A;  3EXN A;  3D4U A;  2B3V A;  2CXA A;  2PJB A;  2V77 A;  4P4B A;  2BUE A;  1NSL A;  3T9Y A;  4IUS A;  3B3C A;  2I79 A;  3DR8 A;  1NSA A;  3BI0 A;  3D7H A;  3FRM A;  3IO1 A;  3SXO A;  3TFY A;  2ZOF A;  1QSM A;  1DTD A;  4FD7 A;  2PE3 A;  3BHX A;  3N5F A;  4C2Y A;  2DPT A;  3D8P A;  4UIA A;  2Q7S A;  3H5Z A;  5F09 A;  4C68 A;  3KL9 A;  3JRU A;  5K8M A;  4LQ6 A;  2NMT A;  4MJ8 A;  1AUG A;  2VI7 A;  3FMC A;  2WZN A;  4NJR A;  3SJG A;  4ZGY B;  4EVY A;  4HPS A;  2ODF A;  2CY2 A;  2Z10 A;  2PR8 A;  1VKC A;  4BMH A;  1F2O A;  3IGR A;  1Y0Y A;  2CTC A;  4IHM A;  2Q7B A;  4JZ0 A;  3KHZ A;  3IU1 A;  4ONW A;  5AG6 A;  1MJA A;  2Z3N A;  2BSW A;  4UCP A;  4EWT A;  5HH1 A;  1TKF A;  4KLV A;  1Y0R A;  4PQA A;  3R96 A;  3V8I A;  4MHP A;  4C7H A;  4FAI A;  5LRK A;  4II9 A;  1KZF A;  3HLP A;  3H8G A;  2PIY A;  4NGT A;  3SI0 A;  2PJ6 A;  4IK2 A;  4CRY B;  4CGL A;  2QIR A;  1CX8 A;  1YVO A;  2Q0Y A;  4A33 A;  2V8V A;  3PBB A;  5F48 A;  3R9E A;  1UWY A;  2VZY A;  1M1D A;  3EC4 A;  2R98 A;  2Z0Z A;  4P4F A;  1CJW A;  1PU9 A;  4R87 A;  4CGM A;  4X8I A;  3SJF A;  2ZEH A;  5HVF A;  5C88 A;  1BPM A;  4FD4 A;  3KZW A;  4PK3 A;  4A39 A;  2EUI A;  2JEW A;  2FS5 A;  3LWU A;  5I0C A;  4Y49 B;  2HC9 A;  3TO7 A;  5K8N A;  2WSA A;  1YW6 A;  1K4J A;  4MFJ A;  2GLF A;  4OC4 A;  4WWV A;  1ELM P;  2YNC A;  2OU2 A;  1XEB A;  1Z5R A;  3DDD A;  1EE3 P;  4CPA A;  1IU8 A;  4NGQ A;  1CP6 A;  3D67 A;  2ZW6 A;  4B5O A;  3D7D A;  3B3T A;  2WYR A;  1YVK A;  4MHN A;  1VIX A;  1GYT A;  4KSA A;  4NF1 A;  1Z8X A;  4YU9 A;  3R9G A;  4F9U A;  3S9L A;  1X12 A;  2EVN A;  3CXQ A;  3FB3 A;  4PPZ A;  2WUU A;  2XEF A;  5HVG A;  1ZG8 A;  3KKW A;  2JEV A;  3S6H A;  2EWB A;  4KS9 A;  3KQX A;  3A9L A;  4UFX A;  2PVV A;  2KCW A;  4MCR A;  2Q44 A;  4NGP A;  2G0B A;  3DSB A;  4ZX8 A;  2YNE A;  3PBE A;  5GCN A;  6CPA A;  4FBE A;  3FEC A;  4KUB A;  4AVB A;  3TOA A;  1OZP A;  2OOT A;  4R3K A;  2PR1 A;  2PVW A;  4OC0 A;  4A94 A;  4RS2 A;  4K30 A;  4OLL A;  3SJX A;  1KUX A;  5JPH A;  2I00 A;  3B3V A;  4M85 A;  4AB7 A;  4OIW A;  1KUY A;  2OH1 A;  3RZA A;  2Q51 A;  3LOD A;  4FD6 A;  4IF5 A;  4K3N A;  2B4B A;  3IC1 A;  3L2N A;  2Q04 A;  3QAH A;  2D4P A;  2VXK A;  4UF4 A;  3DNS A;  3TO6 A;  1PCA A;  3W6S A;  5LYD A;  3NE7 A;  5A28 A;  3EFA A;  1TXR A;  3WC7 A;  4MBU A;  3S9N A;  1ZO0 A;  2ZEL A;  3UY5 A;  4C2X A;  2B3U A;  3QAY A;  2PJ7 A;  1TF9 A;  4CAV A;  1KWM A;  1Q2D A;  1YK3 A;  1H8L A;  3I1U A;  2PCU A;  4H6U A;  4IAV A;  2EBJ A;  1JQG A;  3VWD A;  1B6B A;  3CPX A;  2PIZ A;  4H89 A;  4MCQ A;  4R9M A;  3H8F A;  3JVN A;  5AG7 A;  5IB9 A;  4UEE A;  2HQY A;  3FBU A;  1IB1 E;  2FE7 A;  2R1I A;  1Z4E A;  1RTQ A;  2CNT A;  1QMU A;  2O4H A;  3F8K A;  1GHE A;  3PGP A;  2ZPA A;  2WPW A;  4MCS A;  1QST A;  1AMP A;  2AFO A;  4PK2 A;  1WK4 A;  4EME A;  2Z3L A;  5CPA A;  2VL1 A;  1FT7 A;  5BWA B;  4B11 A;  2JBJ A;  5A27 A;  1Y7R A;  2X7B A;  4R57 A;  1CM0 A;  1ARL A;  3T90 A;  1Y9K A;  4LUA A;  3SHP A;  3QB8 A;  2EK9 A;  4YGO A;  2OR4 A;  3FED A;  2ATR A;  3TC8 A;  3NE8 A;  2Q43 A;  4NSQ A;  5DWN A;  5EMI A;  1Y7E A;  3GY9 A;  3FEE A;  1VHO A;  3F5B A;  4HKF A;  2C6P A;  5EC4 A;  1X10 A;  3ISZ A;  3GUX A;  4NGS A;  4JYW A;  2JDD A;  4MY3 A;  3PRT A;  4GM5 A;  2ZED A;  3NH5 A;  4UFV A;  5H84 A;  3R95 A;  1VGY A;  1I12 A;  3KR5 A;  1RXT A;  3SXN A;  4CGP A;  4CRZ B;  5J8C A;  1FNO A;  4QC6 A;  1S5K A;  5JGF A;  2RC4 A;  5HMN A;  4Y49 C;  2OZU A;  3EY5 A;  1F2P A;  4GXH A;  2FIW A;  4U9Z A;  3BI1 A;  3DR6 A;  4TWE A;  3TX8 A;  4A2Z A;  3PEI A;  4MFK A;  4RI1 A;  2P6E A;  4U9Y A;  5J8F A;  3D7F A;  4BD9 A;  2B58 A;  4HNX B;  3P2H A;  1TKJ A;  1Z9U A;  1S60 A;  1NE9 A;  2ZEO A;  1S7N A;  2VBQ A;  4QVT A;  1YQE A;  3PB9 X;  1QSO A;  4DJL A;  5JM6 A;  3TE4 A;  4NEX A;  4M6H A;  3R9F A;  4UBR A;  3SJE A;  3W91 A;  2QEC A;  4MFZ A;  1DE4 C;  4KVM E;  2PJ9 A;  3DLJ A;  3D2M A;  2FVG A;  3IIB A;  3TO9 A;  2EO8 A;  1XIX A;  1TIQ A;  3CPA A;  4QUS A;  4JWP A;  3CT9 A;  1IID A;  4G1P A;  5H86 A;  2YGW A;  4XNH B;  3LD2 A;  5LYF A;  4XNH C;  1S3Z A;  4WJB A;  5EBV A;  4ONU A;  4B6Z A;  4F8Z A;  2C1C A;  4XPD C;  3PFO A;  4A32 A;  4CAE A;  1XF8 A;  1R43 A;  1ZG9 A;  4FWU A;  4U5Y A;  5IX3 A;  1IOF A;  1QSN A;  1PUA A;  4MRI A;  1XMT A;  2P6G A;  2H5M A;  2AJ6 A;  1M4D A;  1BAV A;  1L0C A;  3H8E A;  4KVO E;  4MFQ A;  4P4E A;  1MK4 A;  2AFM A;  4ZX9 A;  4OID A;  4CGO A;  4UA3 A;  5CBM A;  2GE3 A;  2ZEF A;  3GLJ A;  3B8G A;  5F47 A;  3FIX A;  2IQ6 A;  4KOW A;  3CXP A;  2XEG A;  3S6G A;  2G9D A;  4KOT A;  1I1D A;  4YRH A;  3ZJ0 A;  2F7V A;  4ZI6 A;  2V8H A;  4P6Y A;  5ISV A;  2OB0 A;  3VAT A;  2I3C A;  4CGN A;  2PSW A;  4OP4 A;  2AFW A;  2PJ5 A;  1PYT B;  1XMB A;  1QQ9 A;  1LOK A;  1YME A;  1BO4 A;  3N7Z A;  4FD5 A;  2Q4V A;  2RFH A;  5FVJ A;  1CPX A;  1YW4 A;  4NGR A;  3GB0 A;  4Q38 A;  5IB0 A;  3FJU A;  1HDU A;  2C6C A;  3DGV A;  3KQZ A;  4E0A A;  4KOY A;  2ZEG A;  3PB8 X;  3K9T A;  1M44 A;  3GKR A;  1JWQ A;  3ZZI A;  5KTC A;  3JUW A;  4ZYQ A;  2R7H A;  4UEZ A;  3PZJ A;  4Q7A A;  4XPD B;  3S6F A;  3IFE A;  1S7F A;  4UFW A;  2B5G A;  3PB4 X;  4MFP A;  4R6T A;  2BL1 A;  4PXB A;  4MCP A;  4YWY A;  1YGH A; 
#chains in the Genus database with same CATH homology
 1IGB A;  2PJ1 A;  3B35 A;  3KAS A;  5K8O A;  5LYI A;  4PXE A;  4TNU A;  8CPA A;  1CPS A;  2V8G A;  1YLO A;  3WT4 A;  1R3N A;  4DUK A;  4X3R A;  1VHE A;  2PJA A;  2IJZ A;  2NSM A;  3HUV A;  2JBK A;  2RB7 A;  3ISX A;  4ZY2 A;  3S9M A;  2QJ8 A;  2BOA A;  4NFR A;  2DEA A;  5HVH A;  2XEI A;  1TF8 A;  3IWW A;  3PB7 X;  2PJ8 A;  2CIJ A;  2Q4Z A;  4ZY0 A;  1LAN A;  4A37 A;  1OBR A;  1Z8L A;  1F57 A;  2O53 A;  2BCO A;  3RAM A;  3VAR A;  4UEF A;  3IJ3 A;  3NFZ A;  3V7Z A;  5D29 A;  2QYV A;  3B3S A;  2POK A;  1XJO A;  3FX6 A;  5DS0 A;  1HEE A;  1LAM A;  4OC2 A;  2ZEN A;  4DYO A;  3B7I A;  3VH9 A;  5D8N A;  3WC6 A;  3RBU A;  4RUH A;  2GLJ A;  7CPA A;  4MHZ A;  3KI9 A;  4PXC A;  3SI1 A;  1BLL E;  5I4M A;  4AXV A;  5J1Q A;  3B2Y A;  2PRQ A;  1ZG7 A;  1ZLH A;  2ZEE A;  4R7M A;  1TKH A;  4OC5 A;  3PB6 X;  2PJ4 A;  2PJ0 A;  4P4I A;  4FUU A;  4Z65 A;  2EK8 A;  1CG2 A;  1HDQ A;  2AFS A;  3T8W A;  3KR4 A;  4F9V A;  3B3W A;  4O23 A;  1LFW A;  4ZY1 A;  3K2K A;  5LYL A;  3BXM A;  5LRG A;  4W9Y A;  2QVP A;  2CF4 A;  1AYE A;  2C6G A;  4NGN A;  3KGQ A;  4LQG A;  3NA6 A;  2XEJ A;  5HXD A;  1XFO A;  1LAP A;  2ABZ A;  3NH4 A;  4OC1 A;  4R8F A;  4MXU A;  1ZLI A;  3MRU A;  1CBX A;  3WAB A;  4A38 A;  1IY7 A;  3FVL A;  1M4L A;  2F8H A;  4MMO A;  1Q7L A;  2J9A A;  5JH9 A;  5LRJ A;  2NYQ A;  2ZEM A;  1ELL P;  1XBU A;  2GRE A;  2ZOG A;  4X2T A;  2GU2 A;  4R76 A;  3D7G A;  4P10 A;  4P44 A;  3FF3 A;  4P4J A;  1ARM A;  1BPN A;  3PFE A;  2V8D A;  3MN8 A;  4NJQ A;  1XRY A;  2AFZ A;  3D68 A;  4MHY A;  2CTB A;  5ELY A;  5THW A;  3IEH A;  4PXD A;  4OME A;  1CP7 A;  3V38 A;  3NH8 A;  3WC5 A;  3SI2 A;  1YSJ A;  4P45 A;  4EFD A;  3CDX A;  2PJC A;  4OKO A;  2IMO A;  4H2K A;  4UIB A;  4NGM A;  3FH4 A;  2AFU A;  3D66 A;  3LMS A;  2ZEP A;  5K8P A;  2HB6 A;  3QNV A;  1LCP A;  4OC3 A;  2PJ3 A;  2PJ2 A;  3KHX A;  4P4D A;  1Z2L A;  2BO9 A;  2ANP A;  4KSI A;  2AFX A;  3D4U A;  2PJB A;  2V77 A;  4P4B A;  3B3C A;  1NSA A;  3BI0 A;  3D7H A;  3IO1 A;  2ZOF A;  1DTD A;  2PE3 A;  3BHX A;  3N5F A;  4UIA A;  5F09 A;  3KL9 A;  3JRU A;  5K8M A;  3FMC A;  2WZN A;  4NJR A;  3SJG A;  1F2O A;  1Y0Y A;  2CTC A;  4IHM A;  4JZ0 A;  3KHZ A;  4ONW A;  4EWT A;  1TKF A;  1Y0R A;  4PQA A;  4MHP A;  4FAI A;  5LRK A;  3HLP A;  3H8G A;  2PIY A;  4NGT A;  3SI0 A;  2PJ6 A;  4IK2 A;  1CX8 A;  2V8V A;  3PBB A;  1UWY A;  4P4F A;  4X8I A;  3SJF A;  2ZEH A;  5HVF A;  1BPM A;  4A39 A;  3KZW A;  2JEW A;  3LWU A;  2HC9 A;  5K8N A;  1YW6 A;  2GLF A;  4OC4 A;  4WWV A;  1ELM P;  1Z5R A;  4CPA A;  1EE3 P;  4NGQ A;  1CP6 A;  3D67 A;  3D7D A;  3B3T A;  2WYR A;  4MHN A;  1VIX A;  1GYT A;  4YU9 A;  4F9U A;  3S9L A;  5HVG A;  4PPZ A;  2XEF A;  1ZG8 A;  2EWB A;  3KQX A;  2PVV A;  4MCR A;  4NGP A;  4ZX8 A;  3PBE A;  6CPA A;  4FBE A;  3FEC A;  2OOT A;  2PVW A;  4OC0 A;  4A94 A;  3SJX A;  3B3V A;  4OIW A;  3RZA A;  2Q51 A;  4K3N A;  3IC1 A;  3L2N A;  4UF4 A;  1PCA A;  5LYD A;  1TXR A;  3WC7 A;  3S9N A;  2ZEL A;  2PJ7 A;  1TF9 A;  1KWM A;  1H8L A;  3I1U A;  2PCU A;  4IAV A;  1JQG A;  3CPX A;  2PIZ A;  4MCQ A;  3H8F A;  5IB9 A;  4UEE A;  1RTQ A;  1QMU A;  2O4H A;  4MCS A;  1AMP A;  2AFO A;  4EME A;  5CPA A;  2VL1 A;  1FT7 A;  2JBJ A;  1ARL A;  2EK9 A;  2OR4 A;  3FED A;  3TC8 A;  2Q43 A;  1Y7E A;  3FEE A;  1VHO A;  2C6P A;  3ISZ A;  3GUX A;  4NGS A;  4JYW A;  3PRT A;  4GM5 A;  2ZED A;  3NH5 A;  1VGY A;  3KR5 A;  5JGF A;  1FNO A;  1F2P A;  3BI1 A;  4TWE A;  3TX8 A;  3PEI A;  3D7F A;  4BD9 A;  1TKJ A;  2ZEO A;  5JM6 A;  3PB9 X;  3SJE A;  1DE4 C;  2PJ9 A;  3DLJ A;  2FVG A;  3IIB A;  3CPA A;  3CT9 A;  4G1P A;  5LYF A;  4WJB A;  4B6Z A;  4F8Z A;  2C1C A;  3PFO A;  1R43 A;  1ZG9 A;  4FWU A;  4MRI A;  3H8E A;  1BAV A;  5CBM A;  4P4E A;  2AFM A;  4ZX9 A;  4OID A;  2ZEF A;  3GLJ A;  2IQ6 A;  2XEG A;  2G9D A;  4ZI6 A;  2F7V A;  2V8H A;  4P6Y A;  3VAT A;  2I3C A;  4OP4 A;  2AFW A;  2PJ5 A;  1PYT B;  1XMB A;  1QQ9 A;  1LOK A;  1YME A;  2RFH A;  4NGR A;  1CPX A;  1YW4 A;  3GB0 A;  3FJU A;  1HDU A;  2C6C A;  3DGV A;  3KQZ A;  2ZEG A;  3PB8 X;  3K9T A;  4ZYQ A;  4UEZ A;  4Q7A A;  3IFE A;  3PB4 X;  4R6T A;  4DJL A;  4PXB A;  4MCP A;  4YWY A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...