1QQ9A

Streptomyces griseus aminopeptidase complexed with methionine
Total Genus 110
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
110
sequence length
277
structure length
277
Chain Sequence
APDIPLANVKAHLTQLSTIAANNGGNRAHGRPGYKASVDYVKAKLDAAGYTTTLQQFTSGGATGYNLIANWPGGDPNKVLMAGAHLDSVSSGAGINDNGSGSAAVLETALAVSRAGYQPDKHLRFAWWGAEELGLIGSKFYVNNLPSADRSKLAGYLNFDMIGSPNPGYFVYDDDPVIEKTFKNYFAGLNVPTEIETEGDGRSDHAPFKNVGVPVGGLFTGAGYTKSAAQAQKWGGTAGQAFDRCYHSSCDSLSNINDTALDRNSDAAAHAIWTLSS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords AMINOPEPTIDASE
publication title Interactions of Streptomyces griseus aminopeptidase with a methionine product analogue: a structural study at 1.53 A resolution.
pubmed doi rcsb
total genus 110
structure length 277
sequence length 277
ec nomenclature ec 3.4.11.24: Aminopeptidase S.
pdb deposition date 1999-06-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF04389 Peptidase_M28 Peptidase family M28
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.630.10 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Zn peptidases 1qq9A00
3CT9A 2ZEEA 3TC8A 5LRGA 1CG2A 2NYQA 1HEEA 3D7DA 4LQGA 4YWYA 2PJAA 4MHYA 2XEIA 6CPAA 5JGFA 4ZI6A 2GLJA 3SJEA 4OKOA 3KL9A 3BHXA 4CPAA 5DS0A 5LRJA 4UIAA 4P44A 3LWUA 4UEFA 2AFMA 5HVGA 5K8NA 1CPXA 1ZG7A 2CTCA 2PJ7A 3IEHA 5D8NA 3FH4A 4F9UA 2JBJA 3FEEA 2PVVA 3N5FA 4KSIA 3DGVA 3FVLA 4EFDA 4RUHA 2AFXA 4F9VA 3H8GA 2EK9A 2QYVA 3PB7X 1XRYA 4EMEA 3VARA 3IO1A 1XMBA 1OBRA 3H8EA 4ZY1A 4JZ0A 2ZEGA 1BPMA 3WC5A 3PB4X 3KI9A 4FUUA 4WJBA 4A38A 3SI0A 1QMUA 3D7FA 3I1UA 5LYLA 2ZOGA 5F09A 1TKFA 1TKHA 5THWA 3MN8A 4A94A 3S9LA 2ANPA 4G1PA 5I4MA 2OOTA 1FNOA 3VH9A 1H8LA 2ZEPA 4MHPA 3S9NA 3NH4A 1Y7EA 4R6TA 2CF4A 4X2TA 3BXMA 1LAMA 1F2PA 4FBEA 2OR4A 2EWBA 4UF4A 3PFEA 1BAVA 2ZOFA 3PBBA 4NGRA 3LMSA 3B3VA 1IGBA 2ZEOA 1F57A 4A37A 3BI1A 4EWTA 2PIYA 4MHZA 4F8ZA 4OC1A 3HLPA 4NJRA 4OMEA 3L2NA 1R3NA 4AXVA 4ZY2A 2JEWA 3SI2A 2G9DA 2Q51A 3PB9X 1IY7A 3S9MA 4A39A 2NSMA 4UEEA 1ARMA 2I3CA 1F2OA 3NH5A 2CTBA 2AFSA 3IWWA 1LAPA 1TF9A 1YW6A 2VL1A 4P4JA 4TNUA 1LANA 4OIDA 2V8VA 1DE4C 2PJ2A 2PIZA 1ZLIA 1Q7LA 3B35A 5LYFA 1CP7A 1LCPA 2AFOA 2HB6A 1AYEA 1PCAA 5ELYA 1ZLHA 1YLOA 1TF8A 2O4HA 4O23A 2PJ0A 2ZELA 3MRUA 3B3TA 4GM5A 4MCRA 2PCUA 4IHMA 2RB7A 4P6YA 3V7ZA 3GB0A 1ARLA 3HUVA 1LFWA 4NGNA 2C6GA 4OC5A 4BD9A 1YSJA 4MRIA 4UIBA 4JYWA 5LYIA 3FJUA 3BI0A 4TWEA 3D66A 2GREA 3RBUA 4NGQA 4P4EA 3VATA 4DYOA 5JM6A 4ZX9A 5CPAA 1BPNA 3SI1A 4MXUA 3ISZA 3T8WA 1XJOA 3KQXA 2AFZA 2ZEMA 1GYTA 3B2YA 1YMEA 2PJ5A 2ZEFA 4P4BA 1XBUA 4OC0A 4R76A 2ABZA 3CPAA 5IB9A 4NFRA 1FT7A 4OIWA 1HDQA 2J9AA 3B3WA 3B7IA 3QNVA 2Q43A 2ZEDA 2IQ6A 2EK8A 4P4IA 2CIJA 3PEIA 4OC4A 1AMPA 4NGSA 3FECA 1XFOA 4P45A 1M4LA 2BO9A 3GUXA 3H8FA 3IFEA 1BLLE 3NFZA 4P10A 4P4DA 2IMOA 1ELMP 4NGPA 3KZWA 3PB8X 2BOAA 1CBXA 2PJ3A 4MMOA 3PB6X 4MCPA 4OC3A 1ZG8A 4PXEA 3WT4A 2QJ8A 3KR5A 2BCOA 1HDUA 5J1QA 1Z5RA 2C6CA 4R8FA 3WC6A 1UWYA 2HC9A 8CPAA 4PXBA 2QVPA 3CDXA 2JBKA 3RZAA 5HXDA 3CPXA 4PPZA 3IJ3A 4R7MA 1JQGA 4ZYQA 4ZY0A 3JRUA 3KQZA 4YU9A 3KHZA 2XEJA 5K8MA 2V8GA 4NGTA 3K2KA 4NGMA 1R43A 1CPSA 4H2KA 5K8PA 7CPAA 1LOKA 1KWMA 2C1CA 2GU2A 4WWVA 3ISXA 3IC1A 3SJFA 3K9TA 3KGQA 4ONWA 2F8HA 4MCSA 2V77A 1CP6A 1EE3P 2F7VA 1ZG9A 3DLJA 2PVWA 4Q7AA 3PFOA 4P4FA 2PJBA 2RFHA 3KASA 3IIBA 1CX8A 2V8DA 4IK2A 3B3CA 4DJLA 3V38A 2O53A 2WYRA 2WZNA 2AFWA 4W9YA 4IAVA 1Y0YA 2V8HA 3D7GA 3PBEA 2PJCA 3WABA 1Z8LA 5LRKA 2PJ9A 2ZENA 4PQAA 5LYDA 3FF3A 4PXDA 2XEFA 4B6ZA 2PJ1A 2IJZA 2XEGA 1VHEA 5HVHA 4Z65A 4FAIA 1QQ9A 3KR4A 4OP4A 1VHOA 5K8OA 1PYTB 3PRTA 2DEAA 1DTDA 1RTQA 2Q4ZA 1VIXA 2ZEHA 4K3NA 4NJQA 3D67A 3SJXA 4ZX8A 3GLJA 3D7HA 4PXCA 3FX6A 2POKA 1TKJA 2AFUA 3NA6A 3KHXA 5D29A 3NH8A 4OC2A 5HVFA 4DUKA 1Y0RA 2PRQA 2PJ6A 5JH9A 5CBMA 3RAMA 3WC7A 2PE3A 4MCQA 1NSAA 3TX8A 4UEZA 2C6PA 4X3RA 1Z2LA 3D4UA 1TXRA 2PJ4A 3FEDA 2PJ8A 2GLFA 3D68A 4MHNA 3FMCA 4X8IA 1ELLP 1VGYA 3B3SA 3SJGA 2FVGA 4FWUA 1YW4A
chains in the Genus database with same CATH superfamily
3CT9A 4B11A 2ZEEA 4MFQA 1NSLA 3B8GA 3T90A 1BOBA 4FD5A 4MBUA 4MFPA 4KUBA 2GANA 2ARHA 3TC8A 5LRGA 1CG2A 2G3TA 2NYQA 3QB8A 2OZGA 1M4DA 4NF1A 4JWPA 4R87A 4MI4A 1HEEA 3D7DA 2G3AA 4LQGA 4YWYA 2PJAA 4MHYA 4A31A 2XEIA 5DWNA 6CPAA 3LACA 4CAXA 5JGFA 2OH1A 4XPLA 4JLYA 4ZI6A 3CXQA 2GLJA 1V0CA 2FSRA 3SJEA 4QB9A 5J8FA 1Y9KA 4OKOA 2B5GB 4U5YA 3S6GA 4C7HA 4KVOE 2REEA 3KL9A 3BHXA 4CPAA 4EVYA 5DS0A 5LRJA 4UIAA 4UCMA 3G3SA 4P44A 3F8KA 4CRYB 2X7BA 3LWUA 4UEFA 2AFMA 1IU8A 5HVGA 4M6IA 3PGPA 2B5GA 4A2ZA 4BMHA 1WWZA 2IL4A 5K8NA 3K9UA 1CPXA 5AG5A 3CXPA 1ZG7A 2REFA 2GIVA 3R96A 4C7IA 2CTCA 2B58A 5A27A 5KTAA 4IUSA 4CGNA 4DNCA 2PJ7A 4Y49B 3IEHA 5D8NA 3FH4A 4F9UA 4ZGYB 2YGWA 2QMLA 2D4OA 5ISVA 2JBJA 5BWAB 3JUWA 3VWEA 1YGHA 3FEEA 1GHEA 3W6SA 3S6FA 1YX0A 2PVVA 2VXKA 3E0KA 2EUIA 2ZXVA 3N5FA 4KSIA 4CRZB 5IV0A 1Y9WA 3DGVA 3FVLA 1YK3A 1XMTA 4EFDA 4RUHA 2AFXA 2WSAA 3TOAA 3TO9A 4F9VA 3H8GA 2P6EA 2PC1A 2EK9A 2QYVA 3NE8A 1IOFA 3PB7X 3LODA 4X5KA 1XRYA 4XPKA 4UBRA 4EMEA 3VARA 4UCNA 4AVBA 3IO1A 1XMBA 1Z8TA 1OBRA 3H8EA 1MJAA 3N7ZA 4JJXA 4JZ0A 4L8AA 4FD4A 3QAHA 4ZY1A 3C26A 3D3SA 2ZEGA 1BPMA 1Q2CA 4FD6A 4AB7A 3EXNA 3WC5A 3PB4X 3KI9A 4FUUA 3W6XA 4WJBA 3R1KA 4A38A 3PZJA 2Z3PA 3SI0A 1QMUA 3D7FA 4L89A 5CNPA 1CM0A 1KUXA 2J8RA 2WPWA 3EFAA 4A95A 3I1UA 1R57A 5LYLA 2ZOGA 3TOBA 1QSRA 5F09A 1TKFA 1TKHA 5THWA 5IX3A 3MN8A 3S6HA 4A94A 2PR8A 4CYQA 3S9LA 2ANPA 4MY0A 5KTCA 1KUYA 1WK4A 4C2XA 2Q7SA 3TE4A 4G1PA 5I4MA 4KZTA 2OOTA 1S5KA 2R98A 2Z10A 1FNOA 2ZW7A 1H8LA 2FE7A 3VH9A 2AE6A 3FNCA 2ZEPA 4CAEA 3I3GA 4UFXA 5AG7A 2FIAA 4MHPA 3S9NA 3NH4A 1I12A 2HV2A 1Y7EA 4R6TA 2CF4A 2ZPAA 3BXMA 4X2TA 1BO4A 1LAMA 1F2PA 2I00A 4M85A 4FBEA 3GIUA 2FT0A 3IWEA 2OR4A 2EWBA 4UF4A 1IIDA 4F0YA 4F0XA 4IF5A 3PFEA 1RXTA 3FYNA 1BAVA 3CXSA 2R1IA 4KVXA 3H4QA 4F6AA 2ZOFA 2Z3KA 3PBBA 4NGRA 4CYOA 2FXFA 2VQYA 5F46A 3LMSA 3B3VA 1IGBA 2QIRA 2ZEOA 1F57A 1QSOA 3P2HA 4NEXA 1IOIA 1QSNA 4A37A 3BI1A 2B4BA 4QVTA 4EWTA 5GCNA 2PIYA 4MHZA 4F8ZA 4UWJA 5JQ4A 3DDDA 2PDOA 4MFLA 4OADA 3DSBA 4OC1A 3HLPA 4NJRA 4OMEA 4CS0B 1M1DA 2JDDA 3L2NA 1R3NA 2OZHA 3R9GA 4AXVA 4ZY2A 4XPDB 2JEWA 4B12A 3SI2A 2Q4YA 2G9DA 2R7HA 3UY5A 2Q51A 2PQ8A 2R8VA 3PB9X 4J3GA 3T9YA 1P4NA 1IY7A 3S9MA 4A39A 4M3SA 2Q0YA 2FL4A 2NSMA 5G21A 2WUUA 4UEEA 5AG6A 4UFVA 4R57A 1I21A 1ARMA 2I3CA 3I9SA 4PK3A 2QECA 1F2OA 2YNEA 3NH5A 2VEZA 1Z4RA 1CJWA 1MK4A 3WR7A 2CTBA 2RC4A 3PP9A 2AFSA 1FY7A 1S7FA 5G22A 3IU1A 1VHSA 5H86A 2I79A 3IWWA 1MJBA 2YNCA 1LAPA 4CGOA 4RS2A 4KORA 1TF9A 1YW6A 2HQYA 2VL1A 4U9YA 1YREA 1YVOA 4P4JA 4TNUA 1LANA 4OIDA 2Z3NA 2V8VA 1DE4C 1M4GA 2C27A 2PJ2A 2PIZA 1AUGA 2BL1A 1JWQA 1ZLIA 1Q7LA 2PR1A 3B35A 1CP7A 1LCPA 2Z11A 4MFZA 5EBVA 5LYFA 4YFJA 2AFOA 2HB6A 1AYEA 1PCAA 1S7KA 5ELYA 3SXOA 5F48A 4XNHC 1ZLHA 1YLOA 4PSWA 1TF8A 2O28A 2O4HA 4O23A 2D4PA 3FRMA 2JDCA 2PJ0A 2PSWA 3JTKA 2ZELA 3MRUA 3B3TA 3EO4A 4GM5A 4MCRA 4HPSA 4UA3A 2PCUA 1M44A 2GFQA 1XIXA 3GKRA 1RO5A 4JD6A 3VWDA 2WPXA 4IHMA 4H6ZA 1PU9A 3GYAA 2RB7A 4P6YA 2CNMA 3V7ZA 3GB0A 1ARLA 3HUVA 5H84A 2K5TA 1LFWA 4NGNA 2C6GA 4OC5A 5F47A 1KUVA 4BD9A 2DXQA 4NSQA 1YSJA 1YQEA 2PRBA 4MRIA 4UIBA 4JYWA 5LYIA 3FJUA 3BI0A 3TTHA 4TWEA 3D66A 2KCWA 2GREA 4MFKA 3RBUA 4NGQA 4P4EA 2CNSA 1ON0A 3VATA 4DYOA 5FVJA 5A28A 4ZX9A 5JM6A 5CPAA 1Q2YA 1Z4EA 1BPNA 3SI1A 3EC4A 4MXUA 1B6BA 3IWGA 4KOVA 3ISZA 3T8WA 4B5OA 1XJOA 3KQXA 2AFZA 2ZEMA 3BJ7A 3QAYA 4PV6A 2Q7BA 4KUAA 1GYTA 1YR0A 2OB0A 3B2YA 4MJ8A 4KS9A 1YMEA 2PJ5A 4YRHA 5EC4A 2ZEFA 2Z0ZA 4XNHB 4C68A 4CYPA 5I0CA 1X10A 2HUZA 3EY5A 1XBUA 4P4BA 2A4NA 1NE9A 4B13A 3DR6A 4OC0A 4QBJA 4R76A 4AG9A 1KZFA 3G8WA 4PSXA 2ABZA 3CPAA 4CGMA 5IB9A 4NFRA 1FT7A 1Q2DA 2BSWA 4OIWA 1HDQA 3SXNA 2J9AA 4H6UA 2ZW6A 3B3WA 2VBQA 3B7IA 4C2ZA 4M6HA 1N71A 3QNVA 2BEIA 2Q43A 2ZEDA 3IU2A 4B14A 1A2ZA 2IQ6A 1MJ9A 4AG7A 2EK8A 4P4IA 4KOSA 2OZUA 2CIJA 3PEIA 4OC4A 4UCPA 1AMPA 4NGSA 3FECA 4CGPA 2ZW5A 1XFOA 4P45A 1M4LA 1XEBA 2J8MA 4Q36A 4ONUA 3FXTA 2BO9A 3GUXA 3H8FA 3IFEA 1BLLE 3NFZA 4HKFA 4LX9A 4P10A 4P4DA 2IMOA 1ELMP 4NGPA 4A33A 2Z3MA 3KZWA 4KOTA 3PB8X 2BOAA 1CBXA 4II9A 1U6MA 1S7LA 2PJ3A 4MMOA 3PB6X 4MCPA 4OC3A 1ZG8A 4PXEA 4B10A 3WT4A 5E96A 3V8IA 2QJ8A 3KR5A 2BCOA 2ATRA 1QSMA 1HDUA 5J1QA 1X12A 1Z5RA 2C6CA 4KOYA 4OLLA 3F0AA 4R8FA 3WC6A 3RYOA 4BINA 1UWYA 2HC9A 8CPAA 4PXBA 2QVPA 4HNXB 1K4JA 3CDXA 1NMTA 2JBKA 3RZAA 5HXDA 4KOWA 2J8NA 3CPXA 4PPZA 4MY3A 3IJ3A 4R7MA 1JQGA 4ZYQA 4AVCA 2JLMA 4ZY0A 3ZJ0A 2H5MA 3JRUA 3KQZA 4YU9A 3KHZA 2XEJA 5K8MA 3IGRA 2NMTA 2GE3A 2V8GA 4NGTA 1IICA 3K2KA 4RI1A 4NGMA 1Z8XA 5EMIA 1R43A 4ORFA 3BJ8A 2B4DB 4KSFA 1J4JA 1CPSA 3RNZA 4H2KA 2OU2A 4K30A 4R9MA 5K8PA 4AVAA 3TO7A 3FIXA 1LOKA 4KOUA 7CPAA 2EO8A 5J8CA 2VI7A 1KWMA 3SHPA 2B4DA 2C1CA 2GU2A 4NCZA 2DPTA 2B3UA 2CXAA 4WWVA 4NXYA 3ISXA 3IC1A 4LUAA 2F5IA 2Q4VA 3SJFA 1XOVA 3K9TA 3KGQA 4ONWA 2FIWA 4R3LA 2F8HA 2FCKA 5JPHA 4MCSA 2CY2A 1CP6A 2V77A 3FB3A 4MHDA 3TO6A 4A32A 1EE3P 3LD2A 2CNTA 4A30A 5IB0A 4E0AA 2Y0MA 2F7VA 3D8PA 1ZG9A 3DLJA 2PVWA 4ZBGA 4CAFA 4Q7AA 4JXRA 3PFOA 4P4FA 2DPSA 2PJBA 2RFHA 3KASA 3IIBA 4QUSA 4RN7A 1CX8A 1OZPA 2V8DA 4KVME 4IK2A 3B3CA 4DJLA 1B87A 3V38A 2O53A 3TCVA 2VZZA 3D2PA 5C82A 2JEVA 2WYRA 3OWCA 3F5BA 5AGEA 2WZNA 2AFWA 4W9YA 4IAVA 1Y0YA 1S60A 4KLWA 4PK2A 2V8HA 3D7GA 3PBEA 2PJCA 2EVNA 3WABA 1Z8LA 5LRKA 2PJ9A 2ZENA 4PQAA 5LYDA 1Y7RA 3FF3A 4PXDA 2XEFA 1S7NA 4B6ZA 2PJ1A 1ZO0A 2IJZA 2XEGA 4CYNA 1VHEA 5HVHA 2Z3OA 4Z65A 3NE7A 4FAIA 1QQ9A 1XF8A 4C2YA 3D2MA 2AJ6A 2VZYA 3KR4A 4HNWB 5G20A 4OP4A 5G1ZA 1VHOA 5K8OA 1PYTB 2P6FA 3PRTA 2Q04A 2ZW4A 1PUAA 4R3KA 2DEAA 1DTDA 1RTQA 1Z8WA 2Q4ZA 4KSAA 1VIXA 2ZEHA 4HNYB 3MGDA 4CGLA 4K3NA 4GS4A 3W91A 2P0WA 4NJQA 3D67A 4UFWA 3ZZIA 3SJXA 4ZX8A 4M6GA 5DWMA 4MFJA 3GY9A 2YNDA 3CZXA 4E8OA 3GLJA 1P0HA 3D7HA 4PXCA 1SQHA 3FX6A 1M4IA 4JXQA 2ODFA 2POKA 1IB1E 3R9EA 4BBHA 3RO0A 1TKJA 5F49A 2AFUA 1VKCA 4XPDC 3NA6A 1LRZA 3KHXA 4KLVA 5D29A 3TFYA 3NH8A 4OC2A 2BUEA 5HVFA 4DUKA 1Y0RA 3FBUA 3BLNA 4QC6A 2PRQA 4FD7A 4LQ6A 2PJ6A 4B5PB 4E2AA 4CAVA 1L0CA 2DF5A 2P6GA 3DR8A 2YNCC 4I49A 5HMNA 5KTDA 1YVKA 5JH9A 4OAEA 5CBMA 4UWIA 1IYLA 4Q38A 4B5PA 2EBJA 1Z9UA 1IYKA 3RAMA 3WC7A 3R9FA 3JVNA 1QSTA 2PE3A 4MCQA 1XE4A 1NSAA 4GXHA 3TX8A 2G0BA 2C6PA 3DNSA 4UEZA 4X3RA 1I1DA 4KOXA 1Z2LA 3D4UA 4U9ZA 1TXRA 3A9LA 3KKWA 2PJ4A 3FEDA 2PJ8A 2GLFA 1UFHA 3D68A 4MHNA 3FMCA 3H5ZA 2Q44A 4X8IA 3P2FA 3R95A 3S6KA 1ELLP 1TIQA 1YLEA 2Z3LA 5AG4A 1VGYA 2B3VA 2FS5A 3B3SA 4Y49C 5HH1A 1S3ZA 3SJGA 3TT2A 5C88A 2FVGA 4FWUA 4H89A 4CAWA 1YW4A 4YGOA
chains in the Genus database with same CATH topology
3CT9A 2ZEEA 3TC8A 5LRGA 1CG2A 2NYQA 1HEEA 3D7DA 4LQGA 4YWYA 2PJAA 4MHYA 2XEIA 6CPAA 5JGFA 4ZI6A 2GLJA 3SJEA 4OKOA 3KL9A 3BHXA 4CPAA 5DS0A 5LRJA 4UIAA 4P44A 3LWUA 4UEFA 2AFMA 5HVGA 5K8NA 1CPXA 1ZG7A 2CTCA 2PJ7A 3IEHA 5D8NA 3FH4A 4F9UA 2JBJA 3FEEA 2PVVA 3N5FA 4KSIA 3DGVA 3FVLA 4EFDA 4RUHA 2AFXA 4F9VA 3H8GA 2EK9A 2QYVA 3PB7X 1XRYA 4EMEA 3VARA 3IO1A 1XMBA 1OBRA 3H8EA 4ZY1A 4JZ0A 2ZEGA 1BPMA 3WC5A 3PB4X 3KI9A 4FUUA 4WJBA 4A38A 3SI0A 1QMUA 3D7FA 3I1UA 5LYLA 2ZOGA 5F09A 1TKFA 1TKHA 5THWA 3MN8A 4A94A 3S9LA 2ANPA 4G1PA 5I4MA 2OOTA 1FNOA 3VH9A 1H8LA 2ZEPA 4MHPA 3S9NA 3NH4A 1Y7EA 4R6TA 2CF4A 4X2TA 3BXMA 1LAMA 1F2PA 4FBEA 2OR4A 2EWBA 4UF4A 3PFEA 1BAVA 2ZOFA 3PBBA 4NGRA 3LMSA 3B3VA 1IGBA 2ZEOA 1F57A 4A37A 3BI1A 4EWTA 2PIYA 4MHZA 4F8ZA 4OC1A 3HLPA 4NJRA 4OMEA 3L2NA 1R3NA 4AXVA 4ZY2A 2JEWA 3SI2A 2G9DA 2Q51A 3PB9X 1IY7A 3S9MA 4A39A 2NSMA 4UEEA 1ARMA 2I3CA 1F2OA 3NH5A 2CTBA 2AFSA 3IWWA 1LAPA 1TF9A 1YW6A 2VL1A 4P4JA 4TNUA 1LANA 4OIDA 2V8VA 1DE4C 2PJ2A 2PIZA 1ZLIA 1Q7LA 3B35A 5LYFA 1CP7A 1LCPA 2AFOA 2HB6A 1AYEA 1PCAA 5ELYA 1ZLHA 1YLOA 1TF8A 2O4HA 4O23A 2PJ0A 2ZELA 3MRUA 3B3TA 4GM5A 4MCRA 2PCUA 4IHMA 2RB7A 4P6YA 3V7ZA 3GB0A 1ARLA 3HUVA 1LFWA 4NGNA 2C6GA 4OC5A 4BD9A 1YSJA 4MRIA 4UIBA 4JYWA 5LYIA 3FJUA 3BI0A 4TWEA 3D66A 2GREA 3RBUA 4NGQA 4P4EA 3VATA 4DYOA 5JM6A 4ZX9A 5CPAA 1BPNA 3SI1A 4MXUA 3ISZA 3T8WA 1XJOA 3KQXA 2AFZA 2ZEMA 1GYTA 3B2YA 1YMEA 2PJ5A 2ZEFA 4P4BA 1XBUA 4OC0A 4R76A 2ABZA 3CPAA 5IB9A 4NFRA 1FT7A 4OIWA 1HDQA 2J9AA 3B3WA 3B7IA 3QNVA 2Q43A 2ZEDA 2IQ6A 2EK8A 4P4IA 2CIJA 3PEIA 4OC4A 1AMPA 4NGSA 3FECA 1XFOA 4P45A 1M4LA 2BO9A 3GUXA 3H8FA 3IFEA 1BLLE 3NFZA 4P10A 4P4DA 2IMOA 1ELMP 4NGPA 3KZWA 3PB8X 2BOAA 1CBXA 2PJ3A 4MMOA 3PB6X 4MCPA 4OC3A 1ZG8A 4PXEA 3WT4A 2QJ8A 3KR5A 2BCOA 1HDUA 5J1QA 1Z5RA 2C6CA 4R8FA 3WC6A 1UWYA 2HC9A 8CPAA 4PXBA 2QVPA 3CDXA 2JBKA 3RZAA 5HXDA 3CPXA 4PPZA 3IJ3A 4R7MA 1JQGA 4ZYQA 4ZY0A 3JRUA 3KQZA 4YU9A 3KHZA 2XEJA 5K8MA 2V8GA 4NGTA 3K2KA 4NGMA 1R43A 1CPSA 4H2KA 5K8PA 7CPAA 1LOKA 1KWMA 2C1CA 2GU2A 4WWVA 3ISXA 3IC1A 3SJFA 3K9TA 3KGQA 4ONWA 2F8HA 4MCSA 2V77A 1CP6A 1EE3P 2F7VA 1ZG9A 3DLJA 2PVWA 4Q7AA 3PFOA 4P4FA 2PJBA 2RFHA 3KASA 3IIBA 1CX8A 2V8DA 4IK2A 3B3CA 4DJLA 3V38A 2O53A 2WYRA 2WZNA 2AFWA 4W9YA 4IAVA 1Y0YA 2V8HA 3D7GA 3PBEA 2PJCA 3WABA 1Z8LA 5LRKA 2PJ9A 2ZENA 4PQAA 5LYDA 3FF3A 4PXDA 2XEFA 4B6ZA 2PJ1A 2IJZA 2XEGA 1VHEA 5HVHA 4Z65A 4FAIA 1QQ9A 3KR4A 4OP4A 1VHOA 5K8OA 1PYTB 3PRTA 2DEAA 1DTDA 1RTQA 2Q4ZA 1VIXA 2ZEHA 4K3NA 4NJQA 3D67A 3SJXA 4ZX8A 3GLJA 3D7HA 4PXCA 3FX6A 2POKA 1TKJA 2AFUA 3NA6A 3KHXA 5D29A 3NH8A 4OC2A 5HVFA 4DUKA 1Y0RA 2PRQA 2PJ6A 5JH9A 5CBMA 3RAMA 3WC7A 2PE3A 4MCQA 1NSAA 3TX8A 4UEZA 2C6PA 4X3RA 1Z2LA 3D4UA 1TXRA 2PJ4A 3FEDA 2PJ8A 2GLFA 3D68A 4MHNA 3FMCA 4X8IA 1ELLP 1VGYA 3B3SA 3SJGA 2FVGA 4FWUA 1YW4A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3CT9 A;  2ZEE A;  3TC8 A;  5LRG A;  1CG2 A;  2NYQ A;  1HEE A;  3D7D A;  4LQG A;  4YWY A;  2PJA A;  4MHY A;  2XEI A;  6CPA A;  5JGF A;  4ZI6 A;  2GLJ A;  3SJE A;  4OKO A;  3KL9 A;  3BHX A;  4CPA A;  5DS0 A;  5LRJ A;  4UIA A;  4P44 A;  3LWU A;  4UEF A;  2AFM A;  5HVG A;  5K8N A;  1CPX A;  1ZG7 A;  2CTC A;  2PJ7 A;  3IEH A;  5D8N A;  3FH4 A;  4F9U A;  2JBJ A;  3FEE A;  2PVV A;  3N5F A;  4KSI A;  3DGV A;  3FVL A;  4EFD A;  4RUH A;  2AFX A;  4F9V A;  3H8G A;  2EK9 A;  2QYV A;  3PB7 X;  1XRY A;  4EME A;  3VAR A;  3IO1 A;  1XMB A;  1OBR A;  3H8E A;  4ZY1 A;  4JZ0 A;  2ZEG A;  1BPM A;  3WC5 A;  3PB4 X;  3KI9 A;  4FUU A;  4WJB A;  4A38 A;  3SI0 A;  1QMU A;  3D7F A;  3I1U A;  5LYL A;  2ZOG A;  5F09 A;  1TKF A;  1TKH A;  5THW A;  3MN8 A;  4A94 A;  3S9L A;  2ANP A;  4G1P A;  5I4M A;  2OOT A;  1FNO A;  3VH9 A;  1H8L A;  2ZEP A;  4MHP A;  3S9N A;  3NH4 A;  1Y7E A;  4R6T A;  2CF4 A;  4X2T A;  3BXM A;  1LAM A;  1F2P A;  4FBE A;  2OR4 A;  2EWB A;  4UF4 A;  3PFE A;  1BAV A;  2ZOF A;  3PBB A;  4NGR A;  3LMS A;  3B3V A;  1IGB A;  2ZEO A;  1F57 A;  4A37 A;  3BI1 A;  4EWT A;  2PIY A;  4MHZ A;  4F8Z A;  4OC1 A;  3HLP A;  4NJR A;  4OME A;  3L2N A;  1R3N A;  4AXV A;  4ZY2 A;  2JEW A;  3SI2 A;  2G9D A;  2Q51 A;  3PB9 X;  1IY7 A;  3S9M A;  4A39 A;  2NSM A;  4UEE A;  1ARM A;  2I3C A;  1F2O A;  3NH5 A;  2CTB A;  2AFS A;  3IWW A;  1LAP A;  1TF9 A;  1YW6 A;  2VL1 A;  4P4J A;  4TNU A;  1LAN A;  4OID A;  2V8V A;  1DE4 C;  2PJ2 A;  2PIZ A;  1ZLI A;  1Q7L A;  3B35 A;  5LYF A;  1CP7 A;  1LCP A;  2AFO A;  2HB6 A;  1AYE A;  1PCA A;  5ELY A;  1ZLH A;  1YLO A;  1TF8 A;  2O4H A;  4O23 A;  2PJ0 A;  2ZEL A;  3MRU A;  3B3T A;  4GM5 A;  4MCR A;  2PCU A;  4IHM A;  2RB7 A;  4P6Y A;  3V7Z A;  3GB0 A;  1ARL A;  3HUV A;  1LFW A;  4NGN A;  2C6G A;  4OC5 A;  4BD9 A;  1YSJ A;  4MRI A;  4UIB A;  4JYW A;  5LYI A;  3FJU A;  3BI0 A;  4TWE A;  3D66 A;  2GRE A;  3RBU A;  4NGQ A;  4P4E A;  3VAT A;  4DYO A;  5JM6 A;  4ZX9 A;  5CPA A;  1BPN A;  3SI1 A;  4MXU A;  3ISZ A;  3T8W A;  1XJO A;  3KQX A;  2AFZ A;  2ZEM A;  1GYT A;  3B2Y A;  1YME A;  2PJ5 A;  2ZEF A;  4P4B A;  1XBU A;  4OC0 A;  4R76 A;  2ABZ A;  3CPA A;  5IB9 A;  4NFR A;  1FT7 A;  4OIW A;  1HDQ A;  2J9A A;  3B3W A;  3B7I A;  3QNV A;  2Q43 A;  2ZED A;  2IQ6 A;  2EK8 A;  4P4I A;  2CIJ A;  3PEI A;  4OC4 A;  1AMP A;  4NGS A;  3FEC A;  1XFO A;  4P45 A;  1M4L A;  2BO9 A;  3GUX A;  3H8F A;  3IFE A;  1BLL E;  3NFZ A;  4P10 A;  4P4D A;  2IMO A;  1ELM P;  4NGP A;  3KZW A;  3PB8 X;  2BOA A;  1CBX A;  2PJ3 A;  4MMO A;  3PB6 X;  4MCP A;  4OC3 A;  1ZG8 A;  4PXE A;  3WT4 A;  2QJ8 A;  3KR5 A;  2BCO A;  1HDU A;  5J1Q A;  1Z5R A;  2C6C A;  4R8F A;  3WC6 A;  1UWY A;  2HC9 A;  8CPA A;  4PXB A;  2QVP A;  3CDX A;  2JBK A;  3RZA A;  5HXD A;  3CPX A;  4PPZ A;  3IJ3 A;  4R7M A;  1JQG A;  4ZYQ A;  4ZY0 A;  3JRU A;  3KQZ A;  4YU9 A;  3KHZ A;  2XEJ A;  5K8M A;  2V8G A;  4NGT A;  3K2K A;  4NGM A;  1R43 A;  1CPS A;  4H2K A;  5K8P A;  7CPA A;  1LOK A;  1KWM A;  2C1C A;  2GU2 A;  4WWV A;  3ISX A;  3IC1 A;  3SJF A;  3K9T A;  3KGQ A;  4ONW A;  2F8H A;  4MCS A;  2V77 A;  1CP6 A;  1EE3 P;  2F7V A;  1ZG9 A;  3DLJ A;  2PVW A;  4Q7A A;  3PFO A;  4P4F A;  2PJB A;  2RFH A;  3KAS A;  3IIB A;  1CX8 A;  2V8D A;  4IK2 A;  3B3C A;  4DJL A;  3V38 A;  2O53 A;  2WYR A;  2WZN A;  2AFW A;  4W9Y A;  4IAV A;  1Y0Y A;  2V8H A;  3D7G A;  3PBE A;  2PJC A;  3WAB A;  1Z8L A;  5LRK A;  2PJ9 A;  2ZEN A;  4PQA A;  5LYD A;  3FF3 A;  4PXD A;  2XEF A;  4B6Z A;  2PJ1 A;  2IJZ A;  2XEG A;  1VHE A;  5HVH A;  4Z65 A;  4FAI A;  1QQ9 A;  3KR4 A;  4OP4 A;  1VHO A;  5K8O A;  1PYT B;  3PRT A;  2DEA A;  1DTD A;  1RTQ A;  2Q4Z A;  1VIX A;  2ZEH A;  4K3N A;  4NJQ A;  3D67 A;  3SJX A;  4ZX8 A;  3GLJ A;  3D7H A;  4PXC A;  3FX6 A;  2POK A;  1TKJ A;  2AFU A;  3NA6 A;  3KHX A;  5D29 A;  3NH8 A;  4OC2 A;  5HVF A;  4DUK A;  1Y0R A;  2PRQ A;  2PJ6 A;  5JH9 A;  5CBM A;  3RAM A;  3WC7 A;  2PE3 A;  4MCQ A;  1NSA A;  3TX8 A;  4UEZ A;  2C6P A;  4X3R A;  1Z2L A;  3D4U A;  1TXR A;  2PJ4 A;  3FED A;  2PJ8 A;  2GLF A;  3D68 A;  4MHN A;  3FMC A;  4X8I A;  1ELL P;  1VGY A;  3B3S A;  3SJG A;  2FVG A;  4FWU A;  1YW4 A; 
#chains in the Genus database with same CATH topology
 3CT9 A;  4B11 A;  2ZEE A;  4MFQ A;  1NSL A;  3B8G A;  3T90 A;  1BOB A;  4FD5 A;  4MBU A;  4MFP A;  4KUB A;  2GAN A;  2ARH A;  3TC8 A;  5LRG A;  1CG2 A;  2G3T A;  2NYQ A;  3QB8 A;  2OZG A;  1M4D A;  4NF1 A;  4JWP A;  4R87 A;  4MI4 A;  1HEE A;  3D7D A;  2G3A A;  4LQG A;  4YWY A;  2PJA A;  4MHY A;  4A31 A;  2XEI A;  5DWN A;  6CPA A;  3LAC A;  4CAX A;  5JGF A;  2OH1 A;  4XPL A;  4JLY A;  4ZI6 A;  3CXQ A;  2GLJ A;  1V0C A;  2FSR A;  3SJE A;  4QB9 A;  5J8F A;  1Y9K A;  4OKO A;  2B5G B;  4U5Y A;  3S6G A;  4C7H A;  4KVO E;  2REE A;  3KL9 A;  3BHX A;  4CPA A;  4EVY A;  5DS0 A;  5LRJ A;  4UIA A;  4UCM A;  3G3S A;  4P44 A;  3F8K A;  4CRY B;  2X7B A;  3LWU A;  4UEF A;  2AFM A;  1IU8 A;  5HVG A;  4M6I A;  3PGP A;  2B5G A;  4A2Z A;  4BMH A;  1WWZ A;  2IL4 A;  5K8N A;  3K9U A;  1CPX A;  5AG5 A;  3CXP A;  1ZG7 A;  2REF A;  2GIV A;  3R96 A;  4C7I A;  2CTC A;  2B58 A;  5A27 A;  5KTA A;  4IUS A;  4CGN A;  4DNC A;  2PJ7 A;  4Y49 B;  3IEH A;  5D8N A;  3FH4 A;  4F9U A;  4ZGY B;  2YGW A;  2QML A;  2D4O A;  5ISV A;  2JBJ A;  5BWA B;  3JUW A;  3VWE A;  1YGH A;  3FEE A;  1GHE A;  3W6S A;  3S6F A;  1YX0 A;  2PVV A;  2VXK A;  3E0K A;  2EUI A;  2ZXV A;  3N5F A;  4KSI A;  4CRZ B;  5IV0 A;  1Y9W A;  3DGV A;  3FVL A;  1YK3 A;  1XMT A;  4EFD A;  4RUH A;  2AFX A;  2WSA A;  3TOA A;  3TO9 A;  4F9V A;  3H8G A;  2P6E A;  2PC1 A;  2EK9 A;  2QYV A;  3NE8 A;  1IOF A;  3PB7 X;  3LOD A;  4X5K A;  1XRY A;  4XPK A;  4UBR A;  4EME A;  3VAR A;  4UCN A;  4AVB A;  3IO1 A;  1XMB A;  1Z8T A;  1OBR A;  3H8E A;  1MJA A;  3N7Z A;  4JJX A;  4JZ0 A;  4L8A A;  4FD4 A;  3QAH A;  4ZY1 A;  3C26 A;  3D3S A;  2ZEG A;  1BPM A;  1Q2C A;  4FD6 A;  4AB7 A;  3EXN A;  3WC5 A;  3PB4 X;  3KI9 A;  4FUU A;  3W6X A;  4WJB A;  3R1K A;  4A38 A;  3PZJ A;  2Z3P A;  3SI0 A;  1QMU A;  3D7F A;  4L89 A;  5CNP A;  1CM0 A;  1KUX A;  2J8R A;  2WPW A;  3EFA A;  4A95 A;  3I1U A;  1R57 A;  5LYL A;  2ZOG A;  3TOB A;  1QSR A;  5F09 A;  1TKF A;  1TKH A;  5THW A;  5IX3 A;  3MN8 A;  3S6H A;  4A94 A;  2PR8 A;  4CYQ A;  3S9L A;  2ANP A;  4MY0 A;  5KTC A;  1KUY A;  1WK4 A;  4C2X A;  2Q7S A;  3TE4 A;  4G1P A;  5I4M A;  4KZT A;  2OOT A;  1S5K A;  2R98 A;  2Z10 A;  1FNO A;  2ZW7 A;  1H8L A;  2FE7 A;  3VH9 A;  2AE6 A;  3FNC A;  2ZEP A;  4CAE A;  3I3G A;  4UFX A;  5AG7 A;  2FIA A;  4MHP A;  3S9N A;  3NH4 A;  1I12 A;  2HV2 A;  1Y7E A;  4R6T A;  2CF4 A;  2ZPA A;  3BXM A;  4X2T A;  1BO4 A;  1LAM A;  1F2P A;  2I00 A;  4M85 A;  4FBE A;  3GIU A;  2FT0 A;  3IWE A;  2OR4 A;  2EWB A;  4UF4 A;  1IID A;  4F0Y A;  4F0X A;  4IF5 A;  3PFE A;  1RXT A;  3FYN A;  1BAV A;  3CXS A;  2R1I A;  4KVX A;  3H4Q A;  4F6A A;  2ZOF A;  2Z3K A;  3PBB A;  4NGR A;  4CYO A;  2FXF A;  2VQY A;  5F46 A;  3LMS A;  3B3V A;  1IGB A;  2QIR A;  2ZEO A;  1F57 A;  1QSO A;  3P2H A;  4NEX A;  1IOI A;  1QSN A;  4A37 A;  3BI1 A;  2B4B A;  4QVT A;  4EWT A;  5GCN A;  2PIY A;  4MHZ A;  4F8Z A;  4UWJ A;  5JQ4 A;  3DDD A;  2PDO A;  4MFL A;  4OAD A;  3DSB A;  4OC1 A;  3HLP A;  4NJR A;  4OME A;  4CS0 B;  1M1D A;  2JDD A;  3L2N A;  1R3N A;  2OZH A;  3R9G A;  4AXV A;  4ZY2 A;  4XPD B;  2JEW A;  4B12 A;  3SI2 A;  2Q4Y A;  2G9D A;  2R7H A;  3UY5 A;  2Q51 A;  2PQ8 A;  2R8V A;  3PB9 X;  4J3G A;  3T9Y A;  1P4N A;  1IY7 A;  3S9M A;  4A39 A;  4M3S A;  2Q0Y A;  2FL4 A;  2NSM A;  5G21 A;  2WUU A;  4UEE A;  5AG6 A;  4UFV A;  4R57 A;  1I21 A;  1ARM A;  2I3C A;  3I9S A;  4PK3 A;  2QEC A;  1F2O A;  2YNE A;  3NH5 A;  2VEZ A;  1Z4R A;  1CJW A;  1MK4 A;  3WR7 A;  2CTB A;  2RC4 A;  3PP9 A;  2AFS A;  1FY7 A;  1S7F A;  5G22 A;  3IU1 A;  1VHS A;  5H86 A;  2I79 A;  3IWW A;  1MJB A;  2YNC A;  1LAP A;  4CGO A;  4RS2 A;  4KOR A;  1TF9 A;  1YW6 A;  2HQY A;  2VL1 A;  4U9Y A;  1YRE A;  1YVO A;  4P4J A;  4TNU A;  1LAN A;  4OID A;  2Z3N A;  2V8V A;  1DE4 C;  1M4G A;  2C27 A;  2PJ2 A;  2PIZ A;  1AUG A;  2BL1 A;  1JWQ A;  1ZLI A;  1Q7L A;  2PR1 A;  3B35 A;  1CP7 A;  1LCP A;  2Z11 A;  4MFZ A;  5EBV A;  5LYF A;  4YFJ A;  2AFO A;  2HB6 A;  1AYE A;  1PCA A;  1S7K A;  5ELY A;  3SXO A;  5F48 A;  4XNH C;  1ZLH A;  1YLO A;  4PSW A;  1TF8 A;  2O28 A;  2O4H A;  4O23 A;  2D4P A;  3FRM A;  2JDC A;  2PJ0 A;  2PSW A;  3JTK A;  2ZEL A;  3MRU A;  3B3T A;  3EO4 A;  4GM5 A;  4MCR A;  4HPS A;  4UA3 A;  2PCU A;  1M44 A;  2GFQ A;  1XIX A;  3GKR A;  1RO5 A;  4JD6 A;  3VWD A;  2WPX A;  4IHM A;  4H6Z A;  1PU9 A;  3GYA A;  2RB7 A;  4P6Y A;  2CNM A;  3V7Z A;  3GB0 A;  1ARL A;  3HUV A;  5H84 A;  2K5T A;  1LFW A;  4NGN A;  2C6G A;  4OC5 A;  5F47 A;  1KUV A;  4BD9 A;  2DXQ A;  4NSQ A;  1YSJ A;  1YQE A;  2PRB A;  4MRI A;  4UIB A;  4JYW A;  5LYI A;  3FJU A;  3BI0 A;  3TTH A;  4TWE A;  3D66 A;  2KCW A;  2GRE A;  4MFK A;  3RBU A;  4NGQ A;  4P4E A;  2CNS A;  1ON0 A;  3VAT A;  4DYO A;  5FVJ A;  5A28 A;  4ZX9 A;  5JM6 A;  5CPA A;  1Q2Y A;  1Z4E A;  1BPN A;  3SI1 A;  3EC4 A;  4MXU A;  1B6B A;  3IWG A;  4KOV A;  3ISZ A;  3T8W A;  4B5O A;  1XJO A;  3KQX A;  2AFZ A;  2ZEM A;  3BJ7 A;  3QAY A;  4PV6 A;  2Q7B A;  4KUA A;  1GYT A;  1YR0 A;  2OB0 A;  3B2Y A;  4MJ8 A;  4KS9 A;  1YME A;  2PJ5 A;  4YRH A;  5EC4 A;  2ZEF A;  2Z0Z A;  4XNH B;  4C68 A;  4CYP A;  5I0C A;  1X10 A;  2HUZ A;  3EY5 A;  1XBU A;  4P4B A;  2A4N A;  1NE9 A;  4B13 A;  3DR6 A;  4OC0 A;  4QBJ A;  4R76 A;  4AG9 A;  1KZF A;  3G8W A;  4PSX A;  2ABZ A;  3CPA A;  4CGM A;  5IB9 A;  4NFR A;  1FT7 A;  1Q2D A;  2BSW A;  4OIW A;  1HDQ A;  3SXN A;  2J9A A;  4H6U A;  2ZW6 A;  3B3W A;  2VBQ A;  3B7I A;  4C2Z A;  4M6H A;  1N71 A;  3QNV A;  2BEI A;  2Q43 A;  2ZED A;  3IU2 A;  4B14 A;  1A2Z A;  2IQ6 A;  1MJ9 A;  4AG7 A;  2EK8 A;  4P4I A;  4KOS A;  2OZU A;  2CIJ A;  3PEI A;  4OC4 A;  4UCP A;  1AMP A;  4NGS A;  3FEC A;  4CGP A;  2ZW5 A;  1XFO A;  4P45 A;  1M4L A;  1XEB A;  2J8M A;  4Q36 A;  4ONU A;  3FXT A;  2BO9 A;  3GUX A;  3H8F A;  3IFE A;  1BLL E;  3NFZ A;  4HKF A;  4LX9 A;  4P10 A;  4P4D A;  2IMO A;  1ELM P;  4NGP A;  4A33 A;  2Z3M A;  3KZW A;  4KOT A;  3PB8 X;  2BOA A;  1CBX A;  4II9 A;  1U6M A;  1S7L A;  2PJ3 A;  4MMO A;  3PB6 X;  4MCP A;  4OC3 A;  1ZG8 A;  4PXE A;  4B10 A;  3WT4 A;  5E96 A;  3V8I A;  2QJ8 A;  3KR5 A;  2BCO A;  2ATR A;  1QSM A;  1HDU A;  5J1Q A;  1X12 A;  1Z5R A;  2C6C A;  4KOY A;  4OLL A;  3F0A A;  4R8F A;  3WC6 A;  3RYO A;  4BIN A;  1UWY A;  2HC9 A;  8CPA A;  4PXB A;  2QVP A;  4HNX B;  1K4J A;  3CDX A;  1NMT A;  2JBK A;  3RZA A;  5HXD A;  4KOW A;  2J8N A;  3CPX A;  4PPZ A;  4MY3 A;  3IJ3 A;  4R7M A;  1JQG A;  4ZYQ A;  4AVC A;  2JLM A;  4ZY0 A;  3ZJ0 A;  2H5M A;  3JRU A;  3KQZ A;  4YU9 A;  3KHZ A;  2XEJ A;  5K8M A;  3IGR A;  2NMT A;  2GE3 A;  2V8G A;  4NGT A;  1IIC A;  3K2K A;  4RI1 A;  4NGM A;  1Z8X A;  5EMI A;  1R43 A;  4ORF A;  3BJ8 A;  2B4D B;  4KSF A;  1J4J A;  1CPS A;  3RNZ A;  4H2K A;  2OU2 A;  4K30 A;  4R9M A;  5K8P A;  4AVA A;  3TO7 A;  3FIX A;  1LOK A;  4KOU A;  7CPA A;  2EO8 A;  5J8C A;  2VI7 A;  1KWM A;  3SHP A;  2B4D A;  2C1C A;  2GU2 A;  4NCZ A;  2DPT A;  2B3U A;  2CXA A;  4WWV A;  4NXY A;  3ISX A;  3IC1 A;  4LUA A;  2F5I A;  2Q4V A;  3SJF A;  1XOV A;  3K9T A;  3KGQ A;  4ONW A;  2FIW A;  4R3L A;  2F8H A;  2FCK A;  5JPH A;  4MCS A;  2CY2 A;  1CP6 A;  2V77 A;  3FB3 A;  4MHD A;  3TO6 A;  4A32 A;  1EE3 P;  3LD2 A;  2CNT A;  4A30 A;  5IB0 A;  4E0A A;  2Y0M A;  2F7V A;  3D8P A;  1ZG9 A;  3DLJ A;  2PVW A;  4ZBG A;  4CAF A;  4Q7A A;  4JXR A;  3PFO A;  4P4F A;  2DPS A;  2PJB A;  2RFH A;  3KAS A;  3IIB A;  4QUS A;  4RN7 A;  1CX8 A;  1OZP A;  2V8D A;  4KVM E;  4IK2 A;  3B3C A;  4DJL A;  1B87 A;  3V38 A;  2O53 A;  3TCV A;  2VZZ A;  3D2P A;  5C82 A;  2JEV A;  2WYR A;  3OWC A;  3F5B A;  5AGE A;  2WZN A;  2AFW A;  4W9Y A;  4IAV A;  1Y0Y A;  1S60 A;  4KLW A;  4PK2 A;  2V8H A;  3D7G A;  3PBE A;  2PJC A;  2EVN A;  3WAB A;  1Z8L A;  5LRK A;  2PJ9 A;  2ZEN A;  4PQA A;  5LYD A;  1Y7R A;  3FF3 A;  4PXD A;  2XEF A;  1S7N A;  4B6Z A;  2PJ1 A;  1ZO0 A;  2IJZ A;  2XEG A;  4CYN A;  1VHE A;  5HVH A;  2Z3O A;  4Z65 A;  3NE7 A;  4FAI A;  1QQ9 A;  1XF8 A;  4C2Y A;  3D2M A;  2AJ6 A;  2VZY A;  3KR4 A;  4HNW B;  5G20 A;  4OP4 A;  5G1Z A;  1VHO A;  5K8O A;  1PYT B;  2P6F A;  3PRT A;  2Q04 A;  2ZW4 A;  1PUA A;  4R3K A;  2DEA A;  1DTD A;  1RTQ A;  1Z8W A;  2Q4Z A;  4KSA A;  1VIX A;  2ZEH A;  4HNY B;  3MGD A;  4CGL A;  4K3N A;  4GS4 A;  3W91 A;  2P0W A;  4NJQ A;  3D67 A;  4UFW A;  3ZZI A;  3SJX A;  4ZX8 A;  4M6G A;  5DWM A;  4MFJ A;  3GY9 A;  2YND A;  3CZX A;  4E8O A;  3GLJ A;  1P0H A;  3D7H A;  4PXC A;  1SQH A;  3FX6 A;  1M4I A;  4JXQ A;  2ODF A;  2POK A;  1IB1 E;  3R9E A;  4BBH A;  3RO0 A;  1TKJ A;  5F49 A;  2AFU A;  1VKC A;  4XPD C;  3NA6 A;  1LRZ A;  3KHX A;  4KLV A;  5D29 A;  3TFY A;  3NH8 A;  4OC2 A;  2BUE A;  5HVF A;  4DUK A;  1Y0R A;  3FBU A;  3BLN A;  4QC6 A;  2PRQ A;  4FD7 A;  4LQ6 A;  2PJ6 A;  4B5P B;  4E2A A;  4CAV A;  1L0C A;  2DF5 A;  2P6G A;  3DR8 A;  2YNC C;  4I49 A;  5HMN A;  5KTD A;  1YVK A;  5JH9 A;  4OAE A;  5CBM A;  4UWI A;  1IYL A;  4Q38 A;  4B5P A;  2EBJ A;  1Z9U A;  1IYK A;  3RAM A;  3WC7 A;  3R9F A;  3JVN A;  1QST A;  2PE3 A;  4MCQ A;  1XE4 A;  1NSA A;  4GXH A;  3TX8 A;  2G0B A;  2C6P A;  3DNS A;  4UEZ A;  4X3R A;  1I1D A;  4KOX A;  1Z2L A;  3D4U A;  4U9Z A;  1TXR A;  3A9L A;  3KKW A;  2PJ4 A;  3FED A;  2PJ8 A;  2GLF A;  1UFH A;  3D68 A;  4MHN A;  3FMC A;  3H5Z A;  2Q44 A;  4X8I A;  3P2F A;  3R95 A;  3S6K A;  1ELL P;  1TIQ A;  1YLE A;  2Z3L A;  5AG4 A;  1VGY A;  2B3V A;  2FS5 A;  3B3S A;  4Y49 C;  5HH1 A;  1S3Z A;  3SJG A;  3TT2 A;  5C88 A;  2FVG A;  4FWU A;  4H89 A;  4CAW A;  1YW4 A;  4YGO A; 
#chains in the Genus database with same CATH homology
 3CT9 A;  2ZEE A;  3TC8 A;  5LRG A;  1CG2 A;  2NYQ A;  1HEE A;  3D7D A;  4LQG A;  4YWY A;  2PJA A;  4MHY A;  2XEI A;  6CPA A;  5JGF A;  4ZI6 A;  2GLJ A;  3SJE A;  4OKO A;  3KL9 A;  3BHX A;  4CPA A;  5DS0 A;  5LRJ A;  4UIA A;  4P44 A;  3LWU A;  4UEF A;  2AFM A;  5HVG A;  5K8N A;  1CPX A;  1ZG7 A;  2CTC A;  2PJ7 A;  3IEH A;  5D8N A;  3FH4 A;  4F9U A;  2JBJ A;  3FEE A;  2PVV A;  3N5F A;  4KSI A;  3DGV A;  3FVL A;  4EFD A;  4RUH A;  2AFX A;  4F9V A;  3H8G A;  2EK9 A;  2QYV A;  3PB7 X;  1XRY A;  4EME A;  3VAR A;  3IO1 A;  1XMB A;  1OBR A;  3H8E A;  4ZY1 A;  4JZ0 A;  2ZEG A;  1BPM A;  3WC5 A;  3PB4 X;  3KI9 A;  4FUU A;  4WJB A;  4A38 A;  3SI0 A;  1QMU A;  3D7F A;  3I1U A;  5LYL A;  2ZOG A;  5F09 A;  1TKF A;  1TKH A;  5THW A;  3MN8 A;  4A94 A;  3S9L A;  2ANP A;  4G1P A;  5I4M A;  2OOT A;  1FNO A;  3VH9 A;  1H8L A;  2ZEP A;  4MHP A;  3S9N A;  3NH4 A;  1Y7E A;  4R6T A;  2CF4 A;  4X2T A;  3BXM A;  1LAM A;  1F2P A;  4FBE A;  2OR4 A;  2EWB A;  4UF4 A;  3PFE A;  1BAV A;  2ZOF A;  3PBB A;  4NGR A;  3LMS A;  3B3V A;  1IGB A;  2ZEO A;  1F57 A;  4A37 A;  3BI1 A;  4EWT A;  2PIY A;  4MHZ A;  4F8Z A;  4OC1 A;  3HLP A;  4NJR A;  4OME A;  3L2N A;  1R3N A;  4AXV A;  4ZY2 A;  2JEW A;  3SI2 A;  2G9D A;  2Q51 A;  3PB9 X;  1IY7 A;  3S9M A;  4A39 A;  2NSM A;  4UEE A;  1ARM A;  2I3C A;  1F2O A;  3NH5 A;  2CTB A;  2AFS A;  3IWW A;  1LAP A;  1TF9 A;  1YW6 A;  2VL1 A;  4P4J A;  4TNU A;  1LAN A;  4OID A;  2V8V A;  1DE4 C;  2PJ2 A;  2PIZ A;  1ZLI A;  1Q7L A;  3B35 A;  5LYF A;  1CP7 A;  1LCP A;  2AFO A;  2HB6 A;  1AYE A;  1PCA A;  5ELY A;  1ZLH A;  1YLO A;  1TF8 A;  2O4H A;  4O23 A;  2PJ0 A;  2ZEL A;  3MRU A;  3B3T A;  4GM5 A;  4MCR A;  2PCU A;  4IHM A;  2RB7 A;  4P6Y A;  3V7Z A;  3GB0 A;  1ARL A;  3HUV A;  1LFW A;  4NGN A;  2C6G A;  4OC5 A;  4BD9 A;  1YSJ A;  4MRI A;  4UIB A;  4JYW A;  5LYI A;  3FJU A;  3BI0 A;  4TWE A;  3D66 A;  2GRE A;  3RBU A;  4NGQ A;  4P4E A;  3VAT A;  4DYO A;  5JM6 A;  4ZX9 A;  5CPA A;  1BPN A;  3SI1 A;  4MXU A;  3ISZ A;  3T8W A;  1XJO A;  3KQX A;  2AFZ A;  2ZEM A;  1GYT A;  3B2Y A;  1YME A;  2PJ5 A;  2ZEF A;  4P4B A;  1XBU A;  4OC0 A;  4R76 A;  2ABZ A;  3CPA A;  5IB9 A;  4NFR A;  1FT7 A;  4OIW A;  1HDQ A;  2J9A A;  3B3W A;  3B7I A;  3QNV A;  2Q43 A;  2ZED A;  2IQ6 A;  2EK8 A;  4P4I A;  2CIJ A;  3PEI A;  4OC4 A;  1AMP A;  4NGS A;  3FEC A;  1XFO A;  4P45 A;  1M4L A;  2BO9 A;  3GUX A;  3H8F A;  3IFE A;  1BLL E;  3NFZ A;  4P10 A;  4P4D A;  2IMO A;  1ELM P;  4NGP A;  3KZW A;  3PB8 X;  2BOA A;  1CBX A;  2PJ3 A;  4MMO A;  3PB6 X;  4MCP A;  4OC3 A;  1ZG8 A;  4PXE A;  3WT4 A;  2QJ8 A;  3KR5 A;  2BCO A;  1HDU A;  5J1Q A;  1Z5R A;  2C6C A;  4R8F A;  3WC6 A;  1UWY A;  2HC9 A;  8CPA A;  4PXB A;  2QVP A;  3CDX A;  2JBK A;  3RZA A;  5HXD A;  3CPX A;  4PPZ A;  3IJ3 A;  4R7M A;  1JQG A;  4ZYQ A;  4ZY0 A;  3JRU A;  3KQZ A;  4YU9 A;  3KHZ A;  2XEJ A;  5K8M A;  2V8G A;  4NGT A;  3K2K A;  4NGM A;  1R43 A;  1CPS A;  4H2K A;  5K8P A;  7CPA A;  1LOK A;  1KWM A;  2C1C A;  2GU2 A;  4WWV A;  3ISX A;  3IC1 A;  3SJF A;  3K9T A;  3KGQ A;  4ONW A;  2F8H A;  4MCS A;  2V77 A;  1CP6 A;  1EE3 P;  2F7V A;  1ZG9 A;  3DLJ A;  2PVW A;  4Q7A A;  3PFO A;  4P4F A;  2PJB A;  2RFH A;  3KAS A;  3IIB A;  1CX8 A;  2V8D A;  4IK2 A;  3B3C A;  4DJL A;  3V38 A;  2O53 A;  2WYR A;  2WZN A;  2AFW A;  4W9Y A;  4IAV A;  1Y0Y A;  2V8H A;  3D7G A;  3PBE A;  2PJC A;  3WAB A;  1Z8L A;  5LRK A;  2PJ9 A;  2ZEN A;  4PQA A;  5LYD A;  3FF3 A;  4PXD A;  2XEF A;  4B6Z A;  2PJ1 A;  2IJZ A;  2XEG A;  1VHE A;  5HVH A;  4Z65 A;  4FAI A;  1QQ9 A;  3KR4 A;  4OP4 A;  1VHO A;  5K8O A;  1PYT B;  3PRT A;  2DEA A;  1DTD A;  1RTQ A;  2Q4Z A;  1VIX A;  2ZEH A;  4K3N A;  4NJQ A;  3D67 A;  3SJX A;  4ZX8 A;  3GLJ A;  3D7H A;  4PXC A;  3FX6 A;  2POK A;  1TKJ A;  2AFU A;  3NA6 A;  3KHX A;  5D29 A;  3NH8 A;  4OC2 A;  5HVF A;  4DUK A;  1Y0R A;  2PRQ A;  2PJ6 A;  5JH9 A;  5CBM A;  3RAM A;  3WC7 A;  2PE3 A;  4MCQ A;  1NSA A;  3TX8 A;  4UEZ A;  2C6P A;  4X3R A;  1Z2L A;  3D4U A;  1TXR A;  2PJ4 A;  3FED A;  2PJ8 A;  2GLF A;  3D68 A;  4MHN A;  3FMC A;  4X8I A;  1ELL P;  1VGY A;  3B3S A;  3SJG A;  2FVG A;  4FWU A;  1YW4 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...