1QQ9A

Streptomyces griseus aminopeptidase complexed with methionine
Total Genus 110
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
110
sequence length
277
structure length
277
Chain Sequence
APDIPLANVKAHLTQLSTIAANNGGNRAHGRPGYKASVDYVKAKLDAAGYTTTLQQFTSGGATGYNLIANWPGGDPNKVLMAGAHLDSVSSGAGINDNGSGSAAVLETALAVSRAGYQPDKHLRFAWWGAEELGLIGSKFYVNNLPSADRSKLAGYLNFDMIGSPNPGYFVYDDDPVIEKTFKNYFAGLNVPTEIETEGDGRSDHAPFKNVGVPVGGLFTGAGYTKSAAQAQKWGGTAGQAFDRCYHSSCDSLSNINDTALDRNSDAAAHAIWTLSS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords AMINOPEPTIDASE
publication title Interactions of Streptomyces griseus aminopeptidase with a methionine product analogue: a structural study at 1.53 A resolution.
pubmed doi rcsb
molecule tags Hydrolase
total genus 110
structure length 277
sequence length 277
ec nomenclature ec 3.4.11.24: Aminopeptidase S.
pdb deposition date 1999-06-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF04389 Peptidase_M28 Peptidase family M28
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.630.10 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Zn peptidases 1qq9A00
1Z2LA 5LYLA 4F9VA 3RBUA 4IHMA 4FBEA 3PB8X 1VHEA 3ISXA 4ZYQA 4PXBA 4LQGA 1OBRA 4OC5A 2IMOA 3KI9A 3BI1A 4MCRA 4K3NA 4IK2A 3FVLA 1BPMA 4AXVA 6CPAA 2WYRA 3KHXA 2NSMA 3LMSA 1TXRA 4MCPA 2CF4A 4ZY2A 2ANPA 1FT7A 4OC4A 5F09A 3SJFA 2ZENA 2ZEGA 1TF8A 1LOKA 1F2PA 2GLJA 4NJRA 3B35A 1XBUA 2PJCA 4CPAA 4R7MA 4MXUA 1XRYA 1ZG9A 1KWMA 4EMEA 3WC6A 1XMBA 3GB0A 3PB7X 1RTQA 5LRGA 2Q43A 2OOTA 1Y0RA 3B3SA 4TNUA 2PJ9A 4NGRA 3S9LA 3K2KA 5K8PA 2Q4ZA 4ZI6A 3D4UA 4PXCA 1IY7A 1YLOA 3FF3A 1Q7LA 3JRUA 1TKHA 3TC8A 3SI2A 4UEZA 1Z8LA 3IO1A 2V8HA 2WZNA 1DTDA 3KL9A 3KQZA 4NGNA 4YU9A 2V8GA 1F57A 4P4JA 4EFDA 2GREA 2IJZA 1ARMA 1NSAA 2VL1A 4DJLA 1BAVA 2PCUA 1BLLE 3H8GA 2GU2A 3D67A 4ZX9A 4B6ZA 2ZEMA 4BD9A 2PJ5A 3NA6A 4Q7AA 2EK9A 1ZLIA 3D7DA 1PYTB 2PJ7A 4P4EA 3DLJA 2O53A 2ABZA 4R8FA 3PEIA 1ZG8A 3KR4A 3PB4X 3D7HA 3TX8A 4DUKA 2ZEFA 4PQAA 1R3NA 3VATA 3SI1A 3T8WA 2PJ3A 1IGBA 3B3TA 3D66A 1GYTA 2PJBA 2XEGA 5D8NA 3RAMA 2ZEOA 4ONWA 2JEWA 4OC2A 3WC5A 3D7GA 3N5FA 3SJEA 2V8DA 1VHOA 4OC0A 1UWYA 3D7FA 5ELYA 4Z65A 3MN8A 1LANA 1PCAA 1YSJA 1LCPA 4GM5A 2FVGA 2OR4A 3PRTA 3FH4A 3KZWA 1ARLA 1BPNA 4P44A 2PVVA 2PIZA 4NGMA 2PJ2A 3DGVA 3VARA 1VIXA 1H8LA 2PJ4A 5LYIA 4MHNA 4MMOA 3KHZA 4RUHA 1XFOA 2ZEPA 4OKOA 4O23A 3B7IA 4H2KA 4OIDA 3SJGA 2PE3A 5JH9A 1Y7EA 2XEFA 3KQXA 4ZY0A 4MCSA 3PFEA 1ELMP 3LWUA 3VH9A 2AFSA 2ZOGA 2PIYA 3B3WA 1YMEA 4MRIA 5DS0A 2ZELA 2HB6A 1AYEA 2XEJA 3B3CA 5IB9A 2C6CA 4JYWA 4NGPA 1DE4C 2XEIA 5HVHA 4FUUA 4P4DA 3FMCA 1R43A 1CBXA 4NGQA 2AFXA 1CX8A 4KSIA 3KR5A 4P4FA 4NJQA 2POKA 2AFZA 2PJAA 3QNVA 2RB7A 2JBKA 5HXDA 2QYVA 4A39A 4A38A 3HUVA 2JBJA 3FEDA 2C6PA 4OP4A 3BHXA 3K9TA 5HVFA 1ELLP 3MRUA 3WABA 4F9UA 3B2YA 3IIBA 1XJOA 3FJUA 3H8EA 3I1UA 4OC3A 2AFUA 3S9MA 4OIWA 3IFEA 4MCQA 3BI0A 5LYDA 3IC1A 2CIJA 1F2OA 5I4MA 3WC7A 2V77A 1ZLHA 5LYFA 1ZG7A 4EWTA 3NH4A 2PJ0A 2Q51A 4UEEA 3D68A 3GUXA 5CBMA 3FECA 3PBBA 4A37A 2F8HA 1TKJA 4G1PA 3H8FA 1Y0YA 4P45A 3KGQA 4UEFA 3B3VA 2J9AA 4W9YA 2EWBA 4PPZA 3CPXA 2BO9A 4UF4A 4YWYA 2HC9A 1LFWA 2QVPA 1QQ9A 5JGFA 2ZEEA 4OMEA 3FEEA 1JQGA 5K8MA 2AFOA 2BOAA 3L2NA 3IWWA 2ZEDA 4X2TA 8CPAA 4MHZA 2CTBA 4R76A 2PJ6A 2V8VA 4NGTA 4DYOA 4A94A 2AFWA 4P6YA 5J1QA 2CTCA 3NH8A 1CPSA 4IAVA 1AMPA 2RFHA 4WJBA 2DEAA 5D29A 1TKFA 3IEHA 5CPAA 2GLFA 1HDQA 3BXMA 3KASA 4WWVA 3IJ3A 3GLJA 7CPAA 4ZX8A 3V7ZA 3PB9X 2PVWA 4PXEA 4FWUA 4P4IA 3FX6A 1HDUA 1YW4A 3NH5A 2PRQA 2C6GA 2QJ8A 3CDXA 2AFMA 3SI0A 1CP7A 4TWEA 4P4BA 4X3RA 2PJ1A 1CG2A 5LRJA 1FNOA 4NFRA 5HVGA 4ZY1A 1YW6A 1M4LA 1CP6A 3CT9A 1VGYA 4UIBA 4NGSA 2EK8A 2G9DA 5K8NA 2O4HA 5K8OA 3PB6X 4MHPA 2C1CA 4FAIA 3ISZA 2BCOA 1LAPA 1TF9A 3PFOA 2NYQA 4F8ZA 4PXDA 3V38A 2F7VA 1HEEA 3PBEA 3SJXA 1EE3P 3RZAA 1LAMA 2ZOFA 4P10A 5THWA 1CPXA 4UIAA 2PJ8A 4X8IA 3WT4A 4R6TA 4JZ0A 2I3CA 3NFZA 3HLPA 2ZEHA 1Z5RA 4MHYA 5JM6A 5LRKA 2IQ6A 1QMUA 3CPAA 4OC1A 3S9NA
chains in the Genus database with same CATH superfamily
1Z2LA 3P2FA 2H5MA 4M6GA 5LYLA 4F9VA 4HPSA 3T90A 3RBUA 4IHMA 4FBEA 3PB8X 3RNZA 1I21A 4C68A 1VHEA 3ISXA 2JLMA 5AG6A 1M4GA 1Z8XA 4GXHA 3SXNA 4ZYQA 4PXBA 4LQGA 3I9SA 1XMTA 4UBRA 1OBRA 4OC5A 2IMOA 3KI9A 3JTKA 2AJ6A 2AE6A 3DR6A 5BWAB 3BI1A 2R7HA 4MCRA 1B87A 4CAEA 4K3NA 4IK2A 1YK3A 4CGPA 1LRZA 3FVLA 4KOTA 1BPMA 2Q0YA 2WUUA 2X7BA 2YNDA 4AXVA 1IICA 4CGMA 6CPAA 2WYRA 4FD5A 4UA3A 3KHXA 4L89A 2NSMA 3LMSA 1TXRA 4GS4A 1Q2CA 4MCPA 4MHDA 4CRYB 2JEVA 2BL1A 2CF4A 5G20A 4FD7A 4ZY2A 5F47A 2A4NA 2ANPA 3DR8A 3G8WA 3LD2A 1FT7A 4OC4A 2Y0MA 5F09A 3S6FA 3SJFA 4AVAA 4MY0A 1FY7A 2OU2A 2FS5A 2ZEGA 2ZENA 5G1ZA 1TF8A 4QB9A 2P6FA 1LOKA 3IWGA 1F2PA 2GLJA 3TO9A 4A2ZA 4CRZB 4NJRA 3R1KA 2WPXA 3B35A 2Q4VA 1S60A 3F8KA 1XBUA 2Z3MA 4JWPA 2VZZA 2J8NA 2PJCA 2OH1A 2DPSA 4CPAA 4R7MA 2JDDA 4MXUA 5C82A 1XRYA 5J8CA 1ZG9A 4R9MA 3TTHA 5G21A 4B5OA 4CS0B 1KWMA 4EMEA 4ONUA 1NE9A 1RO5A 3IWEA 3WC6A 4KOXA 1XMBA 1YLEA 3GB0A 3PB7X 1RTQA 4YRHA 4UWJA 4CAWA 2B4DA 3JUWA 5LRGA 3TE4A 2Q43A 4Y49B 2OOTA 1Y0RA 3B3SA 4TNUA 2PJ9A 5ISVA 3D3SA 4NGRA 1WWZA 3S9LA 3K2KA 4MFKA 5K8PA 4PK2A 2Q4ZA 4ZI6A 3QAHA 4H6UA 3D4UA 2F5IA 3IU1A 4PXCA 3T9YA 1IY7A 2REEA 1YLOA 3JVNA 2BEIA 3K9UA 4XPLA 2G3AA 3FF3A 1Q7LA 3NE7A 3JRUA 3BJ7A 2C27A 5EBVA 1TKHA 4MFJA 4R3LA 3TC8A 1P4NA 4ORFA 3SI2A 4UEZA 4B11A 1Z8LA 3IO1A 2V8HA 2WZNA 1DTDA 1Y7RA 3TT2A 2I79A 4MI4A 2PR8A 3KL9A 2VBQA 2IL4A 3KQZA 3SXOA 4NGNA 2DPTA 1S7NA 4AG7A 3UY5A 5H86A 4YU9A 2V8GA 4B5PA 2HV2A 3CXSA 1F57A 4P4JA 2Z3PA 4UFVA 2VZYA 2PR1A 4EFDA 1XF8A 2GREA 3R9EA 2IJZA 2ZPAA 1ARMA 2ODFA 3SHPA 4E2AA 1M4DA 5AG5A 4UFXA 4KZTA 1NSAA 2VL1A 3CXPA 4QC6A 4DJLA 3LODA 4I49A 1BAVA 1S7FA 3CZXA 3S6HA 1KUYA 5IX3A 4PSWA 1Z8TA 1IYLA 2PCUA 1BLLE 2GANA 3H8GA 2GU2A 4CAXA 2OZGA 3D67A 1CM0A 4ZX9A 4B6ZA 2ZEMA 4BD9A 2PJ5A 4ZGYB 3FIXA 3NA6A 4MBUA 4Q7AA 2EK9A 3N7ZA 1Y9WA 1ZLIA 3D7DA 1PYTB 2PJ7A 4KUBA 4P4EA 2Z3LA 4NF1A 3DLJA 3E0KA 4MFLA 4UFWA 2O53A 2ABZA 3F0AA 4R8FA 4KOUA 2JDCA 3PGPA 3PEIA 4YGOA 4AB7A 1ZG8A 4HNXB 4M3SA 2VQYA 3KR4A 3PZJA 3FNCA 3D7HA 3BJ8A 3PB4X 3TX8A 5DWNA 4R3KA 2ATRA 2ZEFA 4MFPA 4MJ8A 4PQAA 5H84A 5DWMA 4DUKA 1AUGA 2FE7A 1R3NA 4YFJA 2ARHA 3VATA 3SI1A 1Z4EA 4CGLA 3OWCA 3T8WA 2PJ3A 1X10A 1IGBA 3B3TA 3D66A 1GYTA 2PJBA 3FRMA 2VI7A 2XEGA 5D8NA 4A33A 1KZFA 3RAMA 2ZEOA 4ONWA 2JEWA 4XNHB 4OC2A 3WC5A 5AG7A 2Z3OA 5JPHA 1Z4RA 3D7GA 3N5FA 3SJEA 4C2XA 2V8DA 1VHOA 4OC0A 1UWYA 3D7FA 5ELYA 5GCNA 5F48A 3MN8A 4UWIA 4Z65A 1LANA 1PCAA 4JXQA 1YSJA 2GFQA 4IF5A 1PUAA 1LCPA 2EUIA 4GM5A 2FVGA 4HNYB 2OZHA 2OR4A 3PRTA 4CYQA 2DF5A 4XPKA 2Q4YA 3FH4A 5IV0A 4BINA 3TFYA 3DSBA 3KZWA 1ARLA 1XE4A 1VKCA 4BBHA 1BPNA 1YVOA 4P44A 4K30A 2PVVA 2PIZA 4NGMA 2PJ2A 2D4PA 1I1DA 4M6HA 4PV6A 2YNEA 3DGVA 3VARA 1VIXA 5G22A 1H8LA 2PJ4A 5LYIA 4MHNA 4BMHA 3G3SA 4MMOA 1J4JA 1BOBA 3KHZA 4RUHA 1XFOA 2ZEPA 4OKOA 2KCWA 4O23A 4KVME 3B7IA 3IU2A 3LACA 4H2KA 4OIDA 2K5TA 2PE3A 4LQ6A 3SJGA 2WSAA 5JH9A 2PSWA 2FT0A 1Y7EA 3ZJ0A 2B3UA 3FBUA 4B12A 4A30A 5FVJA 2XEFA 3KQXA 4ZY0A 4MCSA 3PFEA 1ELMP 4HNWB 2BUEA 1OZPA 3LWUA 2DXQA 3VH9A 4CGNA 2AFSA 2ZOGA 3GKRA 4PSXA 2PIYA 3B3WA 1YQEA 4A31A 2ZW6A 1YMEA 1ZO0A 2FCKA 4C2ZA 2CNMA 4MRIA 4C2YA 5DS0A 2ZELA 2HB6A 1AYEA 2B3VA 2XEJA 4F0XA 3KKWA 3B3CA 5IB9A 2C6CA 4JYWA 4NGPA 1DE4C 5I0CA 2XEIA 5HVHA 4FUUA 5EMIA 4P4DA 3FMCA 3TOAA 3F5BA 1R43A 1CBXA 4NGQA 2AFXA 1CX8A 1U6MA 4KSIA 4M6IA 3KR5A 1V0CA 1XEBA 4RS2A 4P4FA 5IB0A 5AGEA 4NJQA 2POKA 2AFZA 4KVOE 4R57A 2PJAA 4Q38A 3EC4A 3QNVA 3H5ZA 2RB7A 3FYNA 2JBKA 3MGDA 2Z11A 4CYNA 1UFHA 1GHEA 2OB0A 5HXDA 2QYVA 4QBJA 1S3ZA 3EXNA 4H89A 4A39A 3W6XA 1QSTA 4A38A 3EFAA 4XPDB 3HUVA 2JBJA 3FEDA 2C6PA 3R95A 4OP4A 3BHXA 4Y49C 4UCMA 4JLYA 2B5GB 3K9TA 4QUSA 5HVFA 2P6GA 1ELLP 4C7HA 3MRUA 2Z0ZA 3QB8A 2EVNA 1Q2YA 3WABA 4F9UA 1YREA 1S5KA 3B2YA 3IIBA 1XJOA 3FJUA 3H8EA 5EC4A 1KUXA 3I1UA 2FXFA 4OC3A 1QSOA 1S7LA 2AFUA 3S9MA 1R57A 2QECA 4OIWA 1P0HA 3S6GA 2Q44A 1M4IA 3IFEA 1N71A 4CYPA 4A32A 4MCQA 1YR0A 2G0BA 3BI0A 1PU9A 1IIDA 3IC1A 5LYDA 2CIJA 4RI1A 5KTCA 4II9A 1F2OA 5I4MA 4U5YA 3WC7A 2V77A 3V8IA 1ZLHA 1VHSA 3RO0A 1JWQA 1BO4A 3P2HA 4KORA 4ZBGA 1ZG7A 1QSMA 5LYFA 4EWTA 2OZUA 3NH4A 2PJ0A 4NXYA 2Q51A 4UEEA 3D68A 3GUXA 1I12A 5CBMA 1L0CA 3FECA 2I00A 2FIAA 1S7KA 3PBBA 2EBJA 4A37A 1IYKA 2Z10A 5CNPA 2F8HA 1TKJA 4G1PA 4XPDC 1Z9UA 3H8FA 1Y0YA 3FB3A 3B8GA 1TIQA 4C7IA 4JD6A 4P45A 4EVYA 3KGQA 4UEFA 4KSAA 3ZZIA 2ZW5A 2J9AA 3B3VA 2PRBA 2QMLA 1IB1E 2VEZA 2EWBA 4W9YA 4PPZA 4DNCA 3CPXA 1K4JA 2BO9A 5KTAA 4HKFA 5A28A 4UF4A 4YWYA 2HC9A 1MJBA 1LFWA 2Q04A 4L8AA 4LUAA 1M44A 3A9LA 5E96A 4B13A 3I3GA 2QVPA 4CGOA 1QQ9A 4OLLA 5JGFA 2HQYA 2RC4A 2ZEEA 4OMEA 4E8OA 2QIRA 1JQGA 3FEEA 4KUAA 5K8MA 2AFOA 2BOAA 1XIXA 2R98A 3L2NA 4X5KA 1YVKA 1RXTA 2EO8A 3IWWA 1Y9KA 2ZEDA 1Q2DA 2PDOA 4X2TA 2B4BA 2CNTA 8CPAA 4MHZA 2CTBA 4R76A 2PJ6A 1MJAA 1MJ9A 1XOVA 2V8VA 4NGTA 3TO6A 4CAVA 4A94A 4DYOA 2AFWA 2PQ8A 3EY5A 4P6YA 4B10A 5J1QA 4LX9A 2REFA 3DDDA 2CTCA 2ZW4A 3NH8A 1IOIA 1WK4A 4OAEA 1CPSA 4IAVA 1AMPA 3IGRA 2B58A 2B4DB 2NMTA 2RFHA 1IOFA 4XNHC 2Q7SA 5J8FA 2YNCA 4WJBA 2DEAA 5D29A 4CAFA 3VWEA 1TKFA 3IEHA 4J3GA 2GLFA 1HDQA 3D8PA 4KLVA 5CPAA 4CYOA 3BXMA 3KASA 4WWVA 3IJ3A 4NEXA 3GLJA 2FL4A 4KOYA 4ZX8A 3V7ZA 7CPAA 2P0WA 3PB9X 2PVWA 4PXEA 4R87A 3R9FA 2WPWA 4FWUA 4FD6A 1NSLA 3NE8A 4P4IA 4UCNA 2HUZA 4JJXA 5JQ4A 3FX6A 1HDUA 2YNCC 1YW4A 2BSWA 2O28A 4AVBA 2J8MA 3GY9A 3NH5A 5A27A 2PRQA 4KLWA 2G3TA 1A2ZA 2C6GA 2QJ8A 3W91A 4KVXA 5AG4A 2PC1A 1X12A 1NMTA 3EO4A 4KOVA 3DNSA 3CXQA 3CDXA 3C26A 2AFMA 2FSRA 4AVCA 3SI0A 1CP7A 4TWEA 4P4BA 4X3RA 2PJ1A 3S6KA 1IU8A 4B5PB 1CG2A 4IUSA 5LRJA 1FNOA 4M85A 4KOSA 2CNSA 4UCPA 4A95A 4MFQA 2VXKA 2Q7BA 4B14A 3GIUA 1YX0A 4FD4A 4NFRA 1B6BA 5HVGA 4F0YA 4ZY1A 1CJWA 1M4LA 1YW6A 1CP6A 3D2MA 3CT9A 1VGYA 4Q36A 4UIBA 2Z3KA 3W6SA 3PP9A 3R96A 4NGSA 2EK8A 3RYOA 5F49A 4KOWA 4KS9A 2G9DA 4NSQA 4F6AA 5K8NA 2ZXVA 4QVTA 2YGWA 2O4HA 2P6EA 1KUVA 2R8VA 3R9GA 4RN7A 5K8OA 4KSFA 4U9YA 1QSNA 3TO7A 3PB6X 4MHPA 2C1CA 1YGHA 4H6ZA 4E0AA 1ON0A 4FAIA 3ISZA 2BCOA 1LAPA 5HH1A 1TF9A 3PFOA 2NYQA 3D2PA 2D4OA 1MK4A 1SQHA 4F8ZA 4PXDA 3V38A 2F7VA 2Z3NA 1HEEA 4U9ZA 4NCZA 3PBEA 3SJXA 1EE3P 3RZAA 5C88A 5F46A 2FIWA 2J8RA 5HMNA 5KTDA 1LAMA 1M1DA 2ZOFA 2B5GA 1QSRA 2CY2A 3FXTA 4P10A 5THWA 4PK3A 1CPXA 4UIAA 3TOBA 3VWDA 3TCVA 2R1IA 4MFZA 2PJ8A 4X8IA 3H4QA 1Z8WA 2ZW7A 4OADA 4MY3A 3WT4A 4R6TA 4JZ0A 3GYAA 3WR7A 3QAYA 2I3CA 3NFZA 3BLNA 3HLPA 2GIVA 4JXRA 2ZEHA 1Z5RA 4MHYA 2CXAA 4AG9A 5JM6A 5LRKA 2IQ6A 1QMUA 3CPAA 4OC1A 3S9NA 2GE3A
chains in the Genus database with same CATH topology
1Z2LA 5LYLA 4F9VA 3RBUA 4IHMA 4FBEA 3PB8X 1VHEA 3ISXA 4ZYQA 4PXBA 4LQGA 1OBRA 4OC5A 2IMOA 3KI9A 3BI1A 4MCRA 4K3NA 4IK2A 3FVLA 1BPMA 4AXVA 6CPAA 2WYRA 3KHXA 2NSMA 3LMSA 1TXRA 4MCPA 2CF4A 4ZY2A 2ANPA 1FT7A 4OC4A 5F09A 3SJFA 2ZENA 2ZEGA 1TF8A 1LOKA 1F2PA 2GLJA 4NJRA 3B35A 1XBUA 2PJCA 4CPAA 4R7MA 4MXUA 1XRYA 1ZG9A 1KWMA 4EMEA 3WC6A 1XMBA 3GB0A 3PB7X 1RTQA 5LRGA 2Q43A 2OOTA 1Y0RA 3B3SA 4TNUA 2PJ9A 4NGRA 3S9LA 3K2KA 5K8PA 2Q4ZA 4ZI6A 3D4UA 4PXCA 1IY7A 1YLOA 3FF3A 1Q7LA 3JRUA 1TKHA 3TC8A 3SI2A 4UEZA 1Z8LA 3IO1A 2V8HA 2WZNA 1DTDA 3KL9A 3KQZA 4NGNA 4YU9A 2V8GA 1F57A 4P4JA 4EFDA 2GREA 2IJZA 1ARMA 1NSAA 2VL1A 4DJLA 1BAVA 2PCUA 1BLLE 3H8GA 2GU2A 3D67A 4ZX9A 4B6ZA 2ZEMA 4BD9A 2PJ5A 3NA6A 4Q7AA 2EK9A 1ZLIA 3D7DA 1PYTB 2PJ7A 4P4EA 3DLJA 2O53A 2ABZA 4R8FA 3PEIA 1ZG8A 3KR4A 3PB4X 3D7HA 3TX8A 4DUKA 2ZEFA 4PQAA 1R3NA 3VATA 3SI1A 3T8WA 2PJ3A 1IGBA 3B3TA 3D66A 1GYTA 2PJBA 2XEGA 5D8NA 3RAMA 2ZEOA 4ONWA 2JEWA 4OC2A 3WC5A 3D7GA 3N5FA 3SJEA 2V8DA 1VHOA 4OC0A 1UWYA 3D7FA 5ELYA 4Z65A 3MN8A 1LANA 1PCAA 1YSJA 1LCPA 4GM5A 2FVGA 2OR4A 3PRTA 3FH4A 3KZWA 1ARLA 1BPNA 4P44A 2PVVA 2PIZA 4NGMA 2PJ2A 3DGVA 3VARA 1VIXA 1H8LA 2PJ4A 5LYIA 4MHNA 4MMOA 3KHZA 4RUHA 1XFOA 2ZEPA 4OKOA 4O23A 3B7IA 4H2KA 4OIDA 3SJGA 2PE3A 5JH9A 1Y7EA 2XEFA 3KQXA 4ZY0A 4MCSA 3PFEA 1ELMP 3LWUA 3VH9A 2AFSA 2ZOGA 2PIYA 3B3WA 1YMEA 4MRIA 5DS0A 2ZELA 2HB6A 1AYEA 2XEJA 3B3CA 5IB9A 2C6CA 4JYWA 4NGPA 1DE4C 2XEIA 5HVHA 4FUUA 4P4DA 3FMCA 1R43A 1CBXA 4NGQA 2AFXA 1CX8A 4KSIA 3KR5A 4P4FA 4NJQA 2POKA 2AFZA 2PJAA 3QNVA 2RB7A 2JBKA 5HXDA 2QYVA 4A39A 4A38A 3HUVA 2JBJA 3FEDA 2C6PA 4OP4A 3BHXA 3K9TA 5HVFA 1ELLP 3MRUA 3WABA 4F9UA 3B2YA 3IIBA 1XJOA 3FJUA 3H8EA 3I1UA 4OC3A 2AFUA 3S9MA 4OIWA 3IFEA 4MCQA 3BI0A 5LYDA 3IC1A 2CIJA 1F2OA 5I4MA 3WC7A 2V77A 1ZLHA 5LYFA 1ZG7A 4EWTA 3NH4A 2PJ0A 2Q51A 4UEEA 3D68A 3GUXA 5CBMA 3FECA 3PBBA 4A37A 2F8HA 1TKJA 4G1PA 3H8FA 1Y0YA 4P45A 3KGQA 4UEFA 3B3VA 2J9AA 4W9YA 2EWBA 4PPZA 3CPXA 2BO9A 4UF4A 4YWYA 2HC9A 1LFWA 2QVPA 1QQ9A 5JGFA 2ZEEA 4OMEA 3FEEA 1JQGA 5K8MA 2AFOA 2BOAA 3L2NA 3IWWA 2ZEDA 4X2TA 8CPAA 4MHZA 2CTBA 4R76A 2PJ6A 2V8VA 4NGTA 4DYOA 4A94A 2AFWA 4P6YA 5J1QA 2CTCA 3NH8A 1CPSA 4IAVA 1AMPA 2RFHA 4WJBA 2DEAA 5D29A 1TKFA 3IEHA 5CPAA 2GLFA 1HDQA 3BXMA 3KASA 4WWVA 3IJ3A 3GLJA 7CPAA 4ZX8A 3V7ZA 3PB9X 2PVWA 4PXEA 4FWUA 4P4IA 3FX6A 1HDUA 1YW4A 3NH5A 2PRQA 2C6GA 2QJ8A 3CDXA 2AFMA 3SI0A 1CP7A 4TWEA 4P4BA 4X3RA 2PJ1A 1CG2A 5LRJA 1FNOA 4NFRA 5HVGA 4ZY1A 1YW6A 1M4LA 1CP6A 3CT9A 1VGYA 4UIBA 4NGSA 2EK8A 2G9DA 5K8NA 2O4HA 5K8OA 3PB6X 4MHPA 2C1CA 4FAIA 3ISZA 2BCOA 1LAPA 1TF9A 3PFOA 2NYQA 4F8ZA 4PXDA 3V38A 2F7VA 1HEEA 3PBEA 3SJXA 1EE3P 3RZAA 1LAMA 2ZOFA 4P10A 5THWA 1CPXA 4UIAA 2PJ8A 4X8IA 3WT4A 4R6TA 4JZ0A 2I3CA 3NFZA 3HLPA 2ZEHA 1Z5RA 4MHYA 5JM6A 5LRKA 2IQ6A 1QMUA 3CPAA 4OC1A 3S9NA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1Z2L A;  5LYL A;  4F9V A;  3RBU A;  4IHM A;  4FBE A;  3PB8 X;  1VHE A;  3ISX A;  4ZYQ A;  4PXB A;  4LQG A;  1OBR A;  4OC5 A;  2IMO A;  3KI9 A;  3BI1 A;  4MCR A;  4K3N A;  4IK2 A;  3FVL A;  1BPM A;  4AXV A;  6CPA A;  2WYR A;  3KHX A;  2NSM A;  3LMS A;  1TXR A;  4MCP A;  2CF4 A;  4ZY2 A;  2ANP A;  1FT7 A;  4OC4 A;  5F09 A;  3SJF A;  2ZEN A;  2ZEG A;  1TF8 A;  1LOK A;  1F2P A;  2GLJ A;  4NJR A;  3B35 A;  1XBU A;  2PJC A;  4CPA A;  4R7M A;  4MXU A;  1XRY A;  1ZG9 A;  1KWM A;  4EME A;  3WC6 A;  1XMB A;  3GB0 A;  3PB7 X;  1RTQ A;  5LRG A;  2Q43 A;  2OOT A;  1Y0R A;  3B3S A;  4TNU A;  2PJ9 A;  4NGR A;  3S9L A;  3K2K A;  5K8P A;  2Q4Z A;  4ZI6 A;  3D4U A;  4PXC A;  1IY7 A;  1YLO A;  3FF3 A;  1Q7L A;  3JRU A;  1TKH A;  3TC8 A;  3SI2 A;  4UEZ A;  1Z8L A;  3IO1 A;  2V8H A;  2WZN A;  1DTD A;  3KL9 A;  3KQZ A;  4NGN A;  4YU9 A;  2V8G A;  1F57 A;  4P4J A;  4EFD A;  2GRE A;  2IJZ A;  1ARM A;  1NSA A;  2VL1 A;  4DJL A;  1BAV A;  2PCU A;  1BLL E;  3H8G A;  2GU2 A;  3D67 A;  4ZX9 A;  4B6Z A;  2ZEM A;  4BD9 A;  2PJ5 A;  3NA6 A;  4Q7A A;  2EK9 A;  1ZLI A;  3D7D A;  1PYT B;  2PJ7 A;  4P4E A;  3DLJ A;  2O53 A;  2ABZ A;  4R8F A;  3PEI A;  1ZG8 A;  3KR4 A;  3PB4 X;  3D7H A;  3TX8 A;  4DUK A;  2ZEF A;  4PQA A;  1R3N A;  3VAT A;  3SI1 A;  3T8W A;  2PJ3 A;  1IGB A;  3B3T A;  3D66 A;  1GYT A;  2PJB A;  2XEG A;  5D8N A;  3RAM A;  2ZEO A;  4ONW A;  2JEW A;  4OC2 A;  3WC5 A;  3D7G A;  3N5F A;  3SJE A;  2V8D A;  1VHO A;  4OC0 A;  1UWY A;  3D7F A;  5ELY A;  4Z65 A;  3MN8 A;  1LAN A;  1PCA A;  1YSJ A;  1LCP A;  4GM5 A;  2FVG A;  2OR4 A;  3PRT A;  3FH4 A;  3KZW A;  1ARL A;  1BPN A;  4P44 A;  2PVV A;  2PIZ A;  4NGM A;  2PJ2 A;  3DGV A;  3VAR A;  1VIX A;  1H8L A;  2PJ4 A;  5LYI A;  4MHN A;  4MMO A;  3KHZ A;  4RUH A;  1XFO A;  2ZEP A;  4OKO A;  4O23 A;  3B7I A;  4H2K A;  4OID A;  3SJG A;  2PE3 A;  5JH9 A;  1Y7E A;  2XEF A;  3KQX A;  4ZY0 A;  4MCS A;  3PFE A;  1ELM P;  3LWU A;  3VH9 A;  2AFS A;  2ZOG A;  2PIY A;  3B3W A;  1YME A;  4MRI A;  5DS0 A;  2ZEL A;  2HB6 A;  1AYE A;  2XEJ A;  3B3C A;  5IB9 A;  2C6C A;  4JYW A;  4NGP A;  1DE4 C;  2XEI A;  5HVH A;  4FUU A;  4P4D A;  3FMC A;  1R43 A;  1CBX A;  4NGQ A;  2AFX A;  1CX8 A;  4KSI A;  3KR5 A;  4P4F A;  4NJQ A;  2POK A;  2AFZ A;  2PJA A;  3QNV A;  2RB7 A;  2JBK A;  5HXD A;  2QYV A;  4A39 A;  4A38 A;  3HUV A;  2JBJ A;  3FED A;  2C6P A;  4OP4 A;  3BHX A;  3K9T A;  5HVF A;  1ELL P;  3MRU A;  3WAB A;  4F9U A;  3B2Y A;  3IIB A;  1XJO A;  3FJU A;  3H8E A;  3I1U A;  4OC3 A;  2AFU A;  3S9M A;  4OIW A;  3IFE A;  4MCQ A;  3BI0 A;  5LYD A;  3IC1 A;  2CIJ A;  1F2O A;  5I4M A;  3WC7 A;  2V77 A;  1ZLH A;  5LYF A;  1ZG7 A;  4EWT A;  3NH4 A;  2PJ0 A;  2Q51 A;  4UEE A;  3D68 A;  3GUX A;  5CBM A;  3FEC A;  3PBB A;  4A37 A;  2F8H A;  1TKJ A;  4G1P A;  3H8F A;  1Y0Y A;  4P45 A;  3KGQ A;  4UEF A;  3B3V A;  2J9A A;  4W9Y A;  2EWB A;  4PPZ A;  3CPX A;  2BO9 A;  4UF4 A;  4YWY A;  2HC9 A;  1LFW A;  2QVP A;  1QQ9 A;  5JGF A;  2ZEE A;  4OME A;  3FEE A;  1JQG A;  5K8M A;  2AFO A;  2BOA A;  3L2N A;  3IWW A;  2ZED A;  4X2T A;  8CPA A;  4MHZ A;  2CTB A;  4R76 A;  2PJ6 A;  2V8V A;  4NGT A;  4DYO A;  4A94 A;  2AFW A;  4P6Y A;  5J1Q A;  2CTC A;  3NH8 A;  1CPS A;  4IAV A;  1AMP A;  2RFH A;  4WJB A;  2DEA A;  5D29 A;  1TKF A;  3IEH A;  5CPA A;  2GLF A;  1HDQ A;  3BXM A;  3KAS A;  4WWV A;  3IJ3 A;  3GLJ A;  7CPA A;  4ZX8 A;  3V7Z A;  3PB9 X;  2PVW A;  4PXE A;  4FWU A;  4P4I A;  3FX6 A;  1HDU A;  1YW4 A;  3NH5 A;  2PRQ A;  2C6G A;  2QJ8 A;  3CDX A;  2AFM A;  3SI0 A;  1CP7 A;  4TWE A;  4P4B A;  4X3R A;  2PJ1 A;  1CG2 A;  5LRJ A;  1FNO A;  4NFR A;  5HVG A;  4ZY1 A;  1YW6 A;  1M4L A;  1CP6 A;  3CT9 A;  1VGY A;  4UIB A;  4NGS A;  2EK8 A;  2G9D A;  5K8N A;  2O4H A;  5K8O A;  3PB6 X;  4MHP A;  2C1C A;  4FAI A;  3ISZ A;  2BCO A;  1LAP A;  1TF9 A;  3PFO A;  2NYQ A;  4F8Z A;  4PXD A;  3V38 A;  2F7V A;  1HEE A;  3PBE A;  3SJX A;  1EE3 P;  3RZA A;  1LAM A;  2ZOF A;  4P10 A;  5THW A;  1CPX A;  4UIA A;  2PJ8 A;  4X8I A;  3WT4 A;  4R6T A;  4JZ0 A;  2I3C A;  3NFZ A;  3HLP A;  2ZEH A;  1Z5R A;  4MHY A;  5JM6 A;  5LRK A;  2IQ6 A;  1QMU A;  3CPA A;  4OC1 A;  3S9N A; 
#chains in the Genus database with same CATH topology
 1Z2L A;  3P2F A;  2H5M A;  4M6G A;  5LYL A;  4F9V A;  4HPS A;  3T90 A;  3RBU A;  4IHM A;  4FBE A;  3PB8 X;  3RNZ A;  1I21 A;  4C68 A;  1VHE A;  3ISX A;  2JLM A;  5AG6 A;  1M4G A;  1Z8X A;  4GXH A;  3SXN A;  4ZYQ A;  4PXB A;  4LQG A;  3I9S A;  1XMT A;  4UBR A;  1OBR A;  4OC5 A;  2IMO A;  3KI9 A;  3JTK A;  2AJ6 A;  2AE6 A;  3DR6 A;  5BWA B;  3BI1 A;  2R7H A;  4MCR A;  1B87 A;  4CAE A;  4K3N A;  4IK2 A;  1YK3 A;  4CGP A;  1LRZ A;  3FVL A;  4KOT A;  1BPM A;  2Q0Y A;  2WUU A;  2X7B A;  2YND A;  4AXV A;  1IIC A;  4CGM A;  6CPA A;  2WYR A;  4FD5 A;  4UA3 A;  3KHX A;  4L89 A;  2NSM A;  3LMS A;  1TXR A;  4GS4 A;  1Q2C A;  4MCP A;  4MHD A;  4CRY B;  2JEV A;  2BL1 A;  2CF4 A;  5G20 A;  4FD7 A;  4ZY2 A;  5F47 A;  2A4N A;  2ANP A;  3DR8 A;  3G8W A;  3LD2 A;  1FT7 A;  4OC4 A;  2Y0M A;  5F09 A;  3S6F A;  3SJF A;  4AVA A;  4MY0 A;  1FY7 A;  2OU2 A;  2FS5 A;  2ZEG A;  2ZEN A;  5G1Z A;  1TF8 A;  4QB9 A;  2P6F A;  1LOK A;  3IWG A;  1F2P A;  2GLJ A;  3TO9 A;  4A2Z A;  4CRZ B;  4NJR A;  3R1K A;  2WPX A;  3B35 A;  2Q4V A;  1S60 A;  3F8K A;  1XBU A;  2Z3M A;  4JWP A;  2VZZ A;  2J8N A;  2PJC A;  2OH1 A;  2DPS A;  4CPA A;  4R7M A;  2JDD A;  4MXU A;  5C82 A;  1XRY A;  5J8C A;  1ZG9 A;  4R9M A;  3TTH A;  5G21 A;  4B5O A;  4CS0 B;  1KWM A;  4EME A;  4ONU A;  1NE9 A;  1RO5 A;  3IWE A;  3WC6 A;  4KOX A;  1XMB A;  1YLE A;  3GB0 A;  3PB7 X;  1RTQ A;  4YRH A;  4UWJ A;  4CAW A;  2B4D A;  3JUW A;  5LRG A;  3TE4 A;  2Q43 A;  4Y49 B;  2OOT A;  1Y0R A;  3B3S A;  4TNU A;  2PJ9 A;  5ISV A;  3D3S A;  4NGR A;  1WWZ A;  3S9L A;  3K2K A;  4MFK A;  5K8P A;  4PK2 A;  2Q4Z A;  4ZI6 A;  3QAH A;  4H6U A;  3D4U A;  2F5I A;  3IU1 A;  4PXC A;  3T9Y A;  1IY7 A;  2REE A;  1YLO A;  3JVN A;  2BEI A;  3K9U A;  4XPL A;  2G3A A;  3FF3 A;  1Q7L A;  3NE7 A;  3JRU A;  3BJ7 A;  2C27 A;  5EBV A;  1TKH A;  4MFJ A;  4R3L A;  3TC8 A;  1P4N A;  4ORF A;  3SI2 A;  4UEZ A;  4B11 A;  1Z8L A;  3IO1 A;  2V8H A;  2WZN A;  1DTD A;  1Y7R A;  3TT2 A;  2I79 A;  4MI4 A;  2PR8 A;  3KL9 A;  2VBQ A;  2IL4 A;  3KQZ A;  3SXO A;  4NGN A;  2DPT A;  1S7N A;  4AG7 A;  3UY5 A;  5H86 A;  4YU9 A;  2V8G A;  4B5P A;  2HV2 A;  3CXS A;  1F57 A;  4P4J A;  2Z3P A;  4UFV A;  2VZY A;  2PR1 A;  4EFD A;  1XF8 A;  2GRE A;  3R9E A;  2IJZ A;  2ZPA A;  1ARM A;  2ODF A;  3SHP A;  4E2A A;  1M4D A;  5AG5 A;  4UFX A;  4KZT A;  1NSA A;  2VL1 A;  3CXP A;  4QC6 A;  4DJL A;  3LOD A;  4I49 A;  1BAV A;  1S7F A;  3CZX A;  3S6H A;  1KUY A;  5IX3 A;  4PSW A;  1Z8T A;  1IYL A;  2PCU A;  1BLL E;  2GAN A;  3H8G A;  2GU2 A;  4CAX A;  2OZG A;  3D67 A;  1CM0 A;  4ZX9 A;  4B6Z A;  2ZEM A;  4BD9 A;  2PJ5 A;  4ZGY B;  3FIX A;  3NA6 A;  4MBU A;  4Q7A A;  2EK9 A;  3N7Z A;  1Y9W A;  1ZLI A;  3D7D A;  1PYT B;  2PJ7 A;  4KUB A;  4P4E A;  2Z3L A;  4NF1 A;  3DLJ A;  3E0K A;  4MFL A;  4UFW A;  2O53 A;  2ABZ A;  3F0A A;  4R8F A;  4KOU A;  2JDC A;  3PGP A;  3PEI A;  4YGO A;  4AB7 A;  1ZG8 A;  4HNX B;  4M3S A;  2VQY A;  3KR4 A;  3PZJ A;  3FNC A;  3D7H A;  3BJ8 A;  3PB4 X;  3TX8 A;  5DWN A;  4R3K A;  2ATR A;  2ZEF A;  4MFP A;  4MJ8 A;  4PQA A;  5H84 A;  5DWM A;  4DUK A;  1AUG A;  2FE7 A;  1R3N A;  4YFJ A;  2ARH A;  3VAT A;  3SI1 A;  1Z4E A;  4CGL A;  3OWC A;  3T8W A;  2PJ3 A;  1X10 A;  1IGB A;  3B3T A;  3D66 A;  1GYT A;  2PJB A;  3FRM A;  2VI7 A;  2XEG A;  5D8N A;  4A33 A;  1KZF A;  3RAM A;  2ZEO A;  4ONW A;  2JEW A;  4XNH B;  4OC2 A;  3WC5 A;  5AG7 A;  2Z3O A;  5JPH A;  1Z4R A;  3D7G A;  3N5F A;  3SJE A;  4C2X A;  2V8D A;  1VHO A;  4OC0 A;  1UWY A;  3D7F A;  5ELY A;  5GCN A;  5F48 A;  3MN8 A;  4UWI A;  4Z65 A;  1LAN A;  1PCA A;  4JXQ A;  1YSJ A;  2GFQ A;  4IF5 A;  1PUA A;  1LCP A;  2EUI A;  4GM5 A;  2FVG A;  4HNY B;  2OZH A;  2OR4 A;  3PRT A;  4CYQ A;  2DF5 A;  4XPK A;  2Q4Y A;  3FH4 A;  5IV0 A;  4BIN A;  3TFY A;  3DSB A;  3KZW A;  1ARL A;  1XE4 A;  1VKC A;  4BBH A;  1BPN A;  1YVO A;  4P44 A;  4K30 A;  2PVV A;  2PIZ A;  4NGM A;  2PJ2 A;  2D4P A;  1I1D A;  4M6H A;  4PV6 A;  2YNE A;  3DGV A;  3VAR A;  1VIX A;  5G22 A;  1H8L A;  2PJ4 A;  5LYI A;  4MHN A;  4BMH A;  3G3S A;  4MMO A;  1J4J A;  1BOB A;  3KHZ A;  4RUH A;  1XFO A;  2ZEP A;  4OKO A;  2KCW A;  4O23 A;  4KVM E;  3B7I A;  3IU2 A;  3LAC A;  4H2K A;  4OID A;  2K5T A;  2PE3 A;  4LQ6 A;  3SJG A;  2WSA A;  5JH9 A;  2PSW A;  2FT0 A;  1Y7E A;  3ZJ0 A;  2B3U A;  3FBU A;  4B12 A;  4A30 A;  5FVJ A;  2XEF A;  3KQX A;  4ZY0 A;  4MCS A;  3PFE A;  1ELM P;  4HNW B;  2BUE A;  1OZP A;  3LWU A;  2DXQ A;  3VH9 A;  4CGN A;  2AFS A;  2ZOG A;  3GKR A;  4PSX A;  2PIY A;  3B3W A;  1YQE A;  4A31 A;  2ZW6 A;  1YME A;  1ZO0 A;  2FCK A;  4C2Z A;  2CNM A;  4MRI A;  4C2Y A;  5DS0 A;  2ZEL A;  2HB6 A;  1AYE A;  2B3V A;  2XEJ A;  4F0X A;  3KKW A;  3B3C A;  5IB9 A;  2C6C A;  4JYW A;  4NGP A;  1DE4 C;  5I0C A;  2XEI A;  5HVH A;  4FUU A;  5EMI A;  4P4D A;  3FMC A;  3TOA A;  3F5B A;  1R43 A;  1CBX A;  4NGQ A;  2AFX A;  1CX8 A;  1U6M A;  4KSI A;  4M6I A;  3KR5 A;  1V0C A;  1XEB A;  4RS2 A;  4P4F A;  5IB0 A;  5AGE A;  4NJQ A;  2POK A;  2AFZ A;  4KVO E;  4R57 A;  2PJA A;  4Q38 A;  3EC4 A;  3QNV A;  3H5Z A;  2RB7 A;  3FYN A;  2JBK A;  3MGD A;  2Z11 A;  4CYN A;  1UFH A;  1GHE A;  2OB0 A;  5HXD A;  2QYV A;  4QBJ A;  1S3Z A;  3EXN A;  4H89 A;  4A39 A;  3W6X A;  1QST A;  4A38 A;  3EFA A;  4XPD B;  3HUV A;  2JBJ A;  3FED A;  2C6P A;  3R95 A;  4OP4 A;  3BHX A;  4Y49 C;  4UCM A;  4JLY A;  2B5G B;  3K9T A;  4QUS A;  5HVF A;  2P6G A;  1ELL P;  4C7H A;  3MRU A;  2Z0Z A;  3QB8 A;  2EVN A;  1Q2Y A;  3WAB A;  4F9U A;  1YRE A;  1S5K A;  3B2Y A;  3IIB A;  1XJO A;  3FJU A;  3H8E A;  5EC4 A;  1KUX A;  3I1U A;  2FXF A;  4OC3 A;  1QSO A;  1S7L A;  2AFU A;  3S9M A;  1R57 A;  2QEC A;  4OIW A;  1P0H A;  3S6G A;  2Q44 A;  1M4I A;  3IFE A;  1N71 A;  4CYP A;  4A32 A;  4MCQ A;  1YR0 A;  2G0B A;  3BI0 A;  1PU9 A;  1IID A;  3IC1 A;  5LYD A;  2CIJ A;  4RI1 A;  5KTC A;  4II9 A;  1F2O A;  5I4M A;  4U5Y A;  3WC7 A;  2V77 A;  3V8I A;  1ZLH A;  1VHS A;  3RO0 A;  1JWQ A;  1BO4 A;  3P2H A;  4KOR A;  4ZBG A;  1ZG7 A;  1QSM A;  5LYF A;  4EWT A;  2OZU A;  3NH4 A;  2PJ0 A;  4NXY A;  2Q51 A;  4UEE A;  3D68 A;  3GUX A;  1I12 A;  5CBM A;  1L0C A;  3FEC A;  2I00 A;  2FIA A;  1S7K A;  3PBB A;  2EBJ A;  4A37 A;  1IYK A;  2Z10 A;  5CNP A;  2F8H A;  1TKJ A;  4G1P A;  4XPD C;  1Z9U A;  3H8F A;  1Y0Y A;  3FB3 A;  3B8G A;  1TIQ A;  4C7I A;  4JD6 A;  4P45 A;  4EVY A;  3KGQ A;  4UEF A;  4KSA A;  3ZZI A;  2ZW5 A;  2J9A A;  3B3V A;  2PRB A;  2QML A;  1IB1 E;  2VEZ A;  2EWB A;  4W9Y A;  4PPZ A;  4DNC A;  3CPX A;  1K4J A;  2BO9 A;  5KTA A;  4HKF A;  5A28 A;  4UF4 A;  4YWY A;  2HC9 A;  1MJB A;  1LFW A;  2Q04 A;  4L8A A;  4LUA A;  1M44 A;  3A9L A;  5E96 A;  4B13 A;  3I3G A;  2QVP A;  4CGO A;  1QQ9 A;  4OLL A;  5JGF A;  2HQY A;  2RC4 A;  2ZEE A;  4OME A;  4E8O A;  2QIR A;  1JQG A;  3FEE A;  4KUA A;  5K8M A;  2AFO A;  2BOA A;  1XIX A;  2R98 A;  3L2N A;  4X5K A;  1YVK A;  1RXT A;  2EO8 A;  3IWW A;  1Y9K A;  2ZED A;  1Q2D A;  2PDO A;  4X2T A;  2B4B A;  2CNT A;  8CPA A;  4MHZ A;  2CTB A;  4R76 A;  2PJ6 A;  1MJA A;  1MJ9 A;  1XOV A;  2V8V A;  4NGT A;  3TO6 A;  4CAV A;  4A94 A;  4DYO A;  2AFW A;  2PQ8 A;  3EY5 A;  4P6Y A;  4B10 A;  5J1Q A;  4LX9 A;  2REF A;  3DDD A;  2CTC A;  2ZW4 A;  3NH8 A;  1IOI A;  1WK4 A;  4OAE A;  1CPS A;  4IAV A;  1AMP A;  3IGR A;  2B58 A;  2B4D B;  2NMT A;  2RFH A;  1IOF A;  4XNH C;  2Q7S A;  5J8F A;  2YNC A;  4WJB A;  2DEA A;  5D29 A;  4CAF A;  3VWE A;  1TKF A;  3IEH A;  4J3G A;  2GLF A;  1HDQ A;  3D8P A;  4KLV A;  5CPA A;  4CYO A;  3BXM A;  3KAS A;  4WWV A;  3IJ3 A;  4NEX A;  3GLJ A;  2FL4 A;  4KOY A;  4ZX8 A;  3V7Z A;  7CPA A;  2P0W A;  3PB9 X;  2PVW A;  4PXE A;  4R87 A;  3R9F A;  2WPW A;  4FWU A;  4FD6 A;  1NSL A;  3NE8 A;  4P4I A;  4UCN A;  2HUZ A;  4JJX A;  5JQ4 A;  3FX6 A;  1HDU A;  2YNC C;  1YW4 A;  2BSW A;  2O28 A;  4AVB A;  2J8M A;  3GY9 A;  3NH5 A;  5A27 A;  2PRQ A;  4KLW A;  2G3T A;  1A2Z A;  2C6G A;  2QJ8 A;  3W91 A;  4KVX A;  5AG4 A;  2PC1 A;  1X12 A;  1NMT A;  3EO4 A;  4KOV A;  3DNS A;  3CXQ A;  3CDX A;  3C26 A;  2AFM A;  2FSR A;  4AVC A;  3SI0 A;  1CP7 A;  4TWE A;  4P4B A;  4X3R A;  2PJ1 A;  3S6K A;  1IU8 A;  4B5P B;  1CG2 A;  4IUS A;  5LRJ A;  1FNO A;  4M85 A;  4KOS A;  2CNS A;  4UCP A;  4A95 A;  4MFQ A;  2VXK A;  2Q7B A;  4B14 A;  3GIU A;  1YX0 A;  4FD4 A;  4NFR A;  1B6B A;  5HVG A;  4F0Y A;  4ZY1 A;  1CJW A;  1M4L A;  1YW6 A;  1CP6 A;  3D2M A;  3CT9 A;  1VGY A;  4Q36 A;  4UIB A;  2Z3K A;  3W6S A;  3PP9 A;  3R96 A;  4NGS A;  2EK8 A;  3RYO A;  5F49 A;  4KOW A;  4KS9 A;  2G9D A;  4NSQ A;  4F6A A;  5K8N A;  2ZXV A;  4QVT A;  2YGW A;  2O4H A;  2P6E A;  1KUV A;  2R8V A;  3R9G A;  4RN7 A;  5K8O A;  4KSF A;  4U9Y A;  1QSN A;  3TO7 A;  3PB6 X;  4MHP A;  2C1C A;  1YGH A;  4H6Z A;  4E0A A;  1ON0 A;  4FAI A;  3ISZ A;  2BCO A;  1LAP A;  5HH1 A;  1TF9 A;  3PFO A;  2NYQ A;  3D2P A;  2D4O A;  1MK4 A;  1SQH A;  4F8Z A;  4PXD A;  3V38 A;  2F7V A;  2Z3N A;  1HEE A;  4U9Z A;  4NCZ A;  3PBE A;  3SJX A;  1EE3 P;  3RZA A;  5C88 A;  5F46 A;  2FIW A;  2J8R A;  5HMN A;  5KTD A;  1LAM A;  1M1D A;  2ZOF A;  2B5G A;  1QSR A;  2CY2 A;  3FXT A;  4P10 A;  5THW A;  4PK3 A;  1CPX A;  4UIA A;  3TOB A;  3VWD A;  3TCV A;  2R1I A;  4MFZ A;  2PJ8 A;  4X8I A;  3H4Q A;  1Z8W A;  2ZW7 A;  4OAD A;  4MY3 A;  3WT4 A;  4R6T A;  4JZ0 A;  3GYA A;  3WR7 A;  3QAY A;  2I3C A;  3NFZ A;  3BLN A;  3HLP A;  2GIV A;  4JXR A;  2ZEH A;  1Z5R A;  4MHY A;  2CXA A;  4AG9 A;  5JM6 A;  5LRK A;  2IQ6 A;  1QMU A;  3CPA A;  4OC1 A;  3S9N A;  2GE3 A; 
#chains in the Genus database with same CATH homology
 1Z2L A;  5LYL A;  4F9V A;  3RBU A;  4IHM A;  4FBE A;  3PB8 X;  1VHE A;  3ISX A;  4ZYQ A;  4PXB A;  4LQG A;  1OBR A;  4OC5 A;  2IMO A;  3KI9 A;  3BI1 A;  4MCR A;  4K3N A;  4IK2 A;  3FVL A;  1BPM A;  4AXV A;  6CPA A;  2WYR A;  3KHX A;  2NSM A;  3LMS A;  1TXR A;  4MCP A;  2CF4 A;  4ZY2 A;  2ANP A;  1FT7 A;  4OC4 A;  5F09 A;  3SJF A;  2ZEN A;  2ZEG A;  1TF8 A;  1LOK A;  1F2P A;  2GLJ A;  4NJR A;  3B35 A;  1XBU A;  2PJC A;  4CPA A;  4R7M A;  4MXU A;  1XRY A;  1ZG9 A;  1KWM A;  4EME A;  3WC6 A;  1XMB A;  3GB0 A;  3PB7 X;  1RTQ A;  5LRG A;  2Q43 A;  2OOT A;  1Y0R A;  3B3S A;  4TNU A;  2PJ9 A;  4NGR A;  3S9L A;  3K2K A;  5K8P A;  2Q4Z A;  4ZI6 A;  3D4U A;  4PXC A;  1IY7 A;  1YLO A;  3FF3 A;  1Q7L A;  3JRU A;  1TKH A;  3TC8 A;  3SI2 A;  4UEZ A;  1Z8L A;  3IO1 A;  2V8H A;  2WZN A;  1DTD A;  3KL9 A;  3KQZ A;  4NGN A;  4YU9 A;  2V8G A;  1F57 A;  4P4J A;  4EFD A;  2GRE A;  2IJZ A;  1ARM A;  1NSA A;  2VL1 A;  4DJL A;  1BAV A;  2PCU A;  1BLL E;  3H8G A;  2GU2 A;  3D67 A;  4ZX9 A;  4B6Z A;  2ZEM A;  4BD9 A;  2PJ5 A;  3NA6 A;  4Q7A A;  2EK9 A;  1ZLI A;  3D7D A;  1PYT B;  2PJ7 A;  4P4E A;  3DLJ A;  2O53 A;  2ABZ A;  4R8F A;  3PEI A;  1ZG8 A;  3KR4 A;  3PB4 X;  3D7H A;  3TX8 A;  4DUK A;  2ZEF A;  4PQA A;  1R3N A;  3VAT A;  3SI1 A;  3T8W A;  2PJ3 A;  1IGB A;  3B3T A;  3D66 A;  1GYT A;  2PJB A;  2XEG A;  5D8N A;  3RAM A;  2ZEO A;  4ONW A;  2JEW A;  4OC2 A;  3WC5 A;  3D7G A;  3N5F A;  3SJE A;  2V8D A;  1VHO A;  4OC0 A;  1UWY A;  3D7F A;  5ELY A;  4Z65 A;  3MN8 A;  1LAN A;  1PCA A;  1YSJ A;  1LCP A;  4GM5 A;  2FVG A;  2OR4 A;  3PRT A;  3FH4 A;  3KZW A;  1ARL A;  1BPN A;  4P44 A;  2PVV A;  2PIZ A;  4NGM A;  2PJ2 A;  3DGV A;  3VAR A;  1VIX A;  1H8L A;  2PJ4 A;  5LYI A;  4MHN A;  4MMO A;  3KHZ A;  4RUH A;  1XFO A;  2ZEP A;  4OKO A;  4O23 A;  3B7I A;  4H2K A;  4OID A;  3SJG A;  2PE3 A;  5JH9 A;  1Y7E A;  2XEF A;  3KQX A;  4ZY0 A;  4MCS A;  3PFE A;  1ELM P;  3LWU A;  3VH9 A;  2AFS A;  2ZOG A;  2PIY A;  3B3W A;  1YME A;  4MRI A;  5DS0 A;  2ZEL A;  2HB6 A;  1AYE A;  2XEJ A;  3B3C A;  5IB9 A;  2C6C A;  4JYW A;  4NGP A;  1DE4 C;  2XEI A;  5HVH A;  4FUU A;  4P4D A;  3FMC A;  1R43 A;  1CBX A;  4NGQ A;  2AFX A;  1CX8 A;  4KSI A;  3KR5 A;  4P4F A;  4NJQ A;  2POK A;  2AFZ A;  2PJA A;  3QNV A;  2RB7 A;  2JBK A;  5HXD A;  2QYV A;  4A39 A;  4A38 A;  3HUV A;  2JBJ A;  3FED A;  2C6P A;  4OP4 A;  3BHX A;  3K9T A;  5HVF A;  1ELL P;  3MRU A;  3WAB A;  4F9U A;  3B2Y A;  3IIB A;  1XJO A;  3FJU A;  3H8E A;  3I1U A;  4OC3 A;  2AFU A;  3S9M A;  4OIW A;  3IFE A;  4MCQ A;  3BI0 A;  5LYD A;  3IC1 A;  2CIJ A;  1F2O A;  5I4M A;  3WC7 A;  2V77 A;  1ZLH A;  5LYF A;  1ZG7 A;  4EWT A;  3NH4 A;  2PJ0 A;  2Q51 A;  4UEE A;  3D68 A;  3GUX A;  5CBM A;  3FEC A;  3PBB A;  4A37 A;  2F8H A;  1TKJ A;  4G1P A;  3H8F A;  1Y0Y A;  4P45 A;  3KGQ A;  4UEF A;  3B3V A;  2J9A A;  4W9Y A;  2EWB A;  4PPZ A;  3CPX A;  2BO9 A;  4UF4 A;  4YWY A;  2HC9 A;  1LFW A;  2QVP A;  1QQ9 A;  5JGF A;  2ZEE A;  4OME A;  3FEE A;  1JQG A;  5K8M A;  2AFO A;  2BOA A;  3L2N A;  3IWW A;  2ZED A;  4X2T A;  8CPA A;  4MHZ A;  2CTB A;  4R76 A;  2PJ6 A;  2V8V A;  4NGT A;  4DYO A;  4A94 A;  2AFW A;  4P6Y A;  5J1Q A;  2CTC A;  3NH8 A;  1CPS A;  4IAV A;  1AMP A;  2RFH A;  4WJB A;  2DEA A;  5D29 A;  1TKF A;  3IEH A;  5CPA A;  2GLF A;  1HDQ A;  3BXM A;  3KAS A;  4WWV A;  3IJ3 A;  3GLJ A;  7CPA A;  4ZX8 A;  3V7Z A;  3PB9 X;  2PVW A;  4PXE A;  4FWU A;  4P4I A;  3FX6 A;  1HDU A;  1YW4 A;  3NH5 A;  2PRQ A;  2C6G A;  2QJ8 A;  3CDX A;  2AFM A;  3SI0 A;  1CP7 A;  4TWE A;  4P4B A;  4X3R A;  2PJ1 A;  1CG2 A;  5LRJ A;  1FNO A;  4NFR A;  5HVG A;  4ZY1 A;  1YW6 A;  1M4L A;  1CP6 A;  3CT9 A;  1VGY A;  4UIB A;  4NGS A;  2EK8 A;  2G9D A;  5K8N A;  2O4H A;  5K8O A;  3PB6 X;  4MHP A;  2C1C A;  4FAI A;  3ISZ A;  2BCO A;  1LAP A;  1TF9 A;  3PFO A;  2NYQ A;  4F8Z A;  4PXD A;  3V38 A;  2F7V A;  1HEE A;  3PBE A;  3SJX A;  1EE3 P;  3RZA A;  1LAM A;  2ZOF A;  4P10 A;  5THW A;  1CPX A;  4UIA A;  2PJ8 A;  4X8I A;  3WT4 A;  4R6T A;  4JZ0 A;  2I3C A;  3NFZ A;  3HLP A;  2ZEH A;  1Z5R A;  4MHY A;  5JM6 A;  5LRK A;  2IQ6 A;  1QMU A;  3CPA A;  4OC1 A;  3S9N A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...